1IBLE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1iblE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1iblE02
3B8HA 1YZ9A 4HYMA 4JI0E 4YY3I 1YYKA 2DEJA 4P7AA 1FWLA 4HY1A 3ZM7A 4DXLA 4X66I 4NXMI 4DR7I 1H74A 4LF4E 4I3HA 4NXNE 4JYAE 2E1RA 5A2QQ 4KQVA 4DR6E 2LJHA 2NPFA 1QU6A 1A6FA 4DR1E 4OOGC 4LFBI 4DV7E 4LFCE 3ADIA 2RTXA 4LF5I 2HKJA 1FNMA 4GKJI 4B3SE 1Z0CA 1T4OA 4M1KA 1J5EI 4ZVIA 2UUCI 3B78A 3OTOI 4YY3E 3T1HI 4B3RI 4LF6I 1B63A 2E5LE 1NHIA 1NHHA 2BM0A 4JI8I 1MX0A 2UU9I 2NUEA 4EMDA 5LL6R 4JI3I 4DR4I 4JI6E 4JI1I 2IHR1 2MDRA 3HULA 2UXCE 4X65E 5IT9C 1FJGI 4DV4I 2HHHE 4LF5E 3ADLA 4LF7I 1H73A 4GKJE 3VYXA 1N36I 2VQFI 4USKA 3H4LA 1O0WA 4MYUA 1X48A 4DR5E 2UUCE 1IBLI 1IBME 4DPUA 2V2ZA 3OTOE 1S4EA 2HFSA 3PYEA 4B3RE 1RR9A 1N34I 2OI2A 1RC7A 1EI1A 4DV0I 2F4VI 4JI8E 2UXBE 3Q1QA 1N33E 1WHNA 4FWGA 4JI4E 2ZBKB 1ZXNA 4OX9E 3QT6A 4M2ZA 4Z7YA 3T1YE 1OJ4A 1Z0BA 2DEIA 2X36A 4JV5E 1KVKA 1H7UA 3V5RA 4B3MI 4MYTA 4AQYI 3C4TA 1VISA 1N0UA 3C4BA 3ZZTA 3J81C 2CZ9A 4P52A 1N34E 4X64I 4DV5E 3WU6A 4DV6E 5LMUI 1ZBTA 4DV3I 2N3GA 1BKNA 1HNWE 3LPSA 1XMQI 5A2QC 1XNRI 5IWAI 1B62A 2RS6A 4FN5A 4DR3I 1XNQI 4B3ME 4HACA 2Q2EB 2LUPB 4DR2I 4UT4A 4LF8I 1T4NA 1KIJA 1DI2A 4WYQB 4DUYE 2BV3A 4DUZI 2A2CA 1U2RA 3VYYA 1I94E 2CPNA 4B3TE 1IBKI 4GKKI 5LMUE 4WUBA 3PYGA 4PRXA 2L3JA 2DMYA 1XMQE 5IWAE 1UHZA 5FLXQ 4X66E 4NXME 4DR7E 3B82A 3ADJA 2B3TB 2RS7A 2L2NA 2UUAI 4DR2E 5BR8I 5LMNI 4RPFA 1X49A 4JG4A 1D6TA 5GMDA 3QT5A 4LFBE 3J7AM 4X62I 5CFFE 1IBKE 1Z59A 4M30A 3LTOA 1N0VC 2V2VA 4GKKE 1N32I 4JI7I 3JAMQ 2ZM6I 1J5EE 1X47A 2R42A 4YHHI 4KHPI 2A2DA 1Z0TA 2HK2A 1S16A 4DPWA 3T1HE 1YYOA 2EFGA 4LF6E 2X7IA 5L3JA 3WU3A 2HKEA 1PVGA 2JY9A 3ZKBA 4LF9I 4Z7CA 2HK3A 2UU9E 1ZM9A 1FI4A 2GS8A 3D4JA 2DB2A 4HXZA 1WHQA 4JI3E 1NHJA 4JI5I 4DR4E 3ADGA 4JI1E 4WUCA 1H7SA 1Z5AA 4X62E 3K17A 1FJGE 1Z0GA 3PYDA 4DV1I 4DV4E 3HTXA 1XMOI 4JI2I 4LF7E 1N36E 2VQFE 1N32E 2VF3A 4DV2I 5GMEA 1IBLE 1KKHA 2V2QA 1Z0EA 2JVAA 2UUBI 1RREA 1PIEA 4DV0E 2F4VE 4LF4I 1STUA 1UILA 4X8WA 4DR6I 2LTSA 4WFTA 2RSMA 1H72C 3ZKDA 2WW4A 3J80Q 4DV1E 1XMOE 3LNUA 2L33A 4HACB 4AQYE 4R1FA 1J26A 1Z0VA 1EA6A 2NUFA 1ZM4A 3WU5A 2UUBE 3ZZ0A 2VQEI 1Z5BA 2L2MA 2ZITA 1UEKA 2J7KA 4X64E 1WUUA 2E5LI 1QZRA 5FLXC 1XHKA 3J7Yp 4DPTA 2N3HA 4DV3E 1KTVA 4PU9A 4JI6I 1XNRE 1YYWA 1HNXI 2UXCI 4X65I 4DR3E 1XNQE 2NA2A 4LFAI 2HHHI 3M6AA 2LBSB 4PRVA 2BM1A 2LTRA 1GQEA 4K0KI 2LRSA 4LF8E 1HR0I 4DR5I 1IBMI 2VQEE 4WUDA 4DPXA 4DUZE 4USMA 3JAMC 1Z5CA 3GONA 1FKAE 1HNZI 3V2UC 1MU5A 2V8PA 2UXBI 1N33I 2B7TA 2EZ6A 3QT7A 4JI4I 3K1JA 4FWDA 4OX9I 2UXDI 1EKZA 1HNXE 1FWKA 1RQ0A 3F0NA 2L3CA 3T1YI 4JV5I 4LFAE 2XEXA 2UUAE 5BR8E 4UTGA 2L2KB 1ZM3A 4K0KE 5LMNE 4ED4A 1HR0E 2R3VA 5IT9Q 3PYFA 3ZZUA 2AJ4A 2YT4A 1HNZE 4DU7A 1PKPA 4DV5I 1ELOA 2NUGA 4JI7E 3WU4A 2DIXA 2ZM6E 3CWVA 4DKKA 4YHHE 4KHPE 2KHXA 4DV6I 2B7VA 1HNWI 3P1XA 2UXDE 4JI0I 1ZXMA 4LF9E 3LLHA 1ZM2A 1T4LB 2V34A 4NXNI 4JYAI 2LJPA 3QT8A 4URLA 4DPYA 3J80C 1K47A 1MG7A 4JI5E 4FWHA 4XTJA 4FW9A 4DU8A 4DR1I 4DUYI 1NZ0A 4LFCI 2LUQA 4DV7I 4JI2E 1Z0WA 1I94I 2HFUA 4B3TI 3J7AG 4DV2E 3J81Q 4B3SI 1DARA
chains in the Genus database with same CATH superfamily
3B8HA 5F3WA 1TF3A 3HQ1A 1YZ9A 2Z5CA 3DD6A 4HYMA 4JI0E 4YY3I 1YYKA 2DEJA 4ISAA 4P7AA 2LE2A 1FWLA 1ZR9A 4HY1A 3ZM7A 2V89A 4DXLA 4X66I 4NXMI 4DR7I 4J8ZA 2PNZB 1H74A 4LF4E 4Q28A 5A69A 2EM8A 1DQ3A 4F2JC 4I3HA 4NXNE 4JYAE 2M4IA 2E1RA 5A2QQ 4KQVA 4DR6E 2LJHA 2NPFA 2FGGA 2DGCA 1A1JA 1G2DC 1QU6A 2NN6E 1A6FA 4DR1E 2GHFA 5JEAA 4OOGC 5JEAB 2JEBA 2EOZA 2EOXA 5AE3A 4LFBI 4DV7E 4LFCE 2KOUA 2EM9A 3ADIA 2RTXA 4ZYDA 1RMDA 4BS9A 4LPFA 4LF5I 2V88A 2HKJA 1FNMA 1YUJA 4GKJI 4LCFA 2ELZA 4B3SE 1Z0CA 1T4OA 2EPCA 3KWRA 5KL2A 2J7JA 1EH8A 2YRMA 4M1KA 4IFDC 5AC4A 1J5EI 1PJQA 4ZVIA 2EMYA 2HJJA 2PO0B 1N3GA 2UUCI 3B78A 1QNTA 4P78A 3OTOI 2EMXA 2CT1A 2EM0A 3L00A 2WBSA 4YY3E 2YTNA 3K6QA 3T1HI 4B3RI 1TF6A 4LF6I 2YTGA 2L92A 2EM6A 2AE8A 1B63A 2O1VA 2E5LE 2EMKA 3BBGA 5JEAD 1NHIA 1R6LA 2EQ1A 1X6EA 1NHHA 2BM0A 4JI8I 1MX0A 4O24A 3ZOQB 2NUEA 2EMIA 2UU9I 4MU1A 4MU4A 4J3DA 4EMDA 5LL6R 2RQLA 4JI3I 2NN6A 2EM7A 3F6HA 4NZVA 4DR4I 4JI6E 2EMBA 4R8OA 4JI1I 2I9IA 3PS2A 4U3DA 1MGTA 2EOSA 4P7DA 2G7HA 2IHR1 2MDRA 3MHSC 4RHBB 5DNYA 2UXCE 1BB8A 3HULA 4X65E 1Z1BA 2Z5EA 5IT9C 1FJGI 2CGEA 4NHRA 4DV4I 2HHHE 1UBDC 4LF5E 3ADLA 1IQOA 