1XNRE

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnrE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrE02
2IHR1 4DV1I 4DR6E 4GKKE 4YY3I 4B3RI 5A2QQ 1Z5AA 2NA2A 1X49A 4DR1I 2VQFI 3Q1QA 4NXME 5IT9C 1HNZE 1XNRE 4LF5I 1XMQI 4JI2I 4YY3E 4GKKI 4X62E 2HKEA 3WU4A 1N32E 1PKPA 4DPXA 1J5EE 1HR0E 1BKNA 1XMOI 4X65E 4LF7E 1KKHA 2HK2A 1ZM4A 3OTOI 3ADLA 4UTGA 4AQYE 1PVGA 3PYDA 4GKJI 4I3HA 1ZBTA 4R1FA 4WUDA 4DUZI 1N32I 2B3TB 1EI1A 4X66I 1GQEA 4HY1A 4JI5E 3J7Yp 4LF6I 2JVAA 2LTSA 4YHHE 4K0KE 4DUYE 1YYWA 4LFAI 4JI7E 4DV7I 5A2QC 4NXMI 1ZM2A 4JV5E 1IBKE 3HTXA 5LMUI 1FNMA 1IBMI 3OTOE 4X64I 4DR7I 2N3GA 4DR5E 1RQ0A 1MU5A 2YT4A 1XHKA 4DR3I 1H7UA 1ZXMA 3QT7A 1UHZA 3ZKDA 2V2ZA 1N33I 2DEIA 2V34A 4HACB 4DUZE 2L33A 2DB2A 2UXCI 3J81C 3VYXA 2J7KA 4B3MI 4DPTA 4HXZA 2A2DA 4DV7E 1XNQE 4B3RE 4URLA 1T4OA 4DV0E 4DV1E 1Z5CA 1FJGI 2LJPA 1H74A 3ZM7A 5FLXQ 1S4EA 4FN5A 1T4LB 4B3TE 2E1RA 2V2VA 2DIXA 4JI8I 4LF7I 2F4VI 1I94E 1H7SA 4WFTA 4MYUA 3PYEA 3WU5A 1A6FA 4M30A 4JI3I 2LJHA 1DI2A 2BM0A 1KTVA 3J7AG 4HYMA 4PRXA 2HHHE 4DV4I 1XNRI 3LNUA 3J80C 2UUAE 4UT4A 5FLXC 1PIEA 1N34I 4DV5I 4LF9I 2F4VE 3LTOA 4B3SE 3K17A 4B3TI 3WU3A 1B63A 1ZXNA 1WHNA 2X7IA 1FKAE 2R3VA 2L3JA 2LRSA 1I94I 2L2MA 4FWGA 2L3CA 4DV2I 4HACA 3QT5A 4DPYA 4FW9A 4B3SI 4DR5I 4KHPI 2E5LE 4LFBE 2WW4A 1IBKI 1D6TA 2E5LI 4LFBI 4LFCE 1YYKA 4DV4E 4DV0I 4JG4A 4LF8I 4X65I 5GMDA 2N3HA 1Z0WA 3M6AA 2RSMA 1NHJA 4RPFA 3T1HI 2DMYA 4WUBA 3ZZUA 2HKJA 2BM1A 1H72C 2RTXA 4JI2E 4ED4A 3J81Q 4LF4I 3QT8A 2UUAI 4DPUA 3WU6A 1DARA 2LUQA 1KVKA 2X36A 3B78A 4JI7I 2CZ9A 1IBME 3LPSA 5LMUE 1HNWI 5L3JA 2HK3A 2Q2EB 3J7AM 4JI6E 3H4LA 4DU8A 4JI8E 1J26A 1J5EI 4JI3E 2UXCE 5LMNI 4KQVA 3JAMQ 3ADGA 2XEXA 3ADIA 3JAMC 3F0NA 1Z0BA 3V5RA 2A2CA 5GMEA 1XMQE 4DV5E 4LF9E 3B8HA 2EFGA 1EA6A 4DR1E 5BR8I 4JI4E 1RC7A 1WHQA 1UEKA 1HNXI 1YYOA 4PU9A 2AJ4A 1Z0GA 3C4BA 4YHHI 4K0KI 4OX9I 4USMA 2DEJA 4LF6E 3B82A 2NUEA 4DU7A 1Z0VA 2B7TA 1N34E 1HR0I 2HFUA 4X64E 4DXLA 1U2RA 2JY9A 2HFSA 4DR3E 4GKJE 4OOGC 2B7VA 4DUYI 3V2UC 2ZBKB 4LFCI 4JI4I 2LTRA 4AQYI 5IWAE 3VYYA 4X8WA 3J80Q 4DR2I 2R42A 3GONA 3ZZTA 1UILA 2EZ6A 2VQEE 4FWDA 2UXBE 1MG7A 2GS8A 4JYAI 3PYGA 2RS7A 2ZITA 4MYTA 2BV3A 1QU6A 3ZZ0A 3PYFA 1N36I 2MDRA 3HULA 4DR4I 1ZM9A 4LF8E 3D4JA 4M2ZA 1Z0CA 3T1YE 2NPFA 4DR2E 4JV5I 2VQFE 1FWLA 3QT6A 1N33E 4USKA 1EKZA 2LUPB 4JI5I 2UUBI 5CFFE 4JYAE 2ZM6I 2UXBI 4X62I 1RR9A 4DV6E 3CWVA 4DR7E 4JI0I 3T1HE 3P1XA 1O0WA 1NZ0A 5IWAI 1N0UA 4P52A 2L2NA 2UUBE 2V8PA 3K1JA 1X47A 4LFAE 3T1YI 3LLHA 4LF5E 1HNZI 4DR4E 4X66E 1HNXE 1Z5BA 2LBSB 4B3ME 4LF4E 2RS6A 4JI1E 1VISA 4FWHA 2OI2A 4Z7CA 1XMOE 2UUCI 1OJ4A 1Z0EA 1WUUA 1N36E 4NXNI 4ZVIA 2V2QA 4EMDA 2UXDE 2CPNA 4JI1I 1MX0A 1N0VC 1ELOA 5BR8E 2HHHI 2UU9E 1HNWE 2NUFA 4P7AA 1B62A 1FI4A 4KHPE 1IBLI 1Z59A 4DR6I 4WUCA 2KHXA 4DV2E 1NHHA 1X48A 2ZM6E 4Z7YA 2NUGA 4DV3I 4DPWA 1KIJA 4JI0E 5LMNE 3ZKBA 4OX9E 2VQEI 4DV6I 1Z0TA 1IBLE 4JI6I 2L2KB 1S16A 2VF3A 2UU9I 4DV3E 1FJGE 1T4NA 1YZ9A 5LL6R 1FWKA 1XNQI 2UXDI 4XTJA 1NHIA 4NXNE 1ZM3A 5IT9Q 1STUA 4DKKA 1QZRA 2UUCE 1K47A 3C4TA 4PRVA 1H73A 3ADJA 1RREA 4M1KA 4WYQB
chains in the Genus database with same CATH superfamily
1R6MA 2ELZA 2V88A 2EMXA 5KL3A 2EN2A 2JOXA 2IHR1 2JE6A 2JWOA 5K36C 2EL5A 3HKMA 4DV1I 4IFDE 4BS9A 4F9AB 4DR6E 4GKKE 2EORA 2WP8A 4YY3I 2BA0G 4B3RI 2JP9A 5A2QQ 5LLQA 4IFDA 1Z5AA 2NA2A 1X49A 1G2DC 4DR1I 1E3PA 2VQFI 5TSEA 2JOBA 3Q1QA 4NXME 3KRNA 5IT9C 4IZJB 5KL7A 3THNA 4R2QA 1HNZE 1XNRE 5A6AA 4LF5I 4MLQA 1XMQI 2EMCA 4JI2I 2GHFA 4YY3E 4GKKI 1KJKA 4X62E 2MKDA 4BA1B 2Z5EA 1RHYA 3BF2A 2EN1A 4P78A 1IQOA 4ZYDA 2ENAA 2HKEA 5IXMB 1A1FA 1OYRA 3WU4A 5C0XB 4OO1B 1N32E 1PKPA 4DPXA 2E1MA 1J5EE 2GO4A 1HR0E 1BKNA 1XMOI 3U1KA 4X65E 2CT1A 4FW7A 1HK7A 4LF7E 1RMDA 1EH6A 2JYAA 1KKHA 2HK2A 1PJQA 1ZU1A 1ZM4A 2C39B 3OTOI 1A1IA 3ADLA 4BMJA 5DNYA 1DGCA 1Y60A 2YTJA 4UTGA 4AQYE 5A6JA 4LTYA 4R8OA 5KL5A 1PVGA 2YWQA 3PYDA 4X9JA 2EN8A 3B4TA 5FWKA 2FTXB 5DROA 2EOXA 2PO0A 2Z5BA 2YTFA 5T6JA 4GKJI 1MEYC 4IZKA 2PNZB 2L6MA 1IMUA 2O1UA 4OZEA 4I3HA 2EPPA 5BR8I 1ZBTA 4R1FA 2LE2A 4WUDA 2C37B 4HTGA 2EMFA 4RHBB 3VHTB 3HPZA 4DUZI 1N32I 5DNXA 2B3TB 3F6HA 4O5GA 1EI1A 4X66I 1GQEA 2WBUA 4HY1A 4JI5E 2EP3A 3J7Yp 4LF6I 2JVAA 3QG5C 2LTSA 4R2SA 2O3ZA 4YHHE 4K0KE 4DUYE 1YYWA 4LFAI 1UDOA 2PRTA 4JI7E 1SFEA 4DV7I 2NN6D 2C38B 3PS1A 