4GKJI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkjI00
1NHHA 1DARA 1QZRA 2XEXA 1N36E 1N32I 2OI2A 1I94E 3ZM7A 4Z7YA 4DUZI 4DR4I 1Z0EA 3WU4A 4YY3E 1Z5CA 3JAMQ 1HNWI 2LJPA 3T1YE 1Z0WA 5BR8E 4DV5I 4DR3I 5A2QC 1IBMI 4WUCA 4ED4A 4FN5A 1A6FA 3LPSA 2VQFE 4LF9I 3LNUA 4K0KI 3ZKBA 4LFAE 1MG7A 2UUAE 4NXNI 4DR7E 4LF6E 4B3TI 1FWKA 2R3VA 1Z0VA 4DV4I 4JI7E 1NHIA 4DV3E 4USKA 4NXMI 1N33E 1H74A 1XNQE 2BV3A 2E5LI 4DV6E 2J7KA 4LFCI 4USMA 4P52A 2UXBI 3V2UC 1HNXE 4JI8E 5FLXQ 1FKAE 3H4LA 4JI3E 4JI5I 1ZXNA 3T1HI 4OX9E 3JAMC 4FW9A 2F4VI 3OTOI 3F0NA 1FNMA 2UUCE 4YHHE 1XHKA 3B82A 4LFBI 1H7UA 4DR5E 4LF5E 1FWLA 4XTJA 2VQEE 4HACA 4X66E 1VISA 5LMUI 1H7SA 1S4EA 1IBKE 4DV0E 4DUYE 2UXCE 1J5EI 4JI4I 3ZKDA 1WUUA 3QT7A 4DV1I 4JI0I 4KHPE 2V34A 2UU9I 1XMOE 2VF3A 4LF8E 4FWHA 3PYEA 4DR2E 4JI6I 1KIJA 4X62E 1HNZE 4DPTA 2X36A 1N34E 4WUDA 1Z0BA 5L3JA 4X65I 4HACB 1XNRI 1NHJA 1N32E 2ZBKB 1KKHA 3PYFA 3QT8A 1N36I 1I94I 1OJ4A 4DV5E 4DR3E 3GONA 1IBME 1Z59A 5BR8I 2BM0A 4UT4A 4DR1I 4JV5I 4LF9E 4WUBA 4I3HA 3B78A 4K0KE 2EFGA 4NXNE 1Z0TA 2HFUA 4HYMA 4DPYA 4JI1I 4MYTA 1FJGI 4B3TE 3ZZTA 2UUAI 4B3RI 2UUBI 4DR7I 2DEIA 4HY1A 4URLA 1KTVA 2HK3A 4JYAI 3WU3A 1D6TA 2E5LE 1N33I 4PRVA 1U2RA 2CZ9A 4M1KA 1XNQI 2UXBE 1KVKA 1HR0E 1HNXI 3ZZUA 4X64I 1UEKA 3T1HE 3J7AG 1BKNA 4GKKE 2F4VE 3K17A 5IWAE 3OTOE 4B3SI 2E1RA 4FWDA 3J81C 4LF4I 4DR6E 1EI1A 4JI2I 1IBLE 4DV2I 4DR5I 4LF5I 2VQEI 5IT9C 1XMQI 1N0UA 1PIEA 1EA6A 4JI4E 4DV1E 2UXDI 3Q1QA 4DUYI 2GS8A 4PU9A 4DV7I 2HHHI 4LF7I 1MX0A 3QT5A 1XMOI 4AQYI 4B3ME 2ZM6E 1K47A 2V2VA 4GKJE 1H72C 1Z5BA 1ZM9A 4DR2I 3B8HA 1ZM2A 5LMNI 1FI4A 4JG4A 4DUZE 4DPUA 4DR4E 3J7AM 1XNRE 2NPFA 1HNWE 2DEJA 4YY3I 3V5RA 3T1YI 2HKEA 2HFSA 1B62A 1NZ0A 5GMDA 3J81Q 3PYGA 2ZITA 2R42A 4P7AA 2VQFI 4DR1E 4JV5E 1H73A 1Z5AA 5IT9Q 4LFAI 4DV4E 1Z0GA 2AJ4A 4LF6I 1RR9A 3D4JA 2A2DA 4NXME 4JI1E 1FJGE 4B3RE 4JI7I 4DV3I 1PVGA 2UUBE 3K1JA 3WU6A 2V8PA 4LFCE 4JYAE 4DV6I 3J80Q 4JI5E 4JI8I 1ZXMA 4MYUA 4UTGA 4JI3I 1S16A 3ZZ0A 4X64E 4OX9I 1HR0I 3LTOA 4GKKI 4B3SE 2X7IA 1N0VC 2BM1A 1RREA 4LFBE 2UUCI 4YHHI 5IWAI 5LL6R 3PYDA 4DU7A 4DXLA 4DPXA 5LMUE 3M6AA 4EMDA 4LF4E 5GMEA 2A2CA 4X66I 1J5EE 2Q2EB 