4HACA

Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
312
structure length
312
Chain Sequence
HSSGLVPRGSHMVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEKCNQVAEAVAGAGGKVTITKPTEQGLKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate kinase
publication title Crystallization and preliminary X-ray diffraction analysis of mevalonate kinase from Methanosarcina mazei.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
total genus 89
structure length 312
sequence length 312
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4hacA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4hacA01
4JI4I 4NXNI 4AQYE 4LFBI 1PVGA 4DV0I 4JG4A 4RPFA 4JI3E 4LF8I 4LF9I 3PYGA 4DU7A 3WU5A 3F0NA 1EI1A 1Z0BA 2VQEI 4DV6E 2ZM6E 1IBLE 2DEJA 4DV4E 4X65I 3T1YI 1J5EE 2HKEA 4P7AA 3QT7A 4PRVA 4DU8A 1H74A 2A2CA 3ZKDA 2V8PA 4FWGA 4DV7E 1I94I 4NXMI 2A2DA 1MU5A 2F4VE 4JI8I 1N33E 3WU4A 3OTOE 5A2QC 2UU9I 2UXCI 5LMUE 4X62I 4DR6E 4DR1E 3LTOA 4DUYE 3J7AM 3WU3A 4M1KA 1XMOE 2X7IA 4LF6I 2UXDI 4LF5I 4HYMA 1HR0I 4JI4E 4NXNE 4LFBE 1Z59A 2V2ZA 4USMA 4WUDA 4DV0E 2UUCI 1KTVA 4LF9E 4LF8E 2VF3A 4X66I 3WU6A 4DXLA 3PYDA 2VQEE 1IBKI 2LJPA 5IT9C 4K0KI 3QT6A 1N36E 4X65E 1S4EA 4XTJA 3T1YE 2HK3A 3V2UC 2UXBE 1MX0A 1PKPA 2BM0A 4KQVA 1XHKA 1I94E 3J81C 4NXME 5BR8I 4EMDA 4LFAI 4JI8E 2J7KA 2UUAI 1HNXI 1ZM4A 2E5LI 2UU9E 4DV1I 3ZZ0A 1B62A 4X62E 1H7UA 1Z5AA 1N32I 1U2RA 4LF6E 2UXDE 4LF5E 2ZITA 1HR0E 1NHIA 3B8HA 2UUCE 4DUZI 5A2QQ 3B82A 4X66E 4DR7I 1KIJA 4UT4A 3H4LA 1IBKE 4K0KE 2VQFI 1N36I 4JI2I 4OX9E 3JAMQ 4B3RI 1ZM9A 1FWLA 2UXBI 1XNRI 4DPUA 2V2VA 2WW4A 3GONA 1Z0EA 2BM1A 4X64I 1ZM2A 5IT9Q 4ZVIA 3J80C 4DR2E 3PYFA 3K17A 5LMNI 1A6FA 1XMQI 5BR8E 4LFAE 5GMDA 1ZM3A 2UUAE 1HNXE 1RR9A 1Z0CA 2E5LE 4DV1E 4GKJE 3T1HI 4DR3I 1N32E 3J81Q 2OI2A 4DR4I 1H73A 3ZM7A 4B3TI 5IWAI 1Z0WA 4DUZE 4WUBA 4LF7E 2HK2A 2ZBKB 4DR7E 1Z5CA 1NZ0A 4JV5E 4YY3I 2VQFE 1H72C 1S16A 4B3MI 4JI2E 4OX9I 1MG7A 4JYAI 4B3RE 3J7AG 2EFGA 1Z0VA 4MYTA 4LF4I 1XNRE 4LFCI 4DV2I 1KKHA 3ZKBA 4DPWA 1NHJA 2GS8A 4X64E 3LNUA 5GMEA 1B63A 2Q2EB 3K1JA 4DR2I 4HACA 4USKA 5LMNE 1XNQI 1HNWI 1FNMA 4DPYA 1XMQE 4WUCA 2HFUA 5FLXC 2DEIA 3QT5A 5LL6R 3PYEA 4FWDA 1IBMI 4GKJI 1DARA 1PIEA 3T1HE 4DR3E 1D6TA 4FN5A 4FW9A 2UUBI 3V5RA 1FI4A 4HACB 3ZZUA 4DR4E 4PRXA 4B3TE 5IWAE 4KHPI 4LF7I 1FKAE 4PU9A 1N0UA 1Z5BA 1H7SA 4YHHI 4JV5I 4DV5I 4YY3E 4DV3I 1Z0GA 4B3ME 1VISA 2HHHI 4JI5I 4JYAE 4I3HA 4FWHA 4LF4E 1FJGI 4Z7CA 1N34I 2HFSA 4MYUA 4DV2E 4LFCE 4JI7I 5L3JA 1ZXNA 3M6AA 3ZZTA 1XNQE 1HNWE 1RREA 4B3SE 3QT8A 1IBME 1HNZE 1NHHA 4JI1I 1N0VC 1WUUA 2UUBE 4HY1A 2R42A 4JI0I 2CZ9A 5FLXQ 2E1RA 4P52A 4KHPE 4JI6I 4R1FA 1FWKA 2V34A 2BV3A 4YHHE 4DV5E 4DR5I 4DPXA 4DV3E 4GKKI 2HHHE 4JI5E 4DPTA 3JAMC 4URLA 1ZXMA 3LPSA 4AQYI 4Z7YA 1FJGE 1N34E 4JI3I 2NPFA 4JI7E 1ELOA 3B78A 2XEXA 4DV6I 1QZRA 2ZM6I 1IBLI 1OJ4A 4DV4I 3D4JA 1J5EI 4UTGA 1BKNA 4B3SI 1Z0TA 3HULA 1HNZI 3J80Q 4JI1E 1UEKA 2AJ4A 4DV7I 2HKJA 4JI0E 2F4VI 2X36A 2R3VA 1N33I 1EA6A 2V2QA 3OTOI 4JI6E 3Q1QA 2UXCE 5LMUI 4DR6I 4DR1I 1KVKA 4ED4A 4DUYI 4DR5E 3CWVA 1XMOI 4GKKE 4HXZA 1K47A
chains in the Genus database with same CATH superfamily
1YDLA 4YS2A 4K5SA 3W8GA 3MMAB 1JJCB 4EYHB 1CJUA 1N56A 3RBEA 3IAS9 3P3CA 3VAHA 2B9WA 1U47A 2F63A 4JYAJ 4WCEQ 1VYAA 1NSAA 3PZPA 1WDDA 5B0AA 1QVGR 5E33A 1I94I 3N6MA 1MU5A 1Q82T 4MIAA 1NJYA 5J2NA 3PFOA 3MR3A 2UU9I 2UXCI 2PD1A 2UUCF 2ZH5A 5AE1A 4QZVB 2LVWA 5K36D 3W66A 1QSLA 1RT3B 2I2YA 1IQTA 4EBEA 1S1WB 4RZRA 1U48A 2Z2MA 4N47A 3HJCA 4KBIA 3QIPA 2VA2A 5EKWA 4X65E 2XG8A 1PAUB 2XMUA 3PXGa 1LV5A 2NXCA 2ILZA 4EYIB 3WX8A 5K8PA 5KFYA 1F9EB 3UDLA 3TJ9A 1NB7A 4KQVA 1XHKA 4QW8A 2NSBA 4PG8A 5AE3A 1TQLA 4EMDA 1FO1A 5JEAF 4MT1A 3PW5A 1FKPB 1MU2B 1Z5AA 1T9WA 1T7PA 4Y2IA 3M7ND 4NZ7A 1IQZA 4ZLJA 2FPHX 5A2QY 1QAJA 3AFGA 4DQRA 5A2QQ 3BDPA 2HHQA 1S48A 2XZTB 1G4CA 4UT4A 2O1WA 2FVRA 5H9FK 1RGVA 3VALA 1AA1B 4E0DA 4B3RI 2QX0A 2VG5B 2PO0B 2B9EA 1WKKA 2L9NA 4OHYA 4FBUA 2HNYB 1EETB 3NS5A 3OHAA 1ZM2A 3OPKA 2VC1A 2R7TA 3V6DB 2MZQA 3NCPA 3K17A 2FB0A 1T03B 3H5UA 1U0SA 3WDOA 2VV5A 4JI0F 2WOMB 2E5LE 1TL4A 2MHEA 4GKJE 2ALZA 1WC6A 4ZOSA 3PHTA 3C14A 4IFDB 2ZBQA 4DR4I 5K36A 4FP9A 4X4NA 2BKPA 2VA3A 4GKKF 2B51A 2PE8A 4KC5A 2BQUA 4KYZA 4LF7E 2ZUAA 3DLJA 2Y8YA 2F4VJ 1TVRA 3NGSA 3AXKA 2LKZA 3KK2A 3G96A 5M2RA 2CVIA 4F04B 4DV6F 1SUQB 2FLLA 2MJNA 1KHVA 2G1HA 3AXMA 3UDEA 1HI1A 1BQNA 2WW8A 4ZITA 4B3SF 4ZVPB 1X7VA 1WG1A 1RDRA 4NL5A 1P6TA 1RT6B 2M5YA 1JLQB 1RAIB 5K8OA 5ETRA 2C2MB 3DGPA 3PR4A 1IKXA 4LCFA 1HW8A 4IG0A 2UUBI 1S76D 1RLCL 2BE2B 3UI3A 2VKZG 5C25A 2OPRB 3GIIA 4JI4F 4A8YA 4ZA1A 4LF9F 3LAKA 3POTB 1U49A 2UVRA 4CLFA 4X62J 1RWVB 5B0CA 3AD8C 3NOGA 1TKXB 2MKYA 4I6AA 3SSQA 1N34I 4OI2A 2UXDJ 2MZTA 1GMUA 2DT9A 2GHPA 1DHMA 5I42B 1Y00A 2W9CA 5M2UA 1SBRA 2CPZA 3MM5A 2IBOA 4IR9A 3PIOQ 2AZ1A 1HNZE 1UZDA 3GE9A 3HVTB 2HQIA 4RNOA 2E5GA 1SH2A 1G2EA 1O5JA 2R8GA 3R6GB 2MLZA 2YQ1A 4DFKA 1XN9A 1UFLA 3MMCB 1RAGB 5HROB 4ED6A 2CQ0A 1R0AB 3SCIE 4QIEA 1JXLA 2BV3A 3GJRB 3L09A 1HNXJ 5F0UA 2L08A 3Q23A 3R5DA 1TU0B 2ROGA 2J0XA 2P5VA 3E8OA 4ZPCA 2QC3A 1K8AT 4J9QA 4LCGA 2V0NA 3EXCX 2H1YA 2HGNA 4IUFA 4BLGA 3T5HA 2BW7A 2E9TA 1C4CA 4QWBA 4X84A 3WX4A 3EWGA 1KFDA 3OTOF 1NK4A 1S1TB 3RRKA 3MCMA 4J5OA 2YWGA 5EGYA 4USVA 1ITPA 4ECQA 1F3VA 5A8KA 2PO1B 2E44A 2DRDA 5KFXA 2L48A 4U95A 3RR8A 2JC0A 4KKOA 2P9GA 2RDIA 4PG4A 3PYGA 4O3QA 4IQMA 2RF2A 4NMXA 4B3TJ 2V69A 4X65I 1VBKA 4N5SA 4DSKA 3T5LA 5FD1A 2W1BA 5DG8A 2CFXA 4P10A 2XHWA 5KAKA 3O3LA 1WD6A 4KGKA 2BBEA 2ZHBA 1AUSL 2D3UA 3C66A 3RUBL 4DV2J 3PM9A 3U1YA 2J76E 2RE1A 1WOSA 3HHLB 2AX0A 1WNEA 4IH6A 2B43A 5EWEA 5A2QC 5LL6d 4S0MA 2R8HA 2Y8WA 4IZKA 3CEDA 3IS9A 5E3CA 1REGX 3SCKE 4I1TA 1RT7A 4IDKA 1KTQA 2WZ1A 2XMKA 2Y0SD 4LFCF 3TQ1A 5KG3A 4IFVA 3KXDA 3ADAC 4JV5J 2FLPA 2O1PA 3K0JA 2L3MA 2PMZD 5L9XA 1UVMA 2GQ0A 5C0XE 3FBCA 2ZNZA 1A0OB 4G65A 1ZAVA 4ILLA 3V4IB 3PCOB 2AJ2A 2E5LI 4P72A 4RKUC 2OSQA 3CCVS 3BO2A 4C6AA 3N6NA 3D6FB 4LF6E 2DGTA 4PQUB 2WSFC 3ENAA 2V4QA 5ETVA 2G2OA 5LT5A 1RADB 2JEGA 1RAEB 3GWCA 1IKXB 1KFSA 5DNLA 2GJFA 4IG0B 3VAJA 1U09A 4DR5J 1M90T 1HBNB 2EVZA 1FHTA 1RA7A 4OZ2A 2JC1A 3I5AA 2BA1D 4U3DA 1QM9A 5D0EA 3KHRA 5GMDA 1Y5YA 1LWEA 4DR4F 1Z0CA 2AT1B 1FF2A 4R0EA 3IXQA 3IWXA 5E3PA 3S01A 3RRHA 3QO9B 1RU1A 3H5XA 3FSYA 3CJKA 4QIVA 1JIHA 2R7WA 4WTYA 3OL7A 2B5JA 3B6BA 5JMNA 4DR7E 2D69A 3GPAA 1X4DA 4P2MA 3QRRA 4DV4F 4DL4A 1Z0VA 3UR3C 4Q0BA 3FQLA 2HG4A 1Q81T 1X9WA 2PNLA 2VG7B 2UUBF 3SCLE 5D0GA 1Q7YT 3NGDA 1C0UA 1C2PA 2KXNB 2SXLA 3DC2A 4I0WA 1S59A 1JXEA 2VC0A 1VRUA 3NEKA 4A8WA 2E5HA 4FW9A 2VFTA 4FVCA 5LOQA 4DUYF 4KQZA 3MEGA 4LIWA 3MXHP 4LFBF 1H7SA 1KLMA 4Y34A 1RT4A 2NREA 3TVKA 2ZDOA 5HQLA 1EQMA 2WB4A 3BBCA 4DQQA 4Q2MA 4B3ME 1OYDA 1NXIA 1HFEL 4Z7CA 2MZJA 4UZCA 1YJNS 3H5SA 1HR0J 5L3JA 