1XNRE

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
molecule tags Ribosome
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnrE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrE02
1XMQE 4P52A 1STUA 3V2UC 1N33I 2LJPA 1J26A 4DR6I 4JI4E 4RPFA 1PIEA 4JYAE 1DARA 5CFFE 1Z0EA 2ZBKB 1U2RA 3QT8A 2UXCE 4USKA 4ED4A 4JI0I 4EMDA 5LMNE 2HFSA 4X64I 4DR1E 4JI7E 1NHJA 1N33E 4LF4E 4JI6E 4LFCI 4FW9A 4LFAE 3ZZUA 3J81C 2NUFA 1OJ4A 1Z0TA 4UT4A 1B63A 1S4EA 4YY3E 4OX9E 3T1HE 2L3JA 4NXMI 2NA2A 1RC7A 4LF5E 2VQFE 1YZ9A 1N0UA 1N36E 1Z0CA 5IWAI 1X49A 2DEJA 1RREA 2ZM6E 4PU9A 4X66I 2HHHI 1ZBTA 2YT4A 3LNUA 1Z5BA 4DUZE 2ZITA 4X65I 3F0NA 4X62E 1N0VC 1O0WA 2CZ9A 1HNXI 4B3MI 4DV7I 4DV0I 3C4TA 4DUYE 1K47A 1DI2A 4LF9I 1UHZA 2RS6A 1ZM4A 4DV5I 3V5RA 1KTVA 4DPXA 4DKKA 4DR3I 2L33A 2Q2EB 2DEIA 3WU6A 4B3ME 1ZXMA 4DV0E 2RTXA 2V34A 1MX0A 4LFBI 1H73A 2UUAE 1T4OA 4DUYI 1UEKA 4GKKI 3PYGA 1VISA 2BM0A 4WUBA 1X48A 3J7Yp 2R42A 5LMUI 2DB2A 4AQYE 3QT7A 1I94I 1KIJA 2E1RA 4DPTA 4DR5I 4FWHA 4LF6I 4M2ZA 2B7VA 4X64E 4URLA 4LF5I 2JY9A 2NUEA 2EFGA 4OOGC 3B82A 4DV4I 3OTOI 4DR2E 3PYEA 2WW4A 1N32E 2R3VA 3JAMQ 3LLHA 1XNQE 1WHQA 4DPWA 4JI5E 3HULA 1FWLA 4JYAI 3K1JA 1XMOE 4DV3E 4R1FA 2N3GA 1FWKA 1WHNA 3PYDA 2L2NA 4DR4E 4DV1E 4DV2E 4JI2E 5GMEA 4KQVA 2JVAA 4HYMA 1H7SA 2XEXA 4JI8E 2LBSB 4MYUA 4DR7E 2OI2A 2UUAI 1QZRA 1N34I 2LTRA 2B3TB 4LF4I 4LF9E 1X47A 2IHR1 3B78A 1HR0I 2HFUA 1IBME 2UXDE 2A2CA 4OX9I 2BM1A 1BKNA 4LF7E 3CWVA 1J5EI 2UUBE 1NHIA 1IBLI 4NXNI 2E5LI 4K0KE 3QT6A 4DPYA 3K17A 4Z7CA 1PKPA 1HNWE 2LUQA 1ELOA 1KVKA 1KKHA 2CPNA 2BV3A 4B3SE 4DUZI 2AJ4A 4B3RI 1NHHA 3ADIA 1EI1A 2X7IA 4PRVA 2UXCI 3WU5A 1UILA 3VYXA 4LF8E 3J81Q 4NXNE 4DV1I 5IWAE 4DXLA 3WU3A 4DV6E 4HACB 4JI6I 4JI1I 4DR6E 4UTGA 1I94E 2DMYA 1FJGI 2LUPB 1IBMI 1Z5CA 3T1HI 2MDRA 1XMOI 2B7TA 3T1YE 4LF8I 4DR4I 1J5EE 4DV2I 3ADLA 2V2QA 4DV4E 1B62A 4KHPE 4GKJE 2UUCE 4X66E 4JI8I 2VQEE 3M6AA 1FNMA 1N34E 2V2VA 4JV5E 1Z0WA 2NUGA 1H72C 1QU6A 2F4VE 1Z0BA 4DR3E 2V8PA 4JI3E 2HKEA 4ZVIA 3ADGA 2LRSA 4NXME 5A2QQ 4B3TI 5A2QC 1XNRI 1H7UA 1N36I 2UUCI 4I3HA 2ZM6I 1GQEA 4XTJA 3Q1QA 2EZ6A 4DV6I 4JI1E 5IT9Q 4HXZA 1HNWI 2LTSA 4AQYI 1YYWA 2F4VI 1ZXNA 3QT5A 4YHHI 1HNZE 4JI3I 1Z59A 2L2MA 4JG4A 1YYKA 2UUBI 4LFBE 1HNXE 3J80Q 4MYTA 3ZKDA 4JI7I 2VQFI 5LL6R 3B8HA 1FI4A 5BR8I 2UXBI 5LMUE 3J7AM 1FJGE 4YHHE 3ZZ0A 4JI0E 5FLXQ 3GONA 4FWGA 4WUDA 3ZZTA 5FLXC 4DPUA 4HACA 4X62I 3PYFA 2HKJA 2HK3A 1Z0GA 2V2ZA 4WUCA 4GKJI 4WYQB 4KHPI 3ADJA 4X8WA 2VF3A 2VQEI 2UXBE 2NPFA 1XNQI 1ZM3A 1Z0VA 3ZM7A 4HY1A 3WU4A 3VYYA 3J80C 1Z5AA 1T4NA 1D6TA 2UXDI 1A6FA 2L3CA 4DV3I 4USMA 1XHKA 3C4BA 3JAMC 3J7AG 4DV7E 4PRXA 3LTOA 5LMNI 4FWDA 4DR7I 1IBKE 5GMDA 1N32I 2N3HA 4WFTA 2L2KB 5BR8E 2KHXA 1MU5A 1T4LB 3D4JA 1H74A 4LFAI 1HR0E 1RR9A 4X65E 1HNZI 2J7KA 2HK2A 4M30A 4DR5E 4LF6E 4YY3I 2A2DA 4FN5A 2E5LE 3H4LA 4JI2I 1IBKI 1WUUA 3ZKBA 3OTOE 4LFCE 5IT9C 4B3RE 4DV5E 1RQ0A 4DU8A 4JI5I 1EKZA 2RS7A 5L3JA 3HTXA 2UU9I 3P1XA 1PVGA 4LF7I 3T1YI 4DR1I 1FKAE 1ZM9A 2LJHA 1EA6A 4M1KA 4GKKE 2RSMA 2X36A 4DR2I 4K0KI 1XMQI 2HHHE 4P7AA 1S16A 2GS8A 4JI4I 4JV5I 4DU7A 4B3SI 1YYOA 2UU9E 1NZ0A 3LPSA 1MG7A 4B3TE 1XNRE 4Z7YA 1ZM2A 1IBLE 2DIXA
chains in the Genus database with same CATH superfamily
4P7DA 1XMQE 4P52A 3HKMA 2RQLA 4NBQA 1STUA 2C39B 4MLVA 4O24A 2JPAA 3V2UC 1N33I 2LJPA 3KZZA 1J26A 2DLQA 4JI4E 1P42A 4DR6I 4IFDA 3K6QA 2M7QA 1UDQA 4RPFA 5DNLA 2ADRA 4BMJA 3DD6A 5IV8B 1PIEA 1X6EA 2V87A 4IS1C 5CFFE 4JYAE 1DARA 2EP3A 1U2RA 1Z0EA 2EM3A 2ZBKB 3QT8A 5JEAC 2YU5A 1RMDA 4F9CB 4WSPA 2UXCE 4USKA 2C37A 4JI0I 4QNKA 4ED4A 1USUA 4EMDA 4ZYEA 2HJJA 2JEBA 2JEBB 2WZOA 5LMNE 2HFSA 4X64I 2EQ0A 3F6GA 1A1FA 2EM0A 5AC4A 4DR1E 4KWYA 1Z1BA 2EPKX 4JI7E 3P06A 1NHJA 2EPNA 4OO1A 5K36A 1N33E 2EMWA 2WBSA 4LF4E 4JI6E 3M85G 2EPAA 3M99B 5K36B 4LFCI 4FW9A 4LPFA 4DMIA 4WX9A 4LFAE 4F6NA 3ZZUA 2CGEA 3NZKA 4MU3A 3J81C 5C0XA 2NUFA 1OJ4A 2HC5A 1Z0TA 2LV2A 4UT4A 3ECRA 1B63A 1S4EA 2EMXA 4YY3E 2EOYA 2EE8A 4OX9E 3T1HE 2C37B 4LTYA 2L3JA 4NXMI 2NA2A 2EL6A 1RC7A 4LF5E 2VQFE 1YZ9A 1N0UA 1N36E 3EPKA 1Z0CA 5IWAI 1X49A 5ADZA 4F9BB 2R76A 1T38A 2DEJA 5AC5A 5A6BD 1RREA 2CSHA 2ZM6E 4PU9A 1L4SA 4X66I 4OKGA 3F6HA 2GPIA 3MHHC 2HHHI 1ZBTA 2EMHA 1BB8A 2YT4A 2M9AA 1WRJA 3LNUA 1Z5BA 4DUZE 3CDJA 4R2RA 2MKDA 2L92A 1X6FA 2BB8A 1A1IA 2LO3A 2ZITA 4X65I 3F0NA 