4GKJI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkjI00
5BR8I 4B3ME 3QT5A 5A2QQ 4LFAI 4LF7I 1I94I 4DV2I 3QT8A 4JG4A 2DEJA 4DPTA 4JI3E 2E1RA 3B82A 3J81C 4DUZI 1H7UA 4USKA 3J80C 1U2RA 1K47A 4LF8I 4DU8A 5GMDA 4DV6E 4JI1I 1IBME 4JI2I 3CWVA 4YHHE 2VF3A 2UU9I 4DR5E 1N36E 1H72C 4LFCE 1FNMA 4DU7A 4LF5I 1IBLE 2HHHI 1S4EA 1MX0A 4X65I 1FJGE 5IT9C 1Z59A 2WW4A 2A2CA 1XNRE 4GKKE 4LF4I 4JI8I 4LFBE 3JAMC 2R3VA 4KHPE 4DR2I 3WU4A 1N33I 3H4LA 3ZKDA 4DPWA 1ZM3A 1ELOA 1Z0BA 4UTGA 4JI6E 2HKEA 4DR1E 1NHJA 3HULA 1N34I 2E5LE 2UXBI 1ZM4A 3PYGA 4B3TE 2V8PA 5LMNE 4P52A 4FWGA 3J7AM 5L3JA 1XMQE 1H73A 4DV7I 2UXDI 4JI0I 2UXCI 4AQYE 4OX9E 1Z5BA 4ED4A 4JI4E 4X66I 1BKNA 4UT4A 4USMA 3ZZTA 4MYTA 5IWAE 4DR3E 5A2QC 2DEIA 2HK2A 3OTOE 1XNQI 2X7IA 4LF6I 1IBKI 3B8HA 1FKAE 1N32E 4URLA 2V34A 2XEXA 4B3RE 4PRXA 2CZ9A 4K0KE 4DR7E 1B62A 4NXNI 1N0UA 1Z0EA 2UUAI 2A2DA 4NXMI 1H74A 4LF9E 1PVGA 1MG7A 5LMUE 2VQFE 2BM1A 3T1HI 1HNWI 4X64I 2VQEI 4DPXA 4DV1I 4I3HA 2ZBKB 1KTVA 4DPUA 2UUCE 2R42A 2V2QA 3T1YE 1IBMI 1PKPA 4X62E 4DV4I 2HFSA 4FWHA 5BR8E 3ZZUA 4R1FA 1HR0I 1MU5A 4DUYI 4PU9A 4LF7E 4LFAE 1I94E 2V2VA 4DV2E 4DR6I 4B3SI 2ZM6I 1FI4A 4YY3I 1J5EI 3ZM7A 4DV0I 4DR4I 4JI5I 1RR9A 4KQVA 4LF8E 1Z5CA 1RREA 4JV5I 3QT6A 1NHIA 4JI1E 2GS8A 4JI2E 1Z0TA 4DR1I 2UU9E 1KIJA 3Q1QA 4LF5E 1HNXI 2HHHE 3D4JA 4DPYA 4X65E 2J7KA 3WU3A 5LL6R 3V5RA 4GKJI 4DV5I 4LF4E 4JI8E 4JI7I 3K1JA 3ZZ0A 4AQYI 4DR2E 3F0NA 1N33E 2UUBI 1PIEA 4DV3I 3K17A 1N34E 4FN5A 1DARA 2UXBE 4JYAI 2F4VI 3PYFA 3PYDA 1XMOI 1OJ4A 1S16A 1UEKA 1KKHA 1VISA 4DV7E 4DR7I 2UXDE 4FWDA 3M6AA 2ZITA 1HNZI 4JI0E 1FWLA 2UXCE 4X66E 1D6TA 5GMEA 2HFUA 4B3MI 2BV3A 4HACB 4JI3I 1ZM9A 1XNQE 4LF6E 1IBKE 1A6FA 1NZ0A 4HXZA 2BM0A 4NXNE 2UUAE 4DV6I 2X36A 2Q2EB 4WUBA 4NXME 4HY1A 3B78A 4YHHI 3QT7A 4DR5I 1N36I 4LFCI 1B63A 1QZRA 1ZXNA 4XTJA 3T1HE 2HKJA 2OI2A 1HNWE 1IBLI 4X64E 2VQEE 1Z0WA 4DV1E 1FJGI 4DUZE 1ZXMA 5FLXQ 1H7SA 1XNRI 4GKKI 3LNUA 4WUDA 4LFBI 2AJ4A 4KHPI 4DV4E 1Z0VA 4EMDA 1HR0E 1ZM2A 4DUYE 4JI6I 1XHKA 3J81Q 3J80Q 4DR6E 3ZKBA 2V2ZA 2E5LI 4B3SE 2ZM6E 4B3TI 4YY3E 1WUUA 1J5EE 5LMNI 4DV0E 4DR4E 1XMQI 4JI5E 1N0VC 4JV5E 4P7AA 4Z7YA 1Z0GA 4OX9I 2EFGA 2NPFA 4JI4I 3LTOA 1HNXE 5IT9Q 5IWAI 4DR3I 3GONA 3OTOI 3JAMQ 4GKJE 1N32I 4DV5E 4M1KA 4B3RI 3WU6A 1Z5AA 4JI7E 4K0KI 3LPSA 4DXLA 2UUBE 4FW9A 4WUCA 4Z7CA 4RPFA 1EA6A 4ZVIA 1FWKA 4DV3E 4LF9I 1NHHA 1EI1A 5LMUI 2VQFI 3PYEA 4HACA 3V2UC 4JYAE 4PRVA 2F4VE 1XMOE 2HK3A 3J7AG 1KVKA 3WU5A 1Z0CA 2UUCI 2LJPA 3T1YI 1HNZE 4MYUA 5FLXC 4HYMA 4X62I
chains in the Genus database with same CATH superfamily