5AXNA 3ONQA 4CH1A 1PC5A 1UEVA 3BPDA 4GO7X 2RB7A 1HNWE 1FXDA 2NN6E 3JSMB 3ELHA 3BGOP 2JDJA 4JB8B 4OJGA 4Y3CA 2HS4A 2F1DA 1NHHA 2MYFA 3NGRA 5DQHA 2C2EA 1CVJA 5F9NA 3TA2A 3R27A 4B9SA 3PRVA 5KOXA 4OIXA 3IWNC 4AIDA 2LECA 1UW9A 2KO1A 1CSJA 4DN0A 3CJTA 2XS2A 2DNQA 4A48A 2XHCA 1JLCB 1D1UA 2H4WB 2VG6B 4YHHE 2QEXS 4DV5E 3S6EA 1V3SA 3TUPA 2AYMA 2C28A 1X5SA 3P49B 5L9NA 3ENVA 3WC2A 5L1LA 1Q8LA 5A8RA 3RB6A 3G82A 4DX5A 2C3UA 3ILOA 3JTOA 1YJWS 3D0IE 3IRXA 4ZCLA 2RMLA 5DRKA 2VFUA 2PI4A 1KOHA 4ALZA 2RNEA 4KSEB 4O44B 4JI2J 1Z0TA 2EFNA 1X31C 4RW8B 4CLTA 3G9CA 4KJIA 3BSAA 2FQQB 4DZ6A 4X4VA 3G8QA 3N0VA 3OL6A 3PR5B 2DHXA 3JB9k 3KLVA 4YB5A 3Q1QA 5LSRA 3NCQA 3DDNA 4NRUA 3HI9A 1WC3A 3FMWA 3THVA 4X65F 5KG1A 2WB1D 3GG0A 3WC0A 2DH7A 4OLOA 2O3ZA 4NCBA 4OMFG 4X4SA 1RB0A 3B54A 2OMLA 4RO0A 5B08A 5D3GA 1OQ6A 1XMQF 4CLYA 1JX4A 3NL0A 2E9ZA 3M8ZA 2YKPA 3J7YI 3EVMA 1WOPA 4R5PA 2NZCA 2V8PA 4HH0A 3G71S 3LP2B 4DR3F 3C6TA 3SQGB 5EL9A 1UJ6A 1T94A 4J7CA 3CUNA 1NK5A 5HMYA 4LF6I 1IBMJ 1VLOA 1S9EB 4YY3F 1RAHB 4WUDA 1KTVA 3EMTA 1JMTA 4DXLA 4DL5A 2HFOA 1TAUA 2DO4A 3PW4A 1NB2A 4CTAB 2IVYA 3VWSA 1YZ6A 4ES3A 1XNQF 2OPPA 4IOBA 2EI5A 3TQEA 2W01A 5D78A 5JEAB 3UN2A 2E5LF 2DPJA 4DSJA 3EXYA 4GKJF 2QSWA 3GU0A 2UP1A 4NXME 3KK3A 3QMQA 3U27A 2W2PP 3S7RA 4WJBA 2X1AA 1ZM4A 2F8EX 4L72B 3BGRB 1HWLA 3RTVA 4NWBA 1TL1A 2F9JA 4LF7F 1VQOS 2YNFA 3NKYA 3LUYA 4LF5E 3U1MA 1L3VA 1SL0A 2GO8A 4AUKA 4K4SA 3GG1A 4JI0J 4DR7I 1GMWA 5E3RA 3JYTA 2W8LA 3Q8YA 4RW7B 1ZZNA 4CO1A 2RJZA 1N5TA 3DLHA 3TZWA 4GKKJ 3GIJA 2ZC3A 3FSXA 2WW4A 3K7RA 3GV7B 3SI8A 5BXIA 1NMEB 2XWXA 1RT4B 2BJDA 1PC4A 4DV6J 4FYDA 3QRPA 4ZVOB 3MECA 3T1AA 3LPYA 4I69A 2BQ3A 2HZAA 4B3SJ 1B70B 1AROP 1LXJA 1O6XA 4WFYA 1PG5B 3FDSA 5FJ4A 4KFBA 3TX8A 4DUZE 1NU4A 3CF5Q 3V6KA 4KIAA 4WXWA 4DL2A 3ZZOA 3FFIA 2CG9A 4B3MI 4OX9I 2FHJA 4IYQA 1I3OB 2R8KA 2HQ3A 4C0OC 5CCLA 1WHWA 3PVXA 3ZKBA 2F1FA 5F8GA 4JI4J 3CJQA 2WBRA 4U8VA 2AHOB 3EZOA 1HNZF 4LF9J 1HNWI 4Y28C 1SV5B 3CO9A 4IS9A 2GZOA 3DN9A 2KB2A 3P45B 2JEAA 1XTZA 4J9LA 2P6SA 4KHRA 4OYOA 2DXFA 3FMBA 2VU5A 1DARA 2A6OA 4ZIVA 4UUXA 1OSCA 2HLUA 3H4BA 4K4ZA 2NYIA 4DR6F 4MKBA 2JNJA 1P9YA 1S9FA 1PBAA 4HTIA 2IDLA 3CMAS 5F41A 4RNFA 2FVPA 4LRBA 4YHHI 4DV5I 4EBCA 3L7ZA 4ECZA 1K1SA 3FVYA 2J9DA 3NLCA 2RHSB 4LF4E 1KBRA 2GVZA 2D1CA 2OPQA 3Q8QB 1JLGA 1RTDB 3HZGA 4KH1B 4NA3A 3TAQA 4ZVUB 2VL1A 2CJAA 2OFHX 3PO4A 4K5RA 5DDRC 1PJ5A 4MIWA 1QAXA 3KDOA 1TMJA 2RRAA 2FJWA 2ZC4A 3QZ8A 2MKHA 1YRTA 3EICA 5T7LB 3TAMA 2RU9A 2Z56B 3KJFB 3BSNA 4P52A 1UMJA 3O1LA 4ES2A 3AA8A 1B0VA 4KGMA 3MUMP 1PO6A 1FTRA 4BA1A 4HT5A 4K0KF 1EIYB 1U8SA 5KT7A 1SI9A 1RWKB 4OX8A 3KKFA 3C6TB 3BGFA 5IC4B 5E7OB 1F5AA 2HGMA 5LSLA 2J7UA 1NKEA 1S1UA 4HDHA 2V8GA 3J81U 3K58A 1RKJA 2DCUB 4OLPA 1DQ8A 1U1NA 4WF9Q 5ADZA 3CGIA 1NK9A 2HLTA 2X36A 5BYRA 2X3DA 1CULB 4HT7A 1GT8A 3ZZZA 2V2QA 1VFJA 4ZVFA 3OJSA 1SVDA 3ZTRA 2Z2ZA 2KVIA 1C1CB 4HXZA 5JUMA 4PCQA 1FKOA 2N7CA 3KK3B 4FBTA 4GRSA 2BKNA 2V4JB 4DFMA 4RUBA 1IKVB 1R6MA 1O8BA 4EGLA 5KG5A 1J5EE 2YNFB 3QFHA 2NXJA 5C0XF 1U45A 1FD2A 1BWEA 4LSNA 2HWHA 5D0HA 1TL5A 4QR0A 4TU7A 2YX1A 3MFIA 4B3OB 4LFCJ 4NXMI 1T11A 3HT3A 1F5BA 4A8OA 2Q1LA 2GA7A 4QWDA 4PXBA 2XM3A 4OX7A 3DI6A 1B7FA 1VQ9S 1R89A 4DR1E 2JX2A 2VHGA 4UQTA 4M1KA 5HMXA 4LF5I 2FHKA 1G7CB 1TTHB 2V2ZA 3K8WA 1QAIA 1V6HA 3T41A 1HPZA 1FX2A 4NEYA 4NZ6A 3MR7A 1IXKA 2BMBA 3R5CA 5HJYA 2K7JA 1WEYA 5I3PA 4K8RA 4DCJB 2RHQB 4FW4A 2QL9B 1G6BA 3DHXA 4K2JA 3VVUA 1URRA 2CPIA 3SDEB 3GMGA 4DS4A 3TW0A 2QMXA 2Z5CB 3BR9A 2BJ1A 3R5AA 4ISAA 4LPFA 4KAIA 4Q44A 2Y1JA 4DG1A 2FVSA 5KFDA 2XTJP 4N8OA 1FVSA 5B0BA 3SQOP 4DR7F 1U2RA 2W2QP 2A10A 2C1EB 3MTKA 4K2XA 2MDAA 4DUZI 1KP6A 1F3FA 3OUYB 1KIJA 3BQ2A 4WXOA 4GQUA 1BQMA 4PWDA 1IBKE 1N36I 3CC7S 2ZVIA 2PA8D 1OWXA 4WPAA 1HQUA 2VZ9A 2XCAA 3GZ7A 2HURA 4LSLA 3M2UB 5F8JA 1WELA 3M8QB 1H98A 2XO7A 1Y7PA 1U6ZA 4DL6A 1CLFA 4LFAE 1MWQA 3CDBA 5K14A 2WVEA 2YKMA 4TXSA 4DV4J 1S6PA 2CRLA 2XYPB 2OGUA 3K5MA 1VBYA 4MAKA 3C2PA 2EKNA 3R2CJ 1IWAA 3KHGA 3GSDA 1TL7B 1RABB 3HKMA 3AJ2A 4ZLNA 3H25A 1Q0NA 3Q22A 3DRSA 5HQMA 3BB5A 3Q2SC 4DUYJ 1BQXA 3NCRA 4Y2AA 4LF4I 3KJVA 1XNRE 2NN6F 4A4JA 1KKHA 4FF2A 1WI6A 4LFBJ 1TKTA 2JRSA 1QVFR 4DR2I 3T3FA 1ZTWA 5LMNE 4YFUA 2B56A 2MGZA 3IC1A 2HFUA 1CJTB 1U2CA 3K85A 3H0PA 1X5PA 2DGOA 1ZETA 5AXLA 4F02A 4FW7A 4F67A 4YB7A 3VZHA 3SCJE 1H6KX 1TUGB 2HZCA 1D6TA 5LMUF 3TVYA 1QTMA 2GAGC 4FPIA 4YHHF 9RUBA 4ENOA 3NWRA 1FNXH 4NXNF 4UOGA 4P7TA 3PS3A 3OL9A 1HW9A 4IOAQ 3CJ2A 1UWAA 4WBFA 3M30A 2M7SA 4NPOA 5E2QA 3DM2B 2KM8B 3IA0A 1HHQA 3UN5A 3MEKA 1PBUA 3QFWA 1NSQA 2K3IA 3MZIA 4IFYB 1FE0A 3KLHB 1TR0A 3KLFB 4LBIA 4XDCA 5D77A 2KT2A 1GFWB 4NYOA 1CS4A 4ILRA 5KFSA 2IOPA 3W61A 2LDYA 2ZKTA 4PKDB 3SSSA 1IM6A 1RQ0A 2CWXA 4X66F 1F2GA 4OI0A 3VGSA 3DXSX 2BA9A 1ZH5A 1E3HA 1BMQB 4QU7A 2DPIA 3CDAA 2XEXA 1NJIT 3JSYA 3HHNB 4Q7AA 2DB1A 1J5EI 1WWHA 3L7UA 1BXNA 2ZD1B 4FXDA 5BR8F 3I0SB 3I4HX 3NGTA 5CYMB 2U1AA 4DV1F 3F73A 2HEKA 1LWXA 3W9HA 3D0GE 5EN1A 1V3ZA 4CYUA 1XMQJ 3MEDB 2G2ZA 3TA1A 1KN6A 3I4PA 4DR1I 3T5JA 4ED4A 5L1KA 3GFXA 2HVZA 1ZBTA 1S57A 1PVGA 4DR3J 4IR1A 2A6MA 2Y0BB 1X4EA 5F8HA 1UPMB 5KFVA 2M52A 1FWPA 4JI3E 1M1GA 3FBEA 3OTCA 4PXCA 3M32A 4H4OB 1EI1A 3CCRS 2BYCA 1XK8A 2FZGB 1D9FA 3Q6NA 2LFVA 4YY3J 2B9YA 3VGTA 3PS1A 2C42A 2HIYA 2V8DA 5ETMA 1VHIA 4ZVQB 2X51A 2G2YA 4C98A 1EHWA 4DV7E 3AY0A 3CXCR 4LF2A 2ZFHA 4LF5F 1XNQJ 1D9DA 1TKZB 2AYEA 2ASDA 1G3OA 1C1BA 1WHVA 1FD8A 3M1VA 1XMOE 2BE9B 4DLGA 2OD6A 4G1PA 4ELTA 4GKJJ 3LWLA 1Y3KA 2Y9HA 4C8NA 4MKAA 1N54B 5IM0A 2MQQA 2ZH6A 2LXUA 2VBXA 4RW6B 3PYDA 1IBKI 2CPFA 5MLCV 4LF7J 4LQ9A 1S4EA 2AGOA 1UA1A 4V19X 3K2YA 4JI5J 3QRQA 5KFNA 3BH7B 1QE1B 2R9LA 1FJGJ 4BA2A 2BEFA 4LFAI 5F3TA 1FDNA 4FF3A 2YKNA 2XSJB 2R7UA 3L9ZA 1TKTB 3EGNA 1DBDA 3FBBA 5D4PA 5A6WA 4HEA9 3J7ZT 4DV3F 2C2RA 3PW2A 2MGZB 3CD6S 4D3GA 2KKHA 5K8NA 3B82A 2GO3A 3H1CA 5HLFA 1BD6A 1CJKA 4CO5A 2NUHA 2G9OA 1S7IA 2FLOA 1FWLA 4C3MA 4U67Q 3IG1B 1XNRI 4DPUA 4ZPVR 1WTFA 2R4FA 4DHVA 4OZ0A 5LMNI 1B99A 4ZVGA 1KR4A 2KYZA 1ZM3A 1SB6A 1WC5A 5I4MA 4HYKA 2VBWA 3DRYA 4B9MA 1S7HA 3J81Y 4WK1A 2R7XA 1N32E 3J81Q 1Z2ZA 4F3OA 3ZM7A 3DYAA 4RW4B 4QPTA 2J0WA 2PGCA 4DL7A 2H5EA 4M8LA 1RT1B 1Z5CA 1B3TA 1UVNA 1S6QA 1GNKA 1MG7A 2DTJA 4ZP7A 4QIWD 4DR6J 2HHXA 1CS4B 2AJFE 2IIHA 2NXNA 1IN0A 5SUHA 4MYTA 1DRZA 9ATCB 4J90A 1NHJA 2GS8A 1PYSB 3IWLA 2NQPA 3GJSB 2WRMA 2FDNA 1U02A 4F4WA 2KT5A 2WVCA 3EJMA 2WP8B 1K1QA 3K5LA 4QPXA 2DNRA 1WDTA 3J80Y 3A3PB 4OO1E 4P75A 1L3UA 3OXGA 1IKWB 1V3RA 3OT9A 1TV6A 2BR2A 2P2CB 1U1OA 3MTJA 1FKAE 4JI8J 5THWA 2HWTA 4O4RA 3VQSA 4M63A 4DN9A 2VQEF 3A8IA 4Y2MA 3OFGA 1P42A 1NKBA 3G2XA 3I96A 3PX0A 3CMES 3GYGA 3GQCA 3W64A 1IKYA 2RDJA 3CCES 3M6AA 5I3UB 3FBFA 2EEYA 4ZCIA 2MXYA 1R27B 3OQ2A 4K0KJ 4QJVA 3RAQA 5F8NA 4FZVA 2HHTA 3CDJA 1KS2A 2MPUA 3V81A 3RB3A 2AE8A 5DRRA 