1XNRE

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnrE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrE02
4GKJI 4B3TI 1Z0BA 4LF4E 1FJGI 4DV4I 2E5LI 1T4LB 1ZXMA 4B3ME 4FWDA 1J26A 4OX9E 4X62E 2UXDI 1IBKE 4DPUA 4DU7A 2AJ4A 1Z0TA 3ZM7A 4R1FA 1Z0CA 2HHHI 2UU9I 3HULA 1N0UA 3ADGA 3B82A 2HKJA 2LRSA 2HHHE 4DR2I 2NUEA 4URLA 5BR8I 4JI3I 4JI1I 3ZKBA 2WW4A 2XEXA 1HNZE 1IBKI 2UXBI 4JI6E 3OTOI 1XNRE 4M30A 1EI1A 4JI8I 3LTOA 4YY3E 4X64E 2JY9A 4HY1A 3GONA 2UUBE 2F4VE 1HNZI 4USMA 4JI7I 3WU4A 2L3CA 1ZM4A 4JI5I 1H73A 2LJHA 4FW9A 1PIEA 2RS6A 2V34A 4LF7I 4DKKA 1N34E 4XTJA 1RQ0A 4DV0E 4DR1I 1BKNA 2NPFA 1K47A 4LFBE 3WU5A 3Q1QA 2NUFA 4NXNI 2CZ9A 1Z5AA 2V8PA 3LLHA 4PU9A 5IWAI 2JVAA 4GKKE 4DV4E 2E5LE 1XNQE 4B3TE 1Z5BA 2DEIA 2DIXA 3P1XA 1NHJA 4WYQB 1ZM2A 1DARA 4ED4A 1HR0E 5L3JA 4I3HA 1S16A 2BM1A 4DV5I 2V2QA 2LUQA 1MU5A 4HACA 2B7TA 1UILA 4JI7E 3J81C 1N36E 4LF9E 2VQEE 2ZM6I 4LF6E 3J7AG 1ELOA 4NXMI 4DR6I 4LFCI 1FI4A 4JI6I 1NZ0A 4B3SI 3PYGA 4DV7E 4EMDA 1N32I 4AQYI 2DB2A 4JI2I 3ZKDA 2HK3A 1S4EA 2NA2A 5BR8E 4DR2E 4DXLA 1ZXNA 1WHNA 4NXME 4DUYE 4DR6E 1T4NA 3J81Q 3T1YI 1UEKA 1YYKA 3CWVA 4X65E 3PYEA 4K0KI 2HK2A 1H74A 4LF8E 1HNWI 4DUYI 1H7UA 2ZITA 2LTRA 4DR7E 3ZZTA 1XMQE 2Q2EB 3WU3A 4M1KA 4LF5E 3T1HE 2LBSB 1H7SA 3PYDA 1QU6A 5LMUE 1I94E 1GQEA 1X47A 1ZBTA 4X66E 4RPFA 1QZRA 2E1RA 1XNQI 1FJGE 2UXCE 2EFGA 4DUZE 2UUCI 1B62A 1U2RA 5A2QC 1IBLI 1FWLA 4DUZI 2B7VA 4YHHE 3V2UC 1X49A 2RTXA 4JV5E 4DV0I 3H4LA 4P7AA 3ZZ0A 3J7Yp 2L3JA 4LF7E 2MDRA 2B3TB 4DR4I 2UUCE 5A2QQ 2UUBI 3K17A 4DV3E 2KHXA 2RS7A 4M2ZA 1J5EE 4LFAI 1Z59A 1KTVA 2X36A 2BV3A 1RR9A 2L2KB 4DV2I 3V5RA 1OJ4A 1HNXE 2R42A 3LPSA 2VQFE 2HFUA 4DR7I 4DR3E 4JI3E 2UUAI 4WUDA 1N34I 2RSMA 2ZBKB 4HXZA 4DR3I 1HNWE 4LF8I 4USKA 1YYWA 2DEJA 2X7IA 4HYMA 2DMYA 2N3HA 1KKHA 3HTXA 1O0WA 1RC7A 4DPWA 1Z0GA 3QT8A 4DV1I 1STUA 3OTOE 3J80C 4MYUA 4FN5A 2ZM6E 3J7AM 4GKJE 4DV6E 1KIJA 1WUUA 1XHKA 4DR4E 1Z0WA 5FLXC 2NUGA 3ADIA 4X8WA 3VYXA 3B78A 4DV5E 3C4TA 2UU9E 4LF6I 4JV5I 2VQFI 1X48A 1HR0I 3VYYA 2UXDE 1FNMA 4X62I 1EA6A 4B3RI 1ZM3A 4P52A 4B3MI 3M6AA 3J80Q 2N3GA 1J5EI 4JYAE 4UTGA 1XMOI 4B3RE 3QT5A 4DR5I 4DU8A 5LMUI 2J7KA 1ZM9A 1T4OA 2V2ZA 4DPYA 4JYAI 4Z7CA 4DR1E 1Z5CA 1N0VC 1YYOA 4YHHI 2IHR1 4FWGA 3JAMQ 4NXNE 2HFSA 1UHZA 3QT6A 4WUBA 4LFBI 1FWKA 2F4VI 3T1YE 1H72C 2VF3A 3K1JA 4DPTA 4X64I 1PVGA 2UXCI 4YY3I 3LNUA 1MG7A 3ZZUA 3ADLA 5IT9Q 4PRVA 3QT7A 4FWHA 2BM0A 4DV1E 3D4JA 5LMNE 4ZVIA 4JI5E 2UXBE 4DV6I 1DI2A 1I94I 4AQYE 3T1HI 4DV7I 4LF5I 4B3SE 4JI8E 1XMQI 4JI1E 4HACB 3ADJA 1XNRI 2UUAE 5FLXQ 2V2VA 2YT4A 4DPXA 1N36I 4LF9I 1NHHA 4MYTA 4K0KE 4X65I 1HNXI 5GMEA 1FKAE 2A2DA 1YZ9A 4DV2E 4PRXA 2L2NA 3JAMC 1Z0VA 1A6FA 2LTSA 2LUPB 2L2MA 2L33A 4LF4I 1MX0A 4JI2E 4WFTA 1N32E 2OI2A 2R3VA 5CFFE 4KQVA 5LL6R 4OX9I 2CPNA 5LMNI 1NHIA 3WU6A 1VISA 4LFAE 4WUCA 4OOGC 4LFCE 4KHPI 3F0NA 5IT9C 4GKKI 4UT4A 5IWAE 1B63A 4DV3I 2VQEI 2EZ6A 2A2CA 3PYFA 1IBMI 4Z7YA 1Z0EA 1N33E 1IBLE 4JI4I 1PKPA 1D6TA 5GMDA 1IBME 4JI0E 1RREA 4JG4A 1WHQA 3C4BA 4KHPE 2LJPA 4JI0I 1KVKA 4DR5E 4X66I 2GS8A 4JI4E 3B8HA 1N33I 1EKZA 2HKEA 1XMOE
chains in the Genus database with same CATH superfamily
4GKJI 4F2JC 2ENAA 4B3TI 4LCFA 2BB8A 2EJ4A 2M7QA 1Z0BA 4LF4E 1FJGI 3P3CA 4DV4I 3HQ1A 2E5LI 2EMYA 1T4LB 1ZXMA 2N8XA 2I9IA 4RHBB 2YTQA 1BB8A 4BA2B 1UDSA 4B3ME 4FWDA 5AC4A 1J26A 2EM6A 5K36F 1A1FA 4OX9E 1G2DC 5C0XF 4R8OA 4X62E 2YSPA 3P3EA 2EN4A 2EOMA 5DNYA 2EL5A 1IBKE 3EPHA 4BHBA 1IQOA 5DROA 4DPUA 2AJ4A 4DU7A 1Z0TA 2GO3A 1E3PA 2EOOA 3ZM7A 4R1FA 2JP9A 2EN2A 2DRPA 1Z0CA 4U3BA 2HHHI 2UU9I 5DRPA 5LLQA 1XMOE 4HTGA 2NN6C 3HULA 1N0UA 4O4KA 3ADGA 3B82A 2HKJA 2LRSA 2HHHE 5ELWA 2NUEA 4URLA 5A69A 2L6MA 4DR2I 5BR8I 1G2FC 2EMGA 4JI1I 3H1CA 2E72A 5AASA 2WW4A 3ZKBA 4MLQA 2XEXA 1HNZE 2EN8A 1IBKI 2UXBI 4IFDE 2LJUA 4JI6E 2DLQA 3OTOI 1XNRE 4M30A 5K36B 2EMIA 2RPCA 4OO1F 3ZOQB 2K4VA 1EI1A 2PNZA 1R6LA 1DGCA 3LTOA 1Y4UA 4JI8I 2EPKX 4YY3E 3Q6MA 4X64E 4R2CA 2JY9A 2V87A 3GONA 2JT2A 2UUBE 4HY1A 2F4VE 1HNZI 4USMA 4JI7I 2EORA 3F6HA 2L3CA 1ZM4A 4QNJA 4BC9A 1H73A 2F1DA 3WU4A 4X64I 2LJHA 4FW9A 4JI5I 2VF1A 1PIEA 4IFDD 2RS6A 2V34A 1RHYA 4FK5C 3L7ZA 2PO1B 2H36X 4LF7I 4DKKA 3THNA 2EMHA 2ENHA 1N34E 4XTJA 1TN9A 1RQ0A 4DV0E 2ODRC 2B9DA 1B69A 3CDJA 4DR1I 1TF3A 2CSHA 4R03A 2EPZA 2HC5A 1BKNA 2NPFA 3DJWA 1K47A 1L4SA 