1YFHA 2YTIA 5A2QC 4NXMI 1ZM2A 4JV5E 2YTPA 1IBKE 3HTXA 4LCHA 5LMUI 4MU0A 1FNMA 1IBMI 3OTOE 4F2JC 2BA0D 4IZJA 2YU5A 2N3GA 4DR5E 4GZNC 1RQ0A 4X64I 4DR7I 5K36F 1MU5A 3MSWA 2EOQA 2YT4A 5EL9A 1XHKA 4DR3I 3MHSC 3H1CA 2YPNA 2EE8A 1H7UA 2PO1A 1ZXMA 3QT7A 1UHZA 2ADRA 5JEAA 3IWCA 2GQ0A 2WNRA 3ZKDA 2ODRC 4BHBA 2V2ZA 4R2EA 1N33I 2DEIA 3LMLA 3MHHC 2V34A 4HACB 1X6FA 4DUZE 1TF6A 1X3CA 2YTQA 2DLKA 2L33A 4LU9A 2DB2A 1YSAC 2DRPA 3K85A 2UXCI 2HGHA 3J81C 3M85G 3VYXA 2J7KA 4B3MI 4DPTA 1X5WA 2Z5CB 4HXZA 2KOUA 2ELYA 2V85A 2YTGA 2A2DA 4BA2A 3AV0A 5K36E 4DV7E 1XNQE 4B3RE 4URLA 1T4OA 1UN6B 1UBDC 4DV0E 4DV1E 4M0VA 1Z5CA 2O1WA 1FJGI 2CG9A 1VI7A 2PNMA 4ZYEA 2LJPA 2EMBA 3M85D 1H74A 5JEAD 2EL6A 3ZM7A 1S4EA 1UDSA 5FLXQ 2EPZA 5C0XD 4U3BA 4FN5A 4LOMA 3M7ND 1T4LB 2JT2A 4IZKB 1YHCA 2YRHA 4B3TE 4KWYA 2EM9A 2E1RA 2MC6A 2IOPA 2NN6F 2NN6C 2DIXA 2V2VA 4JI8I 4LF7I 2F4VI 4N4RB 1I94E 1H7SA 4WFTA 5A6KA 3P3CA 5DNLA 5JEAC 4MYUA 2HJJA 2EL4A 2G7HA 1PJSA 3HQ1A 2VRDA 3PYEA 1A6FA 2L8TA 3WU5A 4IFDC 2I9IA 4AIMA 1USVA 4I8OA 4M30A 3P76A 2LJHA 2J7JA 1A1GA 2MKNA 1DI2A 2YSPA 2BM0A 4JI3I 4BHCA 2EN7A 2EPMX 3J7AG 3JU0A 1KTVA 5DRQA 2WBSA 4WXDA 4HYMA 2VF1A 2RPCA 4IFDD 2NN6A 2HHHE 4MU4A 4PRXA 4DV4I 1XNRI 4AM3A 3LNUA 3J80C 2UUAE 4MU3A 5FLXC 4UT4A 1PIEA 2BB8A 2B9DA 2PO2A 1N34I 4IZJD 4DV5I 4LF9I 2O1VA 2F4VE 5K36B 2L92A 3LTOA 1UDQA 4B3SE 3K17A 2CTDA 2YTNA 5C0XF 2EMWA 2LCEA 1BB8A 2IESA 3WU3A 5JEAE 4B3TI 1BBGA 1B63A 1ZXNA 1WHNA 1YH8A 2X7IA 1G2FC 1FKAE 1IQSA 2R3VA 2L3JA 2LRSA 3C6KA 1I94I 2L2MA 4IS1C 2L3CA 4FWGA 4HACA 3QT5A 4DPYA 4DV2I 4WSGA 1JK1A 2CVEA 3NZKA 4FW9A 4B3SI 4DR5I 4KHPI 4MQYA 2LJUA 2E5LE 4R03A 2LVHA 4LFBE 2GO3A 2WW4A 2DLQA 1IBKI 2ENCA 1D6TA 2EMGA 2JEAA 2Z5CA 2E5LI 2WZOA 2EN4A 3L7ZA 4F6NA 4LFCE 5F3WA 1YYKA 4LFBI 4DV4E 2AE8A 2DMIA 4BA2B 4DV0I 1YPNA 4R2CA 4JG4A 4LF8I 2IERA 4LCFA 4X65I 2M7QA 4FW3A 5GMDA 2N3HA 1Z0WA 4QNJA 1X6EA 3M6AA 2RSMA 1NHJA 3KWRA 3HXLA 4TUIA 4MU1A 4IFDF 4RPFA 3T1HI 2V89A 2DMYA 2WBTA 4LPFA 4OO1E 4N3OA 2RQLA 3FIGA 2EQ3A 2BR2B 2EPNA 4WUBA 3ZZUA 2GLIA 2HKJA 4HEIA 3P3GA 2BM1A 1H72C 2GPIA 4BC9A 2RTXA 1ZBQA 4JI2E 3Q6NA 4ED4A 3J81Q 4LF4I 3IWBA 3QT8A 2UUAI 4WPYA 2EQ1A 3CDJA 4DPUA 3WU6A 3P06A 4WXCA 4WSPA 1DARA 2DSYA 2LUQA 2EN6A 1KVKA 2FGGA 4MDTA 3CDIA 2VE7C 2X36A 2WP8B 3B78A 4JI7I 3L00A 4TUGA 2CZ9A 1IBME 3LPSA 2EOIA 5LMUE 1HNWI 5L3JA 2HK3A 4FW6A 2Q2EB 1WXRA 5A69A 4R2RA 3J7AM 4JI6E 3H4LA 4DU8A 4JI8E 1J26A 2EMAA 1J5EI 1NEIA 4JI3E 2UXCE 5LMNI 2YZTA 2V83A 2YRMA 3TQMA 4KQVA 1Y6ZA 3JAMQ 3ADGA 2EOSA 2WCC3 3ADIA 3RMPA 2XEXA 3JAMC 3F0NA 2YTEA 4FK5C 1Z0BA 5AASA 3V5RA 2Q8UA 2A2CA 5GMEA 1XMQE 2ENHA 2O1TA 4DV5E 4LF9E 2ODRD 2DGCA 1DQ3A 3JTZA 5AE2A 3B8HA 2EPRA 2BA1G 1GTKA 2EFGA 2EOHA 4DR1E 5A6BD 1EA6A 2EOJA 2YU8A 4O43A 2JXPA 1RC7A 3K6QA 4JI4E 2EPCA 1WHQA 4KZSA 1UEKA 2BA1D 5ELWA 1HNXI 1YYOA 4PU9A 4J8ZA 2AJ4A 1Z0GA 2EOMA 2V87A 4O24A 2M9AA 4F6MA 3C4BA 4R2AA 4BA1A 4J3DA 4YHHI 4K0KI 2EJ4A 4OX9I 4USMA 1JK2A 4LF6E 2DEJA 2N8XA 4F9BB 2NUEA 4ZYGA 3B82A 4NHRA 3P3EA 4ISAA 4OO1A 3AUZA 2YRKA 1YUIA 2PNZA 4DU7A 5C0XA 2EMKA 2V8QB 1TF3A 4LCGA 1EH8A 1Z0VA 1X6HA 1AH5A 2EOOA 1T38A 2JEBA 2B7TA 2C37A 1N34E 1HR0I 5C0XC 2HFUA 4O4KA 2YTDA 4R2DA 5AC5A 4X64E 4DXLA 1U2RA 2JY9A 2JPAA 3DD6A 2EMIA 2HFSA 2MDGA 5DRPA 2CSHA 4DR3E 4GKJE 4OO1F 4OOGC 2B7VA 1SR9A 3V2UC 4DUYI 2C38A 4OKGA 3EPHA 2ZBKB 2EOFA 3GCMA 4LFCI 4JI4I 2LTRA 3DJWA 1TN9A 2Z5BB 2PO0B 4AQYI 5IWAE 3VYYA 4X8WA 3J80Q 4DR2I 2EPKX 2EM0A 2R42A 2I13A 3GONA 2EOYA 3ZZTA 1UILA 2EZ6A 2VQEE 2YSOA 4FWDA 2CGEA 2UXBE 2VESA 4U3DA 1MG7A 2GS8A 4JYAI 3PYGA 2RS7A 2ZITA 4MYTA 2WNRB 1ZR9A 2EMZA 2LV2A 2K7IA 4DMIA 1QU6A 2BV3A 1BBOA 3PS2A 3PYFA 1Y4SA 3ZZ0A 1N36I 2EM8A 2MDRA 1A1HA 3HULA 2V86A 4DR4I 3KZZA 1ZM9A 3HJCA 2EPXA 4LF8E 3D4JA 4M2ZA 1Z0CA 5AE1A 3T1YE 5C0XE 2EPLX 3EPJA 2NPFA 1MGTA 4DR2E 4JV5I 2EOZA 2VQFE 4OO1C 3M99B 4Q35B 3UHMA 4FW4A 1FWLA 3QT6A 1N33E 4USKA 5AC4A 1EKZA 2LUPB 2HC5A 4JI5I 2PO1B 3THOB 2UUBI 5KL4A 3EQ1A 5JEAB 2YTOA 5CFFE 1LLMC 4OO1D 4JYAE 2ZM6I 2UXBI 4FW5A 1USUA 2JR1A 1Z1BA 4X62I 1RR9A 3VK6A 2JEBB 3ECRA 1QNTA 4DV6E 3CWVA 4BC7A 2A25A 5KL2A 4DR7E 1OYPA 3T1HE 2D9HA 1O0WA 3P1XA 4P7DA 3UK3C 1NZ0A 4JI0I 2EM3A 5IWAI 1L4SA 4NZVA 2EN3A 1N0UA 4P52A 2KONA 2L2NA 2UUBE 1YUJA 1PJTA 1R6LA 2H36X 2V8PA 3K1JA 1X47A 4LFAE 3T1YI 2FV4B 3LLHA 1P47A 2EQ0A 3BBGA 