5K36C 3HJCA 5BR8I 2BA1G 2PNZB 3NZKA 4B3ME 3QT5A 5A2QQ 3P06A 4LFAI 4LF7I 4IFDC 4LCFA 1I94I 4DV2I 3QT8A 4JG4A 2DEJA 4DPTA 4JI3E 2E1RA 3B82A 3J81C 4DUZI 1H7UA 1YHCA 4USKA 3J80C 1U2RA 2JEBA 5JEAE 1K47A 3P3GA 4LF8I 4DU8A 1P42A 5GMDA 2Z5EA 2CVEA 4DV6E 1HK7A 4JI1I 2BA0G 1IBME 4IS9A 4JI2I 3CWVA 4YHHE 2VF3A 2UU9I 4DR5E 1N36E 2C37B 1H72C 4LFCE 2C38B 1FNMA 2O1UA 4DU7A 4LF5I 1IBLE 2BR2A 2HHHI 1S4EA 1MX0A 5C0XA 1Y4SA 4IZKA 4FW4A 2GO4A 5C0XF 4X65I 1FJGE 4OO1B 5IT9C 1R6LA 4QNKA 1Z59A 2WW4A 4LPFA 1RHYA 2A2CA 2C39A 1XNRE 4GKKE 4LF4I 1UDOA 4JI8I 4LFBE 3JAMC 2R3VA 4BA1B 4KHPE 4LCGA 4OKGA 4DR2I 3WU4A 1N33I 3H4LA 1Y5YA 3ZKDA 4DPWA 3L7ZB 3M7NG 1ZM3A 1ELOA 1Z0BA 4UTGA 4JI6E 2HKEA 4DR1E 1NHJA 3HULA 1N34I 5ELWA 2E5LE 2UXBI 1ZM4A 3PYGA 4OO1E 1UDNA 4B3TE 2V8PA 5LMNE 4P52A 3U1YA 2PNMA 1OYRA 1UDQA 4FWGA 3J7AM 5L3JA 1XMQE 1H73A 2Z5CA 4DV7I 2UXDI 4GQUA 4JI0I 2UXCI 4AQYE 4OX9E 1Z5BA 4ED4A 4JI4E 4X66I 1BKNA 4UT4A 4USMA 4MYTA 4MU3A 3ZZTA 5C0XD 4QNJA 2JEAB 1UDSA 5IWAE 4DR3E 5A2QC 4U3BA 2DEIA 2HK2A 3OTOE 1XNQI 2X7IA 4LF6I 1IBKI 3B8HA 1FKAE 1N32E 4URLA 2V34A 2XEXA 4B3RE 2WNRA 4PRXA 2CZ9A 4LOMA 4K0KE 4DR7E 1B62A 1Y60A 4NXNI 1N0UA 1Z0EA 1E3HA 5JEAA 2UUAI 5JEAF 2A2DA 3PRYA 4NXMI 1H74A 4LF9E 2Z5BB 1PVGA 2PNZA 1MG7A 2NN6C 5LMUE 2VQFE 2BM1A 3T1HI 4AIDA 1HNWI 4X64I 2VQEI 4DPXA 4DV1I 4I3HA 4FW7A 2ZBKB 2PO2B 2PNLA 1KTVA 2BA0D 4OZEA 4DPUA 3GMEA 4FW3A 2UUCE 2R42A 2V2QA 4MQYA 4AIMA 3T1YE 2IERA 3PS2A 2IESA 1IBMI 1PKPA 4X62E 4DV4I 2HFSA 4FWHA 5BR8E 3ZZUA 4R1FA 4ISAA 2CGEA 1HR0I 1MU5A 4DUYI 4PU9A 4LF7E 4LFAE 2C37A 2C38A 1I94E 2V2VA 2WP8B 4DV2E 3Q6NA 4DR6I 3CDJA 4B3SI 2ZM6I 1FI4A 4YY3I 1J5EI 3ZM7A 4OO1A 4DV0I 4DR4I 4OO1F 4JI5I 3M7ND 1RR9A 4KQVA 5JEAD 4LF8E 4J3DA 5K36F 1Z5CA 5K36B 1RREA 4JV5I 2AE8A 2NN6B 3UHMA 3QT6A 4BA1A 1NHIA 5DNXA 3GCMA 2GS8A 4JI1E 4IFDF 4IFDB 3L7ZA 4JI2E 1Z0TA 4DR1I 2UU9E 1KIJA 3Q1QA 1XXEA 4LF5E 4IZKB 1HNXI 2HHHE 3D4JA 4DPYA 4X65E 2C39B 2J7KA 3WU3A 5LL6R 3V5RA 4GKJI 5K36E 2O1WA 4DV5I 2NN6E 4LF4E 4JI8E 4JI7I 4IFDE 1OYPA 3K1JA 3ZZ0A 4AQYI 3M85G 4DR2E 3F0NA 1N33E 2UUBI 1PIEA 4FW6A 3B4TA 1USUA 4IZJB 4DV3I 3K17A 1N34E 4FN5A 1YH8A 1DARA 2PO0B 4JYAI 2UXBE 2F4VI 4OO1D 2JEAA 3PYFA 3PYDA 1XMOI 1OJ4A 1E3PA 1S16A 1UEKA 5K36D 1KKHA 3P3EA 1VISA 4IFDD 4DV7E 4DR7I 2UXDE 4FWDA 3M6AA 2ZITA 3HKMA 2BA1D 1HNZI 4JI0E 2GO3A 1FWLA 2UXCE 4FW5A 5DRPA 4X66E 1D6TA 5GMEA 2HFUA 4B3MI 2CG9A 2PO1B 2Z5BA 2BV3A 4MU4A 2JT2A 4HACB 4NBQA 2JE6B 4BA2B 4JI3I 1ZM9A 2J65A 1XNQE 4LF6E 1IBKE 1A6FA 1NZ0A 1Y4UA 4MDTA 4HXZA 5C0XC 2BM0A 1Y6ZA 4IZJD 2UUAE 4NXNE 4DV6I 2X36A 2Q2EB 4WUBA 4NXME 4HY1A 3B78A 4YHHI 3QT7A 4DR5I 1N36I 4LFCI 1B63A 1QZRA 1ZXNA 4XTJA 3T1HE 2WP8A 2HKJA 2OI2A 1HNWE 1IBLI 4X64E 2VQEE 1Z0WA 4DV1E 3P76A 4MU1A 1FJGI 2GQ0A 4DUZE 1ZXMA 2JEBB 5DNLA 5FLXQ 1H7SA 1XNRI 3PS3A 3LNUA 4GKKI 4WUDA 5K36A 2O1VA 2O1TA 4LFBI 3KRNA 2AJ4A 5DROA 4KHPI 2NN6A 2NN6F 4DV4E 1Z0VA 4EMDA 4IFDA 4LCHA 1HR0E 1ZM2A 4DUYE 4JI6I 1XHKA 3J81Q 2F1DA 3J80Q 3ZKBA 4DR6E 2BR2B 2V2ZA 3H1CA 5C0XB 2E5LI 1VI7A 4B3SE 2ZM6E 4B3TI 4YY3E 1WUUA 