4LFBE 3WU5A 2EOHA 4BBYA 2BA1D 3Q1QA 2NUFA 4O43A 2EN3A 4NXNI 3JTZA 2GHFA 5IV8B 2MKNA 4X9JA 4IFDA 2CZ9A 1Z5AA 2LVHA 2V8QB 2V8PA 3LLHA 4MQYA 4PU9A 2EPMX 2EMZA 3HXLA 1BBOA 5IWAI 2JVAA 4GKKE 2YTNA 4DV4E 2E5LE 1F2IG 4R2PA 1XNQE 2WNRB 2A25A 3BGHA 5AC5A 2JOBA 4B3TE 3AV0A 2YU8A 1Z5BA 2DEIA 4GZNC 2O1TA 2DIXA 3P1XA 2EOFA 1NHJA 4WYQB 1ZM2A 1DARA 3C6MA 1MEYC 1X5WA 4ED4A 2L92A 1HR0E 1TF6A 3LMLA 5L3JA 2C38B 2EM9A 3B4TA 4I3HA 1S16A 4GQUA 2BM1A 4DV5I 2V2QA 2YU5A 2LUQA 4L8NA 1MU5A 1SR9A 4GEQB 1A1GA 5FWKA 2F8BA 4HACA 2B7TA 4F9CB 2EM0A 1T38A 2PO0B 3U1YA 1WRJA 1UILA 2WCC3 4JI7E 3J81C 5IXMB 1N36E 4LF9E 2VQEE 4L5NC 2ZM6I 4LF6E 2MDGA 3J7AG 4F9BB 1ELOA 4NXMI 4DR6I 4LFCI 2C37B 1E3HA 2CGEA 3KRNA 3C6KA 1UDQA 3GCMA 1FI4A 2CG9A 3M85G 2EOEA 3EPKA 4BA1A 4JI6I 2WBSA 1NZ0A 2EMLA 4B3SI 4O24A 3PYGA 4DV7E 2NN6E 4EMDA 2V85A 1EH8A 1N32I 4AQYI 2DB2A 2YSOA 4JI2I 2PNZB 3ZKDA 2HK3A 1S4EA 2EN7A 5C0XA 4IS1C 5AE3A 3P06A 2NA2A 4MU0A 2AE8A 3PS1A 5BR8E 4DR2E 2BR2A 2EMXA 2LCEA 4WPYA 1ZXNA 5EKWA 4DXLA 2Z5EA 3L00A 2PO2A 4U3DA 4Q35B 1WHNA 3KWRA 4DUYE 4NXME 4DR6E 1T4NA 4BCAA 3J81Q 1PJSA 2EM7A 4N3OA 1R6MA 3T1YI 1UEKA 2LE2A 4TUIA 1YYKA 4OZEA 3CWVA 4X65E 3PYEA 5DRQA 4K0KI 2EOIA 2HK2A 1IQSA 2YRKA 2PO1A 1H74A 1ZU1A 4R2SA 3EPJA 4LF8E 1HNWI 4M0VA 1H7UA 4DUYI 2ZITA 3IWBA 1WJPA 2GO4A 1Y60A 1UDNA 2O1WA 2LTRA 4DR7E 3K85A 3GMEA 3ZZTA 4OO1D 1XMQE 2LV2A 2Q2EB 3WU3A 1A1LA 4M1KA 2EMBA 4LF5E 5A6KA 2KOUA 3T1HE 2J7JA 2LBSB 2VE7C 1H7SA 1NCSA 1QU6A 3OMLA 2YTGA 1GQEA 5LMUE 1I94E 3PYDA 5DRRA 4OO1A 1X47A 2EOXA 1ZBTA 5DNXA 4X66E 3BF2A 2NN6D 2EOQA 2EP3A 4M9VC 4RPFA 3GLLA 2ADRA 1QZRA 2E1RA 1XNQI 1FJGE 3ECRA 2UXCE 2EPLX 2EFGA 4F9AB 4AM3A 3F6GA 2CTDA 4DUZE 2UUCI 1KJKA 1B62A 2PO0A 3Q6NA 2GLIA 2YTPA 1U2RA 5A2QC 2EE8A 4HEIA 1Z1BA 3AUZA 3P3GA 2YTFA 3M7ND 4LCHA 2EOSA 1X6HA 2WP8A 1IBLI 1FWLA 1P42A 4DUZI 2C39B 2B7VA 4YHHE 3V2UC 5C0XD 1X49A 1QNTA 2RTXA 4JV5E 2WBUA 4BS9A 2C37A 5EL9A 2EM8A 2EPCA 4DV0I 3H4LA 4P7AA 3ZZ0A 5AE1A 3J7Yp 2L3JA 2NN6F 4LF7E 2IOPA 2MDRA 2B3TB 3IWDA 1VI7A 4MU3A 4DR4I 1PJQA 2UUCE 4FW6A 5A2QQ 2Z5BB 3K17A 2UUBI 4DV3E 2KHXA 2RS7A 5T6JA 4M2ZA 5KL3A 3UHMA 1MGTA 1J5EE 3EQ1A 2MC6A 1Z59A 4LFAI 1KTVA 2X36A 2BV3A 4QNKA 4LOMA 4IS9A 1RR9A 2M4IA 4DMIA 2L2KB 3VK6A 4DV2I 2EQ1A 2WBTA 4IJDA 4MDTA 2FV4B 2V86A 3VHTB 1OJ4A 3V5RA 1ZAAC 3L7ZB 1HNXE 4J8ZA 1HK7A 2EPUA 2R42A 3IWCA 1X3CA 3LPSA 4WSPA 2BR2B 2JYAA 2VQFE 1AAYA 1DQ3A 3K6QA 2HFUA 4DR7I 4DR3E 3HPSA 4IZJB 1YSAC 4JI3E 2EQ3A 1USUA 4LPFA 2UUAI 4WUDA 4IZKB 1N34I 1OYPA 2RSMA 3H09A 3KZZA 2CVEA 2JPAA 2ZBKB 4HXZA 1HNWE 4IZKA 2V83A 3MHHC 1EH7A 4DR3I 2ODRD 1YYWA 2JXPA 4USKA 1ZR9A 2V89A 2WZOA 2DEJA 2X7IA 3M85D 2WP8B 4HYMA 4WXDA 2WNRA 2DMYA 4O5GA 2EMCA 2N3HA 1KKHA 3HTXA 2EOJA 1O0WA 2MC5A 2EOYA 1RC7A 3PS2A 4DPWA 5KL7A 1PDAA 1Z0GA 3QT8A 4DV1I 2NN6A 1YPNA 3BBGA 2I13A 2YTEA 1STUA 4NZVA 3OTOE 1XXEA 5KL6A 3J80C 4MYUA 4LF8I 2M9AA 3FIGA 4IFDB 3TQMA 4TUGA 4FN5A 2ZM6E 5A6BD 3J7AM 4BC7A 4AIMA 4GKJE 4FW5A 2UXDI 4DV6E 1KIJA 1WUUA 1XHKA 2J65A 4DR4E 1YUIA 1Z0WA 4JI3I 3MSWA 5FLXC 2RQLA 2NUGA 2R1FA 1BBGA 3ADIA 5DNLA 4BA2A 1AH5A 4FW4A 4X8WA 3VYXA 4R2DA 4DV5E 3B78A 3C4TA 2EM5A 2YZTA 2UU9E 2Z5CA 4LF6I 4JV5I 2VQFI 5KL2A 2JR1A 1GTKA 2JE6A 1X48A 1JK2A 1HR0I 2C38A 4OKGA 2HJJA 2EOZA 2IOQA 5JEAB 2E1MA 3VYYA 2EMFA 2UXDE 2HGHA 4WX9A 2JOXA 5F3WA 1FNMA 1EA6A 4X62I 3EPLA 2G7HA 4B3RI 1ZM3A 4P52A 4B3MI 2EM4A 1USVA 3M6AA 1GZ6A 2EPPA 3JU0A 2BA0D 4P7DA 2N3GA 3J80Q 1J5EI 4JYAE 4UTGA 2EPOA 2DSYA 5K36C 3QG5C 2EN6A 2JEAB 2O1VA 1XMOI 1X6FA 4B3RE 3QT5A 2V88A 2JEAA 2VESA 4IFDC 1YHCA 4DR5I 4MU4A 4DU8A 5LMUI 4BHCA 2J7KA 1ZM9A 5C0XB 1T4OA 2V2ZA 4DPYA 3M99B 5C0XC 4JYAI 4Z7CA 2ENCA 4DR1E 3HPZA 4F54A 1Z5CA 2EN1A 2IERA 2C39A 4ZYGA 2YTOA 2DLKA 1N0VC 1YYOA 2YRHA 3NZKA 4YHHI 2IHR1 1T39A 4NHRA 3MHSC 2Z5CB 2EL4A 2MKDA 2O3ZA 4FW7A 4FWGA 3JAMQ 4NXNE 2HFSA 4F6MA 1UHZA 3QT6A 4WUBA 1A1HA 4LFBI 2BA0G 2ELZA 1Y5YA 1FWKA 2F4VI 4NBQA 2JEBA 3T1YE 2EMWA 2EPAA 1H72C 2EPXA 5A6AA 2VF3A 3K1JA 1PVGA 1OYSA 2JEBB 4DPTA 1YH8A 2NN6B 4YY3I 1Y6ZA 2UXCI 3UK3C 1MG7A 3LNUA 3PS3A 3PRYA 2JE6B 2GQ0A 3ZZUA 3ADLA 5IT9Q 1LLMC 4AIDA 4PRVA 4MLVA 1A1JA 2PNMA 2L8TA 3QT7A 2BM0A 4FWHA 5JEAC 1PJTA 2RSIA 4DV1E 3D4JA 5JEAE 5LMNE 4ZVIA 2LO3A 4JI5E 4OO1B 2UXBE 1YFHA 1DI2A 4DV6I 4AQYE 1I94I 2BBGA 1X6EA 4P78A 2O1UA 2JWOA 1P47A 4DV7I 