4LF7I 3MHHC 1H73A 4GKJE 3VYXA 2EOOA 5FWKA 1N36I 4BC7A 1B69A 2VQFI 4I8OA 2GQ0A 4USKA 3TQMA 3H4LA 1O0WA 2JXPA 5JEAF 2EMGA 2K7IA 4MYUA 1X48A 4DR5E 2UUCE 1L4SA 1IBME 2Z5BA 1IBLI 4DPUA 2V2ZA 3OTOE 1S4EA 1ZBQA 2MC5A 2WZOA 5C0XC 4O5GA 2HFSA 3PYEA 3THNA 4B3RE 2JOXA 1LLMC 1NEIA 1RR9A 2C37A 3MSWA 2C37B 1N34I 2EPZA 2OI2A 1RC7A 1EI1A 2B9DA 4DV0I 2F4VI 4JI8E 5T6JA 2UXBE 3Q1QA 2FTXB 1N33E 1WHNA 2PNLA 2DRPA 2EN6A 2EOYA 2LCEA 3JTZA 4FWGA 2E1MA 5DROA 4MDTA 4JI4E 2PO2B 2ELYA 2ZBKB 3M99B 2EOQA 1T38A 3P3EA 4LOMA 1ZXNA 4OX9E 1A1LA 3DJWA 3QT6A 2EN2A 5KL5A 5KL6A 4M2ZA 4Z7YA 3B4TA 2O1WA 3BIDA 2LO3A 2IESA 3T1YE 1OJ4A 1Z0BA 2DEIA 2X36A 4JV5E 4GQUA 4F9AB 1KVKA 2MKNA 1H7UA 3L7ZB 3V5RA 4B3MI 2NN6F 4AM3A 4MYTA 4OO1A 4OO1B 3F6GA 4AQYI 3C4TA 4FW6A 1OYRA 2WNRB 1VISA 2C38B 4BA2B 1N0UA 1TN9A 2F8BA 5A6BD 2EL4A 3IWCA 4L8NA 4WXDA 5A6KA 5A6AA 5K36C 2C39B 1X3CA 3EPJA 3C4BA 3ZZTA 3J81C 2ADRA 1G2FC 2WBTA 2M7QA 4BHBA 2PRTA 2CZ9A 2DMIA 4P52A 1RHYA 1N34E 2LVHA 2JE6B 4X64I 2GO3A 4DV5E 3EQ1A 2O1UA 1YH8A 2MC6A 4F9BB 4LCHA 4IZKB 3WU6A 2JP9A 4DV6E 4IFDE 5LMUI 4ZYHA 1ZBTA 2V87A 4R2EA 3EPKA 2N3GA 1BKNA 2BR2A 1DGCA 1WRJA 1HNWE 4DV3I 4OO1D 2HC5A 5AE1A 2Z5CB 3LPSA 1XMQI 5A2QC 1XNRI 5IWAI 1B62A 2RS6A 2EL5A 4FN5A 2K4VA 2EPRA 4DR3I 2EOJA 1XNQI 4B3ME 4O43A 4HACA 4FW5A 2Q2EB 2LUPB 2WBUA 4DR2I 5TSEA 4BBYA 4UT4A 3H1CA 4LF8I 1EH7A 3KZYA 1T4NA 2ENHA 4R2CA 1DI2A 1KIJA 5EKWA 4F9CB 4WYQB 2M1SA 4DUYE 2BV3A 2JEBB 4DUZI 2A2CA 4LCGA 4OO1F 1U2RA 2DLQA 2MKDA 3VYYA 1Y4SA 1I94E 1Y60A 2CPNA 2YSOA 2F1DA 4B3TE 1IBKI 3KZZA 4L5NC 2BB8A 2M9AA 4BA1A 4IFDA 4GKKI 1Y5YA 3M7ND 4M9VC 5LMUE 4WUBA 3PYGA 1ZAAC 2JT2A 4X9JA 3IWBA 5DRPA 4PRXA 2L3JA 2DMYA 2EJ4A 2YWQA 2EP3A 1XMQE 5C0XE 2R76A 5IWAE 3C6KA 1UHZA 2EOMA 2V83A 5FLXQ 4X66E 2EQ3A 4NXME 2D9HA 2ODRC 4DR7E 5JEAC 3B82A 2ODRD 3AV0A 4NBQA 3ADJA 3M7NG 2B3TB 3NZKA 3GMEA 4R2DA 2RS7A 2L2NA 2UUAI 4DR2E 5BR8I 2YU5A 3C6MA 2EPNA 4KWYA 2JWOA 2V8QB 5LMNI 2NN6B 4RPFA 1X49A 4JG4A 1D6TA 1IMUA 3QT5A 5GMDA 3UHMA 4BMJA 4LFBE 3J7AM 5IXMB 2KONA 2RPCA 4X62I 2DLKA 5CFFE 2YU8A 1IBKE 2YTJA 2YTOA 1Z59A 2NABA 2JR1A 4M30A 3LTOA 1N0VC 3QG5C 1YUIA 2V2VA 4GKKE 1N32I 4LU9A 4FK5C 4MLVA 4JI7I 3JAMQ 2WP8A 1UDOA 1BBGA 1E3PA 2WP8B 2ZM6I 1J5EE 4BCAA 1X47A 2R42A 4YHHI 4KHPI 3EPHA 2A2DA 2Z5BB 1YFHA 2BBGA 2CTDA 4IS9A 5K36E 1Z0TA 2HK2A 5IV8B 1S16A 4WX9A 4DPWA 3T1HE 1YYOA 4WXCA 2CG9A 2EFGA 2NN6D 4MU3A 4LF6E 2X7IA 5L3JA 2VE7C 2WCC3 2HKEA 3WU3A 1PVGA 4IFDF 3IWDA 2DSYA 2JY9A 3ZKBA 4HTGA 1Y4UA 5DRRA 4Z7CA 4LF9I 2HK3A 5EL9A 2UU9E 1ZM9A 4IS1C 2EMZA 2H36X 1FI4A 5DNLA 5KL3A 2GS8A 2IERA 3D4JA 2DB2A 1Y6ZA 4HXZA 2YTQA 4FW3A 1WHQA 4WSGA 4JI3E 1NHJA 4TUGA 4DR4E 4JI5I 2EMLA 1X6FA 3ADGA 4JI1E 2IOPA 4WUCA 2EMHA 2GPIA 4R2PA 4QNJA 3DF6A 1H7SA 1Z5AA 4X62E 3K17A 2V86A 1FJGE 1Z0GA 3RMPA 3PYDA 4DV1I 4DV4E 3HTXA 2JPAA 1XMOI 2EM3A 2VESA 4JI2I 4LF7E 2EN3A 1USVA 1N36E 4O4KA 2VQFE 1N32E 2VF3A 4DV2I 2JEAA 3U1YA 2ENAA 1UN6B 5GMEA 5K36A 4RH8A 4GEQB 1IBLE 2FV4B 2YTDA 5A6JA 2EN7A 1KKHA 2V2QA 1Z0EA 2JVAA 2EPLX 2UUBI 2EM2A 3BF2A 4Q35B 1A1HA 1RREA 4KZSA 2A25A 4WSPA 1PIEA 5ADZA 4DV0E 4QNKA 1IQSA 2YTPA 2F4VE 4LF4I 1STUA 1F2IG 4R2QA 1UILA 4X8WA 4MLQA 2PO1A 4OO1C 3UK3C 4DR6I 2BR2B 2EQ0A 2LTSA 4IJDA 5DRQA 4WFTA 2RSMA 1H72C 2YSPA 4AIMA 4R2RA 2YZTA 2EN4A 3ZKDA 2YPNA 2WW4A 4LTYA 3J80Q 3Q6NA 4N4RB 1PJTA 4DV1E 5JEAE 1XMOE 4BHCA 3LNUA 3FIGA 2L33A 4U3BA 1MEYC 4HACB 1PDAA 4AQYE 4R1FA 1J26A 3ECRA 1JK1A 1Z0VA 1EA6A 3AUZA 2NUFA 1BBOA 1ZU1A 3HKMA 2EOHA 1ZM4A 3WU5A 2UUBE 3ZZ0A 3K85A 1AH5A 2VQEI 2MDGA 1Z5BA 2BA1D 2L2MA 2LJUA 2ZITA 1UEKA 1X5WA 1GTKA 4M0VA 2EMFA 4X64E 2J7KA 1WUUA 5K36F 2PNZA 2E5LI 2YTFA 3P3CA 1YHCA 3P76A 4R2AA 1QZRA 3OMLA 3HXLA 4BA1B 4IFDB 2GO4A 3JU0A 5FLXC 1XHKA 2Q8UA 1KJKA 3J7Yp 4DPTA 2N3HA 4DV3E 1KTVA 2BA1G 3H09A 4PU9A 4JI6I 4R2SA 1XNRE 2LMZA 2EPMX 1A1FA 2GLIA 1YYWA 4MQYA 1HNXI 4F6NA 2UXCI 4X65I 2EMWA 3VK6A 4DR3E 1R6MA 1YSAC 5KL4A 1XNQE 2NA2A 5ELWA 2J65A 2EE8A 4FW7A 4LFAI 2HHHI 2BA0D 2V85A 3M6AA 2LBSB 4PRVA 2BM1A 2LTRA 1X6HA 1GQEA 2YTIA 4K0KI 2LRSA 4LF8E 1HR0I 4AIDA 4IFDD 3CDJA 2PO0A 3PS3A 4DR5I 4R03A 1JK2A 5AASA 1IBMI 2IOQA 2VQEE 4OKGA 3M85D 2LT7A 4WUDA 4DPXA 3JAMC 4DUZE 4USMA 1E3HA 2EMAA 1GZ6A 2EOIA 1Z5CA 2BA0G 1UDQA 3GONA 1FKAE 1HNZI 3V2UC 2EM4A 4F54A 2VRDA 1MU5A 2YTEA 1HK7A 2V8PA 3GCMA 2UXBI 1SR9A 1WJPA 