2V83A 2EOQA 4X62E 1N0VC 4N4RB 1O0WA 2CZ9A 2JEAA 5K36E 4IFDB 1HNXI 5DRPA 1QNTA 2PNZB 4B3MI 4DV7I 1ZR9A 4DV0I 2YTQA 2GLIA 4F2JC 3BIDA 4U3BA 3C4TA 4DUYE 2ENHA 1K47A 1DI2A 2IOPA 4LF9I 1UHZA 2RS6A 1ZM4A 4DV5I 3V5RA 3H1CA 1KTVA 3Q6NA 4DPXA 4DKKA 1YSAC 4DR3I 1YFHA 1PJSA 1USVA 2EMKA 2L33A 1IMUA 2O1UA 4R03A 5LLQA 4J8ZA 2Q2EB 4WXDA 4IFDD 5FWKA 4BHBA 1A1KA 2DEIA 2EOJA 5K36D 3WU6A 4B3ME 1G2DC 2ENCA 4DV0E 1ZXMA 2NN6A 3P3CA 2RTXA 2V34A 1MX0A 4LFBI 1H73A 2UUAE 1T4OA 5AE3A 1IQOA 4DUYI 1UEKA 4GKKI 3PYGA 2YTJA 3MHSC 2YWQA 1VISA 2BM0A 4WUBA 1X48A 4IZKA 2EN3A 3J7Yp 2R42A 2WP8A 2PO1B 2ENAA 2DB2A 5IXMB 3AV0A 5LMUI 5KL2A 2IERA 4AQYE 2Z5BA 3QT7A 3K85A 4FW3A 1I94I 2EPXA 4R2CA 1KIJA 2M1SA 3JU0A 2E1RA 1EH6A 4DPTA 4DR5I 4FWHA 5A6BA 4LF6I 1TF6A 2JT2A 4BC7A 3QG5C 2PO0B 4M2ZA 2B7VA 3RMPA 2O3ZA 4X64E 2BA0D 1YUIA 2PO0A 4URLA 3KZYA 3GCMA 4LF5I 2JY9A 1PJTA 2NUEA 2EFGA 4OOGC 2EPPA 2JR1A 3B82A 4DV4I 2V8QB 2MKNA 3OTOI 5EL9A 4DR2E 3PYEA 1P47A 2WW4A 1N32E 1XXEA 2BA1D 2R3VA 3JAMQ 2IESA 1JK1A 3LLHA 1XNQE 4FW4A 1WHQA 2EOHA 5KL5A 4DPWA 2PO1A 4JI5E 2YRHA 4HEIA 2WCC3 3HULA 1FWLA 4JYAI 3PS2A 2LE2A 3K1JA 2C38A 1Y5YA 1XMOE 4DV3E 4R1FA 3P76A 4F54A 3U1YA 1TN9A 2N3GA 1FWKA 1WHNA 2CTDA 2GO4A 1NCSA 2L2NA 2NN6C 4DR4E 3PYDA 1E3PA 4DV1E 4N3OA 3M7ND 4DV2E 4JI2E 3UHMA 4AM3A 4BCAA 1IQSA 1R6LA 4KQVA 2JVAA 2CG9A 2HGHA 4HYMA 5GMEA 2PO2B 1H7SA 2YSOA 4JI8E 2LBSB 2XEXA 4DR7E 2OI2A 4MYUA 2UUAI 5DRRA 2EM6A 5T6JA 1QZRA 1N34I 2LTRA 2B3TB 4LF4I 4LF9E 2F8BA 2E1MA 4GZNC 1X47A 5K36F 4IFDF 2IHR1 3B78A 4MU1A 3HPZA 2NN6B 1HR0I 1Y4UA 2FGGA 1IBME 2HFUA 3VK6A 2E72A 2EPOA 2UXDE 2ELYA 4ZYHA 2A2CA 1MGTA 4OZEA 2YRMA 4OX9I 1ZBQA 1WXRA 2BM1A 1BKNA 2Z5EA 2DSYA 4LF7E 3CWVA 2UUBE 3L00A 1NHIA 2WP8B 3B4TA 4IJDA 1J5EI 1IBLI 3DJWA 4NXNI 4F9AB 3EPLA 2E5LI 4NZVA 4K0KE 3QT6A 4DPYA 1WJPA 2VE7C 4MU0A 3K17A 4Z7CA 5C0XE 4HTGA 2EMZA 1PKPA 2EPLX 2GO3A 1HNWE 2AE8A 1GTKA 3Q6MA 2EQ1A 4O5GA 2LUQA 1ELOA 1KVKA 1KKHA 2CPNA 3EPJA 4B3SE 2BV3A 1EH8A 2AJ4A 4DUZI 5K36C 1NHHA 4R2AA 1PDAA 1X5WA 4WSGA 3ADIA 1EI1A 2X7IA 4IZJB 4PRVA 2UXCI 2YTFA 1OYRA 3WU5A 5EKWA 3HJCA 4IZKB 2PNMA 2FTXB 2DMIA 5DRQA 4M0VA 2VESA 1UILA 3VYXA 3FIGA 4LF8E 4LU9A 3J81Q 4NXNE 2EM7A 2EQ3A 4DV1I 2EMYA 2B9DA 2EOFA 1GZ6A 4AIDA 2N8XA 5IWAE 1YH8A 4DXLA 5F3WA 2EOSA 1E3HA 1HK7A 4MU4A 2KOUA 3WU3A 5JEAA 2EN1A 4DV6E 3THNA 4HACB 4JI6I 4JI1I 1SR9A 3M85D 4BC9A 3GLLA 4DR6E 4UTGA 3OMLA 1I94E 2DMYA 2JOBA 3ZOQB 1FJGI 2LUPB 1F2IG 4FK5C 2NN6D 5A69A 4ISAA 4OO1B 1BBGA 2YTEA 1IBMI 1Z5CA 5DNXA 3T1HI 2MDRA 5KL7A 1XMOI 2B7TA 4OO1F 3T1YE 2L8TA 4LF8I 2BR2A 4B3RI 2DRPA 4DR4I 1J5EE 2EM9A 4R2DA 3ADLA 4DV4E 1B62A 5AE1A 4KHPE 4GKJE 2V2QA 4DV2I 4P78A 3IWCA 4BS9A 2YRKA 4X66E 3MSWA 2EORA 2UUCE 4JI8I 4BA1A 2VQEE 5C0XF 4GEQB 2EM8A 2NN6E 3M6AA 4LCGA 2EN2A 1AH5A 1FNMA 1N34E 4Q35B 2V2VA 2ODRD 4JV5E 1Z0WA 3PRYA 4U3DA 2NUGA 2EPRA 1UDSA 2KONA 3UK3C 1H72C 1QU6A 1A1LA 4R2EA 4ZYDA 2F4VE 3IWBA 1Z0BA 2YSPA 4DR3E 2C39A 2V8PA 2BR2B 2WNRB 2WNRA 2YZTA 3AUZA 2F1DA 4JI3E 2HKEA 4ZVIA 3ADGA 2LRSA 1A1JA 4NXME 5A2QQ 4B3TI 4TUGA 2M4IA 5A2QC 1XNRI 1H7UA 1UDOA 4OO1C 5TSEA 1N36I 2UUCI 4WXCA 4O4KA 2DLKA 4I3HA 1UDNA 4BA1B 2ZM6I 1JK2A 2I13A 2RSIA 1BBOA 1GQEA 4XTJA 3Q1QA 2EZ6A 3HQ1A 4DV6I 2BA1G 4BHCA 2MC5A 4JI1E 5IT9Q 4HXZA 1HNWI 2PRTA 2EPCA 2LTSA 2YPNA 2JWOA 5AASA 1YYWA 5C0XB 1ZXNA 2JE6A 3QT5A 2EMAA 4AQYI 2F4VI 1Y4SA 4YHHI 2K4VA 1HNZE 4JI3I 2EMCA 3BGHA 3EQ1A 1Z59A 2L2MA 2DGCA 5JEAD 4JG4A 2EL4A 1YYKA 2EMFA 2Q8UA 3HPSA 3PS3A 2Z5CA 2UUBI 2EMIA 4IZJA 4LFBE 1HNXE 2EN6A 3J80Q 4MYTA 3ZKDA 4JI7I 2VQFI 2R1FA 2YTIA 1ZAAC 4Q28A 4LOMA 5LL6R 2J65A 3B8HA 1FI4A 2J7JA 5DROA 2EN7A 5BR8I 3DF6A 2UXBI 5LMUE 4R2QA 2EM4A 3J7AM 2I9IA 1FJGE 3HXLA 4YHHE 4M9VC 2O1TA 4BBYA 1ZU1A 2YU8A 3P3EA 4JI0E 3ZZ0A 5FLXQ 3GONA 4FWGA 4WUDA 3ZZTA 3VHTB 5FLXC 1OYPA 4DPUA 4HACA 4X62I 3PYFA 3L7ZB 2HKJA 3KRNA 5A6KA 1DGCA 5JEAB 2YTGA 2RPCA 2HK3A 2MC6A 1X3CA 2EOMA 1NEIA 2V88A 3BBGA 1Z0GA 2V2ZA 3GMEA 4WUCA 1T39A 4WYQB 4GKJI 1Y60A 3ADJA 4X8WA 5C0XD 4KHPI 2O1WA 4MLQA 2VF3A 4LCFA 4L5NC 2EOXA 5ELWA 2VQEI 2UXBE 2NPFA 4RH8A 1XNQI 1ZM3A 4MDTA 4R8OA 1Z0VA 2PO2A 1A1GA 3ZM7A 4HY1A 3WU4A 4OO1D 3VYYA 3J80C 1YHCA 1Z5AA 1T4NA 2CT1A 3H09A 4F6MA 3C6KA 1D6TA 1SFEA 2EOEA 2EL5A 3C6MA 2G7HA 2L3CA 1A6FA 1Y6ZA 4USMA 1XHKA 4R2PA 1A1HA 4DV3I 3C4BA 2NN6F 2C38B 3JAMC 5AE2A 3TQMA 2LMZA 