3T1HI 4LF5I 4ZYHA 4OO1C 1N3GA 2VRDA 4JI8E 4B3SE 1XMQI 4JI1E 3M7NG 4HACB 2GPIA 4R2QA 2YTIA 4R2AA 1ZBQA 3ADJA 4IZJD 1XNRI 2EMKA 2UUAE 1JK1A 3RMPA 4R2EA 2YWQA 2EMAA 2PNLA 5FLXQ 2V2VA 2YT4A 3THOB 1EH6A 4DPXA 2DMIA 1N36I 4LF9I 1NHHA 4MYTA 4K0KE 4X65I 5A6BA 2Q8UA 5C0XE 1IMUA 4R2RA 1RMDA 1HNXI 4RH8A 3HKMA 5GMEA 1FKAE 2D9HA 1YZ9A 4LU9A 4DV2E 2A2DA 4PRXA 4IZJA 2L2NA 2EWLA 3JAMC 1Z0VA 1A6FA 2LTSA 2EQ0A 2L2MA 2LUPB 4F6NA 4LCGA 5JEAA 5KL5A 2NABA 2L33A 2Z5BA 5AE2A 2EPNA 4LF4I 2FGGA 1MX0A 2BA1G 4JI2E 5KL4A 4WFTA 1N32E 4FW3A 2OI2A 2YRMA 2R3VA 5K36D 5CFFE 4KQVA 2YPNA 5LL6R 2LT7A 5JEAD 4WSGA 2CPNA 5LMNI 4OX9I 1UN6B 1NEIA 2CT1A 4WXCA 1NHIA 3WU6A 4N4RB 4Q28A 4IFDF 1OYRA 1VISA 4LFAE 4WUCA 1Y4SA 4OOGC 4LFCE 4KHPI 3HJCA 3F0NA 5A6JA 2EL6A 5IT9C 4ISAA 2YTDA 4UT4A 5IWAE 1B63A 4GKKI 1A1IA 1KYQA 4OO1E 1UDOA 4DV3I 4MU1A 2VQEI 2EZ6A 2A2CA 4LTYA 4ZYEA 1WXRA 3PYFA 1IBMI 2K7IA 2PRTA 4Z7YA 1Z0EA 1N33E 1IBLE 2PO2B 4KZSA 3DD6A 4JI4I 4BMJA 2IESA 1PKPA 1D6TA 1YUJA 5K36E 3CDIA 4I8OA 2KONA 5GMDA 1IBME 4JI0E 1RREA 2R76A 2LMZA 3P76A 3BIDA 1A1KA 4JG4A 3DF6A 2FTXB 1WHQA 3C4BA 2M1SA 2YTJA 4KHPE 2LJPA 5JEAF 5TSEA 1UBDC 5K36A 1SFEA 4JI0I 3U1KA 4J3DA 1KVKA 4BA1B 4DR5E 2EM3A 3KZYA 4X66I 2ELYA 4JI4E 2GS8A 4KWYA 3B8HA 1N33I 1EKZA 2EM2A 4ZYDA 2HKEA 2EPRA 2DGCA 5ADZA
chains in the Genus database with same CATH topology
4GKJI 4B3TI 2M7QA 1Z0BA 4LF4E 1FJGI 4DV4I 3HQ1A 2E5LI 1T4LB 1ZXMA 4B3ME 4FWDA 1J26A 4OX9E 4R8OA 4X62E 2UXDI 5DNYA 1IBKE 4DPUA 4DU7A 2AJ4A 1Z0TA 3ZM7A 4R1FA 1Z0CA 2HHHI 2UU9I 1XMOE 3HULA 1N0UA 3ADGA 3B82A 2HKJA 2LRSA 2HHHE 4DR2I 2NUEA 4URLA 5BR8I 2L6MA 4JI1I 3ZKBA 5AASA 2WW4A 2XEXA 1HNZE 1IBKI 2UXBI 4JI6E 3OTOI 1XNRE 4M30A 3ZOQB 2K4VA 1EI1A 4JI8I 3LTOA 1Y4UA 4YY3E 3Q6MA 4X64E 2JY9A 2V87A 3GONA 4HY1A 2UUBE 2F4VE 1HNZI 4USMA 4JI7I 3WU4A 3F6HA 2L3CA 1ZM4A 4BC9A 1H73A 4JI5I 2LJHA 4FW9A 2VF1A 1PIEA 2RS6A 2V34A 2H36X 4LF7I 4DKKA 1N34E 4XTJA 1RQ0A 4DV0E 2ODRC 2B9DA 4DR1I 4R03A 1BKNA 2NPFA 3DJWA 1K47A 4LFBE 3WU5A 3Q1QA 4BBYA 2NUFA 4NXNI 3JTZA 2CZ9A 1Z5AA 2V8QB 2V8PA 3LLHA 4PU9A 3HXLA 5IWAI 2JVAA 4GKKE 4DV4E 2E5LE 1XNQE 2JOBA 4B3TE 3AV0A 1Z5BA 2DEIA 2O1TA 2DIXA 3P1XA 1NHJA 4WYQB 1ZM2A 1DARA 4ED4A 2L92A 1HR0E 3LMLA 5L3JA 4I3HA 1S16A 2BM1A 4DV5I 2V2QA 2LUQA 4L8NA 1MU5A 1SR9A 4GEQB 5FWKA 2F8BA 4HACA 2B7TA 4F9CB 1UILA 4JI7E 3J81C 1N36E 4LF9E 2VQEE 4L5NC 2ZM6I 4LF6E 3J7AG 4F9BB 1ELOA 4NXMI 4DR6I 4LFCI 2CGEA 1FI4A 2CG9A 4JI6I 1NZ0A 4B3SI 3PYGA 4DV7E 4EMDA 2V85A 1N32I 4AQYI 2DB2A 4JI2I 3ZKDA 2HK3A 1S4EA 5AE3A 3P06A 2NA2A 5BR8E 4DR2E 4DXLA 4WPYA 1ZXNA 2Z5EA 1WHNA 3KWRA 4DUYE 4NXME 4DR6E 1T4NA 4BCAA 3J81Q 4N3OA 3T1YI 1UEKA 2LE2A 4TUIA 1YYKA 3CWVA 4X65E 3PYEA 4K0KI 2HK2A 1H74A 4LF8E 1HNWI 4M0VA 1H7UA 4DUYI 2ZITA 3IWBA 2O1WA 2LTRA 4DR7E 3K85A 3ZZTA 1XMQE 2Q2EB 3WU3A 4M1KA 4LF5E 2KOUA 3T1HE 2LBSB 1H7SA 2VE7C 3PYDA 1QU6A 3OMLA 5LMUE 1GQEA 1I94E 1X47A 1ZBTA 4X66E 4RPFA 1QZRA 2E1RA 1XNQI 1FJGE 2UXCE 2EFGA 4F9AB 3F6GA 4DUZE 2UUCI 1B62A 3Q6NA 1U2RA 5A2QC 3AUZA 1IBLI 1FWLA 4DUZI 2B7VA 4YHHE 3V2UC 1X49A 2RTXA 4JV5E 4BS9A 4DV0I 3H4LA 4P7AA 3ZZ0A 5AE1A 3J7Yp 2L3JA 4LF7E 2IOPA 2MDRA 2B3TB 3IWDA 4DR4I 2UUCE 5A2QQ 2Z5BB 3K17A 2UUBI 4DV3E 2KHXA 2RS7A 5T6JA 4M2ZA 1J5EE 4LFAI 2MC6A 1Z59A 1KTVA 2X36A 2BV3A 1RR9A 2M4IA 4DMIA 2L2KB 3VK6A 4DV2I 3V5RA 2FV4B 2V86A 1OJ4A 1HNXE 4J8ZA 1HK7A 2R42A 3IWCA 3LPSA 4WSPA 2VQFE 1DQ3A 3K6QA 2HFUA 4DR7I 4DR3E 3HPSA 4IZJB 4JI3E 1USUA 2UUAI 4WUDA 4IZKB 1N34I 2RSMA 3H09A 2ZBKB 4HXZA 4IZKA 1HNWE 4DR3I 2V83A 4LF8I 2ODRD 1YYWA 4USKA 2V89A 2WZOA 2DEJA 2X7IA 4HYMA 2DMYA 2N3HA 1KKHA 3HTXA 2MC5A 1O0WA 1RC7A 4DPWA 1Z0GA 3QT8A 4DV1I 1STUA 3OTOE 3J80C 4MYUA 3FIGA 4TUGA 4FN5A 2ZM6E 3J7AM 4BC7A 4GKJE 4DV6E 1KIJA 1WUUA 1XHKA 4DR4E 1Z0WA 3MSWA 5FLXC 2NUGA 3ADIA 4X8WA 3VYXA 4DV5E 3B78A 3C4TA 2UU9E 2YZTA 2Z5CA 4LF6I 4JV5I 2VQFI 2JR1A 1X48A 1HR0I 2IOQA 2E1MA 3VYYA 2UXDE 1FNMA 2JOXA 5F3WA 4X62I 1EA6A 2G7HA 4B3RI 1ZM3A 4P52A 4B3MI 1USVA 3M6AA 1GZ6A 3JU0A 4P7DA 2N3GA 3J80Q 1J5EI 4JYAE 4UTGA 2DSYA 2O1VA 1XMOI 4B3RE 3QT5A 2V88A 4DR5I 4DU8A 5LMUI 2J7KA 1ZM9A 1T4OA 2V2ZA 4DPYA 4JYAI 4Z7CA 4DR1E 3HPZA 4F54A 1Z5CA 1N0VC 1YYOA 4YHHI 2IHR1 2Z5CB 4FWGA 3JAMQ 4NXNE 2HFSA 1UHZA 3QT6A 4WUBA 4LFBI 1FWKA 2F4VI 3T1YE 1H72C 2VF3A 3K1JA 4DPTA 4X64I 4JI3I 1PVGA 2UXCI 4YY3I 