1XNRE

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnrE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrE02
3VYXA 5BR8I 3ADJA 5A2QC 1J26A 1N0VC 1O0WA 1FKAE 1H7SA 1VISA 4UT4A 1BKNA 2UXBE 2UUCI 2DIXA 3QT6A 4LFCE 4ED4A 4GKKE 5LL6R 2NUGA 1HNXI 4X64E 2V8PA 1FJGE 4X65I 4LF8E 3J7AG 2EZ6A 1NHIA 3V2UC 5IT9C 3HTXA 4PU9A 4X62E 1DARA 4DR7I 4WYQB 4LFAE 1FNMA 1ZM4A 3K17A 1KVKA 4DPWA 4YY3E 1X49A 1HNZI 1N36I 1MG7A 4DR1E 3ADLA 4FN5A 1S4EA 4DPXA 4DV3E 1KKHA 2UXBI 4DR5I 1T4NA 3WU3A 2L2MA 2Q2EB 4LFCI 1H7UA 2VF3A 4GKKI 2V2VA 1XMQE 3GONA 2HKJA 2X36A 2YT4A 4B3SE 2HHHE 4X64I 1Z5AA 4I3HA 1FJGI 1EKZA 3LNUA 4LF8I 2J7KA 3J81C 1ELOA 4X62I 1UILA 4LF9E 3PYFA 4JI5E 4HACB 4DXLA 1ZM2A 3VYYA 3B8HA 4YY3I 4DV5E 3ZM7A 2L3CA 2NA2A 4DR1I 3OTOE 1RR9A 4JI7E 4Z7YA 3ZKBA 4YHHE 2LJPA 1J5EE 3T1YE 4DV0E 4DV3I 2B3TB 2LRSA 3WU5A 2NUEA 4WUCA 1PVGA 1Z5BA 4DR2E 1XMQI 4FWDA 3JAMQ 1UHZA 3ZZUA 2L3JA 4B3SI 4NXME 4HYMA 2HHHI 5IWAE 1S16A 4DV6E 1GQEA 1Z0EA 1IBME 3QT7A 3PYEA 2DB2A 4LF9I 4AQYE 3WU6A 4GKJE 1Z0TA 4JI5I 2E1RA 4LF6E 4DV5I 1U2RA 4DR6E 3H4LA 2L33A 4DR3E 3F0NA 3OTOI 3M6AA 4JI7I 2B7VA 4YHHI 1J5EI 3T1YI 4DV0I 1ZXNA 2R3VA 2N3GA 2IHR1 4JI6E 2UUAE 1MX0A 1RREA 1FWKA 1K47A 5FLXQ 1QU6A 2NPFA 2A2CA 4DR2I 3B82A 4DR4E 4DKKA 1YYWA 4NXMI 4WUBA 5IWAI 3PYGA 4WUDA 4DUYE 4DV6I 1YYKA 2RS7A 1IBMI 1Z0CA 2ZM6E 4AQYI 3Q1QA 5FLXC 4FWGA 4GKJI 1N32E 4LF5E 4MYTA 1ZBTA 4JI8I 4LF6I 2GS8A 2ZBKB 4DR6I 1ZM9A 1N34I 4JG4A 4DR3I 1EI1A 4RPFA 4FW9A 4UTGA 4XTJA 3J80Q 1N33E 4FWHA 4M2ZA 4JI4I 4DV4I 4JI6I 2UUAI 2LJHA 4LFBI 2DMYA 4DPYA 4DR4I 3ZZ0A 2XEXA 3LPSA 1KTVA 2LTRA 2JVAA 1H74A 4R1FA 4P7AA 4EMDA 4URLA 4DUYI 5L3JA 1XMOE 2ZM6I 1N32I 4LF5I 3P1XA 5GMDA 4JI2E 2VQFE 4B3TE 4DPUA 1Z0VA 4K0KE 4B3RE 3LLHA 2WW4A 2NUFA 2L2KB 1DI2A 1WUUA 1N33I 2KHXA 2BV3A 1KIJA 4LF7E 5GMEA 1N0UA 1I94I 1MU5A 5LMNI 3J7Yp 2N3HA 2HFSA 5LMUE 2LTSA 1UEKA 1ZM3A 4DU8A 4DV2E 2B7TA 2CPNA 3JAMC 4JI8E 3QT5A 2DEJA 4LF4E 2OI2A 4ZVIA 1XMOI 5A2QQ 4Z7CA 2V34A 4JV5E 1T4LB 4X66E 2LBSB 2EFGA 1B62A 2AJ4A 1STUA 1HR0E 3B78A 4JI2I 2VQEE 3ADGA 4NXNE 3ADIA 2VQFI 2BM1A 4B3TI 3WU4A 1H73A 3ZKDA 4PRXA 4JI4E 4B3RI 4K0KI 4DV4E 3T1HE 2MDRA 3LTOA 4LFBE 3QT8A 4M1KA 1IBLE 2ZITA 1IBKE 1YZ9A 4LF7I 5IT9Q 1RC7A 2DEIA 2BM0A 1HNWE 4JYAE 1XNQE 1NHHA 5LMUI 4P52A 2R42A 4DV2I 1H72C 2CZ9A 4DUZI 4HXZA 2L2NA 4DV7E 1XHKA 4WFTA 1RQ0A 4KHPE 2LUQA 4LF4I 3C4TA 4JV5I 2HKEA 2UXDE 3CWVA 4X66I 4B3ME 1Z0GA 1HR0I 1NZ0A 2VQEI 4NXNI 2E5LE 4DV1E 1OJ4A 4OOGC 3T1HI 1I94E 5LMNE 4JI1E 4DPTA 4PRVA 1Z59A 1Z0BA 3V5RA 2F4VE 1IBLI 2UU9E 1Z0WA 1FWLA 1D6TA 1IBKI 4JI3E 3J81Q 1X48A 3J80C 1XNRE 1PKPA 1HNWI 4JYAI 1QZRA 1XNQI 3ZZTA 4JI0E 4HACA 2HFUA 3C4BA 1NHJA 3PYDA 2HK2A 1B63A 5CFFE 4DV7I 2UUBE 1FI4A 4OX9E 1EA6A 2RTXA 4KHPI 3HULA 4USMA 2UXCE 2RSMA 2UXDI 4LFAI 1X47A 1A6FA 4B3MI 4DR5E 2RS6A 1N34E 2JY9A 2A2DA 5BR8E 1PIEA 1T4OA 2E5LI 3D4JA 4DV1I 4HY1A 4M30A 2LUPB 1ZXMA 2UUCE 3J7AM 4JI1I 1WHNA 3K1JA 4USKA 2F4VI 2HK3A 2UU9I 1HNXE 4JI3I 4DUZE 4X65E 1XNRI 1Z5CA 2V2QA 4JI0I 1YYOA 4X8WA 4DR7E 1WHQA 2UUBI 2V2ZA 4OX9I 1HNZE 2X7IA 2UXCI 4DU7A 1N36E 4KQVA 4MYUA
chains in the Genus database with same CATH superfamily
3VYXA 1YHCA 5BR8I 3ADJA 2C39A 4J3DA 2V89A 3DJWA 5A2QC 2NN6D 1J26A 1N0VC 1O0WA 2DLKA 2KOUA 1FKAE 2JOBA 2YSOA 1H7SA 5JEAF 1VISA 4UT4A 2EM7A 2VESA 1A1LA 4O24A 1BKNA 3C6MA 2WBTA 3L7ZB 2UXBE 2ODRD 3P06A 2YTOA 2UUCI 2DIXA 2EOYA 3QT6A 4LFCE 3BF2A 4ED4A 4GKKE 5JEAC 5LL6R 2NUGA 2EM9A 3ECRA 3M99B 3UHMA 2I9IA 1YUIA 4BMJA 2PNLA 3P3GA 2DSYA 1JK1A 4LU9A 1HNXI 4X64E 2V8PA 1FJGE 1UDOA 4X65I 4LF8E 1T39A 3J7AG 2EZ6A 1NHIA 3HXLA 2CSHA 3V2UC 1A1KA 5IT9C 1F2IG 2C37B 1P47A 2JR1A 3HTXA 4PU9A 2EE8A 4DMIA 4X62E 2VF1A 4WSPA 1DARA 5DRQA 4AIDA 4DR7I 2RSIA 4WYQB 4LFAE 5FWKA 2EOXA 2WBSA 1FNMA 2F8BA 2V86A 1ZM4A 5A6KA 2YTNA 3K17A 5K36D 2EM4A 1DGCA 1KVKA 1P42A 1G2FC 2YTEA 3THNA 4DPWA 4YY3E 1X49A 1HNZI 2YTJA 2EN1A 2GHFA 4TUIA 1N36I 2GPIA 1MG7A 2JT2A 5AE1A 4DR1E 4MU3A 2O1VA 3ADLA 2EN8A 2BA1G 4FN5A 1S4EA 4DPXA 3EQ1A 4DV3E 2I13A 4F6NA 2PNZA 4NBQA 2B9DA 2C38A 4BC9A 5K36A 1KKHA 2UXBI 4DR5I 2IOPA 4R03A 1T4NA 3WU3A 2L2MA 2EM8A 2Q2EB 4IS9A 4LFCI 1H7UA 3HPSA 2PO1A 2VF3A 2V83A 4GKKI 2V2VA 3F6GA 1XMQE 5TSEA 3GONA 5DNYA 2HKJA 2X36A 4RHBB 4AIMA 2YT4A 4ZYHA 2FTXB 4R2QA 2EMYA 1YPNA 4Q28A 4B3SE 2LE2A 2HHHE 4X64I 1Z5AA 