2ZNYA 5D15A 2DISA 1ZPWX 2RAQA 2CG4A 1UVKA 2D3ZA 4EK2A 1NCLA 5HO4A 2R42A 2WNRB 3IFEA 1RT5B 1T8EA 4ZCMA 3HKWA 4KHPE 2PMHA 1FEEA 1AXQA 3Q83A 3BS9A 4E8UA 2JLGA 3J7Z5 2K3KA 3I55S 3BN4A 3ICLA 1VBZA 2KL8A 1LWCA 1NEEA 3RGIA 1Q95G 5DETA 1TL3A 1FDDA 4YB6A 4JI3I 3D67A 1U7LA 4JI7E 2RKIA 4ECWA 4EZ6A 2C3MA 4URSA 2BR0A 2FJEB 1T05A 4U9RA 4MKVA 1LWFB 2CAJA 2LA6A 2QA4S 1UTAA 4JI1E 1UEKA 2RT3A 4DV7I 2C3PA 1RLDA 3VAKA 3OW2R 4DFPA 1S0OA 1WG5A 4EO6A 3U1KA 4KO0B 3PS2A 1BWVA 2M3DA 4ZN3A 4DSLA 4RUAA 2E1AA 3BGLA 5G0RB 5LM7E 4J9SA 1ROFA 1XMOI 3G6VA 3T1HJ 4YMEA 4JP8A 3VGVA 2HNDB 4Y65A 5C0XB 1UP1A 2Z4PA 4IO1A 2AQ4A 4ANDA 5A6PA 1JKHA 1IBLE 3JAMY 5AE2A 1OYRA 5SZTA 3LP0B 1NUEA 2G4BA 2HKEA 4BWMA 4EU0A 4ED8A 6FD1A 2CNNB 2DNYA 2GGPB 3AT1B 4KV8B 2A2CA 3BKFA 3TZYA 2V94A 2IOQA 2KJVA 2DHAA 1VBXA 3A8JA 3H98A 2FC8A 2IAJA 2AZ3A 1J2VA 1RHQB 2G1DA 5J1EB 4U7UD 2IERA 2BANA 2RQ4A 4YP3A 1UVIA 1X4GA 3O6QA 4HYMA 4P74A 1HNVA 2HHVA 3A3NB 2FC9A 2HBZB 3P3DA 1CQMA 1WHXA 2MQLA 2PNMA 4IFDF 2BRKA 4L3KA 3F41A 1UAWA 2UVWA 1RTJA 2I6WA 1ZTTA 1PKPA 3HT0A 4OYZA 3VR1A 3G87A 3O44A 5E5NA 3R7SB 2B8QA 3J81C 4ZN1A 4CLLA 1FK9B 2NSCA 3DLEB 1SJRA 3UQSA 2WHOA 1AZSA 2ZH8A 3GCMA 1WORA 5JVGQ 3DOMA 1NDLA 1UW4A 4LUBA 3BBFA 3P5BP 4K4YA 1N32I 2DKOB 2IY5B 3DOLA 3M8SA 3PKYA 3OHBA 2QMWA 4FW5A 4HI1A 3SV3A 2Z2YB 1S77D 3UW1A 5CD4A 2ZWPA 1YSJA 1XNRF 3GIRA 3MAAB 2O5DA 4C8KA 4OZJA 1ZM9A 3D3CJ 3D54A 2VBYA 1WC1A 2UXBI 2COLA 1WI8A 1W2IA 2CYYA 4MJKA 2ZZTA 2HIQA 4AT1B 7AT1B 1SC1B 3J80C 1XR5A 4F0KA 5AXKA 2CJKA 4ZIWA 3MF5A 2YNIB 2ZM6J 2IC3B 1NK0A 1HBMA 1FRIA 1YBAA 4JI6F 4OI3A 1MN9A 3EGZA 5DNXA 5FDLA 3K5PA 3DLKA 5KG6A 4CLZA 3EZUA 1RA6A 1UDNA 4C7QA 1N5VA 1M5OC 2H51B 3OLAA 3KHHA 1WOOA 1WJ9A 2NN6B 2MQMA 3R1HA 3F44A 2GAHC 4I2PA 1NZ0A 2VQFE 2DNGA 1ULRA 5LMUJ 2Y1RI 1Q4RA 4IG3B 1YZ7A 1F1BB 2OELA 2PSZA 2X1BA 5HMZA 3TZXA 2MLYA 3GV5B 1SQEA 4X64E 4NXNJ 3PO5A 3A8KA 3GFHA 2W7OA 1U24A 3NG8A 1RACB 2I5JA 2AGQA 2AEJA 4C0HA 4C11A 1UCNA 4RW9A 1X9MA 5LL6R 4QYZJ 2EK6A 1N33F 4WKYA 5KFFA 2HQGA 4F50A 4ELVA 4G3IA 2WBMA 4L74A 2OP5A 3FCVA 4KHPI 2L9WA 4DEZA 1S12A 2EG1A 2N3OA 4DV0F 1C0TA 2H48B 4LF8F 4YB1P 4C8MA 4IZJD 4NLXA 4LBHA 4WE1B 1FDBA 4JYAE 1PSDA 3FJ2A 1SC6A 4ZVTB 2U2FA 4R0JA 4JI7I 3VCDA 1M5HA 1FVQA 5BJRA 1MROA 4X66J 4MU1A 5CH7B 1HARA 3H40A 1R6VA 2GJIA 5CYQB 3K89A 1AFJA 5BYQA 4K4VA 3L3CA 1HBUA 4DBQA 2J65A 4X4RA 4E98A 4JI1I 2PI5A 2ROPA 4WFXA 2E1RA 2XS7A 5DROA 1LQ9A 2OLWA 2ZWOA 5BR8J 1NDPA 4GC6A 4F2SA 5JEAC 2MJUA 2AD9A 3KLGA 1A7GE 2OKQA 2ERRA 3M8YA 4NCGA 4DV1J 2WVBA 3JAMC 5J2MB 5KFUA 1VQSA 2YXLA 3DNCA 3ET6A 2W25A 4I2QB 2IAJB 3I5BA 1IBLI 1OJ4A 3DMJB 3KLEA 4BBYA 2JEFA 3GYNA 4RR5A 5AXMA 5KFMA 2HPUA 5HI7A 2OTJS 4XTTA 1N52B 1URNA 4GVBB 3H90A 2K8GA 3MPUB 1XMOF 3HPOA 3BDEA 3I9V9 1RTJB 2FJDB 1UWBB 1FNOA 2CJ9A 5CD4H 2UXCE 3KK1B 1XMBA 4X4OA 2HWIA 4C48A 2DVIA 3GJQB 2K1RA 2FJXA 2X1GA 2VB6A 3W8PA 1HD1A 4NBQA 2VJUA 4NA2A 2R8IA 4ZPDA 3X1LB 1U26A 2ZH3A 1VHFA 3ILIA 3ZO7A 2OFGX 4ED3A 1OY9A 2AF6A 1YJ9S 1RT3A 1FRMA 1S1WA 1QUVA 4ZJOA 2F4VE 3HSZA 3WU4A 4WK3A 3EZ5A 3D9BA 4N41A 4QCLA 1RKIA 3TWZA 3A1YG 4CO4A 2CPJA 1FX4A 2XI3A 3Q24A 1DURA 3WIUA 1X4BA 2B4OA 2CDRB 2Z8QA 4RNHA 3RJMB 2HK3A 1VQ4S 1Q8KA 1FRKA 1FKPA 3DLKB 4URQU 1MU2A 3K5NA 4DV3J 3J7YU 1Y6ZA 3OBIA 2OJ3A 7FDRA 1S6UA 1VJWA 3ZNUA 4F4XA 4CQ1A 1X0PA 2G0JA 3BYPA 5DO2A 4LVNP 2JEJA 1B62A 4X62E 3FSIA 3CD5A 3D6HB 4FYYB 2VG5A 3KUHA 2PO0A 3M8WA 3QIDA 2UXDE 4O0NA 3C46A 2Z5EA 2HBRB 2GO4A 3B8HA 1EETA 1OMSA 2FHOB 1U1RA 3SSRA 1FXRA 3V6DA 4ZLPA 3LQVA 4RUCA 2ZJPQ 3CWJA 3H4LA 1T03A 2YH1A 1HMVB 1RWXB 4ZPWR 5F3ZA 2VQFI 1F0XA 4WP8A 1R8HA 2CNLB 4C8LA 2RS2A 1VS3A 1UZHA 4X64I 4EZ9A 3IBCB 1N5YB 3SFUA 1R6LA 4IFDA 2W9AA 4OO1F 1C0TB 1T9UA 2BOAA 4I64A 1HNXE 1RR9A 4YR3A 2VPYB 1QSSA 1SUQA 2R2TA 4DSFA 1JLAB 2HQCA 3Q8VA 2NR0A 3QZ7A 1J5OB 1RBOB 1SC4B 4OHVA 2ZBCA 1WTBA 1S0NA 1RT6A 1JLQA 3HJVA 1H72C 2ILYA 1GX5A 4JYAI 2F3JA 4B9LA 2BJ7A 2E5JA 1ACMB 1B63A 4EBDA 1FJ7A 3CCLS 2BE2A 3KLGB 3HLUA 2OPRA 4Y2CA 2VQEJ 3UHMA 4WFAQ 1NKCA 1B7YB 3ET6B 1ZZFA 3TX0A 4FWDA 3POTA 1WKLA 2HAIA 4ATNA 4FN5A 4N8NA 1TKXA 4NLSA 3RW7A 3QAUA 4B3TE 1R7IA 1EZZB 3KYLA 3FEYB 5I42A 4JI7F 1X60A 2CUYA 2QGFB 4B02A 1QD1A 3EE3A 2CPXA 2Z2LA 1VCTA 2BACA 1P1LA 2HFSA 1F9HA 4DV2E 1F2HA 1OY6A 3HVTA 1VC5A 3NWGA 3MMCA 2LEAA 5HROA 1SH0A 1R0AA 1S0VA 4KGZB 1XJWB 2W2NP 4XPEA 4RBVA 2K1RB 4RNMA 4WIQA 5K36E 1Q5YA 1WUUA 2CDQA 4LF1A 2KRRA 2E1CA 4CWBA 1NSPA 4CLPA 5IT0A 1YITS 3MD1A 1IBLF 2YNHA 5RUBA 3GJTB 1NZ8A 2DNPA 4FF4A 2Q6BA 1BE4A 1YI2S 4L6V3 1S1TA 4HHJA 1QTNB 3D4JA 4NLOA 2CJYB 3M2RA 4UTGA 1ZPVA 1BKNA 4C97A 4ZJLA 2M70A 1Q7LB 2UUAF 4KTQA 5C24B 2PO1A 3UDCA 4USIA 1KQGB 1D9AA 2FY8A 2ZE2A 5FIIA 2F4VI 3PDNA 3PX4A 3NNHA 2QYGA 3H8YA 2BXJA 4PUOB 1OPIA 1QJHA 3DRRA 4GC7A 4DR5E 2XCPA 3D1HA 2YWEA 3QLHA 4WP9A 3UCUP 3MOJB 3MGJA 4F4KA 2YH0A 1RTIB 1HKAA 4O3OA 2FHMA 1WEZA 4DX6A 2EPIA 1U1MA 5C2CA 5F8IA 1UJ5A 2ZZMA 2KTQA 4IH7A 3HHLA 1RXOB 1EP4A 3BN7A 4XPCA 4RNNA 1X0FA 5D4OA 3UWTA 4ITSA 3TO8A 4J9MA 2XC9A 2J5AA 4WWSA 2BA0D 3IO1A 2ZHOA 3EPIA 2C37B 5IWAF 4X62I 3LTOA 2EFPA 2WONA 3OR1B 5D6GA 1RWPB 2UXDI 4ICLB 4A8XA 2BUNA 4USMA 3DDKA 1O0PA 3LGMA 3VQTA 5HJXA 1I51B 3CO0P 4UW2A 3DD6A 2Q3PA 3CT9A 3KG4A 2JOQA 3V4IA 2JFKA 3BYRA 3F56A 3R7BB 2R8JA 5FLXU 3ZFVA 5HMWA 2HVEA 3CDUA 2ACMA 3TP2A 3B4TA 1P8GA 4WFNQ 2KN4A 2DGSA 3UD4P 3AOBA 2EWHA 4PQUA 3LP1B 3W62A 3CCTA 2E29A 1XBWA 3GYXB 1HNXI 1N5SA 5E41A 5K9FA 3ZZ0A 2KM8C 1R31A 1NSKL 4Q45A 2GFFA 1ZYQA 2C39B 1HR0E 3Q8PB 1HBNA 3RRGA 2OEMA 4EO8A 8RUCA 4X64F 4JI6J 3OL8A 4C3KA 2QJ3A 1KEKA 2AEMA 1TMMA 5I3QA 3M7NG 1Z0EA 3CC4S 3QO9A 1P9QC 3PYFA 1V5VA 3EDRB 2F8HA 3QNWB 2FZCB 1IR0A 3X3UA 4OHZA 3VAFA 2OPSA 1PJ7A 2DNHA 4ANEA 5LJ3Y 5KFWA 5F8LA 2Q79A 1RWOB 1QUPA 3LF0A 3QWUA 3W3SA 3DOKA 3LALA 2CJQA 4B3TI 3ZC4A 4JYAF 4A8QA 2CNKB 3BZQA 4AQYF 1SJFA 3BF4A 1CQNA 1N33J 3TUJC 2VG7A 3EDQB 2MKSA 4JI2E 2POKA 2W8KA 1REVB 1AT1B 4DPOA 1AW0A 4ED5A 4DV2I 1H7XA 2BX6A 3PV8A 1SJQA 4DV0J 4LF8J 4P2FA 4B9UA 1NRKA 4U7CA 5F8MA 3ITHB 4DSEA 2J9EA 2DEIA 3MM9B 2KHDA 4LQ3A 2YNHB 2VH7A 3T1YJ 4URGA 4M5DB 3DDIA 3CVKA 2V2KA 4G1IA 4PG6A 3WHIA 3KWMA 2H5JB 3TR5A 4HACB 4MU3A 2VKRA 4RJVA 4AXJA 2FGOA 3M2RB 1IR2A 4H4KA 2MKJA 5HL7Q 1N0UA 3ILLA 4JV5I 5KFKA 2RRNA 5DS7A 3JSMA 1AYEA 2KHCA 3U1LA 2Y3YA 4HHHA 1MWZA 2RILA 1IJEB 1K0VA 5HBMB 2ZE2B 3VZIA 2MTLA 4CT8A 2HHSA 2D3OR 2AJ1A 3JQMA 4RU9A 8ATCB 3DRRB 4CCHA 1U1QA 1DTQA 1FESA 2AMCB 3QLHB 1I94F 3RAMA 1SL2A 1JLCA 3FNNA 4LRDA 1U2FA 2VG6A 1R43A 1IBME 1JNRB 3IR5B 2UU9F 2UXCF 2LCWA 3VAGA 5DM7Q 1VIXA 4ZJQA 3CIZA 1EP4B 3AJ1A 2D7SA 3W7BA 3E3XA 1B4SA 2YWFA 4R1FA 3NNAA 2YWKA 5IT9U 4DR5I 3SV4A 3Q86A 5JEAD 3I87A 3BR8A 4O44A 4URLA 3D2WA 4FS2A 1RYRA 1TAQA 4RW8A 3QWPA 3BQ0A 4I6YA 3EGWB 4QIGA 1S6OA 1XXEA 3OR2B 3DRPA 2WONB 2Y1LB 1SC3B 3FUYA 1KQFB 2ASYA 3FZ2A 