1Y6ZA 3LNUA 1MG7A 3PRYA 2GQ0A 3ZZUA 3ADLA 5IT9Q 4PRVA 2PNMA 2L8TA 3QT7A 2BM0A 4FWHA 4DV1E 3D4JA 5LMNE 4ZVIA 4JI5E 2UXBE 4DV6I 1DI2A 1I94I 4AQYE 4P78A 2O1UA 3T1HI 2JWOA 4DV7I 4LF5I 4B3SE 4JI8E 1XMQI 4JI1E 4HACB 1ZBQA 3ADJA 4IZJD 1XNRI 2UUAE 3RMPA 2PNLA 5FLXQ 2V2VA 2YT4A 4DPXA 1N36I 4LF9I 1NHHA 4MYTA 4K0KE 4X65I 1HNXI 5GMEA 1FKAE 2A2DA 1YZ9A 4LU9A 4DV2E 4PRXA 4IZJA 2L2NA 2EWLA 3JAMC 1Z0VA 1A6FA 2LTSA 2LUPB 2L2MA 2Z5BA 2L33A 5AE2A 4LF4I 2FGGA 1MX0A 4JI2E 4WFTA 1N32E 2OI2A 2R3VA 5CFFE 4KQVA 5LL6R 4OX9I 2CPNA 5LMNI 1NHIA 3WU6A 4Q28A 1VISA 4LFAE 4WUCA 1Y4SA 4OOGC 4LFCE 4KHPI 3HJCA 3F0NA 5IT9C 4GKKI 4UT4A 5IWAE 1B63A 4DV3I 2VQEI 2EZ6A 2A2CA 4LTYA 3PYFA 1WXRA 1IBMI 4Z7YA 1Z0EA 1N33E 1IBLE 4KZSA 4JI4I 4BMJA 1PKPA 1D6TA 4I8OA 2KONA 5GMDA 1IBME 4JI0E 1RREA 2LMZA 4JG4A 3DF6A 2FTXB 1WHQA 3C4BA 2M1SA 4KHPE 2LJPA 4JI0I 1KVKA 4DR5E 4X66I 2GS8A 4JI4E 3B8HA 1N33I 1EKZA 2HKEA 5ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ I;  4B3T I;  1Z0B A;  4LF4 E;  1FJG I;  4DV4 I;  2E5L I;  1T4L B;  1ZXM A;  4B3M E;  4FWD A;  1J26 A;  4OX9 E;  4X62 E;  2UXD I;  1IBK E;  4DPU A;  4DU7 A;  2AJ4 A;  1Z0T A;  3ZM7 A;  4R1F A;  1Z0C A;  2HHH I;  2UU9 I;  3HUL A;  1N0U A;  3ADG A;  3B82 A;  2HKJ A;  2LRS A;  2HHH E;  4DR2 I;  2NUE A;  4URL A;  5BR8 I;  4JI3 I;  4JI1 I;  3ZKB A;  2WW4 A;  2XEX A;  1HNZ E;  1IBK I;  2UXB I;  4JI6 E;  3OTO I;  1XNR E;  4M30 A;  1EI1 A;  4JI8 I;  3LTO A;  4YY3 E;  4X64 E;  2JY9 A;  4HY1 A;  3GON A;  2UUB E;  2F4V E;  1HNZ I;  4USM A;  4JI7 I;  3WU4 A;  2L3C A;  1ZM4 A;  4JI5 I;  1H73 A;  2LJH A;  4FW9 A;  1PIE A;  2RS6 A;  2V34 A;  4LF7 I;  4DKK A;  1N34 E;  4XTJ A;  1RQ0 A;  4DV0 E;  4DR1 I;  1BKN A;  2NPF A;  1K47 A;  4LFB E;  3WU5 A;  3Q1Q A;  2NUF A;  4NXN I;  2CZ9 A;  1Z5A A;  2V8P A;  3LLH A;  4PU9 A;  5IWA I;  2JVA A;  4GKK E;  4DV4 E;  2E5L E;  1XNQ E;  4B3T E;  1Z5B A;  2DEI A;  2DIX A;  3P1X A;  1NHJ A;  4WYQ B;  1ZM2 A;  1DAR A;  4ED4 A;  1HR0 E;  5L3J A;  4I3H A;  1S16 A;  2BM1 A;  4DV5 I;  2V2Q A;  2LUQ A;  1MU5 A;  4HAC A;  2B7T A;  1UIL A;  4JI7 E;  3J81 C;  1N36 E;  4LF9 E;  2VQE E;  2ZM6 I;  4LF6 E;  3J7A G;  1ELO A;  4NXM I;  4DR6 I;  4LFC I;  1FI4 A;  4JI6 I;  1NZ0 A;  4B3S I;  3PYG A;  4DV7 E;  4EMD A;  1N32 I;  4AQY I;  2DB2 A;  4JI2 I;  3ZKD A;  2HK3 A;  1S4E A;  2NA2 A;  5BR8 E;  4DR2 E;  4DXL A;  1ZXN A;  1WHN A;  4NXM E;  4DUY E;  4DR6 E;  1T4N A;  3J81 Q;  3T1Y I;  1UEK A;  1YYK A;  3CWV A;  4X65 E;  3PYE A;  4K0K I;  2HK2 A;  1H74 A;  4LF8 E;  1HNW I;  4DUY I;  1H7U A;  2ZIT A;  2LTR A;  4DR7 E;  3ZZT A;  1XMQ E;  2Q2E B;  3WU3 A;  4M1K A;  4LF5 E;  3T1H E;  2LBS B;  1H7S A;  3PYD A;  1QU6 A;  5LMU E;  1I94 E;  1GQE A;  1X47 A;  1ZBT A;  4X66 E;  4RPF A;  1QZR A;  2E1R A;  1XNQ I;  1FJG E;  2UXC E;  2EFG A;  4DUZ E;  2UUC I;  1B62 A;  1U2R A;  5A2Q C;  1IBL I;  1FWL A;  4DUZ I;  2B7V A;  4YHH E;  3V2U C;  1X49 A;  2RTX A;  4JV5 E;  4DV0 I;  3H4L A;  4P7A A;  3ZZ0 A;  3J7Y p;  2L3J A;  4LF7 E;  2MDR A;  2B3T B;  4DR4 I;  2UUC E;  5A2Q Q;  2UUB I;  3K17 A;  4DV3 E;  2KHX A;  2RS7 A;  4M2Z A;  1J5E E;  4LFA I;  1Z59 A;  1KTV A;  2X36 A;  2BV3 A;  1RR9 A;  2L2K B;  4DV2 I;  3V5R A;  1OJ4 A;  1HNX E;  2R42 A;  3LPS A;  2VQF E;  2HFU A;  4DR7 I;  4DR3 E;  4JI3 E;  2UUA I;  4WUD A;  1N34 I;  2RSM A;  2ZBK B;  4HXZ A;  4DR3 I;  1HNW E;  4LF8 I;  4USK A;  1YYW A;  2DEJ A;  2X7I A;  4HYM A;  2DMY A;  2N3H A;  1KKH A;  3HTX A;  1O0W A;  1RC7 A;  4DPW A;  1Z0G A;  3QT8 A;  4DV1 I;  1STU A;  3OTO E;  3J80 C;  4MYU A;  4FN5 A;  2ZM6 E;  3J7A M;  4GKJ E;  4DV6 E;  1KIJ A;  1WUU A;  1XHK A;  4DR4 E;  1Z0W A;  5FLX C;  2NUG A;  3ADI A;  4X8W A;  3VYX A;  3B78 A;  4DV5 E;  3C4T A;  2UU9 E;  4LF6 I;  4JV5 I;  2VQF I;  1X48 A;  1HR0 I;  3VYY A;  2UXD E;  1FNM A;  4X62 I;  1EA6 A;  4B3R I;  1ZM3 A;  4P52 A;  4B3M I;  3M6A A;  3J80 Q;  2N3G A;  1J5E I;  4JYA E;  4UTG A;  1XMO I;  4B3R E;  3QT5 A;  4DR5 I;  4DU8 A;  5LMU I;  2J7K A;  1ZM9 A;  1T4O A;  2V2Z A;  4DPY A;  4JYA I;  4Z7C A;  4DR1 E;  1Z5C A;  1N0V C;  1YYO A;  4YHH I;  2IHR 1;  4FWG A;  3JAM Q;  4NXN E;  2HFS A;  1UHZ A;  3QT6 A;  4WUB A;  4LFB I;  1FWK A;  2F4V I;  3T1Y E;  1H72 C;  2VF3 A;  3K1J A;  4DPT A;  4X64 I;  1PVG