4HACA

Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
312
structure length
312
Chain Sequence
HSSGLVPRGSHMVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEKCNQVAEAVAGAGGKVTITKPTEQGLKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary X-ray diffraction analysis of mevalonate kinase from Methanosarcina mazei.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
molecule keywords Mevalonate kinase
total genus 89
structure length 312
sequence length 312
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4hacA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4hacA01
4DR2E 1HR0E 4LFBE 1H73A 1ZM2A 5A2QQ 4DV7E 1K47A 4DV2E 2J7KA 2UU9I 1XMOI 2A2DA 1Z0TA 2OI2A 5LMUI 4DR6E 4DR6I 5FLXQ 1ZXNA 1FJGE 3ZM7A 1HNZI 4B3MI 4LF9I 3V5RA 4HYMA 1HR0I 4LFBI 4JI1E 3ZZUA 4JYAI 4M1KA 4X62E 3LNUA 2VQEE 4P7AA 3T1HE 4B3RE 1I94E 2HK2A 2NPFA 4YHHE 1N0UA 2V2QA 4DR5E 3B82A 4JV5I 4JV5E 4LF5E 4DR5I 3K17A 4YHHI 5GMEA 2BM0A 3ZKBA 3J80Q 1ZM4A 1PIEA 2UXDI 4JI8E 3T1HI 3PYFA 1XNRI 4UT4A 1H7SA 1IBKI 1PVGA 2XEXA 2VQEI 1FWLA 3HULA 4JYAE 1D6TA 4JI1I 1Z59A 1A6FA 1ZXMA 1Z5CA 1KKHA 4LF9E 1Z5AA 4JG4A 4B3ME 1IBLI 1HNZE 2GS8A 1FJGI 1ZM3A 1NHIA 4KHPE 4MYTA 4DR7I 5LMUE 4DPWA 1XMOE 4HXZA 3GONA 1OJ4A 2UU9E 4FW9A 4DV2I 2R3VA 1RR9A 4DV7I 2HHHE 4DPUA 4B3TI 1B62A 3WU6A 4DR2I 2E5LI 5A2QC 3T1YI 1N34I 3WU5A 3ZZTA 4B3SE 3QT6A 3Q1QA 1QZRA 1Z0BA 1BKNA 4EMDA 1VISA 2F4VI 4DU8A 2Q2EB 4X64E 4DV0I 2VQFE 2UUAI 4I3HA 4X65I 1HNXE 4NXNE 1N36I 3V2UC 2ZBKB 1XMQI 4NXME 4LF6E 2ZITA 1N32E 4DV3E 4DR4I 1PKPA 4DUYI 2HKEA 1Z0VA 4YY3E 4GKKI 4JI4E 5IWAE 4LFAE 4PRXA 3ZZ0A 5IT9Q 4DV5E 1MG7A 1IBME 4LF7E 1DARA 4AQYI 2UXBE 2VF3A 1XHKA 2UXCI 2ZM6I 1ZM9A 4LF4I 4LF8I 4DUZE 4DR1E 4Z7YA 4JI5E 4LFCE 2HK3A 4XTJA 1N33E 3B8HA 4DV1I 2UUCI 3WU4A 1Z5BA 3JAMC 3OTOI 3D4JA 4JI0E 4OX9I 1XNQI 1KVKA 3CWVA 2UUBE 1ELOA 2A2CA 4DU7A 1FKAE 4WUDA 4PRVA 1B63A 3H4LA 2EFGA 2V2VA 4JI6I 4DV4E 3JAMQ 3PYGA 4USMA 4DV6E 4GKJE 1MX0A 4FWHA 5LMNE 4DV4I 4JI6E 4DR3I 4FN5A 2HFSA 1RREA 5BR8I 4K0KE 2DEIA 4RPFA 3QT5A 5GMDA 1MU5A 4JI2I 2V2ZA 2UUBI 4HACA 1HNWE 4OX9E 1XNQE 4JI0I 1J5EE 2E1RA 4JI3I 4X66I 4DV1E 4Z7CA 4JI5I 4JI7E 2HKJA 4LF8E 4LF4E 3J81Q 4JI7I 5IT9C 2ZM6E 2UXCE 2AJ4A 3J80C 2CZ9A 4X66E 3WU3A 4JI3E 4LF7I 1IBMI 1J5EI 3LPSA 1S4EA 1HNWI 1FNMA 4WUBA 4JI2E 2WW4A 4K0KI 4JI4I 5BR8E 4YY3I 3J7AM 1Z0GA 1H74A 4DR3E 1S16A 1NZ0A 5LMNI 1FWKA 4LF6I 4GKJI 1XMQE 4DV6I 4WUCA 1N36E 2HFUA 4FWGA 1HNXI 4PU9A 4X65E 1UEKA 4DV0E 2X36A 1H72C 2LJPA 1Z0WA 4KQVA 4USKA 1N0VC 1Z0CA 3QT7A 3QT8A 4ZVIA 2V34A 3LTOA 4DPTA 3OTOE 5FLXC 4B3SI 2UUCE 1N33I 4LFCI 2E5LE 4DUZI 4DR1I 4DXLA 1KTVA 4B3TE 3PYDA 2HHHI 4DPYA 3J81C 2UXBI 1Z0EA 3PYEA 1EI1A 1WUUA 4FWDA 4AQYE 4P52A 4DR7E 2BV3A 4KHPI 4HACB 3ZKDA 4DV5I 1IBLE 4UTGA 4HY1A 3M6AA 2BM1A 5IWAI 4LFAI 3J7AG 4GKKE 4DUYE 2V8PA 1IBKE 4DR4E 1XNRE 4DV3I 1N32I 4JI8I 4NXMI 1EA6A 2UXDE 1NHHA 4NXNI 4URLA 2UUAE 3K1JA 2VQFI 4R1FA 1FI4A 4X64I 2X7IA 1KIJA 4LF5I 4DPXA 4MYUA 2F4VE 4ED4A 1U2RA 1NHJA 5LL6R 1I94I 3B78A 4B3RI 3F0NA 1N34E 2R42A 1H7UA 5L3JA 3T1YE 2DEJA 4X62I
chains in the Genus database with same CATH superfamily
3H5SA 3UD5A 1FJ7A 2RUGA 2BYCA 1T9YA 1HR0E 3MPVA 2OPPA 3CUNA 2YQ1A 4PQUA 4MQYA 4RL1A 2EC0A 3J7YU 3M7ND 4X64F 1MWYA 4DV7E 3W8PA 2E5JA 2GA7A 4JI1F 1HD1A 1RAJA 2ZOFA 3HJCA 2UU9I 1B99A 2YKNB 3PY8A 2Z30B 1S99A 5JMNA 3VAKA 3ENVA 1YRUA 2DHXA 5CA5A 4IFDF 1Z0TA 1B0PA 2IRYA 5KT4A 1UEUA 2BA1G 2ZDOA 8RUCA 4UW2A 1WJ9A 1IKWB 2CNKB 5FLXQ 3M8PA 4PG5A 2D3OR 1ZPWX 4LF7J 2F65A 1ZXNA 4X2BA 1NHUA 1KFSA 4JP8A 2FVSA 2EFOA 3MEGA 4LF5J 2OSRA 2PN6A 2QYGA 2ZVSA 4MTPA 5L9XA 4DR7F 5IWAF 4LFAF 3FQLA 3AOBA 3CDBA 4F0KA 1QAJA 1FEEA 2RRAA 3ITHB 4ZITA 4FF4A 1OPZA 3LGHA 4ID5B 1T11A 2RB7A 4XDCA 1TV6A 4L74A 3SFUA 4C3MA 4CLZA 1UAWA 2A0FB 5KFHA 4GQUA 4JI1E 1FD2A 3DXSX 2BJ7A 3FNNA 4ZCKA 5K20B 3QIPA 4YQWA 2CNNB 2ZHBA 4B3TF 3K5NA 3VWSA 2I0XA 4HH1A 2HNYA 5C24B 3J7Z5 2EBGA 2K3IA 3CD6S 3QGPA 3T5JA 5K5MA 4C0OC 2ATLA 1W26A 1Y10A 2VPZB 3CO9A 4BC7A 2HMIA 4B3RE 1TK0A 2AYBA 1LWCA 1E6YA 2WONB 1BLUA 2RQMA 3KFWX 3RAMA 5CCMA 5JXSA 2N7CA 4CO0A 2KDOA 4LSNA 4FF2A 4O0NA 4CNYA 1CJVA 2EC2A 1S1TB 3OXLA 5F41A 1SPBP 1UA0A 4OO1B 1HBOA 1WI8A 2LA6A 2FZGB 2GW8A 2HK2A 2VBXA 2OPSA 4IH7A 1W2BR 4YHHE 3LPYA 3C16B 1N0UA 2AHOB 5CZVA 4LF9E 1BUXA 4JV5I 1YZ6A 3GV8B 1X4FA 3IS9A 4P7VA 1UCNA 5E2QA 4IH6A 1I94F 4PWDB 5H9EK 1LW2B 2B6AA 5A8KA 1NK5A 2BM0A 4ILMA 2IJFA 1HHTP 5DZ6A 3K58A 3P06A 2WNRA 4B3RF 3DRRA 2B5JA 4CLYA 4LVOP 3PEHA 2DNYA 2K3KA 4OX6A 1SKWA 1HNVA 4F4KA 2RRBA 1JQGA 2JRSA 2WOMA 4DV4J 1YBAA 1FNXH 2PC6A 1NJYA 1K9MT 3C6TB 5JJBA 3W9HA 2FLPA 2MHNA 4C98A 3T1HJ 5F8GA 4HYKA 2BJEA 5DRKA 1T05A 4JI8E 2C39B 1WF0A 3R6GB 1RT6B 2DHAA 4I1TA 2IVFB 4CQ1A 4DV3J 1XMQF 2E66A 1VJQA 2QFIA 2YNHB 2UP1A 4V19J 4YB6A 3I0SB 2PGCA 2IESA 1D6TA 2ZH2A 1RTDA 2B9WA 1S72S 2MSTA 4X4OA 2WBRA 2IVMA 4FBUA 1D3WA 2MB0B 5IT9C 2DJWA 1R8AA 2BA0D 4R0EA 1T02A 2GFFA 2GV1A 4DV1F 3ENQA 2C3OA 5LMUF 1DJ0A 1Z5AA 5HO4A 4DR6F 3W65A 3NMRA 3MEDA 2ZH9A 2LEBA 5B0GA 3NNHA 1K0TA 1YDLA 1IBLI 2XGPA 1HARA 2R8GA 5EWEA 4ZCIA 1A9NB 1FTCA 3DDKA 2J7UA 4DN9A 3DLHA 4C8ZA 4QBUA 3JSYA 2JT2A 5K36C 1RSCA 4LRFA 1CBKA 1X5PA 3R3TA 2QX0A 4DPWA 2QEXS 4ECSA 5I3UA 1ITPA 3KHRA 4MAKA 2F4VF 3GONA 2HRTA 4K4ZA 4MU1A 1OJ4A 2B8PA 3GJQB 3AJ1A 5CZXA 3G6VA 2ZH6A 2FJXA 1U47A 1K8AT 4DV2I 2YKQA 3C3LA 3UWTA 2HHHE 4UOGA 4HI1A 4YR3A 5DG7A 4JYAF 3OXFA 2C37A 1N6QA 3RB3A 1M5PC 3D0GE 3MM9A 1UJ5A 3WU6A 1HA1A 2UXBJ 2W7PA 2NREA 1HFEL 4ZHRA 5LJ3Y 3VTIA 2E5LI 4CLWA 5J2QA 2FJVA 1U8WA 4QU6A 3DI6A 2GZOA 2NZ4A 1JXLA 5DQHA 2JEBB 2GQ2A 2RHSB 1YKWA 3Q22A 1REGX 2DISA 3SYZA 1UVIA 2JEIA 1RAEB 2GVZB 3JS9A 3ZZTA 4IR9A 1R0CB 1NSAA 2PA3A 3LA0A 4HI2A 3ZNJ1 4CRJA 4DV0J 4F4WA 1NK4A 4DUTA 2B5JB 3Q1QA 2CQ2A 3NWGA 3GMGA 2MY7A 4J37A 4DSKA 3HT3A 1B4SA 4C11A 1UFLA 2FZKB 1RTHA 4O3RA 2YVSA 3NMAA 3MAAA 1V5IB 1FERA 1GAOA 1VISA 2MZTA 2BJDA 2RE1A 4HHUA 1RISA 4OI2A 5A76A 4LR9A 4EFAC 3MR5A 2C42A 2F4VI 3AA9A 3M32B 2J76E 3PJXA 5CAAA 3DD6A 3DRXA 1UWAA 2DNRA 2U2FA 4NYOA 3SSQA 2JFKA 3P45B 3CO0P 2VQFE 2HWHA 1SXLA 1X7VA 3M1VA 1HNXE 5B0FA 3EGZA 2KO1A 2J9CA 4RW4A 4OHYA 1YJUA 3V2UC 2YNGA 3L3CA 1T94A 2GQ0A 2GJFA 3SDEA 3OFEA 4FF1A 3DLEA 2KT2A 2W2PP 3AB4B 1DLOB 3VV2B 4HLBA 2XO6A 1F5BA 4P6QA 4DR4I 3KLFA 3GG0A 3U27A 4IFYB 1RHJB 2JNJA 1RT2B 1M5SA 3SXLA 5IFMA 2A6OA 2ALZA 4BA2A 5C42A 4B17A 1AFIA 3BM7A 5ETPA 5G4DA 4R5PB 4HTIA 2E1PA 1GQEA 4L73A 2D74B 2VZ9A 2UUAJ 1S6OA 1OQ3A 1RU1A 1NH8A 4DLEA 5IWAE 2ZFHA 2EFVA 1EKRA 1NRKA 1SUQA 1FF2A 4AXJA 1XR7A 3HI9A 4P2MA 1LW0B 4CO4A 4E8UA 4ETXA 4JI4J 1CQMA 2VFTA 1ZPVA 2M52A 2YWKA 2PFDA 1X5SA 2FUG9 3EICA 4KFBB 4WK1A 3KJVB 1Q5YA 4O3SA 2O1UA 2J7WA 1WEYA 1Z2ZA 1H3DA 2GMHA 1PCAA 3KG0A 3SSRA 4CM2A 5HQLA 2ZH3A 1PILA 4O3QA 1X9SA 2HQGA 4OZ5A 4CLUA 2YNIA 