4GKJI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkjI00
1H72C 1IBKE 2UU9E 4JV5I 1RR9A 4DU8A 4MYTA 4B3TI 4DUZI 4LFBE 4DV3I 1N33I 1MG7A 1FJGE 4HYMA 2VQFI 1DARA 4FWHA 4NXMI 5IWAE 2A2DA 1NHHA 4JI3I 4DV0E 4DR6I 2LJPA 1N36I 2DEIA 4LF8I 5L3JA 3WU4A 2XEXA 4DUZE 1BKNA 2UUAE 4GKKI 4FN5A 1FKAE 2HHHE 2UUBI 4DR7I 2VQEI 1FWKA 4X65E 1ELOA 2V2ZA 2ZM6I 1N34E 1N0UA 1HNXI 1ZM2A 2HKJA 4X65I 4WUCA 4X64I 4LF6E 3J81Q 3ZM7A 1IBLE 2VQEE 3Q1QA 2WW4A 5LL6R 1XMOE 1N34I 4LF9I 4GKKE 3H4LA 1ZM9A 4DV5I 4LFAE 1Z0VA 4JI0I 4DR1I 3JAMQ 4DR7E 4USKA 2HFUA 4DV0I 4DR3I 4DV7I 5LMUI 2ZITA 4JI1E 3K1JA 3WU3A 3LNUA 4JG4A 4UT4A 3ZZ0A 4LF7E 2UUAI 4B3TE 4LFBI 4DPWA 1N32I 1H7UA 4USMA 1K47A 3B78A 1OJ4A 1KKHA 2VQFE 3J80C 1KTVA 5LMUE 3D4JA 4WUDA 3LPSA 4MYUA 4Z7CA 1Z0TA 3T1YE 4X66E 2E1RA 4DV3E 1N33E 2X7IA 4DUYI 3T1HE 4XTJA 3B82A 2BM1A 1FI4A 2V34A 2OI2A 4DR2I 3ZKDA 4YY3I 2A2CA 3LTOA 4LF4I 3WU5A 5A2QQ 2BM0A 2ZM6E 1MX0A 3OTOE 4B3ME 2GS8A 4I3HA 1HR0E 1ZXNA 4JYAI 3K17A 1N0VC 1EI1A 4DR5I 1HNZI 5GMDA 3QT5A 3CWVA 1B62A 4JI4E 5A2QC 2UXDI 4JI7E 4GKJI 4B3SI 4DR5E 1FWLA 2V2QA 3B8HA 1PKPA 4B3SE 4DV2I 5GMEA 4EMDA 1S16A 4WUBA 2UXCE 4DV5E 3F0NA 3WU6A 4OX9E 2HFSA 4LF4E 4JI8I 1XNQI 4FWGA 4DV4E 4DPXA 4YY3E 1H7SA 4DR2E 4ED4A 1A6FA 1ZXMA 4LF5I 5IWAI 2UU9I 2UUCI 2DEJA 3J80Q 3PYDA 4DPYA 3PYFA 2E5LI 4HXZA 4NXNE 1XNRE 4Z7YA 4AQYE 1EA6A 3V5RA 2R3VA 1QZRA 2VF3A 4JI5I 4PU9A 1HNWI 4YHHE 4JI2E 1N36E 4B3RE 4DUYE 4JI3E 4NXME 4X62I 1XMOI 3JAMC 4LF7I 1J5EE 1XNQE 3J7AG 2V2VA 4KHPI 4LF6I 2CZ9A 4DV6I 1Z5AA 4DV4I 4FWDA 2UXCI 4LF5E 1N32E 4LFCI 4JI8E 1HNXE 1IBKI 4K0KI 4DPUA 3ZZTA 3J81C 2EFGA 1WUUA 1Z5BA 1PVGA 5LMNI 5BR8E 4LF9E 2R42A 4HACB 1I94E 4URLA 4DR3E 1Z0EA 1XMQE 1Z59A 2UXDE 4B3MI 1Z0WA 3PYEA 4ZVIA 5BR8I 3GONA 3ZZUA 4K0KE 4DR6E 4DXLA 5LMNE 1S4EA 1KVKA 2HKEA 3J7AM 1D6TA 1VISA 1Z5CA 1U2RA 4DU7A 4KQVA 4DV6E 2X36A 4P7AA 4HY1A 4X64E 4B3RI 3ZKBA 4HACA 3T1YI 4DV1I 4KHPE 4PRVA 5FLXC 4JI6E 1IBMI 4AQYI 1H74A 3T1HI 2UUCE 1Z0CA 1IBME 4M1KA 4YHHI 2F4VI 2NPFA 1FNMA 1MU5A 2Q2EB 2UUBE 2F4VE 2UXBI 4RPFA 1ZM3A 4UTGA 5IT9C 4JV5E 1NHJA 4JI6I 4OX9I 1FJGI 4DR4I 1XHKA 1B63A 2UXBE 2HK2A 3M6AA 2ZBKB 3PYGA 5FLXQ 4JI0E 4JI7I 4GKJE 4R1FA 4P52A 2HK3A 1UEKA 1H73A 4DR1E 4DPTA 4DV7E 1I94I 1NHIA 3QT8A 1IBLI 3HULA 4JI1I 4PRXA 1Z0GA 4LFCE 4JI4I 4DV2E 1HNZE 4JYAE 4LFAI 4DR4E 1NZ0A 1Z0BA 3OTOI 3V2UC 1HNWE 1ZM4A 2J7KA 4X62E 2HHHI 1HR0I 2BV3A 3QT6A 4JI2I 4NXNI 4X66I 2E5LE 4LF8E 1XMQI 1PIEA 1KIJA 4FW9A 3QT7A 1J5EI 1RREA 1XNRI 5IT9Q 2AJ4A 2V8PA 4DV1E 4JI5E
chains in the Genus database with same CATH superfamily