A;  2UXC I;  4YY3 I;  3LNU A;  1MG7 A;  3ZZU A;  3ADL A;  5IT9 Q;  4PRV A;  3QT7 A;  4FWH A;  2BM0 A;  4DV1 E;  3D4J A;  5LMN E;  4ZVI A;  4JI5 E;  2UXB E;  4DV6 I;  1DI2 A;  1I94 I;  4AQY E;  3T1H I;  4DV7 I;  4LF5 I;  4B3S E;  4JI8 E;  1XMQ I;  4JI1 E;  4HAC B;  3ADJ A;  1XNR I;  2UUA E;  5FLX Q;  2V2V A;  2YT4 A;  4DPX A;  1N36 I;  4LF9 I;  1NHH A;  4MYT A;  4K0K E;  4X65 I;  1HNX I;  5GME A;  1FKA E;  2A2D A;  1YZ9 A;  4DV2 E;  4PRX A;  2L2N A;  3JAM C;  1Z0V A;  1A6F A;  2LTS A;  2LUP B;  2L2M A;  2L33 A;  4LF4 I;  1MX0 A;  4JI2 E;  4WFT A;  1N32 E;  2OI2 A;  2R3V A;  5CFF E;  4KQV A;  5LL6 R;  4OX9 I;  2CPN A;  5LMN I;  1NHI A;  3WU6 A;  1VIS A;  4LFA E;  4WUC A;  4OOG C;  4LFC E;  4KHP I;  3F0N A;  5IT9 C;  4GKK I;  4UT4 A;  5IWA E;  1B63 A;  4DV3 I;  2VQE I;  2EZ6 A;  2A2C A;  3PYF A;  1IBM I;  4Z7Y A;  1Z0E A;  1N33 E;  1IBL E;  4JI4 I;  1PKP A;  1D6T A;  5GMD A;  1IBM E;  4JI0 E;  1RRE A;  4JG4 A;  1WHQ A;  3C4B A;  4KHP E;  2LJP A;  4JI0 I;  1KVK A;  4DR5 E;  4X66 I;  2GS8 A;  4JI4 E;  3B8H A;  1N33 I;  1EKZ A;  2HKE A;  1XMO E; 
#chains in the Genus database with same CATH topology
 4GKJ I;  4F2J C;  2ENA A;  4B3T I;  4LCF A;  2BB8 A;  2EJ4 A;  2M7Q A;  1Z0B A;  4LF4 E;  1FJG I;  3P3C A;  4DV4 I;  3HQ1 A;  2E5L I;  2EMY A;  1T4L B;  1ZXM A;  2N8X A;  2I9I A;  4RHB B;  2YTQ A;  1BB8 A;  4BA2 B;  1UDS A;  4B3M E;  4FWD A;  5AC4 A;  1J26 A;  2EM6 A;  5K36 F;  1A1F A;  4OX9 E;  1G2D C;  5C0X F;  4R8O A;  4X62 E;  2YSP A;  3P3E A;  2EN4 A;  2EOM A;  5DNY A;  2EL5 A;  1IBK E;  3EPH A;  4BHB A;  1IQO A;  5DRO A;  4DPU A;  2AJ4 A;  4DU7 A;  1Z0T A;  2GO3 A;  1E3P A;  2EOO A;  3ZM7 A;  4R1F A;  2JP9 A;  2EN2 A;  2DRP A;  1Z0C A;  4U3B A;  2HHH I;  2UU9 I;  5DRP A;  5LLQ A;  1XMO E;  4HTG A;  2NN6 C;  3HUL A;  1N0U A;  4O4K A;  3ADG A;  3B82 A;  2HKJ A;  2LRS A;  2HHH E;  5ELW A;  2NUE A;  4URL A;  5A69 A;  2L6M A;  4DR2 I;  5BR8 I;  1G2F C;  2EMG A;  4JI1 I;  3H1C A;  2E72 A;  5AAS A;  2WW4 A;  3ZKB A;  4MLQ A;  2XEX A;  1HNZ E;  2EN8 A;  1IBK I;  2UXB I;  4IFD E;  2LJU A;  4JI6 E;  2DLQ A;  3OTO I;  1XNR E;  4M30 A;  5K36 B;  2EMI A;  2RPC A;  4OO1 F;  3ZOQ B;  2K4V A;  1EI1 A;  2PNZ A;  1R6L A;  1DGC A;  3LTO A;  1Y4U A;  4JI8 I;  2EPK X;  4YY3 E;  3Q6M A;  4X64 E;  4R2C A;  2JY9 A;  2V87 A;  3GON A;  2JT2 A;  2UUB E;  4HY1 A;  2F4V E;  1HNZ I;  4USM A;  4JI7 I;  2EOR A;  3F6H A;  2L3C A;  1ZM4 A;  4QNJ A;  4BC9 A;  1H73 A;  2F1D A;  3WU4 A;  4X64 I;  2LJH A;  4FW9 A;  4JI5 I;  2VF1 A;  1PIE A;  4IFD D;  2RS6 A;  2V34 A;  1RHY A;  4FK5 C;  3L7Z A;  2PO1 B;  2H36 X;  4LF7 I;  4DKK A;  3THN A;  2EMH A;  2ENH A;  1N34 E;  4XTJ A;  1TN9 A;  1RQ0 A;  4DV0 E;  2ODR C;  2B9D A;  1B69 A;  3CDJ A;  4DR1 I;  1TF3 A;  2CSH A;  4R03 A;  2EPZ A;  2HC5 A;  1BKN A;  2NPF A;  3DJW A;  1K47 A;  1L4S A;  4LFB E;  3WU5 A;  2EOH A;  4BBY A;  2BA1 D;  3Q1Q A;  2NUF A;  4O43 A;  2EN3 A;  4NXN I;  3JTZ A;  2GHF A;  5IV8 B;  2MKN A;  4X9J A;  4IFD A;  2CZ9 A;  1Z5A A;  2LVH A;  2V8Q B;  2V8P A;  3LLH A;  4MQY A;  4PU9 A;  2EPM X;  2EMZ A;  3HXL A;  1BBO A;  5IWA I;  2JVA A;  4GKK E;  2YTN A;  4DV4 E;  2E5L E;  1F2I G;  4R2P A;  1XNQ E;  2WNR B;  2A25 A;  3BGH A;  5AC5 A;  2JOB A;  4B3T E;  3AV0 A;  2YU8 A;  1Z5B A;  2DEI A;  4GZN C;  2O1T A;  2DIX A;  3P1X A;  2EOF A;  1NHJ A;  4WYQ B;  1ZM2 A;  1DAR A;  3C6M A;  1MEY C;  1X5W A;  4ED4 A;  2L92 A;  1HR0 E;  1TF6 A;  3LML A;  5L3J A;  2C38 B;  2EM9 A;  3B4T A;  4I3H A;  1S16 A;  4GQU A;  2BM1 A;  4DV5 I;  2V2Q A;  2YU5 A;  2LUQ A;  4L8N A;  1MU5 A;  1SR9 A;  4GEQ B;  1A1G A;  5FWK A;  2F8B A;  4HAC A;  2B7T A;  4F9C B;  2EM0 A;  1T38 A;  2PO0 B;  3U1Y A;  1WRJ A;  1UIL A;  2WCC 3;  4JI7 E;  3J81 C;  5IXM B;  1N36 E;  4LF9 E;  2VQE E;  4L5N C;  2ZM6 I;  4LF6 E;  2MDG A;  3J7A G;  4F9B B;  1ELO A;  4NXM I;  4DR6 I;  4LFC I;  2C37 B;  1E3H A;  2CGE A;  3KRN A;  3C6K A;  1UDQ A;  3GCM A;  1FI4 A;  2CG9 A;  3M85 G;  2EOE A;  3EPK A;  4BA1 A;  4JI6 I;  2WBS A;  1NZ0 A;  2EML A;  4B3S I;  4O24 A;  3PYG A;  4DV7 E;  2NN6 E;  4EMD A;  2V85 A;  1EH8 A;  1N32 I;  4AQY I;  2DB2 A;  2YSO A;  4JI2 I;  2PNZ B;  3ZKD A;  2HK3 A;  1S4E A;  2EN7 A;  5C0X A;  4IS1 C;  5AE3 A;  