1XNRE

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnrE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrE02
4M30A 4LF8E 4DV4I 2HHHE 1WHNA 3PYGA 4JYAE 5LMNE 1NHJA 4DV2E 3M6AA 1Z59A 1FWLA 4DR6E 1IBLI 3Q1QA 4KHPE 3JAMC 2OI2A 4DR1I 4M2ZA 4LFCE 4LF6I 3J80C 2VF3A 3ADJA 1Z0VA 2R42A 4DPUA 2R3VA 3PYEA 2X36A 3VYYA 4OX9I 4LF4E 2UUCE 1A6FA 1T4NA 4JI3I 1XMQI 3J7AM 2UXBE 4DR4E 1X48A 3T1YE 2UXDE 3T1HI 1N36I 1MX0A 1IBKE 4X66I 4DV1I 5LL6R 1RC7A 3LPSA 2DMYA 2HKEA 4JV5I 2VQFE 1H72C 1HNXE 4DR2E 4MYTA 3J81Q 1YYWA 4YHHE 3VYXA 3B82A 1H7SA 1J5EI 2VQEI 1KKHA 4DPXA 2LUPB 3QT5A 1RQ0A 1WUUA 1KVKA 2AJ4A 2ZM6I 4USKA 2ZITA 5GMDA 1Z5BA 1D6TA 4KQVA 4K0KE 3C4TA 3PYDA 1BKNA 4JI4E 3J81C 1HR0E 4P52A 1GQEA 2HHHI 1FJGI 2UUBE 4WYQB 4MYUA 2UUAE 5LMNI 1S4EA 2RS7A 3ADGA 4DV2I 4JI8I 4DV0E 5IT9Q 1NHHA 4NXNI 1J26A 4PU9A 1T4OA 1N33E 1FKAE 4ZVIA 4LF7E 2UXCE 1Z0EA 3LLHA 1KIJA 4DV5E 2MDRA 1RREA 4JG4A 3WU5A 4DR7I 4LF4I 4USMA 2UU9I 5BR8E 4DU8A 4JI7E 1IBMI 1N34E 4DV6I 4DR4I 4M1KA 4EMDA 4LFBE 3T1YI 3OTOI 4LFAI 3ADIA 4HACB 2HK3A 1PIEA 4GKKE 4PRXA 2VQFI 1HNXI 4DR2I 4HY1A 2XEXA 1H74A 4YHHI 4X64I 2ZBKB 4P7AA 1HNWI 4NXME 1O0WA 1ZM4A 4DV3I 2YT4A 2CPNA 4DR5E 3QT8A 4DUZI 1B62A 1XNRI 3QT7A 3HTXA 4HXZA 2CZ9A 4YY3E 5IWAE 4LF9E 4ED4A 2BM1A 4WUCA 1PKPA 2DB2A 2L2NA 2N3HA 1ZM2A 2L33A 1K47A 1ELOA 2A2CA 2UUBI 4JI5I 4DR3E 2KHXA 1H7UA 1ZBTA 2LTSA 3ZKBA 4X62I 2Q2EB 1XNQI 3PYFA 2HFUA 4DU7A 1N33I 2HFSA 3K17A 4X65E 2IHR1 4DV7E 4DUYE 4DV5I 4B3RE 2WW4A 4FWDA 3J7AG 2L3JA 3J7Yp 4B3TE 4JI0E 2HK2A 2BM0A 2DEIA 4JI7I 1N34I 4B3SE 4JI2E 1HNZE 2NPFA 2NUFA 4LF5E 1FWKA 4OOGC 2RSMA 4JI6I 4WFTA 1I94I 1QU6A 4JI1I 3F0NA 4GKKI 1DARA 2F4VE 3LNUA 4PRVA 4LF8I 1WHQA 3LTOA 1Z0CA 1FI4A 2EFGA 4WUDA 1IBLE 1UEKA 4DXLA 3H4LA 4JYAI 2L2KB 3ZZUA 2N3GA 4LF6E 4DR6I 4KHPI 1QZRA 1VISA 5FLXQ 2NUGA 4LFCI 2E1RA 1U2RA 4LF9I 4FW9A 1XMOE 4JI3E 1X49A 4X8WA 1XMQE 4AQYE 4HACA 2B7TA 2UUCI 1Z5AA 2LJHA 2BV3A 1Z0GA 1N0VC 4DR3I 1N36E 2UXBI 5IT9C 4DV1E 1DI2A 1PVGA 2UXDI 1NHIA 5FLXC 1IBKI 1YZ9A 3ZZTA 1J5EE 1KTVA 3K1JA 3JAMQ 2ZM6E 1EI1A 1EA6A 1N32E 4RPFA 4JI0I 3V5RA 3J80Q 1RR9A 1H73A 4B3SI 1EKZA 2LBSB 3ZKDA 4JI2I 2LRSA 1NZ0A 1HNZI 3B78A 4GKJE 4I3HA 4LF5I 4K0KI 1FJGE 5A2QQ 2F4VI 2GS8A 2EZ6A 2LUQA 4JI4I 3HULA 3WU3A 4JI8E 1HR0I 3B8HA 1S16A 4NXNE 2JY9A 2A2DA 4FWGA 2UUAI 1X47A 1ZXNA 1YYOA 1N0UA 1Z0TA 2V2QA 5LMUE 3ZM7A 4DV0I 1UHZA 2E5LE 1MG7A 2J7KA 4FN5A 1UILA 4LF7I 2UXCI 1FNMA 4DR7E 1B63A 5A2QC 4DPWA 1XMOI 2UU9E 4XTJA 4UTGA 1IBME 1STUA 4AQYI 3GONA 4B3ME 1ZXMA 4DV6E 5GMEA 2LTRA 1Z5CA 5BR8I 3OTOE 4LFAE 2V8PA 4DKKA 2RS6A 2V2ZA 3C4BA 4LFBI 2DIXA 2B3TB 4DV4E 3WU4A 1T4LB 4URLA 4X64E 1HNWE 1MU5A 4DV3E 3P1XA 2NA2A 2L3CA 1YYKA 4DUZE 1XNRE 4NXMI 4DR1E 1N32I 4DR5I 4Z7CA 4HYMA 3D4JA 2DEJA 4YY3I 5IWAI 4DPYA 2X7IA 4GKJI 4OX9E 3QT6A 4JI5E 1Z0BA 2B7VA 1ZM3A 4X62E 2NUEA 4Z7YA 2JVAA 5L3JA 1XNQE 3T1HE 3V2UC 1OJ4A 4WUBA 3WU6A 4X66E 4UT4A 5LMUI 2LJPA 2E5LI 2RTXA 4JV5E 2V34A 4FWHA 4X65I 1ZM9A 5CFFE 1Z0WA 4DV7I 4DUYI 2VQEE 4B3RI 2HKJA 3CWVA 2V2VA 4R1FA 4DPTA 4B3MI 1XHKA 2L2MA 4B3TI 3ZZ0A 4JI6E 3ADLA 1I94E 4JI1E
chains in the Genus database with same CATH superfamily
2L92A 2WBUA 4M30A 4LF8E 3ECRA 4L8NA 5JEAD 2VF1A 2BR2B 4DV4I 2HHHE 2VE7C 3NZKA 1WHNA 3PYGA 4JYAE 5LMNE 1IQSA 2LJUA 2EQ0A 2JR1A 1NHJA 4IS9A 2YRMA 4DV2E 3M6AA 1Z59A 2ENHA 1FWLA 2I9IA 2YTPA 4DR6E 2JEBA 1IBLI 3Q1QA 2L8TA 2L6MA 3JAMC 3QG5C 4KHPE 2YU8A 2EPLX 2OI2A 3KZZA 4DR1I 2EPZA 4M2ZA 4GQUA 4LFCE 4LF6I 1GZ6A 2RQLA 3J80C 2VF3A 5A6JA 3ADJA 1Z0VA 4OO1E 4R2AA 1WXRA 1AH5A 4BHBA 2EMXA 2YTQA 2R42A 4DPUA 2JT2A 1X5WA 2VRDA 4MU3A 2R3VA 3K85A 4KWYA 3PYEA 3PRYA 2GO4A 2X36A 4OO1C 3VYYA 2DGCA 4OX9I 4LF4E 2EM4A 2UUCE 1A6FA 1T4NA 2KOUA 2EN6A 4I8OA 4JI3I 2AE8A 2WBTA 3U1YA 5DNXA 1XMQI 1UDSA 3J7AM 3EPLA 1A1IA 1PJTA 2UXBE 1KYQA 2EMYA 4DR4E 4X9JA 1X48A 1WRJA 3T1YE 2UXDE 2EN3A 3T1HI 3MHSC 1MX0A 1N36I 1IBKE 4P78A 4X66I 2WNRB 4DV1I 2R76A 5LL6R 1RC7A 4J3DA 2RSIA 2YSOA 3LPSA 2DMYA 2EOQA 2E72A 2HKEA 4JV5I 2VQFE 1H72C 3HJCA 2ADRA 1HNXE 4DR2E 4RH8A 4MYTA 3J81Q 2YTOA 2JEAA 1YYWA 4F6MA 2EMCA 4YHHE 2J7JA 4FW3A 3VYXA 3B82A 3M99B 1H7SA 5DNLA 1J5EI 2VQEI 1KKHA 4DPXA 4R03A 2LUPB 4O5GA 2EOSA 3QT5A 2EL5A 2EPOA 2PRTA 1RQ0A 1WUUA 2HC5A 1KVKA 2AJ4A 2ZM6I 4USKA 2YPNA 2ZITA 2ODRC 2C38B 4U3DA 5GMDA 5A69A 2EPAA 4BC9A 