4KQVA 4Z7CA 4JI2E 1IBKI 4DR6I 4DV0I 4DV2E 1ZM4A 4ZVIA 1ELOA 4HXZA 2UXCI 1XMQE 4DU8A 2HKJA 4JI0E 1IBLI 3HULA 5A2QQ 4R1FA 2UU9E 2UXDE 4KHPI 4RPFA 4DV7E 1MU5A 2HHHE 3QT6A 4LF7E 1B63A 4LF8I 3J80C 1PKPA 3CWVA 1Z0CA 4JI6E 2V2QA 4AQYE 5FLXC 2HK2A 3WU5A 4FWGA 2V2ZA 4B3MI 4X62I 2ZM6I 1HNZI 1ZM3A 4DPWA 4X65E 1N34I 4GKJI 2WW4A 4PRXA 5LMNE
chains in the Genus database with same CATH superfamily
1NHHA 4OO1F 1DARA 1QZRA 2XEXA 2GO3A 1N36E 2WNRA 1N32I 2JEBB 2OI2A 1I94E 2NN6F 3ZM7A 2CGEA 4LOMA 4Z7YA 4DUZI 4DR4I 1Z0EA 3WU4A 4YY3E 1Z5CA 3JAMQ 1HNWI 5EL9A 2LJPA 3T1YE 1Z0WA 3M85D 2J65A 5BR8E 4DV5I 4DR3I 2PNZA 4LCGA 1Y4SA 5A2QC 1IBMI 4WUCA 4ED4A 4FN5A 5DRRA 1A6FA 3LPSA 2VQFE 5JEAC 3HKMA 4LF9I 3K85A 1R6MA 3LNUA 4K0KI 3ZKBA 4LFAE 1MG7A 2UUAE 4NXNI 4DR7E 4LF6E 4B3TI 2NN6D 2O1UA 1FWKA 2R3VA 3GCMA 1Z0VA 4DV4I 4JI7E 5ELWA 1NHIA 4DV3E 4USKA 4NXMI 3M7NG 1N33E 1YHCA 1H74A 5K36C 1XNQE 2BV3A 1UDOA 2E5LI 4IFDB 4DV6E 2J7KA 2BA1D 2Z5BA 5K36F 2PO2A 3P3EA 4P52A 4LFCI 4USMA 3V2UC 1HNXE 2UXBI 4JI8E 4OO1A 5FLXQ 3H4LA 1FKAE 1OYPA 4ISAA 4JI3E 4JI5I 1ZXNA 3T1HI 2NN6A 4OX9E 3JAMC 4FW9A 5C0XB 2F4VI 4GQUA 3OTOI 3F0NA 4IFDF 2C38A 1FNMA 4BA1A 2UUCE 4YHHE 5C0XE 1XHKA 3B82A 4LFBI 1H7UA 4DR5E 4LF5E 1FWLA 4XTJA 2JT2A 2VQEE 4HACA 3PS2A 4X66E 1VISA 2BA0D 2Z5EA 4FW6A 5LMUI 2GO4A 1H7SA 4AIDA 1S4EA 1IBKE 4DV0E 4DUYE 2UXCE 4FW7A 4MU4A 1J5EI 4JI4I 3ZKDA 3L7ZB 2Z5BB 3QT7A 1VI7A 1WUUA 4DV1I 3M85G 4JI0I 4OO1B 4KHPE 2V34A 2UU9I 4IFDD 1XMOE 2VF3A 4LF8E 3U1YA 1HK7A 4N3OA 4OO1E 4FWHA 3PYEA 5DNXA 4DR2E 2C38B 4JI6I 1KIJA 4X62E 1HNZE 4BA1B 5DNLA 5C0XD 4QNKA 4DPTA 2X36A 1N34E 4WUDA 1Z0BA 1XXEA 5L3JA 4IFDA 3P3CA 1Y5YA 4X65I 4HACB 2JE6A 1XNRI 2O1VA 1NHJA 1N32E 2ZBKB 1KKHA 3PYFA 3QT8A 2BA1G 1N36I 4MU1A 2IERA 1I94I 3HJCA 3Q6MA 1OJ4A 5C0XA 2O1TA 4DV5E 4DR3E 3GONA 4AM3A 1IBME 1Z59A 1UDNA 3PS3A 5K36B 5JEAF 5BR8I 2BM0A 3UHMA 4OKGA 4UT4A 4DR1I 4OO1D 4JV5I 4LF9E 2PO1A 4WUBA 4I3HA 3B78A 2PNMA 4K0KE 4OZEA 5K36E 2EFGA 4NXNE 1Z0TA 2HFUA 4HYMA 4DPYA 4JI1I 4MYTA 1FJGI 4B3TE 3ZZTA 2UUAI 4B3RI 3KRNA 2UUBI 4DR7I 2DEIA 4HY1A 4URLA 1KTVA 2BA0G 3L7ZA 4NBQA 2HK3A 4JYAI 2JE6B 3WU3A 1D6TA 2E5LE 1N33I 4BA2B 4PRVA 