4HACA

Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
312
structure length
312
Chain Sequence
HSSGLVPRGSHMVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEKCNQVAEAVAGAGGKVTITKPTEQGLKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mevalonate kinase
publication title Crystallization and preliminary X-ray diffraction analysis of mevalonate kinase from Methanosarcina mazei.
pubmed doi rcsb
source organism Methanosarcina mazei
total genus 89
structure length 312
sequence length 312
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4hacA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4hacA01
1KVKA 1I94E 4LFAI 1XMQI 5LL6R 2A2DA 4JI3E 4JI7E 5A2QC 1IBKE 4GKJI 1RR9A 1EA6A 4JYAE 2J7KA 4DR3E 4KHPI 2CZ9A 4DV7I 4B3ME 1KKHA 1FWLA 1QZRA 1N34E 3PYDA 2HKJA 2VQFI 4UTGA 4JI0E 4DR5I 1MG7A 4DV4E 3HULA 1MU5A 4DR7E 1ZM3A 4DV5E 3B8HA 1H7SA 1B63A 4DUZE 4LF9E 2E1RA 4DR4E 4LF7I 3J80C 2HK3A 1HR0I 4JV5I 3LPSA 4USKA 1N0UA 2X36A 3K1JA 4FW9A 4B3RI 5LMUI 1Z5CA 1NZ0A 1FJGI 1XNQE 2GS8A 1IBMI 4X62E 4NXME 4HACA 4LF8I 3ZKBA 3ZZTA 2ZM6E 1J5EI 1VISA 1FKAE 2VF3A 3J81Q 1HNXE 4LFBE 1ZXMA 4DV1I 4LF4I 4B3SI 2DEJA 1NHHA 2LJPA 2UXCI 1XNRI 1XMOI 1FWKA 4LF6E 2F4VI 1Z5BA 2AJ4A 4JI5E 4P52A 1HNZE 4DR2E 3V2UC 3J7AG 4B3TI 4GKKE 2Q2EB 2UXBI 1Z0EA 1N32E 4DV2E 2UU9I 4JI2I 5IWAI 2OI2A 1S4EA 2E5LE 1N0VC 4X66E 3B82A 4DR6E 5BR8E 5IT9Q 3PYEA 3ZM7A 1Z59A 3F0NA 3K17A 4JI1I 1N36I 1FI4A 1N33I 4HACB 4X65I 5LMNE 4X64I 1XHKA 4DPWA 3WU6A 4AQYI 1DARA 1PKPA 4ED4A 4JI8E 2UUBI 3D4JA 4FWGA 4OX9E 3PYGA 3T1YE 3GONA 3V5RA 2UXDI 3M6AA 4YHHE 4DUYE 4DV0E 4NXNE 4KQVA 1XNRE 3JAMQ 3OTOI 4DV3I 4DV6I 1IBLI 4K0KE 2UUCE 2HHHI 3WU5A 4Z7YA 1A6FA 4WUCA 5A2QQ 2UUAI 4JI4I 2HK2A 2BV3A 2BM0A 4DPXA 4JI2E 4DR1I 1Z5AA 2NPFA 4YY3E 4JI6I 3CWVA 4LF5I 3QT8A 3T1HI 4JG4A 1K47A 4R1FA 4FWHA 4LFAE 3ZZUA 2BM1A 1XMQE 2VQEI 4EMDA 1HNWI 1MX0A 4DPTA 1KTVA 5L3JA 1PIEA 2EFGA 4GKJE 1I94I 4JI3I 1PVGA 4JI7I 4KHPE 4DV7E 1IBKI 4WUBA 4JYAI 4PRVA 4UT4A 4DR3I 2VQFE 1D6TA 2ZBKB 3J80Q 4B3MI 1ZM2A 5IT9C 4HYMA 4DR5E 4MYUA 1WUUA 1N34I 1Z0VA 4JI0I 2XEXA 2V8PA 1S16A 4DV4I 1KIJA 4LF7E 4DR7I 4DV5I 4WUDA 1HR0E 4JV5E 4DUZI 4LF9I 1EI1A 4DR4I 1B62A 1Z0BA 1Z0TA 5FLXQ 3H4LA 4B3RE 2ZITA 5LMUE 4PU9A 1FJGE 3PYFA 1H74A 1ZXNA 1IBME 2VQEE 4LF8E 1XNQI 1J5EE 3QT7A 3LTOA 2V2VA 4X62I 4NXMI 1U2RA 2HKEA 4USMA 2V34A 2ZM6I 4DV1E 2HFSA 4LF4E 2X7IA 4B3SE 2HFUA 1HNXI 1NHJA 1H73A 3WU4A 4LFBI 2UXCE 1XMOE 2F4VE 3B78A 3J81C 4PRXA 1RREA 4Z7CA 4P7AA 4B3TE 4LF6I 2UXBE 4XTJA 1Z0GA 4LFCI 4JI5I 1HNZI 4DR2I 2UU9E 4FWDA 4I3HA 5IWAE 1ZM9A 4GKKI 1Z0CA 2V2ZA 1N32I 4DV2I 4M1KA 2E5LI 3QT6A 1N36E 4DXLA 4JI1E 1UEKA 4X66I 3J7AM 1N33E 1ELOA 4DR6I 4X65E 5BR8I 2A2CA 4X64E 2R42A 5GMEA 3Q1QA 1OJ4A 5LMNI 4DPUA 4AQYE 5FLXC 4ZVIA 4HXZA 2WW4A 2UUBE 1ZM4A 4DU8A 4HY1A 2DEIA 3WU3A 2UXDE 4JI8I 4DPYA 1FNMA 3OTOE 2R3VA 4OX9I 4DV3E 3T1YI 4DV6E 1IBLE 4DU7A 5GMDA 4YHHI 4DUYI 4DV0I 2HHHE 4NXNI 4RPFA 1NHIA 4K0KI 2UUAE 4URLA 1Z0WA 4JI4E 4LFCE 2UUCI 3ZZ0A 4DR1E 4MYTA 4JI6E 4LF5E 3T1HE 4FN5A 2V2QA 1BKNA 1H7UA 3JAMC 3QT5A 1HNWE 1H72C 3ZKDA 4YY3I 3LNUA
chains in the Genus database with same CATH superfamily
4ED8A 3T1HF 5DZ7A 2CNLB 4EO6A 1T05A 2VA2A 3VALA 4CLTA 3SCJE 1FKPA 3VAJA 3GIMA 2KFZA 3W65A 1X9MA 2LDYA 4WPAA 4RLEA 5KFSA 3AQPA 3M1VA 2ZC3A 3F56A 2BA0D 2P5VA 3RYLA 4CLSA 2HQCA 2AZ1A 3FSYA 3ZO7A 3UFCX 2GNKA 4IO9Q 2EG1A 4UTGA 1PBUA 1K1SA 2R2UA 1QSSA 4UOHA 4QW8A 3Q89A 3TUIC 2A6OA 1PJ7A 4B3MF 5LSRA 1H0HB 2CQPA 2RILA 3W5YA 3I6PA 2ZH9A 1SB6A 4LF9E 1KQKA 5LSLA 1FCAA 5T41A 4JV5I 5CYMA 5BR8J 5EWFA 3RJMB 3L7ZA 2W2QP 2FJVA 4NOHA 4DLGA 5CYQA 4OHZA 1JK9B 4DN9A 5L39A 2I9SA 1K1QA 2VF3A 2DR7A 3AD8C 3EZUA 3RB6A 3KUHA 3WBZA 1CBKA 2VHGA 2ZJRQ 2NZ4A 1HLWA 3T19A 5ELWA 3PJWA 2UUCJ 2DR6A 3ZTPA 2DGVA 1L5UA 2NXUA 3H42A 1RTJA 4GKKE 3VAFA 5F3ZA 2J9DA 2WVEA 1SQGA 5D0GA 3J7A1 4J7CA 3CSKA 2D69A 2POKA 1CULB 5KFDA 1GMUA 3KKFA 1Q8IA 4UY8T 2BE2A 5F8IA 1N33I 2UV8G 5LMNE 5J2MA 1CS4B 3FEXB 3EJMA 5J2NB 4DLEA 2L08A 4K4TA 2EFQA 1VOMA 4FS1A 4DPWA 4OMFG 2CWXA 2I5JA 1TK0A 3C15B 3F44A 3GMGA 3GONA 4YHHE 4FYWB 2HNZB 5IOLA 4JV5J 1NLKL 4BA2A 4O4GB 1S1XB 1M90T 3SQOP 4U8YA 4PG5A 1HNVA 3AY0A 3OR2A 4JI4I 1S1VA 3QGPA 2BR0A 2JEAB 1QUPA 3HMJG 5AT1B 3PO4A 4LSZB 3KLGA 3LPYA 4FWHA 4ZP9A 3TZYA 1XMQE 4Y0FA 4NLPA 4FYXB 1VMBA 1KTVA 4UQTA 1IQZA 1XK8A 5KFUA 3US5A 1UEUA 1F9FA 4R8UA 4JI3I 3R1LA 4KHPE 2WZ1A 3M2UB 4ED2A 1D1UA 1HBMA 1NM2A 2COLA 1P1TA 4W92B 1Z0VA 2IIHA 1S97A 1IM4A 4F04B 4DV4I 2ATCB 3M8PB 1IR2A 3MPDA 3M6WA 3CGIA 4DUZI 2IY5B 1K9MT 1EI1A 1WC6A 4DR4I 4DZDA 4LRFA 3C6UA 1N33J 4ZCKA 2I1RA 1UW9A 1HYSB 1IXKA 4OZ0A 3QJPA 3BM7A 4Q44A 2B4OA 2YKAA 4I7FB 3NGSA 4DCJB 2YXLA 1S6PA 3NNHA 4OJGA 2X7IA 5L8RC 1HNXI 2B8QA 2MZQA 1NUEA 2KVIA 3FBEA 1B70B 3H5XA 1ZA1B 2ZH3A 1NU4A 3D66A 3TAMB 3BBBA 4JI4J 1SIWB 5KG6A 3KLEB 2W7PA 1WEYA 3QGGA 1F5AA 1HBOA 2W24A 3SCIE 1Z0CA 4OHWA 2XZTB 2V94A 3H2UB 4PG8A 3THVA 1LKZA 4JI3J 1N36E 1RT3B 3KJNB 5B0GA 4G1QB 1MROA 2KB2A 2RF2A 4OL8A 4RWWA 1VQSA 3WIUA 1T9TA 2KYXA 4OX6A 3HXMA 1GEHA 1U1QA 2R7SA 1FKPB 1KFSA 4I0WA 3P8BB 1TK5A 1WI8A 2ILYA 1UL3A 4DV4J 3OVBA 3PR4A 1TP7A 3WU3A 3DRRB 4DL4A 1IJFB 4DUZJ 4ITSA 1RT1A 4DR4J 1MU2A 2DGSA 5GMDA 1QAJA 3M8RA 3VTIA 2ZC4A 3OTOF 3OD2A 2GZOA 5HK4A 1SJRA 2G2YA 1UPMB 5KG7A 2BKOA 2OO4A 4LF5E 5GAEU 5AXNA 3M8QB 2V2QA 5CYMB 3K2YA 2KL8A 2CDQA 2UUAF 4CLPA 3ZKDA 2DB1A 1NXIA 4NI2A 4ED1A 2ERRA 1A9NB 3M7VA 2XC9A 1JXLA 1HNXJ 1U2FA 3OSPA 2PA3A 1VRTA 5H9FJ 1D9DA 1UWBA 4C0BA 5AXMA 4MU1A 1PJ6A 2AJ1A 3PFEA 2KJWA 1IBKF 1FRJA 1X4DA 3I32A 4ZCLA 5BYRA 2YWHA 2OTJS 4P9SA 4PWUA 3R5CA 4M5HA 1T8EA 1XIQA 3Q8YA 2Z5CA 4RBVA 2RU9A 3Q86A 5BJRA 3MFHA 1NHVA 3AJ1A 4N8OA 1CSJA 5C24B 3QRQA 1V3ZA 4LF1A 1RTJB 3K58A 4L6V3 2FD2A 3MR6A 5KFMA 4CH0S 3ENAA 1N0UA 2MHNA 4USJC 2G13A 1UVJA 4B3RI 1NZ0A 2DGWA 3FC9A 4KGXB 3SSSA 1Q78A 4YY3F 4IOCQ 2AGOA 2FPHX 3S01A 3W9JA 2MQMA 2DNKA 2IM0A 4M5DA 4DV1I 1NK4A 3P3GA 2FY8A 2C2MB 3P06A 4ZP6A 3VAIA 1VRUA 3IC1A 1CC8A 3EPGA 4F4XA 3Q6MA 3Q22A 5IC6B 4NLWA 1RT6B 2GMJA 3NCQA 1K0VA 2J6UA 2RKIA 2XSJA 3R2CJ 1SIZA 1HHTP 3IGNA 3P3DA 4DWIA 2AEMA 3LANA 2Z5EA 5IWAI 2OI2A 4KO0B 4BC7A 1HNVB 3CCTA 3DLJA 1ZA2B 1QSYA 4DV2F 4ZN1A 3SIPB 2HRUA 2W9BB 1WHXA 4ID8A 4ELVA 1RADB 2H65B 1Q5YA 1OSDA 4X64I 2OP5A 4KYZA 2KN4A 2VG6A 3QLHB 5DNLA 4ZP8A 4R8UB 2XBPA 1DTQB 1HWLA 1Y0HA 3ZXWA 3GFXA 2WNRA 1WC1A 1HBMB 1SC4B 3VVUA 2BJ3A 1WC5A 2F1FA 2E7WA 1T9VA 4JI8F 4N56A 2GO8A 4ELTA 4U67Q 2O5DA 4B3RJ 2QL9B 3DGPB 1Y6ZA 1A6FA 3UQSA 1JLGB 3MFIA 2EK1A 2XY5A 3T1HI 2GCFA 3C6UB 2RHQB 1GMWD 4P2FA 4R1FA 3K59A 2BM1A 5G0RA 1SJ1A 4F3QA 3DLKA 3OXFA 4DV1J 4F67A 2B8PA 4M63A 3ELHA 1S6PB 1ITPA 4ERDA 1DFDA 2Z56B 3ILIA 3J80Q 1JLBB 4B3MI 2YWKA 5K36C 1KHWA 1I6JA 3MAHA 3LUYA 4CM2A 5IWAJ 4X4SA 3CDEA 3OQ2A 3K89A 4EBDA 