2MDGA 4RHBB 3J7AG 4R2SA 3LMLA 4DV7E 4PRXA 3LTOA 1KJKA 5LMNI 2UXDI 4FWDA 1R6MA 2EJ4A 1B69A 4DR7I 2EPMX 2ELZA 5A6JA 2JOXA 1IBKE 5A6AA 4MQYA 2WBUA 5GMDA 1UN6B 2EOOA 4J3DA 2N3HA 2NABA 4WFTA 2L2KB 3EPHA 4BA2A 4IFDE 1VI7A 5BR8E 2L6MA 2KHXA 1YUJA 4LCHA 1MU5A 1T4LB 3D4JA 1H74A 2V86A 5JEAE 1UBDC 4LFAI 2EN4A 5KL4A 3JTZA 1HR0E 4QNJA 2EM2A 4IZJD 1RR9A 4AIMA 4X65E 2LCEA 1HNZI 2J7KA 2HK2A 1PJQA 5KL3A 4M30A 4DR5E 4FW6A 4LF6E 1LLMC 4YY3I 3KWRA 2YTOA 1AAYA 4FW5A 3CDIA 2A2DA 1EH7A 2BBGA 4FN5A 2ODRC 2E5LE 3H4LA 4JI2I 4BA2B 4OO1E 2EMLA 2YTPA 4X9JA 1N32I 1IBKI 1OYSA 1WUUA 3ZKBA 2VF1A 3OTOE 2GQ0A 4WPYA 5IT9C 2V85A 4LFCE 3P3GA 4GQUA 2CVEA 5C0XC 2EMBA 4B3RE 4DV5E 1RQ0A 3BF2A 2EPZA 2VRDA 4DU8A 4TUIA 2LVHA 4JI5I 1EKZA 2RS7A 5KL6A 2EM5A 3HTXA 5L3JA 2UU9I 3P1XA 4L8NA 2LT7A 1PVGA 2YTNA 1TF3A 2EN8A 2IOQA 4LF7I 3T1YI 2Z5CB 2JEAB 1G2FC 2O1VA 3M7NG 1YPNA 2GHFA 4DR1I 2K7IA 1X6HA 1FKAE 1ZM9A 4ZYGA 2LJHA 1EA6A 4M1KA 4GKKE 2RSMA 2X36A 2YTDA 4DR2I 4K0KI 1XMQI 2HHHE 4P7AA 1S16A 2V89A 2FV4B 2LJUA 2GS8A 4JI4I 1KYQA 2JP9A 3U1KA 4JV5I 4DU7A 3L7ZA 1MEYC 1DQ3A 2EPUA 2H36X 4NHRA 3THOB 4IS9A 4FW7A 5JEAF 1YYOA 4B3SI 2Z5BB 2UU9E 2PNZA 2A25A 4IFDC 4KZSA 2EMGA 1RHYA 2EOIA 1NZ0A 2WBTA 3LPSA 1MG7A 2EOZA 2PNLA 5DNYA 2JXPA 4O43A 4B3TE 2JYAA 1XNRE 2BA0G 2D9HA 4Z7YA 3IWDA 1ZM2A 1IBLE 2JE6B 3PS1A 2EWLA 1N3GA 2DIXA 4I8OA
chains in the Genus database with same CATH topology
4P7DA 1XMQE 4P52A 1STUA 3V2UC 1N33I 2LJPA 1J26A 4DR6I 4JI4E 3K6QA 2M7QA 4RPFA 4BMJA 1PIEA 2V87A 4JYAE 1DARA 5CFFE 1Z0EA 2ZBKB 1U2RA 3QT8A 4F9CB 4WSPA 2UXCE 4USKA 4ED4A 4JI0I 4EMDA 1USUA 2WZOA 5LMNE 2HFSA 4X64I 3F6GA 4DR1E 4JI7E 3P06A 1NHJA 1N33E 4LF4E 4JI6E 4LFCI 4FW9A 4DMIA 4LFAE 3ZZUA 2CGEA 3J81C 2NUFA 1OJ4A 1Z0TA 4UT4A 1B63A 1S4EA 4YY3E 4OX9E 3T1HE 4LTYA 2L3JA 4NXMI 2NA2A 1RC7A 4LF5E 2VQFE 1YZ9A 1N0UA 1N36E 1Z0CA 5IWAI 1X49A 5ADZA 4F9BB 2DEJA 1RREA 2ZM6E 4PU9A 4X66I 3F6HA 2HHHI 1ZBTA 2YT4A 3LNUA 1Z5BA 4DUZE 2L92A 2ZITA 4X65I 3F0NA 2V83A 4X62E 1N0VC 1O0WA 2CZ9A 1HNXI 4B3MI 4DV7I 4DV0I 3C4TA 4DUYE 1K47A 1DI2A 2IOPA 4LF9I 1UHZA 2RS6A 1ZM4A 4DV5I 3V5RA 1KTVA 3Q6NA 4DPXA 4DKKA 4DR3I 1USVA 2L33A 2O1UA 4R03A 4J8ZA 2Q2EB 5FWKA 2DEIA 3WU6A 4B3ME 1ZXMA 4DV0E 2RTXA 2V34A 1MX0A 4LFBI 1H73A 2UUAE 1T4OA 5AE3A 4DUYI 1UEKA 4GKKI 3PYGA 1VISA 2BM0A 4WUBA 1X48A 4IZKA 3J7Yp 2R42A 5LMUI 2DB2A 3AV0A 4AQYE 2Z5BA 3QT7A 3K85A 1I94I 1KIJA 2M1SA 3JU0A 2E1RA 4DPTA 4DR5I 4FWHA 4LF6I 4BC7A 4M2ZA 2B7VA 3RMPA 4X64E 4URLA 4LF5I 2JY9A 2NUEA 2EFGA 4OOGC 2JR1A 3B82A 4DV4I 2V8QB 3OTOI 4DR2E 3PYEA 2WW4A 1N32E 2R3VA 3JAMQ 3LLHA 1XNQE 1WHQA 4DPWA 4JI5E 3HULA 1FWLA 4JYAI 2LE2A 3K1JA 1XMOE 4DV3E 4R1FA 4F54A 2N3GA 1FWKA 1WHNA 3PYDA 2L2NA 4DR4E 4N3OA 4DV1E 4DV2E 4JI2E 4BCAA 5GMEA 4KQVA 2JVAA 2CG9A 4HYMA 1H7SA 2XEXA 4JI8E 2LBSB 4MYUA 4DR7E 2OI2A 2UUAI 5T6JA 1QZRA 1N34I 2LTRA 2B3TB 4LF4I 4LF9E 2F8BA 2E1MA 1X47A 2IHR1 3B78A 1HR0I 3HPZA 1Y4UA 2FGGA 1IBME 2HFUA 3VK6A 2UXDE 2A2CA 4OX9I 1ZBQA 1WXRA 2BM1A 1BKNA 2Z5EA 2DSYA 4LF7E 3CWVA 2UUBE 1NHIA 1J5EI 1IBLI 3DJWA 4NXNI 4F9AB 2E5LI 4K0KE 3QT6A 4DPYA 2VE7C 3K17A 4Z7CA 1PKPA 1HNWE 3Q6MA 2LUQA 1ELOA 1KVKA 1KKHA 2CPNA 2BV3A 4B3SE 4DUZI 2AJ4A 4B3RI 1NHHA 3ADIA 1EI1A 4IZJB 2X7IA 4PRVA 2UXCI 3WU5A 3HJCA 4IZKB 2PNMA 2FTXB 4M0VA 1UILA 3VYXA 3FIGA 4LF8E 4LU9A 3J81Q 4NXNE 4DV1I 2B9DA 1GZ6A 5IWAE 4DXLA 5F3WA 1HK7A 3WU3A 2KOUA 4DV6E 4HACB 4JI6I 4JI1I 1SR9A 4BC9A 4DR6E 4UTGA 3OMLA 1I94E 2DMYA 2JOBA 3ZOQB 1FJGI 2LUPB 1IBMI 1Z5CA 3T1HI 2MDRA 1XMOI 2B7TA 3T1YE 2L8TA 4LF8I 4DR4I 1J5EE 4DV2I 3ADLA 2V2QA 4DV4E 1B62A 5AE1A 4KHPE 4GKJE 4P78A 3IWCA 4BS9A 4X66E 2UUCE 3MSWA 4JI8I 2VQEE 4GEQB 3M6AA 1FNMA 1N34E 2V2VA 2ODRD 4JV5E 1Z0WA 3PRYA 2NUGA 2KONA 1H72C 1QU6A 2F4VE 3IWBA 1Z0BA 4DR3E 2V8PA 2YZTA 3AUZA 4JI3E 2HKEA 4ZVIA 3ADGA 2LRSA 4NXME 5A2QQ 4B3TI 4TUGA 2M4IA 5A2QC 1XNRI 1H7UA 1N36I 2UUCI 4I3HA 2ZM6I 1GQEA 4XTJA 3Q1QA 2EZ6A 3HQ1A 4DV6I 2MC5A 4JI1E 5IT9Q 4HXZA 1HNWI 2LTSA 5AASA 2JWOA 4AQYI 1YYWA 2F4VI 1ZXNA 3QT5A 1Y4SA 4YHHI 2K4VA 1HNZE 4JI3I 1Z59A 2L2MA 4JG4A 1YYKA 3HPSA 2Z5CA 2UUBI 4IZJA 4LFBE 1HNXE 3J80Q 4MYTA 3ZKDA 4JI7I 2VQFI 4Q28A 5LL6R 3B8HA 1FI4A 5BR8I 3DF6A 2UXBI 5LMUE 3J7AM 1FJGE 3HXLA 4YHHE 2O1TA 4BBYA 3ZZ0A 4JI0E 5FLXQ 3GONA 4FWGA 4WUDA 3ZZTA 5FLXC 4DPUA 4HACA 4X62I 3PYFA 2HKJA 2HK3A 2MC6A 1Z0GA 