1J5EE 5LMNI 2O3ZA 3M85D 4DV0E 4DR4E 2IOPA 2IOQA 1XMQI 4JI5E 1USVA 5DRQA 1N0VC 1R6MA 4JV5E 4P7AA 4MU0A 4Z7YA 1Z0GA 1OYSA 4N3OA 4OX9I 2EFGA 2NPFA 4JI4I 5DRRA 3DD6A 4IZJA 5C0XE 5JEAC 3LTOA 1HNXE 5IT9Q 3Q6MA 2PO0A 5IWAI 4DR3I 3GONA 3OTOI 3JAMQ 4GKJE 1N32I 4DV5E 2VESA 4M1KA 4B3RI 2NN6D 2Z5CB 3WU6A 1Z5AA 4JI7E 3GLLA 3P3CA 5EKWA 4K0KI 3LPSA 4DXLA 2UUBE 4FW9A 4WUCA 4Z7CA 4RPFA 1EA6A 4ZVIA 1FWKA 3K85A 4DV3E 4LF9I 1NHHA 1EI1A 5FWKA 3CDIA 2PO1A 5EL9A 5LMUI 2VQFI 3PYEA 4HACA 4U3DA 3V2UC 4JYAE 4PRVA 2F4VE 2JE6A 4BA2A 1XMOE 2HK3A 3J7AG 4AM3A 2WNRB 1KVKA 3WU5A 1Z0CA 2UUCI 2LJPA 2PO2A 3U1KA 3T1YI 5JEAB 1HNZE 4MYUA 4OO1C 5FLXC 3PS1A 4HYMA 4X62I
chains in the Genus database with same CATH topology
3HJCA 5BR8I 4B3ME 3QT5A 5A2QQ 3P06A 4LFAI 4LF7I 1I94I 4DV2I 3QT8A 4JG4A 2DEJA 4DPTA 4JI3E 2E1RA 3B82A 3J81C 4DUZI 1H7UA 4USKA 3J80C 1U2RA 1K47A 4LF8I 4DU8A 5GMDA 2Z5EA 4DV6E 1HK7A 4JI1I 1IBME 4JI2I 3CWVA 4YHHE 2VF3A 2UU9I 4DR5E 1N36E 1H72C 4LFCE 1FNMA 2O1UA 4DU7A 4LF5I 1IBLE 2HHHI 1S4EA 1MX0A 1Y4SA 4IZKA 4X65I 1FJGE 5IT9C 1Z59A 2WW4A 2A2CA 1XNRE 4GKKE 4LF4I 4JI8I 4LFBE 3JAMC 2R3VA 4KHPE 4DR2I 3WU4A 1N33I 3H4LA 3ZKDA 4DPWA 1ZM3A 1ELOA 1Z0BA 4UTGA 4JI6E 2HKEA 4DR1E 1NHJA 3HULA 1N34I 2E5LE 2UXBI 1ZM4A 3PYGA 4B3TE 2V8PA 5LMNE 4P52A 2PNMA 4FWGA 3J7AM 5L3JA 1XMQE 1H73A 2Z5CA 4DV7I 2UXDI 4JI0I 2UXCI 4AQYE 4OX9E 1Z5BA 4ED4A 4JI4E 4X66I 1BKNA 4UT4A 4USMA 3ZZTA 4MYTA 5IWAE 4DR3E 5A2QC 2DEIA 2HK2A 3OTOE 1XNQI 2X7IA 4LF6I 1IBKI 3B8HA 1FKAE 1N32E 4URLA 2V34A 2XEXA 4B3RE 4PRXA 2CZ9A 4K0KE 4DR7E 1B62A 4NXNI 1N0UA 1Z0EA 2UUAI 2A2DA 3PRYA 4NXMI 1H74A 4LF9E 2Z5BB 1PVGA 1MG7A 5LMUE 2VQFE 2BM1A 3T1HI 1HNWI 4X64I 2VQEI 4DPXA 4DV1I 4I3HA 2ZBKB 2PNLA 1KTVA 4DPUA 2UUCE 2R42A 2V2QA 3T1YE 1IBMI 1PKPA 4X62E 4DV4I 2HFSA 4FWHA 5BR8E 3ZZUA 4R1FA 2CGEA 1HR0I 1MU5A 4DUYI 4PU9A 4LF7E 4LFAE 1I94E 2V2VA 4DV2E 3Q6NA 4DR6I 4B3SI 2ZM6I 1FI4A 4YY3I 1J5EI 3ZM7A 4DV0I 4DR4I 4JI5I 1RR9A 4KQVA 4LF8E 1Z5CA 1RREA 4JV5I 3QT6A 1NHIA 4JI1E 2GS8A 4JI2E 1Z0TA 4DR1I 2UU9E 1KIJA 3Q1QA 4LF5E 4IZKB 1HNXI 2HHHE 3D4JA 4DPYA 4X65E 2J7KA 3WU3A 5LL6R 3V5RA 4GKJI 2O1WA 4DV5I 4LF4E 4JI8E 4JI7I 3K1JA 3ZZ0A 4AQYI 4DR2E 3F0NA 1N33E 2UUBI 1PIEA 1USUA 4IZJB 4DV3I 3K17A 1N34E 4FN5A 1DARA 2UXBE 4JYAI 2F4VI 3PYFA 3PYDA 1XMOI 1OJ4A 1S16A 1UEKA 1KKHA 1VISA 4DV7E 4DR7I 2UXDE 4FWDA 3M6AA 2ZITA 1HNZI 4JI0E 1FWLA 2UXCE 4X66E 1D6TA 5GMEA 2HFUA 4B3MI 2CG9A 2Z5BA 2BV3A 4HACB 4JI3I 1ZM9A 1XNQE 4LF6E 1IBKE 1A6FA 1NZ0A 1Y4UA 4HXZA 2BM0A 1Y6ZA 4IZJD 2UUAE 4NXNE 4DV6I 2X36A 2Q2EB 4WUBA 4NXME 4HY1A 3B78A 4YHHI 3QT7A 4DR5I 1N36I 4LFCI 1B63A 1QZRA 1ZXNA 4XTJA 3T1HE 2HKJA 2OI2A 1HNWE 1IBLI 4X64E 2VQEE 1Z0WA 4DV1E 1FJGI 2GQ0A 4DUZE 1ZXMA 5FLXQ 1H7SA 1XNRI 4GKKI 3LNUA 4WUDA 2O1VA 2O1TA 4LFBI 2AJ4A 4KHPI 4DV4E 1Z0VA 4EMDA 1HR0E 