3AXMA 3MTKA 2BQRA 3IWNC 1WEZA 1HBOB 2B5JA 5JXSA 5LMUE 3C14A 1P1LA 2QMWA 1YKWA 2VIHA 4RW9B 1RKIA 4DQIA 2DGOA 4X64J 2HZCA 2E1PA 1U1NA 3M32A 1WNEA 1TKDA 1QJHA 3M2VA 2PIIA 2KJVA 2RF2B 5C0XB 3QT7A 1TELA 2HHQA 2JEFA 2O66A 2AX0A 3D3CJ 1U2RA 2ZM6I 4I64A 2QA1A 5IS2A 2GFFA 2KZMA 3LGHA 1CPZA 2DD8S 1VC6A 1FD8A 3MECA 1WHWA 2AP6A 4TNOA 1U48A 3NCPA 4NMXA 4KAIA 4LFCJ 3I56S 4L74A 2FLLA 5DNXA 3T1HJ 2UXBE 1UW4A 2KXNB 2WHOA 1UJ6A 1IQTA 4FWDA 3KK3A 1ZM9A 1E6YA 4QIVA 4OYPA 4A48A 4WU2A 1CEZA 1JLAB 1X4CA 4M1KA 4IH5A 1TMJA 3R27A 1RTDA 4A8SA 4NI2B 5M2PA 2AJQA 4G3IA 4B3MJ 3CDJA 3LO3A 1B7FA 3V4MA 1VRTB 4RW4A 5FLXC 1XQIA 5ETTA 2XCPA 3Q24A 4QNJA 2PEBA 4OO1C 2W4CA 4X62F 3MM5A 4AUKA 3NWRA 3H2VE 3IG1A 3GP9A 2O01C 2VG5B 3RTVA 4RNHA 1ZH5A 1EKRA 3RAXA 1NJXA 4RNNA 5GVQA 1NHUA 2KT3A 4Q8FA 5K9FA 2DHGA 4PR6A 3CC7S 4JI5F 4AIMA 3MPWA 3E01A 3W2WB 3EYZA 2ZM6J 3CMAS 2DRBA 4RNFA 2CZVC 2Z2ZA 1FDDA 3BS9A 3MOJB 3RB3A 3QMQA 2Z5BA 4DR3E 3GWCA 3G6YA 4Q8EA 2YKOA 1KKHA 2DR9A 1HL6A 2CJQA 3LP2B 2B9WA 4M5DB 3OL6A 2ROEA 1M5SA 5IC4B 3VR1A 1VRUB 3UDVA 4RUCA 1VQ9S 4DPOA 1AT1B 2JLFA 2ZBPA 1S0OA 4LRDA 3R97A 4A8XA 1OPIA 2I6WA 3SI8A 1Z2LA 2X1GA 2UUTA 4FXWA 4PYDA 3AD7C 4GRSA 2HHXA 3IS9A 3MEDB 1WG1A 1X5PA 3FDSA 2Q79A 2C3UA 4XO0A 1X9WA 3A3OB 5HATA 2RUGA 4BS2A 2BACA 3UCUP 3SV3A 1BQNA 2BKPA 5HQLA 4C7QA 2QYGA 3TVZA 2UVWA 2VFSA 2XZDB 1LXNA 1DQ8A 1Z5BA 3PW0A 3TAPA 1X5OA 2MLYA 1OSCA 3CDAA 2Q2EB 2J8AA 3FBCA 3Q23A 3WHIA 1SBRA 2E5LE 4X66E 5ETPA 9RUBA 4BA1A 1VI7A 3B82A 3F0NA 4Y65A 5JVHQ 4WYWA 2GHPA 1DTTB 1SJ3P 1NKCA 4HACB 5G0RB 2YPYA 4DR6F 3DLKB 5D0RA 2PNLA 2FVRA 2OHDA 2CDRB 3P4UB 3GCMA 1NRKA 3FSXA 4FW3A 1IR1A 3DC2A 1UPPA 3W5ZA 2QA4S 4NLYA 1VCTA 8RUCA 3ZTRA 5DQGA 2QLJB 3OTOI 2K1RA 3OPKA 1LOUA 4OYBA 1IBLI 1L3UA 2C2ZB 3ZNUA 2BA0G 4NXNF 2LXIA 1Y5NB 5DZ6A 4EYHB 2UUAI 3HFVA 2HK2A 4K0KF 5CHCB 4U95A 2VG7A 2RB7A 4LRAA 3ISND 1ZOTA 2CNNB 4DI6A 5FWKA 1R8PA 4LFAE 1V6HA 3MTJA 1VRQC 1TAUA 2HFOA 1T9UA 4B9MA 4DSIA 2QMUB 4X4RA 2IC3B 1P27B 4PXCA 3M32B 3GFZA 2VBXA 1WC4A 3C19A 5JEAE 4ER8A 4DL5A 1IBKI 1U45A 1R0CB 2DNHA 2A0FB 5KT3A 4GKJF 3D54A 3ZZOA 5KFXA 2CKWA 4DV7F 1WUUA 1ZYQA 2O3ZA 4WFBQ 2E9TA 2E1AA 3D0IE 5LT5A 5KG0A 3W7BA 1KHVA 3IBFB 4L72B 1IKXA 3KLIA 3JS9A 2W01A 2PFFB 4C0OC 3TX0A 3GZ7A 5FLXQ 4DEZA 3KK3B 1NK7A 4QBUA 2CAJA 2CGEA 3EVOA 5HO4A 2DR5A 3PYFA 2HNDB 2JDJA 3RAQA 2RDIA 1BMQB 1FFGB 1C0UA 1IBME 2OPPA 5AE3A 4ATNA 4LF8E 4ZVFA 1RAHB 1OO0B 2GGPA 4OI3A 3BGUA 4D3HA 2YBVA 2DNYA 2KM8C 2A1BA 1TL7B 1ZTTA 1HQUB 3OTOJ 2H5IB 1VK3A 1IBLJ 2IVMA 5IV3A 4LVNP 3MM5B 4RU2A 2UUAJ 3IG1B 4LRCA 1X4AA 2BRKA 4ANDA 4Q0BB 1XMOF 5KG3A 1IKWB 1URRA 3M2RA 3I5CA 3GIKA 2FHMA 2RH3A 4EGLA 4DV2I 2ZBRA 2PD1A 2M8HA 1IBKJ 1S1WB 3R5AA 3UCZP 4JOUA 3UN5A 1FXDA 4XK8C 4M94A 3PEJA 4KPCA 3P5BP 1AA1B 2AZ3A 2YNGA 3IAM9 1HD0A 1XN9A 3HVTA 1ZM4A 3D5MA 2GQCA 4JI8I 1VGYA 2NSCA 2UUBF 4LUBA 1FXLA 3GLJA 1WKLA 4PYAA 4DV6F 2BJ7A 2MSSA 2AKWB 4MYTA 3HD2A 2HHHF 3IMQJ 1AW0A 1YZ6A 4NLSA 2CPDA 4JUZA 4FVCA 4DUTA 1UAWA 5A8WA 1AXQA 2EC0A 2JC1A 1IUJA 2VPWB 1WKJA 4LSNA 5CXTA 2MZRA 4J9MA 3IWLA 3HT3A 1KD1T 3MF5A 2QZ8A 2F5GA 4ANEA 1KFDA 2Z8QA 5E3PA 1K44A 5T14A 1TL1A 1FWLA 2MEWA 4CT9A 2A18A 2DNLA 4FNIA 1WC3A 5IT0A 2QG9B 2HVEA 2NPIA 2WAQD 3C16B 2DH7A 4DV2J 2UV8A 2HVZA 1EB0A 2OEMA 2W2PP 1Q53A 3BO2A 2KVQE 2YY3A 3TNVA 3ILOA 4ZLLA 4BA1B 2VDIA 5KT4A 3NAIA 2FZCB 1WHVA 2UVVA 3MXHP 2HBRB 4LREA 3CT9A 4JI8J 5FDLA 3CJTA 1M5KC 5E3QA 2IOQA 3SYZA 1FKAF 5F41A 1OYSA 4ZKAA 5CD4H 2JEGA 4WP8A 2BR2A 5JMNA 2LQJA 5SZTA 1NB7A 4X4NA 3NGDA 1S0VA 4HI1A 1PCAA 1TKZA 2KXFA 2AJ4A 5CAAA 3VGVA 4OI1A 1XR6A 2F65A 3RRHA 2B9YA 5IM0A 2XCAA 1N32E 2VFTA 1R8AA 3UVJA 4JI2I 4FYYB 4ZDNA 2CYYA 1YSJA 3V6DA 4F25A 2IMOA 2CIMA 4OZEA 2YWGA 1RAIB 3CCSS 2BMBA 1TZ0A 4ED0A 1RHJB 1XHKA 3OVAA 3GTYX 2IBKA 5DQIA 5HLFA 3FK4A 1Y7PA 3AHPA 2JX2A 2HHTA 1NSPA 3CCUS 2HURA 3OL9A 5IZHA 2OPRA 2VESA 1FRXA 2L3MA 2ABYA 1H98A 4B3SF 4OX9F 3ET6A 3KLIB 1XNRF 3KK2A 5A0YA 1G2EA 4Y28C 4M8LA 2E5IA 5HVFA 1DLOA 3QT8A 4P2SA 5KOWA 2R2SA 4JG4A 3V6JA 3MUVP 1QVGR 3H40A 3LP0A 3DLEA 1C0UB 4WXWA 2CPXA 2OPPB 1YI2S 2GGPB 2G1DA 3HT0A 4WUBA 1J5OB 5H9EK 3PRBA 4C8MA 9ATCB 3LALA 4YUDA 2HNYA 2KYZA 3CCES 3PX0A 1MLAA 1AUDA 5HMWA 5F0WA 1EX8A 3JYTB 4DR7I 3AODA 1HR0E 1R43A 3J7YI 2CPFA 2B3TB 3PHTA 4PG6A 2XMAA 4LCHA 3FJ2A 1RT7B 1LWCB 3GG0A 4JV1A 1X4HA 1YBUA 1IWGA 1NJWA 3JB9k 1RU2A 2HWIA 3MAQA 4N47A 4ZN3A 1M1GA 2ZBCA 1RGVA 3MDFA 2L48A 2YKPA 3QYYA 3HVTB 4J9KA 2BZ2A 4MT1A 1RB0A 1HNIB 3U1LA 4M5GA 1EZZB 5HN0A 3J81Y 4IRDA 5KFQA 2DNZA 3B4MA 1WF2A 2ROGA 4NLDA 5KFKA 3FQLA 2CJBA 2QT7A 4L73A 1P9QC 4NX9A 1T94A 3C46A 3D2WA 1G7CB 1NPKA 3H1CA 5ETLA 5A8WB 4A8FA 4DR6I 2W2MP 5HP1A 4LSNB 4LIWA 5HMYA 3JQJA 1OJ4A 5ETNA 4LR7A 1UKUA 4HHJA 4AQYE 1JLEA 1U0HA 1C4CA 1XNQF 1MSWD 4HH0A 2YKNB 2YQ1A 2HEKA 4DR7J 2HW3A 1QAIA 1CLFA 1B0TA 5JUMA 2N7YA 2VKZG 2FJWA 4NXNI 1TUGB 3BSAA 2PO0B 2K7KA 2Q1LA 2MKCA 4K0KI 2CPZA 3TA2A 4KBIA 5D4LA 1Q79A 2FHJA 4MKAA 1UWAA 1BKNA 3DXSX 4IG0B 1LW0B 3SFUA 2R2TA 4YS2A 2AWZA 3OJUA 1WEXA 4NA3A 3W64A 5B0EA 2DVIA 4JI7E 5A2QC 1DBDA 2AEFA 4Y2CA 2HMIB 4GKJI 3H5UA 1RR9A 5KFVA 4RW7B 4DV7I 3OT9A 2IA0A 5FDLB 1EQMA 4FDFA 1RA6A 4CH7A 3U7JA 2NXEA 3V6KA 3A8JA 1IKVA 5DLGA 3B8HA 2G1HA 4M5LA 2DTJA 2V4QA 2RQKA 2E1RA 1JKHA 3NWGA 2XS7A 4KKOB 2AF6A 5IM0B 4DR6J 2X36A 4IZJA 1Z5CA 3R7BB 2VPYB 1FNXH 1I1GA 2GIRA 1YITS 3Q8PB 1KP6A 2B4UA 3Q83A 4BC9A 2BQUA 3PW7A 2VA3A 3CCZA 2WB1D 3UR3C 2VONA 4B08A 2B7BB 3RBEA 4I6WA 2KFNA 5HLFB 4NXNJ 1RXOB 4QYZK 4ZIWA 2C2EA 4U9RA 2NYIA 4K0KJ 3QIDA 1XMOI 3EE3A 2F4VI 4LMZA 4BDPA 2KG1A 4DR2E 2F1DA 3LW5C 4AIDA 3CCRS 3HHDA 3DRPB 3SDEA 1H7WA 1FRMA 5DDPC 3HSJA 3OLBA 4FNHA 4GKKF 4O0IA 2DISA 4GKJJ 3J7Z5 4P2MA 2FVSA 2VFRA 4DV7J 2HS0A 3ITHA 4ECQA 4RO0A 3UO0A 5LMNF 1J5EF 2R8HA 2UUBI 2EPIA 5KFNA 4ZVGA 2XI2A 1YJUA 2EKNA 4ZCMA 4O44A 1EP4A 5FIIA 2GQ0A 2HNYB 4M5NA 3TARA 4DV6I 5DJBA 5C0XC 2HHHI 4X4QA 3WU5A 4YHHF 3MZIA 4O3PA 2MB0B 3WDOA 3W9IA 4JI2E 4LQ3A 1FKOB 5CD4A 2V4JA 2HVIA 2XMMA 4ANCA 2HFNA 5AE2A 1GT8A 5K14B 8ATCB 4OX7A 1XMQF 3VGSA 4URQU 1GTHA 1OY8A 3MCSA 3PX6A 1XMOJ 2F4VJ 3I31A 4KHPF 2M4MA 4S0MA 1LK7A 1UVLA 3NBPA 2BJ8A 1RI7A 3ISNC 1RACB 2JEBA 1S5ZA 2IJNA 1RAAB 4KQZA 3LGMA 4LF7E 1XR7A 2MQNA 2XWYA 4WUDA 4DDFA 1HWUA 4FVMA 2HQ3A 5HJYA 4HDHA 3AFGA 2KU7A 5JEAA 4U96A 1TV6A 1WDTA 4C9DA 2IDEA 5C2CA 5L1IA 5DQHA 2KDOA 4KC5A 1WACA 1E6VA 3KJFB 1BWVA 2OJ3A 1F6TA 2UUBJ 2ZH5A 5BXIA 4H54A 1VIXA 1HA1A 2ZH4A 1KVJA 2ZKTA 1NAQA 2HFUA 3N4WA 1JLEB 4YR0A 2WB4A 4DV6J 1R31A 4GO5X 1CJTA 1U4BA 4TU9A 3QIPB 2HHHJ 4YEAA 3MWBA 2LQBA 3RW7A 3RB4A 2PI4A 4X4VA 3HK2A 3BGOP 3QFHA 4B3TE 4PQUB 2RS2A 1S9EB 3ZTQA 1UFKA 3DNCA 2LECA 2VPXB 1TL3A 3R5JB 4NA2A 4DSJA 2EK6A 4USHA 1NMEB 1QLNA 4GVBA 2MQOA 4KGVB 1JX4A 4DV5F 2EFVA 2DK2A 1FF2A 3CD7A 3UDEA 3D6TB 3IXQA 1MWYA 1F3VA 1C1BA 2C2OB 