1N33I 2B7TA 3VHTB 3M85G 2EZ6A 3QT7A 1OYPA 3CDIA 4JI4I 5C0XA 5C0XB 3K1JA 4FWDA 2NN6C 4OX9I 2UXDI 1EKZA 1HNXE 1FWKA 1KYQA 1RQ0A 3F0NA 2EMCA 2L3CA 3T1YI 4FW4A 4JV5I 4LFAE 1EH6A 2XEXA 2UUAE 5BR8E 4UTGA 1A1GA 2L2KB 2HGHA 1ZM3A 4K0KE 2O1TA 5LMNE 4OO1E 4ED4A 1HR0E 2R3VA 4MU0A 2EPKX 2O3ZA 5IT9Q 1SFEA 2JOBA 2EORA 2EWLA 1USUA 3PYFA 3HPZA 2I13A 3KRNA 4ZYGA 3ZZUA 4TUIA 1T39A 2AJ4A 1WXRA 3Q6MA 3U1KA 2YT4A 5C0XD 4IZJA 4IZJB 2ENCA 1HNZE 4DU7A 3PRYA 1PKPA 4DV5I 1ELOA 5A6BA 2NUGA 3HJCA 1PJSA 4JI7E 2JEAB 1OYSA 3WU4A 2DIXA 2EN1A 2ZM6E 4DKKA 3CWVA 4YHHE 5K36B 1YPNA 2L8TA 2KHXA 4KHPE 4N3OA 4DV6I 2PO2A 2EM5A 4OZEA 3P06A 3HPSA 2EL6A 2EPOA 2B7VA 2VF1A 4F6MA 1HNWI 2EOEA 2R1FA 2EPXA 2LV2A 3LMLA 4DV7I 4HEIA 3P1XA 4BC9A 2E72A 2UXDE 2RSIA 4JI0I 4GZNC 3THOB 1ZXMA 4LF9E 4DMIA 3LLHA 1ZM2A 2CVEA 1P47A 2EOFA 1T4LB 1UDNA 2YRHA 3L7ZA 5C0XF 2V34A 4NXNI 4JYAI 2LJPA 2PO1B 3P3GA 3QT8A 3PS1A 4IZJD 3J80C 4DPYA 2WNRA 2C38A 4URLA 1K47A 1XXEA 4BA2A 1MG7A 5KL7A 5AE2A 4JI5E 3GLLA 4FWHA 4XTJA 5DNXA 1UDSA 4FW9A 4WPYA 2C39A 5AC5A 1NCSA 5LLQA 1AAYA 4DU8A 4DR1I 1VI7A 5K36D 2EPUA 4DUYI 1A1KA 3BGHA 1NZ0A 2YRKA 2LUQA 2EPAA 4LFCI 1A1IA 4JI2E 4ZYEA 1Z0WA 2JE6A 2PNMA 1I94I 2L6MA 2HFUA 4B3TI 2EPPA 1P42A 3EPLA 3J7AG 4IZKA 4DV2E 3J81Q 4B3SI 2CSHA 2JYAA 2N8XA 2EN8A 1DARA
chains in the Genus database with same CATH topology
3B8HA 5F3WA 3HQ1A 1YZ9A 2Z5CA 4HYMA 4JI0E 4YY3I 1YYKA 2DEJA 4P7AA 2LE2A 1FWLA 4HY1A 3ZM7A 4DXLA 2V89A 4X66I 4NXMI 4DR7I 4J8ZA 1H74A 4LF4E 4Q28A 1DQ3A 4I3HA 4NXNE 4JYAE 2M4IA 2E1RA 5A2QQ 4KQVA 4DR6E 2LJHA 2NPFA 2FGGA 1QU6A 1A6FA 4DR1E 4OOGC 4LFBI 5AE3A 4DV7E 4LFCE 2KOUA 3ADIA 2RTXA 4BS9A 4LF5I 2V88A 2HKJA 1FNMA 4GKJI 4B3SE 1Z0CA 1T4OA 3KWRA 4M1KA 1J5EI 4ZVIA 2UUCI 3B78A 4P78A 3OTOI 4YY3E 3K6QA 3T1HI 4B3RI 4LF6I 2L92A 1B63A 2O1VA 2E5LE 1NHIA 1NHHA 2BM0A 4JI8I 1MX0A 3ZOQB 2NUEA 2UU9I 4EMDA 5LL6R 4JI3I 3F6HA 4DR4I 4JI6E 4R8OA 4JI1I 5DNYA 4P7DA 2G7HA 2IHR1 2MDRA 3HULA 2UXCE 4X65E 2Z5EA 5IT9C 1FJGI 2CGEA 4DV4I 2HHHE 4LF5E 3ADLA 4LF7I 1H73A 4GKJE 3VYXA 5FWKA 1N36I 4BC7A 2VQFI 4I8OA 2GQ0A 4USKA 3H4LA 1O0WA 4MYUA 1X48A 4DR5E 2UUCE 1IBLI 1IBME 2Z5BA 4DPUA 2V2ZA 3OTOE 1S4EA 1ZBQA 2MC5A 2WZOA 2HFSA 3PYEA 4B3RE 2JOXA 1RR9A 3MSWA 1N34I 2OI2A 1RC7A 1EI1A 2B9DA 4DV0I 2F4VI 4JI8E 5T6JA 2UXBE 3Q1QA 2FTXB 1N33E 1WHNA 2PNLA 3JTZA 4FWGA 2E1MA 4JI4E 2ZBKB 1ZXNA 4OX9E 3DJWA 3QT6A 4M2ZA 4Z7YA 2O1WA 3T1YE 1OJ4A 1Z0BA 2DEIA 2X36A 4JV5E 4F9AB 1KVKA 1H7UA 3V5RA 4B3MI 4MYTA 3F6GA 4AQYI 3C4TA 1VISA 1N0UA 2F8BA 3IWCA 4L8NA 3C4BA 3ZZTA 3J81C 2M7QA 2CZ9A 4P52A 1N34E 4X64I 4DV5E 2O1UA 2MC6A 4F9BB 4IZKB 3WU6A 4DV6E 5LMUI 1ZBTA 2V87A 4DV3I 2N3GA 1BKNA 1HNWE 5AE1A 2Z5CB 3LPSA 1XMQI 5A2QC 1XNRI 5IWAI 1B62A 2RS6A 4FN5A 2K4VA 4DR3I 1XNQI 4B3ME 4HACA 2Q2EB 2LUPB 4DR2I 4BBYA 4UT4A 4LF8I 1T4NA 1KIJA 1DI2A 4F9CB 4WYQB 2M1SA 4DUYE 2BV3A 4DUZI 2A2CA 1U2RA 3VYYA 1Y4SA 1I94E 2CPNA 4B3TE 1IBKI 4L5NC 4GKKI 5LMUE 4WUBA 3PYGA 3IWBA 4PRXA 2L3JA 2DMYA 1XMQE 5IWAE 1UHZA 2V83A 5FLXQ 4X66E 4NXME 2ODRC 4DR7E 3B82A 2ODRD 3AV0A 3ADJA 2B3TB 2RS7A 2L2NA 2UUAI 4DR2E 5BR8I 2JWOA 2V8QB 5LMNI 4RPFA 1X49A 4JG4A 1D6TA 5GMDA 3QT5A 4BMJA 4LFBE 3J7AM 2KONA 4X62I 5CFFE 1IBKE 1Z59A 2JR1A 4M30A 3LTOA 1N0VC 2V2VA 4GKKE 1N32I 4LU9A 4JI7I 3JAMQ 2ZM6I 1J5EE 4BCAA 1X47A 2R42A 4YHHI 4KHPI 2A2DA 2Z5BB 1Z0TA 2HK2A 1S16A 4DPWA 3T1HE 1YYOA 2CG9A 2EFGA 4LF6E 2X7IA 5L3JA 2VE7C 3WU3A 2HKEA 1PVGA 3IWDA 2DSYA 2JY9A 3ZKBA 4LF9I 1Y4UA 4Z7CA 2HK3A 2UU9E 1ZM9A 2H36X 1FI4A 2GS8A 3D4JA 2DB2A 1Y6ZA 4HXZA 1WHQA 4JI3E 1NHJA 4TUGA 4DR4E 4JI5I 3ADGA 4JI1E 2IOPA 4WUCA 3DF6A 1H7SA 1Z5AA 4X62E 3K17A 2V86A 1FJGE 1Z0GA 3RMPA 3PYDA 4DV1I 4DV4E 3HTXA 1XMOI 4JI2I 4LF7E 1USVA 1N36E 2VQFE 1N32E 2VF3A 4DV2I 5GMEA 4GEQB 1IBLE 2FV4B 1KKHA 2V2QA 1Z0EA 2JVAA 2UUBI 1RREA 4KZSA 4WSPA 1PIEA 5ADZA 4DV0E 2F4VE 4LF4I 1STUA 1UILA 4X8WA 4DR6I 2LTSA 4WFTA 2RSMA 1H72C 2YZTA 3ZKDA 2WW4A 3J80Q 4LTYA 3Q6NA 4DV1E 1XMOE 3LNUA 2L33A 3FIGA 4HACB 4AQYE 4R1FA 1J26A 1Z0VA 1EA6A 3AUZA 2NUFA 1ZM4A 3WU5A 2UUBE 3ZZ0A 3K85A 2VQEI 1Z5BA 2L2MA 2ZITA 1UEKA 4M0VA 2J7KA 4X64E 1WUUA 2E5LI 1QZRA 3OMLA 3HXLA 3JU0A 5FLXC 1XHKA 3J7Yp 4DPTA 2N3HA 4DV3E 1KTVA 3H09A 4PU9A 4JI6I 1XNRE 2LMZA 1YYWA 1HNXI 2UXCI 4X65I 3VK6A 4DR3E 1XNQE 2NA2A 4LFAI 2HHHI 2V85A 3M6AA 2LBSB 4PRVA 2BM1A 2LTRA 