1ZM2A 4DUYE 4JI6I 1XHKA 3J81Q 3J80Q 4DR6E 3ZKBA 2V2ZA 2E5LI 4B3SE 2ZM6E 4B3TI 4YY3E 1WUUA 1J5EE 5LMNI 4DV0E 4DR4E 2IOPA 2IOQA 1XMQI 4JI5E 1USVA 1N0VC 4JV5E 4P7AA 4Z7YA 1Z0GA 4N3OA 4OX9I 2EFGA 2NPFA 4JI4I 4IZJA 3LTOA 1HNXE 5IT9Q 3Q6MA 5IWAI 4DR3I 3GONA 3OTOI 3JAMQ 4GKJE 1N32I 4DV5E 4M1KA 4B3RI 2Z5CB 3WU6A 1Z5AA 4JI7E 4K0KI 3LPSA 4DXLA 2UUBE 4FW9A 4WUCA 4Z7CA 4RPFA 1EA6A 4ZVIA 1FWKA 3K85A 4DV3E 4LF9I 1NHHA 1EI1A 5FWKA 5LMUI 2VQFI 3PYEA 4HACA 3V2UC 4JYAE 4PRVA 2F4VE 1XMOE 2HK3A 3J7AG 1KVKA 3WU5A 1Z0CA 2UUCI 2LJPA 3T1YI 1HNZE 4MYUA 5FLXC 4HYMA 4X62I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 I;  4B3M E;  3QT5 A;  5A2Q Q;  4LFA I;  4LF7 I;  1I94 I;  4DV2 I;  3QT8 A;  4JG4 A;  2DEJ A;  4DPT A;  4JI3 E;  2E1R A;  3B82 A;  3J81 C;  4DUZ I;  1H7U A;  4USK A;  3J80 C;  1U2R A;  1K47 A;  4LF8 I;  4DU8 A;  5GMD A;  4DV6 E;  4JI1 I;  1IBM E;  4JI2 I;  3CWV A;  4YHH E;  2VF3 A;  2UU9 I;  4DR5 E;  1N36 E;  1H72 C;  4LFC E;  1FNM A;  4DU7 A;  4LF5 I;  1IBL E;  2HHH I;  1S4E A;  1MX0 A;  4X65 I;  1FJG E;  5IT9 C;  1Z59 A;  2WW4 A;  2A2C A;  1XNR E;  4GKK E;  4LF4 I;  4JI8 I;  4LFB E;  3JAM C;  2R3V A;  4KHP E;  4DR2 I;  3WU4 A;  1N33 I;  3H4L A;  3ZKD A;  4DPW A;  1ZM3 A;  1ELO A;  1Z0B A;  4UTG A;  4JI6 E;  2HKE A;  4DR1 E;  1NHJ A;  3HUL A;  1N34 I;  2E5L E;  2UXB I;  1ZM4 A;  3PYG A;  4B3T E;  2V8P A;  5LMN E;  4P52 A;  4FWG A;  3J7A M;  5L3J A;  1XMQ E;  1H73 A;  4DV7 I;  2UXD I;  4JI0 I;  2UXC I;  4AQY E;  4OX9 E;  1Z5B A;  4ED4 A;  4JI4 E;  4X66 I;  1BKN A;  4UT4 A;  4USM A;  3ZZT A;  4MYT A;  5IWA E;  4DR3 E;  5A2Q C;  2DEI A;  2HK2 A;  3OTO E;  1XNQ I;  2X7I A;  4LF6 I;  1IBK I;  3B8H A;  1FKA E;  1N32 E;  4URL A;  2V34 A;  2XEX A;  4B3R E;  4PRX A;  2CZ9 A;  4K0K E;  4DR7 E;  1B62 A;  4NXN I;  1N0U A;  1Z0E A;  2UUA I;  2A2D A;  4NXM I;  1H74 A;  4LF9 E;  1PVG A;  1MG7 A;  5LMU E;  2VQF E;  2BM1 A;  3T1H I;  1HNW I;  4X64 I;  2VQE I;  4DPX A;  4DV1 I;  4I3H A;  2ZBK B;  1KTV A;  4DPU A;  2UUC E;  2R42 A;  2V2Q A;  3T1Y E;  1IBM I;  1PKP A;  4X62 E;  4DV4 I;  2HFS A;  4FWH A;  5BR8 E;  3ZZU A;  4R1F A;  1HR0 I;  1MU5 A;  4DUY I;  4PU9 A;  4LF7 E;  4LFA E;  1I94 E;  2V2V A;  4DV2 E;  4DR6 I;  4B3S I;  2ZM6 I;  1FI4 A;  4YY3 I;  1J5E I;  3ZM7 A;  4DV0 I;  4DR4 I;  4JI5 I;  1RR9 A;  4KQV A;  4LF8 E;  1Z5C A;  1RRE A;  4JV5 I;  3QT6 A;  1NHI A;  4JI1 E;  2GS8 A;  4JI2 E;  1Z0T A;  4DR1 I;  2UU9 E;  1KIJ A;  3Q1Q A;  4LF5 E;  1HNX I;  2HHH E;  3D4J A;  4DPY A;  4X65 E;  2J7K A;  3WU3 A;  5LL6 R;  3V5R A;  4GKJ I;  4DV5 I;  4LF4 E;  4JI8 E;  4JI7 I;  3K1J A;  3ZZ0 A;  4AQY I;  4DR2 E;  3F0N A;  1N33 E;  2UUB I;  1PIE A;  4DV3 I;  3K17 A;  1N34 E;  4FN5 A;  1DAR A;  2UXB E;  4JYA I;  2F4V I;  3PYF A;  3PYD A;  1XMO I;  