1H2VZ 1FESA 2DH8A 4OJ3A 1WI6A 3H98A 3LPEA 2M52A 4OX8A 5DG7A 2O1PA 2Y1LB 3MUTP 1QSLA 4DG1B 3IRWP 2Z0GA 1QE1A 2DEIA 4DFPA 5LSOA 2LEAA 1TK8A 3OBIA 4OX9I 1TL4A 4DV3E 4W90B 3NP5A 3Q8QB 4CYUA 1YJ9S 4EK2A 1NZ8A 4A47A 5KFBA 4QWEA 3K5MA 2PFDA 2LA6A 4WFXA 1RWXB 4J9LA 2DNQA 4J90A 3OTBA 1SH0A 3AQOA 3P45B 1HNWE 2D3O1 1P42A 2QFJA 5DRPA 5C25A 4IZJB 2Z2YB 2FLNA 4K4VA 3R9LA 3FMBA 3NL0A 4J9VA 1RZMA 1WG4A 4TN2A 4URGA 4Z37A 5LOQA 4BLGA 4UW2A 3R7SB 4I67A 2CQBA 1RWNB 2RVJA 1RT2A 3H5YA 3PYDA 2N3OA 1UFWA 2GX8A 4HI2A 4C97A 3G6VA 1XERA 4KHRA 3PW4A 1V3RA 2KH9A 3W2VA 2HK3A 1VFJA 4ILLA 2B56A 3IWXA 3Q8RB 2JNJA 3SDEB 2HZAA 3LGNA 1T3OA 3LF0A 3PEHA 4TKTA 1HBNA 4IR1A 1FHTA 3TOQA 1PGZA 3ENWA 1QTNB 2K7JA 3A12A 4B17A 1GNKA 3I4PA 2HGNA 2DO0A 4OX9J 1PJ5A 4RX6A 2CNOB 4NLXA 5IQQA 3MEEA 1XNRJ 2H5JB 2G9OA 2X51A 3TEHB 3DOKB 1C2PA 4A8KA 4O44B 1EP4B 4FP9A 4TYAA 3J7AG 1YGYA 2F8EX 3I5BA 3HLUA 1YRUA 2UU9I 2CQ0A 1S4EA 2EBGA 3KTQA 3VV2B 1N8RT 2FZKB 4C2MA 1Y3JA 3MD3A 2LA4A 3GYXB 1UDQA 3ZZYA 1JJCB 3DFEA 4FBUA 1U1LA 5DGBA 4EEYA 3ONQA 1DARA 3ICLA 4L75A 4M95A 3TQEA 2MKSA 2DR8A 2CJ9A 5C0XE 4DUYE 3NBPB 2M7SA 5KFJA 2HRYA 4FW5A 3AA8A 1Y10A 3BREA 3MM8A 1E3HA 4RW6A 3FZBA 3AT1B 2MPUA 5A8KA 4BBYA 4HLBA 4ZVEA 4DPXA 5JEAB 3T1AA 1K47A 1TV6B 1SKUB 4R5PA 2V5HG 3JXOA 4CP5A 1WJ9A 2GC8A 4IFDB 4IO1A 3MI7X 1RT4A 1E6VB 4PCQA 1OQ6A 1JXEA 2MQLA 1T7PA 1N5YB 2EC2A 2ADBA 5A76A 3LP1B 1D6TA 4CZCA 3A4TA 4CH1A 1YRTA 4LOMA 3FEZA 1RHKB 1VS3A 5LXRA 2UU9J 1SV5B 4WBFA 2LU1A 4MK9A 2AD9A 2HVDA 1X4EA 4LF9I 5I4MA 4PWDA 2H4WB 2FVCA 2KT5A 1BLUA 4ZPVR 5F9LA 1TL3B 3H4DA 4GVBB 2H54B 3D0GE 2XSFA 2AYGA 4OI4A 4IZJD 2QC3A 1C0TB 4F26A 2JEJA 4IFVA 1RTHA 3IO1A 2MTLA 4LF4E 2X3DA 3KFWX 1RAFB 1H73A 3PV8A 2B4VA 5IQ6A 1S6QA 1WG5A 4C98A 1BXNA 3U27A 3OR1B 2CXEA 2CVIA 1LW2B 4ZA1A 3DOMA 2QA2A 3HHEA 1GAOA 4H4KA 2ZH7A 4GKKI 2DHSA 4ZOSA 4DV4F 3N6LA 2UXBF 3BGRB 2B6AA 4P74A 2CNKB 3EDQB 2W4PA 4X65E 3ZTSA 4U7UK 4P71A 2RQMA 4KV8B 4ZPAA 1MMLA 5LMNI 1MWZA 2LMIA 1RCOB 4N3OA 1LWXA 2WW4A 2MXYA 2NXCA 4DU8A 4HY1A 3N0VA 2V6AA 1RT2B 3N5BA 1B7YB 1X4FA 2QLBB 4LF9J 1FRKA 3NNAA 1EHWA 4MKBA 4YHHI 4FPRA 1CG2A 1RBLA 2IFXA 3GIJA 3CULA 1BQXA 1HBUB 2OFGX 2XULA 3W2VB 1T9WA 5CA5A 1FX2A 3ADAC 4F4AA 1XWLA 1XBWA 4USUA 3G96A 3JAMC 1SUQB 3G6XA 2RQ4A 3LNUA 3M30A 3Q8VA 1HI0P 2WSFC 2XGQA 3H8YA 4J9QA 1XMQI 3CO9A 4DL0C 1S57A 1HBNB 1WDDA 3DDIA 1TL5A 2CJAA 4QQBA 3BO4A 2ALZA 1SL0A 4KHPI 1M0SA 4ZIVA 2BVZA 2XYGB 1N34E 4E2FB 1JLFB 4DR3F 4JI0E 1SJQA 3I55S 3BQ2A 1MG7A 4CDIA 3PY8A 4GKKJ 4C11A 2CQIA 3I0SA 2MHEA 3P76A 4ED7A 2HAIA 5JEAD 1NPRA 1VQNS 1SI9A 1CULA 1T03B 5LMNJ 1X0PA 2NR0A 2XMJA 2MSTA 3B6BA 1A6LA 2A6MA 4OZ3A 1VISA 5J2NA 2OPSA 5J1NA 4P72A 4LFBE 2APOA 4YHHJ 4FYDA 2VBWA 3C15A 5DS7A 1FFSB 1H38A 2GQQA 1WKKA 4TY9A 1FRLA 3BSNA 4KSEB 3A8KA 4LF6E 4WWSA 4B3OB 2DGQA 2V2KA 4P52A 2G0JA 3R6LB 2J7UA 4U7UD 4F0HA 4TY8A 4O4GA 1S1XA 2M2BA 4X4UA 4RW6B 2ZH8A 1YBTA 3KK1A 1YG0A 3K8VA 3I96A 1XMQJ 3O2IA 3KJQB 2LKZA 3BH6B 4OQJA 4ES1A 2BRLA 2YVSA 2Z57B 1VR6A 1N36I 4KHPJ 2E5LF 1S76D 3MOZA 3VAHA 4X66F 4OFZA 1AFIA 1KEKA 3W60A 3H59A 2NQPA 3SEOA 2LXFA 3AB4B 4LRBA 3PRYA 3R6GB 3L7OA 4QIWD 4I2PA 3M2UA 4NASA 3LA0A 1FE0A 2MKHA 3R7NB 1RKJA 3UD4P 3V4IA 2UVRA 1UVKA 2C28A 4DV0E 2Q3PA 5DGAA 5E2QA 1N5SA 3M8PA 3TR5A 4OHYA 4X2BA 2FJAB 2VODA 1QY7A 1TFYA 4PWDB 2NREA 4HDGA 1Z5AA 4YY3E 3NRBA 4LF5I 4QIGA 4NZ6A 2HLUA 1HYSA 5THWA 1M1HA 2VQEI 3IM9A 4O4RA 1NB2A 2EFGA 4MK8A 1LV5A 4E0DA 3UE2A 4LFAF 2LYVA 3TA0A 2RHSB 1NBEB 5IT9U 2VV5A 1RTHB 2PO2A 4LCFA 2Q66A 5JEAF 3HHKA 2O1VA 4DR5E 5D0EA 1D09B 3HSZA 3TAMA 4RZRA 4NCGB 3PNIA 3KLEA 2WSCC 4DCOB 2DRDA 3PKMA 2QX0A 1FVQA 1WWHA 3KLHB 4K2JA 1N36J 3T6JA 1HWJA 3H4LA 4O3RA 2PGCA 1OYDA 4CO3A 5DLFA 4K7QA 2B6AB 1RT3A 3W5XA 4EO8A 1GMWA 4G1QA 1S9FA 1D9FA 1FVSA 5A2QU 2AQ4A 5DROA 4ZHRA 3DM2B 1NSQA 3P3EA 1IBMF 3P6YC 4LF8F 2NYHA 1YIJS 2QJ3A 3SCKE 1VDHA 3NAHA 4RR5A 4LPFA 4QWAA 3MM9A 4ISAA 3CPWR 3DRRA 5FJ4A 3J81C 2XNQA 1ZPVA 4LF5J 2R9LA 2QE5A 1Z0GA 4KY3A 3I0RB 1B64A 3CJ8A 1DJ0A 2RDDA 1TVRA 1FX4A 4PWWA 2V2ZA 2QSFA 1BY9A 3M8QA 1R0AA 3KUEA 4JI1E 1WF1A 3QFWA 5D78A 3GMEA 1N4LA 4UZBA 3M30B 3MPVA 3W62A 4QYZJ 3G4SS 4RKUC 2IM3A 1BUXA 4WTOB 4KJIA 2GHVC 3AB2B 4CO2A 2BANA 4OO1F 3W1YC 3CEDA 2ZM6F 1LXJA 1FE4A 3SCLE 2R3VA 1OIAA 4J9UE 5HROA 3CJRA 3CVKA 1TUVA 3BZQA 4KHMA 2V68A 5C24A 2ZJQQ 4C11B 1S6OA 2C39A 3ZC4A 3D6MB 3ZZ0A 2R7OA 3I0SB 3P5TL 1S99A 4FN5A 2IAJB 4J9PA 2O1TA 4N41A 3OHBA 4F2RA 5F0UA 1WOOA 2R7XA 1RQ0A 3NS6A 4CLFA 4JB8B 5LJ5Y 4M5IA 3PW2A 1EQ0A 5B0FA 2AT1B 3O6QA 4DX8H 4GQUA 4JP8A 3CCJS 4PG4A 3HM9A 2C3MA 4JYAE 2P6SA 2W2OP 2R7UA 2OPSB 2ZFHA 2ZWOA 4MKYA 2D7SA 1RHUB 1KN6A 2E9ZA 1R8CA 3ENVA 2WTFA 3UR0A 1ZM3A 3OXGA 3OJSA 1RT6A 1G1XA 2GJIA 3DI6B 4LR9A 1YJRA 2J65A 4TY8B 5KFCA 2W2NP 4WIQA 2X1BA 4KO0A 3KK1B 5LMUI 2GW8A 4DQQA 4KT0C 1L3VA 1HHQA 2W9BA 4X62E 5F8HA 3W9HA 2E7XA 3QNWB 4OI6A 1HPZB 2CG4A 2JL9A 4ALZA 3QLHA 5KFOA 1APSA 4CNYA 4WZMA 4WU3A 1RYSA 3EICA 1BD6A 1DTQA 4K5RA 2DNPA 4OYOA 2EXUA 1EAYC 4I2PB 2Y1IA 5HVGA 3NGRA 1RUSA 1FEEA 3V4IB 5BYQA 5F8JA 2R7QA 3I4HX 5B0CA 4E8UA 4JI5E 2OIHA 1TR0A 2UXBI 3DGPA 2ZOFA 2DGUA 2HBQB 3GJSB 1JLGA 2XTJP 1N0VC 2XLIA 4EYIB 1SQEA 3NXZA 4MTPA 1HW8A 3PJ9A 1N32F 3RU0A 3PYEA 1Z59A 4F02A 1O6XA 3MHYA 2E5HA 1SVDA 3L7PA 2FVQA 2XHCA 2P6TA 3JSRA 5I42B 3NEKA 3OTDA 2SXLA 4RL1A 1OPZA 2MZTA 2VBZA 2FYXA 1KR4A 1PKPA 2ASYA 2PO2B 3DCAA 1JLBA 3PYGA 3T1YE 2DHXA 4YDXA 3BYRA 3MURP 2C2NA 1UJ5A 5KFZA 4ID5A 5D3GB 3GV8B 4KPYA 3GU0A 2F4FA 2MGZA 3RB0A 5LMUJ 2FIUA 4Z7YA 2EBEA 2DY1A 2G4BA 2ZDPA 3FQKA 1IKYB 4OZ1A 2C37B 3NS5A 4B9SA 4FW7A 2QEXS 2BQ3A 1HKAA 4RW9A 2WOMB 3TYTA 1RWOB 4LBIA 2O3DA 3TJ9A 4C48A 4ED5A 3GJQB 2NS1B 5C0XA 3BSCA 1IBCB 5A8RA 1PVGA 4ZHRB 1UZDA 3Q6NA 2C3PA 7AT1B 2ASJA 4DR3I 2CJKA 3B4DA 1RAEB 1X0FA 3MMAA 1F9HA 4D3GA 5IT9Y 2UUWA 1T9XA 2UXBJ 2IDLA 3MM9B 4FF3A 2X3GA 2E1MC 4PPDA 4N8NA 5E41A 5LJ3Y 2HHUA 3PDNA 1JJHA 2GAGC 3CC2S 1O5JA 4FXVA 1IBLF 5D4PA 2Z4PA 1HR0F 1TVRB 1JLAA 2F63A 1R0AB 3QO9B 2VQEE 3GYNA 2HHSA 4RWXA 1WELA 4EUVA 3BKUA 2B9EA 3QRPA 2R2RA 4RW8B 4HT7A 5A2QY 2QN6B 4IZKA 2CJXB 1OY9A 3BGFA 3NMRA 3MPYA 1O51A 4DZ6A 4BCAA 2BANB 1SKSA 2YNHA 2UXCE 4EBEA 2O67A 4OV6A 2BOPA 1GXLA 1RREA 3PFOA 2VG5A 4ZVOB 3CDUA 4P7AA 5J2QB 5HROB 2IRXA 1X4GA 3F41A 4XTJA 5SUHA 3AH6A 5T7LA 2C39B 4TVAB 2ZZTA 3FRYA 3V6HA 2E5LI 1VQ7S 3TVKA 3L9ZA 4X66I 2AYMA 3QSIA 3W2WA 4IRCA 1YJWS 2ZBIA 2LU2A 1W7WA 3CJ5A 1S0NA 4DR3J 4Q43A 2DHHA 2J0WA 3RAMA 5EKWA 3OL8A 4LF2A 1JQGA 4LT6A 1RAOA 2BDPA 3UCGA 5HMXA 3LP2A 2UXDE 1FNMA 5C42B 4CO5A 3VWSA 2DXDA 4Q2LA 4PUOA 1B4SA 4I2QB 2RD5C 4QJVA 1HWIA 4Q7AA 3W61A 3QBCA 4U8VA 4USIA 5ETSA 4I1TA 2JH3A 3CD0A 1J27A 2JFDA 2NZCA 1SJFA 1ZTWA 2Y3YA 3PRVA 1PAEX 3DLLQ 4LFAI 3MEDA 3ETOA 5GMKa 3IN5A 1VQ6S 1FDNA 3ZNJ1 1OYEA 2IBOA 3QJLA 2WW8A 2V4RA 1R6MA 