1GQEA 4K0KI 2LRSA 4LF8E 1HR0I 4DR5I 4R03A 1IBMI 5AASA 2IOQA 2VQEE 4WUDA 4DPXA 3JAMC 4DUZE 4USMA 1GZ6A 1Z5CA 3GONA 1FKAE 1HNZI 3V2UC 4F54A 1MU5A 1HK7A 2V8PA 2UXBI 1SR9A 1N33I 2B7TA 2EZ6A 3QT7A 4JI4I 3K1JA 4FWDA 4OX9I 2UXDI 1EKZA 1HNXE 1FWKA 1RQ0A 3F0NA 2L3CA 3T1YI 4JV5I 4LFAE 2XEXA 2UUAE 5BR8E 4UTGA 2L2KB 1ZM3A 4K0KE 2O1TA 5LMNE 4ED4A 1HR0E 2R3VA 5IT9Q 2JOBA 2EWLA 1USUA 3PYFA 3HPZA 3ZZUA 4TUIA 2AJ4A 1WXRA 3Q6MA 2YT4A 4IZJA 4IZJB 1HNZE 4DU7A 3PRYA 1PKPA 4DV5I 1ELOA 2NUGA 3HJCA 4JI7E 3WU4A 2DIXA 2ZM6E 3CWVA 4DKKA 4YHHE 4KHPE 2L8TA 2KHXA 4N3OA 4DV6I 3P06A 3HPSA 2B7VA 2VF1A 1HNWI 3LMLA 3P1XA 4BC9A 2UXDE 4JI0I 1ZXMA 4LF9E 4DMIA 3LLHA 1ZM2A 1T4LB 2V34A 4NXNI 4JYAI 2LJPA 4IZJD 3QT8A 4URLA 3J80C 4DPYA 1K47A 1MG7A 4JI5E 5AE2A 4FWHA 4XTJA 4FW9A 4WPYA 4DU8A 4DR1I 4DUYI 1NZ0A 4LFCI 2LUQA 4DV7I 4JI2E 1Z0WA 2PNMA 1I94I 2L6MA 2HFUA 4B3TI 3J7AG 4IZKA 4DV2E 3J81Q 4B3SI 1DARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8H A;  1YZ9 A;  4HYM A;  4JI0 E;  4YY3 I;  1YYK A;  2DEJ A;  4P7A A;  1FWL A;  4HY1 A;  3ZM7 A;  4DXL A;  4X66 I;  4NXM I;  4DR7 I;  1H74 A;  4LF4 E;  4I3H A;  4NXN E;  4JYA E;  2E1R A;  5A2Q Q;  4KQV A;  4DR6 E;  2LJH A;  2NPF A;  1QU6 A;  1A6F A;  4DR1 E;  4OOG C;  4LFB I;  4DV7 E;  4LFC E;  3ADI A;  2RTX A;  4LF5 I;  2HKJ A;  1FNM A;  4GKJ I;  4B3S E;  1Z0C A;  1T4O A;  4M1K A;  1J5E I;  4ZVI A;  2UUC I;  3B78 A;  3OTO I;  4YY3 E;  3T1H I;  4B3R I;  4LF6 I;  1B63 A;  2E5L E;  1NHI A;  1NHH A;  2BM0 A;  4JI8 I;  1MX0 A;  2UU9 I;  2NUE A;  4EMD A;  5LL6 R;  4JI3 I;  4DR4 I;  4JI6 E;  4JI1 I;  2IHR 1;  2MDR A;  3HUL A;  2UXC E;  4X65 E;  5IT9 C;  1FJG I;  4DV4 I;  2HHH E;  4LF5 E;  3ADL A;  4LF7 I;  1H73 A;  4GKJ E;  3VYX A;  1N36 I;  2VQF I;  4USK A;  3H4L A;  1O0W A;  4MYU A;  1X48 A;  4DR5 E;  2UUC E;  1IBL I;  1IBM E;  4DPU A;  2V2Z A;  3OTO E;  1S4E A;  2HFS A;  3PYE A;  4B3R E;  1RR9 A;  1N34 I;  2OI2 A;  1RC7 A;  1EI1 A;  4DV0 I;  2F4V I;  4JI8 E;  2UXB E;  3Q1Q A;  1N33 E;  1WHN A;  4FWG A;  4JI4 E;  2ZBK B;  1ZXN A;  4OX9 E;  3QT6 A;  4M2Z A;  4Z7Y A;  3T1Y E;  1OJ4 A;  1Z0B A;  2DEI A;  2X36 A;  4JV5 E;  1KVK A;  1H7U A;  3V5R A;  4B3M I;  4MYT A;  4AQY I;  3C4T A;  1VIS A;  1N0U A;  3C4B A;  3ZZT A;  3J81 C;  2CZ9 A;  4P52 A;  1N34 E;  4X64 I;  4DV5 E;  3WU6 A;  4DV6 E;  5LMU I;  1ZBT A;  4DV3 I;  2N3G A;  1BKN A;  1HNW E;  3LPS A;  1XMQ I;  5A2Q C;  1XNR I;  5IWA I;  1B62 A;  2RS6 A;  4FN5 A;  4DR3 I;  1XNQ I;  4B3M E;  4HAC A;  2Q2E B;  2LUP B;  4DR2 I;  4UT4 A;  4LF8 I;  1T4N A;  1KIJ A;  1DI2 A;  4WYQ B;  4DUY E;  2BV3 A;  4DUZ I;  2A2C A;  1U2R A;  3VYY A;  1I94 E;  2CPN A;  4B3T E;  1IBK I;  4GKK I;  5LMU E;  4WUB A;  3PYG A;  4PRX A;  2L3J A;  2DMY A;  1XMQ E;  5IWA E;  1UHZ A;  5FLX Q;  4X66 E;  4NXM E;  4DR7 E;  3B82 A;  3ADJ A;  2B3T B;  2RS7 A;  2L2N A;  2UUA I;  4DR2 E;  5BR8 I;  5LMN I;  4RPF A;  1X49 A;  4JG4 A;  1D6T A;  5GMD A;  3QT5 A;  4LFB E;  3J7A M;  4X62 I;  5CFF E;  1IBK E;  1Z59 A;  4M30 A;  3LTO A;  1N0V C;  2V2V A;  4GKK E;  1N32 I;  4JI7 I;  3JAM Q;  2ZM6 I;  1J5E E;  1X47 A;  2R42 A;  4YHH I;  4KHP I;  2A2D A;  1Z0T A;  2HK2 A;  1S16 A;  4DPW A;  3T1H E;  1YYO A;  2EFG A;  4LF6 E;  2X7I A;  5L3J A;  3WU3 A;  2HKE A;  1PVG A;  2JY9 A;  3ZKB A;  4LF9 I;  4Z7C A;  2HK3 A;  2UU9 E;  1ZM9 A;  1FI4 A;  2GS8 A;  3D4J A;  2DB2 A;  4HXZ A;  1WHQ A;  4JI3 E;  1NHJ A;  4JI5 I;  4DR4 E;  3ADG A;  4JI1 E;  4WUC A;  1H7S A;  1Z5A A;  4X62 E;  3K17 A;  1FJG E;  1Z0G A;  3PYD A;  4DV1 I;  4DV4 E;  3HTX A;  1XMO I;  4JI2 I;  4LF7 E;  1N36 E;  2VQF E;  1N32 E;  2VF3 A;  4DV2 I;  5GME A;  1IBL E;  1KKH A;  2V2Q A;  1Z0E A;  2JVA A;  2UUB I;  1RRE A;  1PIE A;  4DV0 E;  2F4V E;  4LF4 I;  1STU A;  1UIL A;  4X8W A;  4DR6 I;  2LTS A;  4WFT A;  2RSM A;  1H72 C;  3ZKD A;  2WW4 A;  3J80 Q;  4DV1 E;  1XMO E;  3LNU A;  2L33 A;  4HAC B;  4AQY E;  4R1F A;  1J26 A;  1Z0V A;  1EA6 A;  2NUF A;  1ZM4 A;  3WU5 A;  2UUB E;  3ZZ0 A;  2VQE I;  1Z5B A;  2L2M A;  2ZIT A;  1UEK A;  2J7K A;  4X64 E;  1WUU A;  2E5L I;  1QZR A;  5FLX C;  1XHK A;  3J7Y p;  4DPT A;  2N3H A;  4DV3 E;  1KTV A;  4PU9 A;  4JI6 I;  1XNR E;  1YYW A;  1HNX I;  2UXC I;  4X65 I;  4DR3 E;  1XNQ E;  2NA2 A;  4LFA I;  2HHH I;  