1H72C 1IBKE 2UU9E 4JV5I 1RR9A 2WP8A 4DU8A 4MYTA 4B3TI 4DUZI 4LFBE 2BA0G 4DV3I 1N33I 5K36D 3CDJA 4BA2A 1MG7A 1FJGE 3PS2A 4HYMA 2VQFI 2JEBB 2PNMA 1DARA 4FWHA 4NXMI 5IWAE 1XXEA 2A2DA 1NHHA 4JI3I 4DV0E 4DR6I 3P06A 2LJPA 1N36I 2DEIA 4LF8I 5L3JA 3PRYA 3WU4A 2XEXA 4DUZE 1BKNA 2UUAE 4GKKI 4FN5A 1FKAE 2Z5BA 2HHHE 2UUBI 4IFDF 4OO1C 2C39B 1UDNA 1OYPA 4DR7I 2VQEI 4IZJD 1FWKA 1UDOA 2NN6D 2CG9A 4X65E 1ELOA 1P42A 2V2ZA 1Y5YA 2ZM6I 5JEAF 3P76A 1N34E 1N0UA 1HNXI 2PNZB 1ZM2A 2HKJA 5C0XB 4X65I 4WUCA 4X64I 4LF6E 3J81Q 3ZM7A 1IBLE 2VQEE 3Q1QA 2WW4A 5LL6R 2IESA 1XMOE 1N34I 2WNRA 4LF9I 4GKKE 3H4LA 1ZM9A 4DV5I 2IOQA 2GO4A 4LFAE 1Z0VA 4JI0I 4OO1A 4DR1I 3JAMQ 4DR7E 4USKA 2HFUA 4DV0I 4DR3I 4IZKA 4DV7I 5LMUI 5DROA 3M85G 5JEAB 2ZITA 4JI1E 3K1JA 5C0XD 3WU3A 3LNUA 1VI7A 4JG4A 4UT4A 3ZZ0A 4LF7E 4N3OA 3UHMA 4MDTA 2UUAI 1OYRA 4B3TE 4LFBI 4DPWA 1N32I 1H7UA 4USMA 1K47A 3B78A 4IZJB 1OJ4A 1KKHA 4FW5A 2VQFE 3J80C 3P3EA 1KTVA 5C0XF 5LMUE 4NBQA 3D4JA 2PO2A 2PO0A 4WUDA 3LPSA 4MQYA 4OO1B 4FW4A 4MYUA 4Z7CA 1Z0TA 3T1YE 4X66E 2E1RA 4DV3E 1N33E 2X7IA 5EL9A 4DUYI 2BA1G 2GQ0A 2NN6E 4FW3A 3T1HE 4XTJA 3DD6A 2NN6A 3L7ZA 2AE8A 3B82A 2BM1A 2JEAB 1FI4A 2V34A 2OI2A 3HKMA 4DR2I 3ZKDA 4LPFA 5K36B 4YY3I 4QNJA 4IZJA 2A2CA 4FW7A 4GQUA 3LTOA 4LF4I 2BR2B 3WU5A 5A2QQ 1Y4UA 2BM0A 4BA1B 2ZM6E 1MX0A 2Z5BB 3HJCA 3OTOE 2GS8A 4I3HA 1HR0E 4B3ME 1ZXNA 4JYAI 3K17A 1N0VC 1EI1A 4DR5I 1HNZI 2BA1D 3CDIA 5JEAC 2PO1B 5GMDA 3QT5A 3CWVA 1B62A 1YH8A 5DRRA 4JI4E 5A2QC 2UXDI 4JI7E 4GKJI 2JT2A 4B3SI 4DR5E 1FWLA 4OO1F 2V2QA 3B8HA 1PKPA 4B3SE 1Y6ZA 4DV2I 5GMEA 4EMDA 2Z5CA 1S16A 4WUBA 4BA2B 2UXCE 4DV5E 3F0NA 4IFDC 3WU6A 2HFSA 4OX9E 4LF4E 4IFDB 4JI8I 1XNQI 4OO1D 1Y60A 4FWGA 4DV4E 4DPXA 4YY3E 1H7SA 4DR2E 2O1VA 4ED4A 4FW6A 4MU0A 1A6FA 2WNRB 2C37A 1ZXMA 4LF5I 5IWAI 5DRQA 1UDSA 2UU9I 1YHCA 2UUCI 2DEJA 3J80Q 3M7NG 3PYDA 2GO3A 2O1TA 4DPYA 3GMEA 3PYFA 2IOPA 2E5LI 2Z5CB 3K85A 4HXZA 4NXNE 1XNRE 4Z7YA 5JEAD 4AQYE 2J65A 1EA6A 3V5RA 5DRPA 2R3VA 1QZRA 2VF3A 2NN6F 4JI5I 4PU9A 1HNWI 4YHHE 4JI2E 1N36E 4B3RE 4DUYE 4U3BA 4JI3E 4MU4A 2IERA 4MU1A 4NXME 4X62I 1XMOI 3JAMC 4LF7I 1J5EE 1XNQE 3J7AG 4IZKB 2V2VA 4KHPI 4LF6I 1USUA 2CZ9A 4OO1E 4DV6I 3KRNA 1HK7A 1Z5AA 4DV4I 4FWDA 2UXCI 4LF5E 1N32E 4LFCI 4JI8E 1HNXE 3M7ND 2JE6B 5EKWA 2PO0B 4QNKA 1IBKI 4K0KI 4DPUA 3ZZTA 3J81C 4LCGA 3U1YA 2EFGA 3H1CA 1WUUA 1Z5BA 3P3CA 1PVGA 5LMNI 5BR8E 4LF9E 2R42A 4HACB 2NN6B 1I94E 4URLA 4DR3E 1Z0EA 1XMQE 1Z59A 2UXDE 1OYSA 4B3MI 1Z0WA 3PYEA 4ZVIA 5BR8I 3GONA 4ISAA 3ZZUA 4K0KE 3U1KA 4IS9A 4J3DA 4DR6E 1USVA 4DXLA 2BA0D 5LMNE 1S4EA 2WP8B 1KVKA 2HKEA 2O3ZA 3J7AM 1D6TA 1VISA 1Z5CA 1U2RA 5K36F 4IFDE 4DU7A 4KQVA 4DV6E 2X36A 5FWKA 2CGEA 1R6MA 4P7AA 4HY1A 4X64E 4B3RI 2JEBA 3ZKBA 4HACA 3T1YI 4DV1I 4KHPE 4LCFA 4PRVA 4AIMA 5FLXC 4JI6E 1IBMI 2JEAA 4AQYI 1H74A 1RHYA 3T1HI 2UUCE 2PNZA 1Z0CA 3P3GA 1IBME 4M1KA 4YHHI 2F4VI 2BR2A 2NPFA 4IFDA 1FNMA 1MU5A 2Q2EB 2UUBE 4LCHA 2F4VE 2UXBI 2CVEA 4RPFA 3Q6NA 1ZM3A 4UTGA 3B4TA 5IT9C 2JE6A 2PO2B 4JV5E 1NHJA 2C38B 4JI6I 4OX9I 4AIDA 2PO1A 1FJGI 2NN6C 