4I3HA 1FJGI 2EPPA 1ZBQA 2YWQA 5A69A 1EKZA 3BIDA 3LNUA 4LF8I 1YFHA 2J7KA 3J81C 1ELOA 4X62I 1UILA 4LF9E 2NN6F 3F6HA 3PYFA 4Q35B 5ADZA 5C0XD 2JEAA 4JI5E 1KYQA 1X6FA 4HACB 2PO0B 4DXLA 4BA2A 4IFDD 1ZM2A 3PS2A 2EOZA 3VYYA 3B8HA 2NABA 4YY3I 2NN6C 4DV5E 4OZEA 4OO1A 1A1GA 2LV2A 3JU0A 2YTDA 1B69A 4R2SA 1ZAAC 3ZM7A 2L3CA 2NA2A 3P3CA 4DR1I 3OTOE 1RR9A 4JI7E 2ODRC 4LPFA 4Z7YA 2EPLX 2JP9A 3ZKBA 2VRDA 4GEQB 4YHHE 4F6MA 1J5EE 3T1YE 4DV0E 2LJPA 4DV3I 1Z1BA 2B3TB 3K6QA 5C0XA 4GQUA 2EOMA 2BR2A 2LRSA 1ZR9A 2EMXA 1USVA 3WU5A 2EOIA 4O43A 1QNTA 2NUEA 3GCMA 5T6JA 1PVGA 1Z5BA 4WUCA 4P7DA 1PDAA 4DR2E 2Z5CB 4FWDA 4QNJA 3JAMQ 1XMQI 4M9VC 1UHZA 4ISAA 3ZZUA 2L3JA 4B3SI 1UDNA 4NXME 2EOJA 1JK2A 1AAYA 4HYMA 4ZYGA 4U3BA 5IWAE 2HHHI 4LCFA 2RPCA 4LTYA 4BA1A 2CT1A 1S16A 2WCC3 1EH8A 4DV6E 1GQEA 2YPNA 1Z0EA 3P76A 3PS3A 4FW5A 1IBME 2E1MA 3QT7A 3PYEA 2DB2A 1Y60A 4FW7A 4L8NA 4LF9I 4AQYE 2WZOA 1L4SA 4GKJE 5AC5A 3WU6A 3KWRA 2Z5EA 4MU4A 1Z0TA 4I8OA 2JXPA 2EQ1A 2E1RA 2HGHA 4JI5I 2DLQA 3VK6A 2M4IA 2EM3A 4R2DA 2CGEA 2CG9A 4LF6E 2IESA 4MU1A 1U2RA 4DV5I 4F9AB 4DR6E 2EMBA 3QG5C 4IZKB 3H4LA 2L92A 4BS9A 2EMKA 2L33A 2M1SA 4DR3E 2EM6A 2LCEA 4FW3A 3F0NA 3OTOI 3M6AA 4DV7I 4JI7I 4IZJD 2LVHA 2B7VA 4FW4A 2LT7A 2J65A 4YHHI 1J5EI 4FK5C 4DV0I 2EWLA 3T1YI 1A1HA 3EPKA 2EJ4A 2C39B 1YUJA 1ZXNA 2R3VA 2N3GA 2IHR1 4JI6E 1EH7A 2UUAE 1MX0A 1RREA 1FWKA 2YRMA 1KJKA 1A1IA 2EP3A 1K47A 1R6LA 1USUA 1Y4SA 1QU6A 5FLXQ 2NPFA 2CTDA 2RQLA 2A2CA 3FIGA 2HJJA 3B82A 4DR2I 2EM2A 4DR4E 2WBUA 4IFDF 2JOXA 4DKKA 2BA0D 1YYWA 2C37A 4IZJA 4WUBA 2ELYA 4NXMI 4FW6A 5IWAI 2O1WA 3PYGA 4WUDA 1GTKA 2LO3A 4DUYE 4DV6I 1WRJA 1YYKA 2EL5A 2RS7A 4IFDC 1IBMI 1Z0CA 2GLIA 2EL4A 2ZM6E 2MKDA 1BBGA 2NN6B 3VHTB 3PRYA 3P3EA 4AQYI 1RMDA 3Q1QA 5FLXC 4FWGA 4GKJI 4MLVA 1N32E 4LF5E 2R76A 4MYTA 1ZBTA 4JI8I 2MC6A 1UDQA 1ZU1A 2EMGA 4WPYA 4LF6I 2IERA 1BBOA 1PJQA 2GS8A 2ZBKB 2YRHA 4DR6I 1ZM9A 3U1KA 2PO2B 1N34I 4JG4A 4DR3I 2NN6E 2D9HA 1EI1A 2ENCA 4HTGA 1OYSA 4RPFA 2EMCA 4N4RB 3M7NG 1DQ3A 2EQ3A 4FW9A 4UTGA 4XTJA 1UN6B 3J80Q 4LOMA 2O1UA 5F3WA 1OYPA 1N33E 4FWHA 4F9BB 5DRRA 3H1CA 4O5GA 4M2ZA 4JI4I 2WNRB 4OO1D 3THOB 4DV4I 4JI6I 2L8TA 2UUAI 2DRPA 2PNZB 2LJHA 1X5WA 2C38B 2JE6A 5ELWA 4LFBI 3KZYA 2EN6A 2DMYA 5K36B 2YTGA 4DPYA 4LCHA 4DR4I 3JTZA 3ZZ0A 1TF6A 3EPLA 2V85A 2XEXA 3LPSA 1KTVA 2LTRA 2PO1B 5DROA 1WJPA 2JVAA 1H74A 4R1FA 4P7AA 2K4VA 4O4KA 4J8ZA 4EMDA 4URLA 4DUYI 3DF6A 3Q6MA 5L3JA 2L6MA 2EM5A 3KRNA 2EMZA 2J7JA 1XMOE 2ZM6I 5K36E 2EOSA 4MLQA 2MKNA 3OMLA 1TF3A 2WP8A 1X3CA 1A1FA 1MEYC 1N32I 4LF5I 2JEBB 4WX9A 3MHHC 3P1XA 5GMDA 2Z5BA 1SFEA 2FGGA 4JI2E 2GO4A 2VQFE 4BHCA 2JWOA 4B3TE 4DPUA 1UBDC 1Z0VA 2JEAB 1LLMC 2EOFA 5JEAA 4BA2B 5AC4A 2MC5A 2DMIA 4B3RE 4K0KE 3LLHA 1Y6ZA 3NZKA 4BCAA 2WW4A 2NUFA 4OO1B 2L2KB 2BA1D 4BC7A 1DI2A 1WUUA 1IQOA 4BBYA 5K36F 4KZSA 2CVEA 1N33I 2KHXA 2BV3A 3PS1A 1KIJA 4LF7E 5GMEA 4ZYEA 2YU5A 1N0UA 3BBGA 1NCSA 1E3HA 1I94I 1MU5A 5LMNI 2A25A 2EOOA 3J7Yp 5K36C 2N3HA 2LJUA 5LMUE 2HFSA 2LTSA 5C0XB 5KL6A 3M85D 2EPRA 4RH8A 4IS1C 2BR2B 4IFDB 1UEKA 3EPHA 1ZM3A 4DU8A 4DV2E 2B7TA 2EPOA 4P78A 4WXDA 2CPNA 1EH6A 4WSGA 3JAMC 4M0VA 4JI8E 3QT5A 2DEJA 3Q6NA 4LF4E 2OI2A 4ZVIA 1XMOI 5A2QQ 4Z7CA 4R2CA 4JV5E 2V34A 4BA1B 5C0XE 1T4LB 4IFDE 2EPCA 3GLLA 5DNLA 4X66E 2F1DA 2FV4B 2LBSB 2M7QA 2EFGA 1B62A 2AJ4A 1STUA 1HR0E 3B78A 3L7ZA 4JI2I 2VQEE 1XXEA 3ADGA 4NXNE 3ADIA 2VQFI 4OO1F 3HQ1A 2BM1A 3EPJA 2BBGA 4B3TI 1TN9A 3WU4A 3IWDA 2PNMA 1H73A 3ZKDA 4PRXA 2YTIA 4JI4E 4R2EA 4B3RI 4K0KI 4DV4E 4R2RA 3T1HE 4OO1C 2MDRA 3LTOA 5EKWA 4LFBE 3QT8A 2EOEA 5A6AA 4F9CB 4NZVA 4M1KA 5C0XF 5KL4A 3B4TA 1IBLE 2ZITA 2K7IA 1IBKE 1YZ9A 4LF7I 5IT9Q 3HKMA 1HK7A 1RC7A 2DEIA 2BM0A 1HNWE 4JYAE 1XNQE 2EMFA 2JPAA 4OKGA 4AM3A 1NHHA 5KL7A 5C0XC 5LMUI 2EOQA 2JYAA 1Y4UA 1UDSA 4P52A 2EMAA 2R42A 4MU0A 3U1YA 4MDTA 3IWBA 4DV2I 3L00A 1H72C 2CZ9A 4DUZI 3H09A 2NN6A 3AV0A 4IJDA 4HXZA 2L2NA 4TUGA 4DV7E 1XHKA 1MGTA 4WFTA 1RQ0A 4KHPE 1SR9A 2LUQA 4IZJB 4LF4I 1RHYA 3C4TA 4JV5I 2HKEA 2UXDE 3CWVA 4U3DA 5KL2A 2AE8A 4X66I 2EN7A 2V8QB 4B3ME 1Z0GA 2YTPA 2PO2A 2EN4A 1HR0I 1NZ0A 5KL3A 2VQEI 4NXNI 2EM0A 3ZOQB 3AUZA 2E5LE 3MSWA 4DV1E 2O1TA 4NHRA 2EMLA 1OJ4A 4OOGC 1PJTA 2V88A 1E3PA 1IMUA 5AE3A 2VE7C 2O3ZA 3T1HI 4GZNC 1I94E 5LMNE 4JI1E 2WNRA 3DD6A 4ZYDA 4DPTA 3GMEA 2E72A 4PRVA 1Z59A 1Z0BA 3V5RA 1NEIA 