3HKMA 1Z5BA 1D6TA 4KQVA 4K0KE 3GCMA 4WXCA 3EPKA 5EKWA 2EMHA 3C4TA 3PYDA 5ELWA 1BKNA 2ENCA 4HEIA 4JI4E 4R2CA 3J81C 2WP8B 1HR0E 3PS2A 4P52A 1GQEA 2CSHA 2HHHI 1FJGI 5K36E 2UUBE 4WYQB 2NN6D 4MYUA 2UUAE 5C0XB 5LMNI 3IWBA 1QNTA 2RS7A 3ADGA 1BB8A 2CTDA 1S4EA 3H1CA 4QNJA 4DV2I 4R2QA 4JI8I 5AC4A 2EM6A 4LU9A 4DV0E 2GO3A 2EL6A 3HXLA 5IT9Q 4BC7A 3AUZA 2EN1A 1J26A 1NHHA 4NXNI 5K36C 4WXDA 3B4TA 2Z5CA 1EH7A 2YRKA 4PU9A 1T4OA 5ADZA 1N33E 1FKAE 4ZVIA 4LF7E 4O4KA 2UXCE 1Z0EA 5DRPA 2EPNA 3LLHA 2EORA 3KRNA 4IZJA 5JEAA 1KIJA 4DV5E 3CDJA 4MQYA 1HK7A 5DRQA 2MDRA 4AM3A 1RREA 2A25A 4JG4A 2PO2B 2FTXB 3JTZA 2Z5BA 3WU5A 4DR7I 4LF4I 4USMA 4BHCA 2YTNA 1USVA 1BBOA 4WPYA 2UU9I 5BR8E 4DU8A 4JI7E 1IBMI 2EP3A 2JE6A 1N34E 2B9DA 4BCAA 2BR2A 4DV6I 3GLLA 4DR4I 1E3PA 2JYAA 4M1KA 4EMDA 4LFBE 1TN9A 4AIMA 3OTOI 1UDNA 3T1YI 3M85D 1WJPA 4LFAI 3ADIA 4HACB 2HK3A 1PIEA 4WSPA 4GKKE 2EPUA 2MC6A 2YTIA 3AV0A 1P47A 4PRXA 2EMIA 2YTDA 1OYSA 1T39A 1A1JA 3IWDA 1UDQA 1A1LA 1Z1BA 4LCFA 2VQFI 1PJSA 2MC5A 1HNXI 4DR2I 4HY1A 2XEXA 2LMZA 2IOPA 3RMPA 1H74A 5A6AA 4YHHI 4X64I 2ZBKB 3OMLA 4P7AA 1HNWI 5IXMB 4NXME 1O0WA 1ZM4A 3L7ZB 4DV3I 4MU1A 2LVHA 5KL2A 2YT4A 2CPNA 4DR5E 4IFDF 3QT8A 2DRPA 5AASA 4OZEA 2FV4B 4DUZI 1EH6A 1B62A 2JOXA 3P3CA 3QT7A 3HTXA 4HXZA 5DRRA 2CZ9A 1XNRI 2MKNA 4YY3E 1OYPA 1GTKA 5IWAE 3Q6NA 4U3BA 4LF9E 1NEIA 4ED4A 2BM1A 4WUCA 4IFDB 2EPCA 2EN4A 1LLMC 1VI7A 2PO0B 1A1FA 5K36A 2JXPA 2M1SA 1PKPA 4MU4A 2DB2A 2L2NA 3IWCA 2YTEA 1AAYA 2N3HA 3C6MA 1ZM2A 4HTGA 2L33A 1YUIA 3EPJA 1G2DC 1KJKA 1ELOA 1K47A 5JEAE 4Q35B 2A2CA 4ZYHA 4Q28A 4ZYGA 2UUBI 3P3EA 2EMAA 4JI5I 4DR3E 4IFDD 2KHXA 1H7UA 1ZBTA 1G2FC 2LTSA 3ZKBA 2EPMX 1YUJA 2Q2EB 4X62I 5KL6A 4R2PA 4OKGA 5JEAC 2EPKX 1XNQI 2EJ4A 2EOHA 3MSWA 2HFUA 3PYFA 3PS1A 3M7NG 1IQOA 4DU7A 1N33I 2HFSA 3K17A 4X65E 5KL7A 1A1HA 4FK5C 2JEBB 2O1TA 4LPFA 2IHR1 4DMIA 4DV7E 4TUIA 4DUYE 3TQMA 4DV5I 3M7ND 4B3RE 1JK2A 4P7DA 2WW4A 4FWDA 3J7AG 2NN6A 2L3JA 3J7Yp 3F6HA 4B3TE 2G7HA 4M9VC 2C37B 2EOZA 2LT7A 4JI0E 2HK2A 2BM0A 2DEIA 2PNZB 4JI7I 2WP8A 1N34I 2O3ZA 2MDGA 4B3SE 4IS1C 2FGGA 2CGEA 4JI2E 1HNZE 1UBDC 1N3GA 2CVEA 2NPFA 2V87A 4NBQA 4F6NA 3FIGA 2NUFA 4LF5E 4OOGC 2RSMA 1FWKA 2BA1D 2YTFA 4JI6I 4WFTA 4BA2B 1I94I 1QU6A 4JI1I 1XXEA 3F0NA 2YTJA 4QNKA 2EM9A 5C0XF 1RMDA 2HGHA 2ELZA 1DARA 2F4VE 2IERA 4GKKI 3BIDA 1NCSA 4RHBB 2EM7A 3LNUA 4PRVA 4LF8I 2N8XA 1WHQA 2V89A 3LTOA 1Z0CA 1FI4A 2EFGA 2WCC3 4WUDA 2V88A 1Y4UA 2I13A 1IBLE 2Z5EA 1UEKA 2C39A 2PNLA 4DXLA 3H4LA 3PS3A 4JYAI 4LCGA 2ELYA 2PO1B 2L2KB 4FW6A 5AC5A 2EOFA 2N3GA 2WZOA 3UHMA 3ZZUA 4LF6E 2JEAB 4DR6I 2PO2A 4FW5A 4KHPI 1QZRA 5KL5A 5EL9A 1VISA 5FLXQ 2EN8A 2EPXA 3JU0A 2NUGA 4LFCI 5C0XD 2PNMA 2E1RA 1U2RA 4LF9I 4BA1B 3BGHA 4FW9A 1JK1A 1XMOE 3VK6A 4JI3E 1X49A 4X8WA 1XMQE 1Y5YA 4AQYE 2R1FA 4TUGA 4HACA 2B7TA 5T6JA 5A6KA 4F54A 1YPNA 2UUCI 5F3WA 1Z5AA 2LJHA 3GMEA 3M85G 2BV3A 1BBGA 5AE2A 5LLQA 2DLQA 1Z0GA 2O1UA 1N0VC 4DR3I 1N36E 2IOQA 2NN6E 4OO1F 2D9HA 4MLVA 2UXBI 5IT9C 4DV1E 2EOXA 1DI2A 1PVGA 4R2RA 2EM0A 2UXDI 2EOYA 3MHHC 1SFEA 2EWLA 1IMUA 1ZBQA 5FLXC 1NHIA 3L7ZA 4IZKB 2EMFA 1IBKI 1YHCA 2EOEA 2NN6C 5AE1A 1L4SA 2YSPA 5FWKA 4OO1B 2M9AA 1YZ9A 4AIDA 3ZZTA 2M7QA 2YZTA 1J5EE 2Z5CB 2EPRA 1KTVA 2BA0D 4R2SA 3K1JA 4L5NC 4GZNC 3Q6MA 3THNA 1ZAAC 3EQ1A 3THOB 4JI4I 3JAMQ 4IZJB 5A6BD 4LTYA 2EMBA 4OO1D 1X6EA 2ZM6E 3DF6A 1EA6A 1EI1A 1UDOA 1N32E 4RPFA 4N4RB 4JI0I 3V5RA 3J80Q 1PJQA 1RR9A 4GEQB 1H73A 4B3SI 1EKZA 4MDTA 2NABA 2LBSB 4BS9A 3ZKDA 4JI2I 2LRSA 1NZ0A 1HNZI 3B78A 3HPZA 4GKJE 4O43A 4IZJD 2JWOA 2F8BA 4I3HA 4LF5I 2JE6B 2EM5A 3H09A 2EM2A 5DNYA 2EOJA 2M4IA 1MEYC 1FJGE 4K0KI 5A2QQ 2BBGA 2F4VI 2GS8A 3LMLA 1P42A 4ZYDA 2EMGA 2KONA 2LUQA 4NHRA 4WX9A 2EZ6A 1E3HA 1Y6ZA 2CG9A 4JI8E 2WNRA 3HULA 5DROA 3B8HA 1DGCA 1HR0I 1S16A 5TSEA 4NXNE 2JY9A 2A2DA 1X3CA 4FWGA 2UUAI 4BMJA 1X47A 3L00A 1ZXNA 1PDAA 1YYOA 5IV8B 1N0UA 1Z0TA 2V2QA 2EMZA 5LMUE 2GQ0A 3ZM7A 4DV0I 1B69A 1A1KA 1UHZA 2E5LE 1MG7A 2J7KA 4FN5A 2GPIA 2C37A 3P3GA 1UILA 4LF7I 2GHFA 2JP9A 1FNMA 2PNZA 2UXCI 4FW4A 2V85A 4DR7E 5K36F 2JOBA 2ODRD 1B63A 3HQ1A 5A2QC 4DPWA 1XMOI 2UU9E 4J8ZA 2C38A 4XTJA 1DQ3A 2EL4A 2V8QB 1IBME 1STUA 4UTGA 3ZOQB 4AQYI 4BA2A 4R8OA 3GONA 1F2IG 4B3ME 1R6LA 1ZXMA 4DV6E 2O1WA 2RPCA 4LOMA 5GMEA 5K36B 1YH8A 2LTRA 2BA1G 2F1DA 1Z5CA 5BR8I 3DJWA 3OTOE 1R6MA 4LFAE 4IFDE 