2DHHA 2HGLA 3KLIA 1Y9OA 1JLBB 4M5HA 4OJ3A 1WHYA 1WC4A 2FIUA 2AJ4A 3KTQA 2IMWP 1HQEA 4JI0E 1UETA 3ISNC 1HHTP 3UE2A 4CIOA 3LANA 3FZBA 5KFTA 4CNZA 1N4LA 2YVSA 1FERA 2W9BB 4GKKE 1DTTA 3G86A 2HHWA 4HI2A 1RTHA 4B3RF 2HNZB 5J2QB 4DV6E 3LP2A 2DEJA 2J0SD 3SQGA 2ZBPA 3NOCA 1NNDA 5EWGA 5A2QU 4DQSA 1QLNA 5D4NA 3PACA 3UNGC 4LRFA 1S9EA 3ZKDA 1WC0A 2C38B 3QBCA 3GFYA 3UD3P 2ZEJA 3B4DA 2ASJA 1N6QA 4M94A 1G1XA 5CHCB 4CTAA 3DLGB 1CC8A 1HR0I 4JI4E 5JEAA 1Z59A 2MEWA 3BKUA 4H4MB 2E1MC 2HVHA 4TLRA 3Q0AA 1U1LA 4LF9E 2VF3A 2QRRA 3G8TA 1QY7A 4GMKA 4HVZA 2OPSB 2IYGA 1FTCA 3J7AN 2LQJA 3BGRA 5KFLA 3DOKB 5KT3A 2CVEA 2HHHJ 1HNXF 5ETNA 2A3JA 2O1TA 1HWIA 1TELA 3AHPA 1UFKA 4TN2A 3CSKA 2GMJA 1DFDA 4RW7A 1Q5VA 3AB4B 2OSRA 4KY3A 2QIFA 4JV0A 4PAAA 4B9TA 2F9DA 2P6TA 2QLXA 1VMBA 4M5JA 4IQXA 3DFEA 1HK7A 2DYAA 1S10A 4C9DA 4O3PA 5KG2A 1N34F 1S79A 1DZ5A 2QT7A 4JI2I 4OX9E 4OO1B 2PNZB 1FRHA 3H20A 1YQHA 3MPWA 3QQCD 1SJ4P 4PXDA 3P06A 3MMJA 2VD3A 1HBOB 2IPOB 2XGQA 2YNGB 1NPRA 4NCAA 1A6FA 4C8YA 5CABA 2KYXA 4KGVB 4I67A 3KJNB 3NY0A 1IVZA 2PO2A 1HLWA 3J7A1 2YWHA 1SKUB 3R2DJ 3JSBA 3BV8A 1OSDA 1X8DA 1EX8A 2C3YA 1M1KT 4CRJA 3OLBA 3W65A 1DTQB 2JE6A 2BA1G 4ZP8A 1VK3A 1SV5A 2CQCA 1RCOB 4NLUA 2BJ8A 4XIUA 4WTOB 3LNUA 4FKXA 3R8YA 2QSFA 3W9IA 5K36F 3I0RB 3QT5A 3T6JA 4JV2A 2LXIA 1JWWA 4RLEA 5C0XC 1IBMI 1H2UX 2APOA 5ETOA 3B4MA 1MW7A 1FI4A 5LSOA 1YH8A 3DRPB 2DD8S 5KFAA 4DLEA 3ILJA 2JFDA 1VOMA 1RTDA 2PO4A 1X4CA 4U96A 5CCMA 3KLIB 4P9SA 5EHHA 1Z0GA 4OYWA 1HQEB 2L41A 2B4PA 2V8HA 3MCNA 2DK2A 1GMWD 4ANCA 5C7PA 5GAHI 4IOCQ 4LFCE 4CH0S 1O51A 2UUCJ 3W2VB 1RJJA 5T7LA 4KB7A 4PR6A 2ABYA 1XR6A 2MKIA 4DDFA 2BJEA 4FXWA 4NLYA 1RSCA 2KG1A 3IM9A 3QT8A 1GQEA 1DTTB 3RB0A 3TI0A 2HYIB 1ZA1B 1RTHB 2Z58B 4J9VA 2IRUA 3GIKA 3GR0A 3W5ZA 1S72S 3IN5A 5FLXY 4JI0I 4DR5F 5FLXQ 3VTIA 2MZRA 3U7JA 2VPXB 2HS0A 4ZVSB 1IJFB 4WYWA 3SEOA 2UUAJ 2W7PA 3D1OA 1LW2B 4GKKI 4DF8A 4FF1A 3DGVA 2UVUA 4G6VB 3QGGA 1T9YA 1ZA2B 1N6QB 4DV6I 2FHJD 3CCUS 3N5FA 1CULA 2YKOA 3W2WB 2CQ1A 4B3SI 2JZ5A 5ETSA 3PY8A 2B6AB 1WF0A 3LPEA 4RBTA 1KSPA 3R6LB 1C1CA 3PX6A 2GQQA 3LW5C 2FYXA 3HD1A 4B9VA 2J0QD 2EW9A 5T41A 5DZ7A 1GEHA 3H2VE 2LA4A 2AGPA 2CZVC 2M0GB 2V4JA 1HI8A 2DCLA 1IKVA 4OYIA 3MPDA 3PRBA 4QYRA 5EUHA 2O1VA 2V6AA 1PGZA 3P3EA 3J81j 2J9DE 2DIUA 1GTEA 2RS8A 3MCSA 3PHEA 4JI4I 1JLFB 2IFXA 2G0IA 4LF9I 4OI1A 1Y0HA 4E2FB 3MEEB 3RU0A 4B3OA 4JV1A 2UVVA 3F0NA 2N82B 2DGWA 3THTA 5IWAJ 4WKRA 4DV4E 4PRFA 1Y3JA 3MAHA 1I1GA 2UV8G 1W25A 4JUZA 2ALYB 2K7KA 3FGVA 3ISZA 3C3LA 4I6WA 2NN6C 2HRYA 2IHR1 5B0DA 5DM6Q 4PXEA 2O3DA 2XULA 3KNAA 1Y10A 3OSPA 2DY1A 2VFVA 3CW2C 4F0MA 3UNYA 1PAEX 3BO3A 5GVQA 4DUYE 5HN0A 4ID8A 5GADI 3IRWP 1OPZA 1LK5A 4LFBE 3EVWA 4QWAA 1FRJA 3I82A 2KT3A 5KT5A 2RH3A 2PO2B 4C4WA 1R8AA 2FJBB 1VQ5S 3SDEA 4MK9A 1NH8A 3EX7B 1SCJB 1LXNA 3DU6A 5K8MA 2XO6A 1N36E 2Z5CA 3N01A 5D4LA 3TA0A 4M5KA 2GIFA 1UPPA 3MDFA 5IT4A 3D1QA 3DHWC 4F4AA 2NXEA 2KFYA 2JE6B 4MDTA 1SL1A 1E6YB 5J2PB 4MFBB 3OUYA 2VDHA 1S99A 2D41A 3AODA 3LGNA 2ATLA 4NASA 4WYLA 3IP0A 1YHCA 4TY8B 2MY7A 4PYDA 1MN7A 3EM1A 4JI2F 3M2UA 2BZ2A 3DLBA 3M8QA 3O2IA 3GCWP 4IO9Q 1HL6A 4NE9C 3MMBB 5KFEA 2DHSA 3CD7A 1S0MA 2YPZA 4IZJB 1VR6A 4Q43A 5IT9Y 3M8PB 4NOHA 4AQYJ 2CJXB 5IT9Q 3HP6A 4ZVIA 2EXUA 4DR2E 3HCXA 3THPA 1TL7A 4PWWA 4ZPTR 4I7FB 4AXIA 1VQ6S 3SYZA 1Y5IB 1HNIB 2V4RA 1VLYA 1JJ4A 1HYSB 2MHNA 2QL5B 2KRBA 2OTLS 2PDAA 4KR0B 3OTOJ 5AJ3F 1S16A 1X4HA 1S5ZA 1CJTA 2RRBA 5T14A 3M8RA 3W9JA 3J7AG 1Q79A 2JEIA 2FD2A 2XLJA 3R9LA 2RIJA 4LFCI 2IBKA 2C2OB 2EC0A 3QAEA 1IBMF 3C6UB 2NLWA 1S1XB 2FY1A 1XMQE 1MMDA 2OEJA 5FLXC 3I9ZA 3HVAA 3GLJA 3GSIA 2M8HA 2CQ4A 1OQ3A 4OYPA 3AQPA 4DR3E 3HHDA 4BC9A 2B4VA 4QWEA 4PRXA 3EPGA 1Y5NB 1EAYC 3DM2A 1HD0A 1I94J 5L38A 2ZDPA 3ZTSA 4YY3E 2B0GA 2M4MA 2UU9J 3CJ5A 2UXCJ 3O5TB 1T9XA 4IFYA 3KLHA 3KLFA 2JT2A 1VDHA 4QWCA 3E01A 5AT1B 2LEBA 4UOFA 3LH2S 3R1LA 3VGUA 2CADA 1XNQE 4R8UA 2EBGA 3D68A 1BLUA 5KFPA 4PABA 3C15B 2C2ZB 2F65A 2Z30B 4TNOA 2C22A 3BSOA 4PYAA 1M1HA 3HD2A 3CDEA 2DR7A 2I1RA 4LF6F 1DQ9A 2D9PA 1U8WA 3OFEA 2WVDA 1FRLA 1UA0A 2C2NA 1NHUA 1SH3A 5DGBA 2ZD1A 1RAOA 1JQGA 4TYBA 4JI5E 1ZXMA 3I0SA 1RTZA 1FJGE 2WSCC 5CYMA 4OZ3A 4NLWA 5EX3A 4DV4I 2W4DA 2YWWA 3N6LA 4PPZA 2CQGA 2ZZNA 3MEDA 3NMAA 1PYTA 4B3RJ 2OO4A 5FWKA 2QO3A 1T3NA 4PG7A 1X4FA 1K44A 3TAPA 2XBPA 2HMIB 2Q6CA 3ZTQA 5HQ8A 4CLKA 2W24A 2I9SA 1NK8A 5B0EA 4H4OA 1CEZA 3ISND 3L7OA 4ZVEA 4A8MP 4DUYI 3N9UC 4HKQA 2H4YB 1FJCA 4ZHRB 1T02A 2AWZA 4LFBI 1LNQA 4DR4J 4UQGA 1QDUB 2ZOFA 5E3AA 1SKRA 4QW9A 1TKZA 5KFZA 1FXLA 1FFGB 2QTWA 5CXTA 5DRPA 1RI7A 2O66A 3OSNA 1H74A 4OV1A 2LYVA 1CJUB 5D0RA 2MB0B 2OMOA 1ICEB 4OZ5A 1MLAA 4RW6A 4DR6E 2OUGA 3EUNA 4TY9A 3WU3A 4NLTA 4RWXA 2X7IA 2CNOB 3AA9A 3GILA 4X4PA 1OYPA 1LEOA 2RQKA 4B3MF 3CCZA 4OX9F 2UUBJ 5MAOA 2GIQA 4FPRA 3WU6A 1DY3A 1XERA 1QE1A 5J2NB 4DMZA 2E66A 3VHQA 5IT9C 1M5KC 4NI2A 2XSJA 1HNWF 1WF1A 4OHXA 4WU2A 3CCWA 4WFBQ 1VQ8S 2JL9A 2AIRB 1CPZA 2BM0A 2VDIA 1N34J 1CBKA 1U25A 3I6PA 3QIPB 4N76A 2DR9A 1SIZA 4JI8E 1JJHA 3K8VA 2OAUA 4NMLA 4USWA 4W90B 2GV1A 4L3NA 2P8IA 1WG4A 2IDEA 3ZTOA 3DLLQ 4DV5F 4XAKA 1LKZA 3IG1A 3L4BC 5GAEI 2YX7A 3A8EA 2XMWA 3K59A 4OYAA 4K0KE 5B0FA 1L3KA 2ROEA 3EVOA 1Q16B 3FEXB 3RR7A 4MU0A 3GLLA 1R0CB 1YKWA 3CCQS 2GX8A 2O1UA 4OHWA 4RW4A 3UN3A 1XMQI 3OXLA 3S8SA 4AYBD 1RT1A 5H1SV 3E01B 4DR3I 3V4MA 1WSRA 3P6YC 4OZNA 4R8UB 1U1KA 1NAQA 1UVJA 2RU3A 1FJEB 5JXSA 1FFWB 1RISA 2M9KA 4YY3I 4DQPA 2WP8A 3IAM9 1T3OA 3C14B 2R7QA 1TZ0A 5K36B 5DGAA 4OL8A 4X4UA 4Y6IA 1IKWA 5GMEA 2Q2EB 4F7VA 1XNQI 1TVRB 4DPYA 4KGXB 3KK2B 1P27B 1RBLA 7FD1A 1TK8A 3WZ0A 2XNQA 4X65J 5ETQA 2J6TA 4QBUA 4GKJI 1BQNB 3BPSP 1PIEA 5HK4A 5JJBA 3T1HE 3TANA 2E7VA 2P9EA 1RK8A 1PYOB 3ZZUA 5C0XD 2YX4A 4IH5A 1L3SA 2NZ4A 4JBCA 1LK7A 4LF7I 2ZH9A 4DI6A 5I3UA 1Y4SA 3I56S 3DGPB 3CD0A 2GHWA 2J6UA 4USTA 4JI5I 1Y60A 1KDNA 1N48A 1W2BR 4F8RA 4O3RA 1FJGI 3H7HB 1USVA 5C25B 4CM0A 3CJ0A 2WNRA 2PN6A 2DXEA 1RT5A 2KU7A 3VF0B 4OJHA 1X5TA 4KPYA 4IFDC 4NXMF 1RREA 2MQOA 1U4BA 5L39A 1OIAA 5ELWA 1E6VA 1DLOA 3BO4A 3KOAA 1VQNS 1N0VC 2A18A 2XGPA 4HY1A 1HWUA 2MZ1A 2CZ9A 2CIMA 2W9CB 3HFVA 3DXBA 1BHNA 2ZOGA 3MM5B 5GAGI 2PEHA 1F60B 5H9EJ 2E5LJ 4DPXA 3CJ3A 2ASLA 1LWFA 1Q53A 2Q43A 3D5MA 4OZ1A 4I4BA 3HO1A 1YRUA 3ZNJ1 2DNNA 2AYGA 3HFKA 4KO0A 5DDPC 3E51A 2AU0A 5G0RA 1T95A 1M5VC 1AFIA 1HNZI 1WSVA 4RU2A 2F7VA 2WTFA 2GMLA 1UDSA 1EQ0A 1VQMS 1UDQA 2HNDA 5C0XA 2R3VA 1H7WA 4NI2B 1EA6A 4QR2A 2KH9A 2BRLA 3NAIA 4DR6I 4DUZF 1KVKA 3LP0A 1N36F 1S1VA 2MKKA 5DRQA 3OD2A 2D9OA 2GGPA 4F3MA 4KV8A 3P5TL 3CB4A 2DR8A 1NK6A 1RHJB 2K2PA 2V9KA 3WU5A 2VBZA 1OS5A 2ZM6E 2DJWA 3PEJA 4RL1A 3HJFA 4AD6A 5A8KB 2IJNA 5J1EA 2W4PA 4KKOB 2MLXA 3D28A 2AKWB 5IFMA 2RF2B 5J1NA 2I8EA 2CXEA 3KMSA 2BDPA 2NN6D 4JI8I 4J9OA 1R3NA 1KQKA 3TJ8A 3IR6B 3JTPA 5LMUE 1IUJA 1TFYA 2EFOA 4CH7A 