4R2AA 2F4VE 1IBLI 2UU9E 1Z0WA 1FWLA 2EPAA 2N8XA 1D6TA 1IBKI 5A6JA 4JI3E 1X48A 3J81Q 3J80C 2EN2A 2V87A 1YSAC 5JEAD 1XNRE 1PKPA 1HNWI 4JYAI 1QZRA 1XNQI 3CDJA 3ZZTA 3M85G 4WXCA 4JI0E 4HACA 4LCGA 2HFUA 2PO0A 3C6KA 3KZZA 3C4BA 2YU8A 4R2PA 4MQYA 1NHJA 2JE6B 2YTQA 3PYDA 2EPKX 2HK2A 3CDIA 5DNXA 3TQMA 5DRPA 3K85A 1B63A 1GZ6A 3IWCA 2EORA 5CFFE 2EL6A 2ENHA 4F54A 2UUBE 4OX9E 1FI4A 3BGHA 2JEBA 1EA6A 2RTXA 4QNKA 4KHPI 3HULA 4USMA 2G7HA 2R1FA 1BB8A 2UXCE 2BB8A 2RSMA 2UXDI 4LFAI 1X47A 2YTFA 1A1JA 5IXMB 1A6FA 4B3MI 2ADRA 2RS6A 4DR5E 2JY9A 3HPZA 1N34E 4R8OA 1R6MA 2A2DA 5BR8E 1PIEA 2ENAA 1YH8A 2EOHA 1T4OA 2EPNA 2KONA 2WP8B 4L5NC 2E5LI 3D4JA 4DV1I 2EPMX 4HY1A 1X6HA 2GQ0A 2MDGA 2EMHA 4M30A 2Z5BB 4N3OA 2Z5CA 5AASA 2LUPB 1ZXMA 5IV8B 2UUCE 1N3GA 5LLQA 2M9AA 1WXRA 3M7ND 4HEIA 3J7AM 2YZTA 5KL5A 4JI1I 5EL9A 5A6BD 1WHNA 5JEAB 4OO1E 3K1JA 1AH5A 1PJSA 1X6EA 2LMZA 2BA0G 2HK3A 4USKA 2F4VI 2UU9I 2YRKA 2EN3A 3MHSC 5AE2A 1HNXE 2EPUA 2H36X 4JI3I 2EPZA 4X9JA 4KWYA 4IFDA 4BHBA 4DUZE 2IOQA 2Q8UA 4X65E 2PRTA 1XNRI 1Z5CA 2ELZA 3UK3C 2V2QA 2EMIA 4JI0I 1YYOA 4X8WA 1OYRA 5JEAE 4DR7E 1G2DC 1WHQA 2HC5A 1T38A 2GO3A 4IZKA 3RMPA 5A6BA 2EMWA 2UUBI 2V2ZA 4OX9I 1Y5YA 3LMLA 2DGCA 1HNZE 2X7IA 3HJCA 2YSPA 2EQ0A 2UXCI 4F2JC 1VI7A 2EPXA 4DU7A 1N36E 4KQVA 4MYUA 1IQSA
chains in the Genus database with same CATH topology
3VYXA 5BR8I 3ADJA 2V89A 3DJWA 5A2QC 1J26A 1N0VC 1O0WA 2KOUA 1FKAE 2JOBA 1H7SA 1VISA 4UT4A 1BKNA 2UXBE 2ODRD 3P06A 2UUCI 2DIXA 3QT6A 4LFCE 4ED4A 4GKKE 5LL6R 2NUGA 4BMJA 2PNLA 2DSYA 4LU9A 1HNXI 4X64E 2V8PA 1FJGE 4X65I 4LF8E 3J7AG 2EZ6A 1NHIA 3HXLA 3V2UC 5IT9C 2JR1A 3HTXA 4PU9A 4X62E 4DMIA 1DARA 2VF1A 4WSPA 4DR7I 4WYQB 4LFAE 5FWKA 1FNMA 2F8BA 2V86A 1ZM4A 3K17A 1KVKA 4DPWA 4YY3E 1X49A 1HNZI 4TUIA 1N36I 1MG7A 5AE1A 4DR1E 2O1VA 3ADLA 4FN5A 1S4EA 4DPXA 4DV3E 2B9DA 4BC9A 1KKHA 2UXBI 4DR5I 2IOPA 4R03A 1T4NA 3WU3A 2L2MA 2Q2EB 4LFCI 1H7UA 3HPSA 2VF3A 2V83A 4GKKI 2V2VA 3F6GA 1XMQE 3GONA 5DNYA 2HKJA 2X36A 2YT4A 2FTXB 4B3SE 4Q28A 2LE2A 2HHHE 4X64I 1Z5AA 4I3HA 1FJGI 1ZBQA 1EKZA 3LNUA 4LF8I 2J7KA 3J81C 1ELOA 4X62I 1UILA 4LF9E 3F6HA 3PYFA 5ADZA 4JI5E 4HACB 4DXLA 1ZM2A 3VYYA 3B8HA 4YY3I 4DV5E 3JU0A 3ZM7A 2L3CA 2NA2A 4DR1I 3OTOE 1RR9A 4JI7E 2ODRC 4Z7YA 3ZKBA 4GEQB 4YHHE 2LJPA 1J5EE 3T1YE 4DV0E 4DV3I 2B3TB 3K6QA 2LRSA 1USVA 3WU5A 2NUEA 5T6JA 1PVGA 1Z5BA 4WUCA 4P7DA 4DR2E 4FWDA 2Z5CB 3JAMQ 1XMQI 1UHZA 3ZZUA 2L3JA 4B3SI 4NXME 4HYMA 2HHHI 5IWAE 4LTYA 1S16A 4DV6E 1GQEA 1Z0EA 1IBME 2E1MA 3QT7A 3PYEA 2DB2A 4LF9I 4L8NA 4AQYE 2WZOA 3WU6A 4GKJE 3KWRA 2Z5EA 1Z0TA 4I8OA 4JI5I 2E1RA 3VK6A 2M4IA 2CGEA 2CG9A 4LF6E 4DV5I 1U2RA 4F9AB 4DR6E 4IZKB 3H4LA 2L92A 4BS9A 2L33A 4DR3E 2M1SA 3F0NA 3OTOI 3M6AA 4JI7I 4IZJD 2B7VA 4YHHI 1J5EI 3T1YI 4DV0I 2EWLA 1ZXNA 2R3VA 2N3GA 2IHR1 4JI6E 2UUAE 1MX0A 1RREA 1FWKA 1Y4SA 1K47A 1USUA 5FLXQ 1QU6A 2NPFA 2A2CA 4DR2I 3FIGA 3B82A 4DR4E 2JOXA 4DKKA 1YYWA 4NXMI 4IZJA 4WUBA 5IWAI 2O1WA 3PYGA 4WUDA 4DUYE 4DV6I 1YYKA 2RS7A 1IBMI 1Z0CA 2ZM6E 3PRYA 4AQYI 3Q1QA 5FLXC 4FWGA 4GKJI 1N32E 4LF5E 4MYTA 1ZBTA 4JI8I 2MC6A 4WPYA 4LF6I 2GS8A 2ZBKB 4DR6I 1ZM9A 1N34I 4JG4A 4DR3I 1EI1A 4RPFA 1DQ3A 4FW9A 4UTGA 4XTJA 3J80Q 2O1UA 5F3WA 1N33E 4FWHA 4F9BB 4M2ZA 4JI4I 4DV4I 4JI6I 2L8TA 2UUAI 2LJHA 4LFBI 2DMYA 4DPYA 4DR4I 3JTZA 3ZZ0A 2XEXA 2V85A 3LPSA 1KTVA 2LTRA 2JVAA 1H74A 4R1FA 4P7AA 2K4VA 4J8ZA 4EMDA 4URLA 4DUYI 3DF6A 3Q6MA 5L3JA 2L6MA 1XMOE 2ZM6I 3OMLA 1N32I 4LF5I 3P1XA 5GMDA 2Z5BA 2FGGA 4JI2E 2VQFE 2JWOA 4B3TE 4DPUA 1Z0VA 2MC5A 4K0KE 4B3RE 1Y6ZA 3LLHA 4BCAA 2WW4A 2NUFA 2L2KB 4BC7A 1DI2A 1WUUA 4BBYA 4KZSA 1N33I 2KHXA 2BV3A 1KIJA 4LF7E 5GMEA 1N0UA 1I94I 1MU5A 5LMNI 3J7Yp 2N3HA 2HFSA 5LMUE 2LTSA 1UEKA 1ZM3A 4DU8A 4DV2E 2B7TA 4P78A 2CPNA 3JAMC 4M0VA 4JI8E 3QT5A 2DEJA 3Q6NA 4LF4E 2OI2A 4ZVIA 1XMOI 5A2QQ 4Z7CA 2V34A 4JV5E 1T4LB 4X66E 2FV4B 2LBSB 2M7QA 2EFGA 1B62A 2AJ4A 1STUA 1HR0E 3B78A 4JI2I 2VQEE 3ADGA 4NXNE 3ADIA 2VQFI 3HQ1A 2BM1A 4B3TI 3WU4A 3IWDA 2PNMA 1H73A 3ZKDA 4PRXA 4JI4E 4B3RI 4K0KI 4DV4E 3T1HE 2MDRA 3LTOA 4LFBE 3QT8A 4F9CB 4M1KA 1IBLE 2ZITA 1IBKE 1YZ9A 4LF7I 5IT9Q 1HK7A 1RC7A 2DEIA 2BM0A 1HNWE 4JYAE 1XNQE 1NHHA 5LMUI 1Y4UA 4P52A 2R42A 3IWBA 4DV2I 1H72C 2CZ9A 4DUZI 3H09A 3AV0A 4HXZA 2L2NA 4TUGA 4DV7E 1XHKA 4WFTA 1RQ0A 4KHPE 1SR9A 2LUQA 4IZJB 4LF4I 3C4TA 4JV5I 