1XNRE

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnrE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrE02
3ADGA 3J7AG 3ZKBA 5GMEA 4NXNE 4HACB 2GS8A 3J80C 3ZZUA 1WHQA 4DV7E 2VQFI 3WU4A 1QZRA 2UXCI 2RTXA 2KHXA 1ZM2A 2Q2EB 4YHHI 4DV0I 4DUYI 3K17A 2AJ4A 2UUBI 4LFBE 1O0WA 3T1HE 5BR8E 4DXLA 4M1KA 4YY3E 2ZM6E 4DV5I 1RQ0A 1STUA 3JAMQ 2YT4A 4LF6E 5A2QQ 2UXDI 3C4BA 1I94E 5IT9Q 1IBKE 4M30A 4X65I 1ZXNA 3QT8A 4OX9E 4LF8I 1KKHA 2DIXA 2RSMA 1FI4A 1Z0CA 3ZM7A 4MYUA 4JI5I 1H72C 2NA2A 4GKKE 4DU8A 5IWAI 4P7AA 1S16A 1HR0I 3LNUA 1VISA 4JYAI 4JI3I 2HHHI 3QT5A 1ZM9A 1Z5AA 1UHZA 1IBLI 4PRVA 4XTJA 1KVKA 1X47A 4URLA 2ZBKB 1HNZE 4DV1I 4DV6E 1MG7A 1DARA 4B3MI 1WHNA 4DPWA 2VQEE 4X64I 2JVAA 4FN5A 1NZ0A 4DPXA 4DR2I 4JI6E 4LFAE 1MX0A 2XEXA 1XHKA 1DI2A 4JI4I 1Z5CA 2F4VE 2MDRA 1H73A 3WU5A 1ELOA 1HNXE 2V2VA 4WFTA 2UUCI 4JI8E 1N0VC 1N32E 1XMQI 5FLXQ 2RS7A 1RR9A 2UU9E 4LF4E 1XNQI 3J81C 3V2UC 1NHIA 3OTOI 2HK3A 3PYDA 4GKJI 4HY1A 3F0NA 4B3SE 4HYMA 4LF5I 1H7UA 2R42A 2V34A 4FWHA 4KHPE 4LF7E 4WUBA 4DR5E 4DV3E 1FNMA 2BV3A 3D4JA 1PKPA 2HFSA 4JI2I 5CFFE 3V5RA 2UUAI 1Z0BA 1A6FA 1XNRE 4DPTA 3B8HA 2BM0A 4UTGA 4I3HA 4JI7I 1FWLA 4NXNI 1HNWI 3QT7A 1N33E 4DV7I 4ED4A 5LL6R 4LFCE 3PYFA 4HACA 1MU5A 3JAMC 2UXCE 4PRXA 4JG4A 3ZZTA 4DV0E 4LFBI 3J80Q 3T1HI 3LTOA 4DR7I 3T1YI 2UUBE 2DEIA 4YY3I 1K47A 1UILA 1Z0VA 4DV5E 1T4OA 4DV2I 2NUFA 3HULA 4X62E 1I94I 2L2NA 4OOGC 1PIEA 1Z5BA 2HFUA 3K1JA 4OX9I 2NPFA 4X65E 2DEJA 4DR6E 3WU6A 4LF8E 2DB2A 4DR1I 1ZM4A 4WUDA 4DUZI 4DV4I 1X48A 1FJGE 4USKA 4DR3I 4GKKI 2UXBE 1N0UA 4B3RI 5IWAE 1YYOA 3ADIA 1HR0E 1B63A 2HHHE 2OI2A 1EKZA 1J5EE 3PYGA 4WUCA 4LF9I 1J26A 2N3GA 1HNZI 4DV6I 1ZBTA 4P52A 2L33A 1PVGA 2X7IA 3CWVA 4DPUA 1IBMI 2NUEA 3ADJA 1UEKA 2ZITA 2V2QA 1OJ4A 4JI6I 1U2RA 4LFAI 4JV5E 4DR2E 4JI0E 3GONA 4DU7A 4USMA 2DMYA 1RC7A 4KQVA 5LMNI 2LUPB 1KIJA 2LUQA 3P1XA 2LJPA 4K0KI 4JI1E 4JI8I 2RS6A 1H74A 1N32I 1Z0TA 1RREA 4X66E 1XMQE 2EZ6A 2UU9I 4LF4I 5L3JA 1N34E 2R3VA 1T4LB 1H7SA 1XNQE 4NXME 1XMOE 2E5LE 4B3SI 3VYXA 4MYTA 2V2ZA 4FWDA 3J81Q 1NHJA 4AQYI 2L3JA 4R1FA 4B3TE 1GQEA 1FWKA 1WUUA 4ZVIA 4DR5I 5LMUE 4DR4E 4PU9A 4HXZA 2X36A 3LLHA 4JI2E 1N36E 3B78A 2E1RA 1XNRI 3QT6A 3WU3A 3ZZ0A 1QU6A 4JI7E 2VQFE 2B3TB 4M2ZA 3C4TA 2B7VA 4DKKA 1N33I 1HNWE 3J7AM 1Z0GA 1S4EA 5A2QC 4YHHE 4DUYE 4LFCI 2EFGA 2IHR1 2L3CA 5BR8I 2ZM6I 5IT9C 2HKEA 4LF6I 1Z59A 4RPFA 4FWGA 1BKNA 2UXDE 4DR7E 1IBKI 3T1YE 3M6AA 1X49A 3PYEA 1Z0EA 1NHHA 4X62I 2LRSA 4DV2E 2CPNA 1ZXMA 3HTXA 3LPSA 3B82A 1YZ9A 2L2KB 4DR6I 4JI5E 3VYYA 3Q1QA 4DR1E 1ZM3A 2L2MA 1FJGI 4DUZE 4DV4E 2JY9A 2UXBI 4JYAE 4JI3E 4DR3E 4Z7YA 1FKAE 1IBLE 3H4LA 2NUGA 4B3RE 2A2DA 4DPYA 3J7Yp 1J5EI 4DV1E 1T4NA 2VQEI 2N3HA 2J7KA 4B3ME 5GMDA 1B62A 4LF9E 4X64E 1Z0WA 2LTRA 5FLXC 2V8PA 4JI4E 1IBME 2LJHA 2F4VI 4JV5I 1HNXI 4JI0I 2BM1A 1EA6A 2UUCE 5LMNE 4X8WA 3ADLA 4FW9A 2CZ9A 2LTSA 4JI1I 1YYKA 4K0KE 4EMDA 3OTOE 4X66I 4GKJE 4Z7CA 1N34I 2WW4A 4UT4A 4NXMI 4LF5E 1XMOI 3ZKDA 2B7TA 2E5LI 4KHPI 4LF7I 4DV3I 2A2CA 1YYWA 2HK2A 4B3TI 4AQYE 2UUAE 4WYQB 1EI1A 1D6TA 5LMUI 2VF3A 4DR4I 2LBSB 2HKJA 1KTVA 1N36I
chains in the Genus database with same CATH superfamily
3IWBA 3P3GA 4GZNC 2JR1A 3ADGA 2JP9A 3J7AG 3ZKBA 5K36B 2EN7A 5KL4A 2EPRA 1R6LA 4MQYA 5GMEA 2EMLA 1YSAC 4NXNE 4HACB 4MU1A 2EQ1A 2K7IA 4IFDD 1T38A 2YRHA 3NZKA 3PRYA 4ISAA 3AV0A 2GS8A 3J80C 1Z1BA 3ZZUA 2B9DA 2EJ4A 1WHQA 3C6KA 4BS9A 2EOSA 4WX9A 4DV7E 2O1WA 2FGGA 3PS3A 4FW3A 2EQ3A 3WU4A 1MGTA 1QZRA 2UXCI 2RTXA 2A25A 2DGCA 2KHXA 5AE3A 5JEAA 1ZM2A 2Q2EB 2K4VA 4YHHI 4DV0I 4DUYI 2CSHA 3K17A 2EMBA 2V87A 2AJ4A 2UUBI 1WXRA 4IS1C 3LMLA 4LFBE 1O0WA 2YTGA 3HJCA 3T1HE 1GZ6A 3M85G 5BR8E 2MKDA 4M1KA 4DXLA 4YY3E 1DQ3A 2ZM6E 3MHHC 2EN2A 2JE6A 4DV5I 2UU9I 3DF6A 1RQ0A 1STUA 4KZSA 1USUA 2YT4A 2EPZA 3JAMQ 1Y4SA 4LF6E 2Z5BA 1YHCA 2CVEA 2PNMA 1ZR9A 2EL5A 5AASA 4OO1A 4BMJA 2M9AA 5A2QQ 2UXDI 3C4BA 1I94E 4BBYA 4AIMA 1Y6ZA 1JK2A 5IT9Q 1IBKE 4M30A 4X65I 1ZXNA 3QT8A 2PNZB 1UDSA 2R1FA 1SFEA 4OX9E 2IOQA 4LF8I 2ELYA 1KKHA 2ADRA 2DIXA 2DLKA 2H36X 3F6GA 2RSMA 3BIDA 4N4RB 1FI4A 3HXLA 1VI7A 5DROA 2EM6A 2NN6F 4IZKA 1Z0CA 4ZYHA 2BB8A 3ZM7A 2EM0A 4MYUA 1Y4UA 4JI5I 1H72C 4R2QA 2NA2A 2NN6D 4GKKE 2PO2A 4OO1E 4DU8A 2DMIA 2EOYA 5IWAI 4P7AA 1S16A 2C37A 2JXPA 2WBSA 2BR2A 2V8QB 3Q6MA 1EH6A 1HR0I 3LNUA 1VISA 4JYAI 1QNTA 