3P06 A;  2NA2 A;  4MU0 A;  2AE8 A;  3PS1 A;  5BR8 E;  4DR2 E;  2BR2 A;  2EMX A;  2LCE A;  4WPY A;  1ZXN A;  5EKW A;  4DXL A;  2Z5E A;  3L00 A;  2PO2 A;  4U3D A;  4Q35 B;  1WHN A;  3KWR A;  4DUY E;  4NXM E;  4DR6 E;  1T4N A;  4BCA A;  3J81 Q;  1PJS A;  2EM7 A;  4N3O A;  1R6M A;  3T1Y I;  1UEK A;  2LE2 A;  4TUI A;  1YYK A;  4OZE A;  3CWV A;  4X65 E;  3PYE A;  5DRQ A;  4K0K I;  2EOI A;  2HK2 A;  1IQS A;  2YRK A;  2PO1 A;  1H74 A;  1ZU1 A;  4R2S A;  3EPJ A;  4LF8 E;  1HNW I;  4M0V A;  1H7U A;  4DUY I;  2ZIT A;  3IWB A;  1WJP A;  2GO4 A;  1Y60 A;  1UDN A;  2O1W A;  2LTR A;  4DR7 E;  3K85 A;  3GME A;  3ZZT A;  4OO1 D;  1XMQ E;  2LV2 A;  2Q2E B;  3WU3 A;  1A1L A;  4M1K A;  2EMB A;  4LF5 E;  5A6K A;  2KOU A;  3T1H E;  2J7J A;  2LBS B;  2VE7 C;  1H7S A;  1NCS A;  1QU6 A;  3OML A;  2YTG A;  1GQE A;  5LMU E;  1I94 E;  3PYD A;  5DRR A;  4OO1 A;  1X47 A;  2EOX A;  1ZBT A;  5DNX A;  4X66 E;  3BF2 A;  2NN6 D;  2EOQ A;  2EP3 A;  4M9V C;  4RPF A;  3GLL A;  2ADR A;  1QZR A;  2E1R A;  1XNQ I;  1FJG E;  3ECR A;  2UXC E;  2EPL X;  2EFG A;  4F9A B;  4AM3 A;  3F6G A;  2CTD A;  4DUZ E;  2UUC I;  1KJK A;  1B62 A;  2PO0 A;  3Q6N A;  2GLI A;  2YTP A;  1U2R A;  5A2Q C;  2EE8 A;  4HEI A;  1Z1B A;  3AUZ A;  3P3G A;  2YTF A;  3M7N D;  4LCH A;  2EOS A;  1X6H A;  2WP8 A;  1IBL I;  1FWL A;  1P42 A;  4DUZ I;  2C39 B;  2B7V A;  4YHH E;  3V2U C;  5C0X D;  1X49 A;  1QNT A;  2RTX A;  4JV5 E;  2WBU A;  4BS9 A;  2C37 A;  5EL9 A;  2EM8 A;  2EPC A;  4DV0 I;  3H4L A;  4P7A A;  3ZZ0 A;  5AE1 A;  3J7Y p;  2L3J A;  2NN6 F;  4LF7 E;  2IOP A;  2MDR A;  2B3T B;  3IWD A;  1VI7 A;  4MU3 A;  4DR4 I;  1PJQ A;  2UUC E;  4FW6 A;  5A2Q Q;  2Z5B B;  3K17 A;  2UUB I;  4DV3 E;  2KHX A;  2RS7 A;  5T6J A;  4M2Z A;  5KL3 A;  3UHM A;  1MGT A;  1J5E E;  3EQ1 A;  2MC6 A;  1Z59 A;  4LFA I;  1KTV A;  2X36 A;  2BV3 A;  4QNK A;  4LOM A;  4IS9 A;  1RR9 A;  2M4I A;  4DMI A;  2L2K B;  3VK6 A;  4DV2 I;  2EQ1 A;  2WBT A;  4IJD A;  4MDT A;  2FV4 B;  2V86 A;  3VHT B;  1OJ4 A;  3V5R A;  1ZAA C;  3L7Z B;  1HNX E;  4J8Z A;  1HK7 A;  2EPU A;  2R42 A;  3IWC A;  1X3C A;  3LPS A;  4WSP A;  2BR2 B;  2JYA A;  2VQF E;  1AAY A;  1DQ3 A;  3K6Q A;  2HFU A;  4DR7 I;  4DR3 E;  3HPS A;  4IZJ B;  1YSA C;  4JI3 E;  2EQ3 A;  1USU A;  4LPF A;  2UUA I;  4WUD A;  4IZK B;  1N34 I;  1OYP A;  2RSM A;  3H09 A;  3KZZ A;  2CVE A;  2JPA A;  2ZBK B;  4HXZ A;  1HNW E;  4IZK A;  2V83 A;  3MHH C;  1EH7 A;  4DR3 I;  2ODR D;  1YYW A;  2JXP A;  4USK A;  1ZR9 A;  2V89 A;  2WZO A;  2DEJ A;  2X7I A;  3M85 D;  2WP8 B;  4HYM A;  4WXD A;  2WNR A;  2DMY A;  4O5G A;  2EMC A;  2N3H A;  1KKH A;  3HTX A;  2EOJ A;  1O0W A;  2MC5 A;  2EOY A;  1RC7 A;  3PS2 A;  4DPW A;  5KL7 A;  1PDA A;  1Z0G A;  3QT8 A;  4DV1 I;  2NN6 A;  1YPN A;  3BBG A;  2I13 A;  2YTE A;  1STU A;  4NZV A;  3OTO E;  1XXE A;  5KL6 A;  3J80 C;  4MYU A;  4LF8 I;  2M9A A;  3FIG A;  4IFD B;  3TQM A;  4TUG A;  4FN5 A;  2ZM6 E;  5A6B D;  3J7A M;  4BC7 A;  4AIM A;  4GKJ E;  4FW5 A;  2UXD I;  4DV6 E;  1KIJ A;  1WUU A;  1XHK A;  2J65 A;  4DR4 E;  1YUI A;  1Z0W A;  4JI3 I;  3MSW A;  5FLX C;  2RQL A;  2NUG A;  2R1F A;  1BBG A;  3ADI A;  5DNL A;  4BA2 A;  1AH5 A;  4FW4 A;  4X8W A;  3VYX A;  4R2D A;  4DV5 E;  3B78 A;  3C4T A;  2EM5 A;  2YZT A;  2UU9 E;  2Z5C A;  4LF6 I;  4JV5 I;  2VQF I;  5KL2 A;  2JR1 A;  1GTK A;  2JE6 A;  1X48 A;  1JK2 A;  1HR0 I;  2C38 A;  4OKG A;  2HJJ A;  2EOZ A;  2IOQ A;  5JEA B;  2E1M A;  3VYY A;  2EMF A;  2UXD E;  2HGH A;  4WX9 A;  2JOX A;  5F3W A;  1FNM A;  1EA6 A;  4X62 I;  3EPL A;  2G7H A;  4B3R I;  1ZM3 A;  4P52 A;  4B3M I;  2EM4 A;  1USV A;  3M6A A;  1GZ6 A;  2EPP A;  3JU0 A;  2BA0 D;  4P7D A;  2N3G A;  3J80 Q;  1J5E I;  4JYA E;  4UTG A;  2EPO A;  2DSY A;  5K36 C;  3QG5 C;  2EN6 A;  2JEA B;  2O1V A;  1XMO I;  1X6F A;  4B3R E;  3QT5 A;  2V88 A;  2JEA A;  2VES A;  4IFD C;  1YHC A;  4DR5 I;  4MU4 A;  4DU8 A;  5LMU I;  4BHC A;  2J7K A;  1ZM9 A;  5C0X B;  1T4O A;  2V2Z A;  4DPY A;  3M99 B;  5C0X C;  4JYA I;  4Z7C A;  2ENC A;  4DR1 E;  3HPZ A;  4F54 A;  1Z5C A;  2EN1 A;  2IER A;  2C39 A;  4ZYG A;  2YTO A;  2DLK A;  1N0V C;  1YYO A;  2YRH A;  3NZK A;  4YHH I;  2IHR 1;  1T39 A;  4NHR A;  3MHS C;  2Z5C B;  2EL4 A;  2MKD A;  2O3Z A;  4FW7 