2YPZA 4JI7F 1N6QA 1CJKA 2KZZA 3BQ0A 4W98A 5U47A 4MIWA 1UFLA 2GO9A 2HRTA 1S12A 5HMZA 4EU0A 4DF4A 2E5LJ 4Q5VA 4X66J 1NJIT 3HJVA 4H4MB 2PO1A 1EETB 1AROP 2YNFB 4RNMA 4B9LA 3ZZRA 3IP0A 2Y0SD 1NHKL 2HG4A 4FPIA 3D3BJ 4CTAA 4HTIA 1IBMI 1DTTA 4HHUA 3KNAA 4HACA 3ULHA 4LF8I 5EX3A 5G4DA 4WE1B 3PM9A 1ZS6A 2WVFA 4RU9A 1U7LA 2P9GA 3L7UA 4AL5A 5JEAC 2EI5A 6AT1B 3FNNA 1LWFA 4IQXA 1GK8A 1MN9A 1R6YA 1NSKL 4IFDC 4ID5B 2I38A 1OS5A 4OYZA 3QJJA 4ZPBA 4M5JA 1RT5A 5GADU 1TKXB 2EFOA 2MGZB 2L9WA 1NK5A 4LFAJ 4WK1A 1VBZA 2RSQA 3BDEA 4AXIA 1YRXA 1NH8A 3I87A 3T9ZA 1Z1ZA 4CIOA 1MMNA 3BO3A 4M5MA 2IC3A 2HHVA 2VH7A 4QU6A 2DO4A 2CG8A 4P75A 4Y3CA 2MQPA 2A3JA 4TLQA 1U8WA 2FGOA 5A8RB 2Y1RI 4R25A 3WU6A 4M5KA 4DOZA 1GXUA 1GX5A 5ETMA 2PSZA 4PZVA 2OGUA 1D3WA 3A3NB 4DS5A 1CC7A 3MMAB 2V8DA 1KTQA 3IR7B 2IRYA 2QIFA 3CIZA 1RK8A 4KQVA 2BA1G 1U02A 4GVLA 4TQRA 3CCWA 1RWPB 2KHDA 3N5FA 4YB1P 4HKQA 1FJEB 2HS3A 3NGKA 1S1TB 1IBMJ 4QWBA 4LF8J 3BB5A 2HNDA 2MKKA 4YFUA 1B0PA 3OL7A 2D1CA 4JI2F 2D9PA 4HTJA 4Q2MA 3O3LA 4DFJA 2DITA 4WJBA 3HZGA 1TL7A 1D9AA 1HQUA 2OSQA 4UT4A 1KBRA 4U3DA 2GVZA 2ZBKB 4IZKB 2BBEA 4MYUA 2CVEA 5D15A 4IH7A 1JLQA 2YNHB 3I5AA 2JLGA 4Q45A 4WYLA 4AXJA 4WP9A 2IA6A 3UNGC 4Q0BA 3ILJA 2XY6A 2V8HA 2NXJA 4CT8A 4MU4A 4RJVA 1IKWA 4Y2IA 2NN6E 1UP1A 3NG8A 4LF7F 3OTCA 3JAMU 2OELA 4PKDB 5T7LB 3OFGA 1CJVB 1S1WA 4OZJA 2I8EA 1OWXA 4KH0B 2C2DA 2CUYA 2V2VA 2EFPA 2V34A 4QIEA 3I82A 4IOAQ 4B3SE 2J5AA 3T5HA 3G82B 3D0HE 3VAMA 3RW6A 2H3EB 4MMOA 4KH1B 2M5YA 1RLDA 4KGMA 2XS5A 2M9KA 2QL7B 5E3AA 4PUOB 5JVGQ 3CJ2A 2VFVA 1WC0A 3CJ0A 2ATLA 2E1CA 4U6PA 1GTEA 4B3TF 4UY85 1MW7A 2VBYA 5DRRA 4DR7F 1N32I 2ZEJA 1N54B 1E3PA 1PO6A 1SL1A 4DXLA 1UEKA 3KDOA 3DRXA 3THTA 1VLYA 4AM3A 2FZGB 5J1PA 1V5VA 5KFIA 2U2FA 3LH2S 1U24A 2YQ3A 3K7RA 3U1KA 1XMBA 4J5OA 4Y2AA 3JSMB 1XJWB 1RJJA 3UDCA 3UD3P 3TJ8A 1REVB 4LQ9A 1N6QB 2RMLA 1CJKB 2DKOB 2FHOB 1S77D 2ZOGA 1RA7A 3KHLA 2XWXA 3BR9A 2HYIB 2OH2A 2IPOB 1QAXA 2K3KA 2RNEA 3C16A 4ECXA 1KOOA 2ASDA 2OPQB 4DV3F 5ETRA 1FTCA 4AL6A 3GFYA 4JI6E 2C3OA 4MIAA 2M88A 4HVZA 4CRJA 1H7UA 2PO1B 4CCHA 4MU3A 2PA8D 2KTQA 3BBFA 4K8RA 1KVKA 3RR7A 1I94E 1Y5YA 3AJDA 2A2DA 4CTAB 1HNWF 2DPJA 4UUWA 3O5TB 2R7VA 5C0XD 1MWQA 3TUZC 2PDAA 5HSPA 2AIRB 4QOTA 2IHR1 4TU8A 1VC0A 2E66A 3PR5B 2UVUA 1Y00A 1QZRA 1VHFA 1Q8LA 1YVFA 4DN0A 2ZD1B 1MU5A 1S9GB 1LWFB 2W1BA 5F8MA 1B63A 4DFMA 1N32J 3HPOA 1I5OB 2J0SD 1HQ2A 3CJSA 5EL9A 2DPIA 4IH6A 2CA9A 1F2GA 1CJUA 1RT5B 1ZAWA 1HR0I 2IM1A 1X4BA 2X1FA 2F9DA 2FVPA 4C8ZA 4NLTA 2CPIA 3CJKB 2VKRA 2YWWA 5E3CA 1YWXA 1YLXA 1GQEA 3P49B 1S0MA 3QWPA 1XNQE 2FJBB 4NXME 2ZE2B 3MR7A 1KS2A 3KNGA 2PNZA 2JRSA 1USVA 3MR2A 2VOPA 2VD3A 3GE9A 4IFDE 5DG8A 3T41A 1RISA 1NJZA 1WSVA 5KFYA 4F0MA 4RBTA 2JWNA 4ECWA 3MR5A 2C2RA 1HNZE 1VJWA 4TLRA 3L4BC 3EDRB 2QTWA 4DMZA 3TQ1A 1FDAA 4EZ6A 1IJEB 1YBAA 2ACMA 1Q86T 1PSDA 2F40A 1U49A 4OYWA 2RT3A 3C66A 3U02A 2BA9A 1M5HA 1K0TA 4DQSA 3JQKA 1V9OA 5A6PA 3QZ7A 1Y4SA 4MU0A 4H4OB 3M9OB 4LSLB 4AQYI 1J5OA 2LQ5A 4DHVA 3QZ8A 4H4KC 4C8KA 3A3PB 3RRGA 2GVZB 2EKYA 3J81U 5KFAA 1P8GA 4G6VB 2HQDA 1X5SA 1HR0J 4KTQA 3JSBA 3V81B 1FJCA 1JLQB 2WBRA 3JYTA 1NDCA 4XTTA 4DL7A 3EVMA 5C0XF 4DUYF 4C8NA 1O0PA 4AD6A 2F4VF 2Y0BB 2BM0A 3BKFA 1U47A 2LQ8A 2VPZB 2D3UA 3NMAA 1RT7A 1LWCA 4HEA9 3HJCA 4C8LA 2FLOA 1CQNA 1PIEA 3KHRA 2YTCA 3AD9C 1RHYA 4JI7I 2PMWA 5K8OA 3G2XA 3TJAA 3RG6A 2AJ2A 3M85D 3EGWB 3W8PA 2VQFE 2HGLA 3DKDA 4AT1B 1A7GE 3W8GA 1HNIA 4DX5A 2CPYA 2CJYB 4NEYA 4ZLNA 4XPEA 3KOAA 2YNIB 1L3SA 2KO1A 2KKHA 3EZ5A 3JTPA 3HHLA 1Y3KA 3TRGA 2EEYA 1Z0TA 3T5JA 2VJUA 2RUSA 5CCLA 2PI5A 1O8BA 1RTZA 1SJ4P 1FJGE 2OMOA 2YKMA 4RNOA 3CJQA 1R6LA 5K8MA 6FDRA 4CI0B 4NEZA 3JAMY 2XZWA 1T11A 4AQYJ 1J5EE 2FJEB 2QL5B 1VQ8S 3EUNA 4F50A 1W26A 2HWHA 2IJFA 4MH8A 1NHJA 2YKNA 3D1HA 3EZOA 1VLOA 2FGCA 4ZS6A 4USVA 4LF4F 2V9WA 4PRXA 4NMLA 1VQOS 1RWKB 3DU5A 2RRBA 1F60B 4NCAA 2PO0A 2AGPA 5J2PA 1ZZFA 3U1NA 4KFBA 3OFFA 4DR2I 3GPAA 4IQMA 5E33A 2DT9A 2CQDA 1RU1A 5D0HA 4WFAQ 5KT5A 3SQGB 4IG0A 1LW0A 2FLPA 3PX4A 4E98A 3L3CA 4JI7J 1UVMA 1F2HA 2ZHAA 2L41A 2MLZA 5FD1A 2GAHC 2HMIA 1GFWB 4TXSA 2XMUA 2HBYB 4DPUA 4X65F 2HBZB 1T9YA 4RW7A 2KT2A 4O3QA 3LWMA 4YR3A 5B0AA 1BHNA 2V8VA 1XXEA 1KLNA 1IR0A 4DPYA 4I69A 1FK9B 1PYSB 2CPJA 3T5KA 2ZKUA 3MMBB 3CCLS 1S49A 1U1MA 1DQ9A 3OUYA 3IRXB 1Q95G 4KKOA 4DR1E 4ILRA 3AAWB 1CJUB 2MY8A 3QAEA 5E3RA 4NWBA 2C22A 1RBOB 3EVWA 2ZH1A 5M2UA 1HW9A 1X60A 3BKTA 5KFTA 3CF5Q 3DD6A 2DNRA 5A6WA 5L9XA 4WF9Q 3KMQA 1LNQA 2PNZB 5DDRC 3MEKA 1VBKA 3NLCA 3TA1A 4DR2J 3DU6A 1U1OA 1H6KX 2IYIA 4DV5E 1N34F 4ZVPB 4JI0F 3O44A 2DNGA 4LF7I 3J80C 2ZBQA 3PCOB 2VASA 4WXOA 1L3TA 2G2OA 4J37A 2MY7A 2QGFB 1HHSA 2YX7A 3D68A 3DRPA 2ZDOA 2WRMA 2J9CA 5E7OB 2D3ZA 2XM3A 2N4DA 1S7IA 1GH8A 1KNZA 2V9KA 1T05B 2PEHA 3DN9A 3M05A 4QW9A 3M1VB 2W7OA 1NKBA 5KT6A 4WCEQ 3MM7A 4I56A 1U26A 2L9NA 2GJFA 2LJPA 4LFBF 2DCLA 2Y9HA 2HHPA 2JHEA 1NH7A 4WK3A 3CUNA 3FSIA 4JI2J 4B3TI 1JXVA 4DFKA 1Y5LB 1Z0EA 1WOSA 4R0JA 4LF6F 2RRNA 3L7ZB 1D8YA 2FC9A 1KWMA 1RHMB 2OKQA 1FT8A 5HVHA 2JVRA 1FKOA 1F0XA 3DLHA 4XPCA 5BR8E 5CYQB 3ZM7A 2IMWP 2F8HA 5K14A 4V19X 5E0OA 1F5CA 1NNDA 1WHYA 2MZJA 2FC8A 4A8YA 3GQCA 5IT4A 3DRSA 2GIQA 1B99A 3CWJA 4B9UA 4ECUA 2AGQA 3BN7A 3DDNA 4ETZA 1RABB 1MMDA 4P73A 4XDCA 4B9VA 2OTLS 4LF7J 2LVWA 2FJXA 1UMJA 2J76E 2R8KA 2GVDA 3S1TA 4DV3I 4CNZA 4Y2MA 3GIRA 2UUCE 1YX2A 2BEFA 4DV0F 3CJ3A 1V3SA 2W9CA 3HHLB 1X7VA 3CWVA 3BF4A 5L1KA 1NDPA 1QUVA 3ZZUA 5EWEA 2BE2B 2FY1A 1HNWI 2YKMB 2UU9F 4DPTA 1M5PC 4O3NA 4A8QA 4PRFA 5J2MB 1M5OC 2ZNYA 2XNRA 6FD1A 5KFEA 3NOCA 2J7WA 1SC6A 3AOBA 4EWTA 2I5JB 4OYIA 3BDPA 1ZM2A 5IT9C 2DGTA 3QIPA 4B3TJ 1DURA 3BJYA 3D28A 1G6BA 3FRZA 4G65A 4NPOA 4ZJQA 4BA2B 4DR5F 5I3PA 4P6QA 4PQUA 3K57A 2C2KB 1S9EA 1QD1A 3HI9A 2CZ4A 4JV5E 5J2PB 3OR2B 1S1VB 4KFBB 3KLFA 1S1UA 3ZZPA 3VZIA 3KLGB 1B0VA 2MQQA 2RU3A 1RAJA 1PILA 3VAKA 3R5GA 1SC1B 1Q8BA 5K5MA 2J6TA 1RBAA 2NSBA 2WVDA 5EUHA 1YK9A 1VQ5S 4NCBA 4P7VA 4DV3J 2NN6A 4DG1A 5GAHU 3JTNA 3VQTA 4U3BA 3T3FA 2LCWA 5ADZA 3B78A 4DX6A 3X1LB 4QU7A 4OI2A 1YJVA 3BYPA 4LCGA 1D8ZA 4YQWA 4LFCI 3CDWA 3NKYA 4I3HA 3KHHA 1HNWJ 4LVOP 3OUYB 1YJ7A 2GIFA 4A8OA 5ETQA 4IRKA 4LF9F 1TFWA 3HHNB 2IERA 1U6FA 4ETXA 1N33E 2CADA 4ILMA 2PNMA 1K8AT 4JI1F 3CMQA 3DGVA 4DF8A 4C8OA 2HQIA 4HXZA 4EZ9A 4ZJOA 3THPA 1VC5A 1JNRB 3TWZA 2KRBA 2HPUA 2M0GB 8AT1B 3GCXP 4DU7A 4DJBA 1U25A 4DUYI 2W8KA 2OFHX 4Y00A 5KFPA 4FXDA 4JI4E 1LWEA 1SCJB 2BUNA 1HARA 3BR8A 1KDNA 3C6TA 3GLLA 2H48B 1VQYA 3QT5A 1MROB 3CXCR 2AE8A 2BKNA 5GAGU 1S10A 4JI3E 4HL9A 3HSDA 2PO4A 3KLVA 1HI1A 3CW2C 1X5TA 3QPIA 4EFAC 2VFUA 4JYAF 3MM7B 4K2XA 2AJFE 2WONA 1RT1B 1QAYA 3DOKA 1MU2B 4DV4E 4NYZA 2JEIA 2ZVSA 2VZ9A 2HWTA 4DUZE 5ETVA 4DR4E 2C42A 4ZVSB 4WKYA 4BWJA 3HHLD 2WBMA 2OEKA 1C1CA 2JFKA 3K5LA 1NK6A 1Z2ZA 2AJ0A 2ZH6A 3HZEA 1P6TA 3K5NA 3Q2SC 