2WCC3 4JI3I 2HHHI 2E72A 3QT5A 2J65A 1ZM9A 1Z5AA 4IFDE 1UHZA 4IZJA 1IBLI 2F1DA 4PRVA 4XTJA 3KWRA 2LJUA 1KVKA 2JWOA 2EMHA 2GPIA 2YSOA 4QNJA 1X47A 4URLA 2ZBKB 2YPNA 4GQUA 2IOPA 2DLQA 1HNZE 4NBQA 5DRPA 4DV1I 2O1TA 4DV6E 3K85A 1MG7A 1DARA 2YTPA 2IESA 1WHNA 1L4SA 4ZYDA 4DPWA 4B3MI 4Q35B 2VQEE 3MHSC 4X64I 2JVAA 4FN5A 1NZ0A 2ENHA 2YTQA 3B4TA 4JI6E 5KL3A 4DPXA 5JEAC 1T39A 4DR2I 2HGHA 4LFAE 1MX0A 2EMKA 1XHKA 2XEXA 1TF6A 1A1LA 1DI2A 5DRQA 2Z5CB 4JI4I 2J7JA 1Z5CA 2LT7A 2NN6A 4LCHA 1PJTA 2L8TA 2F4VE 2MDRA 2EMFA 1H73A 2EPNA 3WU5A 1ELOA 2EN4A 1HNXE 2V2VA 4WFTA 2UUCI 5C0XD 2LCEA 4OO1C 4J8ZA 4JI8E 1N0VC 1N32E 1XMQI 5FLXQ 4R2DA 2RS7A 4BA1A 4ZYEA 2WNRA 1RR9A 2UU9E 4LF4E 1XNQI 2NABA 3BBGA 3J81C 2GO4A 3V2UC 1NHIA 2LMZA 1R6MA 2EOFA 5ADZA 2DRPA 2HK3A 3OTOI 3PYDA 4GKJI 4HY1A 4IFDC 2MDGA 2EOOA 4IS9A 2WP8B 3F0NA 4R2CA 4B3SE 5LLQA 3H1CA 3Q6NA 4HYMA 2R76A 1UDNA 4LF5I 4BHCA 5K36D 5T6JA 1H7UA 3MSWA 5A6AA 2R42A 3THNA 4RH8A 2YRKA 2GO3A 2V34A 1X6EA 4FWHA 4KHPE 2EMGA 2PRTA 4LF7E 4WUBA 4DR5E 2EPXA 4DV3E 1FNMA 1IMUA 4KWYA 2C39B 1F2IG 2BV3A 4P78A 4QNKA 1MEYC 3D4JA 2FV4B 4BA2A 1PKPA 2HFSA 5AC4A 3HKMA 5CFFE 3V5RA 2YTDA 2UUAI 4JI2I 1Z0BA 1A6FA 4LCGA 5C0XA 3GMEA 1AH5A 1XNRE 4U3DA 2RPCA 4DPTA 3B8HA 4J3DA 4TUIA 2BM0A 1G2DC 1UN6B 4UTGA 4I3HA 4JI7I 2EMXA 1X3CA 2YZTA 2C38A 1FWLA 4NXNI 2EM9A 3U1YA 1HNWI 3QT7A 1WRJA 2CTDA 2ODRC 1N33E 4WXDA 4AM3A 4DV7I 2JOXA 2V89A 4ED4A 5LL6R 5K36A 2D9HA 4L5NC 4LFCE 3PYFA 2M4IA 1P42A 4F54A 4HACA 2YSPA 1MU5A 2NN6C 3JAMC 2UXCE 3GLLA 2EOIA 4TUGA 4JG4A 4PRXA 3ZZTA 2WBUA 4DV0E 4LFBI 1YPNA 4IZJD 1NEIA 2EMIA 3J80Q 2EMWA 3LTOA 3T1HI 2YWQA 3T1YI 2KOUA 2UUBE 4DR7I 2DEIA 4YY3I 1K47A 2EPMX 1X6FA 5KL5A 2EOQA 3EQ1A 1UILA 2CT1A 1Z0VA 4DV5E 2O1UA 2GLIA 1T4OA 2EL4A 4DV2I 2NUFA 3HULA 5JEAE 4X62E 1I94I 2E1MA 1SR9A 4IFDB 1Y5YA 2ODRD 1E3HA 2L2NA 4OOGC 1PIEA 1Z5BA 2HFUA 3K1JA 2JEAB 5ELWA 4OX9I 2NPFA 4X65E 1WJPA 2DEJA 2RSIA 4DR6E 1UDOA 4HTGA 2BA0G 2EOEA 3WU6A 2V85A 4LF8E 2DB2A 2L92A 4DR1I 4I8OA 1ZM4A 4R2EA 1PDAA 2YTNA 3KZZA 4ZYGA 5A6BD 5DNLA 2EM7A 4WUDA 4DUZI 2PNZA 4DV4I 1X48A 3CDJA 1FJGE 1EH7A 1BBOA 4USKA 4DR3I 4GKKI 2UXBE 4N3OA 2EOZA 4FW5A 1PJSA 4FW4A 2IERA 1N0UA 4B3RI 5IWAE 4MU3A 3QG5C 5C0XC 1YYOA 3ADIA 1HR0E 2DSYA 4RHBB 1B63A 3RMPA 3CDIA 2HHHE 2OI2A 1EKZA 1KJKA 2PO0B 1J5EE 3PYGA 4WUCA 2EPCA 3KZYA 4LF9I 3ZOQB 1J26A 3GCMA 2N3GA 1HNZI 4DV6I 1ZBTA 1DGCA 4P52A 2L33A 1PVGA 2X7IA 4O24A 2AE8A 4NHRA 3CWVA 1LLMC 4DPUA 1IBMI 5K36C 4WSPA 3L7ZB 2NUEA 2MC6A 3ADJA 1UEKA 2CG9A 2EE8A 2V2QA 2ZITA 1OJ4A 5A6BA 4JI6I 1U2RA 4LFAI 4JV5E 4R03A 4DR2E 4JI0E 3GONA 4DU7A 2EN6A 2G7HA 2YRMA 2DMYA 2LV2A 4BC7A 4OZEA 1RC7A 4USMA 2VF1A 2F8BA 4KQVA 5LMNI 1ZU1A 2V83A 2LUPB 1KIJA 2LUQA 3P1XA 2LJPA 1Y60A 3THOB 3DD6A 4K0KI 4JI1E 4JI8I 2RS6A 1H74A 1N32I 2Z5CA 1Z0TA 1RREA 3P06A 4BC9A 4X66E 2EPPA 1XMQE 1TF3A 2EZ6A 1IQSA 2JEBB 3DJWA 2NN6E 1N34E 5L3JA 4LF4I 2R3VA 2JT2A 1T4LB 1H7SA 1A1FA 2O3ZA 1XNQE 3BGHA 2YU8A 2EMZA 2L6MA 4NXME 5KL7A 1XMOE 3K6QA 1KYQA 1GTKA 5IXMB 2E5LE 3U1KA 2O1VA 2VESA 4B3SI 2PO1B 3VYXA 3P3EA 2HC5A 4MYTA 5KL2A 4M9VC 4U3BA 2V2ZA 4FWDA 2EPKX 2BBGA 1OYSA 1RHYA 3J81Q 1NHJA 4AQYI 2L3JA 4R1FA 1N33I 3UK3C 4B3TE 2EM2A 2BA1D 4HEIA 1GQEA 1FWKA 1WUUA 2EPLX 2WP8A 2EQ0A 5DRRA 4ZVIA 4DR5I 1N3GA 4FW7A 5LMUE 3EPJA 4DR4E 4PU9A 2MC5A 2FTXB 4FK5C 3F6HA 4GEQB 2X36A 4HXZA 5DNXA 3LLHA 4OO1F 2EWLA 2EPAA 4JI2E 4O5GA 1N36E 1A1IA 1BBGA 3TQMA 4LU9A 3B78A 2EMCA 4O4KA 1YH8A 2E1RA 4LOMA 1XNRI 3JTZA 4R8OA 5AE2A 2C39A 5JEAB 3QT6A 3WU3A 1X5WA 3ZZ0A 3HQ1A 1QU6A 3EPLA 2BA0D 2EM3A 4AIDA 4JI7E 4IFDF 2VQFE 2B3TB 2EOXA 3HPSA 4M2ZA 3C4TA 2B7VA 4DKKA 2JE6B 5A6KA 2YTFA 2GHFA 1HNWE 5C0XE 2LE2A 5F3WA 4LTYA 2VQFI 2JYAA 3J7AM 1Z0GA 1S4EA 2Z5BB 5A2QC 4YHHE 4OO1B 3P76A 4DUYE 1HK7A 4LFCI 2EFGA 4M0VA 2BA1G 2IHR1 2L3CA 5BR8I 2ZM6I 5IT9C 1RMDA 1AAYA 4OKGA 5IV8B 4WPYA 2HKEA 4LF6I 1Z59A 4RPFA 2EORA 4FWGA 3IWDA 4FW6A 3AUZA 2UXDE 1YFHA 1BKNA 4WXCA 4DR7E 1TN9A 3T1YE 1IBKI 3PS2A 5K36E 1X49A 3M6AA 3PYEA 4IZKB 1Z0EA 1NHHA 3EPKA 1UBDC 4O43A 2LRSA 1P47A 1A1GA 4BHBA 4X62I 2Z5EA 4DV2E 2CPNA 1ZXMA 2PO2B 4F2JC 1UDQA 3HTXA 1ZBQA 2EN8A 3LPSA 1OYRA 1A1KA 2C37B 1XXEA 1G2FC 1YZ9A 3B82A 2BR2B 2L2KB 4DR6I 2M7QA 4L8NA 2WZOA 2YTIA 2LO3A 4JI5E 2YTEA 4IFDA 3VYYA 3BF2A 3Q1QA 4DR1E 3VK6A 4IZJB 1ZM3A 2JEAA 3ECRA 2L2MA 1FJGI 2EM5A 