4DR4I 3PS1A 1XHKA 5C0XE 3GCMA 1B63A 2UXBE 2HK2A 3M6AA 2ZBKB 3PYGA 5ELWA 5FLXQ 4JI0E 4JI7I 2O1WA 4GKJE 4R1FA 4P52A 2O1UA 2HK3A 5K36E 1UEKA 1H73A 4DR1E 4BA1A 4DPTA 1E3PA 2VESA 3GLLA 4DV7E 1I94I 1Y4SA 4LOMA 1NHIA 3QT8A 1IBLI 4AM3A 3HULA 4JI1I 4PRXA 3NZKA 1Z0GA 2F1DA 5JEAE 4LFCE 4JI4I 3M85D 2C38A 4DV2E 1HNZE 5JEAA 4JYAE 4IFDD 4MU3A 5DNXA 4LFAI 4DR4E 5DNLA 2Z5EA 1NZ0A 1Z0BA 3OTOI 3V2UC 3PS3A 5K36A 1HNWE 1ZM4A 2J7KA 4OZEA 4X62E 4U3DA 2HHHI 1HR0I 5C0XC 1E3HA 2BV3A 3QT6A 4JI2I 4NXNI 5C0XA 4X66I 2E5LE 1UDQA 4LF8E 1XMQI 1PIEA 1KIJA 2PNLA 4FW9A 3QT7A 1J5EI 5K36C 1RREA 1XNRI 5IT9Q 4OKGA 2AJ4A 2V8PA 1R6LA 4DV1E 2C37B 4JI5E 3L7ZB 3Q6MA 2C39A
chains in the Genus database with same CATH topology
1H72C 1IBKE 2UU9E 4JV5I 1RR9A 4DU8A 4MYTA 4B3TI 4DUZI 4LFBE 4DV3I 1N33I 1MG7A 1FJGE 4HYMA 2VQFI 2PNMA 1DARA 4FWHA 4NXMI 5IWAE 2A2DA 1NHHA 4JI3I 4DV0E 4DR6I 3P06A 2LJPA 1N36I 2DEIA 4LF8I 5L3JA 3PRYA 3WU4A 2XEXA 4DUZE 1BKNA 2UUAE 4GKKI 4FN5A 1FKAE 2Z5BA 2HHHE 2UUBI 4DR7I 2VQEI 4IZJD 1FWKA 2CG9A 4X65E 1ELOA 2V2ZA 2ZM6I 1N34E 1N0UA 1HNXI 1ZM2A 2HKJA 4X65I 4WUCA 4X64I 4LF6E 3J81Q 3ZM7A 1IBLE 2VQEE 3Q1QA 2WW4A 5LL6R 1XMOE 1N34I 4LF9I 4GKKE 3H4LA 1ZM9A 4DV5I 2IOQA 4LFAE 1Z0VA 4JI0I 4DR1I 3JAMQ 4DR7E 4USKA 2HFUA 4DV0I 4DR3I 4IZKA 4DV7I 5LMUI 2ZITA 4JI1E 3K1JA 3WU3A 3LNUA 4JG4A 4UT4A 3ZZ0A 4LF7E 4N3OA 2UUAI 4B3TE 4LFBI 4DPWA 1N32I 1H7UA 4USMA 1K47A 3B78A 4IZJB 1OJ4A 1KKHA 2VQFE 3J80C 1KTVA 5LMUE 3D4JA 4WUDA 3LPSA 4MYUA 4Z7CA 1Z0TA 3T1YE 4X66E 2E1RA 4DV3E 1N33E 2X7IA 4DUYI 2GQ0A 3T1HE 4XTJA 3B82A 2BM1A 1FI4A 2V34A 2OI2A 4DR2I 3ZKDA 4YY3I 4IZJA 2A2CA 3LTOA 4LF4I 3WU5A 5A2QQ 1Y4UA 2BM0A 2ZM6E 1MX0A 2Z5BB 3HJCA 3OTOE 4B3ME 2GS8A 4I3HA 1HR0E 1ZXNA 4JYAI 3K17A 1N0VC 1EI1A 4DR5I 1HNZI 5GMDA 3QT5A 3CWVA 1B62A 4JI4E 5A2QC 2UXDI 4JI7E 4GKJI 4B3SI 4DR5E 1FWLA 2V2QA 3B8HA 1PKPA 4B3SE 1Y6ZA 4DV2I 5GMEA 4EMDA 2Z5CA 1S16A 4WUBA 2UXCE 4DV5E 3F0NA 3WU6A 2HFSA 4OX9E 4LF4E 4JI8I 1XNQI 4FWGA 4DV4E 4DPXA 4YY3E 1H7SA 4DR2E 2O1VA 4ED4A 1A6FA 1ZXMA 4LF5I 5IWAI 2UU9I 2UUCI 2DEJA 3J80Q 3PYDA 2O1TA 4DPYA 3PYFA 2IOPA 2E5LI 2Z5CB 3K85A 4HXZA 4NXNE 1XNRE 4Z7YA 4AQYE 1EA6A 3V5RA 2R3VA 1QZRA 2VF3A 4JI5I 4PU9A 1HNWI 4YHHE 4JI2E 1N36E 4B3RE 4DUYE 4JI3E 4NXME 4X62I 1XMOI 3JAMC 4LF7I 1J5EE 1XNQE 3J7AG 4IZKB 2V2VA 4KHPI 4LF6I 1USUA 2CZ9A 4DV6I 1HK7A 1Z5AA 4DV4I 4FWDA 2UXCI 4LF5E 1N32E 4LFCI 4JI8E 1HNXE 1IBKI 4K0KI 4DPUA 3ZZTA 3J81C 2EFGA 1WUUA 1Z5BA 1PVGA 5LMNI 5BR8E 4LF9E 2R42A 4HACB 1I94E 4URLA 4DR3E 1Z0EA 1XMQE 1Z59A 2UXDE 4B3MI 1Z0WA 3PYEA 4ZVIA 5BR8I 3GONA 3ZZUA 4K0KE 4DR6E 1USVA 4DXLA 5LMNE 1S4EA 1KVKA 2HKEA 3J7AM 1D6TA 1VISA 1Z5CA 1U2RA 4DU7A 4KQVA 4DV6E 2X36A 5FWKA 2CGEA 4P7AA 4HY1A 4X64E 4B3RI 3ZKBA 4HACA 3T1YI 4DV1I 4KHPE 4PRVA 5FLXC 4JI6E 1IBMI 4AQYI 1H74A 3T1HI 2UUCE 1Z0CA 