4CO1A 4ZPWR 3DXBA 5KAKA 4NLUA 1VBXA 5CCMA 4PPZA 1C4AA 4IS9A 3SBMA 4CQ1A 3GYGA 1UWBB 1YJTA 5IV4A 4A46A 1ACMB 1HNXE 5KFWA 3PG9A 2HFZA 4KGZB 2DH9A 2Q43A 3DRSB 5F9NA 4DUYJ 4LF4I 1UZHA 3UWTA 3TZWA 2EWHA 4JBCA 4AFFA 1U2CA 2HQFA 2Z5CB 1FWKA 1FERA 1JNZB 3QGHA 5HJXA 4X4PA 2GVDB 1Q4RA 3C8YA 1VYAA 3TX8A 2XLJA 3PS3A 1I51B 1GMVA 3VAGA 1UDNA 3FGVA 1HQEA 2ZHBA 2W9CB 1YJNS 2ZZNA 5IT9Q 3FBFA 4DCPB 3WIVA 4IFDA 4N77A 4MFBA 4X65I 3PTWA 4FS2A 1YHQS 1NPPA 3MMCA 3RUBL 5D6GA 3CCQS 1N5YA 4DSLA 1ICEB 4OZ5A 3DLGA 4IR9A 3NS7B 2EG2A 3LP1A 2FJDB 1U09A 2OAUA 5F3TA 3AJ2A 3L09A 5DRQA 3MEGA 3LOUA 2DGXA 5DM7Q 5KT2A 1SV5A 3T1YF 2RIJA 1Q7LB 2RKIB 4OIXA 2ZVIA 2XSJB 4IG3A 2PN6A 3JSYA 1Z4UA 2H4YB 1LEOA 3KUGA 5A2QQ 1QDUB 2R8GA 2CQHA 2LDIA 1NKEA 4V19J 2J0XA 3KLFB 2QLFB 1S1UB 5ETKA 2XS2A 5DDQC 3HX9A 2UZAA 4I6AA 1VQ4S 2MJUA 2CG9A 1C0TA 4LF4J 1UEVA 4DBQA 1R7IA 2VG6B 2WVCA 5HBMA 4RBUA 2ZJPQ 1N36F 4F2SA 2R8JA 3F73A 2K2PA 1MNEA 1SKWA 2WNRB 2NN6B 1N34I 4K4WA 1LQ9A 2OSRA 2VB6A 4JI0I 4ES2A 3OR1A 2W8LA 1KIJA 1LW2A 2OUGA 1JIHA 4FW6A 2CFXA 1UDSA 1NDLA 3IGVA 2JJ4D 4B3RE 3GB0A 2MLXA 3BGRA 4X65J 2D9OA 3EWGA 2OMLA 2WVBA 4OZ2A 5DO2A 3G71S 5E5NA 3WZ0A 3M8YA 2YWEA 3DHWC 5HANA 4NA1A 4LF5F 2AX1A 1RWWB 4KV8A 1RWVB 1IM6A 5DRKA 2VQEF 4QR1A 1TTHB 4JV0A 5L1LA 2D3OR 4DV1E 2HVHA 5L9NA 2JT2A 3KHGA 3WU4A 4LFBI 1PYTA 2H1YA 4OLPA 3S6EA 1FTRA 4K5SA 2GA7A 2ZUAA 3SSRA 4Z7CA 2UXCF 2KI2A 4HYKA 4C8YA 3VHQA 1R8HA 2BW7A 3WQPA 2B0GA 1HFEL 4LF6I 3ZZZA 1HBUA 4C6AA 1FO1A 5IWAE 4NLGA 2R7WA 2NLWA 1LWEB 2B5JB 2P9EA 3C14B 4NE9C 4PXDA 3U1MA 1SUQA 3HVWA 3C6TB 5B09A 3PS1A 1ELOA 4C3KA 1R3NA 3MM6A 3M2VB 2XB2D 1DAXA 4X64E 2IYGA 3J7ZT 2C38A 4KIAA 5K36E 1PYOB 1TQLA 1N34J 3AOAA 1RDRA 3CDIA 4UQGA 4JI0J 3M7ND 3MECB 2GMHA 5HI7A 1ZAXA 3PXGa 3CJ4A 3KYLA 4YOEA 3SZ2A 4USWA 1JLFA 1WORA 4R0EA 3HFKA 3M8ZA 2WONB 4DV0I 3K5OA 3G6ES 2UXDF 2QA4G 2QLXA 1Y11A 2ASLA 3TUJC 3M85G 1JJ2R 2QO3A 4LFCE 2HIQA 1E6YB 3PO5A 1HK7A 3LWLA 3T1HE 3N6MA 2HAFA 1C1CB 3DMJA 2RS8A 4YY3I 3IBWA 2IESA 1T03A 2ZUGA 1RTDB 5LL6R 4WTYA 4LFBJ 3BBCA 2DNOA 3KXDA 2YQ0A 1EA6A 5I3QA 1ROFA 4RW4B 4B3ME 4DQPA 3E51A 1VJQA 5L1JA 4O23A 4LF6J 4DR5I 3HULA 2B7CB 4NLRA 1TUWA 2F9JA 4ZITA 4B3OA 1RHRB 1U1PA 3SMZA 5GADI 3FCVA 4J9SA 4O3OA 3D6HB 1HQEB 2XG8A 3E01B 1FNOA 3EM1A 4OO1E 1BE4A 3KDNA 2ZZMA 3ZKBA 5LXYA 2ZM6E 4MFBB 4ES3A 2Z5BB 5J1EA 2NXNA 3MMCB 2EW9A 2V67A 4DV0J 3NGUA 3L95X 2DEJA 3DLGB 2NN6D 4B9TA 1QVFR 3D1OA 3HSGA 4OJHA 3QRRA 2E7VA 5DM6Q 2GQ2A 3G8QA 3LAMA 4ICLA 1VQKS 3MEGB 1V5IB 3EGVA 4YY3J 2B4PA 2B9XA 3IR6B 4IG3B 1ZZNA 3T9NA 3CNQP 3PW5A 3NZKA 3VCDA 1F3FA 1T0TV 2OD4A 1OY6A 3IS9B 3K17A 4WFZA 2MJNA 4JI1I 2DY9A 5D4NA 1DZ5A 3KG1A 1IVZA 3UI3A 2GO4A 5LMUF 3GFHA 3GCWP 2N7CA 3OW2R 5H1SV 4DR5J 4I68A 4IOBA 5HBMB 3R5DA 1HD1A 1BQNB 4O0NA 4ED4A 3M8SA 4W4MA 1F9EB 1Q8KA 3P96A 3TAQA 3OFHA 4NCGA 2BJ1A 3SV4A 2AHOB 4FYVB 3KLHA 3Q0AA 2DHAA 3NY0A 3O8WA 3C2PA 1F1BB 3TANA 4LJMA 1LK5A 1VBYA 1OYRA 2DJWA 1OYPA 4IUFA 4KRWA 5C5JA 4EMDA 2B43A 5L3JA 3KG0A 1FXRA 2H51B 1NSAA 3HKWA 2IVYA 4YR2A 3C3LA 1DHMA 3BH7B 3GSDA 4L3KA 5EHHA 1SQFA 3DM2A 3HFZB 3CMES 2N4CA 3LQVA 4JYAI 5JJBA 3VGTA 4F4ZA 4QR2A 3WX4A 3FMWA 1RP5A 3AA9A 3MCMA 4BHQA 1DY3A 4ZVTB 2K1RB 2XMVA 3PIOQ 2V8PA 3O1LA 1XC9A 1DRZA 3WX8A 2K3IA 4UOFA 3QAUA 1UVNA 1UETA 1XTZA 4MAKA 1Y60A 5KFRA 2OLWA 2E44A 1S7HA 3I0RA 4JI1J 4Z2XA 3W63A 2VG7B 2BJDA 4UOCA 2NN6F 1X8DA 3TI0A 3ILLA 3MCOA 3SFGA 2W4DA 4F8RA 5KFHA 2ALYB 2QYCA 3CE8A 1FD2A 3MM6B 4QPXA 4X62I 4FW4A 3NNCA 2C38B 3DOLA 4ECZA 2BA1D 2MMYA 2HFSA 4PG7A 4B9NA 3FCWA 1RSCA 3GILA 1RWUA 1N88A 3MR3A 4RUHA 4AYBD 4F4YA 2H9ZA 2PMZD 3IA0A 3N01A 1IKXB 3R8YA 3J80U 4N76A 1KC8T 7FDRA 4MJKA 1FWPA 3M6UA 4JI5I 3OVSA 5KT7A 1AYEA 5C2GA 4QPTA 2E5GA 4OKGA 4X84A 2IAJA 5AJ3F 2YWFA 3TW0A 3EGZA 2ZOMA 1NDKA 2CQ1A 4ZLJA 1N56A 3DMJB 4MK7A 4U7CA 2Y1JA 3RZAA 4JYAJ 3GV7B 3WC2A 4IFDD 3J7AN 4NYOA 2PMHA 4BWMA 1N5VA 2P9CA 3TP2A 5K20B 4FF1A 4OYXA 5D77A 3OTOE 2M70A 4DL3A 2BOAA 3T1YI 4FKYA 1IBLE 3QGIA 1W2IA 4F4WA 5EN1A 1P9YA 3PRDA 1UTAA 3M2RB 2WP8A 4URSA 5K8PA 2UUAE 3DI6A 4YB7A 3DDKA 3N79A 2H5EA 1U1KA 2XQCA 2HQGA 3MAAA 4X62J 2J0QD 1TU0B 4JI6F 2J8SA 1A0OB 1BQMA 2XI3A 1LFPA 2Z58B 2FUG9 5D4OA 1IBKE 3D6FB 1HPZA 2YNGB 1YDLA 1I94F 3M6XA 5F8NA 2D74B 2L9DA 5J1EB 1FA0A 4AE5A 2YX4A 2HKJA 5K8NA 3TZXA 4QNKA 4JI5J 1EJ7L 3PJXA 5AXLA 1RCXB 4ZK7M 3OFEA 2XO7A 4ICLB 4ECVA 3FUYA 4GC7A 3E8OA 2K8GA 2O1UA 3KRNA 3E2EA 2LQ9A 4OHXA 2HGMA 3K1JA 3KWMA 1B3TA 4FF4A 2QSWA 2GS8A 4HH1A 5D8HB 5I42A 4DSFA 1UCNA 2A10A 1G4CA 5IXUA 2YX1A 3Q2TC 3LAKA 1SH3A 4NXMF 3T1YJ 4UUXA 1TL1B 4WKRA 2MKIA 1ZXMA 3HHLC 3VGUA 2IJRA 3JQMA 1NZAA 2M3DA 4TYBA 4DX7A 4NRTA 3N6NA 2UXCI 1SXLA 1PAUB 5D3GA 2KRRA 3GR1A 2XYHB 4IFDF 1QM9A 4G1IA 2F7VA 3V2UC 4PXBA 1JB0C 4CLLA 2DYAA 3T5LA 2KHCA 4DV2E 2JVOA 4Y2KA 1XR5A 4GMKA 1HNZF 3BEGB 1IKYA 2C37A 4GO7X 2GV1A 2WOMA 4Y34A 1M1KT 3TVYA 2V50A 1U1RA 4WIIA 1YTYA 2QLWA 3UPFA 4MKVA 3X3UA 1H7XA 1S72S 3G8SA 4JI8E 1Y9OA 2BR2B 4ELUA 1X31C 2UXDI 3M6AA 2AMCB 3JAMQ 2AV5A 3M9NB 1TKZB 2BXJA 2XY7A 1I3OB 5BYSA 3UDLA 3K5PA 1SPBP 1R27B 2BJEA 3MUMP 2JLEA 3U1YA 3HO1A 3H90A 2XMKA 4WUCA 2G0CA 2BE7D 3UVJB 4FBTA 2Z2MA 2VQEJ 1VQMS 2YKQA 1ZPWX 5ETOA 3V6DB 2QRRA 3GJTB 3MD1A 3OSNA 3QO9A 4P10A 4OYMA 4DQRA 3BGLA 1PBAA 3HKZD 2VU5A 2LEPA 2IVFB 2CQ3A 4RW8A 2UXCJ 3R1HA 4KE5A 3GG1A 3DOLB 4PRVA 2QMXA 3R3TA 1VQLS 3CB4A 2VUGA 2OPRB 5KFLA 3FFIA 2W9AA 1Q0NA 4V1Ak 4CLUA 2VQFF 2XEXA 4ECTA 1VQPS 1S16A 1W2BR 2VC0A 1UJ4A 3ET6B 5J2QA 4ENOA 3KK2B 1YHCA 3FZ2A 5A0YB 3MMJA 2DRAA 3FBBA 2ZITA 1DLOB 4PU9A 2W25A 3H5SA 2GMLA 5IFMA 3A8IA 3R2DJ 3LP0B 3DLEB 3R5BA 3N9UC 1FJGF 3LTOA 1IWAA 2MDAA 4USMA 5L46A 2F8MA 3GSIA 2UXDJ 3IAS9 4KGKA 3PACA 1OMSA 4WZQA 2DCUB 1SC3B 1F5BA 5HAOA 1YZ7A 5C42A 3RBXA 3UHMA 1N48A 4I2QA 1VHIA 2HZVA 3DYAA 3RR8A 2WP8B 1S48A 3J80Y 2QV6A 5EGYA 1PC5A 3HDSA 1U6BA 4NRUA 2RAQA 4DSKA 3QT6A 1S59A 1KLMA 3MAAB 2PC6A 3CO0P 1KOHA 2R42A 5FLXU 2DBBA 1BQMB 4C4WA 3UD5A 3BPSP 5KG5A 3NGTA 2LXUA 1RLCL 5HL7Q 1OQ3A 2MQ8A 2CPEA 1Q82T 2ILZA 1JMTA 4NYPA 3A13A 2UP1A 4QR0A 2XMTA 1Y4UA 1FFWB 1ULRA 3P3CA 3H20A 4NBQA 1VIOA 5CH7B 3TUPA 4A8MP 4XAKA 5K36A 2F3JA 4H4MA 4IDKA 1NCLA 1AZSA 3T6BA 3MPUB 1EETA 3H0PA 5CZVA 1YQHA 1SKRA 2YNFA 4J3DA 1NK0A 1ZBTA 1H72C 2RJZA 4F0KA 2XYPB 4DR1F 1WTBA 1KRPA 3GJRB 5KFGA 5HP1B 3ZFVA 1MN7A 3EX7B 2WCXA 4OV1A 2JZ5A 2XGPA 4QWCA 1VK8A 2CWKA 4WE1A 2Z2LA 3HCXA 2J7KA 1U0HB 1L3KA 2CZ9A 3OHAA 4NLQA 3QWUA 1FRIA 1Q1KA 2R7TA 2J6SA 2R7RA 2WSEC 5KG4A 4B02A 1YH8A 4DR7E 3CD5A 1H7SA 3JTOA 1R8BA 2MYFA 3Q8UA 5GAEI 1HIYA 1TKTA 3ENQA 4CLWA 2AEJA 2XMWA 1TKXA 5AE1A 5KOXA 4UOGA 1UVIA 4K4SA 3AXKA 2AYBA 4FW9A 3PHEA 4Y6IA 3KG4A 2Q6CA 3M8WA 2NCKL 2G0IA 3K0JA 1RWMB 2LLZA 2J9DE 5M2RA 2X1AA 2YH0A 1M5VC 3J81Q 4LBHA 3CIMA 1FRHA 3SSQA 1KQGB 4QIFA 2RE1A 1NK9A 2BABA 2V0NA 4B3SI 