1U2RA 4M1KA 5DRQA 2CZ9A 4IFDE 1XNQI 2UXBE 1KVKA 1HR0E 2Z5CB 1HNXI 3ZZUA 4X64I 1UEKA 3T1HE 3J7AG 1BKNA 4GKKE 4FW4A 2F4VE 3K17A 2IOPA 5IWAE 3OTOE 4B3SI 2E1RA 3H1CA 4MDTA 2PO1B 3GMEA 5FWKA 1E3HA 4IS9A 4FWDA 5JEAA 5K36D 2GQ0A 3GLLA 2C37B 3J81C 3B4TA 4LF4I 4DR6E 2CG9A 2F1DA 2WP8B 1R6LA 1EI1A 2O3ZA 4JI2I 1IBLE 4DV2I 4DR5I 4LF5I 4IZJB 2VQEI 5IT9C 1XMQI 1N0UA 1PIEA 1EA6A 4JI4E 4DV1E 2UXDI 3Q1QA 4DUYI 2GS8A 5K36A 4U3DA 1USVA 4PU9A 4DV7I 2JEAB 2HHHI 4LF7I 2PO0A 3P3GA 1MX0A 3NZKA 4FW3A 4IZKA 3QT5A 3DD6A 1XMOI 4AQYI 4B3ME 2ZM6E 2VESA 1K47A 2V2VA 1Y6ZA 4GKJE 4MU3A 1H72C 1Z5BA 1ZM9A 4DR2I 3B8HA 3Q6NA 5JEAB 1ZM2A 5LMNI 4MU0A 1FI4A 4BA2A 4JG4A 4DUZE 4DPUA 4DR4E 3J7AM 4OO1C 1XNRE 2NPFA 5JEAE 1HNWE 2AE8A 2Z5CA 4LCFA 2DEJA 4YY3I 2NN6C 3V5RA 3T1YI 4MQYA 2HKEA 1E3PA 4LPFA 2HFSA 1OYSA 3U1KA 1B62A 1NZ0A 4IZJD 2IOQA 5GMDA 2PO0B 3J81Q 3PYGA 2ZITA 2R42A 4P7AA 2VQFI 2C39A 5DRPA 4QNJA 4DR1E 4IZKB 4JV5E 1H73A 2C37A 2BR2B 3P76A 1Z5AA 5IT9Q 4LFAI 2WP8A 4DV4E 1Z0GA 2AJ4A 4LF6I 1RR9A 3D4JA 2A2DA 4NXME 4JI1E 4IZJA 4U3BA 1FJGE 4B3RE 4JI7I 4DV3I 1PVGA 2UUBE 3K1JA 3WU6A 2V8PA 4LFCE 4JYAE 5JEAD 4DV6I 2JEAA 3J80Q 4JI5E 4JI8I 2WNRB 1Y60A 1ZXMA 4MYUA 4UTGA 4JI3I 1S16A 3ZZ0A 4X64E 4OX9I 1HR0I 2O1WA 3CDIA 2C39B 3LTOA 2PNZB 4GKKI 3PRYA 4B3SE 2X7IA 1N0VC 2BM1A 1RREA 4IFDC 4LFBE 2UUCI 4YHHI 5IWAI 5LL6R 3PYDA 4DU7A 4DXLA 1USUA 4DPXA 5LMUE 3M6AA 4EMDA 4LF4E 5GMEA 2A2CA 4X66I 5DROA 3M7ND 4LCHA 1J5EE 2JEBA 2Q2EB 4KQVA 4Z7CA 4JI2E 1IBKI 4DR6I 5EKWA 4DV0I 4DV2E 1ZM4A 2CVEA 4ZVIA 5C0XC 1ELOA 4HXZA 2UXCI 3P06A 1XMQE 4DU8A 2HKJA 4JI0E 1IBLI 3HULA 5A2QQ 1UDSA 4R1FA 5C0XF 2UU9E 4J3DA 2UXDE 3PS1A 4KHPI 4RPFA 1YH8A 4DV7E 1MU5A 2HHHE 3QT6A 2PO2B 4LF7E 1B63A 4LF8I 3J80C 2BR2A 4FW5A 1Y4UA 1PKPA 1P42A 3CWVA 1Z0CA 2PNLA 4JI6E 2V2QA 2NN6B 4AQYE 2IESA 4AIMA 5FLXC 2HK2A 3WU5A 1OYRA 4FWGA 2V2ZA 4B3MI 1RHYA 4X62I 2ZM6I 1HNZI 1ZM3A 4DPWA 4X65E 2NN6E 1N34I 3CDJA 4GKJI 1UDQA 2WW4A 4PRXA 5LMNE
chains in the Genus database with same CATH topology