1OJ4 A;  1S16 A;  1UEK A;  1KKH A;  1VIS A;  4DV7 E;  4DR7 I;  2UXD E;  4FWD A;  3M6A A;  2ZIT A;  1HNZ I;  4JI0 E;  1FWL A;  2UXC E;  4X66 E;  1D6T A;  5GME A;  2HFU A;  4B3M I;  2BV3 A;  4HAC B;  4JI3 I;  1ZM9 A;  1XNQ E;  4LF6 E;  1IBK E;  1A6F A;  1NZ0 A;  4HXZ A;  2BM0 A;  4NXN E;  2UUA E;  4DV6 I;  2X36 A;  2Q2E B;  4WUB A;  4NXM E;  4HY1 A;  3B78 A;  4YHH I;  3QT7 A;  4DR5 I;  1N36 I;  4LFC I;  1B63 A;  1QZR A;  1ZXN A;  4XTJ A;  3T1H E;  2HKJ A;  2OI2 A;  1HNW E;  1IBL I;  4X64 E;  2VQE E;  1Z0W A;  4DV1 E;  1FJG I;  4DUZ E;  1ZXM A;  5FLX Q;  1H7S A;  1XNR I;  4GKK I;  3LNU A;  4WUD A;  4LFB I;  2AJ4 A;  4KHP I;  4DV4 E;  1Z0V A;  4EMD A;  1HR0 E;  1ZM2 A;  4DUY E;  4JI6 I;  1XHK A;  3J81 Q;  3J80 Q;  4DR6 E;  3ZKB A;  2V2Z A;  2E5L I;  4B3S E;  2ZM6 E;  4B3T I;  4YY3 E;  1WUU A;  1J5E E;  5LMN I;  4DV0 E;  4DR4 E;  1XMQ I;  4JI5 E;  1N0V C;  4JV5 E;  4P7A A;  4Z7Y A;  1Z0G A;  4OX9 I;  2EFG A;  2NPF A;  4JI4 I;  3LTO A;  1HNX E;  5IT9 Q;  5IWA I;  4DR3 I;  3GON A;  3OTO I;  3JAM Q;  4GKJ E;  1N32 I;  4DV5 E;  4M1K A;  4B3R I;  3WU6 A;  1Z5A A;  4JI7 E;  4K0K I;  3LPS A;  4DXL A;  2UUB E;  4FW9 A;  4WUC A;  4Z7C A;  4RPF A;  1EA6 A;  4ZVI A;  1FWK A;  4DV3 E;  4LF9 I;  1NHH A;  1EI1 A;  5LMU I;  2VQF I;  3PYE A;  4HAC A;  3V2U C;  4JYA E;  4PRV A;  2F4V E;  1XMO E;  2HK3 A;  3J7A G;  1KVK A;  3WU5 A;  1Z0C A;  2UUC I;  2LJP A;  3T1Y I;  1HNZ E;  4MYU A;  5FLX C;  4HYM A;  4X62 I; 
#chains in the Genus database with same CATH topology
 5K36 C;  3HJC A;  5BR8 I;  2BA1 G;  2PNZ B;  3NZK A;  4B3M E;  3QT5 A;  5A2Q Q;  3P06 A;  4LFA I;  4LF7 I;  4IFD C;  4LCF A;  1I94 I;  4DV2 I;  3QT8 A;  4JG4 A;  2DEJ A;  4DPT A;  4JI3 E;  2E1R A;  3B82 A;  3J81 C;  4DUZ I;  1H7U A;  1YHC A;  4USK A;  3J80 C;  1U2R A;  2JEB A;  5JEA E;  1K47 A;  3P3G A;  4LF8 I;  4DU8 A;  1P42 A;  5GMD A;  2Z5E A;  2CVE A;  4DV6 E;  1HK7 A;  4JI1 I;  2BA0 G;  1IBM E;  4IS9 A;  4JI2 I;  3CWV A;  4YHH E;  2VF3 A;  2UU9 I;  4DR5 E;  1N36 E;  2C37 B;  1H72 C;  4LFC E;  2C38 B;  1FNM A;  2O1U A;  4DU7 A;  4LF5 I;  1IBL E;  2BR2 A;  2HHH I;  1S4E A;  1MX0 A;  5C0X A;  1Y4S A;  4IZK A;  4FW4 A;  2GO4 A;  5C0X F;  4X65 I;  1FJG E;  4OO1 B;  5IT9 C;  1R6L A;  4QNK A;  1Z59 A;  2WW4 A;  4LPF A;  1RHY A;  2A2C A;  2C39 A;  1XNR E;  4GKK E;  4LF4 I;  1UDO A;  4JI8 I;  4LFB E;  3JAM C;  2R3V A;  4BA1 B;  4KHP E;  4LCG A;  4OKG A;  4DR2 I;  3WU4 A;  1N33 I;  3H4L A;  1Y5Y A;  3ZKD A;  4DPW A;  3L7Z B;  3M7N G;  1ZM3 A;  1ELO A;  1Z0B A;  4UTG A;  4JI6 E;  2HKE A;  4DR1 E;  1NHJ A;  3HUL A;  1N34 I;  5ELW A;  2E5L E;  2UXB I;  1ZM4 A;  3PYG A;  4OO1 E;  1UDN A;  4B3T E;  2V8P A;  5LMN E;  4P52 A;  3U1Y A;  2PNM A;  1OYR A;  1UDQ A;  4FWG A;  3J7A M;  5L3J