3M6A A;  2LBS B;  4PRV A;  2BM1 A;  2LTR A;  1GQE A;  4K0K I;  2LRS A;  4LF8 E;  1HR0 I;  4DR5 I;  1IBM I;  2VQE E;  4WUD A;  4DPX A;  4DUZ E;  4USM A;  3JAM C;  1Z5C A;  3GON A;  1FKA E;  1HNZ I;  3V2U C;  1MU5 A;  2V8P A;  2UXB I;  1N33 I;  2B7T A;  2EZ6 A;  3QT7 A;  4JI4 I;  3K1J A;  4FWD A;  4OX9 I;  2UXD I;  1EKZ A;  1HNX E;  1FWK A;  1RQ0 A;  3F0N A;  2L3C A;  3T1Y I;  4JV5 I;  4LFA E;  2XEX A;  2UUA E;  5BR8 E;  4UTG A;  2L2K B;  1ZM3 A;  4K0K E;  5LMN E;  4ED4 A;  1HR0 E;  2R3V A;  5IT9 Q;  3PYF A;  3ZZU A;  2AJ4 A;  2YT4 A;  1HNZ E;  4DU7 A;  1PKP A;  4DV5 I;  1ELO A;  2NUG A;  4JI7 E;  3WU4 A;  2DIX A;  2ZM6 E;  3CWV A;  4DKK A;  4YHH E;  4KHP E;  2KHX A;  4DV6 I;  2B7V A;  1HNW I;  3P1X A;  2UXD E;  4JI0 I;  1ZXM A;  4LF9 E;  3LLH A;  1ZM2 A;  1T4L B;  2V34 A;  4NXN I;  4JYA I;  2LJP A;  3QT8 A;  4URL A;  4DPY A;  3J80 C;  1K47 A;  1MG7 A;  4JI5 E;  4FWH A;  4XTJ A;  4FW9 A;  4DU8 A;  4DR1 I;  4DUY I;  1NZ0 A;  4LFC I;  2LUQ A;  4DV7 I;  4JI2 E;  1Z0W A;  1I94 I;  2HFU A;  4B3T I;  3J7A G;  4DV2 E;  3J81 Q;  4B3S I;  1DAR A; 
#chains in the Genus database with same CATH topology
 3B8H A;  5F3W A;  1TF3 A;  3HQ1 A;  1YZ9 A;  2Z5C A;  3DD6 A;  4HYM A;  4JI0 E;  4YY3 I;  1YYK A;  2DEJ A;  4ISA A;  4P7A A;  2LE2 A;  1FWL A;  1ZR9 A;  4HY1 A;  3ZM7 A;  2V89 A;  4DXL A;  4X66 I;  4NXM I;  4DR7 I;  4J8Z A;  2PNZ B;  1H74 A;  4LF4 E;  4Q28 A;  5A69 A;  2EM8 A;  1DQ3 A;  4F2J C;  4I3H A;  4NXN E;  4JYA E;  2M4I A;  2E1R A;  5A2Q Q;  4KQV A;  4DR6 E;  2LJH A;  2NPF A;  2FGG A;  2DGC A;  1A1J A;  1G2D C;  1QU6 A;  2NN6 E;  1A6F A;  4DR1 E;  2GHF A;  5JEA A;  4OOG C;  5JEA B;  2JEB A;  2EOZ A;  2EOX A;  5AE3 A;  4LFB I;  4DV7 E;  4LFC E;  2KOU A;  2EM9 A;  3ADI A;  2RTX A;  4ZYD A;  1RMD A;  4BS9 A;  4LPF A;  4LF5 I;  2V88 A;  2HKJ A;  1FNM A;  1YUJ A;  4GKJ I;  4LCF A;  2ELZ A;  4B3S E;  1Z0C A;  1T4O A;  2EPC A;  3KWR A;  5KL2 A;  2J7J A;  1EH8 A;  2YRM A;  4M1K A;  4IFD C;  5AC4 A;  1J5E I;  1PJQ A;  4ZVI A;  2EMY A;  2HJJ A;  2PO0 B;  1N3G A;  2UUC I;  3B78 A;  1QNT A;  4P78 A;  3OTO I;  2EMX A;  2CT1 A;  2EM0 A;  3L00 A;  2WBS A;  4YY3 E;  2YTN A;  3K6Q A;  3T1H I;  4B3R I;  1TF6 A;  4LF6 I;  2YTG A;  2L92 A;  2EM6 A;  2AE8 A;  1B63 A;  2O1V A;  2E5L E;  2EMK A;  3BBG A;  5JEA D;  1NHI A;  1R6L A;  2EQ1 A;  1X6E A;  1NHH A;  2BM0 A;  4JI8 I;  1MX0 A;  4O24 A;  3ZOQ B;  2NUE A;  2EMI A;  2UU9 I;  4MU1 A;  4MU4 A;  4J3D A;  4EMD A;  5LL6 R;  2RQL A;  4JI3 I;  2NN6 A;  2EM7 A;  3F6H A;  4NZV A;  4DR4 I;  4JI6 E;  2EMB A;  4R8O A;  4JI1 I;  2I9I A;  3PS2 A;  4U3D A;  1MGT A;  2EOS A;  4P7D A;  2G7H A;  2IHR 1;  2MDR A;  3MHS C;  4RHB B;  5DNY A;  2UXC E;  1BB8 A;  3HUL A;  4X65 E;  1Z1B A;  2Z5E A;  5IT9 C;  1FJG I;  2CGE A;  4NHR A;  4DV4 I;  2HHH E;  1UBD C;  4LF5 E;  3ADL A;  1IQO A;  4LF7 I;  3MHH C;  1H73 A;  4GKJ E;  3VYX A;  2EOO A;  5FWK A;  1N36 I;  4BC7 A;  1B69 A;  2VQF I;  4I8O A;  2GQ0 A;  4USK A;  3TQM A;  3H4L A;  1O0W A;  2JXP A;  5JEA F;  2EMG A;  2K7I A;  4MYU A;  1X48 A;  4DR5 E;  2UUC E;  1L4S A;  1IBM E;  2Z5B A;  1IBL I;  4DPU A;  2V2Z A;  3OTO E;  1S4E A;  1ZBQ A;  2MC5 A;  2WZO A;  5C0X C;  4O5G A;  2HFS A;  3PYE A;  3THN A;  4B3R E;  2JOX A;  1LLM C;  1NEI A;  1RR9 A;  2C37 A;  3MSW A;  2C37 B;  1N34 I;  2EPZ A;  2OI2 A;  1RC7 A;  1EI1 A;  2B9D A;  4DV0 I;  2F4V I;  4JI8 E;  5T6J A;  2UXB E;  3Q1Q A;  2FTX B;  1N33 E;  1WHN A;  2PNL A;  2DRP A;  2EN6 A;  2EOY A;  2LCE A;  3JTZ A;  4FWG A;  2E1M A;  5DRO A;  4MDT A;  4JI4 E;  2PO2 B;  2ELY A;  2ZBK B;  3M99 B;  2EOQ A;  1T38 A;  3P3E A;  4LOM A;  1ZXN A;  4OX9 E;  1A1L A;  3DJW A;  3QT6 A;  2EN2 A;  5KL5 A;  5KL6 A;  4M2Z A;  4Z7Y A;  3B4T A;  2O1W A;  3BID A;  2LO3 A;  2IES A;  3T1Y E;  1OJ4 A;  1Z0B A;  2DEI A;  2X36 A;  4JV5 E;  4GQU A;  4F9A B;  1KVK A;  2MKN A;  1H7U A;  3L7Z B;  3V5R A;  4B3M I;  2NN6 F;  4AM3 A;  4MYT A;  4OO1 A;  4OO1 B;  3F6G A;  4AQY I;  3C4T A;  4FW6 A;  1OYR A;  2WNR B;  1VIS A;  2C38 B;  4BA2 B;  1N0U A;  1TN9 A;  2F8B A;  5A6B D;  2EL4 A;  3IWC A;  4L8N A;  4WXD A;  5A6K A;  5A6A A;  5K36 C;  2C39 B;  1X3C A;  3EPJ A;  3C4B A;  3ZZT A;  3J81 C;  2ADR A;  1G2F C;  2WBT A;  2M7Q A;  4BHB