1NHHA 1DARA 1QZRA 2XEXA 1N36E 1N32I 2OI2A 1I94E 3ZM7A 2CGEA 4Z7YA 4DUZI 4DR4I 1Z0EA 3WU4A 4YY3E 1Z5CA 3JAMQ 1HNWI 2LJPA 3T1YE 1Z0WA 5BR8E 4DV5I 4DR3I 1Y4SA 5A2QC 1IBMI 4WUCA 4ED4A 4FN5A 1A6FA 3LPSA 2VQFE 4LF9I 3K85A 3LNUA 4K0KI 3ZKBA 4LFAE 1MG7A 2UUAE 4NXNI 4DR7E 4LF6E 4B3TI 2O1UA 1FWKA 2R3VA 1Z0VA 4DV4I 4JI7E 1NHIA 4DV3E 4USKA 4NXMI 1N33E 1H74A 1XNQE 2BV3A 2E5LI 4DV6E 2J7KA 2Z5BA 4LFCI 4USMA 4P52A 2UXBI 3V2UC 1HNXE 4JI8E 5FLXQ 3H4LA 1FKAE 4JI3E 4JI5I 1ZXNA 3T1HI 4OX9E 3JAMC 4FW9A 2F4VI 3OTOI 3F0NA 1FNMA 2UUCE 4YHHE 1XHKA 3B82A 4LFBI 1H7UA 4DR5E 4LF5E 1FWLA 4XTJA 2VQEE 4HACA 4X66E 1VISA 2Z5EA 5LMUI 1H7SA 1S4EA 1IBKE 4DV0E 4DUYE 2UXCE 1J5EI 4JI4I 3ZKDA 1WUUA 2Z5BB 3QT7A 4DV1I 4JI0I 4KHPE 2V34A 2UU9I 1XMOE 2VF3A 4LF8E 1HK7A 4N3OA 4FWHA 3PYEA 4DR2E 4JI6I 1KIJA 4X62E 1HNZE 4DPTA 2X36A 1N34E 4WUDA 1Z0BA 5L3JA 4X65I 4HACB 1XNRI 2O1VA 1NHJA 1N32E 2ZBKB 1KKHA 3PYFA 3QT8A 1N36I 1I94I 3HJCA 3Q6MA 1OJ4A 2O1TA 4DV5E 4DR3E 3GONA 1IBME 1Z59A 5BR8I 2BM0A 4UT4A 4DR1I 4JV5I 4LF9E 4WUBA 4I3HA 3B78A 2PNMA 4K0KE 2EFGA 4NXNE 1Z0TA 2HFUA 4HYMA 4DPYA 4JI1I 4MYTA 1FJGI 4B3TE 3ZZTA 2UUAI 4B3RI 2UUBI 4DR7I 2DEIA 4HY1A 4URLA 1KTVA 2HK3A 4JYAI 3WU3A 1D6TA 2E5LE 1N33I 4PRVA 1U2RA 2CZ9A 4M1KA 1XNQI 2UXBE 1KVKA 1HR0E 2Z5CB 1HNXI 3ZZUA 4X64I 1UEKA 3T1HE 3J7AG 1BKNA 4GKKE 2F4VE 3K17A 2IOPA 5IWAE 3OTOE 4B3SI 2E1RA 5FWKA 4FWDA 2GQ0A 3J81C 4LF4I 4DR6E 2CG9A 1EI1A 4JI2I 1IBLE 4DV2I 4DR5I 4LF5I 4IZJB 2VQEI 5IT9C 1XMQI 1N0UA 1PIEA 1EA6A 4JI4E 4DV1E 2UXDI 3Q1QA 4DUYI 2GS8A 1USVA 4PU9A 4DV7I 2HHHI 4LF7I 1MX0A 4IZKA 3QT5A 1XMOI 4AQYI 4B3ME 2ZM6E 1K47A 2V2VA 1Y6ZA 4GKJE 1H72C 1Z5BA 1ZM9A 4DR2I 3B8HA 3Q6NA 1ZM2A 5LMNI 1FI4A 4JG4A 4DUZE 4DPUA 4DR4E 3J7AM 1XNRE 2NPFA 1HNWE 2Z5CA 2DEJA 4YY3I 3V5RA 3T1YI 2HKEA 2HFSA 1B62A 1NZ0A 4IZJD 2IOQA 5GMDA 3J81Q 3PYGA 2ZITA 2R42A 4P7AA 2VQFI 4DR1E 4IZKB 4JV5E 1H73A 1Z5AA 5IT9Q 4LFAI 4DV4E 1Z0GA 2AJ4A 4LF6I 1RR9A 3D4JA 2A2DA 4NXME 4JI1E 4IZJA 1FJGE 4B3RE 4JI7I 4DV3I 1PVGA 2UUBE 3K1JA 3WU6A 2V8PA 4LFCE 4JYAE 4DV6I 3J80Q 4JI5E 4JI8I 1ZXMA 4MYUA 4UTGA 4JI3I 1S16A 3ZZ0A 4X64E 4OX9I 1HR0I 2O1WA 3LTOA 4GKKI 3PRYA 4B3SE 2X7IA 1N0VC 2BM1A 1RREA 4LFBE 2UUCI 4YHHI 5IWAI 5LL6R 3PYDA 4DU7A 4DXLA 1USUA 4DPXA 5LMUE 3M6AA 4EMDA 4LF4E 5GMEA 2A2CA 4X66I 1J5EE 2Q2EB 4KQVA 4Z7CA 