2UV8A 2OLWA 1MG7A 3LW5C 3AJDA 1Y4SA 4JYAI 2VD3A 1VQKS 2XNQA 5FDLB 4OYAA 4OX7A 4OYIA 1UZDA 3OHAA 1PJ6A 3DMJA 3HHEA 3RW6A 1SB6A 1GMWD 4A8SA 4FBTA 3GCWP 4IZJA 5K36A 3DRSB 2BE7D 3W62A 1DY3A 3HJFA 1ZAWA 2ABYA 3CJ8A 5HMWA 1QAXA 3K57A 4ED2A 4LF4I 4B9UA 2MLXA 3R5AA 1OMSA 2VQEJ 3EXYA 2UU9E 1VQNS 5EDWA 3G96A 3QRRA 4KTQA 1EHWA 2VB6A 2J5AA 2RU9A 1QSLA 2NXCA 3WC0A 1YZ7A 3FEXB 3ZNUA 3KLGB 4XTJA 3M6WA 2GIQA 4FF3A 2VV5A 1SIZA 1RT1B 2M0GB 5AXNA 3G8QA 2E5HA 2QC3A 4DR6I 1K73T 1HIYA 1YJRA 1TUGB 3M6XA 2B3TB 4RW8B 1F9HA 4TKTA 3G71S 3NL0A 1G2EA 3D67A 1URRA 4JI0E 3SQGB 3OFHA 2R2TA 1XEZA 2R7QA 3UVJA 2V94A 2C38A 2OP5A 4UF4A 2W9BB 1X4BA 4N41A 1TELA 3U7JA 2XY7A 1FRHA 3VZIA 3GV7B 2AV5A 2BRKA 1FTRA 1LW0A 3MMJA 2WSEC 4RWXA 3QGHA 1RYRA 1UW4A 3JSRA 4MFBB 3OL9A 4FW6A 4WUDA 5C0XA 3RB6A 2O3DA 4ZVUB 4R8UB 2PD1A 1RI7A 1TKTB 2EFGA 2H54B 2OH2A 3H4LA 3O44A 5I3QA 1RCOB 2Y1LB 3MCNA 4JI6I 2ZEJA 3N6MA 3CCVS 1HPZA 5MLCV 1YH8A 1S9GB 2AMCB 3PYGA 2VJVA 3J7AN 1YSJA 2PNLA 3HHKA 2MKSA 4PXEA 4TN2A 2ASJA 3ICLA 1U1KA 2Y1JA 2DD8S 2XULA 1VIXA 2JDJA 4NPOA 1QAYA 3I56S 3PKYA 3RU0A 4AE5A 3CC2S 4LF8J 1AYEA 4C2MA 1R8CA 5ADZA 5ETSA 3BGFA 2ZC4A 2IJNA 2N7YA 2JEAB 1OYEA 4WFNQ 3OVBA 2CJBA 4HHJA 2RIJA 1QVFR 1NU4A 1SI9A 3J80U 2WVEA 1DAXA 2HNDA 2LKZA 5GMDA 3IBWA 3EVOA 2Z58B 1WWHA 3ILLA 4MH8A 4ZA1A 2FLLA 3UR3C 1FXRA 3D2WA 3KNAA 4UOHA 4ECQA 2A3JA 4JI2I 2XLKA 2RDDA 3MM6A 3A13A 1WKJA 4A8YA 1LFPA 1RCXB 3W7BA 4A47A 1Z2LA 4AQYF 2VONA 2B43A 1O0PA 2V5HG 4OX9E 1XNQE 3DDNA 3BSNA 2MKYA 1J5EE 1MWZA 3D6TB 4NLQA 3LP2B 4FW3A 2E1RA 4DR4J 1R6YA 5KT7A 5AJ3J 4I2QB 2MDAA 3L7OA 4OZ0A 2P9GA 1V6HA 3AY0A 4RU9A 4TLRA 3CB4A 3UN3A 2HVDA 4DR2J 4DL3A 2VA3A 1BXNA 2CJAA 3ZTPA 3EM1A 3HSGA 3M8YA 3MWBA 3FEYB 4JYAJ 3EDRB 2IY5B 3P3CA 3D0IE 1X8DA 2DIUA 3GSIA 1SQFA 4CLPA 5IT4A 4DV1J 4JI5I 2QLWA 2Z4PA 5KFJA 2LXFA 2NXNA 2VPYB 1T9VA 2ZVIA 3MZIA 5J2QB 1QSYA 2HKJA 3EPGA 1EIYB 3SCLE 2VG6A 1XC9A 3RB0A 3FZBA 1LXNA 3Q6NA 2OFHX 4AUKA 2W9AA 2Z5EA 3P96A 4WXOA 4A8KA 1VQLS 4J9OA 5H9FK 4N7TA 2KXHA 4L3KA 1WEZA 3ZTQA 2LXIA 4PQAA 1N36J 2HFNA 2NYIA 4KGZB 4DS5A 2AGPA 3LP0A 3BDPA 2DGOA 3LGNA 3CCRS 4LFBJ 2Z5CB 2LFVA 3EGNA 1P8GA 2ZBQA 1EETB 3B54A 5IV3A 1Y3JA 3QLHB 4N5SA 2ZM6J 3NNCA 2ZH5A 1TKDA 1RREA 1JWWA 1S7IA 5C0XD 1V3SA 3M2UB 5A8WB 3SQOP 3QGGA 2MKJA 1FNMA 4KKOB 3D0HE 2DGTA 2O67A 1NO8A 1Y00A 2OPRB 4FPIA 3S1TA 3SFGA 3CCQS 1GT8A 4KPYA 2NXEA 2HFOA 1VQ4S 1FDDA 4QW9A 2RRNA 2WW4A 3QJLA 4JI2E 4DOZA 2Z56B 3MM7A 3L7ZA 1UWBB 5JEAA 4K0KI 2MTLA 4JI5F 1KRPA 5J2MB 5BR8E 3BQ1A 2Q1LA 3CJ2A 3J7AM 4U7UD 3IMQJ 1HBMA 2OTJS 1N4LA 3MPYA 3TX0A 4LT6A 3KLEA 2NN6B 3KKFA 5LMNI 5KG3A 2FHKA 2QSFA 3OW2R 3HT0A 4ELVA 2MLYA 2OHDA 2V9WA 2LMIA 3H4BA 4IRDA 2IDLA 4X62J 1WC0A 1JLCA 3LALA 4FPRA 4ERDA 4IS9A 3BGOP 2UVRA 4K7QA 2NXJA 3R2CJ 1SL1A 1VJWA 1TK5A 3SSSA 4KB7A 3MURP 4DR1F 3NS5A 4WXWA 5AE2A 1VQ7S 4KH0B 4NLRA 1U1LA 4KGVB 4WCEQ 1Q8KA 1D9FA 2I2YA 1RT7A 1EZZB 1WF1A 2HVEA 4OYOA 4C3KA 2JSXA 2ZKTA 3CDWA 1NBEB 2R8IA 3QGIA 3W5YA 2G0JA 3DOKB 2FJBB 1WF2A 1V5VA 2HAFA 2XMMA 3EMTA 3TW0A 4NWBA 5HVHA 4J91A 3JYTA 1V3ZA 4M5LA 4USKA 3M8QA 2YWWA 2C2NA 3TO8A 2W2QP 3AD8C 2AQ4A 3PHTA 2JE6A 3QT7A 2NN6F 3TA0A 4ZVIA 5IS2A 1FFSB 2ZHOA 5HQ8A 4K0KF 1IKXA 1YIJS 3M2VB 3N4WA 3FEZA 4QYRA 9RUBA 2L48A 2HZAA 4OFZA 4JBCA 1AZSA 1FNOA 1DTTB 1ZZFA 5FLXC 1R6MA 3KMSA 1VR6A 1LK7A 3AODA 1XWLA 2W8KA 2FC9A 4DR3J 3W60A 3PACA 2J65A 3ISNC 3T5LA 2BJ3A 1WHVA 3J7A1 1NAQA 3MM5A 2HYIB 3JXOA 1LEOA 4ZOSA 2B9XA 4PUOB 3QFWA 5J2MA 4ICLB 2E5LE 1JLBA 3MM7B 3L7ZB 3VAJA 4P2FA 1VRUB 1WC3A 1SIWB 3QIPB 2G2ZA 1CC8A 2OFGX 2H51B 3ZO7A 4ALZA 5GAHU 2UUBJ 4B3TE 3E3XA 2KZZA 1VRUA 3I6PA 4DPYA 2HHHI 2KI2A 4FWHA 1Q16B 4IR1A 3J81C 2F5GA 2RSQA 4ZVPB 1XMOJ 4FYYB 2I1RA 2KT5A 3HHLB 5C0XE 4DR1I 1EETA 1Z0EA 4FWDA 3CVKA 1JLGA 2G9OA 3JTNA 2V50A 1VQPS 1OSDA 4ETZA 2DH7A 1M1HA 2ADCA 2FY1A 1S0VA 3IG1B 5DQGA 1SJ1A 2MMYA 3H5XA 3DHWC 3CC4S 2D41A 3ZKDA 3H2LA 2HBRB 2JFDA 4OQJA 1OYRA 2HHTA 1X5OA 4RNHA 5A8RA 4F26A 4RNOA 2KXNB 4K50A 4U3DA 2JVRA 3Q8YA 5KFNA 2KRBA 3K8WA 3POTB 2CPFA 2KHCA 3NY0A 2XMVA 4Y6IA 4QR2A 5T41A 2FTRA 1WG4A 3MGJA 4EBEA 2UZAA 4Y28C 2W2OP 2XY5A 2LCWA 3M6AA 5IWAI 4LFAI 2ATCB 4OZ3A 1RP5A 5KFLA 2W25A 3OJUA 3HVRA 1R89A 1RUSA 3GYGA 2V8PA 3UDLA 3MUMP 4LFAE 1IBKE 3IGVA 4LF9J 3C2PA 1NM2A 2CPDA 1HYSB 2H5JB 3MR7A 4AM3A 3CWJA 2E9ZA 2MYFA 2BJ8A 2WCXA 4FVMA 2GAGC 2IDEA 5M2UA 3RR7A 1ZS6A 2C2EA 2NLWA 1SJFA 1P6TA 2X1AA 4IG3B 1JNZB 1UPPA 4DX8H 2DXEA 3U02A 1NDPA 2PE8A 3UNYA 1HD0A 3OL6A 2I9SA 1HBMB 1F9FA 1FT8A 4X4PA 4A8MP 2DPJA 4DSIA 5FIIA 2VPXB 2JVOA 4TVAB 2WP8A 4QIVA 1N5VA 2PI4A 4QWBA 4DF4A 4QNJA 1TUWA 5DRRA 1Q81T 2LEPA 1WSVA 4ED4A 3FVYA 4USHA 4ZVEA 4JV0A 2C2DA 1SL0A 5A2QU 6AT1B 5K9FA 1RAOA 4BA1B 4ZPCA 5BYSA 3DLGA 4JV5F 1GEHA 2CJXB 3GFHA 3BGLA 3CDIA 3AH6A 5GAGI 4DR6J 5LL6R 4Q5VA 1VHIA 1I94I 3PVXA 1HHQA 2Z0GA 4LBIA 4WP9A 2XQCA 1IWAA 3B78A 5LJ5Y 3KLHB 3DGVA 3KK3B 3U1LA 4LIWA 4B3RI 2M2BA 2LQ5A 4XIUA 4A8FA 2G2YA 1G4CA 4N47A 2GQCA 2FGOA 2R42A 4C8MA 1F5CA 2JZ5A 2DEJA 4RO0A 4F2RA 3E01B 3WHIA 4F0MA 5B08A 1F2GA 1AA1B 2XSJB 4O3NA 4DR2E 4LFBE 2MLZA 3CCSS 2WVBA 2IBOA 4LREA 4X84A 1SJQA 2WSCC 5K14A 1R8PA 1Y9OA 4IZKA 3F73A 1NH7A 2V9KA 4DV2E 2EFPA 1GK8A 3UVJB 2DTJA 2J7KA 3DGPA 4C6AA 4DN0A 2GMLA 2AW0A 2DNMA 3QIDA 3L9ZA 2A2DA 4RWWA 3H4DA 1RBLA 4OYMA 2FVQA 4CTAA 1JLGB 3CEDA 1JB0C 2BJ9A 2CZVC 2E7VA 2EK6A 3DM2B 4NYPA 4CP5A 4WKYA 5GMKa 5KT3A 3VAIA 3PO5A 4I2QA 3M8WA 3SMZA 5LM7E 3B4TA 1SV5A 2LQ9A 3MEEB 3PX6A 1FJGE 1S1VB 2KRRA 5E7OB 3GQCA 1HNZI 4DR1J 1NPKA 4KR0B 3MMBA 1MMNA 5DDRC 3BO4A 3EE3A 2ZH1A 1S6PB 2UVWA 4M63A 1GXLA 3IA0A 2XO7A 1YHCA 1NZ8A 3NOGA 2BW7A 2EKYA 2ZBCA 4ZP9A 3M9NB 3DOLA 4P9SA 1U2FA 2XMWA 3PNIA 3CXCR 4DV2F 4ECWA 3P3GA 4IOBA 3R1LA 4WKRA 2ZBRA 2OELA 4X62E 2RS2A 4QWCA 4FXDA 1APSA 3HP6A 2IFXA 2OUGA 3A8EA 1RACB 3FDSA 4HT7A 4C7QA 5L1JA 4JOUA 5EX3A 3Q8SB 4CT9A 4PG8A 3NWRA 2QG9B 1DBDA 3AOAA 4PG4A 4Q7AA 5D77A 1CQNA 5E3AA 2N3OA 4J9SA 5KFIA 4DF8A 3Q86A 1AZSB 1UFWA 4YDDB 4JI8J 3E2EA 2EW9A 4GKKJ 2R7WA 2GHWA 2VQEF 4DCJB 1KWMA 2Z2LA 3HHLD 2OO4A 4ECZA 5HP1A 2D3UA 3AXKA 3BO3A 4GC7A 1AT1B 4YR0A 1NK9A 2V0NA 2XSFA 3N28A 4TXSA 2BA1D 1SUQB 4TU7A 3GIKA 4RLEA 1U25A 2V2QA 2AZ1A 2LYVA 4XO0A 2W01A 2PMZD 4JI0J 2AJQA 1B7YB 2NUUG 3D7SB 3DOKA 1QLNA 2NN6E 2P9EA 1R0AA 4MJKA 5C25A 4PXDA 3ENAA 2Y9HA 2NR0A 2C2OB 4OL8A 4BA2B 1RLDA 5AXKA 4F4YA 2VG7A 4K4SA 2HSEB 3ZKBA 5HP1B 3C46A 5J1EA 2JEFA 4C4WA 3BF4A 2W2MP 6FD1A 5KG0A 2NS1B 1AROP 1TMMA 1ZM4A 4ED5A 2L41A 1S0MA 4EUVA 3CGIA 3NGUA 4EO6A 2RU3A 2Y1IA 1QUPA 4DX7A 4JI1J 5E41A 1TFYA 5IOLA 5EKWA 2UUCJ 2LDYA 3H59A 4X64J 4FYWB 5D6GA 1VK8A 1NHKL 2KFNA 2I5JA 1BQMA 1C1BB 2YPYA 3GFZA 3R1HA 3GZ7A 3TWZA 2IAJB 2HRUA 4OJGA 4DCOB 3EDQB 4YB7A 4CYUB 2VQEI 4WJBA 2V8VA 2VH7A 1NHVA 3HULA 4IZJD 3KDOA 1ZA2B 4DR4F 4CH1A 3GJSB 1TP7A 3C66A 