4LF5E 1HNZI 2IOQA 4DR4E 2EM2A 1Y5YA 4X66E 1HNXE 2EMYA 1B69A 1UDNA 1Z5BA 2PO2B 1OYSA 2LBSB 3HPSA 4B3ME 4L8NA 5ADZA 4LF4E 2MC5A 3Q6MA 4BBYA 4QNKA 5EKWA 5K36A 2RS6A 4JI1E 1VISA 3C6MA 4FWHA 2OI2A 4MLVA 4Z7CA 1XMOE 2E72A 2UUCI 1OJ4A 2LMZA 1A1KA 1Z0EA 1WRJA 4AIDA 1WUUA 1N36E 4L5NC 4NXNI 4ZVIA 3M7NG 2V2QA 3F6GA 4F54A 2JE6B 4EMDA 2UXDE 1EH7A 2CPNA 4R2PA 2K4VA 1ZAAC 4GQUA 3EPLA 4RH8A 5DRRA 2EWLA 4JI1I 3H09A 4IFDB 4Q28A 1MX0A 1Y4UA 1N0VC 1ELOA 2RSIA 2EPUA 2NN6B 5BR8E 2JEAB 3U1YA 3EPKA 2HHHI 2UU9E 3L7ZB 1HNWE 5A6BA 2NUFA 3ZOQB 1B62A 4P7AA 2J65A 2LO3A 2R76A 2M4IA 3BGHA 1FI4A 4KHPE 3GMEA 1IBLI 2EPAA 1Z59A 4DR6I 4GEQB 4WUCA 5AE3A 2KHXA 2M1SA 4DV2E 1NHHA 5JEAF 1X48A 2ZM6E 4Z7YA 2NUGA 4WX9A 4DV3I 3DF6A 2F1DA 1T39A 1WJPA 1KIJA 4DPWA 4JI0E 2EM7A 5LMNE 2BR2A 4OX9E 3ZKBA 2VQEI 4DV6I 3PS3A 2EM4A 2F8BA 2EM5A 1IBLE 1Z0TA 4JI6I 5IV8B 3KZYA 2EM6A 3BIDA 2L2KB 1E3HA 1S16A 2C39A 2VF3A 4ZYHA 5KL6A 4DV3E 2UU9I 2BBGA 3GLLA 4F9CB 4IS9A 1KYQA 1FJGE 1T4NA 1YZ9A 2EOEA 5LL6R 1FWKA 2NABA 4IJDA 1XNQI 2EMHA 3PRYA 2UXDI 1F2IG 1XXEA 1AAYA 4XTJA 2LT7A 2EMLA 1N3GA 3OMLA 4M9VC 1NHIA 4NXNE 1ZM3A 1NCSA 5IT9Q 3IWDA 1STUA 4BCAA 1A1JA 2NN6E 4DKKA 2R1FA 1QZRA 2UUCE 1K47A 3C4TA 4PRVA 1H73A 2EPOA 1A1LA 2PNLA 5K36D 4NBQA 3ADJA 1RREA 1GZ6A 4M1KA 1P42A 1PDAA 4WYQB
chains in the Genus database with same CATH topology
2V88A 2JOXA 2IHR1 2JWOA 4DV1I 4BS9A 4F9AB 4DR6E 4GKKE 4YY3I 4B3RI 5A2QQ 1Z5AA 2NA2A 1X49A 4DR1I 2VQFI 2JOBA 3Q1QA 4NXME 5IT9C 4IZJB 1HNZE 1XNRE 4LF5I 1XMQI 4JI2I 4YY3E 4GKKI 4X62E 2Z5EA 4P78A 2HKEA 3WU4A 1N32E 1PKPA 4DPXA 2E1MA 1J5EE 1HR0E 1BKNA 1XMOI 4X65E 1HK7A 4LF7E 1KKHA 2HK2A 1ZM4A 3OTOI 3ADLA 4BMJA 5DNYA 4UTGA 4AQYE 4LTYA 4R8OA 1PVGA 3PYDA 5FWKA 2FTXB 2Z5BA 5T6JA 4GKJI 4IZKA 2L6MA 2O1UA 4I3HA 1ZBTA 4R1FA 2LE2A 4WUDA 4DUZI 3HPZA 1N32I 2B3TB 3F6HA 1EI1A 4X66I 1GQEA 4HY1A 4JI5E 3J7Yp 4LF6I 2JVAA 2LTSA 4YHHE 4K0KE 4DUYE 1YYWA 4LFAI 4JI7E 4DV7I 5A2QC 4NXMI 1ZM2A 4JV5E 1IBKE 3HTXA 5LMUI 1FNMA 1IBMI 3OTOE 4IZJA 4X64I 4DR7I 2N3GA 4DR5E 1RQ0A 1MU5A 3MSWA 2YT4A 1XHKA 4DR3I 1H7UA 1ZXMA 3QT7A 1UHZA 3IWCA 2GQ0A 3ZKDA 2ODRC 2V2ZA 1N33I 2DEIA 3LMLA 2V34A 4HACB 4DUZE 4LU9A 2L33A 2DB2A 2UXCI 3K85A 3J81C 3VYXA 2J7KA 4B3MI 4DPTA 4HXZA 2Z5CB 2KOUA 2V85A 2A2DA 3AV0A 4DV7E 1XNQE 4B3RE 4URLA 1T4OA 4DV0E 4DV1E 4M0VA 1Z5CA 2O1WA 1FJGI 2CG9A 2PNMA 2LJPA 1H74A 3ZM7A 5FLXQ 1S4EA 4FN5A 1T4LB 4IZKB 4B3TE 2E1RA 2IOPA 2MC6A 2V2VA 2DIXA 4JI8I 4LF7I 2F4VI 1I94E 1H7SA 4WFTA 4MYUA 3PYEA 2G7HA 3WU5A 3HQ1A 1A6FA 2L8TA 1USVA 4I8OA 4M30A 4JI3I 2LJHA 1DI2A 2BM0A 3J7AG 1KTVA 3JU0A 4HYMA 2VF1A 4PRXA 2HHHE 4DV4I 1XNRI 3LNUA 3J80C 2UUAE 4UT4A 5FLXC 1PIEA 2B9DA 1N34I 4IZJD 4DV5I 4LF9I 2O1VA 2F4VE 2L92A 3LTOA 4B3SE 3K17A 4B3TI 3WU3A 1B63A 1ZXNA 1WHNA 2X7IA 1FKAE 2R3VA 2L3JA 2LRSA 1I94I 2L2MA 4FWGA 2L3CA 4DV2I 4HACA 3QT5A 4DPYA 4FW9A 4B3SI 4DR5I 4KHPI 2E5LE 4R03A 4LFBE 2WW4A 1IBKI 1D6TA 2Z5CA 2E5LI 2WZOA 4LFBI 4LFCE 5F3WA 1YYKA 4DV4E 4DV0I 4JG4A 4LF8I 4X65I 2M7QA 5GMDA 2N3HA 1Z0WA 3M6AA 2RSMA 1NHJA 3KWRA 3HXLA 4TUIA 4RPFA 3T1HI 2V89A 2DMYA 4N3OA 3FIGA 4WUBA 3ZZUA 2HKJA 2BM1A 1H72C 4BC9A 2RTXA 1ZBQA 4JI2E 3Q6NA 4ED4A 3J81Q 4LF4I 3IWBA 3QT8A 2UUAI 4WPYA 4DPUA 3WU6A 3P06A 4WSPA 1DARA 2DSYA 2LUQA 1KVKA 2FGGA 2VE7C 2X36A 3B78A 4JI7I 4TUGA 2CZ9A 1IBME 3LPSA 5LMUE 1HNWI 5L3JA 2HK3A 2Q2EB 1WXRA 3J7AM 4JI6E 3H4LA 4DU8A 4JI8E 1J26A 1J5EI 4JI3E 2UXCE 5LMNI 2YZTA 2V83A 4KQVA 1Y6ZA 3JAMQ 3ADGA 2XEXA 3ADIA 3RMPA 3JAMC 3F0NA 1Z0BA 5AASA 3V5RA 2A2CA 5GMEA 1XMQE 2O1TA 4DV5E 4LF9E 2ODRD 1DQ3A 3JTZA 5AE2A 3B8HA 2EFGA 1EA6A 4DR1E 1USUA 5BR8I 4JI4E 1RC7A 3K6QA 1WHQA 4KZSA 1UEKA 1HNXI 1YYOA 4PU9A 4J8ZA 2AJ4A 1Z0GA 2V87A 3C4BA 4YHHI 4K0KI 4OX9I 4USMA 2DEJA 4LF6E 3B82A 4F9BB 2NUEA 3AUZA 4DU7A 2V8QB 1Z0VA 2B7TA 1N34E 1HR0I 2HFUA 4X64E 4DXLA 1U2RA 2JY9A 2HFSA 4DR3E 4GKJE 4OOGC 2B7VA 1SR9A 3V2UC 4DUYI 2ZBKB 4LFCI 4JI4I 2LTRA 3DJWA 2Z5BB 4AQYI 5IWAE 3VYYA 4X8WA 3J80Q 4DR2I 2R42A 3GONA 3ZZTA 1UILA 2EZ6A 2VQEE 4FWDA 2CGEA 2UXBE 1MG7A 2GS8A 4JYAI 3PYGA 2RS7A 2ZITA 4MYTA 4DMIA 1QU6A 2BV3A 3ZZ0A 3PYFA 1N36I 1Y4SA 2MDRA 3HULA 2V86A 4DR4I 1ZM9A 3HJCA 4LF8E 3D4JA 4M2ZA 1Z0CA 5AE1A 3T1YE 2NPFA 4DR2E 4JV5I 2VQFE 1FWLA 3QT6A 1N33E 4USKA 1EKZA 2LUPB 4JI5I 2UUBI 5CFFE 4JYAE 2ZM6I 2UXBI 2JR1A 4X62I 1RR9A 3VK6A 4DV6E 