2ZNZA 3E3XA 2LP4A 4N7TA 2VJVA 1XNRI 3RBDA 3G9CA 1IKVB 3FVYA 3H4BA 2ZWPA 4X4TA 3AOCA 4ZCIA 3BPDA 4DS4A 4ZVUB 2KXHA 4OO1A 1JKHB 3FKBA 1R89A 1RE1B 4LR8A 3IR5B 1PC4A 5DETA 3M7NG 4J9NA 1QTMA 3D1QA 4YN3B 1S1TA 2XO6A 4OHVA 1WOPA 4FZVA 2FQQB 4DR6E 2NN6C 1Q5VA 2IOPA 4CO0A 2Z30B 3RBZA 5BR8F 2BW2A 4WFYA 4PAAA 5KG2A 4ZVQB 2FB0A 1NJYA 4P7TA 3D4JA 5H9FK 4FWGA 2HS4A 2NUHA 2DNMA 5I3UA 3FFIB 4UF4A 4NXNE 1AUSL 2DNNA 4K0KE 2HIYA 3CC4S 1Q16B 4ED3A 4F3OA 4QCLA 1EKSA 4HR2A 3EPIA 4RUBA 2NPFA 2UUCF 4JI6I 1CQMA 5EX0A 1CJVA 3ISZA 3BQ1A 3M4XA 4CO4A 4GKJE 1I94I 4B3SJ 2QFIA 3TEGA 4YDDB 3ITHB 4ZPTR 4DV7E 4FKXA 5GAHI 1RHQB 1FDBA 1R0BG 1TMMA 3G82A 3HKMA 1N5QA 4HYMA 4J9OA 1REGX 5DDOC 4AQYF 5AJ3J 2PE8A 2O1WA 3H7HB 3DYAB 3PS2A 1DQAA 1Z0BA 2M8DB 4YP3A 1K73T 4J9RA 2C1EB 4JV5F 3IFEA 2V4JB 4YB6A 1H74A 2MKYA 1ZXNA 3IBCB 2D41A 4ECSA 3KJVA 1KLMB 1XNQI 1G3OA 2ROPA 1JLCA 4QZVB 1LFWA 4O3SA 4NXMI 2HKEA 3PKYA 2V8GA 1NEEA 1D0EA 1HMVA 3OLAA 3JSMA 1USUA 2BYCA 5CYJA 1KSPA 1REVA 1U0SA 3GR0A 3EXYA 1XMOE 1T02A 2JEBB 2F4VE 3RRKA 4PXEA 1SL2A 4K59A 3DHXA 2BJ9A 5B0DA 4JI6J 4ZJLA 3S7RA 2FHJD 2OPQA 1HNZI 3HF5A 1WSRA 2JE6A 2JSXA 3OTEA 2IRUA 4IFYA 5K36B 5KTQA 4IDKB 1I94J 1AZSB 1S4FA 5GAGI 5AXKA 1Y4ZB 2C3YA 1ZAVA 2A2CA 2R4FA 3BV8A 5GMEA 4UZCA 1GX6A 4XDDA 2ADCA 3Q1QA 1N33F 3GV5B 3IM8A 3WC0A 7FD1A 4ZVIA 3UN2A 5FLXY 4FF2A 2VICA 4K4ZA 2UUBE 3SXLA 2VC1A 1CJTB 1EIYB 3NCRA 4DL6A 4C3LA 3FEYB 2ZD1A 4DV6E 4ZLPA 1S9GA 4AL7A 2ZH2A 4IYQA 4J91A 5LM7E 2HHHE 2CPHA 4KB7A 5EDWA 2R8IA 4C3MA 1Q81T 3TZZA 1H2TZ 1NHIA 4URLA 1Z0WA 2E9RX 3TO8A 2N3LA 4XIUA 1TKTB 1UA1A 3A1YG 1XNQJ 3POTA 3CJKA 3HVRA 3W66A 4JI4F 4NXMJ 4DR2F 1WF0A 2ZHOA 4CLYA 1CVJA 1C1BB 4P2XA 2DXEA 3B4TA 2CQGA 2DXFA 2CQ2A 2ZE2A 1R6VA 5C7PA 1H3DA 4DL2A 4JI3F 3G87A 2ACYA 2V69A 4OZLA 4YB5A 1HI8A 1BC6A 1QE1B 3OV7A 3G8TA 5F8LA 2VQFI 4ZPDA 1HNZJ 1UA0A 3CCVS 4CYUB 4F3MA 2GJ2A 2Y8WA 3CD6S 1WD6A 2MZ1A 1RAGB 5CZXA 4N5SA 3D67A 1RTIA 2I2YA 2AYEA 2GHWA 4OO1B 5KG1A 4CLZA 4WFNQ 3LPSA 4USKA 3UW1A 4DUZF 2XLKA 3UN3A 4DR4F 2EVZA 2IM2A 4TU7A 1FJGI 1KQFB 5C25B 4OZNA 1NK8A 2JOQA 2DIUA 2E29A 4GC6A 3ZZTA 1J5EI 1FKAE 5KFFA 4A4JA 1URNA 5HQMA 4H4OA 5MLCV 4C0HA 1AFJA 4LSLA 3ETMA 4G1PA 1NHHA 3H25A 1HNXF 2AU0A 2HLTA 3S8SA 1S79A 3CDBA 3CCMS 5I3UB 3CTRA 3KMSA 3V81A 4QYRA 1KVIA 1GXTA 4K50A 3H2LA 5B08A 2VDHA 3VVTA 1FJ7A 2GO3A 3BSOA 2W7AA 1PKUA 1J2VA 2CQCA 4YMEA 2Y8YA 4RUAA 2E5JA 4NZ0A 1FI4A 4MIBA 2BX6A 2FHKA 1NO8A 2U1AA 3HP6A 2VQFJ 1S6UA 2OEJA 1W25A 3MEEB 3VF0B 4OX9E 1Y5IB 2WK4A 2DIVA 1KONA 3V5RA 2VL1A 1XNRE 3M6VA 2MKJA 4CWBA 1SH2A 4K4XA 3EXCX 5DG9A 3MCNA 1N5TA 2YNIA 5B7WA 2FDNA 1FJGJ 4CLKA 4F7VA 1JWWA 3DLBA 5CABA 5K36D 2BV3A 2KG0A 4DR1I 3QQCD 1J5EJ 4QWDA 5EWGA 5H9EJ 2RDJA 2HFVA 4NZ7A 1MX0A 1CS4A 1H2UX 5LL6d 4DSEA 3KJVB 2CQ4A 1JLCB 1U6ZA 1UDOA 1HMVB 2BE9B 4ECRA 1EARA 2HNZA 4CM0A 2NUUG 4TQSA 1BWEA 2MZSA 4NL5A 4NLOA 3A8EA 3Q8SB 3M9MB 4DV5I 1KQSR 2EFNA 3MM8B 4ZP7A 4PEOA 3I9V9 1HWKA 4IKAA 4ED6A 3K8WA 3RGIA 4NLVA 1BGXT 2YH1A 2JEAA 2AW0A 5A8KB 1B62A 3D7SB 4A8WA 1T95A 2JE6B 4LBPA 4X4OA 3SQGA 4K4UA 4IFYB 4JV2A 4R5PB 3D9BA 3W3SA 2RRAA 4USTA 1N52B 4F36A 3UNYA 4B3RF 3VQSA 4PQAA 4HT5A 1RT4B 4OI0A 3FCHA 5L38A 3PIPQ 3PVXA 3HJFA 5B0BA 5HQ8A 2XHWA 5CQGA 4EI2A 1T3NA 4OLOA 3QATA 4DV1F 4F4KA 1ZETA 1FK9A 1RYRA 2N82B 4ZPCA 4DR1J 3G86A 3MMBA 4EBCA 2CRLA 4MQYA 3MGJA 2HSEB 2UU9E 4OO1D 2B51A 2FTRA 3IRXA 2J9EA 4KR0B 4PABA 2OD6A 4WP3A 3J7YU 1JJ4A 2V63A 4ZVHA 5F8GA 4OYAA 3POTB 1FEHA 1U8SA 4ZMMA 5IWAF 5RUBA 3J7AM 4HHHA 3N28A 4ECYA 5BR8I 4I7FA 2P2CB 4I6YA 2HHWA 3NOGA 4OJ1A 4IFVB 3EGNA 4ZVRB 2JC0A 5MAOA 4X64F 2G2ZA 3ZTOA 2VOOA 1XEZA 5K36F 4K4YA 1TAQA 1X9SA 4L3NA 3OXLA 1S6QB 1WTFA 3K85A 2RQCA 4DV5J 3BN4A 1AB8A 4MDTA 2LFVA 5ITHA 3J81j 3VZHA 2PT0A 3B54A 4LIRA 1Q7YT 3EMTA 2KFYA 2K06A 3DOMB 2KM8B 2I0XA 4RPFA 2P8IA 3HD1A 2UUCI 1RTIB 2LEBA 4L76A 1PG5B 2Q6BA 4I4BA 3PZPA 3HVAA 3DRYA 3GIIA 4LFCF 3QSYB 3I9ZA 1IN0A
chains in the Genus database with same CATH topology
1KVKA 4IZJB 1I94E 4LFAI 1XMQI 5LL6R 2A2DA 4JI3E 4JI7E 5A2QC 1IBKE 4GKJI 1RR9A 1EA6A 4JYAE 2J7KA 2Z5BA 4DR3E 4KHPI 2CZ9A 4DV7I 4B3ME 1KKHA 1FWLA 1QZRA 1N34E 3PYDA 2HKJA 2VQFI 4UTGA 4JI0E 4DR5I 1MG7A 4DV4E 3HULA 2Z5CA 1MU5A 4DR7E 1ZM3A 4DV5E 3B8HA 1H7SA 1B63A 4DUZE 4LF9E 2E1RA 4DR4E 4LF7I 3J80C 2HK3A 2O1UA 1HR0I 4JV5I 3LPSA 4USKA 1N0UA 2X36A 3K1JA 4FW9A 4B3RI 4IZJA 5LMUI 1Z5CA 1NZ0A 1FJGI 1XNQE 2GS8A 1IBMI 4X62E 4NXME 4HACA 4LF8I 3ZKBA 3ZZTA 2ZM6E 1J5EI 1VISA 1FKAE 2VF3A 3J81Q 2Z5BB 1HNXE 2IOQA 1USVA 4LFBE 1ZXMA 4DV1I 4LF4I 4B3SI 2DEJA 1NHHA 3P06A 2LJPA 2UXCI 3Q6MA 1XNRI 2Z5CB 1XMOI 1FWKA 4LF6E 2F4VI 1Z5BA 2AJ4A 4JI5E 4P52A 1HNZE 4DR2E 3V2UC 3J7AG 4B3TI 4GKKE 2Q2EB 2UXBI 1Z0EA 1N32E 4DV2E 2UU9I 4JI2I 2Z5EA 5IWAI 2OI2A 1S4EA 2E5LE 1N0VC 4X66E 3B82A 4DR6E 5BR8E 5IT9Q 3PYEA 3ZM7A 1Z59A 3F0NA 3K17A 4JI1I 1N36I 1FI4A 2IOPA 1N33I 4HACB 4X65I 5LMNE 2PNLA 4X64I 1Y4SA 1XHKA 3PRYA 4DPWA 3WU6A 4AQYI 1DARA 1PKPA 4ED4A 4JI8E 2UUBI 3D4JA 4FWGA 4OX9E 3PYGA 3T1YE 3GONA 3V5RA 2UXDI 3M6AA 4YHHE 4DUYE 4DV0E 4NXNE 2GQ0A 4KQVA 1XNRE 3JAMQ 3OTOI 4DV3I 4DV6I 1IBLI 4K0KE 2UUCE 2HHHI 3WU5A 4Z7YA 1Y6ZA 1A6FA 4WUCA 5A2QQ 2UUAI 4JI4I 2HK2A 2BV3A 2BM0A 4DPXA 4JI2E 4DR1I 1Z5AA 2NPFA 4YY3E 4JI6I 3CWVA 4LF5I 3QT8A 3T1HI 4JG4A 5FWKA 1K47A 4R1FA 4FWHA 4LFAE 3ZZUA 2BM1A 1XMQE 2VQEI 4EMDA 1HNWI 1MX0A 4DPTA 1KTVA 5L3JA 3HJCA 1PIEA 2EFGA 2CG9A 4GKJE 1I94I 4JI3I 1PVGA 4JI7I 4KHPE 4DV7E 1IBKI 4WUBA 3Q6NA 4JYAI 4PRVA 4UT4A 4DR3I 2VQFE 1D6TA 2O1VA 2ZBKB 3J80Q 4IZKB 4B3MI 1ZM2A 5IT9C 4HYMA 4DR5E 4MYUA 1WUUA 1N34I 1Z0VA 4JI0I 2XEXA 2V8PA 1S16A 4DV4I 1KIJA 4LF7E 4DR7I 4DV5I 2O1WA 4WUDA 1HR0E 4JV5E 4DUZI 4LF9I 1EI1A 4DR4I 1B62A 1Z0BA 1Z0TA 5FLXQ 3H4LA 4B3RE 2ZITA 5LMUE 2CGEA 4PU9A 1FJGE 3PYFA 1H74A 4IZJD 1ZXNA 1IBME 2VQEE 4LF8E 1XNQI 1J5EE 3QT7A 3LTOA 2V2VA 4X62I 4NXMI 1U2RA 2HKEA 4USMA 2V34A 2ZM6I 4DV1E 2HFSA 4LF4E 1USUA 4IZKA 2X7IA 4B3SE 2HFUA 1HNXI 1NHJA 1H73A 3WU4A 4LFBI 2UXCE 1XMOE 2F4VE 3B78A 3J81C 4PRXA 1RREA 4Z7CA 4P7AA 4B3TE 4LF6I 2UXBE 4XTJA 1Z0GA 4LFCI 4JI5I 1HNZI 4DR2I 2UU9E 4FWDA 4I3HA 5IWAE 1ZM9A 4GKKI 1Z0CA 2V2ZA 1N32I 4DV2I 4M1KA 2E5LI 3QT6A 1N36E 4DXLA 4JI1E 1UEKA 4X66I 3J7AM 1N33E 1ELOA 4DR6I 4X65E 5BR8I 2A2CA 2PNMA 4X64E 2R42A 5GMEA 3Q1QA 1OJ4A 5LMNI 4DPUA 4AQYE 5FLXC 4ZVIA 4N3OA 4HXZA 2WW4A 2UUBE 1ZM4A 4DU8A 4HY1A 2DEIA 3K85A 3WU3A 2UXDE 4JI8I 4DPYA 1FNMA 3OTOE 2R3VA 4OX9I 4DV3E 3T1YI 4DV6E 1IBLE 4DU7A 5GMDA 4YHHI 4DUYI 4DV0I 1Y4UA 2HHHE 4NXNI 4RPFA 1NHIA 4K0KI 2UUAE 4URLA 1Z0WA 4JI4E 4LFCE 2UUCI 3ZZ0A 4DR1E 4MYTA 4JI6E 1HK7A 4LF5E 3T1HE 4FN5A 2V2QA 1BKNA 1H7UA 3JAMC 2O1TA 3QT5A 1HNWE 1H72C 3ZKDA 4YY3I 3LNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVK A;  1I94 E;  4LFA I;  1XMQ I;  5LL6 R;  2A2D A;  4JI3 E;  