3ILIA 5HI7A 2R4FA 4RNFA 8ATCB 4I6YA 1H98A 3RB4A 2KVQE 1A6FA 3G6XA 2Y1RI 4JB8B 4JV5J 3D9BA 1Z5CA 1KKHA 1JLBB 3HLUA 3ZTRA 4UZCA 5M2PA 4B3ME 1S57A 1R8HA 2CZ4A 2RJZA 2BOAA 4MU3A 1HNZE 3MM5B 1UL3A 2J6SA 4ISAA 2JH3A 3Q0AA 1J2VA 3TAMA 1NSKL 3GV5B 4J9PA 3MD3A 1N8RT 5KOXA 2EG2A 1NJXA 3EVMA 1S77D 2Y0SD 3RG6A 4OI4A 2OTLS 4LOMA 1S12A 1QVGR 2HHQA 2JEBA 3M05A 1KQFB 4FW5A 3J81U 2E9RX 5K36D 5LXYA 2FYXA 3DGPB 3G2XA 1XMOE 3DI6B 4IKAA 4HXZA 3PRDA 1QTNB 1RHUB 4UQTA 1YHQS 4U9RA 3OPKA 1RR9A 3GMEA 3CNQP 4ZHRB 1RABB 1YLXA 2G4BA 4DV7I 1FRMA 1Y7PA 1WTFA 3I32A 2V4JB 4NCGA 3SCJE 3P76A 3T6BA 1CSJA 3R27A 4IQXA 2LQ8A 1U6BA 2FGCA 1SC3B 2QL7B 1FRXA 1S10A 1RTIA 1U0HA 4LF4F 2BRLA 3T1YI 1YJWS 2YXLA 5CXTA 3DXBA 1GXUA 2DY1A 3MM8A 4GRSA 3T9ZA 1U1QA 3I9ZA 1FCAA 2BKNA 2BW2A 2PO1B 1VQOS 3O2IA 2VDHA 3TP2A 1TUVA 4DL7A 2YNFA 5F9LA 2M8DB 2AJ1A 1JJ4A 3FCHA 1VC6A 1NKCA 3DLEB 2CPIA 4H4MA 2Z2ZA 3J81j 4NLPA 4P74A 2DR7A 2VODA 1QZRA 2NSBA 2YNGB 5B0DA 4PR6A 3W2WA 3KJNB 3S8SA 5ETKA 4EI2A 5GADI 3EGWB 4PZVA 4ZVGA 2CQ3A 2P9CA 3HX9A 4EMDA 1F1BB 2IYGA 4ZN3A 5KFFA 2XMAA 4N8OA 3KLEB 3H40A 4DR5F 3W5XA 2CJYB 1VGYA 2OEJA 3I0RB 3BEGB 3IM9A 4J7CA 4QR0A 4DI6A 1QM9A 5MAOA 2Y8WA 3AD9C 4R0JA 4DL4A 1G1XA 1UDNA 2DXFA 2M70A 4PPDA 5HQMA 5FLXU 2BEFA 2J0SD 3QPIA 2UUAI 4XTTA 3RBZA 2Q66A 4YN3B 4H4MB 1UZHA 2AJFE 4EWTA 2YWGA 4ZIVA 3PKMA 1MMDA 5JVGQ 1PYOB 2OSQA 4HHHA 2V4RA 3T1YF 1V9OA 2E7XA 3QZ7A 1S9GA 4JI6F 2HHVA 1KHWA 3QLHA 2XM3A 4LF6E 2ZITA 4ZP7A 2X3DA 3MDFA 4DV3E 2EVZA 1JLFB 3P5TL 5D0GA 3CIMA 3VVTA 2DNKA 3CMAS 1CJTA 2HFZA 4RU2A 3DU5A 3OL7A 3TEGA 2YWHA 3HDSA 2YX1A 4F4XA 4EK2A 4LPFA 1HWKA 2EK1A 2DR6A 4P71A 1JJCB 5ETVA 3WBZA 3GU0A 4I6AA 3RRKA 1YJ9S 4YY3E 2MKCA 4K2XA 4ECVA 4AXIA 4Y0FA 2YKAA 4HVZA 5KFUA 4NEZA 3ZZ0A 1FJGF 4KGKA 4KBIA 1Q8LA 2CJ9A 4RW7A 5KFEA 2CIMA 4D3GA 2ZOMA 4ZS6A 2X1FA 1IWGA 1RQ0A 4DV5E 3OXGA 3QO9A 1B0VA 3CCTA 3WDOA 5KT2A 4YOEA 3W2WB 2BA9A 3L4BC 2IRXA 4OHZA 2CG9A 3OT9A 4DFJA 2UUAF 1LXJA 1IBME 3ILOA 5ETRA 4W4MA 2IC3A 4ID8A 2MQQA 3I5CA 3GLLA 4J90A 3A3OB 4DR1E 4AQYI 3NKYA 2HNYB 5C24A 1VQYA 4MKBA 2YNFB 3VCDA 1WC6A 1FKAF 2UXBE 5D3GA 1PYTA 3LUYA 2UXCI 3FJ2A 1SKUB 2KT3A 4KRWA 4LBPA 4X4UA 5KG4A 1HWJA 3PM9A 2ERRA 2ZH8A 3O6QA 2K7JA 3V6DB 1CLFA 1HKAA 2F7VA 3GJRB 2CAJA 2YKOA 3Q2SC 2XZDB 5C2CA 2KTQA 2K7KA 1MLAA 1TMJA 3RRGA 4XPEA 2GO3A 1JK9B 3HJVA 3C15B 3G82B 4RJVA 5KT5A 3GILA 4Z7YA 5KG7A 2ZJQQ 2AYEA 3JSBA 2PFFB 3Q6MA 1X4AA 2NSCA 3DMJB 3ET6B 1S79A 4PYDA 2UVVA 4JI5E 3ZZRA 2QMUB 3PRBA 4DG1A 4ZMMA 4CCHA 3B8HA 2VHGA 1CJUB 3HO1A 1K44A 1RT5A 4M5KA 2F1DA 3GE9A 3WU4A 1LFWA 1KDNA 2RQCA 2K06A 2O5DA 4USWA 2Y8YA 2C2ZB 1RHQB 2DHHA 4MKAA 3C6TA 1DTQB 4NASA 2GO4A 3LWLA 2RVJA 2AYMA 4PWWA 3RW7A 2RS8A 1HBNA 2RNEA 1LV5A 4B02A 4JI3J 3CJ0A 2XNRA 3HHLC 2BVZA 2FPHX 2JC0A 4DV0F 4QPXA 2ASDA 3LNUA 4LCFA 4R8UA 1FKAE 3WIUA 4KHRA 4C3LA 7FDRA 4EZ9A 1WC5A 3LOUA 5L9NA 3DNCA 2CFXA 4OO1F 4PRVA 2VOOA 4K4YA 2I38A 1N36F 1RT7B 4HKQA 4NLSA 4WYWA 4LF1A 1ZTWA 2AE8A 2WVCA 4J9RA 3CJ4A 3OTOJ 1N5SA 4MKYA 2MZSA 2W9BA 1BD6A 3N6LA 2XS7A 4WZQA 2HBQB 5DETA 1PJ7A 2W9CB 1QE1B 1P1LA 2DO4A 1ULRA 2ZC3A 2ZUAA 3Q83A 3K5OA 4PXBA 4USMA 1C1BA 2CQ0A 2CQ1A 3UPFA 3TAQA 4ZN1A 1YI2S 4OYBA 4Q8EA 4UY85 4HDHA 1B0TA 1DRZA 1RTZA 1U6FA 4ZVSB 5ELWA 1KSPA 1ZXMA 4DV4I 4JI6E 1WHWA 4DR3I 1R43A 2DGWA 3TOQA 1XERA 3U1MA 5J1EB 3B4MA 3NZKA 1TL3B 1M5OC 4JI7F 1X5TA 1N88A 3OD2A 3LH2S 4ANCA 2DEIA 4RPFA 3Q8RB 2XTJP 3QT5A 3OR2B 4W92B 1CS4A 1MU5A 3UD3P 2O1TA 3Q8QB 1RTHB 4ID5A 4QNKA 1L5UA 2D9OA 5LXRA 2VJUA 2UUBI 3NBPA 3BGRA 4BS2A 1WC4A 3EWGA 2CQBA 2IYIA 1Q95G 3BGUA 3ZZYA 3G9CA 4HH0A 2C3PA 5CD4H 3ENWA 4JI0I 3GIMA 5HK4A 3DM2A 2E1AA 2GVZA 3N01A 5FJ4A 1X4CA 1IKWA 3T1HF 3GG1A 2IHR1 2MZJA 3HSJA 2FQQB 4QW8A 2CQPA 3KWMA 5CYJA 4RUCA 1XMQJ 1PG5B 3VALA 2FJDB 2HNZA 3D5MA 1G3OA 3GJTB 1IM4A 3FFIA 1TKXB 3BKTA 3TEHB 4ZIWA 2HIYA 4WPAA 1KLMB 3J81Y 4NLXA 3D54A 1ROFA 2NUHA 1WHXA 3ET6A 2CDQA 2R7XA 3HPOA 1EQ0A 3R9LA 1WI6A 4DV4F 2C37B 1NZAA 4FKYA 4FS2A 4I7FB 4K5SA 2GC8A 4LF4E 2DB1A 3IP0A 3UE2A 2VICA 1UVNA 4LCHA 1AUSL 4JI7I 4FNIA 4GVLA 4A8WA 5JEAD 5EUHA 5GAEI 1JLAA 3MFHA 4R5PA 3I82A 2XGQA 4LVNP 1TR0A 3EX7B 1DFDA 4QPTA 3MMBB 1GMUA 3ZZZA 4DDFA 1SC1B 3OTOF 1RT2A 3G8SA 3MAQA 1I94J 3V4IB 4O23A 2CZ9A 4TNOA 4FW9A 3LP2A 1HNIA 4O0IA 1QSSA 3TRGA 1T9WA 2QA2A 2R7RA 1HNXF 1ZBTA 2UUBF 4LF7I 2C28A 1P27B 4AIDA 5JVHQ 3G86A 1C4AA 1S4EA 4Q43A 2DRBA 2F8MA 2W1BA 3M30B 3MFIA 4KHMA 2HLTA 4QIEA 4WE1B 1S59A 2FJEB 4BA1A 3EPIA 2CA9A 4BLGA 2VKZG 1VDHA 4OLPA 2H48B 2QL9B 2XMKA 3D68A 3ETMA 4ZVRB 3UDEA 2JC1A 2PDAA 4M5JA 2KL8A 3OTCA 4LMZA 1S97A 3C14B 4EEYA 1TK8A 3DCAA 4ZVQB 5K14B 4IZKB 3UDCA 2MJNA 1FWPA 3BKUA 1PO6A 3FGVA 3I0SA 4C8KA 2JEAA 2O3ZA 1SVDA 1UFKA 2BUNA 4YP3A 5BYRA 4G3IA 1VRTA 5CYQB 4FVCA 3CJKB 4B3TJ 1Z0GA 1H74A 2MGZB 3PS2A 3I87A 4BWMA 2IOPA 4F50A 4DV7J 2RQKA 3WC2A 1NZ0A 3KJQB 4BC9A 3IGNA 1WKLA 1IQTA 1N32J 1N33F 4GKJI 3OSNA 1C1CB 2QRRA 3CD7A 1HYSA 1XMQE 3PEJA 3CJ3A 2GJIA 2JOQA 3KG4A 3IWXA 4CLFA 1TKZA 1RAHB 2YKMB 3GR1A 4EGLA 1JLEB 3BQ0A 2LECA 1NK8A 1FJCA 1N36E 3IR6B 3M7VA 1HNXI 2AWZA 3P8BB 4RBVA 1UEKA 2FHOB 4LF7F 3SIPB 1KS2A 4JI7J 4DV0E 1LKZA 4ZCMA 4NA2A 2X36A 2HWIA 3S7RA 4DV5J 1X0FA 4OKGA 3POTA 2AEFA 4U67Q 4KQZA 4BCAA 1SJ4P 4N76A 5EL9A 1DQAA 1WTBA 2J0WA 3MPWA 4FP9A 2LU2A 2CQCA 3QT8A 1FVSA 4OYXA 2V34A 3GFXA 4CLSA 4Q2LA 5G0RB 1N5TA 1E6YB 1U09A 2A18A 2AZ3A 2CWXA 3M30A 3BB5A 1PKUA 2ROGA 5FLXY 2MKKA 1R6LA 3M85D 2W4PA 2HHHJ 2W9CA 1FA0A 3VAMA 5B0BA 2UUCE 4U3BA 1JKHA 4GKJF 1K0VA 1N33I 2PEBA 5IQQA 2DPIA 2XHWA 3T41A 4LFCI 1VBYA 3CCZA 4R25A 1CPZA 3ISND 3C6UA 1JLAB 5DROA 1X31C 4FKXA 1RTIB 4O3PA 5C5JA 2EKNA 2H5EA 2N4CA 3OVAA 3DLLQ 4B3OA 3PW4A 2OD6A 2IMOA 4S0MA 4DMZA 1RWOB 1R6VA 3MOJB 4F02A 1U7LA 4P73A 1FKOB 4LRBA 4CDIA 4LSZB 5HBMA 1KVIA 2HVZA 2HNZB 3MD1A 4IO9Q 4I64A 1M5KC 1EI1A 1WUUA 2CQHA 4IO1A 1OSCA 2GQQA 1KQKA 1KNZA 2BV3A 2WK4A 4CLTA 4FW4A 2HGMA 1EAYC 1M5HA 3OTEA 4HACB 4CLLA 3M9MB 3D3BJ 4ELUA 1IR1A 1IBLE 5D15A 1SKSA 4YUDA 4XDDA 1S5ZA 2E44A 3GWCA 3M8QB 1LQ9A 1H2TZ 3BGRB 3BPSP 3NAHA 2OMLA 2OPQA 4ZLPA 1RKIA 4Q45A 2ASLA 5GADU 2N4DA 1HMVA 4G1PA 4USVA 8AT1B 1YBUA 1LW2A 5KT6A 1HNZF 3UI3A 3M7NG 2PIIA 1YRXA 3PRYA 5E3CA 4ZLLA 1HR0I 2CQDA 3QSIA 1YG0A 1X4EA 1I51B 5DZ7A 5AXLA 2DR9A 2FVPA 2EWHA 1Y5NB 3KG1A 3TVZA 2XCAA 4ICLA 1LWFB 1HR0F 1T95A 4DR4E 1MROA 1H7XA 1FK9B 4IG0B 1XNRE 1JLCB 5E3RA 3CT9A 1B7FA 2HVHA 4DQIA 2LDIA 2IVYA 4TQSA 2DCLA 2MQPA 3HHDA 2CYYA 3F41A 4PAAA 5E3QA 3Q8PB 3QO9B 3QZ8A 2F8HA 3QRQA 1VOMA 1NHHA 4MDTA 2KKHA 5LSOA 1QE1A 4JG4A 4OO1E 3BR8A 2GCFA 4URLA 4OZJA 3UN5A 2UUAE 1FFGB 2AJ0A 1XIQA 3K85A 1FI4A 2FLOA 2LEAA 2X7IA 5HLFA 4R1FA 2D1CA 3RZAA 1U49A 1KIJA 4N8NA 2PO0A 3KK2A 2FHJD 3NRBA 2VFRA 3TNVA 2DRAA 1CG2A 3UNGC 4CO3A 2ROPA 2XZWA 2VG5B 4DL6A 1PBUA 2NZCA 2XLIA 2KZMA 4XK8C 1JLEA 4KT0C 