3CWVA 4BC7A 4DR7E 4JI0I 3T1HE 3P1XA 1O0WA 4P7DA 1NZ0A 5IWAI 1N0UA 4P52A 2KONA 2L2NA 2UUBE 2V8PA 2H36X 3K1JA 1X47A 4LFAE 3T1YI 2FV4B 3LLHA 4LF5E 1HNZI 2IOQA 4DR4E 4X66E 1HNXE 1Z5BA 2LBSB 3HPSA 4B3ME 4L8NA 5ADZA 4LF4E 2MC5A 3Q6MA 4BBYA 2RS6A 4JI1E 1VISA 4FWHA 2OI2A 4Z7CA 1XMOE 2UUCI 1OJ4A 2LMZA 1Z0EA 1WUUA 1N36E 4L5NC 4NXNI 4ZVIA 2V2QA 3F6GA 4F54A 4EMDA 2UXDE 2CPNA 2K4VA 4JI1I 2EWLA 3H09A 4Q28A 1MX0A 1Y4UA 1N0VC 1ELOA 5BR8E 2HHHI 2UU9E 1HNWE 2NUFA 3ZOQB 1B62A 4P7AA 2M4IA 1FI4A 4KHPE 1IBLI 1Z59A 4DR6I 4GEQB 4WUCA 5AE3A 2KHXA 2M1SA 4DV2E 1NHHA 1X48A 2ZM6E 4Z7YA 2NUGA 4DV3I 3DF6A 4DPWA 1KIJA 4JI0E 5LMNE 3ZKBA 4OX9E 2VQEI 4DV6I 2F8BA 1IBLE 1Z0TA 4JI6I 2L2KB 1S16A 2VF3A 2UU9I 4DV3E 4F9CB 1FJGE 1T4NA 1YZ9A 5LL6R 1FWKA 1XNQI 3PRYA 2UXDI 4XTJA 3OMLA 1NHIA 4NXNE 1ZM3A 5IT9Q 3IWDA 1STUA 4BCAA 4DKKA 1QZRA 2UUCE 1K47A 3C4TA 4PRVA 1H73A 2PNLA 3ADJA 1RREA 1GZ6A 4M1KA 4WYQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHR 1;  4DV1 I;  4DR6 E;  4GKK E;  4YY3 I;  4B3R I;  5A2Q Q;  1Z5A A;  2NA2 A;  1X49 A;  4DR1 I;  2VQF I;  3Q1Q A;  4NXM E;  5IT9 C;  1HNZ E;  1XNR E;  4LF5 I;  1XMQ I;  4JI2 I;  4YY3 E;  4GKK I;  4X62 E;  2HKE A;  3WU4 A;  1N32 E;  1PKP A;  4DPX A;  1J5E E;  1HR0 E;  1BKN A;  1XMO I;  4X65 E;  4LF7 E;  1KKH A;  2HK2 A;  1ZM4 A;  3OTO I;  3ADL A;  4UTG A;  4AQY E;  1PVG A;  3PYD A;  4GKJ I;  4I3H A;  1ZBT A;  4R1F A;  4WUD A;  4DUZ I;  1N32 I;  2B3T B;  1EI1 A;  4X66 I;  1GQE A;  4HY1 A;  4JI5 E;  3J7Y p;  4LF6 I;  2JVA A;  2LTS A;  4YHH E;  4K0K E;  4DUY E;  1YYW A;  4LFA I;  4JI7 E;  4DV7 I;  5A2Q C;  4NXM I;  1ZM2 A;  4JV5 E;  1IBK E;  3HTX A;  5LMU I;  1FNM A;  1IBM I;  3OTO E;  4X64 I;  4DR7 I;  2N3G A;  4DR5 E;  1RQ0 A;  1MU5 A;  2YT4 A;  1XHK A;  4DR3 I;  1H7U A;  1ZXM A;  3QT7 A;  1UHZ A;  3ZKD A;  2V2Z A;  1N33 I;  2DEI A;  2V34 A;  4HAC B;  4DUZ E;  2L33 A;  2DB2 A;  2UXC I;  3J81 C;  3VYX A;  2J7K A;  4B3M I;  4DPT A;  4HXZ A;  2A2D A;  4DV7 E;  1XNQ E;  4B3R E;  4URL A;  1T4O A;  4DV0 E;  4DV1 E;  1Z5C A;  1FJG I;  2LJP A;  1H74 A;  3ZM7 A;  5FLX Q;  1S4E A;  4FN5 A;  1T4L B;  4B3T E;  2E1R A;  2V2V A;  2DIX A;  4JI8 I;  4LF7 I;  2F4V I;  1I94 E;  1H7S A;  4WFT A;  4MYU A;  3PYE A;  3WU5 A;  1A6F A;  4M30 A;  4JI3 I;  2LJH A;  1DI2 A;  2BM0 A;  1KTV A;  3J7A G;  4HYM A;  4PRX A;  2HHH E;  4DV4 I;  1XNR I;  3LNU A;  3J80 C;  2UUA E;  4UT4 A;  5FLX C;  1PIE A;  1N34 I;  4DV5 I;  4LF9 I;  2F4V E;  3LTO A;  4B3S E;  3K17 A;  4B3T I;  3WU3 A;  1B63 A;  1ZXN A;  1WHN A;  2X7I A;  1FKA E;  2R3V A;  2L3J A;  2LRS A;  1I94 I;  2L2M A;  4FWG A;  2L3C A;  4DV2 I;  4HAC A;  3QT5 A;  4DPY A;  4FW9 A;  4B3S I;  4DR5 I;  4KHP I;  2E5L E;  4LFB E;  2WW4 A;  1IBK I;  1D6T A;  2E5L I;  4LFB I;  4LFC E;  1YYK A;  4DV4 E;  4DV0 I;  4JG4 A;  4LF8 I;  4X65 I;  5GMD A;  2N3H A;  1Z0W A;  3M6A A;  2RSM A;  1NHJ A;  4RPF A;  3T1H I;  2DMY A;  4WUB A;  3ZZU A;  2HKJ A;  2BM1 A;  1H72 C;  2RTX A;  4JI2 E;  4ED4 A;  3J81 Q;  4LF4 I;  3QT8 A;  2UUA I;  4DPU A;  3WU6 A;  1DAR A;  2LUQ A;  1KVK A;  2X36 A;  3B78 A;  4JI7 I;  2CZ9 A;  1IBM E;  3LPS A;  5LMU E;  1HNW I;  5L3J A;  2HK3 A;  2Q2E B;  3J7A M;  4JI6 E;  3H4L A;  4DU8 A;  4JI8 E;  1J26 A;  1J5E I;  4JI3 E;  2UXC E;  5LMN I;  4KQV A;  3JAM Q;  3ADG A;  2XEX A;  3ADI A;  3JAM C;  3F0N A;  1Z0B A;  3V5R A;  2A2C A;  5GME A;  1XMQ E;  4DV5 E;  4LF9 E;  3B8H A;  2EFG A;  1EA6 A;  4DR1 E;  5BR8 I;  4JI4 E;  1RC7 A;  1WHQ A;  1UEK A;  1HNX I;  1YYO A;  4PU9 A;  2AJ4 A;  1Z0G A;  3C4B A;  4YHH I;  4K0K I;  4OX9 I;  4USM A;  2DEJ A;  4LF6 E;  3B82 A;  2NUE A;  4DU7 A;  1Z0V A;  2B7T A;  1N34 E;  1HR0 I;  2HFU A;  4X64 E;  4DXL A;  1U2R A;  2JY9 A;  2HFS A;  4DR3 E;  4GKJ E;  4OOG C;  2B7V A;  4DUY I;  3V2U C;  2ZBK B;  4LFC I;  4JI4 I;  2LTR A;  4AQY I;  5IWA E;  3VYY A;  4X8W A;  3J80 Q;  4DR2 I;  2R42 A;  3GON A;  3ZZT A;  1UIL A;  2EZ6 A;  2VQE E;  4FWD A;  2UXB E;  1MG7 A;  2GS8 A;  4JYA I;  3PYG A;  2RS7 A;  2ZIT A;  4MYT A;  2BV3 A;  1QU6 A;  3ZZ0 A;  3PYF A;  1N36 I;  2MDR A;  3HUL A;  4DR4 I;  1ZM9 A;  4LF8 E;  3D4J A;  4M2Z A;  1Z0C A;  3T1Y E;  2NPF A;  4DR2 E;  4JV5 I;  2VQF E;  1FWL A;  3QT6 A;  1N33 E;  4USK A;  1EKZ A;  2LUP B;  4JI5 I;  2UUB I;  