A;  4FWG A;  3JAM Q;  4NXN E;  2HFS A;  4F6M A;  1UHZ A;  3QT6 A;  4WUB A;  1A1H A;  4LFB I;  2BA0 G;  2ELZ A;  1Y5Y A;  1FWK A;  2F4V I;  4NBQ A;  2JEB A;  3T1Y E;  2EMW A;  2EPA A;  1H72 C;  2EPX A;  5A6A A;  2VF3 A;  3K1J A;  1PVG A;  1OYS A;  2JEB B;  4DPT A;  1YH8 A;  2NN6 B;  4YY3 I;  1Y6Z A;  2UXC I;  3UK3 C;  1MG7 A;  3LNU A;  3PS3 A;  3PRY A;  2JE6 B;  2GQ0 A;  3ZZU A;  3ADL A;  5IT9 Q;  1LLM C;  4AID A;  4PRV A;  4MLV A;  1A1J A;  2PNM A;  2L8T A;  3QT7 A;  2BM0 A;  4FWH A;  5JEA C;  1PJT A;  2RSI A;  4DV1 E;  3D4J A;  5JEA E;  5LMN E;  4ZVI A;  2LO3 A;  4JI5 E;  4OO1 B;  2UXB E;  1YFH A;  1DI2 A;  4DV6 I;  4AQY E;  1I94 I;  2BBG A;  1X6E A;  4P78 A;  2O1U A;  2JWO A;  1P47 A;  4DV7 I;  3T1H I;  4LF5 I;  4ZYH A;  4OO1 C;  1N3G A;  2VRD A;  4JI8 E;  4B3S E;  1XMQ I;  4JI1 E;  3M7N G;  4HAC B;  2GPI A;  4R2Q A;  2YTI A;  4R2A A;  1ZBQ A;  3ADJ A;  4IZJ D;  1XNR I;  2EMK A;  2UUA E;  1JK1 A;  3RMP A;  4R2E A;  2YWQ A;  2EMA A;  2PNL A;  5FLX Q;  2V2V A;  2YT4 A;  3THO B;  1EH6 A;  4DPX A;  2DMI A;  1N36 I;  4LF9 I;  1NHH A;  4MYT A;  4K0K E;  4X65 I;  5A6B A;  2Q8U A;  5C0X E;  1IMU A;  4R2R A;  1RMD A;  1HNX I;  4RH8 A;  3HKM A;  5GME A;  1FKA E;  2D9H A;  1YZ9 A;  4LU9 A;  4DV2 E;  2A2D A;  4PRX A;  4IZJ A;  2L2N A;  2EWL A;  3JAM C;  1Z0V A;  1A6F A;  2LTS A;  2EQ0 A;  2L2M A;  2LUP B;  4F6N A;  4LCG A;  5JEA A;  5KL5 A;  2NAB A;  2L33 A;  2Z5B A;  5AE2 A;  2EPN A;  4LF4 I;  2FGG A;  1MX0 A;  2BA1 G;  4JI2 E;  5KL4 A;  4WFT A;  1N32 E;  4FW3 A;  2OI2 A;  2YRM A;  2R3V A;  5K36 D;  5CFF E;  4KQV A;  2YPN A;  5LL6 R;  2LT7 A;  5JEA D;  4WSG A;  2CPN A;  5LMN I;  4OX9 I;  1UN6 B;  1NEI A;  2CT1 A;  4WXC A;  1NHI A;  3WU6 A;  4N4R B;  4Q28 A;  4IFD F;  1OYR A;  1VIS A;  4LFA E;  4WUC A;  1Y4S A;  4OOG C;  4LFC E;  4KHP I;  3HJC A;  3F0N A;  5A6J A;  2EL6 A;  5IT9 C;  4ISA A;  2YTD A;  4UT4 A;  5IWA E;  1B63 A;  4GKK I;  1A1I A;  1KYQ A;  4OO1 E;  1UDO A;  4DV3 I;  4MU1 A;  2VQE I;  2EZ6 A;  2A2C A;  4LTY A;  4ZYE A;  1WXR A;  3PYF A;  1IBM I;  2K7I A;  2PRT A;  4Z7Y A;  1Z0E A;  1N33 E;  1IBL E;  2PO2 B;  4KZS A;  3DD6 A;  4JI4 I;  4BMJ A;  2IES A;  1PKP A;  1D6T A;  1YUJ A;  5K36 E;  3CDI A;  4I8O A;  2KON A;  5GMD A;  1IBM E;  4JI0 E;  1RRE A;  2R76 A;  2LMZ A;  3P76 A;  3BID A;  1A1K A;  4JG4 A;  3DF6 A;  2FTX B;  1WHQ A;  3C4B A;  2M1S A;  2YTJ A;  4KHP E;  2LJP A;  5JEA F;  5TSE A;  1UBD C;  5K36 A;  1SFE A;  4JI0 I;  3U1K A;  4J3D A;  1KVK A;  4BA1 B;  4DR5 E;  2EM3 A;  3KZY A;  4X66 I;  2ELY A;  4JI4 E;  2GS8 A;  4KWY A;  3B8H A;  1N33 I;  1EKZ A;  2EM2 A;  4ZYD A;  2HKE A;  2EPR A;  2DGC A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 4GKJ I;  4B3T I;  2M7Q A;  1Z0B A;  4LF4 E;  1FJG I;  4DV4 I;  3HQ1 A;  2E5L I;  1T4L B;  1ZXM A;  4B3M E;  4FWD A;  1J26 A;  4OX9 E;  4R8O A;  4X62 E;  2UXD I;  5DNY A;  1IBK E;  4DPU A;  4DU7 A;  2AJ4 A;  1Z0T A;  3ZM7 A;  4R1F A;  1Z0C A;  2HHH I;  2UU9 I;  1XMO E;  3HUL A;  1N0U A;  3ADG A;  3B82 A;  2HKJ A;  2LRS A;  2HHH E;  4DR2 I;  2NUE A;  4URL A;  5BR8 I;  2L6M A;  4JI1 I;  3ZKB A;  5AAS A;  2WW4 A;  2XEX A;  1HNZ E;  1IBK I;  2UXB I;  4JI6 E;  3OTO I;  1XNR E;  4M30 A;  3ZOQ B;  2K4V A;  1EI1 A;  4JI8 I;  3LTO A;  1Y4U A;  4YY3 E;  3Q6M A;  4X64 E;  2JY9 A;  2V87 A;  3GON A;  4HY1 A;  2UUB E;  2F4V E;  1HNZ I;  4USM A;  4JI7 I;  3WU4 A;  3F6H A;  2L3C A;  1ZM4 A;  4BC9 A;  1H73 A;  4JI5 I;  2LJH A;  4FW9 A;  2VF1 A;  1PIE A;  2RS6 A;  2V34 A;  2H36 X;  4LF7 I;  4DKK A;  1N34 E;  4XTJ A;  1RQ0 A;  4DV0 E;  2ODR C;  2B9D A;  4DR1 I;  4R03 A;  1BKN A;  2NPF A;  3DJW A;  1K47 A;  4LFB E;  3WU5 A;  3Q1Q A;  4BBY A;  2NUF A;  4NXN I;  3JTZ A;  2CZ9 A;  1Z5A A;  2V8Q B;  2V8P A;  3LLH A;  4PU9 A;  3HXL A;  5IWA I;  2JVA A;  4GKK E;  4DV4 E;  2E5L E;  1XNQ E;  2JOB A;  4B3T E;  3AV0 A;  1Z5B A;  2DEI A;  2O1T A;  2DIX A;  3P1X A;  1NHJ A;  4WYQ B;  1ZM2 A;  1DAR A;  4ED4 A;  2L92 A;  1HR0 E;  3LML A;  5L3J A;  4I3H A;  1S16 A;  2BM1 A;  4DV5 I;  2V2Q A;  2LUQ A;  4L8N A;  1MU5 A;  1SR9 A;  4GEQ B;  5FWK A;  2F8B A;  4HAC A;  2B7T A;  4F9C B;  1UIL A;  4JI7 E;  3J81 C;  1N36 E;  4LF9 E;  2VQE E;  4L5N C;  2ZM6 I;  4LF6 E;  3J7A G;  4F9B