4JI2E 1IBKI 4DR6I 4DV0I 4DV2E 1ZM4A 4ZVIA 1ELOA 4HXZA 2UXCI 3P06A 1XMQE 4DU8A 2HKJA 4JI0E 1IBLI 3HULA 5A2QQ 4R1FA 2UU9E 2UXDE 4KHPI 4RPFA 4DV7E 1MU5A 2HHHE 3QT6A 4LF7E 1B63A 4LF8I 3J80C 1Y4UA 1PKPA 3CWVA 1Z0CA 2PNLA 4JI6E 2V2QA 4AQYE 5FLXC 2HK2A 3WU5A 4FWGA 2V2ZA 4B3MI 4X62I 2ZM6I 1HNZI 1ZM3A 4DPWA 4X65E 1N34I 4GKJI 2WW4A 4PRXA 5LMNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHH A;  1DAR A;  1QZR A;  2XEX A;  1N36 E;  1N32 I;  2OI2 A;  1I94 E;  3ZM7 A;  4Z7Y A;  4DUZ I;  4DR4 I;  1Z0E A;  3WU4 A;  4YY3 E;  1Z5C A;  3JAM Q;  1HNW I;  2LJP A;  3T1Y E;  1Z0W A;  5BR8 E;  4DV5 I;  4DR3 I;  5A2Q C;  1IBM I;  4WUC A;  4ED4 A;  4FN5 A;  1A6F A;  3LPS A;  2VQF E;  4LF9 I;  3LNU A;  4K0K I;  3ZKB A;  4LFA E;  1MG7 A;  2UUA E;  4NXN I;  4DR7 E;  4LF6 E;  4B3T I;  1FWK A;  2R3V A;  1Z0V A;  4DV4 I;  4JI7 E;  1NHI A;  4DV3 E;  4USK A;  4NXM I;  1N33 E;  1H74 A;  1XNQ E;  2BV3 A;  2E5L I;  4DV6 E;  2J7K A;  4LFC I;  4USM A;  4P52 A;  2UXB I;  3V2U C;  1HNX E;  4JI8 E;  5FLX Q;  1FKA E;  3H4L A;  4JI3 E;  4JI5 I;  1ZXN A;  3T1H I;  4OX9 E;  3JAM C;  4FW9 A;  2F4V I;  3OTO I;  3F0N A;  1FNM A;  2UUC E;  4YHH E;  1XHK A;  3B82 A;  4LFB I;  1H7U A;  4DR5 E;  4LF5 E;  1FWL A;  4XTJ A;  2VQE E;  4HAC A;  4X66 E;  1VIS A;  5LMU I;  1H7S A;  1S4E A;  1IBK E;  4DV0 E;  4DUY E;  2UXC E;  1J5E I;  4JI4 I;  3ZKD A;  1WUU A;  3QT7 A;  4DV1 I;  4JI0 I;  4KHP E;  2V34 A;  2UU9 I;  1XMO E;  2VF3 A;  4LF8 E;  4FWH A;  3PYE A;  4DR2 E;  4JI6 I;  1KIJ A;  4X62 E;  1HNZ E;  4DPT A;  2X36 A;  1N34 E;  4WUD A;  1Z0B A;  5L3J A;  4X65 I;  4HAC B;  1XNR I;  1NHJ A;  1N32 E;  2ZBK B;  1KKH A;  3PYF A;  3QT8 A;  1N36 I;  1I94 I;  1OJ4 A;  4DV5 E;  4DR3 E;  3GON A;  1IBM E;  1Z59 A;  5BR8 I;  2BM0 A;  4UT4 A;  4DR1 I;  4JV5 I;  4LF9 E;  4WUB A;  4I3H A;  3B78 A;  4K0K E;  2EFG A;  4NXN E;  1Z0T A;  2HFU A;  4HYM A;  4DPY A;  4JI1 I;  4MYT A;  1FJG I;  4B3T E;  3ZZT A;  2UUA I;  4B3R I;  2UUB I;  4DR7 I;  2DEI A;  4HY1 A;  4URL A;  1KTV A;  2HK3 A;  4JYA I;  3WU3 A;  1D6T A;  2E5L E;  1N33 I;  4PRV A;  1U2R A;  2CZ9 A;  4M1K A;  1XNQ I;  2UXB E;  1KVK