A;  2PRT A;  2CZ9 A;  2DMI A;  4P52 A;  1RHY A;  1N34 E;  2LVH A;  2JE6 B;  4X64 I;  2GO3 A;  4DV5 E;  3EQ1 A;  2O1U A;  1YH8 A;  2MC6 A;  4F9B B;  4LCH A;  4IZK B;  3WU6 A;  2JP9 A;  4DV6 E;  4IFD E;  5LMU I;  4ZYH A;  1ZBT A;  2V87 A;  4R2E A;  3EPK A;  2N3G A;  1BKN A;  2BR2 A;  1DGC A;  1WRJ A;  1HNW E;  4DV3 I;  4OO1 D;  2HC5 A;  5AE1 A;  2Z5C B;  3LPS A;  1XMQ I;  5A2Q C;  1XNR I;  5IWA I;  1B62 A;  2RS6 A;  2EL5 A;  4FN5 A;  2K4V A;  2EPR A;  4DR3 I;  2EOJ A;  1XNQ I;  4B3M E;  4O43 A;  4HAC A;  4FW5 A;  2Q2E B;  2LUP B;  2WBU A;  4DR2 I;  5TSE A;  4BBY A;  4UT4 A;  3H1C A;  4LF8 I;  1EH7 A;  3KZY A;  1T4N A;  2ENH A;  4R2C A;  1DI2 A;  1KIJ A;  5EKW A;  4F9C B;  4WYQ B;  2M1S A;  4DUY E;  2BV3 A;  2JEB B;  4DUZ I;  2A2C A;  4LCG A;  4OO1 F;  1U2R A;  2DLQ A;  2MKD A;  3VYY A;  1Y4S A;  1I94 E;  1Y60 A;  2CPN A;  2YSO A;  2F1D A;  4B3T E;  1IBK I;  3KZZ A;  4L5N C;  2BB8 A;  2M9A A;  4BA1 A;  4IFD A;  4GKK I;  1Y5Y A;  3M7N D;  4M9V C;  5LMU E;  4WUB A;  3PYG A;  1ZAA C;  2JT2 A;  4X9J A;  3IWB A;  5DRP A;  4PRX A;  2L3J A;  2DMY A;  2EJ4 A;  2YWQ A;  2EP3 A;  1XMQ E;  5C0X E;  2R76 A;  5IWA E;  3C6K A;  1UHZ A;  2EOM A;  2V83 A;  5FLX Q;  4X66 E;  2EQ3 A;  4NXM E;  2D9H A;  2ODR C;  4DR7 E;  5JEA C;  3B82 A;  2ODR D;  3AV0 A;  4NBQ A;  3ADJ A;  3M7N G;  2B3T B;  3NZK A;  3GME A;  4R2D A;  2RS7 A;  2L2N A;  2UUA I;  4DR2 E;  5BR8 I;  2YU5 A;  3C6M A;  2EPN A;  4KWY A;  2JWO A;  2V8Q B;  5LMN I;  2NN6 B;  4RPF A;  1X49 A;  4JG4 A;  1D6T A;  1IMU A;  3QT5 A;  5GMD A;  3UHM A;  4BMJ A;  4LFB E;  3J7A M;  5IXM B;  2KON A;  2RPC A;  4X62 I;  2DLK A;  5CFF E;  2YU8 A;  1IBK E;  2YTJ A;  2YTO A;  1Z59 A;  2NAB A;  2JR1 A;  4M30 A;  3LTO A;  1N0V C;  3QG5 C;  1YUI A;  2V2V A;  4GKK E;  1N32 I;  4LU9 A;  4FK5 C;  4MLV A;  4JI7 I;  3JAM Q;  2WP8 A;  1UDO A;  1BBG A;  1E3P A;  2WP8 B;  2ZM6 I;  1J5E E;  4BCA A;  1X47 A;  2R42 A;  4YHH I;  4KHP I;  3EPH A;  2A2D A;  2Z5B B;  1YFH A;  2BBG A;  2CTD A;  4IS9 A;  5K36 E;  1Z0T A;  2HK2 A;  5IV8 B;  1S16 A;  4WX9 A;  4DPW A;  3T1H E;  1YYO A;  4WXC A;  2CG9 A;  2EFG A;  2NN6 D;  4MU3 A;  4LF6 E;  2X7I A;  5L3J A;  2VE7 C;  2WCC 3;  2HKE A;  3WU3 A;  1PVG A;  4IFD F;  3IWD A;  2DSY A;  2JY9 A;  3ZKB A;  4HTG A;  1Y4U A;  5DRR A;  4Z7C A;  4LF9 I;  2HK3 A;  5EL9 A;  2UU9 E;  1ZM9 A;  4IS1 C;  2EMZ A;  2H36 X;  1FI4 A;  5DNL A;  5KL3 A;  2GS8 A;  2IER A;  3D4J A;  2DB2 A;  1Y6Z A;  4HXZ A;  2YTQ A;  4FW3 A;  1WHQ A;  4WSG A;  4JI3 E;  1NHJ A;  4TUG A;  4DR4 E;  4JI5 I;  2EML A;  1X6F A;  3ADG A;  4JI1 E;  2IOP A;  4WUC A;  2EMH A;  2GPI A;  4R2P A;  4QNJ A;  3DF6 A;  1H7S A;  1Z5A A;  4X62 E;  3K17 A;  2V86 A;  1FJG E;  1Z0G A;  3RMP A;  3PYD A;  4DV1 I;  4DV4 E;  3HTX A;  2JPA A;  1XMO I;  2EM3 A;  2VES A;  4JI2 I;  4LF7 E;  2EN3 A;  1USV A;  1N36 E;  4O4K A;  2VQF E;  1N32 E;  2VF3 A;  4DV2 I;  2JEA A;  3U1Y A;  2ENA A;  1UN6 B;  5GME A;  5K36 A;  4RH8 A;  4GEQ B;  1IBL E;  2FV4 B;  2YTD A;  5A6J A;  2EN7 A;  1KKH A;  2V2Q A;  1Z0E A;  2JVA A;  2EPL X;  2UUB I;  2EM2 A;  3BF2 A;  4Q35 B;  1A1H A;  1RRE A;  4KZS A;  2A25 A;  4WSP A;  1PIE A;  5ADZ A;  4DV0 E;  4QNK A;  1IQS A;  2YTP A;  2F4V E;  4LF4 I;  1STU A;  1F2I G;  4R2Q A;  1UIL A;  4X8W A;  4MLQ A;  2PO1 A;  4OO1 C;  3UK3 C;  4DR6 I;  2BR2 B;  2EQ0 A;  2LTS A;  4IJD A;  5DRQ A;  4WFT A;  2RSM A;  1H72 C;  2YSP A;  4AIM A;  4R2R A;  2YZT A;  2EN4 A;  3ZKD A;  2YPN A;  2WW4 A;  4LTY A;  3J80 Q;  3Q6N A;  4N4R B;  1PJT A;  4DV1 E;  5JEA E;  1XMO E;  4BHC A;  3LNU A;  3FIG A;  2L33 A;  4U3B A;  1MEY C;  4HAC B;  1PDA A;  4AQY E;  4R1F A;  1J26 A;  3ECR A;  1JK1 A;  1Z0V A;  1EA6 A;  3AUZ A;  2NUF A;  1BBO A;  1ZU1 A;  3HKM A;  2EOH A;  1ZM4 A;  3WU5 A;  2UUB E;  3ZZ0 A;  3K85 A;  1AH5 A;  2VQE I;  2MDG A;  1Z5B A;  2BA1 D;  2L2M A;  2LJU A;  2ZIT A;  1UEK A;  1X5W A;  1GTK A;  4M0V A;  2EMF A;  4X64 E;  2J7K A;  1WUU A;  5K36 F;  2PNZ A;  2E5L I;  2YTF A;  3P3C A;  1YHC A;  3P76 A;  4R2A A;  1QZR A;  3OML A;  3HXL A;  4BA1 B;  4IFD B;  2GO4 A;  3JU0 A;  5FLX C;  1XHK A;  2Q8U A;  1KJK A;  3J7Y p;  4DPT A;  2N3H A;  4DV3 E;  1KTV A;  2BA1 G;  3H09 A;  4PU9 A;  4JI6 I;  4R2S A;  1XNR E;  2LMZ A;  2EPM