2V2ZA 2V88A 4WUCA 4GKJI 4WYQB 4KHPI 3ADJA 4X8WA 2O1WA 2VF3A 4L5NC 2VQEI 2UXBE 2NPFA 1XNQI 1ZM3A 4R8OA 1Z0VA 3ZM7A 4HY1A 3WU4A 3VYYA 3J80C 1Z5AA 1T4NA 3H09A 1D6TA 2UXDI 2G7HA 2L3CA 1A6FA 1Y6ZA 4USMA 1XHKA 4DV3I 3C4BA 3JAMC 5AE2A 2LMZA 3J7AG 3LMLA 4DV7E 4PRXA 3LTOA 5LMNI 4FWDA 4DR7I 1IBKE 2JOXA 5GMDA 1N32I 2N3HA 4WFTA 2L2KB 5BR8E 2L6MA 2KHXA 1MU5A 1T4LB 3D4JA 1H74A 2V86A 4LFAI 1HR0E 3JTZA 4IZJD 1RR9A 4X65E 1HNZI 2J7KA 2HK2A 4M30A 4DR5E 4LF6E 4YY3I 3KWRA 2A2DA 4FN5A 2ODRC 2E5LE 3H4LA 4JI2I 1IBKI 1WUUA 3ZKBA 2VF1A 3OTOE 2GQ0A 4WPYA 5IT9C 2V85A 4LFCE 4B3RE 4DV5E 1RQ0A 4DU8A 4TUIA 4JI5I 1EKZA 2RS7A 5L3JA 3HTXA 2UU9I 3P1XA 4L8NA 1PVGA 2IOQA 4LF7I 3T1YI 2Z5CB 2O1VA 4DR1I 1FKAE 1ZM9A 2LJHA 1EA6A 4M1KA 4GKKE 2RSMA 2X36A 4DR2I 4K0KI 1XMQI 2HHHE 4P7AA 1S16A 2V89A 2FV4B 2GS8A 4JI4I 4JV5I 4DU7A 1DQ3A 2H36X 4B3SI 1YYOA 2Z5BB 2UU9E 4KZSA 1NZ0A 3LPSA 1MG7A 2PNLA 5DNYA 4B3TE 1XNRE 4Z7YA 3IWDA 1ZM2A 1IBLE 2EWLA 2DIXA 4I8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ E;  4P52 A;  1STU A;  3V2U C;  1N33 I;  2LJP A;  1J26 A;  4DR6 I;  4JI4 E;  4RPF A;  1PIE A;  4JYA E;  1DAR A;  5CFF E;  1Z0E A;  2ZBK B;  1U2R A;  3QT8 A;  2UXC E;  4USK A;  4ED4 A;  4JI0 I;  4EMD A;  5LMN E;  2HFS A;  4X64 I;  4DR1 E;  4JI7 E;  1NHJ A;  1N33 E;  4LF4 E;  4JI6 E;  4LFC I;  4FW9 A;  4LFA E;  3ZZU A;  3J81 C;  2NUF A;  1OJ4 A;  1Z0T A;  4UT4 A;  1B63 A;  1S4E A;  4YY3 E;  4OX9 E;  3T1H E;  2L3J A;  4NXM I;  2NA2 A;  1RC7 A;  4LF5 E;  2VQF E;  1YZ9 A;  1N0U A;  1N36 E;  1Z0C A;  5IWA I;  1X49 A;  2DEJ A;  1RRE A;  2ZM6 E;  4PU9 A;  4X66 I;  2HHH I;  1ZBT A;  2YT4 A;  3LNU A;  1Z5B A;  4DUZ E;  2ZIT A;  4X65 I;  3F0N A;  4X62 E;  1N0V C;  1O0W A;  2CZ9 A;  1HNX I;  4B3M I;  4DV7 I;  4DV0 I;  3C4T A;  4DUY E;  1K47 A;  1DI2 A;  4LF9 I;  1UHZ A;  2RS6 A;  1ZM4 A;  4DV5 I;  3V5R A;  1KTV A;  4DPX A;  4DKK A;  4DR3 I;  2L33 A;  2Q2E B;  2DEI A;  3WU6 A;  4B3M E;  1ZXM A;  4DV0 E;  2RTX A;  2V34 A;  1MX0 A;  4LFB I;  1H73 A;  2UUA E;  1T4O A;  4DUY I;  1UEK A;  4GKK I;  3PYG A;  1VIS A;  2BM0 A;  4WUB A;  1X48 A;  3J7Y p;  2R42 A;  5LMU I;  2DB2 A;  4AQY E;  3QT7 A;  1I94 I;  1KIJ A;  2E1R A;  4DPT A;  4DR5 I;  4FWH A;  4LF6 I;  4M2Z A;  2B7V A;  4X64 E;  4URL A;  4LF5 I;  2JY9 A;  2NUE A;  2EFG A;  4OOG C;  3B82 A;  4DV4 I;  3OTO I;  4DR2 E;  3PYE A;  2WW4 A;  1N32 E;  2R3V A;  3JAM Q;  3LLH A;  1XNQ E;  1WHQ A;  4DPW A;  4JI5 E;  3HUL A;  1FWL A;  4JYA I;  3K1J A;  1XMO E;  4DV3 E;  4R1F A;  2N3G A;  1FWK A;  1WHN A;  3PYD A;  2L2N A;  4DR4 E;  4DV1 E;  4DV2 E;  4JI2 E;  5GME A;  4KQV A;  2JVA A;  4HYM A;  1H7S A;  2XEX A;  4JI8 E;  2LBS B;  4MYU A;  4DR7 E;  2OI2 A;  2UUA I;  1QZR A;  1N34 I;  2LTR A;  2B3T B;  4LF4 I;  4LF9 E;  1X47 A;  2IHR 1;  3B78 A;  1HR0 I;  2HFU A;  1IBM E;  2UXD E;  2A2C A;  4OX9 I;  2BM1 A;  1BKN A;  4LF7 E;  3CWV A;  1J5E I;  2UUB E;  1NHI A;  1IBL I;  4NXN I;  2E5L I;  4K0K E;  3QT6 A;  4DPY A;  3K17 A;  4Z7C A;  1PKP A;  1HNW E;  2LUQ A;  1ELO A;  1KVK A;  1KKH A;  2CPN A;  2BV3 A;  4B3S E;  4DUZ I;  2AJ4 A;  4B3R I;  1NHH A;  3ADI A;  1EI1 A;  2X7I A;  4PRV A;  2UXC I;  3WU5 A;  1UIL A;  3VYX A;  4LF8 E;  3J81 Q;  4NXN E;  4DV1 I;  5IWA E;  4DXL A;  3WU3 A;  4DV6 E;  4HAC B;  4JI6 I;  4JI1 I;  4DR6 E;  4UTG A;  1I94 E;  2DMY A;  1FJG I;  2LUP B;  1IBM I;  1Z5C A;  3T1H I;  2MDR A;  1XMO I;  2B7T A;  3T1Y E;  4LF8 I;  4DR4 I;  1J5E E;  4DV2 I;  3ADL A;  2V2Q A;  4DV4 E;  1B62 A;  4KHP E;  4GKJ E;  2UUC E;  4X66 E;  4JI8 I;  2VQE E;  3M6A A;  1FNM A;  1N34 E;  2V2V A;  4JV5 E;  1Z0W A;  2NUG A;  1H72 C;  1QU6 A;  2F4V E;  1Z0B A;  4DR3 E;  2V8P A;  4JI3 E;  2HKE A;  4ZVI A;  3ADG A;  2LRS A;  4NXM E;  5A2Q Q;  4B3T I;  5A2Q C;  1XNR I;  1H7U A;  1N36 I;  2UUC I;  4I3H A;  2ZM6 I;  1GQE A;  4XTJ A;  3Q1Q A;  2EZ6 A;  4DV6 I;  4JI1 E;  5IT9 Q;  4HXZ A;  1HNW I;  2LTS A;  4AQY I;  1YYW A;  2F4V I;  1ZXN A;  3QT5 A;  4YHH I;  1HNZ E;  4JI3 I;  1Z59 A;  2L2M A;  4JG4 A;  1YYK A;  2UUB I;  4LFB E;  1HNX E;  3J80 Q;  4MYT A;  3ZKD A;  4JI7 I;  2VQF I;  5LL6 R;  3B8H A;  1FI4 A;  5BR8 I;  2UXB I;  5LMU E;  3J7A M;  1FJG E;  4YHH E;  3ZZ0 A;  4JI0 E;  5FLX Q;  3GON A;  4FWG A;  4WUD A;  3ZZT A;  5FLX C;  4DPU A;  4HAC A;  