2EE8A 2ENAA 5KL3A 2V8PA 3VHTB 1X6FA 1OYRA 1EH8A 4DKKA 2RS6A 2J65A 2V2ZA 5C0XA 3C4BA 2GLIA 2DIXA 2YWQA 2PO1A 4LFBI 1TF3A 5KL4A 3F6GA 2B3TB 2EOOA 5K36D 4DV4E 3WU4A 2V86A 4NZVA 1T4LB 4URLA 1SR9A 2CT1A 4IFDC 4MLQA 2EPPA 4X64E 2HJJA 1HNWE 1MU5A 2JPAA 5AE3A 4DV3E 4WSGA 1TF6A 3P1XA 2NA2A 2E1MA 2EOIA 2NN6F 2EMLA 2LCEA 2L3CA 1Y60A 4BA1A 2VESA 1YYKA 2LO3A 4DUZE 3BF2A 1XNRE 4NXMI 4DR1E 2BB8A 3WU3A 3K6QA 1N32I 4DR5I 4Z7CA 4BBYA 4F9AB 2EQ3A 2NN6B 4HYMA 3D4JA 2DEJA 4YY3I 5IWAI 3U1KA 4DPYA 2X7IA 4ISAA 4GKJI 2EMKA 4OX9E 4R2EA 3QT6A 3EPHA 1T38A 3CDIA 3P76A 3HPSA 4JI5E 1Z0BA 4IZKA 2B7VA 2DLKA 4F9BB 1ZM3A 4X62E 2NUEA 2EQ1A 3P06A 5A6BA 2JVAA 4LCHA 4Z7YA 4OO1A 4N3OA 5L3JA 4O24A 2K7IA 2LE2A 1XNQE 2H36X 4FW7A 3T1HE 3V2UC 1OJ4A 4ZYEA 4WUBA 2WBSA 2EM3A 4X66E 3WU6A 2EM8A 4IJDA 4UT4A 5LMUI 4R2DA 1YFHA 2LJPA 3C6KA 2DSYA 2E5LI 2RTXA 2C39B 3KWRA 2BA0G 2YTGA 3UK3C 4JV5E 2V34A 2V83A 1MGTA 4KZSA 1YSAC 4FWHA 4X65I 1RHYA 1ZM9A 2YU5A 5CFFE 2EMWA 2K4VA 1Z0WA 5JEAF 3KZYA 1Y4SA 5C0XE 2DMIA 4DV7I 4DUYI 2LV2A 2Q8UA 1UN6B 2VQEE 4B3RI 3BBGA 4M0VA 2HKJA 3DD6A 3CWVA 4IFDA 2IESA 4F2JC 2PO0A 2V2VA 4R1FA 4DPTA 1ZR9A 4F9CB 1XHKA 5JEAB 5C0XC 4B3MI 2L2MA 4B3TI 2MKDA 2O1VA 3ZZ0A 1X6HA 4JI6E 2EOMA 1ZU1A 3ADLA 2Z5BB 1I94E 1USUA 4MU0A 4JI1E 1A1GA 2EN2A 2EN7A 2YRHA
chains in the Genus database with same CATH topology
2L92A 4M30A 4LF8E 4L8NA 2VF1A 4DV4I 2HHHE 2VE7C 1WHNA 3PYGA 4JYAE 5LMNE 2JR1A 1NHJA 4DV2E 3M6AA 1Z59A 1FWLA 4DR6E 1IBLI 3Q1QA 2L8TA 2L6MA 3JAMC 4KHPE 2OI2A 4DR1I 4M2ZA 4LFCE 4LF6I 1GZ6A 3J80C 2VF3A 3ADJA 1Z0VA 1WXRA 2R42A 4DPUA 2R3VA 3K85A 3PYEA 3PRYA 2X36A 3VYYA 4OX9I 4LF4E 2UUCE 1A6FA 1T4NA 2KOUA 4I8OA 4JI3I 1XMQI 3J7AM 2UXBE 4DR4E 1X48A 3T1YE 2UXDE 3T1HI 1N36I 1MX0A 1IBKE 4P78A 4X66I 4DV1I 5LL6R 1RC7A 3LPSA 2DMYA 2HKEA 4JV5I 2VQFE 1H72C 3HJCA 1HNXE 4DR2E 4MYTA 3J81Q 1YYWA 4YHHE 3VYXA 3B82A 1H7SA 1J5EI 2VQEI 1KKHA 4DPXA 4R03A 2LUPB 3QT5A 1RQ0A 1WUUA 1KVKA 2AJ4A 2ZM6I 4USKA 2ZITA 2ODRC 5GMDA 4BC9A 1Z5BA 1D6TA 4KQVA 4K0KE 3C4TA 3PYDA 1BKNA 4JI4E 3J81C 1HR0E 4P52A 1GQEA 2HHHI 1FJGI 2UUBE 4WYQB 4MYUA 2UUAE 5LMNI 3IWBA 1S4EA 2RS7A 3ADGA 4DV2I 4JI8I 4DV0E 4LU9A 3HXLA 5IT9Q 4BC7A 3AUZA 1J26A 1NHHA 4NXNI 2Z5CA 4PU9A 1T4OA 1N33E 5ADZA 1FKAE 4ZVIA 4LF7E 2UXCE 1Z0EA 3LLHA 4IZJA 1KIJA 4DV5E 1HK7A 2MDRA 1RREA 4JG4A 2FTXB 3JTZA 2Z5BA 3WU5A 4DR7I 4LF4I 4USMA 1USVA 4WPYA 2UU9I 5BR8E 4DU8A 4JI7E 1IBMI 1N34E 2B9DA 4BCAA 4DV6I 4DR4I 4M1KA 4EMDA 4LFBE 3T1YI 3OTOI 4LFAI 3ADIA 4HACB 2HK3A 1PIEA 4WSPA 4GKKE 2MC6A 3AV0A 4PRXA 3IWDA 2VQFI 2MC5A 1HNXI 4DR2I 4HY1A 2XEXA 2LMZA 2IOPA 3RMPA 1H74A 4YHHI 4X64I 2ZBKB 3OMLA 4P7AA 1HNWI 4NXME 1O0WA 1ZM4A 4DV3I 2YT4A 2CPNA 4DR5E 3QT8A 5AASA 2FV4B 4DUZI 1B62A 2JOXA 3QT7A 1XNRI 3HTXA 4HXZA 2CZ9A 4YY3E 5IWAE 3Q6NA 4LF9E 4ED4A 2BM1A 4WUCA 2M1SA 1PKPA 2DB2A 2L2NA 3IWCA 2N3HA 1ZM2A 2L33A 1K47A 1ELOA 2A2CA 4Q28A 2UUBI 4JI5I 4DR3E 2KHXA 1H7UA 1ZBTA 2LTSA 3ZKBA 4X62I 2Q2EB 1XNQI 3MSWA 2HFUA 3PYFA 4DU7A 1N33I 2HFSA 3K17A 4X65E 2O1TA 2IHR1 4DMIA 4DV7E 4TUIA 4DUYE 4DV5I 4B3RE 4P7DA 2WW4A 4FWDA 3J7AG 2L3JA 3J7Yp 3F6HA 4B3TE 2G7HA 4JI0E 2HK2A 2BM0A 2DEIA 4JI7I 1N34I 4B3SE 2FGGA 2CGEA 4JI2E 1HNZE 2NPFA 2V87A 2NUFA 3FIGA 4LF5E 1FWKA 4OOGC 2RSMA 4JI6I 4WFTA 1I94I 1QU6A 4JI1I 3F0NA 4GKKI 1DARA 2F4VE 3LNUA 4PRVA 4LF8I 1WHQA 2V89A 3LTOA 1Z0CA 1FI4A 2EFGA 4WUDA 2V88A 1Y4UA 2Z5EA 1IBLE 1UEKA 2PNLA 4DXLA 3H4LA 4JYAI 2L2KB 3ZZUA 2N3GA 2WZOA 4LF6E 4DR6I 4KHPI 1QZRA 1VISA 5FLXQ 3JU0A 2NUGA 4LFCI 2PNMA 2E1RA 1U2RA 4LF9I 4FW9A 1XMOE 3VK6A 4JI3E 1X49A 4X8WA 1XMQE 4AQYE 4TUGA 4HACA 2B7TA 5T6JA 4F54A 2UUCI 5F3WA 1Z5AA 2LJHA 2BV3A 5AE2A 2O1UA 1Z0GA 1N0VC 4DR3I 1N36E 2IOQA 2UXBI 5IT9C 4DV1E 1DI2A 1PVGA 2UXDI 2EWLA 1NHIA 1ZBQA 5FLXC 4IZKB 1IBKI 5AE1A 5FWKA 1YZ9A 3ZZTA 2M7QA 2YZTA 1J5EE 2Z5CB 1KTVA 3K1JA 4L5NC 3Q6MA 3JAMQ 4IZJB 4LTYA 2ZM6E 1EI1A 3DF6A 1EA6A 1N32E 4RPFA 4JI0I 3V5RA 3J80Q 1RR9A 4GEQB 1H73A 4B3SI 1EKZA 2LBSB 3ZKDA 4BS9A 4JI2I 2LRSA 1NZ0A 1HNZI 3B78A 3HPZA 4GKJE 4IZJD 2JWOA 2F8BA 4I3HA 4LF5I 3H09A 5DNYA 4K0KI 2M4IA 1FJGE 5A2QQ 2F4VI 2GS8A 3LMLA 2EZ6A 2KONA 2LUQA 1Y6ZA 3HULA 2CG9A 3WU3A 4JI4I 4JI8E 1HR0I 3B8HA 1S16A 4NXNE 2JY9A 2A2DA 4FWGA 2UUAI 4BMJA 1X47A 1ZXNA 1YYOA 1N0UA 1Z0TA 2V2QA 5LMUE 2GQ0A 3ZM7A 4DV0I 1UHZA 2E5LE 1MG7A 2J7KA 4FN5A 