5CFF E;  4JYA E;  2ZM6 I;  2UXB I;  4X62 I;  1RR9 A;  4DV6 E;  3CWV A;  4DR7 E;  4JI0 I;  3T1H E;  3P1X A;  1O0W A;  1NZ0 A;  5IWA I;  1N0U A;  4P52 A;  2L2N A;  2UUB E;  2V8P A;  3K1J A;  1X47 A;  4LFA E;  3T1Y I;  3LLH A;  4LF5 E;  1HNZ I;  4DR4 E;  4X66 E;  1HNX E;  1Z5B A;  2LBS B;  4B3M E;  4LF4 E;  2RS6 A;  4JI1 E;  1VIS A;  4FWH A;  2OI2 A;  4Z7C A;  1XMO E;  2UUC I;  1OJ4 A;  1Z0E A;  1WUU A;  1N36 E;  4NXN I;  4ZVI A;  2V2Q A;  4EMD A;  2UXD E;  2CPN A;  4JI1 I;  1MX0 A;  1N0V C;  1ELO A;  5BR8 E;  2HHH I;  2UU9 E;  1HNW E;  2NUF A;  4P7A A;  1B62 A;  1FI4 A;  4KHP E;  1IBL I;  1Z59 A;  4DR6 I;  4WUC A;  2KHX A;  4DV2 E;  1NHH A;  1X48 A;  2ZM6 E;  4Z7Y A;  2NUG A;  4DV3 I;  4DPW A;  1KIJ A;  4JI0 E;  5LMN E;  3ZKB A;  4OX9 E;  2VQE I;  4DV6 I;  1Z0T A;  1IBL E;  4JI6 I;  2L2K B;  1S16 A;  2VF3 A;  2UU9 I;  4DV3 E;  1FJG E;  1T4N A;  1YZ9 A;  5LL6 R;  1FWK A;  1XNQ I;  2UXD I;  4XTJ A;  1NHI A;  4NXN E;  1ZM3 A;  5IT9 Q;  1STU A;  4DKK A;  1QZR A;  2UUC E;  1K47 A;  3C4T A;  4PRV A;  1H73 A;  3ADJ A;  1RRE A;  4M1K A;  4WYQ B; 
#chains in the Genus database with same CATH topology
 1R6M A;  2ELZ A;  2V88 A;  2EMX A;  5KL3 A;  2EN2 A;  2JOX A;  2IHR 1;  2JE6 A;  2JWO A;  5K36 C;  2EL5 A;  3HKM A;  4DV1 I;  4IFD E;  4BS9 A;  4F9A B;  4DR6 E;  4GKK E;  2EOR A;  2WP8 A;  4YY3 I;  2BA0 G;  4B3R I;  2JP9 A;  5A2Q Q;  5LLQ A;  4IFD A;  1Z5A A;  2NA2 A;  1X49 A;  1G2D C;  4DR1 I;  1E3P A;  2VQF I;  5TSE A;  2JOB A;  3Q1Q A;  4NXM E;  3KRN A;  5IT9 C;  4IZJ B;  5KL7 A;  3THN A;  4R2Q A;  1HNZ E;  1XNR E;  5A6A A;  4LF5 I;  4MLQ A;  1XMQ I;  2EMC A;  4JI2 I;  2GHF A;  4YY3 E;  4GKK I;  1KJK A;  4X62 E;  2MKD A;  4BA1 B;  2Z5E A;  1RHY A;  3BF2 A;  2EN1 A;  4P78 A;  1IQO A;  4ZYD A;  2ENA A;  2HKE A;  5IXM B;  1A1F A;  1OYR A;  3WU4 A;  5C0X B;  4OO1 B;  1N32 E;  1PKP A;  4DPX A;  2E1M A;  1J5E E;  2GO4 A;  1HR0 E;  1BKN A;  1XMO I;  3U1K A;  4X65 E;  2CT1 A;  4FW7 A;  1HK7 A;  4LF7 E;  1RMD A;  1EH6 A;  2JYA A;  1KKH A;  2HK2 A;  1PJQ A;  1ZU1 A;  1ZM4 A;  2C39 B;  3OTO I;  1A1I A;  3ADL A;  4BMJ A;  5DNY A;  1DGC A;  1Y60 A;  2YTJ A;  4UTG A;  4AQY E;  5A6J A;  4LTY A;  4R8O A;  5KL5 A;  1PVG A;  2YWQ A;  3PYD A;  4X9J A;  2EN8 A;  3B4T A;  5FWK A;  2FTX B;  5DRO A;  2EOX A;  2PO0 A;  2Z5B A;  2YTF A;  5T6J A;  4GKJ I;  1MEY C;  4IZK A;  2PNZ B;  2L6M A;  1IMU A;  2O1U A;  4OZE A;  4I3H A;  2EPP A;  5BR8 I;  1ZBT A;  4R1F A;  2LE2 A;  4WUD A;  2C37 B;  4HTG A;  2EMF A;  4RHB B;  3VHT B;  3HPZ A;  4DUZ I;  1N32 I;  5DNX A;  2B3T B;  3F6H A;  4O5G A;  1EI1 A;  4X66 I;  1GQE A;  2WBU A;  4HY1 A;  4JI5 E;  2EP3 A;  3J7Y p;  4LF6 I;  2JVA A;  3QG5 C;  2LTS A;  4R2S A;  2O3Z A;  4YHH E;  4K0K E;  4DUY E;  1YYW A;  4LFA I;  1UDO A;  2PRT A;  4JI7 E;  1SFE A;  4DV7 I;  2NN6 D;  2C38 B;  3PS1 A;  1YFH A;  2YTI A;  5A2Q C;  4NXM I;  1ZM2 A;  4JV5 E;  2YTP A;  1IBK E;  3HTX A;  4LCH A;  5LMU I;  4MU0 A;  1FNM A;  1IBM I;  3OTO E;  4F2J C;  2BA0 D;  4IZJ A;  2YU5 A;  2N3G A;  4DR5 E;  4GZN C;  1RQ0 A;  4X64 I;  4DR7 I;  5K36 F;  1MU5 A;  3MSW A;  2EOQ A;  2YT4 A;  5EL9 A;  1XHK A;  4DR3 I;  3MHS C;  3H1C A;  2YPN A;  2EE8 A;  1H7U A;  2PO1 A;  1ZXM A;  3QT7 A;  1UHZ A;  2ADR A;  5JEA A;  3IWC A;  2GQ0 A;  2WNR A;  3ZKD A;  2ODR C;  4BHB A;  2V2Z A;  4R2E A;  1N33 I;  2DEI A;  3LML A;  3MHH C;  2V34 A;  4HAC B;  1X6F A;  4DUZ E;  1TF6 A;  1X3C A;  2YTQ A;  2DLK A;  2L33 A;  4LU9 A;  2DB2 A;  1YSA C;  2DRP A;  3K85 A;  2UXC I;  2HGH A;  3J81 C;  3M85 G;  3VYX A;  2J7K A;  4B3M I;  4DPT A;  1X5W A;  2Z5C B;  4HXZ A;  2KOU A;  2ELY A;  2V85 A;  2YTG A;  2A2D A;  4BA2 A;  3AV0 A;  5K36 E;  4DV7 E;  1XNQ E;  4B3R E;  4URL A;  1T4O A;  1UN6 B;  1UBD C;  4DV0 E;  4DV1 E;  4M0V A;  1Z5C A;  2O1W A;  1FJG I;  2CG9 A;  1VI7 A;  2PNM A;  4ZYE A;  2LJP A;  2EMB A;  3M85 D;  1H74 A;  5JEA D;  2EL6 A;  3ZM7 A;  1S4E A;  1UDS A;  5FLX Q;  2EPZ A;  5C0X D;  4U3B A;  4FN5 A;  4LOM A;  3M7N D;  1T4L B;  2JT2 A;  4IZK B;  1YHC A;  2YRH A;  4B3T E;  4KWY A;  2EM9 A;  2E1R A;  2MC6 A;  2IOP A;  2NN6 F;  2NN6 C;  2DIX A;  2V2V A;  4JI8 I;  4LF7 I;  2F4V I;  4N4R B;  1I94 E;  1H7S A;  4WFT A;  5A6K A;  3P3C A;  5DNL A;  5JEA C;  