2HKEA 2UXDE 3CWVA 4X66I 2V8QB 4B3ME 1Z0GA 1HR0I 1NZ0A 2VQEI 4NXNI 3ZOQB 3AUZA 2E5LE 3MSWA 4DV1E 2O1TA 1OJ4A 4OOGC 2V88A 5AE3A 2VE7C 3T1HI 1I94E 5LMNE 4JI1E 4DPTA 4PRVA 1Z59A 1Z0BA 3V5RA 2F4VE 1IBLI 2UU9E 1Z0WA 1FWLA 1D6TA 1IBKI 4JI3E 3J81Q 1X48A 3J80C 2V87A 1XNRE 1PKPA 1HNWI 4JYAI 1QZRA 1XNQI 3ZZTA 4JI0E 4HACA 2HFUA 3C4BA 1NHJA 3PYDA 2HK2A 3K85A 1B63A 1GZ6A 3IWCA 5CFFE 4DV7I 2UUBE 4F54A 1FI4A 4OX9E 1EA6A 2RTXA 4KHPI 3HULA 4USMA 2G7HA 2UXCE 2RSMA 2UXDI 4LFAI 1X47A 1A6FA 4B3MI 4DR5E 2RS6A 1N34E 2JY9A 3HPZA 4R8OA 2A2DA 5BR8E 1PIEA 2KONA 1T4OA 4L5NC 2E5LI 3D4JA 4DV1I 4HY1A 2GQ0A 4M30A 2Z5BB 4N3OA 2Z5CA 5AASA 2LUPB 1ZXMA 2UUCE 1WXRA 3J7AM 2YZTA 4JI1I 1WHNA 3K1JA 2LMZA 4USKA 2F4VI 2HK3A 2UU9I 5AE2A 1HNXE 2H36X 4JI3I 4DUZE 2IOQA 4X65E 1XNRI 1Z5CA 2V2QA 4JI0I 1YYOA 4X8WA 4DR7E 1WHQA 4IZKA 3RMPA 2UUBI 2V2ZA 4OX9I 3LMLA 1HNZE 2X7IA 3HJCA 2UXCI 4DU7A 1N36E 4KQVA 4MYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYX A;  5BR8 I;  3ADJ A;  5A2Q C;  1J26 A;  1N0V C;  1O0W A;  1FKA E;  1H7S A;  1VIS A;  4UT4 A;  1BKN A;  2UXB E;  2UUC I;  2DIX A;  3QT6 A;  4LFC E;  4ED4 A;  4GKK E;  5LL6 R;  2NUG A;  1HNX I;  4X64 E;  2V8P A;  1FJG E;  4X65 I;  4LF8 E;  3J7A G;  2EZ6 A;  1NHI A;  3V2U C;  5IT9 C;  3HTX A;  4PU9 A;  4X62 E;  1DAR A;  4DR7 I;  4WYQ B;  4LFA E;  1FNM A;  1ZM4 A;  3K17 A;  1KVK A;  4DPW A;  4YY3 E;  1X49 A;  1HNZ I;  1N36 I;  1MG7 A;  4DR1 E;  3ADL A;  4FN5 A;  1S4E A;  4DPX A;  4DV3 E;  1KKH A;  2UXB I;  4DR5 I;  1T4N A;  3WU3 A;  2L2M A;  2Q2E B;  4LFC I;  1H7U A;  2VF3 A;  4GKK I;  2V2V A;  1XMQ E;  3GON A;  2HKJ A;  2X36 A;  2YT4 A;  4B3S E;  2HHH E;  4X64 I;  1Z5A A;  4I3H A;  1FJG I;  1EKZ A;  3LNU A;  4LF8 I;  2J7K A;  3J81 C;  1ELO A;  4X62 I;  1UIL A;  4LF9 E;  3PYF A;  4JI5 E;  4HAC B;  4DXL A;  1ZM2 A;  3VYY A;  3B8H A;  4YY3 I;  4DV5 E;  3ZM7 A;  2L3C A;  2NA2 A;  4DR1 I;  3OTO E;  1RR9 A;  4JI7 E;  4Z7Y A;  3ZKB A;  4YHH E;  2LJP A;  1J5E E;  3T1Y E;  4DV0 E;  4DV3 I;  2B3T B;  2LRS A;  3WU5 A;  2NUE A;  4WUC A;  1PVG A;  1Z5B A;  4DR2 E;  1XMQ I;  4FWD A;  3JAM Q;  1UHZ A;  3ZZU A;  2L3J A;  4B3S I;  4NXM E;  4HYM A;  2HHH I;  5IWA E;  1S16 A;  4DV6 E;  1GQE A;  1Z0E A;  1IBM E;  3QT7 A;  3PYE A;  2DB2 A;  4LF9 I;  4AQY E;  3WU6 A;  4GKJ E;  1Z0T A;  4JI5 I;  2E1R A;  4LF6 E;  4DV5 I;  1U2R A;  4DR6 E;  3H4L A;  2L33 A;  4DR3 E;  3F0N A;  3OTO I;  3M6A A;  4JI7 I;  2B7V A;  4YHH I;  1J5E I;  3T1Y I;  4DV0 I;  1ZXN A;  2R3V A;  2N3G A;  2IHR 1;  4JI6 E;  2UUA E;  1MX0 A;  1RRE A;  1FWK A;  1K47 A;  5FLX Q;  1QU6 A;  2NPF A;  2A2C A;  4DR2 I;  3B82 A;  4DR4 E;  4DKK A;  1YYW A;  4NXM I;  4WUB A;  5IWA I;  3PYG A;  4WUD A;  4DUY E;  4DV6 I;  1YYK A;  2RS7 A;  1IBM I;  1Z0C A;  2ZM6 E;  4AQY I;  3Q1Q A;  5FLX C;  4FWG A;  4GKJ I;  1N32 E;  4LF5 E;  4MYT A;  1ZBT A;  4JI8 I;  4LF6 I;  2GS8 A;  2ZBK B;  4DR6 I;  1ZM9 A;  1N34 I;  4JG4 A;  4DR3 I;  1EI1 A;  4RPF A;  4FW9 A;  4UTG A;  4XTJ A;  3J80 Q;  1N33 E;  4FWH A;  4M2Z A;  4JI4 I;  4DV4 I;  4JI6 I;  2UUA I;  2LJH A;  4LFB I;  2DMY A;  4DPY A;  4DR4 I;  3ZZ0 A;  2XEX A;  3LPS A;  1KTV A;  2LTR A;  2JVA A;  1H74 A;  4R1F A;  4P7A A;  4EMD A;  4URL A;  4DUY I;  5L3J A;  1XMO E;  2ZM6 I;  1N32 I;  4LF5 I;  3P1X A;  5GMD A;  4JI2 E;  2VQF E;  4B3T E;  4DPU A;  1Z0V A;  4K0K E;  4B3R E;  3LLH A;  2WW4 A;  2NUF A;  2L2K B;  1DI2 A;  1WUU A;  1N33 I;  2KHX A;  2BV3 A;  1KIJ A;  4LF7 E;  5GME A;  1N0U A;  1I94 I;  1MU5 A;  5LMN I;  3J7Y p;  2N3H A;  2HFS A;  5LMU E;  2LTS A;  1UEK A;  1ZM3 A;  4DU8 A;  4DV2 E;  2B7T A;  2CPN A;  3JAM C;  4JI8 E;  3QT5 A;  2DEJ A;  4LF4 E;  2OI2 A;  4ZVI A;  1XMO I;  5A2Q Q;  4Z7C A;  2V34 A;  4JV5 E;  1T4L B;  4X66 E;  2LBS B;  2EFG A;  1B62 A;  2AJ4 A;  1STU A;  1HR0 E;  3B78 A;  4JI2 I;  2VQE E;  3ADG A;  4NXN E;  3ADI A;  2VQF I;  2BM1 A;  4B3T I;  3WU4 A;  1H73 A;  3ZKD A;  4PRX A;  4JI4 E;  4B3R I;  4K0K I;  4DV4 E;  3T1H E;  2MDR A;  3LTO A;  4LFB E;  3QT8 A;  4M1K A;  1IBL E;  2ZIT A;  1IBK E;  1YZ9 A;  4LF7 I;  5IT9 Q;  1RC7 A;  2DEI A;  2BM0 A;  1HNW E;  4JYA E;  1XNQ E;  1NHH A;  5LMU I;  4P52 A;  2R42 A;  4DV2 I;  1H72 C;  2CZ9 A;  4DUZ I;  4HXZ A;  2L2N A;  4DV7 E;  1XHK A;  4WFT A;  1RQ0 A;  