4JI7 E;  5A2Q C;  1IBK E;  4GKJ I;  1RR9 A;  1EA6 A;  4JYA E;  2J7K A;  4DR3 E;  4KHP I;  2CZ9 A;  4DV7 I;  4B3M E;  1KKH A;  1FWL A;  1QZR A;  1N34 E;  3PYD A;  2HKJ A;  2VQF I;  4UTG A;  4JI0 E;  4DR5 I;  1MG7 A;  4DV4 E;  3HUL A;  1MU5 A;  4DR7 E;  1ZM3 A;  4DV5 E;  3B8H A;  1H7S A;  1B63 A;  4DUZ E;  4LF9 E;  2E1R A;  4DR4 E;  4LF7 I;  3J80 C;  2HK3 A;  1HR0 I;  4JV5 I;  3LPS A;  4USK A;  1N0U A;  2X36 A;  3K1J A;  4FW9 A;  4B3R I;  5LMU I;  1Z5C A;  1NZ0 A;  1FJG I;  1XNQ E;  2GS8 A;  1IBM I;  4X62 E;  4NXM E;  4HAC A;  4LF8 I;  3ZKB A;  3ZZT A;  2ZM6 E;  1J5E I;  1VIS A;  1FKA E;  2VF3 A;  3J81 Q;  1HNX E;  4LFB E;  1ZXM A;  4DV1 I;  4LF4 I;  4B3S I;  2DEJ A;  1NHH A;  2LJP A;  2UXC I;  1XNR I;  1XMO I;  1FWK A;  4LF6 E;  2F4V I;  1Z5B A;  2AJ4 A;  4JI5 E;  4P52 A;  1HNZ E;  4DR2 E;  3V2U C;  3J7A G;  4B3T I;  4GKK E;  2Q2E B;  2UXB I;  1Z0E A;  1N32 E;  4DV2 E;  2UU9 I;  4JI2 I;  5IWA I;  2OI2 A;  1S4E A;  2E5L E;  1N0V C;  4X66 E;  3B82 A;  4DR6 E;  5BR8 E;  5IT9 Q;  3PYE A;  3ZM7 A;  1Z59 A;  3F0N A;  3K17 A;  4JI1 I;  1N36 I;  1FI4 A;  1N33 I;  4HAC B;  4X65 I;  5LMN E;  4X64 I;  1XHK A;  4DPW A;  3WU6 A;  4AQY I;  1DAR A;  1PKP A;  4ED4 A;  4JI8 E;  2UUB I;  3D4J A;  4FWG A;  4OX9 E;  3PYG A;  3T1Y E;  3GON A;  3V5R A;  2UXD I;  3M6A A;  4YHH E;  4DUY E;  4DV0 E;  4NXN E;  4KQV A;  1XNR E;  3JAM Q;  3OTO I;  4DV3 I;  4DV6 I;  1IBL I;  4K0K E;  2UUC E;  2HHH I;  3WU5 A;  4Z7Y A;  1A6F A;  4WUC A;  5A2Q Q;  2UUA I;  4JI4 I;  2HK2 A;  2BV3 A;  2BM0 A;  4DPX A;  4JI2 E;  4DR1 I;  1Z5A A;  2NPF A;  4YY3 E;  4JI6 I;  3CWV A;  4LF5 I;  3QT8 A;  3T1H I;  4JG4 A;  1K47 A;  4R1F A;  4FWH A;  4LFA E;  3ZZU A;  2BM1 A;  1XMQ E;  2VQE I;  4EMD A;  1HNW I;  1MX0 A;  4DPT A;  1KTV A;  5L3J A;  1PIE A;  2EFG A;  4GKJ E;  1I94 I;  4JI3 I;  1PVG A;  4JI7 I;  4KHP E;  4DV7 E;  1IBK I;  4WUB A;  4JYA I;  4PRV A;  4UT4 A;  4DR3 I;  2VQF E;  1D6T A;  2ZBK B;  3J80 Q;  4B3M I;  1ZM2 A;  5IT9 C;  4HYM A;  4DR5 E;  4MYU A;  1WUU A;  1N34 I;  1Z0V A;  4JI0 I;  2XEX A;  2V8P A;  1S16 A;  4DV4 I;  1KIJ A;  4LF7 E;  4DR7 I;  4DV5 I;  4WUD A;  1HR0 E;  4JV5 E;  4DUZ I;  4LF9 I;  1EI1 A;  4DR4 I;  1B62 A;  1Z0B A;  1Z0T A;  5FLX Q;  3H4L A;  4B3R E;  2ZIT A;  5LMU E;  4PU9 A;  1FJG E;  3PYF A;  1H74 A;  1ZXN A;  1IBM E;  2VQE E;  4LF8 E;  1XNQ I;  1J5E E;  3QT7 A;  3LTO A;  2V2V A;  4X62 I;  4NXM I;  1U2R A;  2HKE A;  4USM A;  2V34 A;  2ZM6 I;  4DV1 E;  2HFS A;  4LF4 E;  2X7I A;  4B3S E;  2HFU A;  1HNX I;  1NHJ A;  1H73 A;  3WU4 A;  4LFB I;  2UXC E;  1XMO E;  2F4V E;  3B78 A;  3J81 C;  4PRX A;  1RRE A;  4Z7C A;  4P7A A;  4B3T E;  4LF6 I;  2UXB E;  4XTJ A;  1Z0G A;  4LFC I;  4JI5 I;  1HNZ I;  4DR2 I;  2UU9 E;  4FWD A;  4I3H A;  5IWA E;  1ZM9 A;  4GKK I;  1Z0C A;  2V2Z A;  1N32 I;  4DV2 I;  4M1K A;  2E5L I;  3QT6 A;  1N36 E;  4DXL A;  4JI1 E;  1UEK A;  4X66 I;  3J7A M;  1N33 E;  1ELO A;  4DR6 I;  4X65 E;  5BR8 I;  2A2C A;  4X64 E;  2R42 A;  5GME A;  3Q1Q A;  1OJ4 A;  5LMN I;  4DPU A;  4AQY E;  5FLX C;  4ZVI A;  4HXZ A;  2WW4 A;  2UUB E;  1ZM4 A;  4DU8 A;  4HY1 A;  2DEI A;  3WU3 A;  2UXD E;  4JI8 I;  4DPY A;  1FNM A;  3OTO E;  2R3V A;  4OX9 I;  4DV3 E;  3T1Y I;  4DV6 E;  1IBL E;  4DU7 A;  5GMD A;  4YHH I;  4DUY I;  4DV0 I;  2HHH E;  4NXN I;  4RPF A;  1NHI A;  4K0K I;  2UUA E;  4URL A;  1Z0W A;  4JI4 E;  4LFC E;  2UUC I;  3ZZ0 A;  4DR1 E;  4MYT A;  4JI6 E;  4LF5 E;  3T1H E;  4FN5 A;  2V2Q A;  1BKN A;  1H7U A;  3JAM C;  3QT5 A;  1HNW E;  1H72 C;  3ZKD A;  4YY3 I;  3LNU A; 
#chains in the Genus database with same CATH topology
 4ED8 A;  3T1H F;  5DZ7 A;  2CNL B;  4EO6 A;  1T05 A;  2VA2 A;  3VAL A;  4CLT A;  3SCJ E;  1FKP A;  3VAJ A;  3GIM A;  2KFZ A;  3W65 A;  1X9M A;  2LDY A;  4WPA A;  4RLE A;  5KFS A;  3AQP A;  3M1V A;  2ZC3 A;  3F56 A;  2BA0 D;  2P5V A;  3RYL A;  4CLS A;  2HQC A;  2AZ1 A;  3FSY A;  3ZO7 A;  3UFC X;  2GNK A;  4IO9 Q;  2EG1 A;  4UTG A;  1PBU A;  1K1S A;  2R2U A;  1QSS A;  4UOH A;  4QW8 A;  3Q89 A;  3TUI C;  2A6O A;  1PJ7 A;  4B3M F;  5LSR A;  1H0H B;  2CQP A;  2RIL A;  3W5Y A;  3I6P A;  2ZH9 A;  1SB6 A;  4LF9 E;  1KQK A;  5LSL A;  1FCA A;  5T41 A;  4JV5 I;  5CYM A;  5BR8 J;  5EWF A;  3RJM B;  3L7Z A;  2W2Q P;  2FJV A;  4NOH A;  4DLG A;  5CYQ A;  4OHZ A;  1JK9 B;  4DN9 A;  5L39 A;  2I9S A;  1K1Q A;  2VF3 A;  2DR7 A;  3AD8 C;  3EZU A;  3RB6 A;  3KUH A;  3WBZ A;  1CBK A;  2VHG A;  2ZJR Q;  2NZ4 A;  1HLW A;  3T19 A;  5ELW A;  3PJW A;  2UUC J;  2DR6 A;  3ZTP A;  2DGV A;  1L5U A;  2NXU A;  3H42 A;  1RTJ A;  4GKK E;  3VAF A;  5F3Z A;  2J9D A;  2WVE A;  1SQG A;  5D0G A;  3J7A 1;  4J7C A;  3CSK A;  2D69 A;  2POK A;  1CUL B;  5KFD A;  1GMU A;  3KKF A;  1Q8I A;  4UY8 T;  2BE2 A;  5F8I A;  1N33 I;  2UV8 G;  5LMN E;  5J2M A;  1CS4 B;  3FEX B;  3EJM A;  5J2N B;  4DLE A;  2L08 A;  4K4T A;  2EFQ A;  1VOM A;  4FS1 A;  4DPW A;  4OMF G;  2CWX A;  2I5J A;  1TK0 A;  3C15 B;  3F44 A;  3GMG A;  3GON A;  4YHH E;  4FYW B;  2HNZ B;  5IOL A;  4JV5 J;  1NLK L;  4BA2 A;  4O4G B;  1S1X B;  1M90 T;  3SQO P;  4U8Y A;  4PG5 A;  1HNV A;  3AY0 A;  3OR2 A;  4JI4 I;  1S1V A;  3QGP A;  2BR0 A;  2JEA B;  1QUP A;  3HMJ G;  5AT1 B;  3PO4 A;  4LSZ B;  3KLG A;  3LPY A;  4FWH A;  4ZP9 A;  3TZY A;  1XMQ E;  4Y0F A;  4NLP A;  4FYX B;  1VMB A;  1KTV A;  4UQT A;  1IQZ A;  1XK8 A;  5KFU A;  3US5 A;  1UEU A;  1F9F A;  4R8U A;  4JI3 I;  3R1L A;  4KHP E;  2WZ1 A;  3M2U B;  4ED2 A;  1D1U A;  1HBM A;  1NM2 A;  2COL A;  1P1T A;  4W92 B;  1Z0V A;  2IIH A;  1S97 A;  1IM4 A;  4F04 B;  4DV4 I;  2ATC B;  3M8P B;  1IR2 A;  3MPD A;  3M6W A;  3CGI A;  4DUZ I;  2IY5 B;  1K9M T;  1EI1 A;  1WC6 A;  4DR4 I;  4DZD A;  4LRF A;  3C6U A;  1N33 J;  4ZCK A;  2I1R A;  1UW9 A;  1HYS B;  1IXK A;  4OZ0 A;  3QJP A;  3BM7 A;  4Q44 A;  2B4O A;  2YKA A;  4I7F B;  3NGS A;  4DCJ B;  2YXL A;  1S6P A;  3NNH A;  4OJG A;  2X7I A;  5L8R C;  1HNX I;  2B8Q A;  2MZQ A;  1NUE A;  2KVI A;  3FBE A;  1B70 B;  3H5X A;  1ZA1 B;  2ZH3 A;  1NU4 A;  3D66 A;  3TAM B;  3BBB A;  4JI4 J;  1SIW B;  5KG6 A;  3KLE B;  2W7P A;  1WEY A;  3QGG A;  1F5A A;  1HBO A;  2W24 A;  3SCI E;  1Z0C A;  4OHW A;  2XZT B;  2V94 A;  3H2U B;  4PG8 A;  3THV A;  1LKZ A;  4JI3 J;  1N36 E;  1RT3 B;  3KJN B;  5B0G A;  4G1Q B;  1MRO A;  2KB2 A;  2RF2 A;  4OL8 A;  4RWW A;  1VQS A;  3WIU A;  1T9T A;  2KYX A;  4OX6 A;  3HXM A;  1GEH A;  1U1Q A;  2R7S A;  1FKP B;  1KFS A;  4I0W A;  3P8B B;  1TK5 A;  1WI8 A;  2ILY A;  1UL3 A;  4DV4 J;  3OVB A;  3PR4 A;  1TP7 A;  3WU3 A;  3DRR B;  4DL4 A;  1IJF B;  4DUZ J;  4ITS A;  1RT1 A;  4DR4 J;  1MU2 A;  2DGS A;  5GMD A;  1QAJ A;  3M8R A;  3VTI A;  2ZC4 A;  3OTO