4B3SF 1F9EB 2VFSA 4NA1A 2AGOA 3CJQA 1TFWA 3BSCA 3CULA 3DOMB 2C22A 2Z5CA 1SH0A 4F3MA 1MU2A 2CPHA 2POKA 3M6VA 4U8VA 4M5IA 2VKRA 2UUTA 5B09A 1X60A 4N56A 3I4PA 5KFTA 2HEKA 2AU0A 1F60B 1W2IA 2ZE2A 3EZOA 1KOHA 2N82B 5EWFA 4YDXA 2XS2A 4GKJJ 3CDAA 4FYVB 4DQQA 2LXUA 4KO0A 4X62I 4WK3A 2VG6B 4IFDC 3BBFA 1WOOA 3OUYB 3D28A 2DNHA 4Y00A 4A48A 1URNA 3Q2TC 1ZM2A 4MU0A 3H2VE 1D9DA 4B9LA 1U45A 5F9NA 2ACYA 3X1LB 4ZCLA 1RJJA 4NEYA 3W61A 4CO5A 2MKIA 2HS0A 4Y2CA 3C8YA 5D0RA 2DGQA 3D1OA 5ETMA 5A8KB 4QU7A 1FDAA 4P10A 2MKHA 3VZHA 5JEAC 2A10A 1A7GE 3PHEA 5A8WA 5C2GA 3BPDA 3CCMS 4DV5F 1WDDA 1NKBA 4NLDA 4C8LA 2M9KA 3T1AA 3Q24A 3PFEA 2YX7A 1VQ6S 2PO4A 3MM8B 3MMAA 4CTAB 2VIHA 4DFPA 1S1UB 1RA7A 3CIZA 2G1HA 4F25A 3HXMA 2O1VA 4KY3A 4LF9I 3BKFA 2F9JA 2BXJA 4LUBA 4YHHF 4H4KA 4TU9A 1A6LA 1M5VC 1N33J 4F3QA 5CH7B 1W25A 2YH1A 2DNLA 2Z8QA 2O1PA 4FDFA 1RTDB 2GNKA 3O3LA 4AL6A 4OZ1A 4ED3A 1E3PA 3H25A 4LFBI 4DV7F 2AP6A 2LQJA 2YY3A 4M1KA 2QIFA 1H2VZ 3A4TA 4K2JA 4JI8F 3SI8A 2B4UA 2UXDF 2MQNA 2VQEE 3R7SB 2UXDJ 1RKJA 4P7AA 2QJ3A 4PRFA 5LL6d 2BKPA 1FVQA 3THTA 1ZETA 4LF8E 3DOMA 2IA6A 3AOCA 2HQCA 1JLFA 4UZBA 1UKUA 1VBKA 1S9EB 2WSFC 2YTCA 3FBFA 3R7NB 3DRRB 4WIQA 1F2HA 4K4VA 1Z1ZA 1EX8A 4OZLA 5DM6Q 3DKDA 3BZQA 1ZAVA 3DN9A 4GO7X 4K8RA 3DRYA 4LF5F 1Q5VA 1RAAB 5GVQA 4U7UK 3NGKA 3W9JA 1O6XA 2HVIA 5EN1A 2NPFA 4PWDA 2COLA 2MGZA 2D7SA 1ZZNA 4CNZA 2M8HA 2YWEA 2JL9A 3B82A 4FXVA 3W2VA 4JV5E 2DNNA 2M88A 4LF5E 1PBAA 2C2MB 2X51A 3A8KA 4DR5I 4U7CA 4DSFA 2BX6A 2ZNZA 4YHHI 1XN9A 4TY9A 2AX0A 2DGSA 2IAJA 3OBIA 4Y2AA 1SJ3P 4OO1A 4DX5A 3J80Q 1EQMA 3TANA 1X4HA 2IA0A 3PX0A 2CADA 1PIEA 3HD2A 3K8VA 3NAIA 4RW8A 5L1KA 2UXDI 1OY9A 4IFVA 3W9IA 2FLNA 2L3MA 4HEA9 5L8RC 2A6MA 4YY3J 3I5BA 2QZ8A 1FK9A 2EXUA 3CDEA 4ZVTB 4B9NA 1F5AA 3AHPA 1HNIB 2HURA 2FHMA 4OI0A 1H7SA 2QLJB 3A3NB 1U0SA 1PVGA 2J0XA 3CDJA 2BE2A 2XEXA 2O1WA 2HLUA 3KNGA 3NLCA 1R0AB 4ENOA 2G0IA 3CJTA 3P6YC 3J7ZT 4K4TA 2B51A 3N79A 2ZDPA 4AT1B 3ITHA 1FE0A 3R5CA 4MFBA 1HI8A 4P2XA 2CVEA 4IDKA 4KGMA 1IBMJ 4IZJB 3ZXWA 5IC4B 4JUZA 3G6YA 2BQUA 2MZ1A 1RWXB 3DYAA 4I69A 1KLMA 3CMES 2ACMA 1USVA 2Y0BB 3TUPA 4NLWA 1BMQB 1FJGI 3HVTB 2MQOA 1NHIA 4KHPE 2K2PA 5HANA 5LSRA 3OFGA 3HK2A 4ITSA 1Y60A 1FRIA 2DIVA 2RKIA 1RT5B 5KG6A 3P3DA 3M8RA 1UETA 3M8ZA 5AE1A 4JV1A 3NP5A 3OQ2A 4EYHB 3CDUA 4ZJLA 3KLVA 2CPZA 1PAUB 2WW8A 4OIXA 5HJXA 1Q79A 2EG1A 3FBBA 3NS7B 5A6PA 1BWVA 1SQEA 2YQ0A 2KN4A 2R3VA 4IDKB 2QGFB 1B70B 5LT5A 4LF8F 4PQUB 1OY6A 5T7LB 1FHTA 5ETTA 4DPUA 4KGXB 2UXCF 4X65F 1B62A 1G6BA 3D6FB 3OR2A 4DUYJ 4F4ZA 1RGVA 1YJ7A 5C42B 3OLAA 2BE2B 1XTZA 4B9TA 3RYLA 4IUFA 5A2QC 2DY9A 3WZ0A 5DQIA 3HKWA 3W66A 2R8KA 1IM6A 4ECXA 3BREA 2GO9A 2YQ3A 3H90A 3IRXB 5IT0A 2DYAA 4TYAA 4QCLA 4ECUA 1VC0A 2WTFA 4B3SE 2VFVA 1QY7A 3EZUA 2GIFA 2I5JB 2DO0A 2LLZA 4M5NA 4NLUA 4NX9A 4PCQA 3QT6A 5F3ZA 3UQSA 1NEEA 1TL4A 3N5BA 2EEYA 5ETQA 1AUDA 3R5BA 3H98A 1JLQA 3M1VB 2YNIB 1DZ5A 1FX4A 2JX2A 2V63A 4GC6A 3PS3A 4C0BA 1LOUA 4A4JA 3JTPA 3H5YA 3QRPA 2JE6B 3F44A 4L75A 2XSJA 4BHQA 2RH3A 1WSRA 2MEWA 1UJ4A 3MCMA 5C25B 5KTQA 3S6EA 3HFZB 3DC2A 3EZ5A 2BKOA 1KP6A 2KFZA 4Z2XA 4DV0I 2ZZMA 1P9QC 1VQSA 1CJTB 3CW2C 4V1Ak 4FW7A 2OEKA 4X65I 1N34J 3V81B 2XLJA 1TKZB 2YKMA 1NLKL 4H54A 1RT4A 5D8HB 3SCKE 5HSPA 1N36I 3KK3A 1XNRF 4MIBA 1DTQA 1IBKF 1IKVB 1JXVA 5FD1A 1U1NA 4KPCA 3RBDA 2ZBKB 5HVFA 5KG5A 1RTJA 5A2QQ 2BBEA 4M5MA 4DL0C 3M2RB 1N32E 4QIWD 2VBWA 4TQRA 5D0HA 4RUHA 5HL7Q 2PA8D 4WWSA 2PI5A 1NDCA 3CD0A 3IC1A 4UOCA 3RJMB 1R0BG 2HKEA 4I68A 4DG1B 2FDNA 4LRAA 3QFHA 5KFYA 1Q86T 2HQIA 5HVGA 5A0YA 2M7SA 1Z0VA 4GKKI 3AT1B 2VC0A 4LF6J 3HKMA 2DK2A 2KH9A 3C14A 4JI4E 2I8EA 3MPUB 2GHPA 2RUSA 2VDIA 2BZ2A 4DR3F 4ZPBA 1M1KT 4F8RA 5IT9Q 5KFWA 1AW0A 2UUCF 1UDSA 2QA4S 3RBXA 3GCXP 4DQSA 3MAAB 1N5YA 1MWQA 5H9FJ 1RHYA 3TYTA 3HF5A 3FQKA 3J7YI 4KKOA 4YB1P 3CJRA 5C0XF 1NSQA 4K4WA 4LF7E 1SV5B 2F1FA 3V4IA 4O4GB 2BE9B 2KXFA 3EUNA 2HWTA 1VQ5S 3N6NA 3HMJG 1AB8A 4JI0F 5DRQA 2GGPB 5BXIA 2VF3A 1KOOA 4WTOB 3MR2A 1VRQC 5F8JA 2ZM6I 2ASYA 4ANEA 3DLBA 2B9YA 3OR1B 1BY9A 1F3FA 4JI6J 1P42A 2IPOB 4CWBA 2V4JA 2YH0A 3E8OA 3M9OB 5BYQA 1U6ZA 4OX8A 1HQUA 3VQSA 4LSLA 1KQSR 3PO4A 4LF8I 1OYSA 1IKYB 2CG4A 3MXHP 1TZ0A 3OJSA 2DNPA 4Q0BB 4GKKF 1Q0NA 2DR5A 4LFCE 2HK3A 1SCJB 1QUVA 5ETLA 1VFJA 3AXMA 5C0XB 2U1AA 1RHKB 1N33E 1ICEB 1S6QB 5DG9A 2UUCI 1Z5BA 2HHWA 3KJFB 3U1NA 1O5JA 3BN7A 4LRCA 4AIMA 1YBTA 5EX0A 1HNVB 4P2SA 4WFXA 3KDNA 4UQGA 4ECTA 1PJ5A 2X1GA 3FZ2A 3D4JA 1J27A 1RWUA 2G13A 2MZRA 4HDGA 3JAMY 4RBUA 4DR5J 2ZZNA 4OX9I 1XNQI 2AD9A 3I5AA 4DQRA 1KVKA 3D6MB 3FC9A 2UV8G 5HJYA 3CWVA 3HSDA 3P3EA 1WACA 1ELOA 1RAIB 2A2CA 3MEKA 4M8LA 4NRUA 2PO0B 2UUBE 3MM6B 5A2QY 2RDIA 5I4MA 4RUBA 1HNXJ 3KK2B 3FSXA 1U1RA 3R6LB 3PW5A 2ZM6F 4DSEA 2UUWA 4K4UA 1PC4A 4LR7A 5DLFA 2W2NP 1FEHA 2ZWOA 3IR7B 2RQ4A 4X66F 2XB2D 1F3VA 1B3TA 2CWKA 2AGQA 4IG3A 2VA2A 2HS4A 1AFJA 1HLWA 1T05B 4F67A 1L3VA 1EKSA 4OI3A 3DRPA 4UUXA 4Y34A 4F36A 4GKJE 4FXWA 1GX6A 3IFEA 1S0OA 1MX0A 4U95A 3GCMA 3ILJA 3OTDA 3BJYA 4WP8A 1RWWB 2CPEA 5GAHI 2P6TA 5KFXA 1RT4B 2FJAB 3FCVA 4K4XA 4E98A 2WNRB 2GIRA 3GFYA 5F8LA 2N3LA 3TVYA 5BR8I 1TKTA 4I67A 1E3HA 2OMOA 4JV2A 2JJ4D 2MQLA 1C4CA 1T9XA 3BYRA 2D69A 4KYZA 4NL5A 1HBNB 3TA2A 4X4TA 1YTYA 2V2ZA 3WX4A 4X4VA 2FY8A 2P8IA 4OI6A 4OHWA 2J9EA 4Q2MA 3VAFA 4HACA 1WELA 3GTYX 1H7WA 2XMJA 3W5ZA 1NB2A 4NYZA 2UU9J 1HK7A 4LSNB 1IR0A 1XQIA 2WRMA 2HBYB 3RRHA 1N56A 4G1IA 2Z2MA 4X66I 1YWXA 2RILA 2NN6A 1N34E 3KUHA 2HMIB 4DV1E 5FWKA 3T3FA 5AXMA 2HZVA 3NNAA 1Q8BA 2DNGA 2V6AA 3HHLA 3V6JA 3TI0A 1I5OB 4DEZA 1M1GA 2ZUGA 5HN0A 3NCQA 1D1UA 1WD6A 2KYZA 5IM0A 3KK1B 2OPPB 2VBYA 4B3OB 2F4FA 1XXEA 1A0OB 1X4GA 4DPOA 5DJBA 5DGAA 4DQPA 4LFCF 3DFEA 2PMHA 1VLYA 3J81Q 1GMVA 1T0TV 5BR8F 2W4CA 1V3RA 1WHYA 1S1VA 1SC4B 5T7LA 5KFBA 1CULA 5J2NB 3K59A 4QYZJ 4DV6J 2UXCE 4X66J 1Y11A 3J80C 2IC3B 2FJWA 2MSSA 5LSLA 1BGXT 2C3YA 3MAHA 1RZMA 4USJC 4TLQA 3M8PB 2H4WB 5E33A 1GH8A 5J2PB 4L6V3 2RKIB 4UOFA 1J5EJ 3LPSA 1J5EI 4ECYA 5F8IA 2VOPA 1Q1KA 1BKNA 1M0SA 1VC5A 1HNWI 4QQBA 5L39A 3ETOA 3W64A 3VGUA 4CLKA 4DHVA 3NGTA 3NOCA 5CABA 3Q23A 5ETOA 4C8OA 4TYBA 4PABA 3VGVA 3ELHA 1XJWB 2CRLA 2Q43A 2QT7A 5DNLA 4H4OB 1JIHA 1Q7LB 1WG5A 1X0PA 3PRVA 4G1QB 1VMBA 4ZPDA 2OEMA 4ZLJA 1DURA 3QMQA 1F6TA 4W98A 4NXNJ 5DNXA 3SEOA 2OJ3A 4G6VB 5IXUA 3NXZA 3PW2A 5ITHA 1EP4A 2IM1A 1FESA 2Z57B 1XBWA 2B4OA 2H5IB 4B08A 3VAGA 4NLYA 4FS1A 1C2PA 2XI2A 2W24A 1M90T 4NMXA 4B9VA 4MU4A 3FMBA 1WORA 3BR9A 4WP3A 5KFQA 4ANDA 4LF6I 2JLEA 1KBRA 1U02A 3FSYA 1Y5LB 3O5TB 3J80Y 1UEVA 3V6HA 1VQMS 2E5LJ 1NDKA 1AXQA 2DGUA 1YJNS 1EARA 2DGVA 5IC6B 2HFUA 3CCUS 3GIRA 4DUZF 3IAS9 1S9FA 4FWGA 3ULHA 1VRTB 5CYQA 1S6UA 4NE9C 4XPCA 4P72A 2DR8A 4PU9A 4X65E 1VQ9S 2OIHA 2V8HA 1WNEA 2GAHC 3A1YG 2LP4A 2D9PA 3MECB 4U96A 4TU8A 1HNWF 1FRLA 2MPUA 1S7HA 1U2CA 1VLOA 3Q8VA 