1X6HA 4DUZE 4DV4E 2EOJA 2JY9A 3M99B 2UXBI 3L00A 4JI3E 1EH8A 4JYAE 3P3CA 2YTJA 4R2AA 4DR3E 1B69A 1A1JA 2JOBA 4F9CB 2MKNA 4Z7YA 1FKAE 4F6MA 2EOHA 2ELZA 1IBLE 3H4LA 2NUGA 2KONA 4B3RE 2V88A 2YTOA 1IQOA 4MDTA 2A2DA 3M7ND 4MU4A 2PNLA 4F6NA 4DPYA 2CGEA 5KL6A 3J7Yp 1E3PA 1J5EI 2V86A 5EL9A 5EKWA 3VHTB 4DV1E 2NN6B 2I13A 1T4NA 2VQEI 2N3HA 2J7KA 4B3ME 5GMDA 2EMAA 2ENAA 1B62A 1NCSA 2HJJA 4X64E 4LF9E 2EPOA 1Z0WA 3UHMA 2LTRA 2EPUA 2YU5A 2PO0A 2VRDA 2EN3A 4MLVA 5FLXC 2V8PA 4JI4E 1IBME 2M1SA 2JPAA 4BA1B 2LJHA 2WNRB 3OMLA 2F4VI 4F9AB 3FIGA 1A1HA 4X9JA 4JV5I 5A6JA 5AC5A 4IJDA 1YUIA 1HNXI 4JI0I 4R2PA 2LVHA 2EMYA 4MLQA 2BM1A 1EA6A 3H09A 2UUCE 4DMIA 4R2SA 2RQLA 3M7NG 3L7ZA 3KRNA 5C0XF 5LMNE 4X8WA 5A69A 1ZAAC 3ADLA 4Q28A 5AE1A 4F9BB 2LTSA 2Q8UA 1JK1A 1USVA 2CZ9A 4FW9A 4JI1I 1YYKA 4K0KE 4EMDA 5FWKA 3OTOE 3JU0A 2EN1A 4X66I 4GKJE 3PS1A 4Z7CA 1OYPA 1N34I 4P7DA 2WW4A 4UT4A 5JEAF 4NXMI 4WSGA 4LF5E 3ZKDA 2B7TA 1XMOI 3IWCA 4BA2B 2E5LI 2EM8A 4NZVA 4KHPI 3C6MA 5K36F 4LPFA 4LF7I 5JEAD 2WBTA 5C0XB 4DV3I 1PJQA 2N8XA 1YUJA 2JEBA 2A2CA 2EL6A 4R2RA 4BCAA 1YYWA 2HK2A 4B3TI 5DNYA 3HPZA 4AQYE 2GQ0A 2EM4A 2EOMA 4WYQB 2UUAE 2C38B 1EI1A 3M85D 2PO1A 2ENCA 2VF3A 5LMUI 2VE7C 4DR4I 1D6TA 2EP3A 4OO1D 3EPHA 1BB8A 2LBSB 2HKJA 2I9IA 1KTVA 5TSEA 4LCFA 4MU0A 1N36I
chains in the Genus database with same CATH topology
3IWBA 2JR1A 3ADGA 3J7AG 3ZKBA 5GMEA 4NXNE 4HACB 3PRYA 3AV0A 2GS8A 3J80C 3ZZUA 2B9DA 1WHQA 4BS9A 4DV7E 2O1WA 2VQFI 2FGGA 3WU4A 1QZRA 2UXCI 2RTXA 2KHXA 5AE3A 1ZM2A 2Q2EB 2K4VA 4YHHI 4DV0I 4DUYI 3K17A 2V87A 2AJ4A 2UUBI 1WXRA 4LFBE 3LMLA 3HJCA 1O0WA 3T1HE 1GZ6A 5BR8E 4DXLA 4M1KA 4YY3E 1DQ3A 2ZM6E 4DV5I 3DF6A 1RQ0A 1STUA 4KZSA 1USUA 2YT4A 3JAMQ 1Y4SA 4LF6E 2Z5BA 2PNMA 5A2QQ 5AASA 2UXDI 4BMJA 3C4BA 1I94E 4BBYA 1Y6ZA 5IT9Q 1IBKE 4M30A 4X65I 1ZXNA 3QT8A 4OX9E 2IOQA 4LF8I 1KKHA 2DIXA 2H36X 3F6GA 2RSMA 1FI4A 3HXLA 4IZKA 1Z0CA 3ZM7A 4MYUA 1Y4UA 4JI5I 1H72C 2NA2A 4GKKE 4DU8A 5IWAI 4P7AA 1S16A 1HR0I 2V8QB 3Q6MA 3LNUA 1VISA 4JYAI 4JI3I 2HHHI 3QT5A 1ZM9A 1Z5AA 1UHZA 4IZJA 1IBLI 4PRVA 4XTJA 3KWRA 1KVKA 2JWOA 1X47A 4URLA 2ZBKB 2IOPA 1HNZE 4DV1I 2O1TA 4DV6E 3K85A 1MG7A 1DARA 4B3MI 1WHNA 4DPWA 2VQEE 4X64I 2JVAA 4FN5A 1NZ0A 4DPXA 4DR2I 4JI6E 4LFAE 1MX0A 2XEXA 1XHKA 1DI2A 2Z5CB 4JI4I 1Z5CA 2L8TA 2F4VE 2MDRA 1H73A 3WU5A 1ELOA 1HNXE 2V2VA 4WFTA 2UUCI 4J8ZA 4JI8E 1N0VC 1N32E 1XMQI 5FLXQ 2RS7A 1RR9A 2UU9E 4LF4E 1XNQI 3J81C 3V2UC 1NHIA 2LMZA 5ADZA 3OTOI 2HK3A 3PYDA 4GKJI 4HY1A 3F0NA 4B3SE 3Q6NA 4HYMA 4LF5I 5T6JA 1H7UA 3MSWA 2R42A 2V34A 4FWHA 4KHPE 4LF7E 4WUBA 4DR5E 4DV3E 1FNMA 2BV3A 4P78A 3D4JA 2FV4B 1PKPA 2HFSA 4JI2I 5CFFE 3V5RA 2UUAI 1Z0BA 1A6FA 1XNRE 4DPTA 3B8HA 4TUIA 2BM0A 4UTGA 4I3HA 4JI7I 2YZTA 1FWLA 4NXNI 1HNWI 3QT7A 2ODRC 1N33E 4DV7I 2JOXA 2V89A 4ED4A 5LL6R 4LFCE 4L5NC 3PYFA 2M4IA 4F54A 4HACA 1MU5A 3JAMC 2UXCE 4PRXA 4TUGA 4JG4A 3ZZTA 4DV0E 4LFBI 4IZJD 3J80Q 3T1HI 3LTOA 4DR7I 3T1YI 2KOUA 2UUBE 2DEIA 4YY3I 1K47A 1UILA 1Z0VA 4DV5E 2O1UA 1T4OA 4DV2I 2NUFA 3HULA 4X62E 1I94I 2E1MA 1SR9A 2ODRD 2L2NA 4OOGC 1PIEA 1Z5BA 2HFUA 3K1JA 4OX9I 2NPFA 4X65E 2DEJA 4DR6E 3WU6A 2V85A 4LF8E 2DB2A 2L92A 4DR1I 4I8OA 1ZM4A 4WUDA 4DUZI 4DV4I 1X48A 1FJGE 4USKA 4DR3I 4GKKI 2UXBE 4N3OA 1N0UA 4B3RI 5IWAE 1YYOA 3ADIA 1HR0E 2DSYA 1B63A 3RMPA 2HHHE 2OI2A 1EKZA 1J5EE 3PYGA 4WUCA 4LF9I 3ZOQB 1J26A 2N3GA 1HNZI 4DV6I 1ZBTA 4P52A 2L33A 1PVGA 2X7IA 3CWVA 4DPUA 1IBMI 4WSPA 2NUEA 2MC6A 3ADJA 1UEKA 2CG9A 2ZITA 2V2QA 1OJ4A 4JI6I 1U2RA 4LFAI 4JV5E 4R03A 4DR2E 4JI0E 3GONA 4DU7A 4USMA 2G7HA 2DMYA 4BC7A 1RC7A 2VF1A 2F8BA 4KQVA 5LMNI 2V83A 2LUPB 1KIJA 2LUQA 3P1XA 2LJPA 4K0KI 4JI1E 4JI8I 2RS6A 1H74A 1N32I 2Z5CA 1Z0TA 1RREA 3P06A 4BC9A 4X66E 1XMQE 2EZ6A 2UU9I 4LF4I 3DJWA 5L3JA 1N34E 2R3VA 1T4LB 1H7SA 1XNQE 2L6MA 4NXME 1XMOE 3K6QA 2E5LE 2O1VA 4B3SI 3VYXA 4MYTA 2V2ZA 4FWDA 3J81Q 1NHJA 4AQYI 2L3JA 4R1FA 4B3TE 1GQEA 1FWKA 1WUUA 4ZVIA 4DR5I 5LMUE 4DR4E 4PU9A 2MC5A 2FTXB 3F6HA 4GEQB 2X36A 4HXZA 3LLHA 2EWLA 4JI2E 1N36E 4LU9A 3B78A 2E1RA 1XNRI 3JTZA 4R8OA 5AE2A 3QT6A 3WU3A 3ZZ0A 3HQ1A 1QU6A 4JI7E 2VQFE 2B3TB 3HPSA 4M2ZA 3C4TA 2B7VA 4DKKA 1N33I 1HNWE 3J7AM 2LE2A 5F3WA 4LTYA 1Z0GA 1S4EA 2Z5BB 5A2QC 4YHHE 4DUYE 1HK7A 4LFCI 2EFGA 4M0VA 2IHR1 2L3CA 5BR8I 2ZM6I 5IT9C 4WPYA 2HKEA 4LF6I 1Z59A 4RPFA 4FWGA 3IWDA 3AUZA 2UXDE 