1UILA 4LF7I 2UXCI 1FNMA 2V85A 4DR7E 2JOBA 2ODRD 1B63A 3HQ1A 5A2QC 4DPWA 1XMOI 2UU9E 4J8ZA 4XTJA 1DQ3A 2V8QB 4UTGA 1IBME 1STUA 3ZOQB 4AQYI 4R8OA 3GONA 4B3ME 1ZXMA 4DV6E 2O1WA 5GMEA 2LTRA 1Z5CA 5BR8I 3DJWA 3OTOE 4LFAE 2V8PA 4DKKA 2RS6A 2V2ZA 3C4BA 4LFBI 2DIXA 3F6GA 2B3TB 4DV4E 3WU4A 2V86A 1T4LB 4URLA 1SR9A 4X64E 1HNWE 1MU5A 5AE3A 4DV3E 3P1XA 2NA2A 2E1MA 2L3CA 1YYKA 4DUZE 1XNRE 4NXMI 4DR1E 3K6QA 1N32I 4DR5I 4Z7CA 4BBYA 4F9AB 4HYMA 3D4JA 2DEJA 4YY3I 5IWAI 4DPYA 2X7IA 4GKJI 4OX9E 3QT6A 3HPSA 4JI5E 1Z0BA 4IZKA 2B7VA 4F9BB 1ZM3A 4X62E 2NUEA 3P06A 4Z7YA 2JVAA 4N3OA 5L3JA 2LE2A 1XNQE 2H36X 3T1HE 3V2UC 1OJ4A 4WUBA 3WU6A 4X66E 4UT4A 5LMUI 2LJPA 2DSYA 2E5LI 2RTXA 3KWRA 4JV5E 2V34A 2V83A 4KZSA 4FWHA 4X65I 1ZM9A 5CFFE 2K4VA 1Z0WA 1Y4SA 4DV7I 4DUYI 2VQEE 4B3RI 4M0VA 2HKJA 3CWVA 2V2VA 4R1FA 4DPTA 4B3MI 4F9CB 1XHKA 2L2MA 4B3TI 2O1VA 3ZZ0A 4JI6E 3ADLA 2Z5BB 1I94E 1USUA 4JI1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M30 A;  4LF8 E;  4DV4 I;  2HHH E;  1WHN A;  3PYG A;  4JYA E;  5LMN E;  1NHJ A;  4DV2 E;  3M6A A;  1Z59 A;  1FWL A;  4DR6 E;  1IBL I;  3Q1Q A;  4KHP E;  3JAM C;  2OI2 A;  4DR1 I;  4M2Z A;  4LFC E;  4LF6 I;  3J80 C;  2VF3 A;  3ADJ A;  1Z0V A;  2R42 A;  4DPU A;  2R3V A;  3PYE A;  2X36 A;  3VYY A;  4OX9 I;  4LF4 E;  2UUC E;  1A6F A;  1T4N A;  4JI3 I;  1XMQ I;  3J7A M;  2UXB E;  4DR4 E;  1X48 A;  3T1Y E;  2UXD E;  3T1H I;  1N36 I;  1MX0 A;  1IBK E;  4X66 I;  4DV1 I;  5LL6 R;  1RC7 A;  3LPS A;  2DMY A;  2HKE A;  4JV5 I;  2VQF E;  1H72 C;  1HNX E;  4DR2 E;  4MYT A;  3J81 Q;  1YYW A;  4YHH E;  3VYX A;  3B82 A;  1H7S A;  1J5E I;  2VQE I;  1KKH A;  4DPX A;  2LUP B;  3QT5 A;  1RQ0 A;  1WUU A;  1KVK A;  2AJ4 A;  2ZM6 I;  4USK A;  2ZIT A;  5GMD A;  1Z5B A;  1D6T A;  4KQV A;  4K0K E;  3C4T A;  3PYD A;  1BKN A;  4JI4 E;  3J81 C;  1HR0 E;  4P52 A;  1GQE A;  2HHH I;  1FJG I;  2UUB E;  4WYQ B;  4MYU A;  2UUA E;  5LMN I;  1S4E A;  2RS7 A;  3ADG A;  4DV2 I;  4JI8 I;  4DV0 E;  5IT9 Q;  1NHH A;  4NXN I;  1J26 A;  4PU9 A;  1T4O A;  1N33 E;  1FKA E;  4ZVI A;  4LF7 E;  2UXC E;  1Z0E A;  3LLH A;  1KIJ A;  4DV5 E;  2MDR A;  1RRE A;  4JG4 A;  3WU5 A;  4DR7 I;  4LF4 I;  4USM A;  2UU9 I;  5BR8 E;  4DU8 A;  4JI7 E;  1IBM I;  1N34 E;  4DV6 I;  4DR4 I;  4M1K A;  4EMD A;  4LFB E;  3T1Y I;  3OTO I;  4LFA I;  3ADI A;  4HAC B;  2HK3 A;  1PIE A;  4GKK E;  4PRX A;  2VQF I;  1HNX I;  4DR2 I;  4HY1 A;  2XEX A;  1H74 A;  4YHH I;  4X64 I;  2ZBK B;  4P7A A;  1HNW I;  4NXM E;  1O0W A;  1ZM4 A;  4DV3 I;  2YT4 A;  2CPN A;  4DR5 E;  3QT8 A;  4DUZ I;  1B62 A;  1XNR I;  3QT7 A;  3HTX A;  4HXZ A;  2CZ9 A;  4YY3 E;  5IWA E;  4LF9 E;  4ED4 A;  2BM1 A;  4WUC A;  1PKP A;  2DB2 A;  2L2N A;  2N3H A;  1ZM2 A;  2L33 A;  1K47 A;  1ELO A;  2A2C A;  2UUB I;  4JI5 I;  4DR3 E;  2KHX A;  1H7U A;  1ZBT A;  2LTS A;  3ZKB A;  4X62 I;  2Q2E B;  1XNQ I;  3PYF A;  2HFU A;  4DU7 A;  1N33 I;  2HFS A;  3K17 A;  4X65 E;  2IHR 1;  4DV7 E;  4DUY E;  4DV5 I;  4B3R E;  2WW4 A;  4FWD A;  3J7A G;  2L3J A;  3J7Y p;  4B3T E;  4JI0 E;  2HK2 A;  2BM0 A;  2DEI A;  4JI7 I;  1N34 I;  4B3S E;  4JI2 E;  1HNZ E;  2NPF A;  2NUF A;  4LF5 E;  1FWK A;  4OOG C;  2RSM A;  4JI6 I;  4WFT A;  1I94 I;  1QU6 A;  4JI1 I;  3F0N A;  4GKK I;  1DAR A;  2F4V E;  3LNU A;  4PRV A;  4LF8 I;  1WHQ A;  3LTO A;  1Z0C A;  1FI4 A;  2EFG A;  4WUD A;  1IBL E;  1UEK A;  4DXL A;  3H4L A;  4JYA I;  2L2K B;  3ZZU A;  2N3G A;  4LF6 E;  4DR6 I;  4KHP I;  1QZR A;  1VIS A;  5FLX Q;  2NUG A;  4LFC I;  2E1R A;  1U2R A;  4LF9 I;  4FW9 A;  1XMO E;  4JI3 E;  1X49 A;  4X8W A;  1XMQ E;  4AQY E;  4HAC A;  2B7T A;  2UUC I;  1Z5A A;  2LJH A;  2BV3 A;  1Z0G A;  1N0V C;  4DR3 I;  1N36 E;  2UXB I;  5IT9 C;  4DV1 E;  1DI2 A;  1PVG A;  2UXD I;  1NHI A;  5FLX C;  1IBK I;  1YZ9 A;  3ZZT A;  1J5E E;  1KTV A;  3K1J A;  3JAM Q;  2ZM6 E;  1EI1 A;  1EA6 A;  1N32 E;  4RPF A;  4JI0 I;  3V5R A;  3J80 Q;  1RR9 A;  1H73 A;  4B3S I;  1EKZ A;  2LBS B;  3ZKD A;  4JI2 I;  2LRS A;  1NZ0 A;  1HNZ I;  3B78 A;  4GKJ E;  4I3H A;  4LF5 I;  4K0K I;  1FJG E;  5A2Q Q;  2F4V I;  2GS8 A;  2EZ6 A;  2LUQ A;  4JI4 I;  3HUL A;  3WU3 A;  4JI8 E;  1HR0 I;  3B8H A;  1S16 A;  4NXN E;  2JY9 A;  2A2D A;  4FWG A;  2UUA I;  1X47 A;  1ZXN A;  1YYO A;  1N0U A;  1Z0T A;  