3DOLB 5B0AA 1GX5A 1HWUA 5A6WA 4C8NA 5KFZA 1Y4ZB 1REVA 3KLIB 4DS4A 3MUTP 3OLBA 4DSLA 3PG9A 4IYQA 4WE1A 3JQKA 5SUHA 4MMOA 1NDLA 3LTOA 2B4PA 2E5IA 2AYGA 1FDBA 4Y2MA 1GXTA 2HS3A 2ILZA 4B3MF 5CHCB 2SXLA 4KHPF 2QTWA 3LO3A 2Q6CA 4YB5A 2F8EX 3MEEA 3OTOE 1UVMA 4RNMA 5L1LA 1C0UB 4B3SI 2PO1A 1XR5A 3V4MA 4OYWA 2NQPA 1HNWJ 3KUEA 1T9TA 5B0CA 3KUGA 4LF6F 1S6QA 1U0HB 4PG7A 1OYPA 2G2OA 1KR4A 3QWPA 3IO1A 4LR8A 3H0PA 4Q8FA 4DFMA 3MI7X 2W8LA 4DUZI 2B4VA 4NCGB 3T1YJ 4IOAQ 4PPZA 2XYPB 1WG1A 1HQUB 3PYDA 4X62F 2E7WA 3HD1A 1O8BA 1IBKJ 1HQEA 2RF2B 5LMUI 4HR2A 3E01A 3QAEA 3W8GA 3KHLA 5HROB 1L3SA 4NLGA 4NXMF 2B8QA 2J6TA 1R27B 4K59A 4URSA 2UXBI 4IH5A 4FYDA 3HZGA 3KTQA 4PWUA 1NNDA 3RAXA 4P52A 1YITS 4NXNF 1L3TA 2PNZB 2R8HA 4KSEB 3IR5B 4JI5J 3TJ9A 4YFUA 2VQFF 1EB0A 4KHPI 1VIOA 3T19A 1NCLA 5J2NA 3UD4P 5KFOA 4DV5I 1CJKB 2DH9A 3QWUA 4ZDNA 3HFKA 1RWMB 3FRZA 1WC1A 3TARA 2RMLA 3FBEA 1J5OA 3DLGB 3PCOB 1SBRA 4M5HA 3BQ2A 4OHVA 1XK8A 1U48A 2BANA 2H65B 2HGNA 2P6SA 2V8GA 1ZOTA 4Y2IA 5KFKA 1T8EA 1RBAA 1TL3A 3K7RA 4KE5A 5IM0B 2HNDB 4LF9F 2HHUA 1HL6A 4RBTA 2ZH7A 3J7AG 3SV4A 5D4NA 4BWJA 3MECA 4P7TA 4PUOA 4GKKE 1RT3A 4LF4J 1T03B 4GVBA 1S76D 4U8YA 4DUYE 1WOSA 4LFBF 2LQBA 4DV6F 5FDLA 1DHMA 1RT6A 5RUBA 3LAMA 3UFCX 1FRJA 5JEAF 3JTOA 3N0VA 4YEAA 5J1PA 5BR8J 4JI8I 1H6KX 2VC1A 2WVFA 1RAGB 3ISZA 3UW1A 4RUAA 4ED8A 3PS1A 4ED7A 3M2VA 1FJEB 4EZ6A 4C8YA 2V68A 2UXBF 4OHXA 4QWAA 3BS9A 1O51A 3FKBA 4DCPB 2KJVA 4NXNI 3HFVA 3K1JA 2VQFJ 3TA1A 3AA8A 2VBZA 2CJKA 1EP4B 2VPWB 3TAPA 4YS2A 2IERA 2VQFI 1TVRA 2HBZB 4KIAA 3ZTOA 5E0OA 3DLKA 1HI1A 3EVWA 3BO2A 4LF5I 4DPXA 3ZZOA 2KB2A 1XMOF 4NMLA 2IM0A 3RBEA 4H4OA 3PW7A 2CQGA 3TUJC 4OZNA 3G87A 3KLFB 4NXMJ 5AE3A 4F3OA 4FZVA 4HL9A 3ADAC 3K0JA 7FD1A 4AQYJ 3PV8A 2J8AA 2XS5A 3HZEA 4IQMA 3GP9A 1RK8A 2KJWA 5GAEU 1HWLA 1SC6A 3D3CJ 2Y3YA 3IG1A 5T14A 4ZKAA 2C2KB 4BDPA 4MK9A 2M5YA 1CJUA 4RW6B 2GX8A 3Q89A 5J2PA 1Z4UA 3PX4A 3IBCB 3KHHA 1VQ8S 4OV1A 3JB9k 1RT3B 3MF5A 3TR5A 5DDOC 3GLJA 1MROB 4MKVA 2DNOA 1Y4UA 5L3JA 5E5NA 3KLGA 3FRYA 7AT1B 3I4HX 4WFZA 3M32A 1JJ2R 3BV8A 4P75A 4V19X 3KRNA 3IBFB 2H9ZA 1H73A 3WX8A 5KAKA 1YRTA 4KHPJ 3RAQA 3H2UB 4DL2A 4ILLA 2XHCA 1K47A 1HMVB 4C11B 4CH0S 4EYIB 3V6KA 2B56A 5D3GB 4B9SA 5K8NA 2AKWB 5D78A 5K36B 1XMOI 1SH3A 2DNQA 1MN9A 3ZFVA 3TZZA 3BBBA 4ZPTR 1RDRA 1NJIT 2OI2A 2EI5A 4AYBD 2Z5BA 4DR6E 2Q6BA 2LU1A 2GJ2A 2HAIA 2ZBPA 4RW6A 1D0EA 4YMEA 4IRCA 2KFYA 2HGLA 2F9DA 1DTTA 4KH1B 2C3MA 5HROA 4J9QA 3HVTA 3TZXA 3ZM7A 4DUZJ 2E9TA 4B3MI 3VAHA 1WOPA 4J9LA 1S0NA 1MMLA 1YGYA 4NOHA 3TQ1A 2CDRB 3K2YA 1OS5A 3V5RA 3LWMA 1Q82T 4DZDA 3OR1A 4M95A 4HYMA 3NGSA 3HM9A 3ZZUA 1Q8IA 1SL2A 1GTHA 1U26A 3DLKB 3CJ5A 4F7VA 3BYPA 1Q78A 2E29A 1TL7B 4L76A 4ZPVR 2BACA 2NXUA 3C6UB 2IRUA 1L3KA 3GPAA 4IRKA 3LAKA 3QJPA 2DGXA 1N52B 2J9DE 2QLXA 2HW3A 4DV2J 4IFYA 2NN6C 5U47A 4OO1D 4KV8B 3KLHA 3QJJA 5HMXA 1HI0P 2CUYA 5B7WA 4CZCA 2ZHAA 2QO3A 1RHRB 1IBCB 1PSDA 4WFBQ 3G6ES 1S4FA 1I3OB 2E5GA 2L9WA 3WIVA 5H1SV 2J0QD 2PT0A 5KFMA 3GYXB 4Y2KA 4J9VA 1LWEA 1JMTA 1CEZA 4DX6A 2ZD1B 3M8SA 1I94E 3LGMA 4RW4B 2MQ8A 3WQPA 3C19A 1RU2A 4CI0B 3OVSA 5DO2A 3VQTA 3D66A 1VS3A 4OYPA 4GVBB 1IR2A 4IFDE 4NLOA 1BE4A 3L7PA 4LF2A 4DR5E 2YWFA 1PYSB 1YK9A 3LP1A 5A0YB 5I42A 4MK7A 2M4MA 2WB4A 3K17A 5GMEA 1OO0B 3HVWA 1YQHA 2WVDA 1UTAA 1NB7A 2LVWA 3AQPA 1QD1A 4A8OA 5F8HA 3SV3A 3S01A 3M2UA 2ZOGA 3M4XA 3MCSA 4Y3CA 5H9EJ 3I9V9 1XR6A 3PXGa 2F3JA 1KQGB 1N54B 4WYLA 5ETNA 1GNKA 4NBQA 2PNZA 3T1HI 3PYFA 2FZCB 4K5RA 1S1WA 1XNRI 4UT4A 1RWVB 1TL7A 2NCKL 2KHDA 1IBKI 3PZPA 1FWLA 5K8PA 4DR2F 1W7WA 4WU3A 4ED0A 4NZ0A 2BR0A 2R8JA 3MHYA 4JYAE 3KYLA 4JI1I 4L72B 1Z59A 2UU9F 3US5A 2CVIA 3JSMB 2R7UA 5DDPC 1B64A 4OO1C 4HT5A 3QQCD 5L46A 5A8RB 4RZRA 1N6QB 5B0EA 1S1TA 4USIA 2CPJA 5D4LA 1PAEX 3FK4A 2QA4G 3NCRA 1I6JA 2QSWA 3I55S 1T3NA 1NPPA 3UR0A 1IQZA 4AFFA 3CCLS 1VBZA 1I1GA 2GS8A 1ZM3A 4QWEA 4WF9Q 1UJ6A 2ROEA 1RBOB 4NZ6A 4MYTA 1RB0A 3LPEA 3NS6A 4FYXB 3HVAA 4DR7I 1R31A 2IIHA 3AB2B 4RKUC 1QTMA 4ZVFA 1UDQA 4O4GA 5LMUE 1C0UA 4U6PA 3T6JA 5IT9U 1Q4RA 1D09B 1K1SA 1S49A 2PEHA 2KG1A 1IJEB 2H1YA 2NYHA 4DFKA 4QIGA 3H1CA 3PDNA 4DWIA 1P9YA 5CD4A 5F8NA 3MEDB 5KFGA 5JEAE 4QJVA 2XYHB 3OTBA 3CSKA 2L9DA 4Z37A 2CPYA 4B3TI 3KK1A 5IZHA 4KAIA 4CH7A 3MTJA 4LRDA 4DR2I 3OUYA 1RADB 3L7UA 2GVDA 3QBCA 2ZKUA 3NGRA 2XC9A 2CJQA 2GHVC 2APOA 1NSPA 2BABA 2YNHA 1BQXA 1BQMB 1OY8A 3A3PB 2PMWA 3SBMA 3RR8A 4HY1A 1N34I 2F4VE 3CCJS 3WU5A 1Z0BA 5C0XC 1U8SA 2WZ1A 5KFAA 1U24A 3KHGA 5LMNJ 4PYAA 2QYCA 4DUYF 1OPIA 1MU2B 1RTJB 1UPMB 4B3MJ 4MIAA 4X65J 4IFDD 2B7BB 2CKWA 5C7PA 1BWEA 2WOMB 4A46A 3B6BA 4LCGA 3DYAB 5KFSA 2AF6A 4ILRA 1HPZB 3I31A 5D4PA 1FE4A 4KFBA 2KM8B 2CQ4A 1Y3KA 2I6WA 2ZWPA 2HFVA 4OLOA 5E3PA 5DG8A 3TJ8A 4ECRA 3UCUP 3NBPB 3HHNB 4UUWA 4OX9F 1XNQF 3U1YA 2VG5A 4DU8A 3JYTB 3BDEA 3N9UC 2XYGB 3OV7A 1CVJA 4LJMA 1TVRB 2EBEA 2R7SA 2Q2EB 4CT8A 3IS9B 1MN7A 4AD6A 2YKPA 4LFCJ 4KC5A 2FVRA 5EHHA 1UW9A 4X64E 2DKOB 5KFCA 1P1TA 2JEGA 4I3HA 4NXNE 4OJ3A 3A8IA 4N3OA 4ELTA 9ATCB 4ZJOA 3HCXA 4ZK7M 2OGUA 1JLQB 3QATA 5F8MA 3DHXA 3HSZA 4IFVB 4J9MA 5K36F 3SQGA 1XMQI 2NN6D 2F40A 1USUA 4G65A 4NXME 2JWNA 2ZNYA 2JEJA 1N34F 2J8SA 2C1EB 1CC7A 1T03A 1T3OA 2HZCA 4RR5A 5F0UA 5KG1A 1PKPA 3IRXA 2H3EB 1T7PA 1NK6A 4DUYI 3BBCA 2XWXA 3N5FA 4RX6A 3G8TA 1CULB 1UWBA 5JEAB 4ZPAA 2FIUA 2XCPA 1NK7A 1S6PA 1JJHA 1IBLF 1VHFA 1Y5YA 2AEJA 3T1HE 2YBVA 3O1LA 4PRXA 4OV6A 1Q53A 3I96A 4ZLNA 4NRTA 4K0KJ 4QYZK 5K8OA 1UDOA 1Y5IB 3DRSA 4WIIA 4AL7A 1IUJA 2CQIA 5DDQC 2WBMA 1KEKA 2DITA 3AJ2A 1KD1T 1H2UX 3GR0A 4M94A 4IFDB 2CPXA 1U1MA 3TQEA 3CCWA 3UO0A 3F56A 1UMJA 1DARA 4WFAQ 2HHPA 2PO2B 1ZTTA 1GTEA 2A1BA 2IM3A 3RGIA 4JI2J 1HBUA 4NI2A 1RAFB 3PIPQ 1RWPB 1XHKA 5EWGA 2YKNA 5J1NA 3JSMA 4CO2A 4J9KA 1FKOA 1ZM9A 2HQ3A 2FHJA 3TX8A 2FB0A 3KJVA 2XMTA 4ES3A 3G4SS 1U1OA 2HQDA 1VCTA 1XNRJ 4I56A 3R8YA 2VU5A 3ONQA 4OZEA 4DUZE 3P5BP 2V2KA 1SJRA 2RHQB 4L3NA 4NA3A 4F0HA 2XG8A 4USTA 3R97A 1U4BA 1S1UA 5THWA 3EXCX 1S1WB 2HIQA 2QL5B 2FC8A 1F0XA 3L95X 3MMAB 5D0EA 4YR2A 4QWDA 3MUVP 1NKEA 4DV1I 1VK3A 2M3DA 3K5MA 2D3O1 3OTOI 3THVA 2DXDA 5IQ6A 4A8XA 2QMWA 2CNOB 1RE1B 3QSYB 4AL5A 5DRPA 1FXLA 2K1RA 2MHEA 3DDIA 4W90B 3JAMC 1GMWA 3DRPB 2J9DA 3PJWA 3SDEB 3PR5B 1ZAXA 3CCES 3UCGA 4YHHJ 1UVJA 1HHSA 4MIWA 2RT3A 2R7VA 3H5UA 1FKPB 2EPIA 1J5EF 4DR7J 2DRDA 1GFWB 1H0HB 4RW7B 3PIOQ 2F63A 4O44A 4DU7A 1TL5A 4OZ2A 4E2FB 2ZH4A 2O66A 4ER8A 2R9LA 2HRYA 2L9NA 4KO0B 1D8ZA 4QIFA 3W2VB 4D3HA 5DGBA 2XWYA 1RHMB 4X4SA 2BQ3A 1N32F 1HW8A 1B63A 4NXMI 3T5KA 1BC6A 1KONA 2ZD1A 1N48A 1FXDA 1SH2A 2V2VA 2EFNA 1FD8A 2VL1A 4O4RA 2GMJA 3CE8A 4RW9B 4WU2A 2FD2A 3NCPA 3FMWA 4DV4E 3HKZD 4M5DB 4IOCQ 3JAMQ 2Z2YB 3BSOA 4C97A 2UXCJ 4I2PA 1IKVA 1TU0B 4DV6E 2BJ1A 2G1DA 3UHMA 3BH6B 1X4DA 2V4QA 2DNZA 2MXYA 5JUMA 3IN5A 1VBXA 2QV6A 1C1CA 1HQ2A 3DU6A 2KYXA 3A12A 