4X62 I;  3PYF A;  2HKJ A;  2HK3 A;  1Z0G A;  2V2Z A;  4WUC A;  4GKJ I;  4WYQ B;  4KHP I;  3ADJ A;  4X8W A;  2VF3 A;  2VQE I;  2UXB E;  2NPF A;  1XNQ I;  1ZM3 A;  1Z0V A;  3ZM7 A;  4HY1 A;  3WU4 A;  3VYY A;  3J80 C;  1Z5A A;  1T4N A;  1D6T A;  2UXD I;  1A6F A;  2L3C A;  4DV3 I;  4USM A;  1XHK A;  3C4B A;  3JAM C;  3J7A G;  4DV7 E;  4PRX A;  3LTO A;  5LMN I;  4FWD A;  4DR7 I;  1IBK E;  5GMD A;  1N32 I;  2N3H A;  4WFT A;  2L2K B;  5BR8 E;  2KHX A;  1MU5 A;  1T4L B;  3D4J A;  1H74 A;  4LFA I;  1HR0 E;  1RR9 A;  4X65 E;  1HNZ I;  2J7K A;  2HK2 A;  4M30 A;  4DR5 E;  4LF6 E;  4YY3 I;  2A2D A;  4FN5 A;  2E5L E;  3H4L A;  4JI2 I;  1IBK I;  1WUU A;  3ZKB A;  3OTO E;  4LFC E;  5IT9 C;  4B3R E;  4DV5 E;  1RQ0 A;  4DU8 A;  4JI5 I;  1EKZ A;  2RS7 A;  5L3J A;  3HTX A;  2UU9 I;  3P1X A;  1PVG A;  4LF7 I;  3T1Y I;  4DR1 I;  1FKA E;  1ZM9 A;  2LJH A;  1EA6 A;  4M1K A;  4GKK E;  2RSM A;  2X36 A;  4DR2 I;  4K0K I;  1XMQ I;  2HHH E;  4P7A A;  1S16 A;  2GS8 A;  4JI4 I;  4JV5 I;  4DU7 A;  4B3S I;  1YYO A;  2UU9 E;  1NZ0 A;  3LPS A;  1MG7 A;  4B3T E;  1XNR E;  4Z7Y A;  1ZM2 A;  1IBL E;  2DIX A; 
#chains in the Genus database with same CATH topology
 4P7D A;  1XMQ E;  4P52 A;  3HKM A;  2RQL A;  4NBQ A;  1STU A;  2C39 B;  4MLV A;  4O24 A;  2JPA A;  3V2U C;  1N33 I;  2LJP A;  3KZZ A;  1J26 A;  2DLQ A;  4JI4 E;  1P42 A;  4DR6 I;  4IFD A;  3K6Q A;  2M7Q A;  1UDQ A;  4RPF A;  5DNL A;  2ADR A;  4BMJ A;  3DD6 A;  5IV8 B;  1PIE A;  1X6E A;  2V87 A;  4IS1 C;  5CFF E;  4JYA E;  1DAR A;  2EP3 A;  1U2R A;  1Z0E A;  2EM3 A;  2ZBK B;  3QT8 A;  5JEA C;  2YU5 A;  1RMD A;  4F9C B;  4WSP A;  2UXC E;  4USK A;  2C37 A;  4JI0 I;  4QNK A;  4ED4 A;  1USU A;  4EMD A;  4ZYE A;  2HJJ A;  2JEB A;  2JEB B;  2WZO A;  5LMN E;  2HFS A;  4X64 I;  2EQ0 A;  3F6G A;  1A1F A;  2EM0 A;  5AC4 A;  4DR1 E;  4KWY A;  1Z1B A;  2EPK X;  4JI7 E;  3P06 A;  1NHJ A;  2EPN A;  4OO1 A;  5K36 A;  1N33 E;  2EMW A;  2WBS A;  4LF4 E;  4JI6 E;  3M85 G;  2EPA A;  3M99 B;  5K36 B;  4LFC I;  4FW9 A;  4LPF A;  4DMI A;  4WX9 A;  4LFA E;  4F6N A;  3ZZU A;  2CGE A;  3NZK A;  4MU3 A;  3J81 C;  5C0X A;  2NUF A;  1OJ4 A;  2HC5 A;  1Z0T A;  2LV2 A;  4UT4 A;  3ECR A;  1B63 A;  1S4E A;  2EMX A;  4YY3 E;  2EOY A;  2EE8 A;  4OX9 E;  3T1H E;  2C37 B;  4LTY A;  2L3J A;  4NXM I;  2NA2 A;  2EL6 A;  1RC7 A;  4LF5 E;  2VQF E;  1YZ9 A;  1N0U A;  1N36 E;  3EPK A;  1Z0C A;  5IWA I;  1X49 A;  5ADZ A;  4F9B B;  2R76 A;  1T38 A;  2DEJ A;  5AC5 A;  5A6B D;  1RRE A;  2CSH A;  2ZM6 E;  4PU9 A;  1L4S A;  4X66 I;  4OKG A;  3F6H A;  2GPI A;  3MHH C;  2HHH I;  1ZBT A;  2EMH A;  1BB8 A;  2YT4 A;  2M9A A;  1WRJ A;  3LNU A;  1Z5B A;  4DUZ E;  3CDJ A;  4R2R A;  2MKD A;  2L92 A;  1X6F A;  2BB8 A;  1A1I A;  2LO3 A;  2ZIT A;  4X65 I;  3F0N A;  2V83 A;  2EOQ A;  4X62 E;  1N0V C;  4N4R B;  1O0W A;  2CZ9 A;  2JEA A;  5K36 E;  4IFD B;  1HNX I;  5DRP A;  1QNT A;  2PNZ B;  4B3M I;  4DV7 I;  1ZR9 A;  4DV0 I;  2YTQ A;  2GLI A;  4F2J C;  3BID A;  4U3B A;  3C4T A;  4DUY E;  2ENH A;  1K47 A;  1DI2 A;  2IOP A;  4LF9 I;  1UHZ A;  2RS6 A;  1ZM4 A;  4DV5 I;  3V5R A;  3H1C A;  1KTV A;  3Q6N A;  4DPX A;  4DKK A;  1YSA C;  4DR3 I;  1YFH A;  1PJS A;  1USV A;  2EMK A;  2L33 A;  1IMU A;  2O1U A;  4R03 A;  5LLQ A;  4J8Z A;  2Q2E B;  4WXD A;  4IFD D;  5FWK A;  4BHB A;  1A1K A;  2DEI A;  2EOJ A;  5K36 D;  3WU6 A;  4B3M E;  1G2D C;  2ENC A;  4DV0 E;  1ZXM A;  2NN6 A;  3P3C A;  2RTX A;  2V34 A;  1MX0 A;  4LFB I;  1H73 A;  2UUA E;  1T4O A;  5AE3 A;  1IQO A;  4DUY I;  1UEK A;  4GKK I;  3PYG A;  2YTJ A;  3MHS C;  2YWQ A;  1VIS A;  2BM0 A;  4WUB A;  1X48 A;  4IZK A;  2EN3 A;  3J7Y p;  2R42 A;  2WP8 A;  2PO1 B;  2ENA A;  2DB2 A;  5IXM B;  3AV0 A;  5LMU I;  5KL2 A;  2IER A;  4AQY E;  2Z5B A;  3QT7 A;  3K85 A;  4FW3 A;  1I94 I;  2EPX A;  4R2C A;  1KIJ A;  2M1S A;  3JU0 A;  2E1R A;  1EH6 A;  4DPT A;  4DR5 I;  4FWH A;  5A6B A;  4LF6 I;  1TF6 A;  2JT2 A;  4BC7 A;  3QG5 C;  2PO0 B;  4M2Z A;  2B7V A;  3RMP A;  2O3Z A;  4X64 E;  2BA0 D;  1YUI A;  2PO0 A;  4URL A;  3KZY A;  3GCM A;  4LF5 I;  2JY9 A;  1PJT A;  2NUE A;  2EFG A;  4OOG C;  2EPP A;  2JR1 A;  3B82 A;  4DV4 I;  2V8Q B;  2MKN A;  3OTO I;  5EL9 A;  4DR2 E;  3PYE A;  1P47 A;  2WW4 A;  1N32 E;  1XXE A;  