4KHP E;  2LUQ A;  4LF4 I;  3C4T A;  4JV5 I;  2HKE A;  2UXD E;  3CWV A;  4X66 I;  4B3M E;  1Z0G A;  1HR0 I;  1NZ0 A;  2VQE I;  4NXN I;  2E5L E;  4DV1 E;  1OJ4 A;  4OOG C;  3T1H I;  1I94 E;  5LMN E;  4JI1 E;  4DPT A;  4PRV A;  1Z59 A;  1Z0B A;  3V5R A;  2F4V E;  1IBL I;  2UU9 E;  1Z0W A;  1FWL A;  1D6T A;  1IBK I;  4JI3 E;  3J81 Q;  1X48 A;  3J80 C;  1XNR E;  1PKP A;  1HNW I;  4JYA I;  1QZR A;  1XNQ I;  3ZZT A;  4JI0 E;  4HAC A;  2HFU A;  3C4B A;  1NHJ A;  3PYD A;  2HK2 A;  1B63 A;  5CFF E;  4DV7 I;  2UUB E;  1FI4 A;  4OX9 E;  1EA6 A;  2RTX A;  4KHP I;  3HUL A;  4USM A;  2UXC E;  2RSM A;  2UXD I;  4LFA I;  1X47 A;  1A6F A;  4B3M I;  4DR5 E;  2RS6 A;  1N34 E;  2JY9 A;  2A2D A;  5BR8 E;  1PIE A;  1T4O A;  2E5L I;  3D4J A;  4DV1 I;  4HY1 A;  4M30 A;  2LUP B;  1ZXM A;  2UUC E;  3J7A M;  4JI1 I;  1WHN A;  3K1J A;  4USK A;  2F4V I;  2HK3 A;  2UU9 I;  1HNX E;  4JI3 I;  4DUZ E;  4X65 E;  1XNR I;  1Z5C A;  2V2Q A;  4JI0 I;  1YYO A;  4X8W A;  4DR7 E;  1WHQ A;  2UUB I;  2V2Z A;  4OX9 I;  1HNZ E;  2X7I A;  2UXC I;  4DU7 A;  1N36 E;  4KQV A;  4MYU A; 
#chains in the Genus database with same CATH topology
 3VYX A;  1YHC A;  5BR8 I;  3ADJ A;  2C39 A;  4J3D A;  2V89 A;  3DJW A;  5A2Q C;  2NN6 D;  1J26 A;  1N0V C;  1O0W A;  2DLK A;  2KOU A;  1FKA E;  2JOB A;  2YSO A;  1H7S A;  5JEA F;  1VIS A;  4UT4 A;  2EM7 A;  2VES A;  1A1L A;  4O24 A;  1BKN A;  3C6M A;  2WBT A;  3L7Z B;  2UXB E;  2ODR D;  3P06 A;  2YTO A;  2UUC I;  2DIX A;  2EOY A;  3QT6 A;  4LFC E;  3BF2 A;  4ED4 A;  4GKK E;  5JEA C;  5LL6 R;  2NUG A;  2EM9 A;  3ECR A;  3M99 B;  3UHM A;  2I9I A;  1YUI A;  4BMJ A;  2PNL A;  3P3G A;  2DSY A;  1JK1 A;  4LU9 A;  1HNX I;  4X64 E;  2V8P A;  1FJG E;  1UDO A;  4X65 I;  4LF8 E;  1T39 A;  3J7A G;  2EZ6 A;  1NHI A;  3HXL A;  2CSH A;  3V2U C;  1A1K A;  5IT9 C;  1F2I G;  2C37 B;  1P47 A;  2JR1 A;  3HTX A;  4PU9 A;  2EE8 A;  4DMI A;  4X62 E;  2VF1 A;  4WSP A;  1DAR A;  5DRQ A;  4AID A;  4DR7 I;  2RSI A;  4WYQ B;  4LFA E;  5FWK A;  2EOX A;  2WBS A;  1FNM A;  2F8B A;  2V86 A;  1ZM4 A;  5A6K A;  2YTN A;  3K17 A;  5K36 D;  2EM4 A;  1DGC A;  1KVK A;  1P42 A;  1G2F C;  2YTE A;  3THN A;  4DPW A;  4YY3 E;  1X49 A;  1HNZ I;  2YTJ A;  2EN1 A;  2GHF A;  4TUI A;  1N36 I;  2GPI A;  1MG7 A;  2JT2 A;  5AE1 A;  4DR1 E;  4MU3 A;  2O1V A;  3ADL A;  2EN8 A;  2BA1 G;  4FN5 A;  1S4E A;  4DPX A;  3EQ1 A;  4DV3 E;  2I13 A;  4F6N A;  2PNZ A;  4NBQ A;  2B9D A;  2C38 A;  4BC9 A;  5K36 A;  1KKH A;  2UXB I;  4DR5 I;  2IOP A;  4R03 A;  1T4N A;  3WU3 A;  2L2M A;  2EM8 A;  2Q2E B;  4IS9 A;  4LFC I;  1H7U A;  3HPS A;  2PO1 A;  2VF3 A;  2V83 A;  4GKK I;  2V2V A;  3F6G A;  1XMQ E;  5TSE A;  3GON A;  5DNY A;  2HKJ A;  2X36 A;  4RHB B;  4AIM A;  2YT4 A;  4ZYH A;  2FTX B;  4R2Q A;  2EMY A;  1YPN A;  4Q28 A;  4B3S E;  2LE2 A;  2HHH E;  4X64 I;  1Z5A A;  4I3H A;  1FJG I;  2EPP A;  1ZBQ A;  2YWQ A;  5A69 A;  1EKZ A;  3BID A;  3LNU A;  4LF8 I;  1YFH A;  2J7K A;  3J81 C;  1ELO A;  4X62 I;  1UIL A;  4LF9 E;  2NN6 F;  3F6H A;  3PYF A;  4Q35 B;  5ADZ A;  5C0X D;  2JEA A;  4JI5 E;  1KYQ A;  1X6F A;  4HAC B;  2PO0 B;  4DXL A;  4BA2 A;  4IFD D;  1ZM2 A;  3PS2 A;  2EOZ A;  3VYY A;  3B8H A;  2NAB A;  4YY3 I;  2NN6 C;  4DV5 E;  4OZE A;  4OO1 A;  1A1G A;  2LV2 A;  3JU0 A;  2YTD A;  1B69 A;  4R2S A;  1ZAA C;  3ZM7 A;  2L3C A;  2NA2 A;  3P3C A;  4DR1 I;  3OTO E;  1RR9 A;  4JI7 E;  2ODR C;  4LPF A;  4Z7Y A;  2EPL X;  2JP9 A;  3ZKB A;  2VRD A;  4GEQ B;  4YHH E;  4F6M A;  1J5E E;  3T1Y E;  4DV0 E;  2LJP A;  4DV3 I;  1Z1B A;  2B3T B;  3K6Q A;  5C0X A;  4GQU A;  2EOM A;  2BR2 A;  2LRS A;  1ZR9 A;  2EMX A;  1USV A;  3WU5 A;  2EOI A;  4O43 A;  1QNT A;  2NUE A;  3GCM A;  5T6J A;  1PVG A;  1Z5B A;  4WUC A;  4P7D A;  1PDA A;  4DR2 E;  2Z5C B;  4FWD A;  4QNJ A;  3JAM Q;  1XMQ I;  4M9V C;  1UHZ A;  4ISA A;  3ZZU A;  2L3J A;  4B3S I;  1UDN A;  4NXM E;  2EOJ A;  1JK2 A;  1AAY A;  4HYM A;  4ZYG A;  4U3B A;  5IWA E;  2HHH I;  4LCF A;  2RPC A;  4LTY A;  4BA1 A;  2CT1 A;  1S16 A;  2WCC 3;  1EH8 A;  4DV6 E;  1GQE A;  2YPN A;  1Z0E A;  3P76 A;  3PS3 A;  4FW5 A;  1IBM E;  2E1M A;  3QT7 A;  3PYE A;  2DB2 A;  1Y60 A;  4FW7 A;  4L8N A;  4LF9 I;  4AQY E;  2WZO A;  1L4S A;  4GKJ E;  5AC5 A;  3WU6 A;  