A;  1XMQ E;  1H73 A;  2Z5C A;  4DV7 I;  2UXD I;  4GQU A;  4JI0 I;  2UXC I;  4AQY E;  4OX9 E;  1Z5B A;  4ED4 A;  4JI4 E;  4X66 I;  1BKN A;  4UT4 A;  4USM A;  4MYT A;  4MU3 A;  3ZZT A;  5C0X D;  4QNJ A;  2JEA B;  1UDS A;  5IWA E;  4DR3 E;  5A2Q C;  4U3B A;  2DEI A;  2HK2 A;  3OTO E;  1XNQ I;  2X7I A;  4LF6 I;  1IBK I;  3B8H A;  1FKA E;  1N32 E;  4URL A;  2V34 A;  2XEX A;  4B3R E;  2WNR A;  4PRX A;  2CZ9 A;  4LOM A;  4K0K E;  4DR7 E;  1B62 A;  1Y60 A;  4NXN I;  1N0U A;  1Z0E A;  1E3H A;  5JEA A;  2UUA I;  5JEA F;  2A2D A;  3PRY A;  4NXM I;  1H74 A;  4LF9 E;  2Z5B B;  1PVG A;  2PNZ A;  1MG7 A;  2NN6 C;  5LMU E;  2VQF E;  2BM1 A;  3T1H I;  4AID A;  1HNW I;  4X64 I;  2VQE I;  4DPX A;  4DV1 I;  4I3H A;  4FW7 A;  2ZBK B;  2PO2 B;  2PNL A;  1KTV A;  2BA0 D;  4OZE A;  4DPU A;  3GME A;  4FW3 A;  2UUC E;  2R42 A;  2V2Q A;  4MQY A;  4AIM A;  3T1Y E;  2IER A;  3PS2 A;  2IES A;  1IBM I;  1PKP A;  4X62 E;  4DV4 I;  2HFS A;  4FWH A;  5BR8 E;  3ZZU A;  4R1F A;  4ISA A;  2CGE A;  1HR0 I;  1MU5 A;  4DUY I;  4PU9 A;  4LF7 E;  4LFA E;  2C37 A;  2C38 A;  1I94 E;  2V2V A;  2WP8 B;  4DV2 E;  3Q6N A;  4DR6 I;  3CDJ A;  4B3S I;  2ZM6 I;  1FI4 A;  4YY3 I;  1J5E I;  3ZM7 A;  4OO1 A;  4DV0 I;  4DR4 I;  4OO1 F;  4JI5 I;  3M7N D;  1RR9 A;  4KQV A;  5JEA D;  4LF8 E;  4J3D A;  5K36 F;  1Z5C A;  5K36 B;  1RRE A;  4JV5 I;  2AE8 A;  2NN6 B;  3UHM A;  3QT6 A;  4BA1 A;  1NHI A;  5DNX A;  3GCM A;  2GS8 A;  4JI1 E;  4IFD F;  4IFD B;  3L7Z A;  4JI2 E;  1Z0T A;  4DR1 I;  2UU9 E;  1KIJ A;  3Q1Q A;  1XXE A;  4LF5 E;  4IZK B;  1HNX I;  2HHH E;  3D4J A;  4DPY A;  4X65 E;  2C39 B;  2J7K A;  3WU3 A;  5LL6 R;  3V5R A;  4GKJ I;  5K36 E;  2O1W A;  4DV5 I;  2NN6 E;  4LF4 E;  4JI8 E;  4JI7 I;  4IFD E;  1OYP A;  3K1J A;  3ZZ0 A;  4AQY I;  3M85 G;  4DR2 E;  3F0N A;  1N33 E;  2UUB I;  1PIE A;  4FW6 A;  3B4T A;  1USU A;  4IZJ B;  4DV3 I;  3K17 A;  1N34 E;  4FN5 A;  1YH8 A;  1DAR A;  2PO0 B;  4JYA I;  2UXB E;  2F4V I;  4OO1 D;  2JEA A;  3PYF A;  3PYD A;  1XMO I;  1OJ4 A;  1E3P A;  1S16 A;  1UEK A;  5K36 D;  1KKH A;  3P3E A;  1VIS A;  4IFD D;  4DV7 E;  4DR7 I;  2UXD E;  4FWD A;  3M6A A;  2ZIT A;  3HKM A;  2BA1 D;  1HNZ I;  4JI0 E;  2GO3 A;  1FWL A;  2UXC E;  4FW5 A;  5DRP A;  4X66 E;  1D6T A;  5GME A;  2HFU A;  4B3M I;  2CG9 A;  2PO1 B;  2Z5B A;  2BV3 A;  4MU4 A;  2JT2 A;  4HAC B;  4NBQ A;  2JE6 B;  4BA2 B;  4JI3 I;  1ZM9 A;  2J65 A;  1XNQ E;  4LF6 E;  1IBK E;  1A6F A;  1NZ0 A;  1Y4U A;  4MDT A;  4HXZ A;  5C0X C;  2BM0 A;  1Y6Z A;  4IZJ D;  2UUA E;  4NXN E;  4DV6 I;  2X36 A;  2Q2E B;  4WUB A;  4NXM E;  4HY1 A;  3B78 A;  4YHH I;  3QT7 A;  4DR5 I;  1N36 I;  4LFC I;  1B63 A;  1QZR A;  1ZXN A;  4XTJ A;  3T1H E;  2WP8 A;  2HKJ A;  2OI2 A;  1HNW E;  1IBL I;  4X64 E;  2VQE E;  1Z0W