4J5OA 4I2PB 4MT1A 2E1MC 4PEOA 5LMNE 1IXKA 1RXOB 5HMYA 1JX4A 3JQMA 2F4VJ 2B6AB 4DSJA 1TAUA 4I6WA 5F0WA 4RW9A 5D4OA 4FN5A 4USUA 2HFSA 3K5LA 3LANA 2XMUA 4G1QA 4GMKA 1KTQA 4PG6A 2FVCA 4ZJQA 4RNNA 2VFUA 5HMZA 5AJ3F 3OL8A 4K0KE 2BR2B 1FDNA 1IKYA 3IWLA 3JQJA 1NK0A 2C2RA 1SQGA 1KN6A 1YVFA 3LP1B 3AAWB 3VGTA 5I42B 3MM9B 1KVJA 1BQNB 3H7HB 2QE5A 2ALYB 5LMUJ 3GSDA 2C38B 2D3ZA 2R7OA 2P5VA 2DHGA 4ES2A 5KOWA 1HNWE 4DBQA 1IBMF 3VVUA 4B9MA 4CO1A 4EU0A 4BBYA 4CM0A 2DVIA 4ZPWR 1R7IA 1RT1A 4JI3I 3GYNA 4WBFA 4F4AA 3PR4A 1VYAA 3FCWA 3AD7C 5KFRA 2MQMA 3RTVA 1LNQA 1LWFA 2J6UA 1RWKB 2Q79A 4OMFG 2IBKA 1UVLA 4HTJA 4ZP6A 3H42A 3ZTSA 4Z7CA 5AT1B 3BH7B 4JI7E 1N5YB 5IT9Y 4F2SA 4N77A 4YY3F 3ZZPA 1TV6B 1UP1A 3TUZC 1HW9A 1ZH5A 2B0GA 3D6HB 2X3GA 2OPQB 5CQGA 3QYYA 3TJAA 3BSAA 5SZTA 4DL5A 1RLCL 1S1XA 2KVIA 3MEGB 2VESA 5DM7Q 2ZM6E 1KHVA 3O8WA 2KM8C 2CNLB 2JHEA 3NGDA 1OYDA 1TKXA 2AJ4A 1HR0J 3IWNC 2W7OA 2ZE2B 3BN4A 3CF5Q 4EBDA 4DLGA 1X9MA 4X66E 2AJ2A 4ZVHA 1YX2A 2PO2A 3WU3A 4J9UE 2ZBIA 4JI3E 5KFDA 1IBMI 3GIJA 1H38A 3M85G 1IKXB 3PTWA 2Z5BB 5HBMB 1HNZJ 1IN0A 3FSIA 3LF0A 3TAMB 3VF0B 3CC7S 4I4BA 1S1XB 4WUBA 4I0WA 4JI3F 5L1IA 1ZYQA 3VR1A 2ZJPQ 1ZA1B 2EFQA 2V8DA 3THPA 4NCAA 2QFJA 2VASA 3KXDA 2XY6A 4JI4I 4KJIA 1PC5A 2R2SA 1IVZA 4J9NA 4YY3I 4M5GA 4DZ6A 1IJFB 1JKHB 1JNRB 3X3UA 3VHQA 2OPSB 5HLFB 3MTKA 1NJZA 2DHSA 4EBCA 4DR3E 4C48A 1Q7YT 1L3UA 2MY8A 4CYUA 1DLOA 1QDUB 4Q44A 2WAQD 1S16A 1U1PA 1CJVB 3ZC4A 3MOZA 1VI7A 1FWKA 4EO8A 1ACMB 1YJTA 1WEXA 5BJRA 3KOAA 2IOQA 3IM8A 3QAUA 4ES1A 1RYSA 2IMWP 2CGEA 4DV6I 1JXEA 5G0RA 2YX4A 4LFAJ 1LWCB 3W63A 5IWAJ 4WUCA 2B9EA 2AIRB 2C39A 4IG0A 1SKRA 4UY8T 1TTHB 4A8QA 1BQNA 2NPIA 2IJRA 2WHOA 2RAQA 4OJ1A 2AT1B 2VG7B 4JI2F 3R5DA 3UDVA 1NJWA 4B3RJ 1H72C 5KFVA 2QN6B 2LJPA 1Z0WA 3CD5A 1NUEA 1N0VC 2RD5C 4KQVA 2V67A 4X4RA 2DCUB 4E0DA 2OPRA 2HHXA 4PXCA 1X9WA 3KMQA 1Z0CA 4NZ7A 3K89A 1CJKA 3EJMA 3UCZP 2XBPA 1DQ8A 1HWIA 5F3TA 3FUYA 4ZP8A 1E6VA 3MMCA 2YPZA 4DPTA 3TZYA 4JI4F 1S9EA 3D1QA 3L09A 3MPDA 1UA1A 3P49B 3TZWA 1FJGJ 2QA1A 1EJ7L 4M5DA 5IV4A 4ED6A 1MNEA 1IBLJ 3LP0B 3AQOA 4QR1A 1OIAA 3CTRA 4URGA 1KC8T 4OI1A 3CJKA 1S48A 2LA4A 5I3UB 3AFGA 4J3DA 1MSWD 2RDJA 3NG8A 4Q0BA 3QNWB 4LSLB 5EGYA 4X4NA 2BR2A 2GVDB 1FRKA 3R5JB 2CXEA 3C15A 3DLJA 2O01C 2ZZTA 3G82A 4O44B 1KTVA 3IXQA 2DBBA 4H4KC 3H20A 4DXLA 1C0TB 2G0CA 4B3SJ 2AX1A 1FFWB 2MZQA 5DS7A 3TVKA 2L08A 3PJ9A 4DJBA 3IAM9 2BANB 4F04B 4QOTA 4ZVOB 2GGPA 5CYMA 3V6DA 1R3NA 3T5HA 1H7UA 1WKKA 2R7TA 3U1KA 1J5OB 1UVKA 1PGZA 4C0HA 2XI3A 2B7CB 1YJVA 2K1RB 3E51A 3GB0A 2HQFA 3K5PA 1N5QA 3MCOA 3EGVA 3PYEA 5HAOA 3PW0A 4AQYE 6FDRA 2C3UA 1NPRA 4IFDA 4DR7E 2HHSA 3CJSA 3SZ2A 1FX2A 4NLTA 1TL1A 2W7AA 2BA0G 2PNMA 4OYZA 4OX9J 4OJHA 1XNQJ 3P4UB 2DT9A 2OD4A 1LK5A 3KLIA 4CIOA 1C0TA 3EYZA 3Q8UA 2KG0A 4I7FA 4UTGA 1HQEB 2H4YB 1KFDA 2HG4A 2RF2A 1RA6A 3B4DA 3CMQA 3FBCA 3SCIE 3UN2A 2BDPA 5M2RA 2BM1A 1OQ6A 1TAQA 2IM2A 2XZTB 5K8MA 1T9UA 4QZVB 3VGSA 4X4QA 5LMNF 2UVUA 1LWXA 3LQVA 3NEKA 2HPUA 3FFIB 2BMBA 2JLGA 3R5GA 2ADBA 1HBUB 4NI2B 2DH8A 2X1BA 1TQLA 3IRWP 1NXIA 1RWNB 2GO8A 2QMXA 4LIRA 4TY8B 4URQU 1G7CB 3M2RA 4PKDB 3CPWR 4ED1A 5K36E 1OWXA 2ZJRQ 4LQ9A 4LQ3A 4DV3I 1N32I 3OSPA 4LBHA 3W3SA 1EA6A 2OKQA 2AEMA 1DQ9A 2BOPA 4WTYA 3R2DJ 4GO5X 1E6VB 3MMCB 2E5LF 1FO1A 2UXDE 2V69A 3V81A 2P2CB 1Y0HA 1BHNA 2K8GA 3R7BB 4NCBA 4MK8A 3OFFA 3GIIA 1D9AA 4XAKA 4TY8A 1CS4B 1Y6ZA 4C9DA 5CCLA 5KFPA 4X64I 3JAMU 2KU7A 2VUGA 1QJHA 4ATNA 4FNHA 1REVB 3C16A 4WZMA 2QLBB 1D8YA 4MYUA 5GAGU 3I0RA 1HBOB 1U2RA 5KG2A 2WP8B 1R8BA 3MR6A 2ILYA 2Q3PA 1NHJA 1MW7A 3D1HA 1FKPA 3RUBL 4O3OA 5LOQA 5I3PA 3A8JA 1XMBA 4NLVA 5DLGA 3OHBA 4WFYA 2WB1D 2WONA 2JLFA 3PFOA 5HATA 2R2UA 1LWEB 2R2RA 5L38A 1KLNA 1WDTA 1TL1B 4Y65A 2MJUA 2CG8A 2OAUA 2PSZA 3F0NA 2QLFB 4DV3F 2BQRA 1NMEB 2E1CA 4KV8A 3H8YA 1K1QA 3T9NA 3TUIC 3MR3A 1QAIA 3T1YE 2W4DA 3W1YC 3M6UA 5CYMB 2HHHF
chains in the Genus database with same CATH topology
4DR2E 1HR0E 4LFBE 1H73A 1ZM2A 4IZKA 5A2QQ 4DV7E 1K47A 4DV2E 2J7KA 3HJCA 2UU9I 1XMOI 2A2DA 1Z0TA 2OI2A 5LMUI 2Z5BA 4DR6E 4DR6I 5FLXQ 1ZXNA 1FJGE 3ZM7A 1HNZI 2O1VA 4B3MI 4LF9I 3V5RA 4HYMA 1HR0I 4LFBI 4JI1E 3ZZUA 4JYAI 4M1KA 4X62E 3LNUA 2VQEE 4P7AA 3T1HE 4B3RE 1I94E 2HK2A 2NPFA 4YHHE 1N0UA 2V2QA 4DR5E 3B82A 4JV5I 4JV5E 4LF5E 4DR5I 3K17A 4YHHI 5GMEA 2BM0A 3ZKBA 3J80Q 3P06A 1ZM4A 1PIEA 2O1UA 2UXDI 4JI8E 3T1HI 3PYFA 1XNRI 4UT4A 1H7SA 1IBKI 1PVGA 2XEXA 2O1WA 2VQEI 1FWLA 3HULA 4IZJD 4JYAE 1D6TA 4JI1I 1Z59A 1A6FA 4IZJB 1ZXMA 1Z5CA 1KKHA 4LF9E 1Z5AA 4B3ME 1USVA 4JG4A 1IBLI 1HNZE 2GS8A 1FJGI 1ZM3A 1NHIA 4KHPE 4MYTA 4DR7I 5LMUE 4DPWA 1XMOE 4HXZA 3GONA 1OJ4A 2UU9E 4FW9A 4DV2I 2R3VA 1RR9A 4DV7I 2HHHE 4DPUA 4B3TI 1B62A 3WU6A 4DR2I 2E5LI 5A2QC 3T1YI 1N34I 3WU5A 3ZZTA 4B3SE 3QT6A 3Q1QA 1QZRA 1Z0BA 1BKNA 4EMDA 1VISA 2F4VI 4DU8A 2Q2EB 4X64E 4DV0I 2VQFE 2UUAI 4I3HA 4X65I 1HNXE 4NXNE 4N3OA 1N36I 3V2UC 2GQ0A 2ZBKB 1XMQI 1USUA 4NXME 4LF6E 2ZITA 1N32E 4DV3E 4DR4I 1PKPA 4DUYI 2HKEA 1Z0VA 4YY3E 4GKKI 4JI4E 5IWAE 4LFAE 4PRXA 3ZZ0A 5IT9Q 4DV5E 2CG9A 1MG7A 1IBME 4LF7E 1Y4SA 1DARA 4AQYI 2UXBE 2VF3A 1XHKA 2UXCI 4IZJA 2ZM6I 1ZM9A 4LF4I 4LF8I 4DUZE 4DR1E 4Z7YA 3Q6MA 4JI5E 4LFCE 2HK3A 4XTJA 1N33E 3B8HA 4DV1I 2UUCI 3WU4A 1Z5BA 3JAMC 3OTOI 3D4JA 4JI0E 4OX9I 1XNQI 1KVKA 3CWVA 2UUBE 1ELOA 2A2CA 4DU7A 1FKAE 4WUDA 4PRVA 1B63A 3H4LA 2EFGA 2V2VA 4JI6I 4DV4E 3JAMQ 3PYGA 4USMA 4DV6E 2PNLA 4GKJE 1MX0A 4FWHA 5LMNE 4DV4I 4JI6E 4DR3I 4FN5A 2HFSA 1RREA 5BR8I 4K0KE 2DEIA 4RPFA 3QT5A 5GMDA 1MU5A 2O1TA 4JI2I 2V2ZA 2UUBI 4HACA 1HNWE 4OX9E 1XNQE 4JI0I 1J5EE 1HK7A 2E1RA 4JI3I 4X66I 4DV1E 5FWKA 4Z7CA 4JI5I 4JI7E 2HKJA 4LF8E 3Q6NA 4LF4E 2Z5EA 3J81Q 4JI7I 5IT9C 2ZM6E 2UXCE 2AJ4A 3J80C 2Z5CB 2CZ9A 4X66E 3WU3A 4JI3E 4LF7I 1IBMI 1J5EI 3LPSA 2Z5BB 1S4EA 1HNWI 1FNMA 4WUBA 4JI2E 2WW4A 4IZKB 4K0KI 4JI4I 5BR8E 4YY3I 3J7AM 1Z0GA 1H74A 4DR3E 1S16A 2IOPA 1NZ0A 5LMNI 1FWKA 4LF6I 4GKJI 2IOQA 1XMQE 2CGEA 4DV6I 4WUCA 1N36E 2HFUA 4FWGA 1HNXI 4PU9A 4X65E 1UEKA 4DV0E 2X36A 1H72C 2LJPA 1Z0WA 4KQVA 4USKA 1N0VC 1Z0CA 3QT7A 3QT8A 4ZVIA 2V34A 3LTOA 4DPTA 3OTOE 5FLXC 4B3SI 2UUCE 1N33I 4LFCI 2E5LE 4DUZI 4DR1I 4DXLA 1KTVA 4B3TE 3PYDA 2HHHI 4DPYA 3J81C 2UXBI 1Z0EA 3PYEA 1EI1A 1WUUA 4FWDA 4AQYE 4P52A 4DR7E 2BV3A 4KHPI 4HACB 3ZKDA 4DV5I 2PNMA 1IBLE 4UTGA 4HY1A 3M6AA 2BM1A 5IWAI 3PRYA 4LFAI 3J7AG 4GKKE 4DUYE 2V8PA 1IBKE 4DR4E 1XNRE 4DV3I 1N32I 4JI8I 4NXMI 1EA6A 2UXDE 1NHHA 4NXNI 4URLA 2UUAE 3K1JA 2VQFI 1Y6ZA 3K85A 1FI4A 4R1FA 2X7IA 4X64I 1KIJA 4LF5I 4DPXA 4MYUA 2F4VE 4ED4A 1U2RA 1NHJA 5LL6R 1I94I 3B78A 2Z5CA 4B3RI 3F0NA 1N34E 2R42A 1H7UA 5L3JA 1Y4UA 3T1YE 2DEJA 4X62I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 E;  1HR0 E;  4LFB E;  1H73 A;  1ZM2 A;  5A2Q Q;  4DV7 E;  1K47 A;  4DV2 E;  2J7K A;  2UU9 I;  1XMO I;  