3AB2B 5IQQA 1HNZJ 2KXFA 3Q8UA 1CJVA 2FJVA 4NXNE 4PPDA 1Y4ZB 4ZVRB 1TKDA 2LQ9A 4LF4F 5H9EK 2CGEA 1DJ0A 4F3QA 4K0KI 5F9LA 2DNZA 3MM7A 1FK9A 2H3EB 1R8BA 1FE4A 3DLEA 4IZKB 4DR2F 3IS9B 3G8SA 4ZK7M 4ECVA 4RX6A 3W5YA 4LCHA 1BGXT 2UXBE 1NO8A 1RT7B 2I0XA 4R25A 2QMUB 4IDKB 6AT1B 1Q8BA 2GNKA 4X2BA 2EKYA 4UOHA 4KHMA 4FVMA 2VFSA 2OEKA 5ITHA 4IFVB 2ATCB 4AE5A 4DCOB 1JK9B 1N88A 2J7KA 3ZTPA 1VIOA 2YTCA 1VI7A 1A6LA 3MAAA 1ZAWA 3OVBA 2CQDA 2BABA 3OV7A 4MH8A 4B08A 3HXMA 3BQ1A 4F25A 2RQMA 4X66E 1VQYA 4LRAA 4OZEA 4ER8A 3QYYA 1HQ2A 4XK8C 2IVFB 2YNIA 4CNYA 2IC3A 3TRGA 2ZJRQ 2CPYA 1UJ4A 3HHLC 4ED0A 2OH2A 2CQPA 2CPEA 3CDWA 5D8HB 5ETKA 4ZLLA 3MPYA 3IBWA 5KFOA 5AJ3J 5BR8E 3DCAA 2QL7B 4FW3A 5HSPA 2NN6A 3WIVA 4TQRA 2J8AA 4DV1E 1NZAA 5B09A 3T1HI 4FXVA 4IG3A 2OI2A 4LVOP 1FEHA 1UVLA 3P76A 5HVFA 3Q6MA 2ZBKB 1LWEB 4NZ0A 2RQCA 2YQ3A 3HVRA 1Y5LB 2N4CA 1E6VB 1DLOB 2XMMA 2XY6A 3RBZA 4K59A 1J5EF 1R8PA 3CJKB 3QGPA 4DPWA 2B5JB 3FK4A 4M5LA 4NLDA 4YQWA 3AJDA 4DSIA 3D66A 2E5IA 4Q0BB 4CI0B 1YGYA 4WE1A 2UV8A 4DR1F 3CTRA 2V5HG 5CZXA 1H2TZ 4JI5F 2HRUA 2GJ2A 3QJPA 1FJGF 3M9MB 1C0UB 3A12A 2R7OA 1NK7A 1Z1ZA 4LT6A 4F4YA 3Q2TC 1VRUB 3OTBA 2VJVA 5CYQA 3MWBA 4DWIA 1RU2A 2R7SA 2YKQA 1RYSA 4CLWA 4WP3A 4LF6J 3MEGB 4MYUA 2JEBA 1XEZA 1ZS6A 2HFZA 2M8DB 3R5BA 1YG0A 3R7NB 4LMZA 1KLMB 3N5BA 1IWGA 2CZ4A 1PILA 5DDOC 2XB2D 1S1VB 4ZP9A 1SQGA 3AAWB 1RAAB 3HHEA 5DQGA 1WEXA 5L46A 3OJUA 5J2MA 2ZVSA 3MFHA 1NM2A 2CPHA 4I2QA 3MHYA 5HP1A 4W92B 2JVRA 3GTYX 3M7VA 3CJRA 3NGUA 2V34A 3DMJA 4DS5A 3UO0A 4MKYA 2M2BA 4KE5A 4BS2A 4DV3E 1LFWA 5HVGA 1SPBP 4TVAB 1IBKF 3RBDA 4MMOA 2YY3A 3VAIA 2QLFB 2JJ4D 2BQRA 2H65B 1I5OB 1ELOA 1KVIA 4GVBA 4MIBA 4UY8T 2ZM6I 1GMVA 4DR7J 5BYSA 3TYTA 2H5IB 1UWBA 4NYZA 1YBTA 3MD3A 1NLKL 1CJVB 1OYEA 4DUTA 4LFAF 3KK1A 4OV6A 3HULA 5KT4A 5A8RB 3OTDA 3G82B 3H2UB 4YR0A 1H38A 3MM7B 3IRXB 4OO1C 1YTYA 2LU1A 1UKUA 3RAXA 5LMUI 3MM8A 4H4KC 4FYVB 3CWVA 2LLZA 1K9MT 1GH8A 4XO0A 1M5SA 1K47A 4NXNI 4F4ZA 3PEHA 5ETPA 2V50A 1DQAA 3Q8RB 1VRTA 1U6BA 3GIMA 4DL3A 5LMNF 4PRVA 4DU8A 4B3MJ 4OX9J 1XIQA 3I32A 4JI8F 3BGUA 3TUZC 5KG4A 5DLGA 3ENWA 3SZ2A 2BE7D 4Q5VA 4AM3A 5K20B 4M5MA 1U1PA 2WK4A 3UVJA 4ECSA 1KLNA 4AIMA 1VC6A 2B9XA 2PMWA 4OKGA 3PKMA 2WVFA 5GMKa 1D0EA 1HNWJ 2NCKL 5D3GB 4DF4A 2K06A 4QNJA 1RCXB 1MWYA 4R5PB 4KT0C 5IC6B 1EKSA 5KG0A 4A8FA 4ELUA 4MK8A 4X66I 3NS7B 2VESA 2VQEE 4J9PA 4GVLA 4J91A 2CPDA 4YHHJ 3V2UC 4DV5J 1S49A 1HA1A 1E3PA 1KWMA 1Q86T 2W7AA 1RT2A 1V9OA 3VAMA 1RE1B 5BR8I 3ZZRA 2BJ9A 2XWYA 2LQ5A 1M0SA 2CQHA 2JLEA 2HZVA 1JB0C 3RW6A 3HSJA 2OPPB 3JTNA 1HMVA 1PCAA 4DV1I 2E7WA 3GFZA 2DNKA 4N77A 2ZJQQ 3MPVA 2QN6B 3BM7A 4LJMA 4Q8FA 1D8YA 3S1TA 3U02A 1N5YA 4N56A 2PIIA 5K5MA 2B3TB 3J80U 1TL1B 1B0PA 3OFHA 3CJ4A 1QSYA 1UEUA 1PKUA 2ZH4A 2WCXA 2XLIA 4UY85 2PA3A 1GXUA 2CA9A 1TK0A 3P4UB 3Q89A 2DRBA 2DNOA 1JLAA 3KFWX 1F6TA 2DGVA 3PTWA 3JYTB 5CQGA 1OYSA 3T1HF 4AFFA 1J5OA 4A8KA 1YX2A 1U0HA 3DU5A 1SKSA 2JEBB 4Y0FA 2GVDA 1D09B 4ES1A 1H73A 4ECUA 4OYMA 3CCMS 4C2MA 4O3SA 2WSEC 4JI3F 1R8CA 3MECB 4ZPAA 3CIMA 3HX9A 3A4TA 1S97A 3HDSA 1JLEA 2EFGA 2VOPA 3GMEA 2OD4A 4KFBB 1B64A 2DY9A 5HP1B 1RHUB 3MI7X 4PG5A 2DNLA 4HH1A 4Z37A 4M5IA 2HHUA 3W63A 3FFIB 4F26A 4DV7F 2XZDB 2KZMA 3P96A 1MMNA 5CA5A 5A8WA 1RHYA 1TUVA 4J9UE 4TKTA 5DQIA 1F5CA 5IV3A 3GR1A 3KMQA 3GV8B 2JEAB 4NXMJ 5CAAA 4QQBA 3MUVP 1SKWA 1WF2A 1TFWA 4DV3I 1IBCB 4F2RA 1CG2A 2NYHA 4CT9A 3EYZA 1YBUA 3RB4A 4ETXA 4YR2A 3TARA 4LF5J 4IFDE 4YDDB 5HAOA 3PRDA 4NRTA 4J37A 3ZZTA 2V9WA 3H4DA 3KG0A 3TOQA 3MM8B 4TQSA 2XQCA 3PJWA 1AB8A 3L7ZB 2DGUA 2HBYB 4IFDD 2GVZB 1NJWA 1Q8IA 5CYJA 2OPQB 1JLGB 3JAMU 3MR6A 3KRNA 1VRTB 4M5GA 4OX6A 2ADCA 1Z4UA 4FYXB 4ILMA 3PJXA 4YUDA 4PQAA 3NXZA 1FWKA 2RSQA 4EFAC 2HQFA 1EJ7L 2J8SA 5GAHU 2ZM6F 3M6XA 1RHMB 2VFRA 3UVJB 3TAMB 5C24A 2NPFA 4K7QA 4FW6A 3QJJA 1RWMB 2MSSA 1QZRA 3ZZPA 2KXHA 4DUZJ 1VQ7S 2XSFA 2DNMA 4LR8A 1TP7A 4ECTA 2KZZA 3T5KA 3M6VA 4BA1B 3K57A 4P6QA 1N36J 4PUOA 1RZMA 5KOWA 1KD1T 3OTEA 2R7VA 2PEBA 3HSDA 3AOCA 1RTIA 1S1UB 1N32F 2PC6A 4JI6E 2LQ8A 3AD9C 5KFBA 1CC7A 3UPFA 5F0WA 1RT2B 4QU6A 5IOLA 2ZOMA 1H2VZ 2F4FA 4DU7A 2UXBF 2MY8A 2VQEI 3KDNA 1GXLA 2FJAB 2IM3A 4K4XA 4M5NA 3QT7A 1FKOB 3BREA 2C37A 4TU9A 1USUA 2V8VA 5LJ5Y 5LXYA 3MCOA 3OR1A 4LF4J 3H42A 4ICLA 2F5GA 2GQCA 1S9GA 4FWGA 1M5PC 2N7YA 4DR2J 2C3OA 1TUWA 1N33E 4O23A 5HANA 4C3LA 2FGCA 4LSNB 3QATA 1FKAF 1PJ6A 2DGQA 3GP9A 3NBPA 4G1QA 2QLWA 3PRYA 4NLVA 3G4SS 4USJC 2XNRA 4ZPBA 3BKTA 3ZZYA 4DV0E 5KT6A 2EC2A 4LF8E 6FDRA 3MOZA 2R2SA 4TYAA 2YKAA 4DOZA 1JXVA 2E7XA 3A13A 4QR1A 3UCZP 3CE8A 4NYPA 3DI6B 3LP1A 3UDVA 3QT6A 1U0HB 3TNVA 2B8PA 2HAFA 2CKWA 3P3GA 4XTJA 3T1YE 3M2VA 2GVDB 1N5QA 1RHRB 1MX0A 3OVSA 1HPZB 2QFJA 2C39A 2AYBA 3T19A 4OYXA 4LRCA 3T9NA 2PFFB 4KPCA 2ZHAA 1VQPS 3V6JA 1JLEB 4KHPF 5GADU 4L73A 1JNZB 4USHA 1WACA 1KNZA 1YJRA 3R5GA 3ETMA 4PWUA 4YEAA 4IKAA 3KUEA 4P2SA 2Z57B 1FFSB 1ZOTA 3UCGA 4DG1B 2RDDA 2FVQA 1YJUA 4MU4A 1DAXA 5A8WB 3VV2B 4BC7A 4WIIA 4K50A 2MSTA 1LOUA 2V2VA 2LMIA 2BM1A 1TK5A 3HHLD 3MR2A 4P71A 2B4UA 3SFGA 3CPWR 3MR5A 1BQMB 3HKZD 4PWDB 4JI1F 3PFEA 5KFRA 4ECRA 4AL5A 1HQUB 1J5EJ 3KG1A 2KDOA 1SQFA 3H59A 4ZMMA 1EARA 2D3O1 2RVJA 1SJ1A 3M6WA 3D0HE 4LSLB 3LA0A 1REVA 2QLBB 3BSCA 2CQ3A 2OIHA 4NX9A 4Z2XA 4WUBA 1QAYA 2HK2A 5K14B 2YKMB 3FQKA 3G6ES 1S6PB 5B7WA 3BBBA 4JV5E 3ITHA 4UF4A 2HW3A 3BJYA 3CDIA 3MM9A 4DR1J 1X4AA 4X4QA 3DRXA 5E0OA 4M5DA 2LQBA 2RUGA 1IR1A 2H9ZA 2E9RX 5EWFA 1KHWA 3PW7A 3K1JA 4HACA 4USKA 2CQIA 3HMJG 4CDIA 4P2XA 5C2GA 3DRSB 3M85D 5A0YA 2DITA 3KJVB 4W98A 2JLFA 2IYIA 1HWJA 3H2LA 4ZP6A 5HBMA 4BCAA 2VONA 4DX7A 2J6SA 4CO0A 4PU9A 4EEYA 3JQJA 3QPIA 3OXFA 2UUWA 4RBUA 5C42A 5M2PA 3D7SB 3HM9A 1SXLA 1FCAA 2AV5A 2GW8A 4XDDA 2ZUGA 1C4AA 4LSZB 5DJBA 3SBMA 1VQKS 3BH6B 5IV4A 4JOUA 2NS1B 1UDOA 4ERDA 2XZWA 1IBKJ 5L8RC 2X3GA 2AEFA 3R5JB 3M30B 4I68A 2WAQD 3D3BJ 3U1NA 2V67A 4LBPA 2IESA 5CZVA 3D6MB 2IM2A 1KC8T 5U47A 4ZKAA 2DGXA 2HFVA 3IGNA 2P9CA 4DFJA 5IZHA 3CC2S 4P7VA 2GCFA 4JI6I 4LFAJ 3HK2A 3OR2A 5ETLA 2R2RA 4A8SA 1RBAA 2NXUA 4CO3A 1VK8A 4HL9A 2HHHE 1S9GB 2VOOA 2QV6A 4MK7A 3KUGA 1JLBA 3D6TB 1RWWB 4P73A 2HBQB 3B78A 1YHQS 3LAMA 3WBZA 3NBPB 4G1QB 3CCJS 2ADBA 2O01C 4NLRA 3Q8SB 3J80Q 1X5OA 2F40A 2W9BA 2UZAA 1XNRJ 1NJXA 1NH7A 2VUGA 2HKJA 5DG9A 2ZH1A 4ECXA 1N33I 3T6BA 3I31A 3M2VB 2HNZA 5LMNJ 4U3BA 5J2QA 4HDGA 2QA4G 3QSYB 4OO1D 1H3DA 2C2DA 4O4GA 4EUVA 2GC8A 4F36A 5L1IA 4K4UA 3M85G 5KFGA 2VICA 2VQFF 3UFCX 4IRKA 4N3OA 4DV0I 4JG4A 3CCSS 2VIHA 3G6XA 3L95X 5HVHA 4LF8I 1IM4A 4EI2A 1GTHA 2Z5BA 4CYUB 2C38A 2FTRA 5DLFA 4LR9A 3T1YI 2QZ8A 3TUIC 2EFVA 2AJ0A 4OI6A 3HF5A 2E1PA 3DLGA 1V5IB 2VPWB 3M32B 2GHVC 2ZBRA 3ENQA 2LU2A 2JSXA 1K0TA 3C8YA 4H4MA 4OQJA 2DRAA 2XMJA 1HHSA 5KFCA 5K36C 1L5UA 1J27A 4OFZA 2W4CA 2IJFA 4QIFA 1BC6A 5L1JA 3M6UA 3C19A 2V68A 4ZVHA 4HHUA 