B;  1ELO A;  4NXM I;  4DR6 I;  4LFC I;  2CGE A;  1FI4 A;  2CG9 A;  4JI6 I;  1NZ0 A;  4B3S I;  3PYG A;  4DV7 E;  4EMD A;  2V85 A;  1N32 I;  4AQY I;  2DB2 A;  4JI2 I;  3ZKD A;  2HK3 A;  1S4E A;  5AE3 A;  3P06 A;  2NA2 A;  5BR8 E;  4DR2 E;  4DXL A;  4WPY A;  1ZXN A;  2Z5E A;  1WHN A;  3KWR A;  4DUY E;  4NXM E;  4DR6 E;  1T4N A;  4BCA A;  3J81 Q;  4N3O A;  3T1Y I;  1UEK A;  2LE2 A;  4TUI A;  1YYK A;  3CWV A;  4X65 E;  3PYE A;  4K0K I;  2HK2 A;  1H74 A;  4LF8 E;  1HNW I;  4M0V A;  1H7U A;  4DUY I;  2ZIT A;  3IWB A;  2O1W A;  2LTR A;  4DR7 E;  3K85 A;  3ZZT A;  1XMQ E;  2Q2E B;  3WU3 A;  4M1K A;  4LF5 E;  2KOU A;  3T1H E;  2LBS B;  1H7S A;  2VE7 C;  3PYD A;  1QU6 A;  3OML A;  5LMU E;  1GQE A;  1I94 E;  1X47 A;  1ZBT A;  4X66 E;  4RPF A;  1QZR A;  2E1R A;  1XNQ I;  1FJG E;  2UXC E;  2EFG A;  4F9A B;  3F6G A;  4DUZ E;  2UUC I;  1B62 A;  3Q6N A;  1U2R A;  5A2Q C;  3AUZ A;  1IBL I;  1FWL A;  4DUZ I;  2B7V A;  4YHH E;  3V2U C;  1X49 A;  2RTX A;  4JV5 E;  4BS9 A;  4DV0 I;  3H4L A;  4P7A A;  3ZZ0 A;  5AE1 A;  3J7Y p;  2L3J A;  4LF7 E;  2IOP A;  2MDR A;  2B3T B;  3IWD A;  4DR4 I;  2UUC E;  5A2Q Q;  2Z5B B;  3K17 A;  2UUB I;  4DV3 E;  2KHX A;  2RS7 A;  5T6J A;  4M2Z A;  1J5E E;  4LFA I;  2MC6 A;  1Z59 A;  1KTV A;  2X36 A;  2BV3 A;  1RR9 A;  2M4I A;  4DMI A;  2L2K B;  3VK6 A;  4DV2 I;  3V5R A;  2FV4 B;  2V86 A;  1OJ4 A;  1HNX E;  4J8Z A;  1HK7 A;  2R42 A;  3IWC A;  3LPS A;  4WSP A;  2VQF E;  1DQ3 A;  3K6Q A;  2HFU A;  4DR7 I;  4DR3 E;  3HPS A;  4IZJ B;  4JI3 E;  1USU A;  2UUA I;  4WUD A;  4IZK B;  1N34 I;  2RSM A;  3H09 A;  2ZBK B;  4HXZ A;  4IZK A;  1HNW E;  4DR3 I;  2V83 A;  4LF8 I;  2ODR D;  1YYW A;  4USK A;  2V89 A;  2WZO A;  2DEJ A;  2X7I A;  4HYM A;  2DMY A;  2N3H A;  1KKH A;  3HTX A;  2MC5 A;  1O0W A;  1RC7 A;  4DPW A;  1Z0G A;  3QT8 A;  4DV1 I;  1STU A;  3OTO E;  3J80 C;  4MYU A;  3FIG A;  4TUG A;  4FN5 A;  2ZM6 E;  3J7A M;  4BC7 A;  4GKJ E;  4DV6 E;  1KIJ A;  1WUU A;  1XHK A;  4DR4 E;  1Z0W A;  3MSW A;  5FLX C;  2NUG A;  3ADI A;  4X8W A;  3VYX A;  4DV5 E;  3B78 A;  3C4T A;  2UU9 E;  2YZT A;  2Z5C A;  4LF6 I;  4JV5 I;  2VQF I;  2JR1 A;  1X48 A;  1HR0 I;  2IOQ A;  2E1M A;  3VYY A;  2UXD E;  1FNM A;  2JOX A;  5F3W A;  4X62 I;  1EA6 A;  2G7H A;  4B3R I;  1ZM3 A;  4P52 A;  4B3M I;  1USV A;  3M6A A;  1GZ6 A;  3JU0 A;  4P7D A;  2N3G A;  3J80 Q;  1J5E I;  4JYA E;  4UTG A;  2DSY A;  2O1V A;  1XMO I;  4B3R E;  3QT5 A;  2V88 A;  4DR5 I;  4DU8 A;  5LMU I;  2J7K A;  1ZM9 A;  1T4O A;  2V2Z A;  4DPY A;  4JYA I;  4Z7C A;  4DR1 E;  3HPZ A;  4F54 A;  1Z5C A;  1N0V C;  1YYO A;  4YHH I;  2IHR 1;  2Z5C B;  4FWG A;  3JAM Q;  4NXN E;  2HFS A;  1UHZ A;  3QT6 A;  4WUB A;  4LFB I;  1FWK A;  2F4V I;  3T1Y E;  1H72 C;  2VF3 A;  3K1J A;  4DPT A;  4X64 I;  4JI3 I;  1PVG A;  2UXC I;  4YY3 I;  1Y6Z A;  3LNU A;  1MG7 A;  3PRY A;  2GQ0 A;  3ZZU A;  3ADL A;  5IT9 Q;  4PRV A;  2PNM A;  2L8T A;  3QT7 A;  2BM0 A;  4FWH A;  4DV1 E;  3D4J A;  5LMN E;  4ZVI A;  4JI5 E;  2UXB E;  4DV6 I;  1DI2 A;  1I94 I;  4AQY E;  4P78 A;  2O1U A;  3T1H I;  2JWO A;  4DV7 I;  4LF5 I;  4B3S E;  4JI8 E;  1XMQ I;  4JI1 E;  4HAC B;  1ZBQ A;  3ADJ A;  4IZJ D;  1XNR I;  2UUA E;  3RMP A;  2PNL A;  5FLX Q;  2V2V A;  2YT4 A;  4DPX A;  1N36 I;  4LF9 I;  1NHH A;  4MYT A;  4K0K E;  4X65 I;  1HNX I;  5GME A;  1FKA E;  2A2D A;  1YZ9 A;  4LU9 A;  4DV2 E;  4PRX A;  4IZJ A;  2L2N A;  2EWL A;  3JAM C;  1Z0V A;  1A6F A;  2LTS A;  2LUP B;  2L2M A;  2Z5B A;  2L33 A;  5AE2 A;  4LF4 I;  2FGG A;  1MX0 A;  4JI2 E;  4WFT A;  1N32 E;  2OI2 A;  2R3V A;  5CFF E;  4KQV A;  5LL6 R;  4OX9 I;  2CPN A;  5LMN I;  1NHI A;  3WU6 A;  4Q28 A;  1VIS A;  4LFA E;  4WUC A;  1Y4S A;  4OOG C;  4LFC E;  4KHP I;  3HJC A;  3F0N A;  5IT9 C;  4GKK I;  4UT4 A;  5IWA E;  1B63 A;  4DV3 I;  2VQE I;  2EZ6 A;  2A2C A;  4LTY A;  3PYF A;  1WXR A;  1IBM I;  4Z7Y A;  1Z0E A;  1N33 E;  1IBL E;  4KZS A;  4JI4 I;  4BMJ A;  1PKP A;  1D6T A;  4I8O A;  2KON A;  5GMD A;  1IBM E;  4JI0 E;  1RRE A;  2LMZ A;  4JG4 A;  3DF6 A;  2FTX B;  1WHQ A;  3C4B A;  2M1S A;  4KHP E;  2LJP A;  4JI0 I;  1KVK A;  4DR5 E;  4X66 I;  2GS8 A;  4JI4 E;  3B8H A;  1N33 I;  1EKZ A;  2HKE A;  5ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...