X;  1A1F A;  2GLI A;  1YYW A;  4MQY A;  1HNX I;  4F6N A;  2UXC I;  4X65 I;  2EMW A;  3VK6 A;  4DR3 E;  1R6M A;  1YSA C;  5KL4 A;  1XNQ E;  2NA2 A;  5ELW A;  2J65 A;  2EE8 A;  4FW7 A;  4LFA I;  2HHH I;  2BA0 D;  2V85 A;  3M6A A;  2LBS B;  4PRV A;  2BM1 A;  2LTR A;  1X6H A;  1GQE A;  2YTI A;  4K0K I;  2LRS A;  4LF8 E;  1HR0 I;  4AID A;  4IFD D;  3CDJ A;  2PO0 A;  3PS3 A;  4DR5 I;  4R03 A;  1JK2 A;  5AAS A;  1IBM I;  2IOQ A;  2VQE E;  4OKG A;  3M85 D;  2LT7 A;  4WUD A;  4DPX A;  3JAM C;  4DUZ E;  4USM A;  1E3H A;  2EMA A;  1GZ6 A;  2EOI A;  1Z5C A;  2BA0 G;  1UDQ A;  3GON A;  1FKA E;  1HNZ I;  3V2U C;  2EM4 A;  4F54 A;  2VRD A;  1MU5 A;  2YTE A;  1HK7 A;  2V8P A;  3GCM A;  2UXB I;  1SR9 A;  1WJP A;  1N33 I;  2B7T A;  3VHT B;  3M85 G;  2EZ6 A;  3QT7 A;  1OYP A;  3CDI A;  4JI4 I;  5C0X A;  5C0X B;  3K1J A;  4FWD A;  2NN6 C;  4OX9 I;  2UXD I;  1EKZ A;  1HNX E;  1FWK A;  1KYQ A;  1RQ0 A;  3F0N A;  2EMC A;  2L3C A;  3T1Y I;  4FW4 A;  4JV5 I;  4LFA E;  1EH6 A;  2XEX A;  2UUA E;  5BR8 E;  4UTG A;  1A1G A;  2L2K B;  2HGH A;  1ZM3 A;  4K0K E;  2O1T A;  5LMN E;  4OO1 E;  4ED4 A;  1HR0 E;  2R3V A;  4MU0 A;  2EPK X;  2O3Z A;  5IT9 Q;  1SFE A;  2JOB A;  2EOR A;  2EWL A;  1USU A;  3PYF A;  3HPZ A;  2I13 A;  3KRN A;  4ZYG A;  3ZZU A;  4TUI A;  1T39 A;  2AJ4 A;  1WXR A;  3Q6M A;  3U1K A;  2YT4 A;  5C0X D;  4IZJ A;  4IZJ B;  2ENC A;  1HNZ E;  4DU7 A;  3PRY A;  1PKP A;  4DV5 I;  1ELO A;  5A6B A;  2NUG A;  3HJC A;  1PJS A;  4JI7 E;  2JEA B;  1OYS A;  3WU4 A;  2DIX A;  2EN1 A;  2ZM6 E;  4DKK A;  3CWV A;  4YHH E;  5K36 B;  1YPN A;  2L8T A;  2KHX A;  4KHP E;  4N3O A;  4DV6 I;  2PO2 A;  2EM5 A;  4OZE A;  3P06 A;  3HPS A;  2EL6 A;  2EPO A;  2B7V A;  2VF1 A;  4F6M A;  1HNW I;  2EOE A;  2R1F A;  2EPX A;  2LV2 A;  3LML A;  4DV7 I;  4HEI A;  3P1X A;  4BC9 A;  2E72 A;  2UXD E;  2RSI A;  4JI0 I;  4GZN C;  3THO B;  1ZXM A;  4LF9 E;  4DMI A;  3LLH A;  1ZM2 A;  2CVE A;  1P47 A;  2EOF A;  1T4L B;  1UDN A;  2YRH A;  3L7Z A;  5C0X F;  2V34 A;  4NXN I;  4JYA I;  2LJP A;  2PO1 B;  3P3G A;  3QT8 A;  3PS1 A;  4IZJ D;  3J80 C;  4DPY A;  2WNR A;  2C38 A;  4URL A;  1K47 A;  1XXE A;  4BA2 A;  1MG7 A;  5KL7 A;  5AE2 A;  4JI5 E;  3GLL A;  4FWH A;  4XTJ A;  5DNX A;  1UDS A;  4FW9 A;  4WPY A;  2C39 A;  5AC5 A;  1NCS A;  5LLQ A;  1AAY A;  4DU8 A;  4DR1 I;  1VI7 A;  5K36 D;  2EPU A;  4DUY I;  1A1K A;  3BGH A;  1NZ0 A;  2YRK A;  2LUQ A;  2EPA A;  4LFC I;  1A1I A;  4JI2 E;  4ZYE A;  1Z0W A;  2JE6 A;  2PNM A;  1I94 I;  2L6M A;  2HFU A;  4B3T I;  2EPP A;  1P42 A;  3EPL A;  3J7A G;  4IZK A;  4DV2 E;  3J81 Q;  4B3S I;  2CSH A;  2JYA A;  2N8X A;  2EN8 A;  1DAR A; 
#chains in the Genus database with same CATH homology
 3B8H A;  5F3W A;  3HQ1 A;  1YZ9 A;  2Z5C A;  4HYM A;  4JI0 E;  4YY3 I;  1YYK A;  2DEJ A;  4P7A A;  2LE2 A;  1FWL A;  4HY1 A;  3ZM7 A;  4DXL A;  2V89 A;  4X66 I;  4NXM I;  4DR7 I;  4J8Z A;  1H74 A;  4LF4 E;  4Q28 A;  1DQ3 A;  4I3H A;  4NXN E;  4JYA E;  2M4I A;  2E1R A;  5A2Q Q;  4KQV A;  4DR6 E;  2LJH A;  2NPF A;  2FGG A;  1QU6 A;  1A6F A;  4DR1 E;  4OOG C;  4LFB I;  5AE3 A;  4DV7 E;  4LFC E;  2KOU A;  3ADI A;  2RTX A;  4BS9 A;  4LF5 I;  2V88 A;  2HKJ A;  1FNM A;  4GKJ I;  4B3S E;  1Z0C A;  1T4O A;  3KWR A;  4M1K A;  1J5E I;  4ZVI A;  2UUC I;  3B78 A;  4P78 A;  3OTO I;  4YY3 E;  3K6Q A;  3T1H I;  4B3R I;  4LF6 I;  2L92 A;  1B63 A;  2O1V A;  2E5L E;  1NHI A;  1NHH A;  2BM0 A;  4JI8 I;  1MX0 A;  3ZOQ B;  2NUE A;  2UU9 I;  4EMD A;  5LL6 R;  4JI3 I;  3F6H A;  4DR4 I;  4JI6 E;  4R8O A;  4JI1 I;  5DNY A;  4P7D A;  2G7H A;  2IHR 1;  2MDR A;  3HUL A;  2UXC E;  4X65 E;  2Z5E A;  5IT9 C;  1FJG I;  2CGE A;  4DV4 I;  2HHH E;  4LF5 E;  3ADL A;  4LF7 I;  1H73 A;  4GKJ E;  3VYX A;  5FWK A;  1N36 I;  4BC7 A;  2VQF I;  4I8O A;  2GQ0 A;  4USK A;  3H4L A;  1O0W A;  4MYU A;  1X48 A;  4DR5 E;  2UUC E;  1IBL I;  1IBM E;  2Z5B A;  4DPU A;  2V2Z A;  3OTO E;  1S4E A;  1ZBQ A;  2MC5 A;  2WZO A;  2HFS A;  3PYE A;  4B3R E;  2JOX A;  1RR9 A;  3MSW A;  1N34 I;  2OI2 A;  1RC7 A;  1EI1 A;  2B9D A;  4DV0 I;  2F4V I;  4JI8 E;  5T6J A;  2UXB E;  3Q1Q A;  2FTX B;  1N33 E;  1WHN A;  2PNL A;  3JTZ A;  4FWG A;  2E1M A;  4JI4 E;  2ZBK B;  1ZXN A;  4OX9 E;  3DJW A;  3QT6 A;  4M2Z