4MYU A;  2HJJ A;  2EL4 A;  2G7H A;  1PJS A;  3HQ1 A;  2VRD A;  3PYE A;  1A6F A;  2L8T A;  3WU5 A;  4IFD C;  2I9I A;  4AIM A;  1USV A;  4I8O A;  4M30 A;  3P76 A;  2LJH A;  2J7J A;  1A1G A;  2MKN A;  1DI2 A;  2YSP A;  2BM0 A;  4JI3 I;  4BHC A;  2EN7 A;  2EPM X;  3J7A G;  3JU0 A;  1KTV A;  5DRQ A;  2WBS A;  4WXD A;  4HYM A;  2VF1 A;  2RPC A;  4IFD D;  2NN6 A;  2HHH E;  4MU4 A;  4PRX A;  4DV4 I;  1XNR I;  4AM3 A;  3LNU A;  3J80 C;  2UUA E;  4MU3 A;  5FLX C;  4UT4 A;  1PIE A;  2BB8 A;  2B9D A;  2PO2 A;  1N34 I;  4IZJ D;  4DV5 I;  4LF9 I;  2O1V A;  2F4V E;  5K36 B;  2L92 A;  3LTO A;  1UDQ A;  4B3S E;  3K17 A;  2CTD A;  2YTN A;  5C0X F;  2EMW A;  2LCE A;  1BB8 A;  2IES A;  3WU3 A;  5JEA E;  4B3T I;  1BBG A;  1B63 A;  1ZXN A;  1WHN A;  1YH8 A;  2X7I A;  1G2F C;  1FKA E;  1IQS A;  2R3V A;  2L3J A;  2LRS A;  3C6K A;  1I94 I;  2L2M A;  4IS1 C;  2L3C A;  4FWG A;  4HAC A;  3QT5 A;  4DPY A;  4DV2 I;  4WSG A;  1JK1 A;  2CVE A;  3NZK A;  4FW9 A;  4B3S I;  4DR5 I;  4KHP I;  4MQY A;  2LJU A;  2E5L E;  4R03 A;  2LVH A;  4LFB E;  2GO3 A;  2WW4 A;  2DLQ A;  1IBK I;  2ENC A;  1D6T A;  2EMG A;  2JEA A;  2Z5C A;  2E5L I;  2WZO A;  2EN4 A;  3L7Z A;  4F6N A;  4LFC E;  5F3W A;  1YYK A;  4LFB I;  4DV4 E;  2AE8 A;  2DMI A;  4BA2 B;  4DV0 I;  1YPN A;  4R2C A;  4JG4 A;  4LF8 I;  2IER A;  4LCF A;  4X65 I;  2M7Q A;  4FW3 A;  5GMD A;  2N3H A;  1Z0W A;  4QNJ A;  1X6E A;  3M6A A;  2RSM A;  1NHJ A;  3KWR A;  3HXL A;  4TUI A;  4MU1 A;  4IFD F;  4RPF A;  3T1H I;  2V89 A;  2DMY A;  2WBT A;  4LPF A;  4OO1 E;  4N3O A;  2RQL A;  3FIG A;  2EQ3 A;  2BR2 B;  2EPN A;  4WUB A;  3ZZU A;  2GLI A;  2HKJ A;  4HEI A;  3P3G A;  2BM1 A;  1H72 C;  2GPI A;  4BC9 A;  2RTX A;  1ZBQ A;  4JI2 E;  3Q6N A;  4ED4 A;  3J81 Q;  4LF4 I;  3IWB A;  3QT8 A;  2UUA I;  4WPY A;  2EQ1 A;  3CDJ A;  4DPU A;  3WU6 A;  3P06 A;  4WXC A;  4WSP A;  1DAR A;  2DSY A;  2LUQ A;  2EN6 A;  1KVK A;  2FGG A;  4MDT A;  3CDI A;  2VE7 C;  2X36 A;  2WP8 B;  3B78 A;  4JI7 I;  3L00 A;  4TUG A;  2CZ9 A;  1IBM E;  3LPS A;  2EOI A;  5LMU E;  1HNW I;  5L3J A;  2HK3 A;  4FW6 A;  2Q2E B;  1WXR A;  5A69 A;  4R2R A;  3J7A M;  4JI6 E;  3H4L A;  4DU8 A;  4JI8 E;  1J26 A;  2EMA A;  1J5E I;  1NEI A;  4JI3 E;  2UXC E;  5LMN I;  2YZT A;  2V83 A;  2YRM A;  3TQM A;  4KQV A;  1Y6Z A;  3JAM Q;  3ADG A;  2EOS A;  2WCC 3;  3ADI A;  3RMP A;  2XEX A;  3JAM C;  3F0N A;  2YTE A;  4FK5 C;  1Z0B A;  5AAS A;  3V5R A;  2Q8U A;  2A2C A;  5GME A;  1XMQ E;  2ENH A;  2O1T A;  4DV5 E;  4LF9 E;  2ODR D;  2DGC A;  1DQ3 A;  3JTZ A;  5AE2 A;  3B8H A;  2EPR A;  2BA1 G;  1GTK A;  2EFG A;  2EOH A;  4DR1 E;  5A6B D;  1EA6 A;  2EOJ A;  2YU8 A;  4O43 A;  2JXP A;  1RC7 A;  3K6Q A;  4JI4 E;  2EPC A;  1WHQ A;  4KZS A;  1UEK A;  2BA1 D;  5ELW A;  1HNX I;  1YYO A;  4PU9 A;  4J8Z A;  2AJ4 A;  1Z0G A;  2EOM A;  2V87 A;  4O24 A;  2M9A A;  4F6M A;  3C4B A;  4R2A A;  4BA1 A;  4J3D A;  4YHH I;  4K0K I;  2EJ4 A;  4OX9 I;  4USM A;  1JK2 A;  4LF6 E;  2DEJ A;  2N8X A;  4F9B B;  2NUE A;  4ZYG A;  3B82 A;  4NHR A;  3P3E A;  4ISA A;  4OO1 A;  3AUZ A;  2YRK A;  1YUI A;  2PNZ A;  4DU7 A;  5C0X A;  2EMK A;  2V8Q B;  1TF3 A;  4LCG A;  1EH8 A;  1Z0V A;  1X6H A;  1AH5 A;  2EOO A;  1T38 A;  2JEB A;  2B7T A;  2C37 A;  1N34 E;  1HR0 I;  5C0X C;  2HFU A;  4O4K A;  2YTD A;  4R2D A;  5AC5 A;  4X64 E;  4DXL A;  1U2R A;  2JY9 A;  2JPA A;  3DD6 A;  2EMI A;  2HFS A;  2MDG A;  5DRP A;  2CSH A;  4DR3 E;  4GKJ E;  4OO1 F;  4OOG C;  2B7V A;  1SR9 A;  3V2U C;  4DUY I;  2C38 A;  4OKG A;  3EPH A;  2ZBK B;  2EOF A;  3GCM A;  4LFC I;  4JI4 I;  2LTR A;  3DJW A;  1TN9 A;  2Z5B B;  2PO0 B;  4AQY I;  5IWA E;  3VYY A;  4X8W A;  3J80 Q;  4DR2 I;  2EPK X;  2EM0 A;  2R42 A;  2I13 A;  3GON A;  2EOY A;  3ZZT A;  1UIL A;  2EZ6 A;  2VQE E;  2YSO A;  4FWD A;  2CGE A;  2UXB E;  2VES A;  4U3D A;  1MG7 A;  2GS8 A;  4JYA I;  3PYG A;  2RS7 A;  2ZIT A;  4MYT A;  2WNR B;  1ZR9 A;  2EMZ A;  2LV2 A;  2K7I A;  4DMI A;  1QU6 A;  2BV3 A;  1BBO A;  3PS2 A;  3PYF A;  1Y4S A;  3ZZ0 A;  1N36 I;  2EM8 A;  2MDR A;  1A1H A;  3HUL A;  2V86 A;  4DR4 I;  3KZZ A;  1ZM9 A;  3HJC A;  2EPX A;  4LF8 E;  3D4J A;  4M2Z A;  1Z0C A;  5AE1 A;  3T1Y E;  5C0X E;  2EPL X;  3EPJ A;  2NPF A;  1MGT A;  4DR2 E;  4JV5 I;  