2V2Q A;  5LMU E;  3ZM7 A;  4DV0 I;  1UHZ A;  2E5L E;  1MG7 A;  2J7K A;  4FN5 A;  1UIL A;  4LF7 I;  2UXC I;  1FNM A;  4DR7 E;  1B63 A;  5A2Q C;  4DPW A;  1XMO I;  2UU9 E;  4XTJ A;  4UTG A;  1IBM E;  1STU A;  4AQY I;  3GON A;  4B3M E;  1ZXM A;  4DV6 E;  5GME A;  2LTR A;  1Z5C A;  5BR8 I;  3OTO E;  4LFA E;  2V8P A;  4DKK A;  2RS6 A;  2V2Z A;  3C4B A;  4LFB I;  2DIX A;  2B3T B;  4DV4 E;  3WU4 A;  1T4L B;  4URL A;  4X64 E;  1HNW E;  1MU5 A;  4DV3 E;  3P1X A;  2NA2 A;  2L3C A;  1YYK A;  4DUZ E;  1XNR E;  4NXM I;  4DR1 E;  1N32 I;  4DR5 I;  4Z7C A;  4HYM A;  3D4J A;  2DEJ A;  4YY3 I;  5IWA I;  4DPY A;  2X7I A;  4GKJ I;  4OX9 E;  3QT6 A;  4JI5 E;  1Z0B A;  2B7V A;  1ZM3 A;  4X62 E;  2NUE A;  4Z7Y A;  2JVA A;  5L3J A;  1XNQ E;  3T1H E;  3V2U C;  1OJ4 A;  4WUB A;  3WU6 A;  4X66 E;  4UT4 A;  5LMU I;  2LJP A;  2E5L I;  2RTX A;  4JV5 E;  2V34 A;  4FWH A;  4X65 I;  1ZM9 A;  5CFF E;  1Z0W A;  4DV7 I;  4DUY I;  2VQE E;  4B3R I;  2HKJ A;  3CWV A;  2V2V A;  4R1F A;  4DPT A;  4B3M I;  1XHK A;  2L2M A;  4B3T I;  3ZZ0 A;  4JI6 E;  3ADL A;  1I94 E;  4JI1 E; 
#chains in the Genus database with same CATH topology
 2L92 A;  2WBU A;  4M30 A;  4LF8 E;  3ECR A;  4L8N A;  5JEA D;  2VF1 A;  2BR2 B;  4DV4 I;  2HHH E;  2VE7 C;  3NZK A;  1WHN A;  3PYG A;  4JYA E;  5LMN E;  1IQS A;  2LJU A;  2EQ0 A;  2JR1 A;  1NHJ A;  4IS9 A;  2YRM A;  4DV2 E;  3M6A A;  1Z59 A;  2ENH A;  1FWL A;  2I9I A;  2YTP A;  4DR6 E;  2JEB A;  1IBL I;  3Q1Q A;  2L8T A;  2L6M A;  3JAM C;  3QG5 C;  4KHP E;  2YU8 A;  2EPL X;  2OI2 A;  3KZZ A;  4DR1 I;  2EPZ A;  4M2Z A;  4GQU A;  4LFC E;  4LF6 I;  1GZ6 A;  2RQL A;  3J80 C;  2VF3 A;  5A6J A;  3ADJ A;  1Z0V A;  4OO1 E;  4R2A A;  1WXR A;  1AH5 A;  4BHB A;  2EMX A;  2YTQ A;  2R42 A;  4DPU A;  2JT2 A;  1X5W A;  2VRD A;  4MU3 A;  2R3V A;  3K85 A;  4KWY A;  3PYE A;  3PRY A;  2GO4 A;  2X36 A;  4OO1 C;  3VYY A;  2DGC A;  4OX9 I;  4LF4 E;  2EM4 A;  2UUC E;  1A6F A;  1T4N A;  2KOU A;  2EN6 A;  4I8O A;  4JI3 I;  2AE8 A;  2WBT A;  3U1Y A;  5DNX A;  1XMQ I;  1UDS A;  3J7A M;  3EPL A;  1A1I A;  1PJT A;  2UXB E;  1KYQ A;  2EMY A;  4DR4 E;  4X9J A;  1X48 A;  1WRJ A;  3T1Y E;  2UXD E;  2EN3 A;  3T1H I;  3MHS C;  1MX0 A;  1N36 I;  1IBK E;  4P78 A;  4X66 I;  2WNR B;  4DV1 I;  2R76 A;  5LL6 R;  1RC7 A;  4J3D A;  2RSI A;  2YSO A;  3LPS A;  2DMY A;  2EOQ A;  2E72 A;  2HKE A;  4JV5 I;  2VQF E;  1H72 C;  3HJC A;  2ADR A;  1HNX E;  4DR2 E;  4RH8 A;  4MYT A;  3J81 Q;  2YTO A;  2JEA A;  1YYW A;  4F6M A;  2EMC A;  4YHH E;  2J7J A;  4FW3 A;  3VYX A;  3B82 A;  3M99 B;  1H7S A;  5DNL A;  1J5E I;  2VQE I;  1KKH A;  4DPX A;  4R03 A;  2LUP B;  4O5G A;  2EOS A;  3QT5 A;  2EL5 A;  2EPO A;  2PRT A;  1RQ0 A;  1WUU A;  2HC5 A;  1KVK A;  2AJ4 A;  2ZM6 I;  4USK A;  2YPN A;  2ZIT A;  2ODR C;  2C38 B;  4U3D A;  5GMD A;  5A69 A;  2EPA A;  4BC9 A;  3HKM A;  1Z5B A;  1D6T A;  4KQV A;  4K0K E;  3GCM A;  4WXC A;  3EPK A;  5EKW A;  2EMH A;  3C4T A;  3PYD A;  5ELW A;  1BKN A;  2ENC A;  4HEI A;  4JI4 E;  4R2C A;  3J81 C;  2WP8 B;  1HR0 E;  3PS2 A;  4P52 A;  1GQE A;  2CSH A;  2HHH I;  1FJG I;  5K36 E;  2UUB E;  4WYQ B;  2NN6 D;  4MYU A;  2UUA E;  5C0X B;  5LMN I;  3IWB A;  1QNT A;  2RS7 A;  3ADG A;  1BB8 A;  2CTD A;  1S4E A;  3H1C A;  4QNJ A;  4DV2 I;  4R2Q A;  4JI8 I;  5AC4 A;  2EM6 A;  4LU9 A;  4DV0 E;  2GO3 A;  2EL6 A;  3HXL A;  5IT9 Q;  4BC7 A;  3AUZ A;  2EN1 A;  1J26 A;  1NHH A;  4NXN I;  5K36 C;  4WXD A;  3B4T A;  2Z5C A;  1EH7 A;  2YRK A;  4PU9 A;  1T4O A;  5ADZ A;  1N33 E;  1FKA E;  4ZVI A;  4LF7 E;  4O4K A;  2UXC E;  1Z0E A;  5DRP A;  2EPN A;  3LLH A;  2EOR A;  3KRN A;  4IZJ A;  5JEA A;  1KIJ A;  4DV5 E;  3CDJ A;  4MQY A;  1HK7 A;  5DRQ A;  2MDR A;  4AM3 A;  1RRE A;  2A25 A;  4JG4 A;  2PO2 B;  2FTX B;  3JTZ A;  2Z5B A;  3WU5 A;  4DR7 I;  4LF4 I;  4USM A;  4BHC A;  2YTN A;  1USV A;  1BBO A;  4WPY A;  2UU9 I;  5BR8 E;  4DU8 A;  4JI7 E;  1IBM I;  2EP3 A;  2JE6 A;  1N34 E;  2B9D A;  4BCA A;  2BR2 A;  4DV6 I;  3GLL A;  4DR4 I;  1E3P A;  2JYA A;  4M1K A;  4EMD A;  4LFB E;  1TN9 A;  4AIM A;  3OTO I;  1UDN A;  3T1Y I;  3M85 D;  1WJP A;  4LFA I;  3ADI A;  4HAC B;  2HK3 A;  1PIE A;  4WSP A;  4GKK E;  2EPU A;  2MC6 A;  2YTI A;  3AV0 A;  1P47 A;  4PRX A;  2EMI A;  