3KWR A;  2Z5E A;  4MU4 A;  1Z0T A;  4I8O A;  2JXP A;  2EQ1 A;  2E1R A;  2HGH A;  4JI5 I;  2DLQ A;  3VK6 A;  2M4I A;  2EM3 A;  4R2D A;  2CGE A;  2CG9 A;  4LF6 E;  2IES A;  4MU1 A;  1U2R A;  4DV5 I;  4F9A B;  4DR6 E;  2EMB A;  3QG5 C;  4IZK B;  3H4L A;  2L92 A;  4BS9 A;  2EMK A;  2L33 A;  2M1S A;  4DR3 E;  2EM6 A;  2LCE A;  4FW3 A;  3F0N A;  3OTO I;  3M6A A;  4DV7 I;  4JI7 I;  4IZJ D;  2LVH A;  2B7V A;  4FW4 A;  2LT7 A;  2J65 A;  4YHH I;  1J5E I;  4FK5 C;  4DV0 I;  2EWL A;  3T1Y I;  1A1H A;  3EPK A;  2EJ4 A;  2C39 B;  1YUJ A;  1ZXN A;  2R3V A;  2N3G A;  2IHR 1;  4JI6 E;  1EH7 A;  2UUA E;  1MX0 A;  1RRE A;  1FWK A;  2YRM A;  1KJK A;  1A1I A;  2EP3 A;  1K47 A;  1R6L A;  1USU A;  1Y4S A;  1QU6 A;  5FLX Q;  2NPF A;  2CTD A;  2RQL A;  2A2C A;  3FIG A;  2HJJ A;  3B82 A;  4DR2 I;  2EM2 A;  4DR4 E;  2WBU A;  4IFD F;  2JOX A;  4DKK A;  2BA0 D;  1YYW A;  2C37 A;  4IZJ A;  4WUB A;  2ELY A;  4NXM I;  4FW6 A;  5IWA I;  2O1W A;  3PYG A;  4WUD A;  1GTK A;  2LO3 A;  4DUY E;  4DV6 I;  1WRJ A;  1YYK A;  2EL5 A;  2RS7 A;  4IFD C;  1IBM I;  1Z0C A;  2GLI A;  2EL4 A;  2ZM6 E;  2MKD A;  1BBG A;  2NN6 B;  3VHT B;  3PRY A;  3P3E A;  4AQY I;  1RMD A;  3Q1Q A;  5FLX C;  4FWG A;  4GKJ I;  4MLV A;  1N32 E;  4LF5 E;  2R76 A;  4MYT A;  1ZBT A;  4JI8 I;  2MC6 A;  1UDQ A;  1ZU1 A;  2EMG A;  4WPY A;  4LF6 I;  2IER A;  1BBO A;  1PJQ A;  2GS8 A;  2ZBK B;  2YRH A;  4DR6 I;  1ZM9 A;  3U1K A;  2PO2 B;  1N34 I;  4JG4 A;  4DR3 I;  2NN6 E;  2D9H A;  1EI1 A;  2ENC A;  4HTG A;  1OYS A;  4RPF A;  2EMC A;  4N4R B;  3M7N G;  1DQ3 A;  2EQ3 A;  4FW9 A;  4UTG A;  4XTJ A;  1UN6 B;  3J80 Q;  4LOM A;  2O1U A;  5F3W A;  1OYP A;  1N33 E;  4FWH A;  4F9B B;  5DRR A;  3H1C A;  4O5G A;  4M2Z A;  4JI4 I;  2WNR B;  4OO1 D;  3THO B;  4DV4 I;  4JI6 I;  2L8T A;  2UUA I;  2DRP A;  2PNZ B;  2LJH A;  1X5W A;  2C38 B;  2JE6 A;  5ELW A;  4LFB I;  3KZY A;  2EN6 A;  2DMY A;  5K36 B;  2YTG A;  4DPY A;  4LCH A;  4DR4 I;  3JTZ A;  3ZZ0 A;  1TF6 A;  3EPL A;  2V85 A;  2XEX A;  3LPS A;  1KTV A;  2LTR A;  2PO1 B;  5DRO A;  1WJP A;  2JVA A;  1H74 A;  4R1F A;  4P7A A;  2K4V A;  4O4K A;  4J8Z A;  4EMD A;  4URL A;  4DUY I;  3DF6 A;  3Q6M A;  5L3J A;  2L6M A;  2EM5 A;  3KRN A;  2EMZ A;  2J7J A;  1XMO E;  2ZM6 I;  5K36 E;  2EOS A;  4MLQ A;  2MKN A;  3OML A;  1TF3 A;  2WP8 A;  1X3C A;  1A1F A;  1MEY C;  1N32 I;  4LF5 I;  2JEB B;  4WX9 A;  3MHH C;  3P1X A;  5GMD A;  2Z5B A;  1SFE A;  2FGG A;  4JI2 E;  2GO4 A;  2VQF E;  4BHC A;  2JWO A;  4B3T E;  4DPU A;  1UBD C;  1Z0V A;  2JEA B;  1LLM C;  2EOF A;  5JEA A;  4BA2 B;  5AC4 A;  2MC5 A;  2DMI A;  4B3R E;  4K0K E;  3LLH A;  1Y6Z A;  3NZK A;  4BCA A;  2WW4 A;  2NUF A;  4OO1 B;  2L2K B;  2BA1 D;  4BC7 A;  1DI2 A;  1WUU A;  1IQO A;  4BBY A;  5K36 F;  4KZS A;  2CVE A;  1N33 I;  2KHX A;  2BV3 A;  3PS1 A;  1KIJ A;  4LF7 E;  5GME A;  4ZYE A;  2YU5 A;  1N0U A;  3BBG A;  1NCS A;  1E3H A;  1I94 I;  1MU5 A;  5LMN I;  2A25 A;  2EOO A;  3J7Y p;  5K36 C;  2N3H A;  2LJU A;  5LMU E;  2HFS A;  2LTS A;  5C0X B;  5KL6 A;  3M85 D;  2EPR A;  4RH8 A;  4IS1 C;  2BR2 B;  4IFD B;  1UEK A;  3EPH A;  1ZM3 A;  4DU8 A;  4DV2 E;  2B7T A;  2EPO A;  4P78 A;  4WXD A;  2CPN A;  1EH6 A;  4WSG A;  3JAM C;  4M0V A;  4JI8 E;  3QT5 A;  2DEJ A;  3Q6N A;  4LF4 E;  2OI2 A;  4ZVI A;  1XMO I;  5A2Q Q;  4Z7C A;  4R2C A;  4JV5 E;  2V34 A;  4BA1 B;  5C0X E;  1T4L B;  4IFD E;  2EPC A;  3GLL A;  5DNL A;  4X66 E;  2F1D A;  2FV4 B;  2LBS B;  2M7Q A;  2EFG A;  1B62 A;  2AJ4 A;  1STU A;  1HR0 E;  3B78 A;  3L7Z A;  4JI2 I;  2VQE E;  1XXE A;  3ADG A;  4NXN E;  3ADI A;  2VQF I;  4OO1 F;  3HQ1 A;  2BM1 A;  3EPJ A;  2BBG A;  4B3T I;  1TN9 A;  3WU4 A;  3IWD A;  2PNM A;  1H73 A;  3ZKD A;  4PRX A;  2YTI A;  4JI4 E;  4R2E A;  4B3R I;  4K0K I;  4DV4 E;  4R2R A;  3T1H E;  4OO1 C;  2MDR A;  3LTO A;  5EKW A;  4LFB E;  3QT8 A;  2EOE A;  5A6A A;  4F9C B;  4NZV A;  4M1K A;  5C0X F;  5KL4 A;  3B4T A;  1IBL E;  2ZIT A;  2K7I A;  1IBK E;  1YZ9 A;  4LF7 I;  5IT9 Q;  3HKM A;  1HK7 A;  1RC7 A;  2DEI A;  2BM0 A;  1HNW E;  4JYA E;  1XNQ E;  2EMF A;  2JPA A;  4OKG A;  4AM3 A;  1NHH A;  5KL7 A;  5C0X C;  5LMU I;  2EOQ A;  2JYA A;  1Y4U A;  1UDS A;  4P52 A;  2EMA A;  2R42 A;  4MU0 A;  3U1Y A;  4MDT A;  3IWB A;  