1IBME 4M1KA 4YHHI 2F4VI 2NPFA 1FNMA 1MU5A 2Q2EB 2UUBE 2F4VE 2UXBI 4RPFA 3Q6NA 1ZM3A 4UTGA 5IT9C 4JV5E 1NHJA 4JI6I 4OX9I 1FJGI 4DR4I 1XHKA 1B63A 2UXBE 2HK2A 3M6AA 2ZBKB 3PYGA 5FLXQ 4JI0E 4JI7I 2O1WA 4GKJE 4R1FA 4P52A 2O1UA 2HK3A 1UEKA 1H73A 4DR1E 4DPTA 4DV7E 1I94I 1Y4SA 1NHIA 3QT8A 1IBLI 3HULA 4JI1I 4PRXA 1Z0GA 4LFCE 4JI4I 4DV2E 1HNZE 4JYAE 4LFAI 4DR4E 2Z5EA 1NZ0A 1Z0BA 3OTOI 3V2UC 1HNWE 1ZM4A 2J7KA 4X62E 2HHHI 1HR0I 2BV3A 3QT6A 4JI2I 4NXNI 4X66I 2E5LE 4LF8E 1XMQI 1PIEA 1KIJA 2PNLA 4FW9A 3QT7A 1J5EI 1RREA 1XNRI 5IT9Q 2AJ4A 2V8PA 4DV1E 4JI5E 3Q6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H72 C;  1IBK E;  2UU9 E;  4JV5 I;  1RR9 A;  4DU8 A;  4MYT A;  4B3T I;  4DUZ I;  4LFB E;  4DV3 I;  1N33 I;  1MG7 A;  1FJG E;  4HYM A;  2VQF I;  1DAR A;  4FWH A;  4NXM I;  5IWA E;  2A2D A;  1NHH A;  4JI3 I;  4DV0 E;  4DR6 I;  2LJP A;  1N36 I;  2DEI A;  4LF8 I;  5L3J A;  3WU4 A;  2XEX A;  4DUZ E;  1BKN A;  2UUA E;  4GKK I;  4FN5 A;  1FKA E;  2HHH E;  2UUB I;  4DR7 I;  2VQE I;  1FWK A;  4X65 E;  1ELO A;  2V2Z A;  2ZM6 I;  1N34 E;  1N0U A;  1HNX I;  1ZM2 A;  2HKJ A;  4X65 I;  4WUC A;  4X64 I;  4LF6 E;  3J81 Q;  3ZM7 A;  1IBL E;  2VQE E;  3Q1Q A;  2WW4 A;  5LL6 R;  1XMO E;  1N34 I;  4LF9 I;  4GKK E;  3H4L A;  1ZM9 A;  4DV5 I;  4LFA E;  1Z0V A;  4JI0 I;  4DR1 I;  3JAM Q;  4DR7 E;  4USK A;  2HFU A;  4DV0 I;  4DR3 I;  4DV7 I;  5LMU I;  2ZIT A;  4JI1 E;  3K1J A;  3WU3 A;  3LNU A;  4JG4 A;  4UT4 A;  3ZZ0 A;  4LF7 E;  2UUA I;  4B3T E;  4LFB I;  4DPW A;  1N32 I;  1H7U A;  4USM A;  1K47 A;  3B78 A;  1OJ4 A;  1KKH A;  2VQF E;  3J80 C;  1KTV A;  5LMU E;  3D4J A;  4WUD A;  3LPS A;  4MYU A;  4Z7C A;  1Z0T A;  3T1Y E;  4X66 E;  2E1R A;  4DV3 E;  1N33 E;  2X7I A;  4DUY I;  3T1H E;  4XTJ A;  3B82 A;  2BM1 A;  1FI4 A;  2V34 A;  2OI2 A;  4DR2 I;  3ZKD A;  4YY3 I;  2A2C A;  3LTO A;  4LF4 I;  3WU5 A;  5A2Q Q;  2BM0 A;  2ZM6 E;  1MX0 A;  3OTO E;  4B3M E;  2GS8 A;  4I3H A;  1HR0 E;  1ZXN A;  4JYA I;  3K17 A;  1N0V C;  1EI1 A;  4DR5 I;  1HNZ I;  5GMD A;  3QT5 A;  3CWV A;  1B62 A;  4JI4 E;  5A2Q C;  2UXD I;  4JI7 E;  4GKJ I;  4B3S I;  4DR5 E;  1FWL A;  2V2Q A;  3B8H A;  1PKP A;  4B3S E;  4DV2 I;  5GME A;  4EMD A;  1S16 A;  4WUB A;  2UXC E;  4DV5 E;  3F0N A;  3WU6 A;  4OX9 E;  2HFS A;  4LF4 E;  4JI8 I;  1XNQ I;  4FWG A;  4DV4 E;  4DPX A;  4YY3 E;  1H7S A;  4DR2 E;  4ED4 A;  1A6F A;  1ZXM A;  4LF5 I;  5IWA I;  2UU9 I;  2UUC I;  2DEJ A;  3J80 Q;  3PYD A;  4DPY A;  3PYF A;  2E5L I;  4HXZ A;  4NXN E;  1XNR E;  4Z7Y A;  4AQY E;  1EA6 A;  3V5R A;  2R3V A;  1QZR A;  2VF3 A;  4JI5 I;  4PU9 A;  1HNW I;  4YHH E;  4JI2 E;  1N36 E;  4B3R E;  4DUY E;  4JI3 E;  4NXM E;  4X62 I;  1XMO I;  3JAM C;  4LF7 I;  1J5E E;  1XNQ E;  3J7A G;  2V2V A;  4KHP I;  4LF6 I;  2CZ9 A;  