A;  1HR0 E;  1HNX I;  3ZZU A;  4X64 I;  1UEK A;  3T1H E;  3J7A G;  1BKN A;  4GKK E;  2F4V E;  3K17 A;  5IWA E;  3OTO E;  4B3S I;  2E1R A;  4FWD A;  3J81 C;  4LF4 I;  4DR6 E;  1EI1 A;  4JI2 I;  1IBL E;  4DV2 I;  4DR5 I;  4LF5 I;  2VQE I;  5IT9 C;  1XMQ I;  1N0U A;  1PIE A;  1EA6 A;  4JI4 E;  4DV1 E;  2UXD I;  3Q1Q A;  4DUY I;  2GS8 A;  4PU9 A;  4DV7 I;  2HHH I;  4LF7 I;  1MX0 A;  3QT5 A;  1XMO I;  4AQY I;  4B3M E;  2ZM6 E;  1K47 A;  2V2V A;  4GKJ E;  1H72 C;  1Z5B A;  1ZM9 A;  4DR2 I;  3B8H A;  1ZM2 A;  5LMN I;  1FI4 A;  4JG4 A;  4DUZ E;  4DPU A;  4DR4 E;  3J7A M;  1XNR E;  2NPF A;  1HNW E;  2DEJ A;  4YY3 I;  3V5R A;  3T1Y I;  2HKE A;  2HFS A;  1B62 A;  1NZ0 A;  5GMD A;  3J81 Q;  3PYG A;  2ZIT A;  2R42 A;  4P7A A;  2VQF I;  4DR1 E;  4JV5 E;  1H73 A;  1Z5A A;  5IT9 Q;  4LFA I;  4DV4 E;  1Z0G A;  2AJ4 A;  4LF6 I;  1RR9 A;  3D4J A;  2A2D A;  4NXM E;  4JI1 E;  1FJG E;  4B3R E;  4JI7 I;  4DV3 I;  1PVG A;  2UUB E;  3K1J A;  3WU6 A;  2V8P A;  4LFC E;  4JYA E;  4DV6 I;  3J80 Q;  4JI5 E;  4JI8 I;  1ZXM A;  4MYU A;  4UTG A;  4JI3 I;  1S16 A;  3ZZ0 A;  4X64 E;  4OX9 I;  1HR0 I;  3LTO A;  4GKK I;  4B3S E;  2X7I A;  1N0V C;  2BM1 A;  1RRE A;  4LFB E;  2UUC I;  4YHH I;  5IWA I;  5LL6 R;  3PYD A;  4DU7 A;  4DXL A;  4DPX A;  5LMU E;  3M6A A;  4EMD A;  4LF4 E;  5GME A;  2A2C A;  4X66 I;  1J5E E;  2Q2E B;  4KQV A;  4Z7C A;  4JI2 E;  1IBK I;  4DR6 I;  4DV0 I;  4DV2 E;  1ZM4 A;  4ZVI A;  1ELO A;  4HXZ A;  2UXC I;  1XMQ E;  4DU8 A;  2HKJ A;  4JI0 E;  1IBL I;  3HUL A;  5A2Q Q;  4R1F A;  2UU9 E;  2UXD E;  4KHP I;  4RPF A;  4DV7 E;  1MU5 A;  2HHH E;  3QT6 A;  4LF7 E;  1B63 A;  4LF8 I;  3J80 C;  1PKP A;  3CWV A;  1Z0C A;  4JI6 E;  2V2Q A;  4AQY E;  5FLX C;  2HK2 A;  3WU5 A;  4FWG A;  2V2Z A;  4B3M I;  4X62 I;  2ZM6 I;  1HNZ I;  1ZM3 A;  4DPW A;  4X65 E;  1N34 I;  4GKJ I;  2WW4 A;  4PRX A;  5LMN E; 
#chains in the Genus database with same CATH topology