4DV2 I;  3L00 A;  1H72 C;  2CZ9 A;  4DUZ I;  3H09 A;  2NN6 A;  3AV0 A;  4IJD A;  4HXZ A;  2L2N A;  4TUG A;  4DV7 E;  1XHK A;  1MGT A;  4WFT A;  1RQ0 A;  4KHP E;  1SR9 A;  2LUQ A;  4IZJ B;  4LF4 I;  1RHY A;  3C4T A;  4JV5 I;  2HKE A;  2UXD E;  3CWV A;  4U3D A;  5KL2 A;  2AE8 A;  4X66 I;  2EN7 A;  2V8Q B;  4B3M E;  1Z0G A;  2YTP A;  2PO2 A;  2EN4 A;  1HR0 I;  1NZ0 A;  5KL3 A;  2VQE I;  4NXN I;  2EM0 A;  3ZOQ B;  3AUZ A;  2E5L E;  3MSW A;  4DV1 E;  2O1T A;  4NHR A;  2EML A;  1OJ4 A;  4OOG C;  1PJT A;  2V88 A;  1E3P A;  1IMU A;  5AE3 A;  2VE7 C;  2O3Z A;  3T1H I;  4GZN C;  1I94 E;  5LMN E;  4JI1 E;  2WNR A;  3DD6 A;  4ZYD A;  4DPT A;  3GME A;  2E72 A;  4PRV A;  1Z59 A;  1Z0B A;  3V5R A;  1NEI A;  4R2A A;  2F4V E;  1IBL I;  2UU9 E;  1Z0W A;  1FWL A;  2EPA A;  2N8X A;  1D6T A;  1IBK I;  5A6J A;  4JI3 E;  1X48 A;  3J81 Q;  3J80 C;  2EN2 A;  2V87 A;  1YSA C;  5JEA D;  1XNR E;  1PKP A;  1HNW I;  4JYA I;  1QZR A;  1XNQ I;  3CDJ A;  3ZZT A;  3M85 G;  4WXC A;  4JI0 E;  4HAC A;  4LCG A;  2HFU A;  2PO0 A;  3C6K A;  3KZZ A;  3C4B A;  2YU8 A;  4R2P A;  4MQY A;  1NHJ A;  2JE6 B;  2YTQ A;  3PYD A;  2EPK X;  2HK2 A;  3CDI A;  5DNX A;  3TQM A;  5DRP A;  3K85 A;  1B63 A;  1GZ6 A;  3IWC A;  2EOR A;  5CFF E;  2EL6 A;  2ENH A;  4F54 A;  2UUB E;  4OX9 E;  1FI4 A;  3BGH A;  2JEB A;  1EA6 A;  2RTX A;  4QNK A;  4KHP I;  3HUL A;  4USM A;  2G7H A;  2R1F A;  1BB8 A;  2UXC E;  2BB8 A;  2RSM A;  2UXD I;  4LFA I;  1X47 A;  2YTF A;  1A1J A;  5IXM B;  1A6F A;  4B3M I;  2ADR A;  2RS6 A;  4DR5 E;  2JY9 A;  3HPZ A;  1N34 E;  4R8O A;  1R6M A;  2A2D A;  5BR8 E;  1PIE A;  2ENA A;  1YH8 A;  2EOH A;  1T4O A;  2EPN A;  2KON A;  2WP8 B;  4L5N C;  2E5L I;  3D4J A;  4DV1 I;  2EPM X;  4HY1 A;  1X6H A;  2GQ0 A;  2MDG A;  2EMH A;  4M30 A;  2Z5B B;  4N3O A;  2Z5C A;  5AAS A;  2LUP B;  1ZXM A;  5IV8 B;  2UUC E;  1N3G A;  5LLQ A;  2M9A A;  1WXR A;  3M7N D;  4HEI A;  3J7A M;  2YZT A;  5KL5 A;  4JI1 I;  5EL9 A;  5A6B D;  1WHN A;  5JEA B;  4OO1 E;  3K1J A;  1AH5 A;  1PJS A;  1X6E A;  2LMZ A;  2BA0 G;  2HK3 A;  4USK A;  2F4V I;  2UU9 I;  2YRK A;  2EN3 A;  3MHS C;  5AE2 A;  1HNX E;  2EPU A;  2H36 X;  4JI3 I;  2EPZ A;  4X9J A;  4KWY A;  4IFD A;  4BHB A;  4DUZ E;  2IOQ A;  2Q8U A;  4X65 E;  2PRT A;  1XNR I;  1Z5C A;  2ELZ A;  3UK3 C;  2V2Q A;  2EMI A;  4JI0 I;  1YYO A;  4X8W A;  1OYR A;  5JEA E;  4DR7 E;  1G2D C;  1WHQ A;  2HC5 A;  1T38 A;  2GO3 A;  4IZK A;  3RMP A;  5A6B A;  2EMW A;  2UUB I;  2V2Z A;  4OX9 I;  1Y5Y A;  3LML A;  2DGC A;  1HNZ E;  2X7I A;  3HJC A;  2YSP A;  2EQ0 A;  2UXC I;  4F2J C;  1VI7 A;  2EPX A;  4DU7 A;  1N36 E;  4KQV A;  4MYU A;  1IQS A; 
#chains in the Genus database with same CATH homology
 3VYX A;  5BR8 I;  3ADJ A;  2V89 A;  3DJW A;  5A2Q C;  1J26 A;  1N0V C;  1O0W A;  2KOU A;  1FKA E;  2JOB A;  1H7S A;  1VIS A;  4UT4 A;  1BKN A;  2UXB E;  2ODR D;  3P06 A;  2UUC I;  2DIX A;  3QT6 A;  4LFC E;  4ED4 A;  4GKK E;  5LL6 R;  2NUG A;  4BMJ A;  2PNL A;  2DSY A;  4LU9 A;  1HNX I;  4X64 E;  2V8P A;  1FJG E;  4X65 I;  4LF8 E;  3J7A G;  2EZ6 A;  1NHI A;  3HXL A;  3V2U C;  5IT9 C;  2JR1 A;  3HTX A;  4PU9 A;  4X62 E;  4DMI A;  1DAR A;  2VF1 A;  4WSP A;  4DR7 I;  4WYQ B;  4LFA E;  5FWK A;  1FNM A;  2F8B A;  2V86 A;  1ZM4 A;  3K17 A;  1KVK A;  4DPW A;  4YY3 E;  1X49 A;  1HNZ I;  4TUI A;  1N36 I;  1MG7 A;  5AE1 A;  4DR1 E;  2O1V A;  3ADL A;  4FN5 A;  1S4E A;  4DPX A;  4DV3 E;  2B9D A;  4BC9 A;  1KKH A;  2UXB I;  4DR5 I;  2IOP A;  4R03 A;  1T4N A;  3WU3 A;  2L2M A;  2Q2E B;  4LFC I;  1H7U A;  3HPS A;  2VF3 A;  2V83 A;  4GKK I;  2V2V A;  3F6G A;  1XMQ E;  3GON A;  5DNY A;  2HKJ A;  2X36 A;  2YT4 A;  2FTX B;  4B3S E;  4Q28 A;  2LE2 A;  2HHH E;  4X64 I;  1Z5A A;  4I3H A;  1FJG I;  1ZBQ A;  1EKZ A;  3LNU A;  4LF8 I;  2J7K A;  3J81 C;  1ELO A;  4X62 I;  1UIL A;  4LF9 E;  3F6H A;  3PYF A;  5ADZ A;  4JI5 E;  4HAC B;  4DXL A;  1ZM2 A;  3VYY A;  3B8H A;  4YY3 I;  4DV5 E;  3JU0 A;  3ZM7 A;  2L3C A;  2NA2 A;  4DR1 I;  3OTO E;  1RR9 A;  4JI7 E;  2ODR C;  4Z7Y A;  3ZKB A;  4GEQ B;  4YHH E;  2LJP A;  1J5E E;  3T1Y E;  4DV0 E;  4DV3 I;  2B3T B;  3K6Q A;  2LRS A;  1USV A;  3WU5 A;  2NUE A;  5T6J A;  1PVG A;  1Z5B A;  4WUC A;  4P7D A;  4DR2 E;  4FWD A;  2Z5C