3RZAA 5IQ6A 3QGHA 2BA0G 2LJPA 2HQDA 1C1BB 4NLGA 2XI2A 4EWTA 3M1VB 5A76A 3LOUA 3M9OB 1MSWD 2HFNA 2B7BB 3LWMA 5DZ6A 3T9ZA 2EK1A 2XY7A 3KNGA 1YJTA 3TJAA 2MQ8A 2XYGB 5IM0B 4NEZA 2EG2A 3FCHA 2GQ2A 2LP4A 3LGHA 2HRTA 1LW0A 3R3TA 4OZLA 2QLJB 1H7UA 4OO1A 3BEGB 3C16A 2PNZA 3O8WA 3N79A 2Q66A 4I56A 3PNIA 4J9RA 4BA2B 2UUCE 3MUTP 1HBOA 1FA0A 2YKNB 2YNGA 2FLNA 4N7TA 4FDFA 5A0YB 4FYWB 1KOOA 3RBXA 4ED7A 3JAMQ 4L75A 2IRYA 4YOEA 2IJRA 3GONA 3NNCA 2DH8A 1XQIA 2DR6A 3A3OB 3WQPA 1YVFA 4JI3J 2DO0A 3ZXWA 2PT0A 4ID5A 5HLFB 1CJKB 2VASA 5KFJA 4BWJA 5C42B 2KJWA 2UUAE 1D3WA 3NMRA 3M9NB 2DHGA 1H0HB 2V63A 2GMHA 2JH3A 2D74B 3TEHB 5IXUA 5JEAE 1F9FA 5GAEU 1FT8A 1T9VA 4FKYA 1S4FA 1Z0WA 4J9NA 3NGKA 4DV7J 4Y00A 2F8MA 3FEZA 4K4TA 1NDCA 2C2KB 3I0RA 4H54A 4ZDNA 2QA2A 1FRXA 2HVDA 1XMOJ 3DYAB 2O67A 3MM6A 4A46A 4ECYA 2IM0A 1KVJA 4USUA 2IVMA 3CJ8A 4J9KA 3DKDA 3RYLA 3W5XA 1S6QB 1YLXA 4YN3B 2F4VF 1X9SA 5EX0A 5HATA 3HFZB 3W1YC 4NLQA 3V5RA 4KH0B 5KTQA 4C8ZA 3IMQJ 4V1Ak 5DDQC 4QNKA 2XY5A 5J1PA 5IWAE 2FZKB 3W2VA 1HIYA 2GIRA 2MKCA 1Z5BA 4HTJA 4O0IA 4OYBA 3ETOA 1VISA 2HHHI 1I6JA 1NPKA 1TV6B 3JQKA 2BR2B 2KVQE 2W2OP 3KJQB 1YJ7A 2BJ3A 4O4GB 5ETTA 3IGVA 2AJQA 4B3SE 4IRDA 2IRXA 4RWWA 1LW2A 1IKYB 2IM1A 2VPZB 3R97A 4AL6A 1YIJS 2Z5BB 4X62F 4O3NA 1RAJA 3NS6A 5EDWA 1WKJA 1Z2LA 2RUSA 2UXDF 3HVWA 1HI0P 1OY8A 3V81B 3W2WA 2XMAA 2B6AA 3SXLA 1N32J 4Z7YA 2AP6A 5C5JA 2DR5A 4DJBA 2QE5A 1BY9A 2KFZA 3G6YA 1T9TA 1Q1KA 3H5YA 5KFHA 2R7RA 4C0BA 1LWCB 3M4XA 1UFWA 4CM2A 1TL3B 1RWNB 1YK9A 2IMOA 2W2MP 4DZDA 2CJBA 1VQLS 3IBFB 4X4TA 3K5OA 3NP5A 2JWNA 2I38A 4Q2LA 2UXBJ 2RKIB 3M05A 4OJ1A 1JLFA 3AD7C 1A9NB 5GAGU 3PJ9A 3MEEA 4RUHA 4DX8H 3V6HA 1T05B 3W60A 4YDXA 4LIRA 5E3QA 1KONA 5KT2A 1W26A 2MQNA 5IS2A 4AQYE 2YBVA 4DCPB 2ZH2A 3T1YF 3CULA 4B9NA 4RPFA 3RG6A 1LFPA 1LW0B 2DH9A 3AH6A 1Z0BA 3MAQA 4CLSA 4WU3A 2HSEB 3C16B 2DBBA 3EGVA 4U6PA 3P8BB 3L7PA 4P7AA 4NA1A 8AT1B 1NDKA 4CLUA 2XLKA 3IM8A 2G0CA 4HLBA 3TVZA 2A2DA 1JKHB 3FKBA 1W7WA 4Q8EA 2XMTA 2HVIA 1VRQC 3OTOE 5KFQA 3MURP 4B3TF 1UL3A 2ZBIA 1XC9A 2QFIA 3SIPB 4NLPA 3J7AM 1OO0B 2PFDA 4L76A 3JSRA 2N4DA 4ID5B 2UUCI 2NPIA 1RUSA 4DQIA 2J9CA 3FRZA 1EB0A 4DV2F 4KHPJ 1E6YA 5J2PA 3CJSA 2BANB 3FRYA 4MFBA 3NAHA 1NHVA 5JVHQ 1Y4UA 4CZCA 2KFNA 1HNVB 4UOCA 1GXTA 2N3LA 4TY8A 3GB0A 4W4MA 4GO5X 4JI7J 1I94E 1FDAA 2CQ2A 2FUG9 4LREA 2H54B 3MMAA 2JHEA 4QYZK 2UUAI 5KFIA 1NHKL 2HHPA 2UU9E 2R2UA 3JXOA 3MMBA 3MM6B 1R0BG 4QOTA 2XMVA 3SMZA 4MQYA 1HWKA 2MZSA 1SJ3P 4JV5F 2ZITA 4IZJA 1GX6A 1P1TA 4JI1J 1NHIA 3M8PA 4U8YA 4LOMA 4UZBA 1AZSB 4LR7A 1RWUA 4CO2A 4B17A 3DOMB 4TLQA 3PIPQ 4I7FA 5DG7A 3DOLB 2EBEA 3VVTA 1HNIA 2IA0A 3LO3A 2CWKA 1HYSA 2DXDA 2G13A 4IRCA 3N28A 1IBLJ 4FS1A 3UD5A 5KG7A 3QJLA 3AQOA 3HSGA 2LEPA 4BHQA 2OHDA 2X1FA 1MNEA 2QA1A 5IWAI 4PZVA 1BUXA 1NBEB 4A47A 4ED2A 1VC0A 3C6UA 1HBMB 3TZZA 1S1XA 2Y1IA 2IA6A 2CQBA 2GO9A 2AX1A 2YPYA 2DIVA 4B3RE 5FDLB 1N8RT 3NZKA 3HHKA 2J7WA 1XWLA 1GAOA 2JVOA 2YQ0A 4DL0C 2FVCA 4ETZA 2A1BA 4I2PB 1FNMA 2ZKUA 4WUCA 2MMYA 1YWXA 3PYEA 4F0HA 4CP5A 4ZS6A 3PG9A 1ZAXA 4WFZA 1KRPA 4ZCKA 2Z0GA 4AL7A 4FNIA 4WZMA 4DR4E 1VGYA 2MQPA 5B0GA 2I5JB 2HNYA 2HHHF 3HZEA 4C11B 4RW9B 2LDIA 1YRXA 1VJQA 2BW2A 3FC9A 3JS9A 3E2EA 2XS5A 3UR0A 3GCXP 1T0TV 2QYCA 2WOMA 2BKOA 3C15A 2KI2A 4I3HA 4FWHA 1NJZA 1RHKB 1JJ2R 1ZXNA 3QGIA 3CMQA 3IR7B 1YJVA 2A0FB 2QG9B 4WZQA 2LXFA 3OFFA 2VODA 3N4WA 1KQSR 4Y2KA 4K4WA 2CG8A 2ACYA 2BVZA 1D8ZA 4HR2A 4MTPA 2UUBE 4TU8A 3TEGA 1RAFB 4D3HA 1MROB 2L9DA 1HR0F 3FCWA 4V19J 4J3DA 1EKRA 2XYHB 1SIWB 2ZH7A 1L3TA 1HBUB 4U7UK 2BOPA 5LXRA 4DPTA 2HS3A 1B0TA 3LPSA 4AQYI 2EFQA 3I5CA 4ED1A 4UUWA 1N34E 2RD5C 5G4DA 2HMIA 1Y11A 1NPPA 3ULHA 3NRBA 1Q78A 1U6FA 2VQFJ 4NCGB 3KHLA 1R6YA 4FNHA 3CNQP 3US5A 3AOAA 4C8OA 3OVAA 2B7CB 3QSIA 1MMLA 4BDPA 1GK8A 1XR7A 4ZHRA 4KRWA 1K73T 4M95A 4X64J 3KLEB 1AUDA 2NUUG 2M88A 3OTOI 1APSA 1RP5A 4PEOA 3PW0A 2UUTA 2AW0A 2KG0A 5H9FJ 4OI4A
chains in the Genus database with same CATH topology
4JI4I 4NXNI 4AQYE 4LFBI 1PVGA 4N3OA 4DV0I 4JG4A 4RPFA 4JI3E 4LF8I 4LF9I 3PYGA 4DU7A 3WU5A 2Z5BA 3F0NA 1EI1A 1Z0BA 2VQEI 4DV6E 2ZM6E 1IBLE 2DEJA 4DV4E 4X65I 3T1YI 1J5EE 3Q6NA 2HKEA 4P7AA 3QT7A 4PRVA 4DU8A 1USUA 1H74A 2A2CA 3ZKDA 2V8PA 2IOQA 4FWGA 4DV7E 1I94I 4NXMI 2A2DA 1MU5A 2F4VE 4JI8I 1N33E 3WU4A 3OTOE 5A2QC 2UU9I 2UXCI 5LMUE 4X62I 4DR6E 4DR1E 4IZKA 3LTOA 4DUYE 3J7AM 3WU3A 4M1KA 1XMOE 2X7IA 3PRYA 4LF6I 2UXDI 4LF5I 4HYMA 1HR0I 4JI4E 4NXNE 4LFBE 1Z59A 2V2ZA 4USMA 4WUDA 4DV0E 2UUCI 1KTVA 4LF9E 4LF8E 3HJCA 2VF3A 4X66I 3WU6A 4DXLA 3PYDA 2VQEE 2CGEA 1IBKI 2LJPA 5IT9C 4K0KI 2PNMA 3QT6A 1N36E 4X65E 2Z5CA 1S4EA 4IZKB 4XTJA 3T1YE 2HK3A 3V2UC 2UXBE 1Y4UA 1Y6ZA 1MX0A 1PKPA 2BM0A 2GQ0A 4KQVA 1XHKA 1I94E 3J81C 4NXME 2O1TA 5BR8I 4EMDA 4LFAI 2Z5CB 4JI8E 2J7KA 2UUAI 1HNXI 1ZM4A 2E5LI 2UU9E 4DV1I 3ZZ0A 1B62A 4X62E 1H7UA 1Z5AA 1N32I 1U2RA 4LF6E 2UXDE 4LF5E 2ZITA 4IZJA 1HR0E 2Z5EA 1NHIA 3B8HA 2UUCE 4DUZI 5A2QQ 3B82A 4X66E 4DR7I 1HK7A 1KIJA 4UT4A 3H4LA 2O1WA 1IBKE 4K0KE 2VQFI 1N36I 4JI2I 4OX9E 3JAMQ 4B3RI 1ZM9A 4IZJB 1FWLA 2UXBI 1XNRI 4DPUA 2V2VA 2WW4A 3GONA 1Z0EA 2BM1A 4X64I 1ZM2A 5IT9Q 4ZVIA 3P06A 3J80C 2O1UA 4DR2E 3PYFA 3K17A 5LMNI 1A6FA 1XMQI 5BR8E 4LFAE 5GMDA 1ZM3A 2UUAE 1HNXE 1RR9A 1Z0CA 2E5LE 4DV1E 4GKJE 3T1HI 4DR3I 1N32E 3J81Q 2OI2A 4DR4I 1H73A 3ZM7A 4B3TI 5IWAI 1Z0WA 4DUZE 4WUBA 3Q6MA 4LF7E 2HK2A 2ZBKB 4DR7E 1Z5CA 1NZ0A 4JV5E 4YY3I 2VQFE 1H72C 1S16A 2CG9A 4B3MI 4JI2E 4OX9I 1MG7A 4JYAI 4B3RE 3J7AG 2EFGA 1Z0VA 4MYTA 4LF4I 1XNRE 4LFCI 4DV2I 1KKHA 3ZKBA 4DPWA 1NHJA 2GS8A 4X64E 3LNUA 5GMEA 1B63A 2Q2EB 3K1JA 4DR2I 4HACA 4USKA 5LMNE 1XNQI 2PNLA 1HNWI 1FNMA 4DPYA 1XMQE 4WUCA 2HFUA 5FLXC 2DEIA 3QT5A 3K85A 5LL6R 3PYEA 4FWDA 1IBMI 4GKJI 1DARA 1PIEA 3T1HE 4DR3E 1D6TA 4FN5A 4FW9A 2UUBI 3V5RA 1FI4A 4HACB 3ZZUA 4DR4E 4PRXA 4B3TE 5IWAE 4KHPI 4LF7I 1FKAE 4PU9A 1Y4SA 1N0UA 1Z5BA 1H7SA 4YHHI 4JV5I 4DV5I 4YY3E 4DV3I 4IZJD 1Z0GA 4B3ME 1VISA 2HHHI 4JI5I 4JYAE 4I3HA 4FWHA 4LF4E 1FJGI 4Z7CA 1N34I 2HFSA 4MYUA 4DV2E 4LFCE 4JI7I 1USVA 5L3JA 1ZXNA 3M6AA 3ZZTA 1XNQE 1HNWE 1RREA 4B3SE 3QT8A 1IBME 1HNZE 1NHHA 4JI1I 1N0VC 1WUUA 2Z5BB 2UUBE 4HY1A 2R42A 4JI0I 2CZ9A 5FLXQ 2IOPA 2E1RA 4P52A 4KHPE 4JI6I 4R1FA 1FWKA 2V34A 2BV3A 4YHHE 4DV5E 4DR5I 4DPXA 4DV3E 4GKKI 2HHHE 4JI5E 4DPTA 3JAMC 4URLA 1ZXMA 3LPSA 4AQYI 4Z7YA 1FJGE 1N34E 4JI3I 2NPFA 4JI7E 1ELOA 3B78A 2XEXA 4DV6I 1QZRA 2ZM6I 1IBLI 1OJ4A 4DV4I 3D4JA 1J5EI 4UTGA 1BKNA 4B3SI 1Z0TA 3HULA 1HNZI 5FWKA 3J80Q 4JI1E 1UEKA 2AJ4A 4DV7I 2HKJA 4JI0E 2F4VI 2X36A 2R3VA 1N33I 1EA6A 2V2QA 3OTOI 4JI6E 3Q1QA 2UXCE 5LMUI 4DR6I 4DR1I 1KVKA 4ED4A 4DUYI 4DR5E 2O1VA 3CWVA 1XMOI 4GKKE 4HXZA 1K47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 I;  4NXN I;  4AQY E;  4LFB I;  1PVG A;  4DV0 I;  4JG4 A;  4RPF A;  4JI3 E;  