2BA1 D;  2R3V A;  3JAM Q;  2IES A;  1JK1 A;  3LLH A;  1XNQ E;  4FW4 A;  1WHQ A;  2EOH A;  5KL5 A;  4DPW A;  2PO1 A;  4JI5 E;  2YRH A;  4HEI A;  2WCC 3;  3HUL A;  1FWL A;  4JYA I;  3PS2 A;  2LE2 A;  3K1J A;  2C38 A;  1Y5Y A;  1XMO E;  4DV3 E;  4R1F A;  3P76 A;  4F54 A;  3U1Y A;  1TN9 A;  2N3G A;  1FWK A;  1WHN A;  2CTD A;  2GO4 A;  1NCS A;  2L2N A;  2NN6 C;  4DR4 E;  3PYD A;  1E3P A;  4DV1 E;  4N3O A;  3M7N D;  4DV2 E;  4JI2 E;  3UHM A;  4AM3 A;  4BCA A;  1IQS A;  1R6L A;  4KQV A;  2JVA A;  2CG9 A;  2HGH A;  4HYM A;  5GME A;  2PO2 B;  1H7S A;  2YSO A;  4JI8 E;  2LBS B;  2XEX A;  4DR7 E;  2OI2 A;  4MYU A;  2UUA I;  5DRR A;  2EM6 A;  5T6J A;  1QZR A;  1N34 I;  2LTR A;  2B3T B;  4LF4 I;  4LF9 E;  2F8B A;  2E1M A;  4GZN C;  1X47 A;  5K36 F;  4IFD F;  2IHR 1;  3B78 A;  4MU1 A;  3HPZ A;  2NN6 B;  1HR0 I;  1Y4U A;  2FGG A;  1IBM E;  2HFU A;  3VK6 A;  2E72 A;  2EPO A;  2UXD E;  2ELY A;  4ZYH A;  2A2C A;  1MGT A;  4OZE A;  2YRM A;  4OX9 I;  1ZBQ A;  1WXR A;  2BM1 A;  1BKN A;  2Z5E A;  2DSY A;  4LF7 E;  3CWV A;  2UUB E;  3L00 A;  1NHI A;  2WP8 B;  3B4T A;  4IJD A;  1J5E I;  1IBL I;  3DJW A;  4NXN I;  4F9A B;  3EPL A;  2E5L I;  4NZV A;  4K0K E;  3QT6 A;  4DPY A;  1WJP A;  2VE7 C;  4MU0 A;  3K17 A;  4Z7C A;  5C0X E;  4HTG A;  2EMZ A;  1PKP A;  2EPL X;  2GO3 A;  1HNW E;  2AE8 A;  1GTK A;  3Q6M A;  2EQ1 A;  4O5G A;  2LUQ A;  1ELO A;  1KVK A;  1KKH A;  2CPN A;  3EPJ A;  4B3S E;  2BV3 A;  1EH8 A;  2AJ4 A;  4DUZ I;  5K36 C;  1NHH A;  4R2A A;  1PDA A;  1X5W A;  4WSG A;  3ADI A;  1EI1 A;  2X7I A;  4IZJ B;  4PRV A;  2UXC I;  2YTF A;  1OYR A;  3WU5 A;  5EKW A;  3HJC A;  4IZK B;  2PNM A;  2FTX B;  2DMI A;  5DRQ A;  4M0V A;  2VES A;  1UIL A;  3VYX A;  3FIG A;  4LF8 E;  4LU9 A;  3J81 Q;  4NXN E;  2EM7 A;  2EQ3 A;  4DV1 I;  2EMY A;  2B9D A;  2EOF A;  1GZ6 A;  4AID A;  2N8X A;  5IWA E;  1YH8 A;  4DXL A;  5F3W A;  2EOS A;  1E3H A;  1HK7 A;  4MU4 A;  2KOU A;  3WU3 A;  5JEA A;  2EN1 A;  4DV6 E;  3THN A;  4HAC B;  4JI6 I;  4JI1 I;  1SR9 A;  3M85 D;  4BC9 A;  3GLL A;  4DR6 E;  4UTG A;  3OML A;  1I94 E;  2DMY A;  2JOB A;  3ZOQ B;  1FJG I;  2LUP B;  1F2I G;  4FK5 C;  2NN6 D;  5A69 A;  4ISA A;  4OO1 B;  1BBG A;  2YTE A;  1IBM I;  1Z5C A;  5DNX A;  3T1H I;  2MDR A;  5KL7 A;  1XMO I;  2B7T A;  4OO1 F;  3T1Y E;  2L8T A;  4LF8 I;  2BR2 A;  4B3R I;  2DRP A;  4DR4 I;  1J5E E;  2EM9 A;  4R2D A;  3ADL A;  4DV4 E;  1B62 A;  5AE1 A;  4KHP E;  4GKJ E;  2V2Q A;  4DV2 I;  4P78 A;  3IWC A;  4BS9 A;  2YRK A;  4X66 E;  3MSW A;  2EOR A;  2UUC E;  4JI8 I;  4BA1 A;  2VQE E;  5C0X F;  4GEQ B;  2EM8 A;  2NN6 E;  3M6A A;  4LCG A;  2EN2 A;  1AH5 A;  1FNM A;  1N34 E;  4Q35 B;  2V2V A;  2ODR D;  4JV5 E;  1Z0W A;  3PRY A;  4U3D A;  2NUG A;  2EPR A;  1UDS A;  2KON A;  3UK3 C;  1H72 C;  1QU6 A;  1A1L A;  4R2E A;  4ZYD A;  2F4V E;  3IWB A;  1Z0B A;  2YSP A;  4DR3 E;  2C39 A;  2V8P A;  2BR2 B;  2WNR B;  2WNR A;  2YZT A;  3AUZ A;  2F1D A;  4JI3 E;  2HKE A;  4ZVI A;  3ADG A;  2LRS A;  1A1J A;  4NXM E;  5A2Q Q;  4B3T I;  4TUG A;  2M4I A;  5A2Q C;  1XNR I;  1H7U A;  1UDO A;  4OO1 C;  5TSE A;  1N36 I;  2UUC I;  4WXC A;  4O4K A;  2DLK A;  4I3H A;  1UDN A;  4BA1 B;  2ZM6 I;  1JK2 A;  2I13 A;  2RSI A;  1BBO A;  1GQE A;  4XTJ A;  3Q1Q A;  2EZ6 A;  3HQ1 A;  4DV6 I;  2BA1 G;  4BHC A;  2MC5 A;  4JI1 E;  5IT9 Q;  4HXZ A;  1HNW I;  2PRT A;  2EPC A;  2LTS A;  2YPN A;  2JWO A;  5AAS A;  1YYW A;  5C0X B;  1ZXN A;  2JE6 A;  3QT5 A;  2EMA A;  4AQY I;  2F4V I;  1Y4S A;  4YHH I;  2K4V A;  1HNZ E;  4JI3 I;  2EMC A;  3BGH A;  3EQ1 A;  1Z59 A;  2L2M A;  2DGC A;  5JEA D;  4JG4 A;  2EL4 A;  1YYK A;  2EMF A;  2Q8U A;  3HPS A;  3PS3 A;  2Z5C A;  2UUB I;  2EMI A;  4IZJ A;  4LFB E;  1HNX E;  2EN6 A;  3J80 Q;  4MYT A;  3ZKD A;  4JI7 I;  2VQF I;  2R1F A;  2YTI A;  1ZAA C;  4Q28 A;  4LOM A;  5LL6 R;  2J65 A;  3B8H A;  1FI4 A;  2J7J A;  5DRO A;  2EN7 A;  5BR8 I;  3DF6 A;  2UXB I;  5LMU E;  4R2Q A;  2EM4 A;  3J7A M;  2I9I A;  1FJG E;  3HXL A;  4YHH E;  4M9V C;  2O1T A;  4BBY A;  1ZU1 A;  2YU8 A;  3P3E A;  4JI0 E;  3ZZ0 A;  5FLX Q;  3GON A;  4FWG A;  4WUD A;  3ZZT A;  3VHT B;  5FLX C;  1OYP A;  4DPU A;  4HAC A;  4X62 I;  3PYF A;  3L7Z B;  2HKJ A;  3KRN A;  5A6K A;  1DGC A;  5JEA B;  2YTG A;  2RPC