 1NHH A;  4OO1 F;  1DAR A;  1QZR A;  2XEX A;  2GO3 A;  1N36 E;  2WNR A;  1N32 I;  2JEB B;  2OI2 A;  1I94 E;  2NN6 F;  3ZM7 A;  2CGE A;  4LOM A;  4Z7Y A;  4DUZ I;  4DR4 I;  1Z0E A;  3WU4 A;  4YY3 E;  1Z5C A;  3JAM Q;  1HNW I;  5EL9 A;  2LJP A;  3T1Y E;  1Z0W A;  3M85 D;  2J65 A;  5BR8 E;  4DV5 I;  4DR3 I;  2PNZ A;  4LCG A;  1Y4S A;  5A2Q C;  1IBM I;  4WUC A;  4ED4 A;  4FN5 A;  5DRR A;  1A6F A;  3LPS A;  2VQF E;  5JEA C;  3HKM A;  4LF9 I;  3K85 A;  1R6M A;  3LNU A;  4K0K I;  3ZKB A;  4LFA E;  1MG7 A;  2UUA E;  4NXN I;  4DR7 E;  4LF6 E;  4B3T I;  2NN6 D;  2O1U A;  1FWK A;  2R3V A;  3GCM A;  1Z0V A;  4DV4 I;  4JI7 E;  5ELW A;  1NHI A;  4DV3 E;  4USK A;  4NXM I;  3M7N G;  1N33 E;  1YHC A;  1H74 A;  5K36 C;  1XNQ E;  2BV3 A;  1UDO A;  2E5L I;  4IFD B;  4DV6 E;  2J7K A;  2BA1 D;  2Z5B A;  5K36 F;  2PO2 A;  3P3E A;  4P52 A;  4LFC I;  4USM A;  3V2U C;  1HNX E;  2UXB I;  4JI8 E;  4OO1 A;  5FLX Q;  3H4L A;  1FKA E;  1OYP A;  4ISA A;  4JI3 E;  4JI5 I;  1ZXN A;  3T1H I;  2NN6 A;  4OX9 E;  3JAM C;  4FW9 A;  5C0X B;  2F4V I;  4GQU A;  3OTO I;  3F0N A;  4IFD F;  2C38 A;  1FNM A;  4BA1 A;  2UUC E;  4YHH E;  5C0X E;  1XHK A;  3B82 A;  4LFB I;  1H7U A;  4DR5 E;  4LF5 E;  1FWL A;  4XTJ A;  2JT2 A;  2VQE E;  4HAC A;  3PS2 A;  4X66 E;  1VIS A;  2BA0 D;  2Z5E A;  4FW6 A;  5LMU I;  2GO4 A;  1H7S A;  4AID A;  1S4E A;  1IBK E;  4DV0 E;  4DUY E;  2UXC E;  4FW7 A;  4MU4 A;  1J5E I;  4JI4 I;  3ZKD A;  3L7Z B;  2Z5B B;  3QT7 A;  1VI7 A;  1WUU A;  4DV1 I;  3M85 G;  4JI0 I;  4OO1 B;  4KHP E;  2V34 A;  2UU9 I;  4IFD D;  1XMO E;  2VF3 A;  4LF8 E;  3U1Y A;  1HK7 A;  4N3O A;  4OO1 E;  4FWH A;  3PYE A;  5DNX A;  4DR2 E;  2C38 B;  4JI6 I;  1KIJ A;  4X62 E;  1HNZ E;  4BA1 B;  5DNL A;  5C0X D;  4QNK A;  4DPT A;  2X36 A;  1N34 E;  4WUD A;  1Z0B A;  1XXE A;  5L3J A;  4IFD A;  3P3C A;  1Y5Y A;  4X65 I;  4HAC B;  2JE6 A;  1XNR I;  2O1V A;  1NHJ A;  1N32 E;  2ZBK B;  1KKH A;  3PYF A;  3QT8 A;  2BA1 G;  1N36 I;  4MU1 A;  2IER A;  1I94 I;  3HJC A;  3Q6M A;  1OJ4 A;  5C0X A;  2O1T A;  4DV5 E;  4DR3 E;  3GON A;  4AM3 A;  1IBM E;  1Z59 A;  1UDN A;  3PS3 A;  5K36 B;  5JEA F;  5BR8 I;  2BM0 A;  3UHM A;  4OKG A;  4UT4 A;  4DR1 I;  4OO1 D;  4JV5 I;  4LF9 E;  2PO1 A;  4WUB A;  4I3H A;  3B78 A;  2PNM A;  4K0K E;  4OZE A;  5K36 E;  2EFG A;  4NXN E;  1Z0T A;  