1BKNA 4DR7E 1IBKI 3T1YE 1X49A 3M6AA 3PYEA 4IZKB 1Z0EA 1NHHA 4X62I 2LRSA 2Z5EA 4DV2E 2CPNA 1ZXMA 3HTXA 1ZBQA 3LPSA 3B82A 1YZ9A 2L2KB 4DR6I 2M7QA 4L8NA 2WZOA 4JI5E 3VYYA 3Q1QA 4DR1E 3VK6A 4IZJB 1ZM3A 2L2MA 1FJGI 4DUZE 4DV4E 2JY9A 2UXBI 4JYAE 4JI3E 4DR3E 2JOBA 4F9CB 4Z7YA 1FKAE 1IBLE 3H4LA 2NUGA 2KONA 4B3RE 2V88A 2A2DA 2PNLA 4DPYA 2CGEA 3J7Yp 1J5EI 2V86A 4DV1E 1T4NA 2VQEI 2N3HA 2J7KA 4B3ME 5GMDA 1B62A 4LF9E 4X64E 1Z0WA 2LTRA 5FLXC 2V8PA 4JI4E 1IBME 2M1SA 2LJHA 2F4VI 3OMLA 4F9AB 3FIGA 4JV5I 1HNXI 4JI0I 2BM1A 1EA6A 3H09A 2UUCE 4DMIA 5LMNE 4X8WA 3ADLA 4Q28A 5AE1A 4F9BB 2LTSA 1USVA 2CZ9A 4FW9A 4JI1I 1YYKA 4K0KE 4EMDA 5FWKA 3OTOE 3JU0A 4X66I 4GKJE 4Z7CA 1N34I 4P7DA 2WW4A 4UT4A 4NXMI 4LF5E 1XMOI 3ZKDA 2B7TA 3IWCA 2E5LI 4KHPI 4LF7I 4DV3I 2A2CA 4BCAA 1YYWA 2HK2A 4B3TI 5DNYA 3HPZA 4AQYE 2GQ0A 2UUAE 4WYQB 1EI1A 1D6TA 5LMUI 2VF3A 4DR4I 2VE7C 2LBSB 2HKJA 1KTVA 1N36I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADG A;  3J7A G;  3ZKB A;  5GME A;  4NXN E;  4HAC B;  2GS8 A;  3J80 C;  3ZZU A;  1WHQ A;  4DV7 E;  2VQF I;  3WU4 A;  1QZR A;  2UXC I;  2RTX A;  2KHX A;  1ZM2 A;  2Q2E B;  4YHH I;  4DV0 I;  4DUY I;  3K17 A;  2AJ4 A;  2UUB I;  4LFB E;  1O0W A;  3T1H E;  5BR8 E;  4DXL A;  4M1K A;  4YY3 E;  2ZM6 E;  4DV5 I;  1RQ0 A;  1STU A;  3JAM Q;  2YT4 A;  4LF6 E;  5A2Q Q;  2UXD I;  3C4B A;  1I94 E;  5IT9 Q;  1IBK E;  4M30 A;  4X65 I;  1ZXN A;  3QT8 A;  4OX9 E;  4LF8 I;  1KKH A;  2DIX A;  2RSM A;  1FI4 A;  1Z0C A;  3ZM7 A;  4MYU A;  4JI5 I;  1H72 C;  2NA2 A;  4GKK E;  4DU8 A;  5IWA I;  4P7A A;  1S16 A;  1HR0 I;  3LNU A;  1VIS A;  4JYA I;  4JI3 I;  2HHH I;  3QT5 A;  1ZM9 A;  1Z5A A;  1UHZ A;  1IBL I;  4PRV A;  4XTJ A;  1KVK A;  1X47 A;  4URL A;  2ZBK B;  1HNZ E;  4DV1 I;  4DV6 E;  1MG7 A;  1DAR A;  4B3M I;  1WHN A;  4DPW A;  2VQE E;  4X64 I;  2JVA A;  4FN5 A;  1NZ0 A;  4DPX A;  4DR2 I;  4JI6 E;  4LFA E;  1MX0 A;  2XEX A;  1XHK A;  1DI2 A;  4JI4 I;  1Z5C A;  2F4V E;  2MDR A;  1H73 A;  3WU5 A;  1ELO A;  1HNX E;  2V2V A;  4WFT A;  2UUC I;  4JI8 E;  1N0V C;  1N32 E;  1XMQ I;  5FLX Q;  2RS7 A;  1RR9 A;  2UU9 E;  4LF4 E;  1XNQ I;  3J81 C;  3V2U C;  1NHI A;  3OTO I;  2HK3 A;  3PYD A;  4GKJ I;  4HY1 A;  3F0N A;  4B3S E;  4HYM A;  4LF5 I;  1H7U A;  2R42 A;  2V34 A;  4FWH A;  4KHP E;  4LF7 E;  4WUB A;  4DR5 E;  4DV3 E;  1FNM A;  2BV3 A;  3D4J A;  1PKP A;  2HFS A;  4JI2 I;  5CFF E;  3V5R A;  2UUA I;  1Z0B A;  1A6F A;  1XNR E;  4DPT A;  3B8H A;  2BM0 A;  4UTG A;  4I3H A;  4JI7 I;  1FWL A;  4NXN I;  1HNW I;  3QT7 A;  1N33 E;  4DV7 I;  4ED4 A;  5LL6 R;  4LFC E;  3PYF A;  4HAC A;  1MU5 A;  3JAM C;  2UXC E;  4PRX A;  4JG4 A;  3ZZT A;  4DV0 E;  4LFB I;  3J80 Q;  3T1H I;  3LTO A;  4DR7 I;  3T1Y I;  2UUB E;  2DEI A;  4YY3 I;  1K47 A;  1UIL A;  1Z0V A;  4DV5 E;  1T4O A;  4DV2 I;  2NUF A;  3HUL A;  4X62 E;  1I94 I;  2L2N A;  4OOG C;  1PIE A;  1Z5B A;  2HFU A;  3K1J A;  4OX9 I;  2NPF A;  4X65 E;  2DEJ A;  4DR6 E;  3WU6 A;  4LF8 E;  2DB2 A;  4DR1 I;  1ZM4 A;  4WUD A;  4DUZ I;  4DV4 I;  1X48 A;  1FJG E;  4USK A;  4DR3 I;  4GKK I;  2UXB E;  1N0U A;  4B3R I;  5IWA E;  1YYO A;  3ADI A;  1HR0 E;  1B63 A;  2HHH E;  2OI2 A;  1EKZ A;  1J5E E;  3PYG A;  4WUC A;  4LF9 I;  1J26 A;  2N3G A;  1HNZ I;  4DV6 I;  1ZBT A;  4P52 A;  2L33 A;  1PVG A;  2X7I A;  3CWV A;  4DPU A;  1IBM I;  2NUE A;  3ADJ A;  1UEK A;  2ZIT A;  2V2Q A;  1OJ4 A;  4JI6 I;  1U2R A;  4LFA I;  4JV5 E;  4DR2 E;  4JI0 E;  3GON A;  4DU7 A;  4USM A;  2DMY A;  1RC7 A;  4KQV A;  5LMN I;  2LUP B;  1KIJ A;  2LUQ A;  3P1X A;  2LJP A;  4K0K I;  4JI1 E;  4JI8 I;  2RS6 A;  1H74 A;  1N32 I;  1Z0T A;  1RRE A;  4X66 E;  1XMQ E;  2EZ6 A;  2UU9 I;  4LF4 I;  5L3J A;  1N34 E;  2R3V A;  1T4L B;  1H7S A;  1XNQ E;  4NXM E;  1XMO E;  2E5L E;  4B3S I;  3VYX A;  4MYT A;  2V2Z A;  4FWD A;  3J81 Q;  1NHJ A;  4AQY I;  2L3J A;  4R1F A;  4B3T E;  1GQE A;  1FWK A;  1WUU A;  4ZVI A;  4DR5 I;  5LMU E;  4DR4 E;  4PU9 A;  4HXZ A;  2X36 A;  3LLH A;  4JI2 E;  1N36 E;  3B78 A;  2E1R A;  1XNR I;  3QT6 A;  3WU3 A;  3ZZ0 A;  1QU6 A;  4JI7 E;  2VQF E;  2B3T B;  4M2Z A;  3C4T A;  2B7V A;  4DKK A;  1N33 I;  1HNW E;  3J7A M;  1Z0G A;  1S4E A;  5A2Q C;  4YHH E;  4DUY E;  4LFC I;  2EFG A;  2IHR 1;  2L3C A;  5BR8 I;  2ZM6 I;  