F;  3OD2 A;  2GZO A;  5HK4 A;  1SJR A;  2G2Y A;  1UPM B;  5KG7 A;  2BKO A;  2OO4 A;  4LF5 E;  5GAE U;  5AXN A;  3M8Q B;  2V2Q A;  5CYM B;  3K2Y A;  2KL8 A;  2CDQ A;  2UUA F;  4CLP A;  3ZKD A;  2DB1 A;  1NXI A;  4NI2 A;  4ED1 A;  2ERR A;  1A9N B;  3M7V A;  2XC9 A;  1JXL A;  1HNX J;  1U2F A;  3OSP A;  2PA3 A;  1VRT A;  5H9F J;  1D9D A;  1UWB A;  4C0B A;  5AXM A;  4MU1 A;  1PJ6 A;  2AJ1 A;  3PFE A;  2KJW A;  1IBK F;  1FRJ A;  1X4D A;  3I32 A;  4ZCL A;  5BYR A;  2YWH A;  2OTJ S;  4P9S A;  4PWU A;  3R5C A;  4M5H A;  1T8E A;  1XIQ A;  3Q8Y A;  2Z5C A;  4RBV A;  2RU9 A;  3Q86 A;  5BJR A;  3MFH A;  1NHV A;  3AJ1 A;  4N8O A;  1CSJ A;  5C24 B;  3QRQ A;  1V3Z A;  4LF1 A;  1RTJ B;  3K58 A;  4L6V 3;  2FD2 A;  3MR6 A;  5KFM A;  4CH0 S;  3ENA A;  1N0U A;  2MHN A;  4USJ C;  2G13 A;  1UVJ A;  4B3R I;  1NZ0 A;  2DGW A;  3FC9 A;  4KGX B;  3SSS A;  1Q78 A;  4YY3 F;  4IOC Q;  2AGO A;  2FPH X;  3S01 A;  3W9J A;  2MQM A;  2DNK A;  2IM0 A;  4M5D A;  4DV1 I;  1NK4 A;  3P3G A;  2FY8 A;  2C2M B;  3P06 A;  4ZP6 A;  3VAI A;  1VRU A;  3IC1 A;  1CC8 A;  3EPG A;  4F4X A;  3Q6M A;  3Q22 A;  5IC6 B;  4NLW A;  1RT6 B;  2GMJ A;  3NCQ A;  1K0V A;  2J6U A;  2RKI A;  2XSJ A;  3R2C J;  1SIZ A;  1HHT P;  3IGN A;  3P3D A;  4DWI A;  2AEM A;  3LAN A;  2Z5E A;  5IWA I;  2OI2 A;  4KO0 B;  4BC7 A;  1HNV B;  3CCT A;  3DLJ A;  1ZA2 B;  1QSY A;  4DV2 F;  4ZN1 A;  3SIP B;  2HRU A;  2W9B B;  1WHX A;  4ID8 A;  4ELV A;  1RAD B;  2H65 B;  1Q5Y A;  1OSD A;  4X64 I;  2OP5 A;  4KYZ A;  2KN4 A;  2VG6 A;  3QLH B;  5DNL A;  4ZP8 A;  4R8U B;  2XBP A;  1DTQ B;  1HWL A;  1Y0H A;  3ZXW A;  3GFX A;  2WNR A;  1WC1 A;  1HBM B;  1SC4 B;  3VVU A;  2BJ3 A;  1WC5 A;  2F1F A;  2E7W A;  1T9V A;  4JI8 F;  4N56 A;  2GO8 A;  4ELT A;  4U67 Q;  2O5D A;  4B3R J;  2QL9 B;  3DGP B;  1Y6Z A;  1A6F A;  3UQS A;  1JLG B;  3MFI A;  2EK1 A;  2XY5 A;  3T1H I;  2GCF A;  3C6U B;  2RHQ B;  1GMW D;  4P2F A;  4R1F A;  3K59 A;  2BM1 A;  5G0R A;  1SJ1 A;  4F3Q A;  3DLK A;  3OXF A;  4DV1 J;  4F67 A;  2B8P A;  4M63 A;  3ELH A;  1S6P B;  1ITP A;  4ERD A;  1DFD A;  2Z56 B;  3ILI A;  3J80 Q;  1JLB B;  4B3M I;  2YWK A;  5K36 C;  1KHW A;  1I6J A;  3MAH A;  3LUY A;  4CM2 A;  5IWA J;  4X4S A;  3CDE A;  3OQ2 A;  3K89 A;  4EBD A;  3AXM A;  3MTK A;  2BQR A;  3IWN C;  1WEZ A;  1HBO B;  2B5J A;  5JXS A;  5LMU E;  3C14 A;  1P1L A;  2QMW A;  1YKW A;  2VIH A;  4RW9 B;  1RKI A;  4DQI A;  2DGO A;  4X64 J;  2HZC A;  2E1P A;  1U1N A;  3M32 A;  1WNE A;  1TKD A;  1QJH A;  3M2V A;  2PII A;  2KJV A;  2RF2 B;  5C0X B;  3QT7 A;  1TEL A;  2HHQ A;  2JEF A;  2O66 A;  2AX0 A;  3D3C J;  1U2R A;  2ZM6 I;  4I64 A;  2QA1 A;  5IS2 A;  2GFF A;  2KZM A;  3LGH A;  1CPZ A;  2DD8 S;  1VC6 A;  1FD8 A;  3MEC A;  1WHW A;  2AP6 A;  4TNO A;  1U48 A;  3NCP A;  4NMX A;  4KAI A;  4LFC J;  3I56 S;  4L74 A;  2FLL A;  5DNX A;  3T1H J;  2UXB E;  1UW4 A;  2KXN B;  2WHO A;  1UJ6 A;  1IQT A;  4FWD A;  3KK3 A;  1ZM9 A;  1E6Y A;  4QIV A;  4OYP A;  4A48 A;  4WU2 A;  1CEZ A;  1JLA B;  1X4C A;  4M1K A;  4IH5 A;  1TMJ A;  3R27 A;  1RTD A;  4A8S A;  4NI2 B;  5M2P A;  2AJQ A;  4G3I A;  4B3M J;  3CDJ A;  3LO3 A;  1B7F A;  3V4M A;  1VRT B;  4RW4 A;  5FLX C;  1XQI A;  5ETT A;  2XCP A;  3Q24 A;  4QNJ A;  2PEB A;  4OO1 C;  2W4C A;  4X62 F;  3MM5 A;  4AUK A;  3NWR A;  3H2V E;  3IG1 A;  3GP9 A;  2O01 C;  2VG5 B;  3RTV A;  4RNH A;  1ZH5 A;  1EKR A;  3RAX A;  1NJX A;  4RNN A;  5GVQ A;  1NHU A;  2KT3 A;  4Q8F A;  5K9F A;  2DHG A;  4PR6 A;  3CC7 S;  4JI5 F;  4AIM A;  3MPW A;  3E01 A;  3W2W B;  3EYZ A;  2ZM6 J;  3CMA S;  2DRB A;  4RNF A;  2CZV C;  2Z2Z A;  1FDD A;  3BS9 A;  3MOJ B;  3RB3 A;  3QMQ A;  2Z5B A;  4DR3 E;  3GWC A;  3G6Y A;  4Q8E A;  2YKO A;  1KKH A;  2DR9 A;  1HL6 A;  2CJQ A;  3LP2 B;  2B9W A;  4M5D B;  3OL6 A;  2ROE A;  1M5S A;  5IC4 B;  3VR1 A;  1VRU B;  3UDV A;  4RUC A;  1VQ9 S;  4DPO A;  1AT1 B;  2JLF A;  2ZBP A;  1S0O A;  4LRD A;  3R97 A;  4A8X A;  1OPI A;  2I6W A;  3SI8 A;  1Z2L A;  2X1G A;  2UUT A;  4FXW A;  4PYD A;  3AD7 C;  4GRS A;  2HHX A;  3IS9 A;  3MED B;  1WG1 A;  1X5P A;  3FDS A;  2Q79 A;  2C3U A;  4XO0 A;  1X9W A;  3A3O B;  5HAT A;  2RUG A;  4BS2 A;  2BAC A;  3UCU P;  3SV3 A;  1BQN A;  2BKP A;  5HQL A;  4C7Q A;  2QYG A;  3TVZ A;  2UVW A;  2VFS A;  2XZD B;  1LXN A;  1DQ8 A;  1Z5B A;  3PW0 A;  3TAP A;  1X5O A;  2MLY A;  1OSC A;  3CDA A;  2Q2E B;  2J8A A;  3FBC A;  3Q23 A;  3WHI A;  1SBR A;  2E5L E;  4X66 E;  5ETP A;  9RUB A;  4BA1 A;  1VI7 A;  3B82 A;  3F0N A;  4Y65 A;  5JVH Q;  4WYW A;  2GHP A;  1DTT B;  1SJ3 P;  1NKC A;  4HAC B;  5G0R B;  2YPY A;  4DR6 F;  3DLK B;  5D0R A;  2PNL A;  2FVR A;  2OHD A;  2CDR B;  3P4U B;  3GCM A;  1NRK A;  3FSX A;  4FW3 A;  1IR1 A;  3DC2 A;  1UPP A;  3W5Z A;  2QA4 S;  4NLY A;  1VCT A;  8RUC A;  3ZTR A;  5DQG A;  2QLJ B;  3OTO I;  2K1R A;  3OPK A;  1LOU A;  4OYB A;  1IBL I;  1L3U A;  2C2Z B;  3ZNU A;  2BA0 G;  4NXN F;  2LXI A;  1Y5N B;  5DZ6 A;  4EYH B;  2UUA I;  3HFV A;  2HK2 A;  4K0K F;  5CHC B;  4U95 A;  2VG7 A;  2RB7 A;  4LRA A;  3ISN D;  1ZOT A;  2CNN B;  4DI6 A;  5FWK A;  1R8P A;  4LFA E;  1V6H A;  3MTJ A;  1VRQ C;  1TAU A;  2HFO A;  1T9U A;  4B9M A;  4DSI A;  2QMU B;  4X4R A;  2IC3 B;  1P27 B;  4PXC A;  3M32 B;  3GFZ A;  2VBX A;  1WC4 A;  3C19 A;  5JEA E;  4ER8 A;  4DL5 A;  1IBK I;  1U45 A;  1R0C B;  2DNH A;  2A0F B;  5KT3 A;  4GKJ F;  3D54 A;  3ZZO A;  5KFX A;  2CKW A;  4DV7 F;  1WUU A;  1ZYQ A;  2O3Z A;  4WFB Q;  2E9T A;  2E1A A;  3D0I E;  5LT5 A;  5KG0 A;  3W7B A;  1KHV A;  3IBF B;  4L72 B;  1IKX A;  3KLI A;  3JS9 A;  2W01 A;  2PFF B;  4C0O C;  3TX0 A;  3GZ7 A;  5FLX Q;  4DEZ A;  3KK3 B;  1NK7 A;  4QBU A;  2CAJ A;  2CGE A;  3EVO A;  5HO4 A;  2DR5 A;  3PYF A;  2HND B;  2JDJ A;  3RAQ A;  2RDI A;  1BMQ B;  1FFG B;  1C0U A;  1IBM E;  2OPP A;  5AE3 A;  4ATN A;  4LF8 E;  4ZVF A;  1RAH B;  1OO0 B;  2GGP A;  4OI3 A;  3BGU A;  4D3H A;  2YBV A;  2DNY A;  2KM8 C;  2A1B A;  1TL7 B;  1ZTT A;  1HQU B;  3OTO J;  2H5I B;  1VK3 A;  1IBL J;  2IVM A;  5IV3 A;  4LVN P;  3MM5 B;  4RU2 A;  2UUA J;  3IG1 B;  4LRC A;  1X4A A;  2BRK A;  4AND A;  4Q0B B;  1XMO F;  5KG3 A;  1IKW B;  1URR A;  3M2R A;  3I5C A;  3GIK A;  2FHM A;  2RH3 A;  4EGL A;  4DV2 I;  2ZBR A;  2PD1 A;  2M8H A;  1IBK J;  1S1W B;  3R5A A;  3UCZ P;  4JOU A;  3UN5 A;  1FXD A;  4XK8 C;  4M94 A;  3PEJ A;  4KPC A;  3P5B P;  1AA1 B;  2AZ3 A;  2YNG A;  3IAM 9;  1HD0 A;  1XN9 A;  3HVT A;  1ZM4 A;  3D5M A;  2GQC A;  4JI8 I;  1VGY A;  2NSC A;  2UUB F;  4LUB A;  1FXL A;  3GLJ A;  1WKL A;  4PYA A;  4DV6 F;  2BJ7 A;  2MSS A;  2AKW B;  4MYT A;  3HD2 A;  2HHH F;  3IMQ J;  1AW0 A;  1YZ6 A;  4NLS A;  2CPD A;  4JUZ A;  4FVC A;  4DUT A;