2YTD A;  1OYS A;  1T39 A;  1A1J A;  3IWD A;  1UDQ A;  1A1L A;  1Z1B A;  4LCF A;  2VQF I;  1PJS A;  2MC5 A;  1HNX I;  4DR2 I;  4HY1 A;  2XEX A;  2LMZ A;  2IOP A;  3RMP A;  1H74 A;  5A6A A;  4YHH I;  4X64 I;  2ZBK B;  3OML A;  4P7A A;  1HNW I;  5IXM B;  4NXM E;  1O0W A;  1ZM4 A;  3L7Z B;  4DV3 I;  4MU1 A;  2LVH A;  5KL2 A;  2YT4 A;  2CPN A;  4DR5 E;  4IFD F;  3QT8 A;  2DRP A;  5AAS A;  4OZE A;  2FV4 B;  4DUZ I;  1EH6 A;  1B62 A;  2JOX A;  3P3C A;  3QT7 A;  3HTX A;  4HXZ A;  5DRR A;  2CZ9 A;  1XNR I;  2MKN A;  4YY3 E;  1OYP A;  1GTK A;  5IWA E;  3Q6N A;  4U3B A;  4LF9 E;  1NEI A;  4ED4 A;  2BM1 A;  4WUC A;  4IFD B;  2EPC A;  2EN4 A;  1LLM C;  1VI7 A;  2PO0 B;  1A1F A;  5K36 A;  2JXP A;  2M1S A;  1PKP A;  4MU4 A;  2DB2 A;  2L2N A;  3IWC A;  2YTE A;  1AAY A;  2N3H A;  3C6M A;  1ZM2 A;  4HTG A;  2L33 A;  1YUI A;  3EPJ A;  1G2D C;  1KJK A;  1ELO A;  1K47 A;  5JEA E;  4Q35 B;  2A2C A;  4ZYH A;  4Q28 A;  4ZYG A;  2UUB I;  3P3E A;  2EMA A;  4JI5 I;  4DR3 E;  4IFD D;  2KHX A;  1H7U A;  1ZBT A;  1G2F C;  2LTS A;  3ZKB A;  2EPM X;  1YUJ A;  2Q2E B;  4X62 I;  5KL6 A;  4R2P A;  4OKG A;  5JEA C;  2EPK X;  1XNQ I;  2EJ4 A;  2EOH A;  3MSW A;  2HFU A;  3PYF A;  3PS1 A;  3M7N G;  1IQO A;  4DU7 A;  1N33 I;  2HFS A;  3K17 A;  4X65 E;  5KL7 A;  1A1H A;  4FK5 C;  2JEB B;  2O1T A;  4LPF A;  2IHR 1;  4DMI A;  4DV7 E;  4TUI A;  4DUY E;  3TQM A;  4DV5 I;  3M7N D;  4B3R E;  1JK2 A;  4P7D A;  2WW4 A;  4FWD A;  3J7A G;  2NN6 A;  2L3J A;  3J7Y p;  3F6H A;  4B3T E;  2G7H A;  4M9V C;  2C37 B;  2EOZ A;  2LT7 A;  4JI0 E;  2HK2 A;  2BM0 A;  2DEI A;  2PNZ B;  4JI7 I;  2WP8 A;  1N34 I;  2O3Z A;  2MDG A;  4B3S E;  4IS1 C;  2FGG A;  2CGE A;  4JI2 E;  1HNZ E;  1UBD C;  1N3G A;  2CVE A;  2NPF A;  2V87 A;  4NBQ A;  4F6N A;  3FIG A;  2NUF A;  4LF5 E;  4OOG C;  2RSM A;  1FWK A;  2BA1 D;  2YTF A;  4JI6 I;  4WFT A;  4BA2 B;  1I94 I;  1QU6 A;  4JI1 I;  1XXE A;  3F0N A;  2YTJ A;  4QNK A;  2EM9 A;  5C0X F;  1RMD A;  2HGH A;  2ELZ A;  1DAR A;  2F4V E;  2IER A;  4GKK I;  3BID A;  1NCS A;  4RHB B;  2EM7 A;  3LNU A;  4PRV A;  4LF8 I;  2N8X A;  1WHQ A;  2V89 A;  3LTO A;  1Z0C A;  1FI4 A;  2EFG A;  2WCC 3;  4WUD A;  2V88 A;  1Y4U A;  2I13 A;  1IBL E;  2Z5E A;  1UEK A;  2C39 A;  2PNL A;  4DXL A;  3H4L A;  3PS3 A;  4JYA I;  4LCG A;  2ELY A;  2PO1 B;  2L2K B;  4FW6 A;  5AC5 A;  2EOF A;  2N3G A;  2WZO A;  3UHM A;  3ZZU A;  4LF6 E;  2JEA B;  4DR6 I;  2PO2 A;  4FW5 A;  4KHP I;  1QZR A;  5KL5 A;  5EL9 A;  1VIS A;  5FLX Q;  2EN8 A;  2EPX A;  3JU0 A;  2NUG A;  4LFC I;  5C0X D;  2PNM A;  2E1R A;  1U2R A;  4LF9 I;  4BA1 B;  3BGH A;  4FW9 A;  1JK1 A;  1XMO E;  3VK6 A;  4JI3 E;  1X49 A;  4X8W A;  1XMQ E;  1Y5Y A;  4AQY E;  2R1F A;  4TUG A;  4HAC A;  2B7T A;  5T6J A;  5A6K A;  4F54 A;  1YPN A;  2UUC I;  5F3W A;  1Z5A A;  2LJH A;  3GME A;  3M85 G;  2BV3 A;  1BBG A;  5AE2 A;  5LLQ A;  2DLQ A;  1Z0G A;  2O1U A;  1N0V C;  4DR3 I;  1N36 E;  2IOQ A;  2NN6 E;  4OO1 F;  2D9H A;  4MLV A;  2UXB I;  5IT9 C;  4DV1 E;  2EOX A;  1DI2 A;  1PVG A;  4R2R A;  2EM0 A;  2UXD I;  2EOY A;  3MHH C;  1SFE A;  2EWL A;  1IMU A;  1ZBQ A;  5FLX C;  1NHI A;  3L7Z A;  4IZK B;  2EMF A;  1IBK I;  1YHC A;  2EOE A;  2NN6 C;  5AE1 A;  1L4S A;  2YSP A;  5FWK A;  4OO1 B;  2M9A A;  1YZ9 A;  4AID A;  3ZZT A;  2M7Q A;  2YZT A;  1J5E E;  2Z5C B;  2EPR A;  1KTV A;  2BA0 D;  4R2S A;  3K1J A;  4L5N C;  4GZN C;  3Q6M A;  3THN A;  1ZAA C;  3EQ1 A;  3THO B;  4JI4 I;  3JAM Q;  4IZJ B;  5A6B D;  4LTY A;  2EMB A;  4OO1 D;  1X6E A;  2ZM6 E;  3DF6 A;  1EA6 A;  1EI1 A;  1UDO A;  1N32 E;  4RPF A;  4N4R B;  4JI0 I;  3V5R A;  3J80 Q;  1PJQ A;  1RR9 A;  4GEQ B;  1H73 A;  4B3S I;  1EKZ A;  4MDT A;  2NAB A;  2LBS B;  4BS9 A;  3ZKD A;  4JI2 I;  2LRS A;  1NZ0 A;  1HNZ I;  3B78 A;  3HPZ A;  4GKJ E;  4O43 A;  4IZJ D;  2JWO A;  2F8B A;  4I3H A;  4LF5 I;  2JE6 B;  2EM5 A;  3H09 A;  2EM2 A;  5DNY A;  2EOJ A;  2M4I A;  1MEY C;  1FJG E;  4K0K I;  5A2Q Q;  2BBG A;  2F4V I;  2GS8 A;  3LML A;  1P42 A;  4ZYD A;  2EMG A;  2KON A;  2LUQ A;  4NHR A;  4WX9 A;  2EZ6 A;  1E3H A;  1Y6Z A;  2CG9 A;  4JI8 E;  2WNR A;  3HUL A;  5DRO A;  3B8H A;  1DGC A;  1HR0 I;  1S16 A;  5TSE A;  4NXN E;  2JY9 A;  2A2D A;  1X3C A;  4FWG A;  2UUA I;  4BMJ A;  