4DV6 I;  1Z5A A;  4DV4 I;  4FWD A;  2UXC I;  4LF5 E;  1N32 E;  4LFC I;  4JI8 E;  1HNX E;  1IBK I;  4K0K I;  4DPU A;  3ZZT A;  3J81 C;  2EFG A;  1WUU A;  1Z5B A;  1PVG A;  5LMN I;  5BR8 E;  4LF9 E;  2R42 A;  4HAC B;  1I94 E;  4URL A;  4DR3 E;  1Z0E A;  1XMQ E;  1Z59 A;  2UXD E;  4B3M I;  1Z0W A;  3PYE A;  4ZVI A;  5BR8 I;  3GON A;  3ZZU A;  4K0K E;  4DR6 E;  4DXL A;  5LMN E;  1S4E A;  1KVK A;  2HKE A;  3J7A M;  1D6T A;  1VIS A;  1Z5C A;  1U2R A;  4DU7 A;  4KQV A;  4DV6 E;  2X36 A;  4P7A A;  4HY1 A;  4X64 E;  4B3R I;  3ZKB A;  4HAC A;  3T1Y I;  4DV1 I;  4KHP E;  4PRV A;  5FLX C;  4JI6 E;  1IBM I;  4AQY I;  1H74 A;  3T1H I;  2UUC E;  1Z0C A;  1IBM E;  4M1K A;  4YHH I;  2F4V I;  2NPF A;  1FNM A;  1MU5 A;  2Q2E B;  2UUB E;  2F4V E;  2UXB I;  4RPF A;  1ZM3 A;  4UTG A;  5IT9 C;  4JV5 E;  1NHJ A;  4JI6 I;  4OX9 I;  1FJG I;  4DR4 I;  1XHK A;  1B63 A;  2UXB E;  2HK2 A;  3M6A A;  2ZBK B;  3PYG A;  5FLX Q;  4JI0 E;  4JI7 I;  4GKJ E;  4R1F A;  4P52 A;  2HK3 A;  1UEK A;  1H73 A;  4DR1 E;  4DPT A;  4DV7 E;  1I94 I;  1NHI A;  3QT8 A;  1IBL I;  3HUL A;  4JI1 I;  4PRX A;  1Z0G A;  4LFC E;  4JI4 I;  4DV2 E;  1HNZ E;  4JYA E;  4LFA I;  4DR4 E;  1NZ0 A;  1Z0B A;  3OTO I;  3V2U C;  1HNW E;  1ZM4 A;  2J7K A;  4X62 E;  2HHH I;  1HR0 I;  2BV3 A;  3QT6 A;  4JI2 I;  4NXN I;  4X66 I;  2E5L E;  4LF8 E;  1XMQ I;  1PIE A;  1KIJ A;  4FW9 A;  3QT7 A;  1J5E I;  1RRE A;  1XNR I;  5IT9 Q;  2AJ4 A;  2V8P A;  4DV1 E;  4JI5 E; 
#chains in the Genus database with same CATH topology
 1H72 C;  1IBK E;  2UU9 E;  4JV5 I;  1RR9 A;  2WP8 A;  4DU8 A;  4MYT A;  4B3T I;  4DUZ I;  4LFB E;  2BA0 G;  4DV3 I;  1N33 I;  5K36 D;  3CDJ A;  4BA2 A;  1MG7 A;  1FJG E;  3PS2 A;  4HYM A;  2VQF I;  2JEB B;  2PNM A;  1DAR A;  4FWH A;  4NXM I;  5IWA E;  1XXE A;  2A2D A;  1NHH A;  4JI3 I;  4DV0 E;  4DR6 I;  3P06 A;  2LJP A;  1N36 I;  2DEI A;  4LF8 I;  5L3J A;  3PRY A;  3WU4 A;  2XEX A;  4DUZ E;  1BKN A;  2UUA E;  4GKK I;  4FN5 A;  1FKA E;  2Z5B A;  2HHH E;  2UUB I;  4IFD F;  4OO1 C;  2C39 B;  1UDN A;  1OYP A;  4DR7 I;  2VQE I;  4IZJ D;  1FWK A;  1UDO A;  2NN6 D;  2CG9 A;  4X65 E;  1ELO A;  1P42 A;  2V2Z A;  1Y5Y A;  2ZM6 I;  5JEA F;  3P76 A;  1N34 E;  1N0U A;  1HNX I;  2PNZ B;  1ZM2 A;  2HKJ A;  5C0X B;  4X65 I;  4WUC A;  4X64 I;  4LF6 E;  3J81 Q;  3ZM7 A;  1IBL E;  2VQE E;  3Q1Q A;  2WW4 A;  5LL6 R;  2IES A;  1XMO E;  1N34 I;  2WNR A;  4LF9 I;  4GKK E;  3H4L A;  1ZM9 A;  4DV5 I;  2IOQ A;  2GO4 A;  4LFA E;  1Z0V A;  4JI0 I;  4OO1 A;  4DR1 I;  3JAM Q;  4DR7 E;  4USK A;  2HFU A;  4DV0 I;  4DR3 I;  4IZK A;  4DV7 I;  5LMU I;  5DRO A;  3M85 G;  5JEA B;  2ZIT A;  4JI1 E;  3K1J A;  5C0X D;  3WU3 A;  3LNU A;  1VI7 A;  4JG4 A;  4UT4 A;  3ZZ0 A;  4LF7 E;  4N3O A;  3UHM A;  4MDT A;  2UUA