A;  4DV1 E;  3P76 A;  4MU1 A;  1FJG I;  2GQ0 A;  4DUZ E;  1ZXM A;  2JEB B;  5DNL A;  5FLX Q;  1H7S A;  1XNR I;  3PS3 A;  3LNU A;  4GKK I;  4WUD A;  5K36 A;  2O1V A;  2O1T A;  4LFB I;  3KRN A;  2AJ4 A;  5DRO A;  4KHP I;  2NN6 A;  2NN6 F;  4DV4 E;  1Z0V A;  4EMD A;  4IFD A;  4LCH A;  1HR0 E;  1ZM2 A;  4DUY E;  4JI6 I;  1XHK A;  3J81 Q;  2F1D A;  3J80 Q;  3ZKB A;  4DR6 E;  2BR2 B;  2V2Z A;  3H1C A;  5C0X B;  2E5L I;  1VI7 A;  4B3S E;  2ZM6 E;  4B3T I;  4YY3 E;  1WUU A;  1J5E E;  5LMN I;  2O3Z A;  3M85 D;  4DV0 E;  4DR4 E;  2IOP A;  2IOQ A;  1XMQ I;  4JI5 E;  1USV A;  5DRQ A;  1N0V C;  1R6M A;  4JV5 E;  4P7A A;  4MU0 A;  4Z7Y A;  1Z0G A;  1OYS A;  4N3O A;  4OX9 I;  2EFG A;  2NPF A;  4JI4 I;  5DRR A;  3DD6 A;  4IZJ A;  5C0X E;  5JEA C;  3LTO A;  1HNX E;  5IT9 Q;  3Q6M A;  2PO0 A;  5IWA I;  4DR3 I;  3GON A;  3OTO I;  3JAM Q;  4GKJ E;  1N32 I;  4DV5 E;  2VES A;  4M1K A;  4B3R I;  2NN6 D;  2Z5C B;  3WU6 A;  1Z5A A;  4JI7 E;  3GLL A;  3P3C A;  5EKW A;  4K0K I;  3LPS A;  4DXL A;  2UUB E;  4FW9 A;  4WUC A;  4Z7C A;  4RPF A;  1EA6 A;  4ZVI A;  1FWK A;  3K85 A;  4DV3 E;  4LF9 I;  1NHH A;  1EI1 A;  5FWK A;  3CDI A;  2PO1 A;  5EL9 A;  5LMU I;  2VQF I;  3PYE A;  4HAC A;  4U3D A;  3V2U C;  4JYA E;  4PRV A;  2F4V E;  2JE6 A;  4BA2 A;  1XMO E;  2HK3 A;  3J7A G;  4AM3 A;  2WNR B;  1KVK A;  3WU5 A;  1Z0C A;  2UUC I;  2LJP A;  2PO2 A;  3U1K A;  3T1Y I;  5JEA B;  1HNZ E;  4MYU A;  4OO1 C;  5FLX C;  3PS1 A;  4HYM A;  4X62 I; 
#chains in the Genus database with same CATH homology
 3HJC A;  5BR8 I;  4B3M E;  3QT5 A;  5A2Q Q;  3P06 A;  4LFA I;  4LF7 I;  1I94 I;  4DV2 I;  3QT8 A;  4JG4 A;  2DEJ A;  4DPT A;  4JI3 E;  2E1R A;  3B82 A;  3J81 C;  4DUZ I;  1H7U A;  4USK A;  3J80 C;  1U2R A;  1K47 A;  4LF8 I;  4DU8 A;  5GMD A;  2Z5E A;  4DV6 E;  1HK7 A;  4JI1 I;  1IBM E;  4JI2 I;  3CWV A;  4YHH E;  2VF3 A;  2UU9 I;  4DR5 E;  1N36 E;  1H72 C;  4LFC E;  1FNM A;  2O1U A;  4DU7 A;  4LF5 I;  1IBL E;  2HHH I;  1S4E A;  1MX0 A;  1Y4S A;  4IZK A;  4X65 I;  1FJG E;  5IT9 C;  1Z59 A;  2WW4 A;  2A2C A;  1XNR E;  4GKK E;  4LF4 I;  4JI8 I;  4LFB E;  3JAM C;  2R3V A;  4KHP E;  4DR2 I;  3WU4 A;  1N33 I;  3H4L A;  3ZKD A;  4DPW A;  1ZM3 A;  1ELO A;  1Z0B A;  4UTG A;  4JI6 E;  2HKE A;  4DR1 E;  1NHJ A;  3HUL A;  1N34 I;  2E5L E;  2UXB I;  1ZM4 A;  3PYG A;  4B3T E;  2V8P A;  5LMN E;  4P52 A;  2PNM A;  4FWG A;  3J7A M;  5L3J A;  1XMQ E;  1H73 A;  2Z5C A;  4DV7 I;  2UXD I;  4JI0 I;  2UXC I;  4AQY E;  4OX9 E;  1Z5B A;  4ED4 A;  4JI4 E;  4X66 I;  1BKN A;  4UT4 A;  4USM A;  3ZZT A;  4MYT A;  5IWA E;  4DR3 E;  5A2Q C;  2DEI A;  2HK2 A;  3OTO E;  1XNQ I;  2X7I A;  4LF6 I;  1IBK I;  3B8H A;  1FKA E;  1N32 E;  4URL A;  2V34 A;  2XEX A;  4B3R E;  4PRX A;  2CZ9 A;  4K0K E;  