2EOZ A;  2VQF E;  4OO1 C;  3M99 B;  4Q35 B;  3UHM A;  4FW4 A;  1FWL A;  3QT6 A;  1N33 E;  4USK A;  5AC4 A;  1EKZ A;  2LUP B;  2HC5 A;  4JI5 I;  2PO1 B;  3THO B;  2UUB I;  5KL4 A;  3EQ1 A;  5JEA B;  2YTO A;  5CFF E;  1LLM C;  4OO1 D;  4JYA E;  2ZM6 I;  2UXB I;  4FW5 A;  1USU A;  2JR1 A;  1Z1B A;  4X62 I;  1RR9 A;  3VK6 A;  2JEB B;  3ECR A;  1QNT A;  4DV6 E;  3CWV A;  4BC7 A;  2A25 A;  5KL2 A;  4DR7 E;  1OYP A;  3T1H E;  2D9H A;  1O0W A;  3P1X A;  4P7D A;  3UK3 C;  1NZ0 A;  4JI0 I;  2EM3 A;  5IWA I;  1L4S A;  4NZV A;  2EN3 A;  1N0U A;  4P52 A;  2KON A;  2L2N A;  2UUB E;  1YUJ A;  1PJT A;  1R6L A;  2H36 X;  2V8P A;  3K1J A;  1X47 A;  4LFA E;  3T1Y I;  2FV4 B;  3LLH A;  1P47 A;  2EQ0 A;  3BBG A;  4LF5 E;  1HNZ I;  2IOQ A;  4DR4 E;  2EM2 A;  1Y5Y A;  4X66 E;  1HNX E;  2EMY A;  1B69 A;  1UDN A;  1Z5B A;  2PO2 B;  1OYS A;  2LBS B;  3HPS A;  4B3M E;  4L8N A;  5ADZ A;  4LF4 E;  2MC5 A;  3Q6M A;  4BBY A;  4QNK A;  5EKW A;  5K36 A;  2RS6 A;  4JI1 E;  1VIS A;  3C6M A;  4FWH A;  2OI2 A;  4MLV A;  4Z7C A;  1XMO E;  2E72 A;  2UUC I;  1OJ4 A;  2LMZ A;  1A1K A;  1Z0E A;  1WRJ A;  4AID A;  1WUU A;  1N36 E;  4L5N C;  4NXN I;  4ZVI A;  3M7N G;  2V2Q A;  3F6G A;  4F54 A;  2JE6 B;  4EMD A;  2UXD E;  1EH7 A;  2CPN A;  4R2P A;  2K4V A;  1ZAA C;  4GQU A;  3EPL A;  4RH8 A;  5DRR A;  2EWL A;  4JI1 I;  3H09 A;  4IFD B;  4Q28 A;  1MX0 A;  1Y4U A;  1N0V C;  1ELO A;  2RSI A;  2EPU A;  2NN6 B;  5BR8 E;  2JEA B;  3U1Y A;  3EPK A;  2HHH I;  2UU9 E;  3L7Z B;  1HNW E;  5A6B A;  2NUF A;  3ZOQ B;  1B62 A;  4P7A A;  2J65 A;  2LO3 A;  2R76 A;  2M4I A;  3BGH A;  1FI4 A;  4KHP E;  3GME A;  1IBL I;  2EPA A;  1Z59 A;  4DR6 I;  4GEQ B;  4WUC A;  5AE3 A;  2KHX A;  2M1S A;  4DV2 E;  1NHH A;  5JEA F;  1X48 A;  2ZM6 E;  4Z7Y A;  2NUG A;  4WX9 A;  4DV3 I;  3DF6 A;  2F1D A;  1T39 A;  1WJP A;  1KIJ A;  4DPW A;  4JI0 E;  2EM7 A;  5LMN E;  2BR2 A;  4OX9 E;  3ZKB A;  2VQE I;  4DV6 I;  3PS3 A;  2EM4 A;  2F8B A;  2EM5 A;  1IBL E;  1Z0T A;  4JI6 I;  5IV8 B;  3KZY A;  2EM6 A;  3BID A;  2L2K B;  1E3H A;  1S16 A;  2C39 A;  2VF3 A;  4ZYH A;  5KL6 A;  4DV3 E;  2UU9 I;  2BBG A;  3GLL A;  4F9C B;  4IS9 A;  1KYQ A;  1FJG E;  1T4N A;  1YZ9 A;  2EOE A;  5LL6 R;  1FWK A;  2NAB A;  4IJD A;  1XNQ I;  2EMH A;  3PRY A;  2UXD I;  1F2I G;  1XXE A;  1AAY A;  4XTJ A;  2LT7 A;  2EML A;  1N3G A;  3OML A;  4M9V C;  1NHI A;  4NXN E;  1ZM3 A;  1NCS A;  5IT9 Q;  3IWD A;  1STU A;  4BCA A;  1A1J A;  2NN6 E;  4DKK A;  2R1F A;  1QZR A;  2UUC E;  1K47 A;  3C4T A;  4PRV A;  1H73 A;  2EPO A;  1A1L A;  2PNL A;  5K36 D;  4NBQ A;  3ADJ A;  1RRE A;  1GZ6 A;  4M1K A;  1P42 A;  1PDA A;  4WYQ B; 
#chains in the Genus database with same CATH homology
 2V88 A;  2JOX A;  2IHR 1;  2JWO A;  4DV1 I;  4BS9 A;  4F9A B;  4DR6 E;  4GKK E;  4YY3 I;  4B3R I;  5A2Q Q;  1Z5A A;  2NA2 A;  1X49 A;  4DR1 I;  2VQF I;  2JOB A;  3Q1Q A;  4NXM E;  5IT9 C;  4IZJ B;  1HNZ E;  1XNR E;  4LF5 I;  1XMQ I;  4JI2 I;  4YY3 E;  4GKK I;  4X62 E;  2Z5E A;  4P78 A;  2HKE A;  3WU4 A;  1N32 E;  1PKP A;  4DPX A;  2E1M A;  1J5E E;  1HR0 E;  1BKN A;  1XMO I;  4X65 E;  1HK7 A;  4LF7 E;  1KKH A;  2HK2 A;  1ZM4 A;  3OTO I;  3ADL A;  4BMJ A;  5DNY A;  4UTG A;  4AQY E;  4LTY A;  4R8O A;  1PVG A;  3PYD A;  5FWK A;  2FTX B;  2Z5B A;  5T6J A;  4GKJ I;  4IZK A;  2L6M A;  2O1U A;  4I3H A;  1ZBT A;  4R1F A;  2LE2 A;  4WUD A;  4DUZ I;  3HPZ A;  1N32 I;  2B3T B;  3F6H A;  1EI1 A;  4X66 I;  1GQE A;  4HY1 A;  4JI5 E;  3J7Y p;  4LF6 I;  2JVA A;  2LTS A;  4YHH E;  4K0K E;  4DUY E;  1YYW A;  4LFA I;  4JI7 E;  4DV7 I;  5A2Q C;  4NXM I;  1ZM2 A;  4JV5 E;  1IBK E;  3HTX A;  5LMU I;  1FNM A;  1IBM I;  3OTO E;  4IZJ A;  4X64 I;  4DR7 I;  2N3G A;  4DR5 E;  1RQ0 A;  1MU5 A;  3MSW A;  2YT4 A;  1XHK A;  4DR3 I;  1H7U A;  1ZXM A;  3QT7 A;  1UHZ A;  3IWC A;  2GQ0 A;  3ZKD A;  2ODR C;  2V2Z A;  1N33 I;  2DEI A;  3LML A;  2V34 A;  4HAC B;  4DUZ E;  4LU9 A;  2L33 A;  2DB2 A;  2UXC I;  3K85 A;  3J81 C;  3VYX A;  2J7K A;  4B3M I;  4DPT A;  4HXZ A;  2Z5C B;  2KOU A;  2V85 A;  2A2D A;  3AV0 A;  4DV7 E;  1XNQ E;  4B3R E;  4URL A;  1T4O A;  4DV0 E;  4DV1 E;  4M0V A;  1Z5C A;  2O1W A;  1FJG I;  2CG9 A;  2PNM A;  2LJP A;  1H74 A;  3ZM7 A;  5FLX Q;  1S4E A;  4FN5 