I;  1OYR A;  4B3T E;  4LFB I;  4DPW A;  1N32 I;  1H7U A;  4USM A;  1K47 A;  3B78 A;  4IZJ B;  1OJ4 A;  1KKH A;  4FW5 A;  2VQF E;  3J80 C;  3P3E A;  1KTV A;  5C0X F;  5LMU E;  4NBQ A;  3D4J A;  2PO2 A;  2PO0 A;  4WUD A;  3LPS A;  4MQY A;  4OO1 B;  4FW4 A;  4MYU A;  4Z7C A;  1Z0T A;  3T1Y E;  4X66 E;  2E1R A;  4DV3 E;  1N33 E;  2X7I A;  5EL9 A;  4DUY I;  2BA1 G;  2GQ0 A;  2NN6 E;  4FW3 A;  3T1H E;  4XTJ A;  3DD6 A;  2NN6 A;  3L7Z A;  2AE8 A;  3B82 A;  2BM1 A;  2JEA B;  1FI4 A;  2V34 A;  2OI2 A;  3HKM A;  4DR2 I;  3ZKD A;  4LPF A;  5K36 B;  4YY3 I;  4QNJ A;  4IZJ A;  2A2C A;  4FW7 A;  4GQU A;  3LTO A;  4LF4 I;  2BR2 B;  3WU5 A;  5A2Q Q;  1Y4U A;  2BM0 A;  4BA1 B;  2ZM6 E;  1MX0 A;  2Z5B B;  3HJC A;  3OTO E;  2GS8 A;  4I3H A;  1HR0 E;  4B3M E;  1ZXN A;  4JYA I;  3K17 A;  1N0V C;  1EI1 A;  4DR5 I;  1HNZ I;  2BA1 D;  3CDI A;  5JEA C;  2PO1 B;  5GMD A;  3QT5 A;  3CWV A;  1B62 A;  1YH8 A;  5DRR A;  4JI4 E;  5A2Q C;  2UXD I;  4JI7 E;  4GKJ I;  2JT2 A;  4B3S I;  4DR5 E;  1FWL A;  4OO1 F;  2V2Q A;  3B8H A;  1PKP A;  4B3S E;  1Y6Z A;  4DV2 I;  5GME A;  4EMD A;  2Z5C A;  1S16 A;  4WUB A;  4BA2 B;  2UXC E;  4DV5 E;  3F0N A;  4IFD C;  3WU6 A;  2HFS A;  4OX9 E;  4LF4 E;  4IFD B;  4JI8 I;  1XNQ I;  4OO1 D;  1Y60 A;  4FWG A;  4DV4 E;  4DPX A;  4YY3 E;  1H7S A;  4DR2 E;  2O1V A;  4ED4 A;  4FW6 A;  4MU0 A;  1A6F A;  2WNR B;  2C37 A;  1ZXM A;  4LF5 I;  5IWA I;  5DRQ A;  1UDS A;  2UU9 I;  1YHC A;  2UUC I;  2DEJ A;  3J80 Q;  3M7N G;  3PYD A;  2GO3 A;  2O1T A;  4DPY A;  3GME A;  3PYF A;  2IOP A;  2E5L I;  2Z5C B;  3K85 A;  4HXZ A;  4NXN E;  1XNR E;  4Z7Y A;  5JEA D;  4AQY E;  2J65 A;  1EA6 A;  3V5R A;  5DRP A;  2R3V A;  1QZR A;  2VF3 A;  2NN6 F;  4JI5 I;  4PU9 A;  1HNW I;  4YHH E;  4JI2 E;  1N36 E;  4B3R E;  4DUY E;  4U3B A;  4JI3 E;  4MU4 A;  2IER A;  4MU1 A;  4NXM E;  4X62 I;  1XMO I;  3JAM C;  4LF7 I;  1J5E E;  1XNQ E;  3J7A G;  4IZK B;  2V2V A;  4KHP I;  4LF6 I;  1USU A;  2CZ9 A;  4OO1 E;  4DV6 I;  3KRN A;  1HK7 A;  1Z5A A;  4DV4 I;  4FWD A;  2UXC I;  4LF5 E;  1N32 E;  4LFC I;  4JI8 E;  1HNX E;  3M7N D;  2JE6 B;  5EKW A;  2PO0 B;  4QNK A;  1IBK I;  4K0K I;  4DPU A;  3ZZT A;  3J81 C;  4LCG A;  3U1Y A;  2EFG A;  3H1C A;  1WUU A;  1Z5B A;  3P3C A;  1PVG A;  5LMN I;  5BR8 E;  4LF9 E;  2R42 A;  4HAC B;  2NN6 B;  1I94 E;  4URL A;  4DR3 E;  1Z0E A;  1XMQ E;  1Z59 A;  2UXD E;  1OYS A;  4B3M I;  1Z0W A;  3PYE A;  4ZVI A;  5BR8 I;  3GON A;  4ISA A;  3ZZU A;  4K0K E;  3U1K A;  4IS9 A;  4J3D A;  4DR6 E;  1USV A;  4DXL A;  2BA0 D;  5LMN E;  1S4E A;  2WP8 B;  1KVK A;  2HKE A;  2O3Z A;  3J7A M;  1D6T A;  1VIS A;  1Z5C A;  1U2R A;  5K36 F;  4IFD E;  4DU7 A;  4KQV A;  4DV6 E;  2X36 A;  5FWK A;  2CGE A;  1R6M A;  4P7A A;  4HY1 A;  4X64 E;  4B3R I;  