A;  2HK3 A;  2MC6 A;  1X3C A;  2EOM A;  1NEI A;  2V88 A;  3BBG A;  1Z0G A;  2V2Z A;  3GME A;  4WUC A;  1T39 A;  4WYQ B;  4GKJ I;  1Y60 A;  3ADJ A;  4X8W A;  5C0X D;  4KHP I;  2O1W A;  4MLQ A;  2VF3 A;  4LCF A;  4L5N C;  2EOX A;  5ELW A;  2VQE I;  2UXB E;  2NPF A;  4RH8 A;  1XNQ I;  1ZM3 A;  4MDT A;  4R8O A;  1Z0V A;  2PO2 A;  1A1G A;  3ZM7 A;  4HY1 A;  3WU4 A;  4OO1 D;  3VYY A;  3J80 C;  1YHC A;  1Z5A A;  1T4N A;  2CT1 A;  3H09 A;  4F6M A;  3C6K A;  1D6T A;  1SFE A;  2EOE A;  2EL5 A;  3C6M A;  2G7H A;  2L3C A;  1A6F A;  1Y6Z A;  4USM A;  1XHK A;  4R2P A;  1A1H A;  4DV3 I;  3C4B A;  2NN6 F;  2C38 B;  3JAM C;  5AE2 A;  3TQM A;  2LMZ A;  2MDG A;  4RHB B;  3J7A G;  4R2S A;  3LML A;  4DV7 E;  4PRX A;  3LTO A;  1KJK A;  5LMN I;  2UXD I;  4FWD A;  1R6M A;  2EJ4 A;  1B69 A;  4DR7 I;  2EPM X;  2ELZ A;  5A6J A;  2JOX A;  1IBK E;  5A6A A;  4MQY A;  2WBU A;  5GMD A;  1UN6 B;  2EOO A;  4J3D A;  2N3H A;  2NAB A;  4WFT A;  2L2K B;  3EPH A;  4BA2 A;  4IFD E;  1VI7 A;  5BR8 E;  2L6M A;  2KHX A;  1YUJ A;  4LCH A;  1MU5 A;  1T4L B;  3D4J A;  1H74 A;  2V86 A;  5JEA E;  1UBD C;  4LFA I;  2EN4 A;  5KL4 A;  3JTZ A;  1HR0 E;  4QNJ A;  2EM2 A;  4IZJ D;  1RR9 A;  4AIM A;  4X65 E;  2LCE A;  1HNZ I;  2J7K A;  2HK2 A;  1PJQ A;  5KL3 A;  4M30 A;  4DR5 E;  4FW6 A;  4LF6 E;  1LLM C;  4YY3 I;  3KWR A;  2YTO A;  1AAY A;  4FW5 A;  3CDI A;  2A2D A;  1EH7 A;  2BBG A;  4FN5 A;  2ODR C;  2E5L E;  3H4L A;  4JI2 I;  4BA2 B;  4OO1 E;  2EML A;  2YTP A;  4X9J A;  1N32 I;  1IBK I;  1OYS A;  1WUU A;  3ZKB A;  2VF1 A;  3OTO E;  2GQ0 A;  4WPY A;  5IT9 C;  2V85 A;  4LFC E;  3P3G A;  4GQU A;  2CVE A;  5C0X C;  2EMB A;  4B3R E;  4DV5 E;  1RQ0 A;  3BF2 A;  2EPZ A;  2VRD A;  4DU8 A;  4TUI A;  2LVH A;  4JI5 I;  1EKZ A;  2RS7 A;  5KL6 A;  2EM5 A;  3HTX A;  5L3J A;  2UU9 I;  3P1X A;  4L8N A;  2LT7 A;  1PVG A;  2YTN A;  1TF3 A;  2EN8 A;  2IOQ A;  4LF7 I;  3T1Y I;  2Z5C B;  2JEA B;  1G2F C;  2O1V A;  3M7N G;  1YPN A;  2GHF A;  4DR1 I;  2K7I A;  1X6H A;  1FKA E;  1ZM9 A;  4ZYG A;  2LJH A;  1EA6 A;  4M1K A;  4GKK E;  2RSM A;  2X36 A;  2YTD A;  4DR2 I;  4K0K I;  1XMQ I;  2HHH E;  4P7A A;  1S16 A;  2V89 A;  2FV4 B;  2LJU A;  2GS8 A;  4JI4 I;  1KYQ A;  2JP9 A;  3U1K A;  4JV5 I;  4DU7 A;  3L7Z A;  1MEY C;  1DQ3 A;  2EPU A;  2H36 X;  4NHR A;  3THO B;  4IS9 A;  4FW7 A;  5JEA F;  1YYO A;  4B3S I;  2Z5B B;  2UU9 E;  2PNZ A;  2A25 A;  4IFD C;  4KZS A;  2EMG A;  1RHY A;  2EOI A;  1NZ0 A;  2WBT A;  3LPS A;  1MG7 A;  2EOZ A;  2PNL A;  5DNY A;  2JXP A;  4O43 A;  4B3T E;  2JYA A;  1XNR E;  2BA0 G;  2D9H A;  4Z7Y A;  3IWD A;  1ZM2 A;  1IBL E;  2JE6 B;  3PS1 A;  2EWL A;  1N3G A;  2DIX A;  4I8O A; 
#chains in the Genus database with same CATH homology
 4P7D A;  1XMQ E;  4P52 A;  1STU A;  3V2U C;  1N33 I;  2LJP A;  1J26 A;  4DR6 I;  4JI4 E;  3K6Q A;  2M7Q A;  4RPF A;  4BMJ A;  1PIE A;  2V87 A;  4JYA E;  1DAR A;  5CFF E;  1Z0E A;  2ZBK B;  1U2R A;  3QT8 A;  4F9C B;  4WSP A;  2UXC E;  4USK A;  4ED4 A;  4JI0 I;  4EMD A;  1USU A;  2WZO A;  5LMN E;  2HFS A;  4X64 I;  3F6G A;  4DR1 E;  4JI7 E;  3P06 A;  1NHJ A;  1N33 E;  4LF4 E;  4JI6 E;  4LFC I;  4FW9 A;  4DMI A;  4LFA E;  3ZZU A;  2CGE A;  3J81 C;  2NUF A;  1OJ4 A;  1Z0T A;  4UT4 A;  1B63 A;  1S4E A;  4YY3 E;  4OX9 E;  3T1H E;  4LTY A;  2L3J A;  4NXM I;  2NA2 A;  1RC7 A;  4LF5 E;  2VQF E;  1YZ9 A;  1N0U A;  1N36 E;  1Z0C A;  5IWA I;  1X49 A;  5ADZ A;  4F9B B;  2DEJ A;  1RRE A;  2ZM6 E;  4PU9 A;  4X66 I;  3F6H A;  2HHH I;  1ZBT A;  2YT4 A;  3LNU A;  1Z5B A;  4DUZ E;  2L92 A;  2ZIT A;  4X65 I;  3F0N A;  2V83 A;  4X62 E;  1N0V C;  1O0W A;  2CZ9 A;  1HNX I;  4B3M I;  4DV7 I;  4DV0 I;  3C4T A;  4DUY E;  1K47 A;  1DI2 A;  2IOP A;  4LF9 I;  1UHZ A;  2RS6 A;  1ZM4 A;  4DV5 I;  3V5R A;  1KTV A;  3Q6N A;  4DPX A;  4DKK A;  4DR3 I;  1USV A;  2L33 A;  2O1U A;  4R03 A;  4J8Z A;  2Q2E B;  5FWK A;  2DEI A;  3WU6 A;  4B3M E;  1ZXM A;  4DV0 E;  2RTX A;  2V34 A;  1MX0 A;  4LFB I;  1H73 A;  2UUA E;  1T4O A;  5AE3 A;  4DUY I;  1UEK A;  4GKK I;  3PYG A;  1VIS A;  2BM0 A;  4WUB A;  1X48 A;  4IZK A;  3J7Y p;  2R42 A;  5LMU I;  2DB2 A;  3AV0 A;  4AQY E;  2Z5B A;  3QT7 A;  3K85 A;  1I94 I;  1KIJ A;  2M1S A;  3JU0 A;  2E1R A;  4DPT A;  4DR5 I;  4FWH A;  4LF6 