5IT9 C;  2HKE A;  4LF6 I;  1Z59 A;  4RPF A;  4FWG A;  1BKN A;  2UXD E;  4DR7 E;  1IBK I;  3T1Y E;  3M6A A;  1X49 A;  3PYE A;  1Z0E A;  1NHH A;  4X62 I;  2LRS A;  4DV2 E;  2CPN A;  1ZXM A;  3HTX A;  3LPS A;  3B82 A;  1YZ9 A;  2L2K B;  4DR6 I;  4JI5 E;  3VYY A;  3Q1Q A;  4DR1 E;  1ZM3 A;  2L2M A;  1FJG I;  4DUZ E;  4DV4 E;  2JY9 A;  2UXB I;  4JYA E;  4JI3 E;  4DR3 E;  4Z7Y A;  1FKA E;  1IBL E;  3H4L A;  2NUG A;  4B3R E;  2A2D A;  4DPY A;  3J7Y p;  1J5E I;  4DV1 E;  1T4N A;  2VQE I;  2N3H A;  2J7K A;  4B3M E;  5GMD A;  1B62 A;  4LF9 E;  4X64 E;  1Z0W A;  2LTR A;  5FLX C;  2V8P A;  4JI4 E;  1IBM E;  2LJH A;  2F4V I;  4JV5 I;  1HNX I;  4JI0 I;  2BM1 A;  1EA6 A;  2UUC E;  5LMN E;  4X8W A;  3ADL A;  4FW9 A;  2CZ9 A;  2LTS A;  4JI1 I;  1YYK A;  4K0K E;  4EMD A;  3OTO E;  4X66 I;  4GKJ E;  4Z7C A;  1N34 I;  2WW4 A;  4UT4 A;  4NXM I;  4LF5 E;  1XMO I;  3ZKD A;  2B7T A;  2E5L I;  4KHP I;  4LF7 I;  4DV3 I;  2A2C A;  1YYW A;  2HK2 A;  4B3T I;  4AQY E;  2UUA E;  4WYQ B;  1EI1 A;  1D6T A;  5LMU I;  2VF3 A;  4DR4 I;  2LBS B;  2HKJ A;  1KTV A;  1N36 I; 
#chains in the Genus database with same CATH topology
 3IWB A;  3P3G A;  4GZN C;  2JR1 A;  3ADG A;  2JP9 A;  3J7A G;  3ZKB A;  5K36 B;  2EN7 A;  5KL4 A;  2EPR A;  1R6L A;  4MQY A;  5GME A;  2EML A;  1YSA C;  4NXN E;  4HAC B;  4MU1 A;  2EQ1 A;  2K7I A;  4IFD D;  1T38 A;  2YRH A;  3NZK A;  3PRY A;  4ISA A;  3AV0 A;  2GS8 A;  3J80 C;  1Z1B A;  3ZZU A;  2B9D A;  2EJ4 A;  1WHQ A;  3C6K A;  4BS9 A;  2EOS A;  4WX9 A;  4DV7 E;  2O1W A;  2FGG A;  3PS3 A;  4FW3 A;  2EQ3 A;  3WU4 A;  1MGT A;  1QZR A;  2UXC I;  2RTX A;  2A25 A;  2DGC A;  2KHX A;  5AE3 A;  5JEA A;  1ZM2 A;  2Q2E B;  2K4V A;  4YHH I;  4DV0 I;  4DUY I;  2CSH A;  3K17 A;  2EMB A;  2V87 A;  2AJ4 A;  2UUB I;  1WXR A;  4IS1 C;  3LML A;  4LFB E;  1O0W A;  2YTG A;  3HJC A;  3T1H E;  1GZ6 A;  3M85 G;  5BR8 E;  2MKD A;  4M1K A;  4DXL A;  4YY3 E;  1DQ3 A;  2ZM6 E;  3MHH C;  2EN2 A;  2JE6 A;  4DV5 I;  2UU9 I;  3DF6 A;  1RQ0 A;  1STU A;  4KZS A;  1USU A;  2YT4 A;  2EPZ A;  3JAM Q;  1Y4S A;  4LF6 E;  2Z5B A;  1YHC A;  2CVE A;  2PNM A;  1ZR9 A;  2EL5 A;  5AAS A;  4OO1 A;  4BMJ A;  2M9A A;  5A2Q Q;  2UXD I;  3C4B A;  1I94 E;  4BBY A;  4AIM A;  1Y6Z A;  1JK2 A;  5IT9 Q;  1IBK E;  4M30 A;  4X65 I;  1ZXN A;  3QT8 A;  2PNZ B;  1UDS A;  2R1F A;  1SFE A;  4OX9 E;  2IOQ A;  4LF8 I;  2ELY A;  1KKH A;  2ADR A;  2DIX A;  2DLK A;  2H36 X;  3F6G A;  2RSM A;  3BID A;  4N4R B;  1FI4 A;  3HXL A;  1VI7 A;  5DRO A;  2EM6 A;  2NN6 F;  4IZK A;  1Z0C A;  4ZYH A;  2BB8 A;  3ZM7 A;  2EM0 A;  4MYU A;  1Y4U A;  4JI5 I;  1H72 C;  4R2Q A;  2NA2 A;  2NN6 D;  4GKK E;  2PO2 A;  4OO1 E;  4DU8 A;  2DMI A;  2EOY A;  5IWA I;  4P7A A;  1S16 A;  2C37 A;  2JXP A;  2WBS A;  2BR2 A;  2V8Q B;  3Q6M A;  1EH6 A;  1HR0 I;  3LNU A;  1VIS A;  4JYA I;  1QNT A;  2WCC 3;  4JI3 I;  2HHH I;  2E72 A;  3QT5 A;  2J65 A;  1ZM9 A;  1Z5A A;  4IFD E;  1UHZ A;  4IZJ A;  1IBL I;  2F1D A;  4PRV A;  4XTJ A;  3KWR A;  2LJU A;  1KVK A;  2JWO A;  2EMH A;  2GPI A;  2YSO A;  4QNJ A;  1X47 A;  4URL A;  2ZBK B;  2YPN A;  4GQU A;  2IOP A;  2DLQ A;  1HNZ E;  4NBQ A;  5DRP A;  4DV1 I;  2O1T A;  4DV6 E;  3K85 A;  1MG7 A;  1DAR A;  2YTP A;  2IES A;  1WHN A;  1L4S A;  4ZYD A;  4DPW A;  4B3M I;  4Q35 B;  2VQE E;  3MHS C;  4X64 I;  2JVA A;  4FN5 A;  1NZ0 A;  2ENH A;  2YTQ A;  3B4T A;  4JI6 E;  5KL3 A;  4DPX A;  5JEA C;  1T39 A;  4DR2 I;  2HGH A;  4LFA E;  1MX0 A;  2EMK A;  1XHK A;  2XEX A;  1TF6 A;  1A1L A;  1DI2 A;  5DRQ A;  2Z5C B;  4JI4 I;  2J7J A;  1Z5C A;  2LT7 A;  2NN6 A;  4LCH A;  1PJT A;  2L8T A;  2F4V E;  2MDR A;  2EMF A;  1H73 A;  2EPN A;  3WU5 A;  1ELO A;  2EN4 A;  1HNX E;  2V2V A;  4WFT A;  2UUC I;  5C0X D;  2LCE A;  4OO1 C;  4J8Z A;  4JI8 E;  1N0V C;  1N32 E;  1XMQ I;  5FLX Q;  4R2D A;  2RS7 A;  4BA1 A;  4ZYE A;  2WNR A;  1RR9 A;  2UU9 E;  4LF4 E;  1XNQ I;  2NAB A;  3BBG A;  3J81 C;  2GO4 A;  3V2U C;  1NHI A;  2LMZ A;  1R6M A;  2EOF A;  5ADZ A;  2DRP A;  2HK3 A;  3OTO I;  3PYD A;  4GKJ I;  4HY1 A;  4IFD C;  2MDG A;  2EOO A;  4IS9 A;  2WP8 B;  3F0N A;  4R2C A;  4B3S E;  5LLQ A;  3H1C A;  3Q6N A;  4HYM A;  2R76 A;  1UDN A;  4LF5 I;  4BHC A;  5K36 D;  5T6J A;  1H7U A;  3MSW A;  5A6A A;  