4LF8 I;  4LF9 I;  3PYG A;  4DU7 A;  3WU5 A;  3F0N A;  1EI1 A;  1Z0B A;  2VQE I;  4DV6 E;  2ZM6 E;  1IBL E;  2DEJ A;  4DV4 E;  4X65 I;  3T1Y I;  1J5E E;  2HKE A;  4P7A A;  3QT7 A;  4PRV A;  4DU8 A;  1H74 A;  2A2C A;  3ZKD A;  2V8P A;  4FWG A;  4DV7 E;  1I94 I;  4NXM I;  2A2D A;  1MU5 A;  2F4V E;  4JI8 I;  1N33 E;  3WU4 A;  3OTO E;  5A2Q C;  2UU9 I;  2UXC I;  5LMU E;  4X62 I;  4DR6 E;  4DR1 E;  3LTO A;  4DUY E;  3J7A M;  3WU3 A;  4M1K A;  1XMO E;  2X7I A;  4LF6 I;  2UXD I;  4LF5 I;  4HYM A;  1HR0 I;  4JI4 E;  4NXN E;  4LFB E;  1Z59 A;  2V2Z A;  4USM A;  4WUD A;  4DV0 E;  2UUC I;  1KTV A;  4LF9 E;  4LF8 E;  2VF3 A;  4X66 I;  3WU6 A;  4DXL A;  3PYD A;  2VQE E;  1IBK I;  2LJP A;  5IT9 C;  4K0K I;  3QT6 A;  1N36 E;  4X65 E;  1S4E A;  4XTJ A;  3T1Y E;  2HK3 A;  3V2U C;  2UXB E;  1MX0 A;  1PKP A;  2BM0 A;  4KQV A;  1XHK A;  1I94 E;  3J81 C;  4NXM E;  5BR8 I;  4EMD A;  4LFA I;  4JI8 E;  2J7K A;  2UUA I;  1HNX I;  1ZM4 A;  2E5L I;  2UU9 E;  4DV1 I;  3ZZ0 A;  1B62 A;  4X62 E;  1H7U A;  1Z5A A;  1N32 I;  1U2R A;  4LF6 E;  2UXD E;  4LF5 E;  2ZIT A;  1HR0 E;  1NHI A;  3B8H A;  2UUC E;  4DUZ I;  5A2Q Q;  3B82 A;  4X66 E;  4DR7 I;  1KIJ A;  4UT4 A;  3H4L A;  1IBK E;  4K0K E;  2VQF I;  1N36 I;  4JI2 I;  4OX9 E;  3JAM Q;  4B3R I;  1ZM9 A;  1FWL A;  2UXB I;  1XNR I;  4DPU A;  2V2V A;  2WW4 A;  3GON A;  1Z0E A;  2BM1 A;  4X64 I;  1ZM2 A;  5IT9 Q;  4ZVI A;  3J80 C;  4DR2 E;  3PYF A;  3K17 A;  5LMN I;  1A6F A;  1XMQ I;  5BR8 E;  4LFA E;  5GMD A;  1ZM3 A;  2UUA E;  1HNX E;  1RR9 A;  1Z0C A;  2E5L E;  4DV1 E;  4GKJ E;  3T1H I;  4DR3 I;  1N32 E;  3J81 Q;  2OI2 A;  4DR4 I;  1H73 A;  3ZM7 A;  4B3T I;  5IWA I;  1Z0W A;  4DUZ E;  4WUB A;  4LF7 E;  2HK2 A;  2ZBK B;  4DR7 E;  1Z5C A;  1NZ0 A;  4JV5 E;  4YY3 I;  2VQF E;  1H72 C;  1S16 A;  4B3M I;  4JI2 E;  4OX9 I;  1MG7 A;  4JYA I;  4B3R E;  3J7A G;  2EFG A;  1Z0V A;  4MYT A;  4LF4 I;  1XNR E;  4LFC I;  4DV2 I;  1KKH A;  3ZKB A;  4DPW A;  1NHJ A;  2GS8 A;  4X64 E;  3LNU A;  5GME A;  1B63 A;  2Q2E B;  3K1J A;  4DR2 I;  4HAC A;  4USK A;  5LMN E;  1XNQ I;  1HNW I;  1FNM A;  4DPY A;  1XMQ E;  4WUC A;  2HFU A;  5FLX C;  2DEI A;  3QT5 A;  5LL6 R;  3PYE A;  4FWD A;  1IBM I;  4GKJ I;  1DAR A;  1PIE A;  3T1H E;  4DR3 E;  1D6T A;  4FN5 A;  4FW9 A;  2UUB I;  3V5R A;  1FI4 A;  4HAC B;  3ZZU A;  4DR4 E;  4PRX A;  4B3T E;  5IWA E;  4KHP I;  4LF7 I;  1FKA E;  4PU9 A;  1N0U A;  1Z5B A;  1H7S A;  4YHH I;  4JV5 I;  4DV5 I;  4YY3 E;  4DV3 I;  1Z0G A;  4B3M E;  1VIS A;  2HHH I;  4JI5 I;  4JYA E;  4I3H A;  4FWH A;  4LF4 E;  1FJG I;  4Z7C A;  1N34 I;  2HFS A;  4MYU A;  4DV2 E;  4LFC E;  4JI7 I;  5L3J A;  1ZXN A;  3M6A A;  3ZZT A;  1XNQ E;  1HNW E;  1RRE A;  4B3S E;  3QT8 A;  1IBM E;  1HNZ E;  1NHH A;  4JI1 I;  1N0V C;  1WUU A;  2UUB E;  4HY1 A;  2R42 A;  4JI0 I;  2CZ9 A;  5FLX Q;  2E1R A;  4P52 A;  4KHP E;  4JI6 I;  4R1F A;  1FWK A;  2V34 A;  2BV3 A;  4YHH E;  4DV5 E;  4DR5 I;  4DPX A;  4DV3 E;  4GKK I;  2HHH E;  4JI5 E;  4DPT A;  3JAM C;  4URL A;  1ZXM A;  3LPS A;  4AQY I;  4Z7Y A;  1FJG E;  1N34 E;  4JI3 I;  2NPF A;  4JI7 E;  1ELO A;  3B78 A;  2XEX A;  4DV6 I;  1QZR A;  2ZM6 I;  1IBL I;  1OJ4 A;  4DV4 I;  3D4J A;  1J5E I;  4UTG A;  1BKN A;  4B3S I;  1Z0T A;  3HUL A;  1HNZ I;  3J80 Q;  4JI1 E;  1UEK A;  2AJ4 A;  4DV7 I;  2HKJ A;  4JI0 E;  2F4V I;  2X36 A;  2R3V A;  1N33 I;  1EA6 A;  2V2Q A;  3OTO I;  4JI6 E;  3Q1Q A;  2UXC E;  5LMU I;  4DR6 I;  4DR1 I;  1KVK A;  4ED4 A;  4DUY I;  4DR5 E;  3CWV A;  1XMO I;  4GKK E;  4HXZ A;  1K47 A; 
#chains in the Genus database with same CATH topology
 1YDL A;  4YS2 A;  4K5S A;  3W8G A;  3MMA B;  1JJC B;  4EYH B;  1CJU A;  1N56 A;  3RBE A;  3IAS 9;  3P3C A;  3VAH A;  2B9W A;  1U47 A;  2F63 A;  4JYA J;  4WCE Q;  1VYA A;  1NSA A;  3PZP A;  1WDD A;  5B0A A;  1QVG R;  5E33 A;  1I94 I;  3N6M A;  1MU5 A;  1Q82 T;  4MIA A;  1NJY A;  5J2N A;  3PFO A;  3MR3 A;  2UU9 I;  2UXC I;  2PD1 A;  2UUC F;  2ZH5 A;  5AE1 A;  4QZV B;  2LVW A;  5K36 D;  3W66 A;  1QSL A;  1RT3 B;  2I2Y A;  1IQT A;  4EBE A;  1S1W B;  4RZR A;  1U48 A;  2Z2M A;  4N47 A;  3HJC A;  4KBI A;  3QIP A;  2VA2 A;  5EKW A;  4X65 E;  2XG8 A;  1PAU B;  2XMU A;  3PXG a;  1LV5 A;  2NXC A;  2ILZ A;  4EYI B;  3WX8 A;  5K8P A;  5KFY A;  1F9E B;  3UDL A;  3TJ9 A;  1NB7 A;  4KQV A;  1XHK A;  4QW8 A;  2NSB A;  4PG8 A;  5AE3 A;  1TQL A;  4EMD A;  1FO1 A;  5JEA F;  4MT1 A;  3PW5 A;  1FKP B;  1MU2 B;  1Z5A A;  1T9W A;  1T7P A;  4Y2I A;  3M7N D;  4NZ7 A;  1IQZ A;  4ZLJ A;  2FPH X;  5A2Q Y;  1QAJ A;  3AFG A;  4DQR A;  5A2Q Q;  3BDP A;  2HHQ A;  1S48 A;  2XZT B;  1G4C A;  4UT4 A;  2O1W A;  2FVR A;  5H9F K;  1RGV A;  3VAL A;  1AA1 B;  4E0D A;  4B3R I;  2QX0 A;  2VG5 B;  2PO0 B;  2B9E A;  1WKK A;  2L9N A;  4OHY A;  4FBU A;  2HNY B;  1EET B;  3NS5 A;  3OHA A;  1ZM2 A;  3OPK A;  2VC1 A;  2R7T A;  3V6D B;  2MZQ A;  3NCP A;  3K17 A;  2FB0 A;  1T03 B;  3H5U A;  1U0S A;  3WDO A;  2VV5 A;  4JI0 F;  2WOM B;  2E5L E;  1TL4 A;  2MHE A;  4GKJ E;  2ALZ A;  1WC6 A;  4ZOS A;  3PHT A;  3C14 A;  4IFD B;  2ZBQ A;  4DR4 I;  5K36 A;  4FP9 A;  4X4N A;  2BKP A;  2VA3 A;  4GKK F;  2B51 A;  2PE8 A;  4KC5 A;  2BQU A;  4KYZ A;  4LF7 E;  2ZUA A;  3DLJ A;  2Y8Y A;  2F4V J;  1TVR A;  3NGS A;  3AXK A;  2LKZ A;  3KK2 A;  3G96 A;  5M2R A;  2CVI A;  4F04 B;  4DV6 F;  1SUQ B;  2FLL A;  2MJN A;  1KHV A;  2G1H A;  3AXM A;  3UDE A;  1HI1 A;  1BQN A;  2WW8 A;  4ZIT A;  4B3S F;  4ZVP B;  1X7V A;  1WG1 A;  1RDR A;  4NL5 A;  1P6T A;  1RT6 B;  2M5Y A;  1JLQ B;  1RAI B;  5K8O A;  5ETR A;  2C2M B;  3DGP A;  3PR4 A;  1IKX A;  4LCF A;  1HW8 A;  4IG0 A;  2UUB I;  1S76 D;  1RLC L;  2BE2 B;  3UI3 A;  2VKZ G;  5C25 A;  2OPR B;  3GII A;  4JI4 F;  4A8Y A;  4ZA1 A;  4LF9 F;  3LAK A;  3POT B;  1U49 A;  2UVR A;  4CLF A;  4X62 J;  1RWV B;  5B0C A;  3AD8 C;  3NOG A;  1TKX B;  2MKY A;  4I6A A;  3SSQ A;  1N34 I;  4OI2 A;  2UXD J;  2MZT A;  1GMU A;  2DT9 A;  2GHP A;  1DHM A;  5I42 B;  1Y00 A;  2W9C A;  5M2U A;  1SBR A;  2CPZ A;  3MM5 A;  2IBO A;  4IR9 A;  3PIO Q;  2AZ1 A;  1HNZ E;  1UZD A;  3GE9 A;  3HVT B;  2HQI A;  4RNO A;  2E5G A;  1SH2 A;  1G2E A;  1O5J A;  2R8G A;  3R6G B;  2MLZ A;  2YQ1 A;  4DFK A;  1XN9 A;  1UFL A;  3MMC B;  1RAG B;  5HRO B;  4ED6 A;  2CQ0 A;  1R0A B;  3SCI E;  4QIE A;  1JXL A;  2BV3 A;  3GJR B;  3L09 A;  1HNX J;  5F0U A;  2L08 A;  3Q23 A;  3R5D A;  1TU0 B;  2ROG A;  2J0X A;  2P5V A;  3E8O A;  4ZPC A;  2QC3 A;  1K8A T;  4J9Q A;  4LCG A;  2V0N A;  3EXC X;  2H1Y A;  2HGN A;  4IUF A;  4BLG A;  3T5H A;  2BW7 A;  2E9T A;  1C4C A;  4QWB A;  4X84 A;  3WX4 A;  3EWG A;  1KFD A;  3OTO F;  1NK4 A;  1S1T B;  3RRK A;  3MCM A;  4J5O A;  2YWG