A;  4Z7Y A;  2O1W A;  3T1Y E;  1OJ4 A;  1Z0B A;  2DEI A;  2X36 A;  4JV5 E;  4F9A B;  1KVK A;  1H7U A;  3V5R A;  4B3M I;  4MYT A;  3F6G A;  4AQY I;  3C4T A;  1VIS A;  1N0U A;  2F8B A;  3IWC A;  4L8N A;  3C4B A;  3ZZT A;  3J81 C;  2M7Q A;  2CZ9 A;  4P52 A;  1N34 E;  4X64 I;  4DV5 E;  2O1U A;  2MC6 A;  4F9B B;  4IZK B;  3WU6 A;  4DV6 E;  5LMU I;  1ZBT A;  2V87 A;  4DV3 I;  2N3G A;  1BKN A;  1HNW E;  5AE1 A;  2Z5C B;  3LPS A;  1XMQ I;  5A2Q C;  1XNR I;  5IWA I;  1B62 A;  2RS6 A;  4FN5 A;  2K4V A;  4DR3 I;  1XNQ I;  4B3M E;  4HAC A;  2Q2E B;  2LUP B;  4DR2 I;  4BBY A;  4UT4 A;  4LF8 I;  1T4N A;  1KIJ A;  1DI2 A;  4F9C B;  4WYQ B;  2M1S A;  4DUY E;  2BV3 A;  4DUZ I;  2A2C A;  1U2R A;  3VYY A;  1Y4S A;  1I94 E;  2CPN A;  4B3T E;  1IBK I;  4L5N C;  4GKK I;  5LMU E;  4WUB A;  3PYG A;  3IWB A;  4PRX A;  2L3J A;  2DMY A;  1XMQ E;  5IWA E;  1UHZ A;  2V83 A;  5FLX Q;  4X66 E;  4NXM E;  2ODR C;  4DR7 E;  3B82 A;  2ODR D;  3AV0 A;  3ADJ A;  2B3T B;  2RS7 A;  2L2N A;  2UUA I;  4DR2 E;  5BR8 I;  2JWO A;  2V8Q B;  5LMN I;  4RPF A;  1X49 A;  4JG4 A;  1D6T A;  5GMD A;  3QT5 A;  4BMJ A;  4LFB E;  3J7A M;  2KON A;  4X62 I;  5CFF E;  1IBK E;  1Z59 A;  2JR1 A;  4M30 A;  3LTO A;  1N0V C;  2V2V A;  4GKK E;  1N32 I;  4LU9 A;  4JI7 I;  3JAM Q;  2ZM6 I;  1J5E E;  4BCA A;  1X47 A;  2R42 A;  4YHH I;  4KHP I;  2A2D A;  2Z5B B;  1Z0T A;  2HK2 A;  1S16 A;  4DPW A;  3T1H E;  1YYO A;  2CG9 A;  2EFG A;  4LF6 E;  2X7I A;  5L3J A;  2VE7 C;  3WU3 A;  2HKE A;  1PVG A;  3IWD A;  2DSY A;  2JY9 A;  3ZKB A;  4LF9 I;  1Y4U A;  4Z7C A;  2HK3 A;  2UU9 E;  1ZM9 A;  2H36 X;  1FI4 A;  2GS8 A;  3D4J A;  2DB2 A;  1Y6Z A;  4HXZ A;  1WHQ A;  4JI3 E;  1NHJ A;  4TUG A;  4DR4 E;  4JI5 I;  3ADG A;  4JI1 E;  2IOP A;  4WUC A;  3DF6 A;  1H7S A;  1Z5A A;  4X62 E;  3K17 A;  2V86 A;  1FJG E;  1Z0G A;  3RMP A;  3PYD A;  4DV1 I;  4DV4 E;  3HTX A;  1XMO I;  4JI2 I;  4LF7 E;  1USV A;  1N36 E;  2VQF E;  1N32 E;  2VF3 A;  4DV2 I;  5GME A;  4GEQ B;  1IBL E;  2FV4 B;  1KKH A;  2V2Q A;  1Z0E A;  2JVA A;  2UUB I;  1RRE A;  4KZS A;  4WSP A;  1PIE A;  5ADZ A;  4DV0 E;  2F4V E;  4LF4 I;  1STU A;  1UIL A;  4X8W A;  4DR6 I;  2LTS A;  4WFT A;  2RSM A;  1H72 C;  2YZT A;  3ZKD A;  2WW4 A;  3J80 Q;  4LTY A;  3Q6N A;  4DV1 E;  1XMO E;  3LNU A;  2L33 A;  3FIG A;  4HAC B;  4AQY E;  4R1F A;  1J26 A;  1Z0V A;  1EA6 A;  3AUZ A;  2NUF A;  1ZM4 A;  3WU5 A;  2UUB E;  3ZZ0 A;  3K85 A;  2VQE I;  1Z5B A;  2L2M A;  2ZIT A;  1UEK A;  4M0V A;  2J7K A;  4X64 E;  1WUU A;  2E5L I;  1QZR A;  3OML A;  3HXL A;  3JU0 A;  5FLX C;  1XHK A;  3J7Y p;  4DPT A;  2N3H A;  4DV3 E;  1KTV A;  3H09 A;  4PU9 A;  4JI6 I;  1XNR E;  2LMZ A;  1YYW A;  1HNX I;  2UXC I;  4X65 I;  3VK6 A;  4DR3 E;  1XNQ E;  2NA2 A;  4LFA I;  2HHH I;  2V85 A;  3M6A A;  2LBS B;  4PRV A;  2BM1 A;  2LTR A;  1GQE A;  4K0K I;  2LRS A;  4LF8 E;  1HR0 I;  4DR5 I;  4R03 A;  1IBM I;  5AAS A;  2IOQ A;  2VQE E;  4WUD A;  4DPX A;  3JAM C;  4DUZ E;  4USM A;  1GZ6 A;  1Z5C A;  3GON A;  1FKA E;  1HNZ I;  3V2U C;  4F54 A;  1MU5 A;  1HK7 A;  2V8P A;  2UXB I;  1SR9 A;  1N33 I;  2B7T A;  2EZ6 A;  3QT7 A;  4JI4 I;  3K1J A;  4FWD A;  4OX9 I;  2UXD I;  1EKZ A;  1HNX E;  1FWK A;  1RQ0 A;  3F0N A;  2L3C A;  3T1Y I;  4JV5 I;  4LFA E;  2XEX A;  2UUA E;  5BR8 E;  4UTG A;  2L2K B;  1ZM3 A;  4K0K E;  2O1T A;  5LMN E;  4ED4 A;  1HR0 E;  2R3V A;  5IT9 Q;  2JOB A;  2EWL A;  1USU A;  3PYF A;  3HPZ A;  3ZZU A;  4TUI A;  2AJ4 A;  1WXR A;  3Q6M A;  2YT4 A;  4IZJ A;  4IZJ B;  1HNZ E;  4DU7 A;  3PRY A;  1PKP A;  4DV5 I;  1ELO A;  2NUG A;  3HJC A;  4JI7 E;  3WU4 A;  2DIX A;  2ZM6 E;  3CWV A;  4DKK A;  4YHH E;  4KHP E;  2L8T A;  2KHX A;  4N3O A;  4DV6 I;  3P06 A;  3HPS A;  2B7V A;  2VF1 A;  1HNW I;  3LML A;  3P1X A;  4BC9 A;  2UXD E;  4JI0 I;  1ZXM A;  4LF9 E;  4DMI A;  3LLH A;  1ZM2 A;  1T4L B;  2V34 A;  4NXN I;  4JYA I;  2LJP A;  4IZJ D;  3QT8 A;  4URL A;  3J80 C;  4DPY A;  1K47 A;  1MG7 A;  4JI5 E;  5AE2 A;  4FWH A;  4XTJ A;  4FW9 A;  4WPY A;  4DU8 A;  4DR1 I;  4DUY I;  1NZ0 A;  4LFC I;  2LUQ A;  4DV7 I;  4JI2 E;  1Z0W A;  2PNM A;  1I94 I;  2L6M A;  2HFU A;  4B3T I;  3J7A G;  4IZK A;  4DV2 E;  3J81 Q;  4B3S I;  1DAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...