2R42 A;  3THN A;  4RH8 A;  2YRK A;  2GO3 A;  2V34 A;  1X6E A;  4FWH A;  4KHP E;  2EMG A;  2PRT A;  4LF7 E;  4WUB A;  4DR5 E;  2EPX A;  4DV3 E;  1FNM A;  1IMU A;  4KWY A;  2C39 B;  1F2I G;  2BV3 A;  4P78 A;  4QNK A;  1MEY C;  3D4J A;  2FV4 B;  4BA2 A;  1PKP A;  2HFS A;  5AC4 A;  3HKM A;  5CFF E;  3V5R A;  2YTD A;  2UUA I;  4JI2 I;  1Z0B A;  1A6F A;  4LCG A;  5C0X A;  3GME A;  1AH5 A;  1XNR E;  4U3D A;  2RPC A;  4DPT A;  3B8H A;  4J3D A;  4TUI A;  2BM0 A;  1G2D C;  1UN6 B;  4UTG A;  4I3H A;  4JI7 I;  2EMX A;  1X3C A;  2YZT A;  2C38 A;  1FWL A;  4NXN I;  2EM9 A;  3U1Y A;  1HNW I;  3QT7 A;  1WRJ A;  2CTD A;  2ODR C;  1N33 E;  4WXD A;  4AM3 A;  4DV7 I;  2JOX A;  2V89 A;  4ED4 A;  5LL6 R;  5K36 A;  2D9H A;  4L5N C;  4LFC E;  3PYF A;  2M4I A;  1P42 A;  4F54 A;  4HAC A;  2YSP A;  1MU5 A;  2NN6 C;  3JAM C;  2UXC E;  3GLL A;  2EOI A;  4TUG A;  4JG4 A;  4PRX A;  3ZZT A;  2WBU A;  4DV0 E;  4LFB I;  1YPN A;  4IZJ D;  1NEI A;  2EMI A;  3J80 Q;  2EMW A;  3LTO A;  3T1H I;  2YWQ A;  3T1Y I;  2KOU A;  2UUB E;  4DR7 I;  2DEI A;  4YY3 I;  1K47 A;  2EPM X;  1X6F A;  5KL5 A;  2EOQ A;  3EQ1 A;  1UIL A;  2CT1 A;  1Z0V A;  4DV5 E;  2O1U A;  2GLI A;  1T4O A;  2EL4 A;  4DV2 I;  2NUF A;  3HUL A;  5JEA E;  4X62 E;  1I94 I;  2E1M A;  1SR9 A;  4IFD B;  1Y5Y A;  2ODR D;  1E3H A;  2L2N A;  4OOG C;  1PIE A;  1Z5B A;  2HFU A;  3K1J A;  2JEA B;  5ELW A;  4OX9 I;  2NPF A;  4X65 E;  1WJP A;  2DEJ A;  2RSI A;  4DR6 E;  1UDO A;  4HTG A;  2BA0 G;  2EOE A;  3WU6 A;  2V85 A;  4LF8 E;  2DB2 A;  2L92 A;  4DR1 I;  4I8O A;  1ZM4 A;  4R2E A;  1PDA A;  2YTN A;  3KZZ A;  4ZYG A;  5A6B D;  5DNL A;  2EM7 A;  4WUD A;  4DUZ I;  2PNZ A;  4DV4 I;  1X48 A;  3CDJ A;  1FJG E;  1EH7 A;  1BBO A;  4USK A;  4DR3 I;  4GKK I;  2UXB E;  4N3O A;  2EOZ A;  4FW5 A;  1PJS A;  4FW4 A;  2IER A;  1N0U A;  4B3R I;  5IWA E;  4MU3 A;  3QG5 C;  5C0X C;  1YYO A;  3ADI A;  1HR0 E;  2DSY A;  4RHB B;  1B63 A;  3RMP A;  3CDI A;  2HHH E;  2OI2 A;  1EKZ A;  1KJK A;  2PO0 B;  1J5E E;  3PYG A;  4WUC A;  2EPC A;  3KZY A;  4LF9 I;  3ZOQ B;  1J26 A;  3GCM A;  2N3G A;  1HNZ I;  4DV6 I;  1ZBT A;  1DGC A;  4P52 A;  2L33 A;  1PVG A;  2X7I A;  4O24 A;  2AE8 A;  4NHR A;  3CWV A;  1LLM C;  4DPU A;  1IBM I;  5K36 C;  4WSP A;  3L7Z B;  2NUE A;  2MC6 A;  3ADJ A;  1UEK A;  2CG9 A;  2EE8 A;  2V2Q A;  2ZIT A;  1OJ4 A;  5A6B A;  4JI6 I;  1U2R A;  4LFA I;  4JV5 E;  4R03 A;  4DR2 E;  4JI0 E;  3GON A;  4DU7 A;  2EN6 A;  2G7H A;  2YRM A;  2DMY A;  2LV2 A;  4BC7 A;  4OZE A;  1RC7 A;  4USM A;  2VF1 A;  2F8B A;  4KQV A;  5LMN I;  1ZU1 A;  2V83 A;  2LUP B;  1KIJ A;  2LUQ A;  3P1X A;  2LJP A;  1Y60 A;  3THO B;  3DD6 A;  4K0K I;  4JI1 E;  4JI8 I;  2RS6 A;  1H74 A;  1N32 I;  2Z5C A;  1Z0T A;  1RRE A;  3P06 A;  4BC9 A;  4X66 E;  2EPP A;  1XMQ E;  1TF3 A;  2EZ6 A;  1IQS A;  2JEB B;  3DJW A;  2NN6 E;  1N34 E;  5L3J A;  4LF4 I;  2R3V A;  2JT2 A;  1T4L B;  1H7S A;  1A1F A;  2O3Z A;  1XNQ E;  3BGH A;  2YU8 A;  2EMZ A;  2L6M A;  4NXM E;  5KL7 A;  1XMO E;  3K6Q A;  1KYQ A;  1GTK A;  5IXM B;  2E5L E;  3U1K A;  2O1V A;  2VES A;  4B3S I;  2PO1 B;  3VYX A;  3P3E A;  2HC5 A;  4MYT A;  5KL2 A;  4M9V C;  4U3B A;  2V2Z A;  4FWD A;  2EPK X;  2BBG A;  1OYS A;  1RHY A;  3J81 Q;  1NHJ A;  4AQY I;  2L3J A;  4R1F A;  1N33 I;  3UK3 C;  4B3T E;  2EM2 A;  2BA1 D;  4HEI A;  1GQE A;  1FWK A;  1WUU A;  2EPL X;  2WP8 A;  2EQ0 A;  5DRR A;  4ZVI A;  4DR5 I;  1N3G A;  4FW7 A;  5LMU E;  3EPJ A;  4DR4 E;  4PU9 A;  2MC5 A;  2FTX B;  4FK5 C;  3F6H A;  4GEQ B;  2X36 A;  4HXZ A;  5DNX A;  3LLH A;  4OO1 F;  2EWL A;  2EPA A;  4JI2 E;  4O5G A;  1N36 E;  1A1I A;  1BBG A;  3TQM A;  4LU9 A;  3B78 A;  2EMC A;  4O4K A;  1YH8 A;  2E1R A;  4LOM A;  1XNR I;  3JTZ A;  4R8O A;  5AE2 A;  2C39 A;  5JEA B;  3QT6 A;  3WU3 A;  1X5W A;  3ZZ0 A;  3HQ1 A;  1QU6 A;  3EPL A;  2BA0 D;  2EM3 A;  4AID A;  4JI7 E;  4IFD F;  2VQF E;  2B3T B;  2EOX A;  3HPS A;  4M2Z A;  3C4T A;  2B7V A;  4DKK A;  2JE6 B;  5A6K A;  2YTF A;  2GHF A;  1HNW E;  5C0X E;  2LE2 A;  5F3W A;  4LTY A;  2VQF I;  2JYA A;  3J7A M;  1Z0G A;  1S4E A;  2Z5B B;  5A2Q C;  4YHH E;  4OO1 B;  3P76 A;  4DUY E;  1HK7 A;  4LFC I;  2EFG A;  4M0V A;  2BA1 G;  2IHR 1;  2L3C A;  5BR8 I;  2ZM6 I;  5IT9 C;  1RMD A;  