A;  5EGY A;  4USV A;  1ITP A;  4ECQ A;  1F3V A;  5A8K A;  2PO1 B;  2E44 A;  2DRD A;  5KFX A;  2L48 A;  4U95 A;  3RR8 A;  2JC0 A;  4KKO A;  2P9G A;  2RDI A;  4PG4 A;  3PYG A;  4O3Q A;  4IQM A;  2RF2 A;  4NMX A;  4B3T J;  2V69 A;  4X65 I;  1VBK A;  4N5S A;  4DSK A;  3T5L A;  5FD1 A;  2W1B A;  5DG8 A;  2CFX A;  4P10 A;  2XHW A;  5KAK A;  3O3L A;  1WD6 A;  4KGK A;  2BBE A;  2ZHB A;  1AUS L;  2D3U A;  3C66 A;  3RUB L;  4DV2 J;  3PM9 A;  3U1Y A;  2J76 E;  2RE1 A;  1WOS A;  3HHL B;  2AX0 A;  1WNE A;  4IH6 A;  2B43 A;  5EWE A;  5A2Q C;  5LL6 d;  4S0M A;  2R8H A;  2Y8W A;  4IZK A;  3CED A;  3IS9 A;  5E3C A;  1REG X;  3SCK E;  4I1T A;  1RT7 A;  4IDK A;  1KTQ A;  2WZ1 A;  2XMK A;  2Y0S D;  4LFC F;  3TQ1 A;  5KG3 A;  4IFV A;  3KXD A;  3ADA C;  4JV5 J;  2FLP A;  2O1P A;  3K0J A;  2L3M A;  2PMZ D;  5L9X A;  1UVM A;  2GQ0 A;  5C0X E;  3FBC A;  2ZNZ A;  1A0O B;  4G65 A;  1ZAV A;  4ILL A;  3V4I B;  3PCO B;  2AJ2 A;  2E5L I;  4P72 A;  4RKU C;  2OSQ A;  3CCV S;  3BO2 A;  4C6A A;  3N6N A;  3D6F B;  4LF6 E;  2DGT A;  4PQU B;  2WSF C;  3ENA A;  2V4Q A;  5ETV A;  2G2O A;  5LT5 A;  1RAD B;  2JEG A;  1RAE B;  3GWC A;  1IKX B;  1KFS A;  5DNL A;  2GJF A;  4IG0 B;  3VAJ A;  1U09 A;  4DR5 J;  1M90 T;  1HBN B;  2EVZ A;  1FHT A;  1RA7 A;  4OZ2 A;  2JC1 A;  3I5A A;  2BA1 D;  4U3D A;  1QM9 A;  5D0E A;  3KHR A;  5GMD A;  1Y5Y A;  1LWE A;  4DR4 F;  1Z0C A;  2AT1 B;  1FF2 A;  4R0E A;  3IXQ A;  3IWX A;  5E3P A;  3S01 A;  3RRH A;  3QO9 B;  1RU1 A;  3H5X A;  3FSY A;  3CJK A;  4QIV A;  1JIH A;  2R7W A;  4WTY A;  3OL7 A;  2B5J A;  3B6B A;  5JMN A;  4DR7 E;  2D69 A;  3GPA A;  1X4D A;  4P2M A;  3QRR A;  4DV4 F;  4DL4 A;  1Z0V A;  3UR3 C;  4Q0B A;  3FQL A;  2HG4 A;  1Q81 T;  1X9W A;  2PNL A;  2VG7 B;  2UUB F;  3SCL E;  5D0G A;  1Q7Y T;  3NGD A;  1C0U A;  1C2P A;  2KXN B;  2SXL A;  3DC2 A;  4I0W A;  1S59 A;  1JXE A;  2VC0 A;  1VRU A;  3NEK A;  4A8W A;  2E5H A;  4FW9 A;  2VFT A;  4FVC A;  5LOQ A;  4DUY F;  4KQZ A;  3MEG A;  4LIW A;  3MXH P;  4LFB F;  1H7S A;  1KLM A;  4Y34 A;  1RT4 A;  2NRE A;  3TVK A;  2ZDO A;  5HQL A;  1EQM A;  2WB4 A;  3BBC A;  4DQQ A;  4Q2M A;  4B3M E;  1OYD A;  1NXI A;  1HFE L;  4Z7C A;  2MZJ A;  4UZC A;  1YJN S;  3H5S A;  1HR0 J;  5L3J A;  5AXN A;  3ONQ A;  4CH1 A;  1PC5 A;  1UEV A;  3BPD A;  4GO7 X;  2RB7 A;  1HNW E;  1FXD A;  2NN6 E;  3JSM B;  3ELH A;  3BGO P;  2JDJ A;  4JB8 B;  4OJG A;  4Y3C A;  2HS4 A;  2F1D A;  1NHH A;  2MYF A;  3NGR A;  5DQH A;  2C2E A;  1CVJ A;  5F9N A;  3TA2 A;  3R27 A;  4B9S A;  3PRV A;  5KOX A;  4OIX A;  3IWN C;  4AID A;  2LEC A;  1UW9 A;  2KO1 A;  1CSJ A;  4DN0 A;  3CJT A;  2XS2 A;  2DNQ A;  4A48 A;  2XHC A;  1JLC B;  1D1U A;  2H4W B;  2VG6 B;  4YHH E;  2QEX S;  4DV5 E;  3S6E A;  1V3S A;  3TUP A;  2AYM A;  2C28 A;  1X5S A;  3P49 B;  5L9N A;  3ENV A;  3WC2 A;  5L1L A;  1Q8L A;  5A8R A;  3RB6 A;  3G82 A;  4DX5 A;  2C3U A;  3ILO A;  3JTO A;  1YJW S;  3D0I E;  3IRX A;  4ZCL A;  2RML A;  5DRK A;  2VFU A;  2PI4 A;  1KOH A;  4ALZ A;  2RNE A;  4KSE B;  4O44 B;  4JI2 J;  1Z0T A;  2EFN A;  1X31 C;  4RW8 B;  4CLT A;  3G9C A;  4KJI A;  3BSA A;  2FQQ B;  4DZ6 A;  4X4V A;  3G8Q A;  3N0V A;  3OL6 A;  3PR5 B;  2DHX A;  3JB9 k;  3KLV A;  4YB5 A;  3Q1Q A;  5LSR A;  3NCQ A;  3DDN A;  4NRU A;  3HI9 A;  1WC3 A;  3FMW A;  3THV A;  4X65 F;  5KG1 A;  2WB1 D;  3GG0 A;  3WC0 A;  2DH7 A;  4OLO A;  2O3Z A;  4NCB A;  4OMF G;  4X4S A;  1RB0 A;  3B54 A;  2OML A;  4RO0 A;  5B08 A;  5D3G A;  1OQ6 A;  1XMQ F;  4CLY A;  1JX4 A;  3NL0 A;  2E9Z A;  3M8Z A;  2YKP A;  3J7Y I;  3EVM A;  1WOP A;  4R5P A;  2NZC A;  2V8P A;  4HH0 A;  3G71 S;  3LP2 B;  4DR3 F;  3C6T A;  3SQG B;  5EL9 A;  1UJ6 A;  1T94 A;  4J7C A;  3CUN A;  1NK5 A;  5HMY A;  4LF6 I;  1IBM J;  1VLO A;  1S9E B;  4YY3 F;  1RAH B;  4WUD A;  1KTV A;  3EMT A;  1JMT A;  4DXL A;  4DL5 A;  2HFO A;  1TAU A;  2DO4 A;  3PW4 A;  1NB2 A;  4CTA B;  2IVY A;  3VWS A;  1YZ6 A;  4ES3 A;  1XNQ F;  2OPP A;  4IOB A;  2EI5 A;  3TQE A;  2W01 A;  5D78 A;  5JEA B;  3UN2 A;  2E5L F;  2DPJ A;  4DSJ A;  3EXY A;  4GKJ F;  2QSW A;  3GU0 A;  2UP1 A;  4NXM E;  3KK3 A;  3QMQ A;  3U27 A;  2W2P P;  3S7R A;  4WJB A;  2X1A A;  1ZM4 A;  2F8E X;  4L72 B;  3BGR B;  1HWL A;  3RTV A;  4NWB A;  1TL1 A;  2F9J A;  4LF7 F;  1VQO S;  2YNF A;  3NKY A;  3LUY A;  4LF5 E;  3U1M A;  1L3V A;  1SL0 A;  2GO8 A;  4AUK A;  4K4S A;  3GG1 A;  4JI0 J;  4DR7 I;  1GMW A;  5E3R A;  3JYT A;  2W8L A;  3Q8Y A;  4RW7 B;  1ZZN A;  4CO1 A;  2RJZ A;  1N5T A;  3DLH A;  3TZW A;  4GKK J;  3GIJ A;  2ZC3 A;  3FSX A;  2WW4 A;  3K7R A;  3GV7 B;  3SI8 A;  5BXI A;  1NME B;  2XWX A;  1RT4 B;  2BJD A;  1PC4 A;  4DV6 J;  4FYD A;  3QRP A;  4ZVO B;  3MEC A;  3T1A A;  3LPY A;  4I69 A;  2BQ3 A;  2HZA A;  4B3S J;  1B70 B;  1ARO P;  1LXJ A;  1O6X A;  4WFY A;  1PG5 B;  3FDS A;  5FJ4 A;  4KFB A;  3TX8 A;  4DUZ E;  1NU4 A;  3CF5 Q;  3V6K A;  4KIA A;  4WXW A;  4DL2 A;  3ZZO A;  3FFI A;  2CG9 A;  4B3M I;  4OX9 I;  2FHJ A;  4IYQ A;  1I3O B;  2R8K A;  2HQ3 A;  4C0O C;  5CCL A;  1WHW A;  3PVX A;  3ZKB A;  2F1F A;  5F8G A;  4JI4 J;  3CJQ A;  2WBR A;  4U8V A;  2AHO B;  3EZO A;  1HNZ F;  4LF9 J;  1HNW I;  4Y28 C;  1SV5 B;  3CO9 A;  4IS9 A;  2GZO A;  3DN9 A;  2KB2 A;  3P45 B;  2JEA A;  1XTZ A;  4J9L A;  2P6S A;  4KHR A;  4OYO A;  2DXF A;  3FMB A;  2VU5 A;  1DAR A;  2A6O A;  4ZIV A;  4UUX A;  1OSC A;  2HLU A;  3H4B A;  4K4Z A;  2NYI A;  4DR6 F;  4MKB A;  2JNJ A;  1P9Y A;  1S9F A;  1PBA A;  4HTI A;  2IDL A;  3CMA S;  5F41 A;  4RNF A;  2FVP A;  4LRB A;  4YHH I;  4DV5 I;  4EBC A;  3L7Z A;  4ECZ A;  1K1S A;  3FVY A;  2J9D A;  3NLC A;  2RHS B;  4LF4 E;  1KBR A;  2GVZ A;  2D1C A;  2OPQ A;  3Q8Q B;  1JLG A;  1RTD B;  3HZG A;  4KH1 B;  4NA3 A;  3TAQ A;  4ZVU B;  2VL1 A;  2CJA A;  2OFH X;  3PO4 A;  4K5R A;  5DDR C;  1PJ5 A;  4MIW A;  1QAX A;  3KDO A;  1TMJ A;  2RRA A;  2FJW A;  2ZC4 A;  3QZ8 A;  2MKH A;  1YRT A;  3EIC A;  5T7L B;  3TAM A;  2RU9 A;  2Z56 B;  3KJF B;  3BSN A;  4P52 A;  1UMJ A;  3O1L A;  4ES2 A;  3AA8 A;  1B0V A;  4KGM A;  3MUM P;  1PO6 A;  1FTR A;  4BA1 A;  4HT5 A;  4K0K F;  1EIY B;  1U8S A;  5KT7 A;  1SI9 A;  1RWK B;  4OX8 A;  3KKF A;  3C6T B;  3BGF A;  5IC4 B;  5E7O B;  1F5A A;  2HGM A;  5LSL A;  2J7U A;  1NKE A;  1S1U A;  4HDH A;  2V8G A;  3J81 U;  3K58 A;  1RKJ A;  2DCU B;  4OLP A;  1DQ8 A;  1U1N A;  4WF9 Q;  5ADZ A;  3CGI A;  1NK9 A;  2HLT A;  2X36 A;  5BYR A;  2X3D A;  1CUL B;  4HT7 A;  1GT8 A;  3ZZZ A;  2V2Q A;  1VFJ A;  4ZVF A;  3OJS A;  1SVD A;  3ZTR A;  2Z2Z A;  2KVI A;  1C1C B;  4HXZ A;  5JUM A;  4PCQ A;  1FKO A;  2N7C A;  3KK3 B;  4FBT A;  4GRS A;  2BKN A;  2V4J B;  4DFM A;  4RUB A;  1IKV B;  1R6M A;  1O8B A;