I;  4BC7 A;  4M2Z A;  2B7V A;  3RMP A;  4X64 E;  4URL A;  4LF5 I;  2JY9 A;  2NUE A;  2EFG A;  4OOG C;  2JR1 A;  3B82 A;  4DV4 I;  2V8Q B;  3OTO I;  4DR2 E;  3PYE A;  2WW4 A;  1N32 E;  2R3V A;  3JAM Q;  3LLH A;  1XNQ E;  1WHQ A;  4DPW A;  4JI5 E;  3HUL A;  1FWL A;  4JYA I;  2LE2 A;  3K1J A;  1XMO E;  4DV3 E;  4R1F A;  4F54 A;  2N3G A;  1FWK A;  1WHN A;  3PYD A;  2L2N A;  4DR4 E;  4N3O A;  4DV1 E;  4DV2 E;  4JI2 E;  4BCA A;  5GME A;  4KQV A;  2JVA A;  2CG9 A;  4HYM A;  1H7S A;  2XEX A;  4JI8 E;  2LBS B;  4MYU A;  4DR7 E;  2OI2 A;  2UUA I;  5T6J A;  1QZR A;  1N34 I;  2LTR A;  2B3T B;  4LF4 I;  4LF9 E;  2F8B A;  2E1M A;  1X47 A;  2IHR 1;  3B78 A;  1HR0 I;  3HPZ A;  1Y4U A;  2FGG A;  1IBM E;  2HFU A;  3VK6 A;  2UXD E;  2A2C A;  4OX9 I;  1ZBQ A;  1WXR A;  2BM1 A;  1BKN A;  2Z5E A;  2DSY A;  4LF7 E;  3CWV A;  2UUB E;  1NHI A;  1J5E I;  1IBL I;  3DJW A;  4NXN I;  4F9A B;  2E5L I;  4K0K E;  3QT6 A;  4DPY A;  2VE7 C;  3K17 A;  4Z7C A;  1PKP A;  1HNW E;  3Q6M A;  2LUQ A;  1ELO A;  1KVK A;  1KKH A;  2CPN A;  2BV3 A;  4B3S E;  4DUZ I;  2AJ4 A;  4B3R I;  1NHH A;  3ADI A;  1EI1 A;  4IZJ B;  2X7I A;  4PRV A;  2UXC I;  3WU5 A;  3HJC A;  4IZK B;  2PNM A;  2FTX B;  4M0V A;  1UIL A;  3VYX A;  3FIG A;  4LF8 E;  4LU9 A;  3J81 Q;  4NXN E;  4DV1 I;  2B9D A;  1GZ6 A;  5IWA E;  4DXL A;  5F3W A;  1HK7 A;  3WU3 A;  2KOU A;  4DV6 E;  4HAC B;  4JI6 I;  4JI1 I;  1SR9 A;  4BC9 A;  4DR6 E;  4UTG A;  3OML A;  1I94 E;  2DMY A;  2JOB A;  3ZOQ B;  1FJG I;  2LUP B;  1IBM I;  1Z5C A;  3T1H I;  2MDR A;  1XMO I;  2B7T A;  3T1Y E;  2L8T A;  4LF8 I;  4DR4 I;  1J5E E;  4DV2 I;  3ADL A;  2V2Q A;  4DV4 E;  1B62 A;  5AE1 A;  4KHP E;  4GKJ E;  4P78 A;  3IWC A;  4BS9 A;  4X66 E;  2UUC E;  3MSW A;  4JI8 I;  2VQE E;  4GEQ B;  3M6A A;  1FNM A;  1N34 E;  2V2V A;  2ODR D;  4JV5 E;  1Z0W A;  3PRY A;  2NUG A;  2KON A;  1H72 C;  1QU6 A;  2F4V E;  3IWB A;  1Z0B A;  4DR3 E;  2V8P A;  2YZT A;  3AUZ A;  4JI3 E;  2HKE A;  4ZVI A;  3ADG A;  2LRS A;  4NXM E;  5A2Q Q;  4B3T I;  4TUG A;  2M4I A;  5A2Q C;  1XNR I;  1H7U A;  1N36 I;  2UUC I;  4I3H A;  2ZM6 I;  1GQE A;  4XTJ A;  3Q1Q A;  2EZ6 A;  3HQ1 A;  4DV6 I;  2MC5 A;  4JI1 E;  5IT9 Q;  4HXZ A;  1HNW I;  2LTS A;  5AAS A;  2JWO A;  4AQY I;  1YYW A;  2F4V I;  1ZXN A;  3QT5 A;  1Y4S A;  4YHH I;  2K4V A;  1HNZ E;  4JI3 I;  1Z59 A;  2L2M A;  4JG4 A;  1YYK A;  3HPS A;  2Z5C A;  2UUB I;  4IZJ A;  4LFB E;  1HNX E;  3J80 Q;  4MYT A;  3ZKD A;  4JI7 I;  2VQF I;  4Q28 A;  5LL6 R;  3B8H A;  1FI4 A;  5BR8 I;  3DF6 A;  2UXB I;  5LMU E;  3J7A M;  1FJG E;  3HXL A;  4YHH E;  2O1T A;  4BBY A;  3ZZ0 A;  4JI0 E;  5FLX Q;  3GON A;  4FWG A;  4WUD A;  3ZZT A;  5FLX C;  4DPU A;  4HAC A;  4X62 I;  3PYF A;  2HKJ A;  2HK3 A;  2MC6 A;  1Z0G A;  2V2Z A;  2V88 A;  4WUC A;  4GKJ I;  4WYQ B;  4KHP I;  3ADJ A;  4X8W A;  2O1W A;  2VF3 A;  4L5N C;  2VQE I;  2UXB E;  2NPF A;  1XNQ I;  1ZM3 A;  4R8O A;  1Z0V A;  3ZM7 A;  4HY1 A;  3WU4 A;  3VYY A;  3J80 C;  1Z5A A;  1T4N A;  3H09 A;  1D6T A;  2UXD I;  2G7H A;  2L3C A;  1A6F A;  1Y6Z A;  4USM A;  1XHK A;  4DV3 I;  3C4B A;  3JAM C;  5AE2 A;  2LMZ A;  3J7A G;  3LML A;  4DV7 E;  4PRX A;  3LTO A;  5LMN I;  4FWD A;  4DR7 I;  1IBK E;  2JOX A;  5GMD A;  1N32 I;  2N3H A;  4WFT A;  2L2K B;  5BR8 E;  2L6M A;  2KHX A;  1MU5 A;  1T4L B;  3D4J A;  1H74 A;  2V86 A;  4LFA I;  1HR0 E;  3JTZ A;  4IZJ D;  1RR9 A;  4X65 E;  1HNZ I;  2J7K A;  2HK2 A;  4M30 A;  4DR5 E;  4LF6 E;  4YY3 I;  3KWR A;  2A2D A;  4FN5 A;  2ODR C;  2E5L E;  3H4L A;  4JI2 I;  1IBK I;  1WUU A;  3ZKB A;  2VF1 A;  3OTO E;  2GQ0 A;  4WPY A;  5IT9 C;  2V85 A;  4LFC E;  4B3R E;  4DV5 E;  1RQ0 A;  4DU8 A;  4TUI A;  4JI5 I;  1EKZ A;  2RS7 A;  5L3J A;  3HTX A;  2UU9 I;  3P1X A;  4L8N A;  1PVG A;  2IOQ A;  4LF7 I;  3T1Y I;  2Z5C B;  2O1V A;  4DR1 I;  1FKA E;  1ZM9 A;  2LJH A;  1EA6 A;  4M1K A;  4GKK E;  2RSM A;  2X36 A;  4DR2 I;  4K0K I;  1XMQ I;  2HHH E;  4P7A A;  1S16 A;  2V89 A;  2FV4 B;  2GS8 A;  4JI4 I;  4JV5 I;  4DU7 A;  1DQ3 A;  2H36 X;  4B3S I;  1YYO A;  2Z5B B;  2UU9 E;  4KZS A;  1NZ0 A;  3LPS A;  1MG7 A;  2PNL A;  5DNY A;  4B3T E;  1XNR E;  4Z7Y A;  3IWD A;  1ZM2 A;  1IBL E;  2EWL A;  2DIX A;  4I8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...