1AAY A;  4OKG A;  5IV8 B;  4WPY A;  2HKE A;  4LF6 I;  1Z59 A;  4RPF A;  2EOR A;  4FWG A;  3IWD A;  4FW6 A;  3AUZ A;  2UXD E;  1YFH A;  1BKN A;  4WXC A;  4DR7 E;  1TN9 A;  3T1Y E;  1IBK I;  3PS2 A;  5K36 E;  1X49 A;  3M6A A;  3PYE A;  4IZK B;  1Z0E A;  1NHH A;  3EPK A;  1UBD C;  4O43 A;  2LRS A;  1P47 A;  1A1G A;  4BHB A;  4X62 I;  2Z5E A;  4DV2 E;  2CPN A;  1ZXM A;  2PO2 B;  4F2J C;  1UDQ A;  3HTX A;  1ZBQ A;  2EN8 A;  3LPS A;  1OYR A;  1A1K A;  2C37 B;  1XXE A;  1G2F C;  1YZ9 A;  3B82 A;  2BR2 B;  2L2K B;  4DR6 I;  2M7Q A;  4L8N A;  2WZO A;  2YTI A;  2LO3 A;  4JI5 E;  2YTE A;  4IFD A;  3VYY A;  3BF2 A;  3Q1Q A;  4DR1 E;  3VK6 A;  4IZJ B;  1ZM3 A;  2JEA A;  3ECR A;  2L2M A;  1FJG I;  2EM5 A;  1X6H A;  4DUZ E;  4DV4 E;  2EOJ A;  2JY9 A;  3M99 B;  2UXB I;  3L00 A;  4JI3 E;  1EH8 A;  4JYA E;  3P3C A;  2YTJ A;  4R2A A;  4DR3 E;  1B69 A;  1A1J A;  2JOB A;  4F9C B;  2MKN A;  4Z7Y A;  1FKA E;  4F6M A;  2EOH A;  2ELZ A;  1IBL E;  3H4L A;  2NUG A;  2KON A;  4B3R E;  2V88 A;  2YTO A;  1IQO A;  4MDT A;  2A2D A;  3M7N D;  4MU4 A;  2PNL A;  4F6N A;  4DPY A;  2CGE A;  5KL6 A;  3J7Y p;  1E3P A;  1J5E I;  2V86 A;  5EL9 A;  5EKW A;  3VHT B;  4DV1 E;  2NN6 B;  2I13 A;  1T4N A;  2VQE I;  2N3H A;  2J7K A;  4B3M E;  5GMD A;  2EMA A;  2ENA A;  1B62 A;  1NCS A;  2HJJ A;  4X64 E;  4LF9 E;  2EPO A;  1Z0W A;  3UHM A;  2LTR A;  2EPU A;  2YU5 A;  2PO0 A;  2VRD A;  2EN3 A;  4MLV A;  5FLX C;  2V8P A;  4JI4 E;  1IBM E;  2M1S A;  2JPA A;  4BA1 B;  2LJH A;  2WNR B;  3OML A;  2F4V I;  4F9A B;  3FIG A;  1A1H A;  4X9J A;  4JV5 I;  5A6J A;  5AC5 A;  4IJD A;  1YUI A;  1HNX I;  4JI0 I;  4R2P A;  2LVH A;  2EMY A;  4MLQ A;  2BM1 A;  1EA6 A;  3H09 A;  2UUC E;  4DMI A;  4R2S A;  2RQL A;  3M7N G;  3L7Z A;  3KRN A;  5C0X F;  5LMN E;  4X8W A;  5A69 A;  1ZAA C;  3ADL A;  4Q28 A;  5AE1 A;  4F9B B;  2LTS A;  2Q8U A;  1JK1 A;  1USV A;  2CZ9 A;  4FW9 A;  4JI1 I;  1YYK A;  4K0K E;  4EMD A;  5FWK A;  3OTO E;  3JU0 A;  2EN1 A;  4X66 I;  4GKJ E;  3PS1 A;  4Z7C A;  1OYP A;  1N34 I;  4P7D A;  2WW4 A;  4UT4 A;  5JEA F;  4NXM I;  4WSG A;  4LF5 E;  3ZKD A;  2B7T A;  1XMO I;  3IWC A;  4BA2 B;  2E5L I;  2EM8 A;  4NZV A;  4KHP I;  3C6M A;  5K36 F;  4LPF A;  4LF7 I;  5JEA D;  2WBT A;  5C0X B;  4DV3 I;  1PJQ A;  2N8X A;  1YUJ A;  2JEB A;  2A2C A;  2EL6 A;  4R2R A;  4BCA A;  1YYW A;  2HK2 A;  4B3T I;  5DNY A;  3HPZ A;  4AQY E;  2GQ0 A;  2EM4 A;  2EOM A;  4WYQ B;  2UUA E;  2C38 B;  1EI1 A;  3M85 D;  2PO1 A;  2ENC A;  2VF3 A;  5LMU I;  2VE7 C;  4DR4 I;  1D6T A;  2EP3 A;  4OO1 D;  3EPH A;  1BB8 A;  2LBS B;  2HKJ A;  2I9I A;  1KTV A;  5TSE A;  4LCF A;  4MU0 A;  1N36 I; 
#chains in the Genus database with same CATH homology
 3IWB A;  2JR1 A;  3ADG A;  3J7A G;  3ZKB A;  5GME A;  4NXN E;  4HAC B;  3PRY A;  3AV0 A;  2GS8 A;  3J80 C;  3ZZU A;  2B9D A;  1WHQ A;  4BS9 A;  4DV7 E;  2O1W A;  2VQF I;  2FGG A;  3WU4 A;  1QZR A;  2UXC I;  2RTX A;  2KHX A;  5AE3 A;  1ZM2 A;  2Q2E B;  2K4V A;  4YHH I;  4DV0 I;  4DUY I;  3K17 A;  2V87 A;  2AJ4 A;  2UUB I;  1WXR A;  4LFB E;  3LML A;  3HJC A;  1O0W A;  3T1H E;  1GZ6 A;  5BR8 E;  4DXL A;  4M1K A;  4YY3 E;  1DQ3 A;  2ZM6 E;  4DV5 I;  3DF6 A;  1RQ0 A;  1STU A;  4KZS A;  1USU A;  2YT4 A;  3JAM Q;  1Y4S A;  4LF6 E;  2Z5B A;  2PNM A;  5A2Q Q;  5AAS A;  2UXD I;  4BMJ A;  3C4B A;  1I94 E;  4BBY A;  1Y6Z A;  5IT9 Q;  1IBK E;  4M30 A;  4X65 I;  1ZXN A;  3QT8 A;  4OX9 E;  2IOQ A;  4LF8 I;  1KKH A;  2DIX A;  2H36 X;  3F6G A;  2RSM A;  1FI4 A;  3HXL A;  4IZK A;  1Z0C A;  3ZM7 A;  4MYU A;  1Y4U A;  4JI5 I;  1H72 C;  2NA2 A;  4GKK E;  4DU8 A;  5IWA I;  4P7A A;  1S16 A;  1HR0 I;  2V8Q B;  3Q6M A;  3LNU A;  1VIS A;  4JYA I;  4JI3 I;  2HHH I;  3QT5 A;  1ZM9 A;  1Z5A A;  1UHZ A;  4IZJ A;  1IBL I;  4PRV A;  4XTJ A;  3KWR A;  1KVK A;  2JWO A;  1X47 A;  4URL A;  2ZBK B;  2IOP A;  1HNZ E;  4DV1 I;  2O1T A;  4DV6 E;  3K85 A;  1MG7 A;  1DAR A;  4B3M I;  1WHN A;  4DPW A;  2VQE E;  4X64 I;  2JVA A;  4FN5 A;  1NZ0 A;  4DPX A;  4DR2 I;  4JI6 E;  4LFA E;  1MX0 A;  2XEX A;  1XHK A;  1DI2 A;  2Z5C B;  4JI4 I;  1Z5C A;  2L8T A;  2F4V E;  2MDR A;  1H73 A;  3WU5 A;  1ELO A;  1HNX E;  2V2V A;  4WFT A;  2UUC I;  4J8Z A;  4JI8 E;  1N0V C;  1N32 E;  1XMQ I;  5FLX Q;  