B;  3JAM Q;  1XMQ I;  1UHZ A;  3ZZU A;  2L3J A;  4B3S I;  4NXM E;  4HYM A;  2HHH I;  5IWA E;  4LTY A;  1S16 A;  4DV6 E;  1GQE A;  1Z0E A;  1IBM E;  2E1M A;  3QT7 A;  3PYE A;  2DB2 A;  4LF9 I;  4L8N A;  4AQY E;  2WZO A;  3WU6 A;  4GKJ E;  3KWR A;  2Z5E A;  1Z0T A;  4I8O A;  4JI5 I;  2E1R A;  3VK6 A;  2M4I A;  2CGE A;  2CG9 A;  4LF6 E;  4DV5 I;  1U2R A;  4F9A B;  4DR6 E;  4IZK B;  3H4L A;  2L92 A;  4BS9 A;  2L33 A;  4DR3 E;  2M1S A;  3F0N A;  3OTO I;  3M6A A;  4JI7 I;  4IZJ D;  2B7V A;  4YHH I;  1J5E I;  3T1Y I;  4DV0 I;  2EWL A;  1ZXN A;  2R3V A;  2N3G A;  2IHR 1;  4JI6 E;  2UUA E;  1MX0 A;  1RRE A;  1FWK A;  1Y4S A;  1K47 A;  1USU A;  5FLX Q;  1QU6 A;  2NPF A;  2A2C A;  4DR2 I;  3FIG A;  3B82 A;  4DR4 E;  2JOX A;  4DKK A;  1YYW A;  4NXM I;  4IZJ A;  4WUB A;  5IWA I;  2O1W A;  3PYG A;  4WUD A;  4DUY E;  4DV6 I;  1YYK A;  2RS7 A;  1IBM I;  1Z0C A;  2ZM6 E;  3PRY A;  4AQY I;  3Q1Q A;  5FLX C;  4FWG A;  4GKJ I;  1N32 E;  4LF5 E;  4MYT A;  1ZBT A;  4JI8 I;  2MC6 A;  4WPY A;  4LF6 I;  2GS8 A;  2ZBK B;  4DR6 I;  1ZM9 A;  1N34 I;  4JG4 A;  4DR3 I;  1EI1 A;  4RPF A;  1DQ3 A;  4FW9 A;  4UTG A;  4XTJ A;  3J80 Q;  2O1U A;  5F3W A;  1N33 E;  4FWH A;  4F9B B;  4M2Z A;  4JI4 I;  4DV4 I;  4JI6 I;  2L8T A;  2UUA I;  2LJH A;  4LFB I;  2DMY A;  4DPY A;  4DR4 I;  3JTZ A;  3ZZ0 A;  2XEX A;  2V85 A;  3LPS A;  1KTV A;  2LTR A;  2JVA A;  1H74 A;  4R1F A;  4P7A A;  2K4V A;  4J8Z A;  4EMD A;  4URL A;  4DUY I;  3DF6 A;  3Q6M A;  5L3J A;  2L6M A;  1XMO E;  2ZM6 I;  3OML A;  1N32 I;  4LF5 I;  3P1X A;  5GMD A;  2Z5B A;  2FGG A;  4JI2 E;  2VQF E;  2JWO A;  4B3T E;  4DPU A;  1Z0V A;  2MC5 A;  4K0K E;  4B3R E;  1Y6Z A;  3LLH A;  4BCA A;  2WW4 A;  2NUF A;  2L2K B;  4BC7 A;  1DI2 A;  1WUU A;  4BBY A;  4KZS A;  1N33 I;  2KHX A;  2BV3 A;  1KIJ A;  4LF7 E;  5GME A;  1N0U A;  1I94 I;  1MU5 A;  5LMN I;  3J7Y p;  2N3H A;  2HFS A;  5LMU E;  2LTS A;  1UEK A;  1ZM3 A;  4DU8 A;  4DV2 E;  2B7T A;  4P78 A;  2CPN A;  3JAM C;  4M0V A;  4JI8 E;  3QT5 A;  2DEJ A;  3Q6N A;  4LF4 E;  2OI2 A;  4ZVI A;  1XMO I;  5A2Q Q;  4Z7C A;  2V34 A;  4JV5 E;  1T4L B;  4X66 E;  2FV4 B;  2LBS B;  2M7Q A;  2EFG A;  1B62 A;  2AJ4 A;  1STU A;  1HR0 E;  3B78 A;  4JI2 I;  2VQE E;  3ADG A;  4NXN E;  3ADI A;  2VQF I;  3HQ1 A;  2BM1 A;  4B3T I;  3WU4 A;  3IWD A;  2PNM A;  1H73 A;  3ZKD A;  4PRX A;  4JI4 E;  4B3R I;  4K0K I;  4DV4 E;  3T1H E;  2MDR A;  3LTO A;  4LFB E;  3QT8 A;  4F9C B;  4M1K A;  1IBL E;  2ZIT A;  1IBK E;  1YZ9 A;  4LF7 I;  5IT9 Q;  1HK7 A;  1RC7 A;  2DEI A;  2BM0 A;  1HNW E;  4JYA E;  1XNQ E;  1NHH A;  5LMU I;  1Y4U A;  4P52 A;  2R42 A;  3IWB A;  4DV2 I;  1H72 C;  2CZ9 A;  4DUZ I;  3H09 A;  3AV0 A;  4HXZ A;  2L2N A;  4TUG A;  4DV7 E;  1XHK A;  4WFT A;  1RQ0 A;  4KHP E;  1SR9 A;  2LUQ A;  4IZJ B;  4LF4 I;  3C4T A;  4JV5 I;  2HKE A;  2UXD E;  3CWV A;  4X66 I;  2V8Q B;  4B3M E;  1Z0G A;  1HR0 I;  1NZ0 A;  2VQE I;  4NXN I;  3ZOQ B;  3AUZ A;  2E5L E;  3MSW A;  4DV1 E;  2O1T A;  1OJ4 A;  4OOG C;  2V88 A;  5AE3 A;  2VE7 C;  3T1H I;  1I94 E;  5LMN E;  4JI1 E;  4DPT A;  4PRV A;  1Z59 A;  1Z0B A;  3V5R A;  2F4V E;  1IBL I;  2UU9 E;  1Z0W A;  1FWL A;  1D6T A;  1IBK I;  4JI3 E;  3J81 Q;  1X48 A;  3J80 C;  2V87 A;  1XNR E;  1PKP A;  1HNW I;  4JYA I;  1QZR A;  1XNQ I;  3ZZT A;  4JI0 E;  4HAC A;  2HFU A;  3C4B A;  1NHJ A;  3PYD A;  2HK2 A;  3K85 A;  1B63 A;  1GZ6 A;  3IWC A;  5CFF E;  4DV7 I;  2UUB E;  4F54 A;  1FI4 A;  4OX9 E;  1EA6 A;  2RTX A;  4KHP I;  3HUL A;  4USM A;  2G7H A;  2UXC E;  2RSM A;  2UXD I;  4LFA I;  1X47 A;  1A6F A;  4B3M I;  4DR5 E;  2RS6 A;  1N34 E;  2JY9 A;  3HPZ A;  4R8O A;  2A2D A;  5BR8 E;  1PIE A;  2KON A;  1T4O A;  4L5N C;  2E5L I;  3D4J A;  4DV1 I;  4HY1 A;  2GQ0 A;  4M30 A;  2Z5B B;  4N3O A;  2Z5C A;  5AAS A;  2LUP B;  1ZXM A;  2UUC E;  1WXR A;  3J7A M;  2YZT A;  4JI1 I;  1WHN A;  3K1J A;  2LMZ A;  4USK A;  2F4V I;  2HK3 A;  2UU9 I;  5AE2 A;  1HNX E;  2H36 X;  4JI3 I;  4DUZ E;  2IOQ A;  4X65 E;  1XNR I;  1Z5C A;  2V2Q A;  4JI0 I;  1YYO A;  4X8W A;  4DR7 E;  1WHQ A;  4IZK A;  3RMP A;  2UUB I;  2V2Z A;  4OX9 I;  3LML A;  1HNZ E;  2X7I A;  3HJC A;  2UXC I;  4DU7 A;  1N36 E;  4KQV A;  4MYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...