2JEB A;  3ZKB A;  4HAC A;  3T1Y I;  4DV1 I;  4KHP E;  4LCF A;  4PRV A;  4AIM A;  5FLX C;  4JI6 E;  1IBM I;  2JEA A;  4AQY I;  1H74 A;  1RHY A;  3T1H I;  2UUC E;  2PNZ A;  1Z0C A;  3P3G A;  1IBM E;  4M1K A;  4YHH I;  2F4V I;  2BR2 A;  2NPF A;  4IFD A;  1FNM A;  1MU5 A;  2Q2E B;  2UUB E;  4LCH A;  2F4V E;  2UXB I;  2CVE A;  4RPF A;  3Q6N A;  1ZM3 A;  4UTG A;  3B4T A;  5IT9 C;  2JE6 A;  2PO2 B;  4JV5 E;  1NHJ A;  2C38 B;  4JI6 I;  4OX9 I;  4AID A;  2PO1 A;  1FJG I;  2NN6 C;  4DR4 I;  3PS1 A;  1XHK A;  5C0X E;  3GCM A;  1B63 A;  2UXB E;  2HK2 A;  3M6A A;  2ZBK B;  3PYG A;  5ELW A;  5FLX Q;  4JI0 E;  4JI7 I;  2O1W A;  4GKJ E;  4R1F A;  4P52 A;  2O1U A;  2HK3 A;  5K36 E;  1UEK A;  1H73 A;  4DR1 E;  4BA1 A;  4DPT A;  1E3P A;  2VES A;  3GLL A;  4DV7 E;  1I94 I;  1Y4S A;  4LOM A;  1NHI A;  3QT8 A;  1IBL I;  4AM3 A;  3HUL A;  4JI1 I;  4PRX A;  3NZK A;  1Z0G A;  2F1D A;  5JEA E;  4LFC E;  4JI4 I;  3M85 D;  2C38 A;  4DV2 E;  1HNZ E;  5JEA A;  4JYA E;  4IFD D;  4MU3 A;  5DNX A;  4LFA I;  4DR4 E;  5DNL A;  2Z5E A;  1NZ0 A;  1Z0B A;  3OTO I;  3V2U C;  3PS3 A;  5K36 A;  1HNW E;  1ZM4 A;  2J7K A;  4OZE A;  4X62 E;  4U3D A;  2HHH I;  1HR0 I;  5C0X C;  1E3H A;  2BV3 A;  3QT6 A;  4JI2 I;  4NXN I;  5C0X A;  4X66 I;  2E5L E;  1UDQ A;  4LF8 E;  1XMQ I;  1PIE A;  1KIJ A;  2PNL A;  4FW9 A;  3QT7 A;  1J5E I;  5K36 C;  1RRE A;  1XNR I;  5IT9 Q;  4OKG A;  2AJ4 A;  2V8P A;  1R6L A;  4DV1 E;  2C37 B;  4JI5 E;  3L7Z B;  3Q6M A;  2C39 A; 
#chains in the Genus database with same CATH homology
 1H72 C;  1IBK E;  2UU9 E;  4JV5 I;  1RR9 A;  4DU8 A;  4MYT A;  4B3T I;  4DUZ I;  4LFB E;  4DV3 I;  1N33 I;  1MG7 A;  1FJG E;  4HYM A;  2VQF I;  2PNM A;  1DAR A;  4FWH A;  4NXM I;  5IWA E;  2A2D A;  1NHH A;  4JI3 I;  4DV0 E;  4DR6 I;  3P06 A;  2LJP A;  1N36 I;  2DEI A;  4LF8 I;  5L3J A;  3PRY A;  3WU4 A;  2XEX A;  4DUZ E;  1BKN A;  2UUA E;  4GKK I;  4FN5 A;  1FKA E;  2Z5B A;  2HHH E;  2UUB I;  4DR7 I;  2VQE I;  4IZJ D;  1FWK A;  2CG9 A;  4X65 E;  1ELO A;  2V2Z A;  2ZM6 I;  1N34 E;  1N0U A;  1HNX I;  1ZM2 A;  2HKJ A;  4X65 I;  4WUC A;  4X64 I;  4LF6 E;  3J81 Q;  3ZM7 A;  1IBL E;  2VQE E;  3Q1Q A;  2WW4 A;  5LL6 R;  1XMO E;  1N34 I;  4LF9 I;  4GKK E;  3H4L A;  1ZM9 A;  4DV5 I;  2IOQ A;  4LFA E;  1Z0V A;  4JI0 I;  4DR1 I;  3JAM Q;  4DR7 E;  4USK A;  2HFU A;  4DV0 I;  4DR3 I;  4IZK A;  4DV7 I;  5LMU I;  2ZIT A;  4JI1 E;  3K1J A;  3WU3 A;  3LNU A;  4JG4 A;  4UT4 A;  3ZZ0 A;  4LF7 E;  4N3O A;  2UUA I;  4B3T E;  4LFB I;  4DPW A;  1N32 I;  1H7U A;  4USM A;  1K47 A;  3B78 A;  4IZJ B;  1OJ4 A;  1KKH A;  2VQF E;  3J80 C;  1KTV A;  5LMU E;  3D4J A;  4WUD A;  3LPS A;  4MYU A;  4Z7C A;  1Z0T A;  3T1Y E;  4X66 E;  2E1R A;  4DV3 E;  1N33 E;  2X7I A;  4DUY I;  2GQ0 A;  3T1H E;  