2A2D A;  1Z0T A;  2OI2 A;  5LMU I;  4DR6 E;  4DR6 I;  5FLX Q;  1ZXN A;  1FJG E;  3ZM7 A;  1HNZ I;  4B3M I;  4LF9 I;  3V5R A;  4HYM A;  1HR0 I;  4LFB I;  4JI1 E;  3ZZU A;  4JYA I;  4M1K A;  4X62 E;  3LNU A;  2VQE E;  4P7A A;  3T1H E;  4B3R E;  1I94 E;  2HK2 A;  2NPF A;  4YHH E;  1N0U A;  2V2Q A;  4DR5 E;  3B82 A;  4JV5 I;  4JV5 E;  4LF5 E;  4DR5 I;  3K17 A;  4YHH I;  5GME A;  2BM0 A;  3ZKB A;  3J80 Q;  1ZM4 A;  1PIE A;  2UXD I;  4JI8 E;  3T1H I;  3PYF A;  1XNR I;  4UT4 A;  1H7S A;  1IBK I;  1PVG A;  2XEX A;  2VQE I;  1FWL A;  3HUL A;  4JYA E;  1D6T A;  4JI1 I;  1Z59 A;  1A6F A;  1ZXM A;  1Z5C A;  1KKH A;  4LF9 E;  1Z5A A;  4JG4 A;  4B3M E;  1IBL I;  1HNZ E;  2GS8 A;  1FJG I;  1ZM3 A;  1NHI A;  4KHP E;  4MYT A;  4DR7 I;  5LMU E;  4DPW A;  1XMO E;  4HXZ A;  3GON A;  1OJ4 A;  2UU9 E;  4FW9 A;  4DV2 I;  2R3V A;  1RR9 A;  4DV7 I;  2HHH E;  4DPU A;  4B3T I;  1B62 A;  3WU6 A;  4DR2 I;  2E5L I;  5A2Q C;  3T1Y I;  1N34 I;  3WU5 A;  3ZZT A;  4B3S E;  3QT6 A;  3Q1Q A;  1QZR A;  1Z0B A;  1BKN A;  4EMD A;  1VIS A;  2F4V I;  4DU8 A;  2Q2E B;  4X64 E;  4DV0 I;  2VQF E;  2UUA I;  4I3H A;  4X65 I;  1HNX E;  4NXN E;  1N36 I;  3V2U C;  2ZBK B;  1XMQ I;  4NXM E;  4LF6 E;  2ZIT A;  1N32 E;  4DV3 E;  4DR4 I;  1PKP A;  4DUY I;  2HKE A;  1Z0V A;  4YY3 E;  4GKK I;  4JI4 E;  5IWA E;  4LFA E;  4PRX A;  3ZZ0 A;  5IT9 Q;  4DV5 E;  1MG7 A;  1IBM E;  4LF7 E;  1DAR A;  4AQY I;  2UXB E;  2VF3 A;  1XHK A;  2UXC I;  2ZM6 I;  1ZM9 A;  4LF4 I;  4LF8 I;  4DUZ E;  4DR1 E;  4Z7Y A;  4JI5 E;  4LFC E;  2HK3 A;  4XTJ A;  1N33 E;  3B8H A;  4DV1 I;  2UUC I;  3WU4 A;  1Z5B A;  3JAM C;  3OTO I;  3D4J A;  4JI0 E;  4OX9 I;  1XNQ I;  1KVK A;  3CWV A;  2UUB E;  1ELO A;  2A2C A;  4DU7 A;  1FKA E;  4WUD A;  4PRV A;  1B63 A;  3H4L A;  2EFG A;  2V2V A;  4JI6 I;  4DV4 E;  3JAM Q;  3PYG A;  4USM A;  4DV6 E;  4GKJ E;  1MX0 A;  4FWH A;  5LMN E;  4DV4 I;  4JI6 E;  4DR3 I;  4FN5 A;  2HFS A;  1RRE A;  5BR8 I;  4K0K E;  2DEI A;  4RPF A;  3QT5 A;  5GMD A;  1MU5 A;  4JI2 I;  2V2Z A;  2UUB I;  4HAC A;  1HNW E;  4OX9 E;  1XNQ E;  4JI0 I;  1J5E E;  2E1R A;  4JI3 I;  4X66 I;  4DV1 E;  4Z7C A;  4JI5 I;  4JI7 E;  2HKJ A;  4LF8 E;  4LF4 E;  3J81 Q;  4JI7 I;  5IT9 C;  2ZM6 E;  2UXC E;  2AJ4 A;  3J80 C;  2CZ9 A;  4X66 E;  3WU3 A;  4JI3 E;  4LF7 I;  1IBM I;  1J5E I;  3LPS A;  1S4E A;  1HNW I;  1FNM A;  4WUB A;  4JI2 E;  2WW4 A;  4K0K I;  4JI4 I;  5BR8 E;  4YY3 I;  3J7A M;  1Z0G A;  1H74 A;  4DR3 E;  1S16 A;  1NZ0 A;  5LMN I;  1FWK A;  4LF6 I;  4GKJ I;  1XMQ E;  4DV6 I;  4WUC A;  1N36 E;  2HFU A;  4FWG A;  1HNX I;  4PU9 A;  4X65 E;  1UEK A;  4DV0 E;  2X36 A;  1H72 C;  2LJP A;  1Z0W A;  4KQV A;  4USK A;  1N0V C;  1Z0C A;  3QT7 A;  3QT8 A;  4ZVI A;  2V34 A;  3LTO A;  4DPT A;  3OTO E;  5FLX C;  4B3S I;  2UUC E;  1N33 I;  4LFC I;  2E5L E;  4DUZ I;  4DR1 I;  4DXL A;  1KTV A;  4B3T E;  3PYD A;  2HHH I;  4DPY A;  3J81 C;  2UXB I;  1Z0E A;  3PYE A;  1EI1 A;  1WUU A;  4FWD A;  4AQY E;  4P52 A;  4DR7 E;  2BV3 A;  4KHP I;  4HAC B;  3ZKD A;  4DV5 I;  1IBL E;  4UTG A;  4HY1 A;  3M6A A;  2BM1 A;  5IWA I;  4LFA I;  3J7A G;  4GKK E;  4DUY E;  2V8P A;  1IBK E;  4DR4 E;  1XNR E;  4DV3 I;  1N32 I;  4JI8 I;  4NXM I;  1EA6 A;  2UXD E;  1NHH A;  4NXN I;  4URL A;  2UUA E;  3K1J A;  2VQF I;  4R1F A;  1FI4 A;  4X64 I;  2X7I A;  1KIJ A;  4LF5 I;  4DPX A;  4MYU A;  2F4V E;  4ED4 A;  1U2R A;  1NHJ A;  5LL6 R;  1I94 I;  3B78 A;  4B3R I;  3F0N A;  1N34 E;  2R42 A;  1H7U A;  5L3J A;  3T1Y E;  2DEJ A;  4X62 I; 
#chains in the Genus database with same CATH topology
 3H5S A;  3UD5 A;  1FJ7 A;  2RUG A;  2BYC A;  1T9Y A;  1HR0 E;  3MPV A;  2OPP A;  3CUN A;  2YQ1 A;  4PQU A;  4MQY A;  4RL1 A;  2EC0 A;  3J7Y U;  3M7N D;  4X64 F;  1MWY A;  4DV7 E;  3W8P A;  2E5J A;  2GA7 A;  4JI1 F;  1HD1 A;  1RAJ A;  2ZOF A;  3HJC A;  2UU9 I;  1B99 A;  2YKN B;  3PY8 A;  2Z30 B;  1S99 A;  5JMN A;  3VAK A;  3ENV A;  1YRU A;  2DHX A;  5CA5 A;  4IFD F;  1Z0T A;  1B0P A;  2IRY A;  5KT4 A;  1UEU A;  2BA1 G;  2ZDO A;  8RUC A;  4UW2 A;  1WJ9 A;  1IKW B;  2CNK B;  5FLX Q;  3M8P A;  4PG5 A;  2D3O R;  1ZPW X;  4LF7 J;  2F65 A;  1ZXN A;  4X2B A;  1NHU A;  1KFS A;  4JP8 A;  2FVS A;  2EFO A;  3MEG A;  4LF5 J;  2OSR A;  2PN6 A;  2QYG A;  2ZVS A;  4MTP A;  5L9X A;  4DR7 F;  5IWA F;  4LFA F;  3FQL A;  3AOB A;  3CDB A;  4F0K A;  1QAJ A;  1FEE A;  2RRA A;  3ITH B;  4ZIT A;  4FF4 A;  1OPZ A;  3LGH A;  4ID5 B;  1T11 A;  2RB7 A;  4XDC A;  1TV6 A;  4L74 A;  3SFU A;  4C3M A;  4CLZ A;  1UAW A;  2A0F B;  5KFH A;  4GQU A;  4JI1 E;  1FD2 A;  3DXS X;  2BJ7 A;  3FNN A;  4ZCK A;  5K20 B;  3QIP A;  4YQW A;  2CNN B;  2ZHB A;  4B3T F;  3K5N A;  3VWS A;  2I0X A;  4HH1 A;  2HNY A;  5C24 B;  3J7Z 5;  2EBG A;  2K3I A;  3CD6 S;  3QGP A;  3T5J A;  5K5M A;  4C0O C;  2ATL A;  1W26 A;  1Y10 A;  2VPZ B;  3CO9 A;  4BC7 A;  2HMI A;  4B3R E;  1TK0 A;  2AYB A;  1LWC A;  1E6Y A;  2WON B;  1BLU A;  2RQM A;  3KFW X;  3RAM A;  5CCM A;  5JXS A;  2N7C A;  4CO0 A;  2KDO A;  4LSN A;  4FF2 A;  4O0N A;  4CNY A;  1CJV A;  2EC2 A;  1S1T B;  3OXL A;  5F41 A;  1SPB P;  1UA0 A;  4OO1 B;  1HBO A;  1WI8 A;  2LA6 A;  2FZG B;  2GW8 A;  2HK2 A;  2VBX A;  2OPS A;  4IH7 A;  1W2B R;  4YHH E;  3LPY A;  3C16 B;  1N0U A;  2AHO B;  5CZV A;  4LF9 E;  1BUX A;  4JV5 I;  1YZ6 A;  3GV8 B;  1X4F A;  3IS9 A;  4P7V A;  1UCN A;  5E2Q A;  4IH6 A;  1I94 F;  4PWD B;  5H9E K;  1LW2 B;  2B6A A;  5A8K A;  1NK5 A;  2BM0 A;  4ILM A;  2IJF A;  1HHT P;  5DZ6 A;  3K58 A;  3P06 A;  2WNR A;  4B3R F;  3DRR A;  2B5J A;  4CLY A;  4LVO P;  3PEH A;  2DNY A;  2K3K A;  4OX6 A;  1SKW A;  1HNV A;  4F4K A;  2RRB A;  1JQG A;  2JRS A;  2WOM A;  4DV4 J;  1YBA A;  1FNX H;  2PC6 A;  1NJY A;  1K9M T;  3C6T B;  5JJB A;  3W9H A;  2FLP A;  2MHN A;  4C98 A;  3T1H J;  5F8G A;  4HYK A;  2BJE A;  5DRK A;  1T05 A;  4JI8 E;  2C39 B;  1WF0 A;  3R6G B;  1RT6 B;  2DHA A;  4I1T A;  2IVF B;  4CQ1 A;  4DV3 J;  1XMQ F;  2E66 A;  1VJQ A;  2QFI A;  2YNH B;  2UP1 A;  4V19 J;  4YB6 A;  3I0S B;  2PGC A;  2IES A;  1D6T A;  2ZH2 A;  1RTD A;  2B9W A;  1S72 S;  2MST A;  4X4O A;  2WBR A;  2IVM A;  4FBU A;  1D3W A;  2MB0 B;  5IT9 C;  2DJW A;  1R8A A;  2BA0 D;  4R0E A;  1T02 A;  2GFF A;  2GV1 A;  4DV1 F;  3ENQ A;  2C3O A;  5LMU F;  1DJ0 A;  1Z5A A;  5HO4 A;  4DR6 F;  3W65 A;  3NMR A;  3MED A;  2ZH9 A;  2LEB A;  5B0G A;  3NNH A;  1K0T A;  1YDL A;  1IBL I;  2XGP A;  1HAR A;  2R8G A;  5EWE A;  4ZCI A;  1A9N B;  1FTC A;  3DDK A;  2J7U A;  4DN9 A;  3DLH A;  4C8Z A;  4QBU A;  3JSY A;  2JT2 A;  5K36 C;  1RSC A;  4LRF A;  1CBK A;  1X5P A;  3R3T A;  2QX0 A;  4DPW A;  2QEX S;  4ECS A;  5I3U A;  1ITP A;  3KHR A;  4MAK A;  2F4V F;  3GON