A;  1T4L B;  4IZK B;  4B3T E;  2E1R A;  2IOP A;  2MC6 A;  2V2V A;  2DIX A;  4JI8 I;  4LF7 I;  2F4V I;  1I94 E;  1H7S A;  4WFT A;  4MYU A;  3PYE A;  2G7H A;  3WU5 A;  3HQ1 A;  1A6F A;  2L8T A;  1USV A;  4I8O A;  4M30 A;  4JI3 I;  2LJH A;  1DI2 A;  2BM0 A;  3J7A G;  1KTV A;  3JU0 A;  4HYM A;  2VF1 A;  4PRX A;  2HHH E;  4DV4 I;  1XNR I;  3LNU A;  3J80 C;  2UUA E;  4UT4 A;  5FLX C;  1PIE A;  2B9D A;  1N34 I;  4IZJ D;  4DV5 I;  4LF9 I;  2O1V A;  2F4V E;  2L92 A;  3LTO A;  4B3S E;  3K17 A;  4B3T I;  3WU3 A;  1B63 A;  1ZXN A;  1WHN A;  2X7I A;  1FKA E;  2R3V A;  2L3J A;  2LRS A;  1I94 I;  2L2M A;  4FWG A;  2L3C A;  4DV2 I;  4HAC A;  3QT5 A;  4DPY A;  4FW9 A;  4B3S I;  4DR5 I;  4KHP I;  2E5L E;  4R03 A;  4LFB E;  2WW4 A;  1IBK I;  1D6T A;  2Z5C A;  2E5L I;  2WZO A;  4LFB I;  4LFC E;  5F3W A;  1YYK A;  4DV4 E;  4DV0 I;  4JG4 A;  4LF8 I;  4X65 I;  2M7Q A;  5GMD A;  2N3H A;  1Z0W A;  3M6A A;  2RSM A;  1NHJ A;  3KWR A;  3HXL A;  4TUI A;  4RPF A;  3T1H I;  2V89 A;  2DMY A;  4N3O A;  3FIG A;  4WUB A;  3ZZU A;  2HKJ A;  2BM1 A;  1H72 C;  4BC9 A;  2RTX A;  1ZBQ A;  4JI2 E;  3Q6N A;  4ED4 A;  3J81 Q;  4LF4 I;  3IWB A;  3QT8 A;  2UUA I;  4WPY A;  4DPU A;  3WU6 A;  3P06 A;  4WSP A;  1DAR A;  2DSY A;  2LUQ A;  1KVK A;  2FGG A;  2VE7 C;  2X36 A;  3B78 A;  4JI7 I;  4TUG A;  2CZ9 A;  1IBM E;  3LPS A;  5LMU E;  1HNW I;  5L3J A;  2HK3 A;  2Q2E B;  1WXR A;  3J7A M;  4JI6 E;  3H4L A;  4DU8 A;  4JI8 E;  1J26 A;  1J5E I;  4JI3 E;  2UXC E;  5LMN I;  2YZT A;  2V83 A;  4KQV A;  1Y6Z A;  3JAM Q;  3ADG A;  2XEX A;  3ADI A;  3RMP A;  3JAM C;  3F0N A;  1Z0B A;  5AAS A;  3V5R A;  2A2C A;  5GME A;  1XMQ E;  2O1T A;  4DV5 E;  4LF9 E;  2ODR D;  1DQ3 A;  3JTZ A;  5AE2 A;  3B8H A;  2EFG A;  1EA6 A;  4DR1 E;  1USU A;  5BR8 I;  4JI4 E;  1RC7 A;  3K6Q A;  1WHQ A;  4KZS A;  1UEK A;  1HNX I;  1YYO A;  4PU9 A;  4J8Z A;  2AJ4 A;  1Z0G A;  2V87 A;  3C4B A;  4YHH I;  4K0K I;  4OX9 I;  4USM A;  2DEJ A;  4LF6 E;  3B82 A;  4F9B B;  2NUE A;  3AUZ A;  4DU7 A;  2V8Q B;  1Z0V A;  2B7T A;  1N34 E;  1HR0 I;  2HFU A;  4X64 E;  4DXL A;  1U2R A;  2JY9 A;  2HFS A;  4DR3 E;  4GKJ E;  4OOG C;  2B7V A;  1SR9 A;  3V2U C;  4DUY I;  2ZBK B;  4LFC I;  4JI4 I;  2LTR A;  3DJW A;  2Z5B B;  4AQY I;  5IWA E;  3VYY A;  4X8W A;  3J80 Q;  4DR2 I;  2R42 A;  3GON A;  3ZZT A;  1UIL A;  2EZ6 A;  2VQE E;  4FWD A;  2CGE A;  2UXB E;  1MG7 A;  2GS8 A;  4JYA I;  3PYG A;  2RS7 A;  2ZIT A;  4MYT A;  4DMI A;  1QU6 A;  2BV3 A;  3ZZ0 A;  3PYF A;  1N36 I;  1Y4S A;  2MDR A;  3HUL A;  2V86 A;  4DR4 I;  1ZM9 A;  3HJC A;  4LF8 E;  3D4J A;  4M2Z A;  1Z0C A;  5AE1 A;  3T1Y E;  2NPF A;  4DR2 E;  4JV5 I;  2VQF E;  1FWL A;  3QT6 A;  1N33 E;  4USK A;  1EKZ A;  2LUP B;  4JI5 I;  2UUB I;  5CFF E;  4JYA E;  2ZM6 I;  2UXB I;  2JR1 A;  4X62 I;  1RR9 A;  3VK6 A;  4DV6 E;  3CWV A;  4BC7 A;  4DR7 E;  4JI0 I;  3T1H E;  3P1X A;  1O0W A;  4P7D A;  1NZ0 A;  5IWA I;  1N0U A;  4P52 A;  2KON A;  2L2N A;  2UUB E;  2V8P A;  2H36 X;  3K1J A;  1X47 A;  4LFA E;  3T1Y I;  2FV4 B;  3LLH A;  4LF5 E;  1HNZ I;  2IOQ A;  4DR4 E;  4X66 E;  1HNX E;  1Z5B A;  2LBS B;  3HPS A;  4B3M E;  4L8N A;  5ADZ A;  4LF4 E;  2MC5 A;  3Q6M A;  4BBY A;  2RS6 A;  4JI1 E;  1VIS A;  4FWH A;  2OI2 A;  4Z7C A;  1XMO E;  2UUC I;  1OJ4 A;  2LMZ A;  1Z0E A;  1WUU A;  1N36 E;  4L5N C;  4NXN I;  4ZVI A;  2V2Q A;  3F6G A;  4F54 A;  4EMD A;  2UXD E;  2CPN A;  2K4V A;  4JI1 I;  2EWL A;  3H09 A;  4Q28 A;  1MX0 A;  1Y4U A;  1N0V C;  1ELO A;  5BR8 E;  2HHH I;  2UU9 E;  1HNW E;  2NUF A;  3ZOQ B;  1B62 A;  4P7A A;  2M4I A;  1FI4 A;  4KHP E;  1IBL I;  1Z59 A;  4DR6 I;  4GEQ B;  4WUC A;  5AE3 A;  2KHX A;  2M1S A;  4DV2 E;  1NHH A;  1X48 A;  2ZM6 E;  4Z7Y A;  2NUG A;  4DV3 I;  3DF6 A;  4DPW A;  1KIJ A;  4JI0 E;  5LMN E;  3ZKB A;  4OX9 E;  2VQE I;  4DV6 I;  2F8B A;  1IBL E;  1Z0T A;  4JI6 I;  2L2K B;  1S16 A;  2VF3 A;  2UU9 I;  4DV3 E;  4F9C B;  1FJG E;  1T4N A;  1YZ9 A;  5LL6 R;  1FWK A;  1XNQ I;  3PRY A;  2UXD I;  4XTJ A;  3OML A;  1NHI A;  4NXN E;  1ZM3 A;  5IT9 Q;  3IWD A;  1STU A;  4BCA A;  4DKK A;  1QZR A;  2UUC E;  1K47 A;  3C4T A;  4PRV A;  1H73 A;  2PNL A;  3ADJ A;  1RRE A;  1GZ6 A;  4M1K A;  4WYQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...