2RS7 A;  1RR9 A;  2UU9 E;  4LF4 E;  1XNQ I;  3J81 C;  3V2U C;  1NHI A;  2LMZ A;  5ADZ A;  3OTO I;  2HK3 A;  3PYD A;  4GKJ I;  4HY1 A;  3F0N A;  4B3S E;  3Q6N A;  4HYM A;  4LF5 I;  5T6J A;  1H7U A;  3MSW A;  2R42 A;  2V34 A;  4FWH A;  4KHP E;  4LF7 E;  4WUB A;  4DR5 E;  4DV3 E;  1FNM A;  2BV3 A;  4P78 A;  3D4J A;  2FV4 B;  1PKP A;  2HFS A;  4JI2 I;  5CFF E;  3V5R A;  2UUA I;  1Z0B A;  1A6F A;  1XNR E;  4DPT A;  3B8H A;  4TUI A;  2BM0 A;  4UTG A;  4I3H A;  4JI7 I;  2YZT A;  1FWL A;  4NXN I;  1HNW I;  3QT7 A;  2ODR C;  1N33 E;  4DV7 I;  2JOX A;  2V89 A;  4ED4 A;  5LL6 R;  4LFC E;  4L5N C;  3PYF A;  2M4I A;  4F54 A;  4HAC A;  1MU5 A;  3JAM C;  2UXC E;  4PRX A;  4TUG A;  4JG4 A;  3ZZT A;  4DV0 E;  4LFB I;  4IZJ D;  3J80 Q;  3T1H I;  3LTO A;  4DR7 I;  3T1Y I;  2KOU A;  2UUB E;  2DEI A;  4YY3 I;  1K47 A;  1UIL A;  1Z0V A;  4DV5 E;  2O1U A;  1T4O A;  4DV2 I;  2NUF A;  3HUL A;  4X62 E;  1I94 I;  2E1M A;  1SR9 A;  2ODR D;  2L2N A;  4OOG C;  1PIE A;  1Z5B A;  2HFU A;  3K1J A;  4OX9 I;  2NPF A;  4X65 E;  2DEJ A;  4DR6 E;  3WU6 A;  2V85 A;  4LF8 E;  2DB2 A;  2L92 A;  4DR1 I;  4I8O A;  1ZM4 A;  4WUD A;  4DUZ I;  4DV4 I;  1X48 A;  1FJG E;  4USK A;  4DR3 I;  4GKK I;  2UXB E;  4N3O A;  1N0U A;  4B3R I;  5IWA E;  1YYO A;  3ADI A;  1HR0 E;  2DSY A;  1B63 A;  3RMP A;  2HHH E;  2OI2 A;  1EKZ A;  1J5E E;  3PYG A;  4WUC A;  4LF9 I;  3ZOQ B;  1J26 A;  2N3G A;  1HNZ I;  4DV6 I;  1ZBT A;  4P52 A;  2L33 A;  1PVG A;  2X7I A;  3CWV A;  4DPU A;  1IBM I;  4WSP A;  2NUE A;  2MC6 A;  3ADJ A;  1UEK A;  2CG9 A;  2ZIT A;  2V2Q A;  1OJ4 A;  4JI6 I;  1U2R A;  4LFA I;  4JV5 E;  4R03 A;  4DR2 E;  4JI0 E;  3GON A;  4DU7 A;  4USM A;  2G7H A;  2DMY A;  4BC7 A;  1RC7 A;  2VF1 A;  2F8B A;  4KQV A;  5LMN I;  2V83 A;  2LUP B;  1KIJ A;  2LUQ A;  3P1X A;  2LJP A;  4K0K I;  4JI1 E;  4JI8 I;  2RS6 A;  1H74 A;  1N32 I;  2Z5C A;  1Z0T A;  1RRE A;  3P06 A;  4BC9 A;  4X66 E;  1XMQ E;  2EZ6 A;  2UU9 I;  4LF4 I;  3DJW A;  5L3J A;  1N34 E;  2R3V A;  1T4L B;  1H7S A;  1XNQ E;  2L6M A;  4NXM E;  1XMO E;  3K6Q A;  2E5L E;  2O1V A;  4B3S I;  3VYX A;  4MYT A;  2V2Z A;  4FWD A;  3J81 Q;  1NHJ A;  4AQY I;  2L3J A;  4R1F A;  4B3T E;  1GQE A;  1FWK A;  1WUU A;  4ZVI A;  4DR5 I;  5LMU E;  4DR4 E;  4PU9 A;  2MC5 A;  2FTX B;  3F6H A;  4GEQ B;  2X36 A;  4HXZ A;  3LLH A;  2EWL A;  4JI2 E;  1N36 E;  4LU9 A;  3B78 A;  2E1R A;  1XNR I;  3JTZ A;  4R8O A;  5AE2 A;  3QT6 A;  3WU3 A;  3ZZ0 A;  3HQ1 A;  1QU6 A;  4JI7 E;  2VQF E;  2B3T B;  3HPS A;  4M2Z A;  3C4T A;  2B7V A;  4DKK A;  1N33 I;  1HNW E;  3J7A M;  2LE2 A;  5F3W A;  4LTY A;  1Z0G A;  1S4E A;  2Z5B B;  5A2Q C;  4YHH E;  4DUY E;  1HK7 A;  4LFC I;  2EFG A;  4M0V A;  2IHR 1;  2L3C A;  5BR8 I;  2ZM6 I;  5IT9 C;  4WPY A;  2HKE A;  4LF6 I;  1Z59 A;  4RPF A;  4FWG A;  3IWD A;  3AUZ A;  2UXD E;  1BKN A;  4DR7 E;  1IBK I;  3T1Y E;  1X49 A;  3M6A A;  3PYE A;  4IZK B;  1Z0E A;  1NHH A;  4X62 I;  2LRS A;  2Z5E A;  4DV2 E;  2CPN A;  1ZXM A;  3HTX A;  1ZBQ A;  3LPS A;  3B82 A;  1YZ9 A;  2L2K B;  4DR6 I;  2M7Q A;  4L8N A;  2WZO A;  4JI5 E;  3VYY A;  3Q1Q A;  4DR1 E;  3VK6 A;  4IZJ B;  1ZM3 A;  2L2M A;  1FJG I;  4DUZ E;  4DV4 E;  2JY9 A;  2UXB I;  4JYA E;  4JI3 E;  4DR3 E;  2JOB A;  4F9C B;  4Z7Y A;  1FKA E;  1IBL E;  3H4L A;  2NUG A;  2KON A;  4B3R E;  2V88 A;  2A2D A;  2PNL A;  4DPY A;  2CGE A;  3J7Y p;  1J5E I;  2V86 A;  4DV1 E;  1T4N A;  2VQE I;  2N3H A;  2J7K A;  4B3M E;  5GMD A;  1B62 A;  4LF9 E;  4X64 E;  1Z0W A;  2LTR A;  5FLX C;  2V8P A;  4JI4 E;  1IBM E;  2M1S A;  2LJH A;  2F4V I;  3OML A;  4F9A B;  3FIG A;  4JV5 I;  1HNX I;  4JI0 I;  2BM1 A;  1EA6 A;  3H09 A;  2UUC E;  4DMI A;  5LMN E;  4X8W A;  3ADL A;  4Q28 A;  5AE1 A;  4F9B B;  2LTS A;  1USV A;  2CZ9 A;  4FW9 A;  4JI1 I;  1YYK A;  4K0K E;  4EMD A;  5FWK A;  3OTO E;  3JU0 A;  4X66 I;  4GKJ E;  4Z7C A;  1N34 I;  4P7D A;  2WW4 A;  4UT4 A;  4NXM I;  4LF5 E;  1XMO I;  3ZKD A;  2B7T A;  3IWC A;  2E5L I;  4KHP I;  4LF7 I;  4DV3 I;  2A2C A;  4BCA A;  1YYW A;  2HK2 A;  4B3T I;  5DNY A;  3HPZ A;  4AQY E;  2GQ0 A;  2UUA E;  4WYQ B;  1EI1 A;  1D6T A;  5LMU I;  2VF3 A;  4DR4 I;  2VE7 C;  2LBS B;  2HKJ A;  1KTV A;  1N36 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...