1X47 A;  3L00 A;  1ZXN A;  1PDA A;  1YYO A;  5IV8 B;  1N0U A;  1Z0T A;  2V2Q A;  2EMZ A;  5LMU E;  2GQ0 A;  3ZM7 A;  4DV0 I;  1B69 A;  1A1K A;  1UHZ A;  2E5L E;  1MG7 A;  2J7K A;  4FN5 A;  2GPI A;  2C37 A;  3P3G A;  1UIL A;  4LF7 I;  2GHF A;  2JP9 A;  1FNM A;  2PNZ A;  2UXC I;  4FW4 A;  2V85 A;  4DR7 E;  5K36 F;  2JOB A;  2ODR D;  1B63 A;  3HQ1 A;  5A2Q C;  4DPW A;  1XMO I;  2UU9 E;  4J8Z A;  2C38 A;  4XTJ A;  1DQ3 A;  2EL4 A;  2V8Q B;  1IBM E;  1STU A;  4UTG A;  3ZOQ B;  4AQY I;  4BA2 A;  4R8O A;  3GON A;  1F2I G;  4B3M E;  1R6L A;  1ZXM A;  4DV6 E;  2O1W A;  2RPC A;  4LOM A;  5GME A;  5K36 B;  1YH8 A;  2LTR A;  2BA1 G;  2F1D A;  1Z5C A;  5BR8 I;  3DJW A;  3OTO E;  1R6M A;  4LFA E;  4IFD E;  2EE8 A;  2ENA A;  5KL3 A;  2V8P A;  3VHT B;  1X6F A;  1OYR A;  1EH8 A;  4DKK A;  2RS6 A;  2J65 A;  2V2Z A;  5C0X A;  3C4B A;  2GLI A;  2DIX A;  2YWQ A;  2PO1 A;  4LFB I;  1TF3 A;  5KL4 A;  3F6G A;  2B3T B;  2EOO A;  5K36 D;  4DV4 E;  3WU4 A;  2V86 A;  4NZV A;  1T4L B;  4URL A;  1SR9 A;  2CT1 A;  4IFD C;  4MLQ A;  2EPP A;  4X64 E;  2HJJ A;  1HNW E;  1MU5 A;  2JPA A;  5AE3 A;  4DV3 E;  4WSG A;  1TF6 A;  3P1X A;  2NA2 A;  2E1M A;  2EOI A;  2NN6 F;  2EML A;  2LCE A;  2L3C A;  1Y60 A;  4BA1 A;  2VES A;  1YYK A;  2LO3 A;  4DUZ E;  3BF2 A;  1XNR E;  4NXM I;  4DR1 E;  2BB8 A;  3WU3 A;  3K6Q A;  1N32 I;  4DR5 I;  4Z7C A;  4BBY A;  4F9A B;  2EQ3 A;  2NN6 B;  4HYM A;  3D4J A;  2DEJ A;  4YY3 I;  5IWA I;  3U1K A;  4DPY A;  2X7I A;  4ISA A;  4GKJ I;  2EMK A;  4OX9 E;  4R2E A;  3QT6 A;  3EPH A;  1T38 A;  3CDI A;  3P76 A;  3HPS A;  4JI5 E;  1Z0B A;  4IZK A;  2B7V A;  2DLK A;  4F9B B;  1ZM3 A;  4X62 E;  2NUE A;  2EQ1 A;  3P06 A;  5A6B A;  2JVA A;  4LCH A;  4Z7Y A;  4OO1 A;  4N3O A;  5L3J A;  4O24 A;  2K7I A;  2LE2 A;  1XNQ E;  2H36 X;  4FW7 A;  3T1H E;  3V2U C;  1OJ4 A;  4ZYE A;  4WUB A;  2WBS A;  2EM3 A;  4X66 E;  3WU6 A;  2EM8 A;  4IJD A;  4UT4 A;  5LMU I;  4R2D A;  1YFH A;  2LJP A;  3C6K A;  2DSY A;  2E5L I;  2RTX A;  2C39 B;  3KWR A;  2BA0 G;  2YTG A;  3UK3 C;  4JV5 E;  2V34 A;  2V83 A;  1MGT A;  4KZS A;  1YSA C;  4FWH A;  4X65 I;  1RHY A;  1ZM9 A;  2YU5 A;  5CFF E;  2EMW A;  2K4V A;  1Z0W A;  5JEA F;  3KZY A;  1Y4S A;  5C0X E;  2DMI A;  4DV7 I;  4DUY I;  2LV2 A;  2Q8U A;  1UN6 B;  2VQE E;  4B3R I;  3BBG A;  4M0V A;  2HKJ A;  3DD6 A;  3CWV A;  4IFD A;  2IES A;  4F2J C;  2PO0 A;  2V2V A;  4R1F A;  4DPT A;  1ZR9 A;  4F9C B;  1XHK A;  5JEA B;  5C0X C;  4B3M I;  2L2M A;  4B3T I;  2MKD A;  2O1V A;  3ZZ0 A;  1X6H A;  4JI6 E;  2EOM A;  1ZU1 A;  3ADL A;  2Z5B B;  1I94 E;  1USU A;  4MU0 A;  4JI1 E;  1A1G A;  2EN2 A;  2EN7 A;  2YRH A; 
#chains in the Genus database with same CATH homology
 2L92 A;  4M30 A;  4LF8 E;  4L8N A;  2VF1 A;  4DV4 I;  2HHH E;  2VE7 C;  1WHN A;  3PYG A;  4JYA E;  5LMN E;  2JR1 A;  1NHJ A;  4DV2 E;  3M6A A;  1Z59 A;  1FWL A;  4DR6 E;  1IBL I;  3Q1Q A;  2L8T A;  2L6M A;  3JAM C;  4KHP E;  2OI2 A;  4DR1 I;  4M2Z A;  4LFC E;  4LF6 I;  1GZ6 A;  3J80 C;  2VF3 A;  3ADJ A;  1Z0V A;  1WXR A;  2R42 A;  4DPU A;  2R3V A;  3K85 A;  3PYE A;  3PRY A;  2X36 A;  3VYY A;  4OX9 I;  4LF4 E;  2UUC E;  1A6F A;  1T4N A;  2KOU A;  4I8O A;  4JI3 I;  1XMQ I;  3J7A M;  2UXB E;  4DR4 E;  1X48 A;  3T1Y E;  2UXD E;  3T1H I;  1N36 I;  1MX0 A;  1IBK E;  4P78 A;  4X66 I;  4DV1 I;  5LL6 R;  1RC7 A;  3LPS A;  2DMY A;  2HKE A;  4JV5 I;  2VQF E;  1H72 C;  3HJC A;  1HNX E;  4DR2 E;  4MYT A;  3J81 Q;  1YYW A;  4YHH E;  3VYX A;  3B82 A;  1H7S A;  1J5E I;  2VQE I;  1KKH A;  4DPX A;  4R03 A;  2LUP B;  3QT5 A;  1RQ0 A;  1WUU A;  1KVK A;  2AJ4 A;  2ZM6 I;  4USK A;  2ZIT A;  2ODR C;  5GMD A;  4BC9 A;  1Z5B A;  1D6T A;  4KQV A;  4K0K E;  3C4T A;  3PYD A;  1BKN A;  4JI4 E;  3J81 C;  1HR0 E;  4P52 A;  1GQE A;  2HHH I;  1FJG I;  2UUB E;  4WYQ B;  4MYU A;  2UUA E;  5LMN I;  3IWB A;  1S4E A;  2RS7 A;  3ADG A;  4DV2 I;  4JI8 I;  4DV0 E;  4LU9 A;  3HXL A;  5IT9 Q;  4BC7 A;  3AUZ A;  1J26 A;  1NHH A;  4NXN I;  2Z5C A;  4PU9 A;  1T4O A;  1N33 E;  5ADZ A;  1FKA E;  4ZVI A;  4LF7 E;  2UXC E;  1Z0E A;  3LLH A;  4IZJ A;  1KIJ A;  4DV5 E;  1HK7 A;  2MDR A;  1RRE A;  4JG4 A;  2FTX B;  3JTZ A;  2Z5B A;  3WU5 A;  4DR7 I;  4LF4 I;  4USM A;  1USV A;  4WPY A;  2UU9 