4XTJ A;  3B82 A;  2BM1 A;  1FI4 A;  2V34 A;  2OI2 A;  4DR2 I;  3ZKD A;  4YY3 I;  4IZJ A;  2A2C A;  3LTO A;  4LF4 I;  3WU5 A;  5A2Q Q;  1Y4U A;  2BM0 A;  2ZM6 E;  1MX0 A;  2Z5B B;  3HJC A;  3OTO E;  4B3M E;  2GS8 A;  4I3H A;  1HR0 E;  1ZXN A;  4JYA I;  3K17 A;  1N0V C;  1EI1 A;  4DR5 I;  1HNZ I;  5GMD A;  3QT5 A;  3CWV A;  1B62 A;  4JI4 E;  5A2Q C;  2UXD I;  4JI7 E;  4GKJ I;  4B3S I;  4DR5 E;  1FWL A;  2V2Q A;  3B8H A;  1PKP A;  4B3S E;  1Y6Z A;  4DV2 I;  5GME A;  4EMD A;  2Z5C A;  1S16 A;  4WUB A;  2UXC E;  4DV5 E;  3F0N A;  3WU6 A;  2HFS A;  4OX9 E;  4LF4 E;  4JI8 I;  1XNQ I;  4FWG A;  4DV4 E;  4DPX A;  4YY3 E;  1H7S A;  4DR2 E;  2O1V A;  4ED4 A;  1A6F A;  1ZXM A;  4LF5 I;  5IWA I;  2UU9 I;  2UUC I;  2DEJ A;  3J80 Q;  3PYD A;  2O1T A;  4DPY A;  3PYF A;  2IOP A;  2E5L I;  2Z5C B;  3K85 A;  4HXZ A;  4NXN E;  1XNR E;  4Z7Y A;  4AQY E;  1EA6 A;  3V5R A;  2R3V A;  1QZR A;  2VF3 A;  4JI5 I;  4PU9 A;  1HNW I;  4YHH E;  4JI2 E;  1N36 E;  4B3R E;  4DUY E;  4JI3 E;  4NXM E;  4X62 I;  1XMO I;  3JAM C;  4LF7 I;  1J5E E;  1XNQ E;  3J7A G;  4IZK B;  2V2V A;  4KHP I;  4LF6 I;  1USU A;  2CZ9 A;  4DV6 I;  1HK7 A;  1Z5A A;  4DV4 I;  4FWD A;  2UXC I;  4LF5 E;  1N32 E;  4LFC I;  4JI8 E;  1HNX E;  1IBK I;  4K0K I;  4DPU A;  3ZZT A;  3J81 C;  2EFG A;  1WUU A;  1Z5B A;  1PVG A;  5LMN I;  5BR8 E;  4LF9 E;  2R42 A;  4HAC B;  1I94 E;  4URL A;  4DR3 E;  1Z0E A;  1XMQ E;  1Z59 A;  2UXD E;  4B3M I;  1Z0W A;  3PYE A;  4ZVI A;  5BR8 I;  3GON A;  3ZZU A;  4K0K E;  4DR6 E;  1USV A;  4DXL A;  5LMN E;  1S4E A;  1KVK A;  2HKE A;  3J7A M;  1D6T A;  1VIS A;  1Z5C A;  1U2R A;  4DU7 A;  4KQV A;  4DV6 E;  2X36 A;  5FWK A;  2CGE A;  4P7A A;  4HY1 A;  4X64 E;  4B3R I;  3ZKB A;  4HAC A;  3T1Y I;  4DV1 I;  4KHP E;  4PRV A;  5FLX C;  4JI6 E;  1IBM I;  4AQY I;  1H74 A;  3T1H I;  2UUC E;  1Z0C A;  1IBM E;  4M1K A;  4YHH I;  2F4V I;  2NPF A;  1FNM A;  1MU5 A;  2Q2E B;  2UUB E;  2F4V E;  2UXB I;  4RPF A;  3Q6N A;  1ZM3 A;  4UTG A;  5IT9 C;  4JV5 E;  1NHJ A;  4JI6 I;  4OX9 I;  1FJG I;  4DR4 I;  1XHK A;  1B63 A;  2UXB E;  2HK2 A;  3M6A A;  2ZBK B;  3PYG A;  5FLX Q;  4JI0 E;  4JI7 I;  2O1W A;  4GKJ E;  4R1F A;  4P52 A;  2O1U A;  2HK3 A;  1UEK A;  1H73 A;  4DR1 E;  4DPT A;  4DV7 E;  1I94 I;  1Y4S A;  1NHI A;  3QT8 A;  1IBL I;  3HUL A;  4JI1 I;  4PRX A;  1Z0G A;  4LFC E;  4JI4 I;  4DV2 E;  1HNZ E;  4JYA E;  4LFA I;  4DR4 E;  2Z5E A;  1NZ0 A;  1Z0B A;  3OTO I;  3V2U C;  1HNW E;  1ZM4 A;  2J7K A;  4X62 E;  2HHH I;  1HR0 I;  2BV3 A;  3QT6 A;  4JI2 I;  4NXN I;  4X66 I;  2E5L E;  4LF8 E;  1XMQ I;  1PIE A;  1KIJ A;  2PNL A;  4FW9 A;  3QT7 A;  1J5E I;  1RRE A;  1XNR I;  5IT9 Q;  2AJ4 A;  2V8P A;  4DV1 E;  4JI5 E;  3Q6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...