A;  2HRT A;  4K4Z A;  4MU1 A;  1OJ4 A;  2B8P A;  3GJQ B;  3AJ1 A;  5CZX A;  3G6V A;  2ZH6 A;  2FJX A;  1U47 A;  1K8A T;  4DV2 I;  2YKQ A;  3C3L A;  3UWT A;  2HHH E;  4UOG A;  4HI1 A;  4YR3 A;  5DG7 A;  4JYA F;  3OXF A;  2C37 A;  1N6Q A;  3RB3 A;  1M5P C;  3D0G E;  3MM9 A;  1UJ5 A;  3WU6 A;  1HA1 A;  2UXB J;  2W7P A;  2NRE A;  1HFE L;  4ZHR A;  5LJ3 Y;  3VTI A;  2E5L I;  4CLW A;  5J2Q A;  2FJV A;  1U8W A;  4QU6 A;  3DI6 A;  2GZO A;  2NZ4 A;  1JXL A;  5DQH A;  2JEB B;  2GQ2 A;  2RHS B;  1YKW A;  3Q22 A;  1REG X;  2DIS A;  3SYZ A;  1UVI A;  2JEI A;  1RAE B;  2GVZ B;  3JS9 A;  3ZZT A;  4IR9 A;  1R0C B;  1NSA A;  2PA3 A;  3LA0 A;  4HI2 A;  3ZNJ 1;  4CRJ A;  4DV0 J;  4F4W A;  1NK4 A;  4DUT A;  2B5J B;  3Q1Q A;  2CQ2 A;  3NWG A;  3GMG A;  2MY7 A;  4J37 A;  4DSK A;  3HT3 A;  1B4S A;  4C11 A;  1UFL A;  2FZK B;  1RTH A;  4O3R A;  2YVS A;  3NMA A;  3MAA A;  1V5I B;  1FER A;  1GAO A;  1VIS A;  2MZT A;  2BJD A;  2RE1 A;  4HHU A;  1RIS A;  4OI2 A;  5A76 A;  4LR9 A;  4EFA C;  3MR5 A;  2C42 A;  2F4V I;  3AA9 A;  3M32 B;  2J76 E;  3PJX A;  5CAA A;  3DD6 A;  3DRX A;  1UWA A;  2DNR A;  2U2F A;  4NYO A;  3SSQ A;  2JFK A;  3P45 B;  3CO0 P;  2VQF E;  2HWH A;  1SXL A;  1X7V A;  3M1V A;  1HNX E;  5B0F A;  3EGZ A;  2KO1 A;  2J9C A;  4RW4 A;  4OHY A;  1YJU A;  3V2U C;  2YNG A;  3L3C A;  1T94 A;  2GQ0 A;  2GJF A;  3SDE A;  3OFE A;  4FF1 A;  3DLE A;  2KT2 A;  2W2P P;  3AB4 B;  1DLO B;  3VV2 B;  4HLB A;  2XO6 A;  1F5B A;  4P6Q A;  4DR4 I;  3KLF A;  3GG0 A;  3U27 A;  4IFY B;  1RHJ B;  2JNJ A;  1RT2 B;  1M5S A;  3SXL A;  5IFM A;  2A6O A;  2ALZ A;  4BA2 A;  5C42 A;  4B17 A;  1AFI A;  3BM7 A;  5ETP A;  5G4D A;  4R5P B;  4HTI A;  2E1P A;  1GQE A;  4L73 A;  2D74 B;  2VZ9 A;  2UUA J;  1S6O A;  1OQ3 A;  1RU1 A;  1NH8 A;  4DLE A;  5IWA E;  2ZFH A;  2EFV A;  1EKR A;  1NRK A;  1SUQ A;  1FF2 A;  4AXJ A;  1XR7 A;  3HI9 A;  4P2M A;  1LW0 B;  4CO4 A;  4E8U A;  4ETX A;  4JI4 J;  1CQM A;  2VFT A;  1ZPV A;  2M52 A;  2YWK A;  2PFD A;  1X5S A;  2FUG 9;  3EIC A;  4KFB B;  4WK1 A;  3KJV B;  1Q5Y A;  4O3S A;  2O1U A;  2J7W A;  1WEY A;  1Z2Z A;  1H3D A;  2GMH A;  1PCA A;  3KG0 A;  3SSR A;  4CM2 A;  5HQL A;  2ZH3 A;  1PIL A;  4O3Q A;  1X9S A;  2HQG A;  4OZ5 A;  4CLU A;  2YNI A;  2UV8 A;  2OLW A;  1MG7 A;  3LW5 C;  3AJD A;  1Y4S A;  4JYA I;  2VD3 A;  1VQK S;  2XNQ A;  5FDL B;  4OYA A;  4OX7 A;  4OYI A;  1UZD A;  3OHA A;  1PJ6 A;  3DMJ A;  3HHE A;  3RW6 A;  1SB6 A;  1GMW D;  4A8S A;  4FBT A;  3GCW P;  4IZJ A;  5K36 A;  3DRS B;  2BE7 D;  3W62 A;  1DY3 A;  3HJF A;  1ZAW A;  2ABY A;  3CJ8 A;  5HMW A;  1QAX A;  3K57 A;  4ED2 A;  4LF4 I;  4B9U A;  2MLX A;  3R5A A;  1OMS A;  2VQE J;  3EXY A;  2UU9 E;  1VQN S;  5EDW A;  3G96 A;  3QRR A;  4KTQ A;  1EHW A;  2VB6 A;  2J5A A;  2RU9 A;  1QSL A;  2NXC A;  3WC0 A;  1YZ7 A;  3FEX B;  3ZNU A;  3KLG B;  4XTJ A;  3M6W A;  2GIQ A;  4FF3 A;  2VV5 A;  1SIZ A;  1RT1 B;  2M0G B;  5AXN A;  3G8Q A;  2E5H A;  2QC3 A;  4DR6 I;  1K73 T;  1HIY A;  1YJR A;  1TUG B;  3M6X A;  2B3T B;  4RW8 B;  1F9H A;  4TKT A;  3G71 S;  3NL0 A;  1G2E A;  3D67 A;  1URR A;  4JI0 E;  3SQG B;  3OFH A;  2R2T A;  1XEZ A;  2R7Q A;  3UVJ A;  2V94 A;  2C38 A;  2OP5 A;  4UF4 A;  2W9B B;  1X4B A;  4N41 A;  1TEL A;  3U7J A;  2XY7 A;  1FRH A;  3VZI A;  3GV7 B;  2AV5 A;  2BRK A;  1FTR A;  1LW0 A;  3MMJ A;  2WSE C;  4RWX A;  3QGH A;  1RYR A;  1UW4 A;  3JSR A;  4MFB B;  3OL9 A;  4FW6 A;  4WUD A;  5C0X A;  3RB6 A;  2O3D A;  4ZVU B;  4R8U B;  2PD1 A;  1RI7 A;  1TKT B;  2EFG A;  2H54 B;  2OH2 A;  3H4L A;  3O44 A;  5I3Q A;  1RCO B;  2Y1L B;  3MCN A;  4JI6 I;  2ZEJ A;  3N6M A;  3CCV S;  1HPZ A;  5MLC V;  1YH8 A;  1S9G B;  2AMC B;  3PYG A;  2VJV A;  3J7A N;  1YSJ A;  2PNL A;  3HHK A;  2MKS A;  4PXE A;  4TN2 A;  2ASJ A;  3ICL A;  1U1K A;  2Y1J A;  2DD8 S;  2XUL A;  1VIX A;  2JDJ A;  4NPO A;  1QAY A;  3I56 S;  3PKY A;  3RU0 A;  4AE5 A;  3CC2 S;  4LF8 J;  1AYE A;  4C2M A;  1R8C A;  5ADZ A;  5ETS A;  3BGF A;  2ZC4 A;  2IJN A;  2N7Y A;  2JEA B;  1OYE A;  4WFN Q;  3OVB A;  2CJB A;  4HHJ A;  2RIJ A;  1QVF R;  1NU4 A;  1SI9 A;  3J80 U;  2WVE A;  1DAX A;  2HND A;  2LKZ A;  5GMD A;  3IBW A;  3EVO A;  2Z58 B;  1WWH A;  3ILL A;  4MH8 A;  4ZA1 A;  2FLL A;  3UR3 C;  1FXR A;  3D2W A;  3KNA A;  4UOH A;  4ECQ A;  2A3J A;  4JI2 I;  2XLK A;  2RDD A;  3MM6 A;  3A13 A;  1WKJ A;  4A8Y A;  1LFP A;  1RCX B;  3W7B A;  4A47 A;  1Z2L A;  4AQY F;  2VON A;  2B43 A;  1O0P A;  2V5H G;  4OX9 E;  1XNQ E;  3DDN A;  3BSN A;  2MKY A;  1J5E E;  1MWZ A;  3D6T B;  4NLQ A;  3LP2 B;  4FW3 A;  2E1R A;  4DR4 J;  1R6Y A;  5KT7 A;  5AJ3 J;  4I2Q B;  2MDA A;  3L7O A;  4OZ0 A;  2P9G A;  1V6H A;  3AY0 A;  4RU9 A;  4TLR A;  3CB4 A;  3UN3 A;  2HVD A;  4DR2 J;  4DL3 A;  2VA3 A;  1BXN A;  2CJA A;  3ZTP A;  3EM1 A;  3HSG A;  3M8Y A;  3MWB A;  3FEY B;  4JYA J;  3EDR B;  2IY5 B;  3P3C A;  3D0I E;  1X8D A;  2DIU A;  3GSI A;  1SQF A;  4CLP A;  5IT4 A;  4DV1 J;  4JI5 I;  2QLW A;  2Z4P A;  5KFJ A;  2LXF A;  2NXN A;  2VPY B;  1T9V A;  2ZVI A;  3MZI A;  5J2Q B;  1QSY A;  2HKJ A;  3EPG A;  1EIY B;  3SCL E;  2VG6 A;  1XC9 A;  3RB0 A;  3FZB A;  1LXN A;  3Q6N A;  2OFH X;  4AUK A;  2W9A A;  2Z5E A;  3P96 A;  4WXO A;  4A8K A;  1VQL S;  4J9O A;  5H9F K;  4N7T A;  2KXH A;  4L3K A;  1WEZ A;  3ZTQ A;  2LXI A;  4PQA A;  1N36 J;  2HFN A;  2NYI A;  4KGZ B;  4DS5 A;  2AGP A;  3LP0 A;  3BDP A;  2DGO A;  3LGN A;  3CCR S;  4LFB J;  2Z5C B;  2LFV A;  3EGN A;  1P8G A;  2ZBQ A;  1EET B;  3B54 A;  5IV3 A;  1Y3J A;  3QLH B;  4N5S A;  2ZM6 J;  3NNC A;  2ZH5 A;  1TKD A;  1RRE A;  1JWW A;  1S7I A;  5C0X D;  1V3S A;  3M2U B;  5A8W B;  3SQO P;  3QGG A;  2MKJ A;  1FNM A;  4KKO B;  3D0H E;  2DGT A;  2O67 A;  1NO8 A;  1Y00 A;  2OPR B;  4FPI A;  3S1T A;  3SFG A;  3CCQ S;  1GT8 A;  4KPY A;  2NXE A;  2HFO A;  1VQ4 S;  1FDD A;  4QW9 A;  2RRN A;  2WW4 A;  3QJL A;  4JI2 E;  4DOZ A;  2Z56 B;  3MM7 A;  3L7Z A;  1UWB B;  5JEA A;  4K0K I;  2MTL A;  4JI5 F;  1KRP A;  5J2M B;  5BR8 E;  3BQ1 A;  2Q1L A;  3CJ2 A;  3J7A M;  4U7U D;  3IMQ J;  1HBM A;  2OTJ S;  1N4L A;  3MPY A;  3TX0 A;  4LT6 A;  3KLE A;  2NN6 B;  3KKF A;  5LMN I;  5KG3 A;  2FHK A;  2QSF A;  3OW2 R;  3HT0 A;  4ELV A;  2MLY A;  2OHD A;  2V9W A;  2LMI A;  3H4B A;  4IRD A;  2IDL A;  4X62 J;  1WC0 A;  1JLC A;  3LAL A;  4FPR A;  4ERD A;  4IS9 A;  3BGO P;  2UVR A;  4K7Q A;  2NXJ A;  3R2C J;  1SL1 A;  1VJW A;  1TK5 A;  3SSS A;  4KB7 A;  3MUR P;  4DR1 F;  3NS5 A;  4WXW A;  5AE2 A;  1VQ7 S;  4KH0 B;  4NLR A;  1U1L A;  4KGV B;  4WCE Q;  1Q8K A;  1D9F A;  2I2Y A;  1RT7 A;  1EZZ B;  1WF1 A;  2HVE A;  4OYO A;  4C3K A;  2JSX A;  2ZKT A;  3CDW A;  1NBE B;  2R8I A;  3QGI A;  3W5Y A;  2