I;  5BR8 E;  4DU8 A;  4JI7 E;  1IBM I;  1N34 E;  2B9D A;  4BCA A;  4DV6 I;  4DR4 I;  4M1K A;  4EMD A;  4LFB E;  3T1Y I;  3OTO I;  4LFA I;  3ADI A;  4HAC B;  2HK3 A;  1PIE A;  4WSP A;  4GKK E;  2MC6 A;  3AV0 A;  4PRX A;  3IWD A;  2VQF I;  2MC5 A;  1HNX I;  4DR2 I;  4HY1 A;  2XEX A;  2LMZ A;  2IOP A;  3RMP A;  1H74 A;  4YHH I;  4X64 I;  2ZBK B;  3OML A;  4P7A A;  1HNW I;  4NXM E;  1O0W A;  1ZM4 A;  4DV3 I;  2YT4 A;  2CPN A;  4DR5 E;  3QT8 A;  5AAS A;  2FV4 B;  4DUZ I;  1B62 A;  2JOX A;  3QT7 A;  1XNR I;  3HTX A;  4HXZ A;  2CZ9 A;  4YY3 E;  5IWA E;  3Q6N A;  4LF9 E;  4ED4 A;  2BM1 A;  4WUC A;  2M1S A;  1PKP A;  2DB2 A;  2L2N A;  3IWC A;  2N3H A;  1ZM2 A;  2L33 A;  1K47 A;  1ELO A;  2A2C A;  4Q28 A;  2UUB I;  4JI5 I;  4DR3 E;  2KHX A;  1H7U A;  1ZBT A;  2LTS A;  3ZKB A;  4X62 I;  2Q2E B;  1XNQ I;  3MSW A;  2HFU A;  3PYF A;  4DU7 A;  1N33 I;  2HFS A;  3K17 A;  4X65 E;  2O1T A;  2IHR 1;  4DMI A;  4DV7 E;  4TUI A;  4DUY E;  4DV5 I;  4B3R E;  4P7D A;  2WW4 A;  4FWD A;  3J7A G;  2L3J A;  3J7Y p;  3F6H A;  4B3T E;  2G7H A;  4JI0 E;  2HK2 A;  2BM0 A;  2DEI A;  4JI7 I;  1N34 I;  4B3S E;  2FGG A;  2CGE A;  4JI2 E;  1HNZ E;  2NPF A;  2V87 A;  2NUF A;  3FIG A;  4LF5 E;  1FWK A;  4OOG C;  2RSM A;  4JI6 I;  4WFT A;  1I94 I;  1QU6 A;  4JI1 I;  3F0N A;  4GKK I;  1DAR A;  2F4V E;  3LNU A;  4PRV A;  4LF8 I;  1WHQ A;  2V89 A;  3LTO A;  1Z0C A;  1FI4 A;  2EFG A;  4WUD A;  2V88 A;  1Y4U A;  2Z5E A;  1IBL E;  1UEK A;  2PNL A;  4DXL A;  3H4L A;  4JYA I;  2L2K B;  3ZZU A;  2N3G A;  2WZO A;  4LF6 E;  4DR6 I;  4KHP I;  1QZR A;  1VIS A;  5FLX Q;  3JU0 A;  2NUG A;  4LFC I;  2PNM A;  2E1R A;  1U2R A;  4LF9 I;  4FW9 A;  1XMO E;  3VK6 A;  4JI3 E;  1X49 A;  4X8W A;  1XMQ E;  4AQY E;  4TUG A;  4HAC A;  2B7T A;  5T6J A;  4F54 A;  2UUC I;  5F3W A;  1Z5A A;  2LJH A;  2BV3 A;  5AE2 A;  2O1U A;  1Z0G A;  1N0V C;  4DR3 I;  1N36 E;  2IOQ A;  2UXB I;  5IT9 C;  4DV1 E;  1DI2 A;  1PVG A;  2UXD I;  2EWL A;  1NHI A;  1ZBQ A;  5FLX C;  4IZK B;  1IBK I;  5AE1 A;  5FWK A;  1YZ9 A;  3ZZT A;  2M7Q A;  2YZT A;  1J5E E;  2Z5C B;  1KTV A;  3K1J A;  4L5N C;  3Q6M A;  3JAM Q;  4IZJ B;  4LTY A;  2ZM6 E;  1EI1 A;  3DF6 A;  1EA6 A;  1N32 E;  4RPF A;  4JI0 I;  3V5R A;  3J80 Q;  1RR9 A;  4GEQ B;  1H73 A;  4B3S I;  1EKZ A;  2LBS B;  3ZKD A;  4BS9 A;  4JI2 I;  2LRS A;  1NZ0 A;  1HNZ I;  3B78 A;  3HPZ A;  4GKJ E;  4IZJ D;  2JWO A;  2F8B A;  4I3H A;  4LF5 I;  3H09 A;  5DNY A;  4K0K I;  2M4I A;  1FJG E;  5A2Q Q;  2F4V I;  2GS8 A;  3LML A;  2EZ6 A;  2KON A;  2LUQ A;  1Y6Z A;  3HUL A;  2CG9 A;  3WU3 A;  4JI4 I;  4JI8 E;  1HR0 I;  3B8H A;  1S16 A;  4NXN E;  2JY9 A;  2A2D A;  4FWG A;  2UUA I;  4BMJ A;  1X47 A;  1ZXN A;  1YYO A;  1N0U A;  1Z0T A;  2V2Q A;  5LMU E;  2GQ0 A;  3ZM7 A;  4DV0 I;  1UHZ A;  2E5L E;  1MG7 A;  2J7K A;  4FN5 A;  1UIL A;  4LF7 I;  2UXC I;  1FNM A;  2V85 A;  4DR7 E;  2JOB A;  2ODR D;  1B63 A;  3HQ1 A;  5A2Q C;  4DPW A;  1XMO I;  2UU9 E;  4J8Z A;  4XTJ A;  1DQ3 A;  2V8Q B;  4UTG A;  1IBM E;  1STU A;  3ZOQ B;  4AQY I;  4R8O A;  3GON A;  4B3M E;  1ZXM A;  4DV6 E;  2O1W A;  5GME A;  2LTR A;  1Z5C A;  5BR8 I;  3DJW A;  3OTO E;  4LFA E;  2V8P A;  4DKK A;  2RS6 A;  2V2Z A;  3C4B A;  4LFB I;  2DIX A;  3F6G A;  2B3T B;  4DV4 E;  3WU4 A;  2V86 A;  1T4L B;  4URL A;  1SR9 A;  4X64 E;  1HNW E;  1MU5 A;  5AE3 A;  4DV3 E;  3P1X A;  2NA2 A;  2E1M A;  2L3C A;  1YYK A;  4DUZ E;  1XNR E;  4NXM I;  4DR1 E;  3K6Q A;  1N32 I;  4DR5 I;  4Z7C A;  4BBY A;  4F9A B;  4HYM A;  3D4J A;  2DEJ A;  4YY3 I;  5IWA I;  4DPY A;  2X7I A;  4GKJ I;  4OX9 E;  3QT6 A;  3HPS A;  4JI5 E;  1Z0B A;  4IZK A;  2B7V A;  4F9B B;  1ZM3 A;  4X62 E;  2NUE A;  3P06 A;  4Z7Y A;  2JVA A;  4N3O A;  5L3J A;  2LE2 A;  1XNQ E;  2H36 X;  3T1H E;  3V2U C;  1OJ4 A;  4WUB A;  3WU6 A;  4X66 E;  4UT4 A;  5LMU I;  2LJP A;  2DSY A;  2E5L I;  2RTX A;  3KWR A;  4JV5 E;  2V34 A;  2V83 A;  4KZS A;  4FWH A;  4X65 I;  1ZM9 A;  5CFF E;  2K4V A;  1Z0W A;  1Y4S A;  4DV7 I;  4DUY I;  2VQE E;  4B3R I;  4M0V A;  2HKJ A;  3CWV A;  2V2V A;  4R1F A;  4DPT A;  4B3M I;  4F9C B;  1XHK A;  2L2M A;  4B3T I;  2O1V A;  3ZZ0 A;  4JI6 E;  3ADL A;  2Z5B B;  1I94 E;  1USU A;  4JI1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...