4DR7 E;  1B62 A;  4NXN I;  1N0U A;  1Z0E A;  2UUA I;  2A2D A;  3PRY A;  4NXM I;  1H74 A;  4LF9 E;  2Z5B B;  1PVG A;  1MG7 A;  5LMU E;  2VQF E;  2BM1 A;  3T1H I;  1HNW I;  4X64 I;  2VQE I;  4DPX A;  4DV1 I;  4I3H A;  2ZBK B;  2PNL A;  1KTV A;  4DPU A;  2UUC E;  2R42 A;  2V2Q A;  3T1Y E;  1IBM I;  1PKP A;  4X62 E;  4DV4 I;  2HFS A;  4FWH A;  5BR8 E;  3ZZU A;  4R1F A;  2CGE A;  1HR0 I;  1MU5 A;  4DUY I;  4PU9 A;  4LF7 E;  4LFA E;  1I94 E;  2V2V A;  4DV2 E;  3Q6N A;  4DR6 I;  4B3S I;  2ZM6 I;  1FI4 A;  4YY3 I;  1J5E I;  3ZM7 A;  4DV0 I;  4DR4 I;  4JI5 I;  1RR9 A;  4KQV A;  4LF8 E;  1Z5C A;  1RRE A;  4JV5 I;  3QT6 A;  1NHI A;  4JI1 E;  2GS8 A;  4JI2 E;  1Z0T A;  4DR1 I;  2UU9 E;  1KIJ A;  3Q1Q A;  4LF5 E;  4IZK B;  1HNX I;  2HHH E;  3D4J A;  4DPY A;  4X65 E;  2J7K A;  3WU3 A;  5LL6 R;  3V5R A;  4GKJ I;  2O1W A;  4DV5 I;  4LF4 E;  4JI8 E;  4JI7 I;  3K1J A;  3ZZ0 A;  4AQY I;  4DR2 E;  3F0N A;  1N33 E;  2UUB I;  1PIE A;  1USU A;  4IZJ B;  4DV3 I;  3K17 A;  1N34 E;  4FN5 A;  1DAR A;  2UXB E;  4JYA I;  2F4V I;  3PYF A;  3PYD A;  1XMO I;  1OJ4 A;  1S16 A;  1UEK A;  1KKH A;  1VIS A;  4DV7 E;  4DR7 I;  2UXD E;  4FWD A;  3M6A A;  2ZIT A;  1HNZ I;  4JI0 E;  1FWL A;  2UXC E;  4X66 E;  1D6T A;  5GME A;  2HFU A;  4B3M I;  2CG9 A;  2Z5B A;  2BV3 A;  4HAC B;  4JI3 I;  1ZM9 A;  1XNQ E;  4LF6 E;  1IBK E;  1A6F A;  1NZ0 A;  1Y4U A;  4HXZ A;  2BM0 A;  1Y6Z A;  4IZJ D;  2UUA E;  4NXN E;  4DV6 I;  2X36 A;  2Q2E B;  4WUB A;  4NXM E;  4HY1 A;  3B78 A;  4YHH I;  3QT7 A;  4DR5 I;  1N36 I;  4LFC I;  1B63 A;  1QZR A;  1ZXN A;  4XTJ A;  3T1H E;  2HKJ A;  2OI2 A;  1HNW E;  1IBL I;  4X64 E;  2VQE E;  1Z0W A;  4DV1 E;  1FJG I;  2GQ0 A;  4DUZ E;  1ZXM A;  5FLX Q;  1H7S A;  1XNR I;  4GKK I;  3LNU A;  4WUD A;  2O1V A;  2O1T A;  4LFB I;  2AJ4 A;  4KHP I;  4DV4 E;  1Z0V A;  4EMD A;  1HR0 E;  1ZM2 A;  4DUY E;  4JI6 I;  1XHK A;  3J81 Q;  3J80 Q;  4DR6 E;  3ZKB A;  2V2Z A;  2E5L I;  4B3S E;  2ZM6 E;  4B3T I;  4YY3 E;  1WUU A;  1J5E E;  5LMN I;  4DV0 E;  4DR4 E;  2IOP A;  2IOQ A;  1XMQ I;  4JI5 E;  1USV A;  1N0V C;  4JV5 E;  4P7A A;  4Z7Y A;  1Z0G A;  4N3O A;  4OX9 I;  2EFG A;  2NPF A;  4JI4 I;  4IZJ A;  3LTO A;  1HNX E;  5IT9 Q;  3Q6M A;  5IWA I;  4DR3 I;  3GON A;  3OTO I;  3JAM Q;  4GKJ E;  1N32 I;  4DV5 E;  4M1K A;  4B3R I;  2Z5C B;  3WU6 A;  1Z5A A;  4JI7 E;  4K0K I;  3LPS A;  4DXL A;  2UUB E;  4FW9 A;  4WUC A;  4Z7C A;  4RPF A;  1EA6 A;  4ZVI A;  1FWK A;  3K85 A;  4DV3 E;  4LF9 I;  1NHH A;  1EI1 A;  5FWK A;  5LMU I;  2VQF I;  3PYE A;  4HAC A;  3V2U C;  4JYA E;  4PRV A;  2F4V E;  1XMO E;  2HK3 A;  3J7A G;  1KVK A;  3WU5 A;  1Z0C A;  2UUC I;  2LJP A;  3T1Y I;  1HNZ E;  4MYU A;  5FLX C;  4HYM A;  4X62 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...