2HFU A;  4HYM A;  4DPY A;  4JI1 I;  4MYT A;  1FJG I;  4B3T E;  3ZZT A;  2UUA I;  4B3R I;  3KRN A;  2UUB I;  4DR7 I;  2DEI A;  4HY1 A;  4URL A;  1KTV A;  2BA0 G;  3L7Z A;  4NBQ A;  2HK3 A;  4JYA I;  2JE6 B;  3WU3 A;  1D6T A;  2E5L E;  1N33 I;  4BA2 B;  4PRV A;  1U2R A;  4M1K A;  5DRQ A;  2CZ9 A;  4IFD E;  1XNQ I;  2UXB E;  1KVK A;  1HR0 E;  2Z5C B;  1HNX I;  3ZZU A;  4X64 I;  1UEK A;  3T1H E;  3J7A G;  1BKN A;  4GKK E;  4FW4 A;  2F4V E;  3K17 A;  2IOP A;  5IWA E;  3OTO E;  4B3S I;  2E1R A;  3H1C A;  4MDT A;  2PO1 B;  3GME A;  5FWK A;  1E3H A;  4IS9 A;  4FWD A;  5JEA A;  5K36 D;  2GQ0 A;  3GLL A;  2C37 B;  3J81 C;  3B4T A;  4LF4 I;  4DR6 E;  2CG9 A;  2F1D A;  2WP8 B;  1R6L A;  1EI1 A;  2O3Z A;  4JI2 I;  1IBL E;  4DV2 I;  4DR5 I;  4LF5 I;  4IZJ B;  2VQE I;  5IT9 C;  1XMQ I;  1N0U A;  1PIE A;  1EA6 A;  4JI4 E;  4DV1 E;  2UXD I;  3Q1Q A;  4DUY I;  2GS8 A;  5K36 A;  4U3D A;  1USV A;  4PU9 A;  4DV7 I;  2JEA B;  2HHH I;  4LF7 I;  2PO0 A;  3P3G A;  1MX0 A;  3NZK A;  4FW3 A;  4IZK A;  3QT5 A;  3DD6 A;  1XMO I;  4AQY I;  4B3M E;  2ZM6 E;  2VES A;  1K47 A;  2V2V A;  1Y6Z A;  4GKJ E;  4MU3 A;  1H72 C;  1Z5B A;  1ZM9 A;  4DR2 I;  3B8H A;  3Q6N A;  5JEA B;  1ZM2 A;  5LMN I;  4MU0 A;  1FI4 A;  4BA2 A;  4JG4 A;  4DUZ E;  4DPU A;  4DR4 E;  3J7A M;  4OO1 C;  1XNR E;  2NPF A;  5JEA E;  1HNW E;  2AE8 A;  2Z5C A;  4LCF A;  2DEJ A;  4YY3 I;  2NN6 C;  3V5R A;  3T1Y I;  4MQY A;  2HKE A;  1E3P A;  4LPF A;  2HFS A;  1OYS A;  3U1K A;  1B62 A;  1NZ0 A;  4IZJ D;  2IOQ A;  5GMD A;  2PO0 B;  3J81 Q;  3PYG A;  2ZIT A;  2R42 A;  4P7A A;  2VQF I;  2C39 A;  5DRP A;  4QNJ A;  4DR1 E;  4IZK B;  4JV5 E;  1H73 A;  2C37 A;  2BR2 B;  3P76 A;  1Z5A A;  5IT9 Q;  4LFA I;  2WP8 A;  4DV4 E;  1Z0G A;  2AJ4 A;  4LF6 I;  1RR9 A;  3D4J A;  2A2D A;  4NXM E;  4JI1 E;  4IZJ A;  4U3B A;  1FJG E;  4B3R E;  4JI7 I;  4DV3 I;  1PVG A;  2UUB E;  3K1J A;  3WU6 A;  2V8P A;  4LFC E;  4JYA E;  5JEA D;  4DV6 I;  2JEA A;  3J80 Q;  4JI5 E;  4JI8 I;  2WNR B;  1Y60 A;  1ZXM A;  4MYU A;  4UTG A;  4JI3 I;  1S16 A;  3ZZ0 A;  4X64 E;  4OX9 I;  1HR0 I;  2O1W A;  3CDI A;  2C39 B;  3LTO A;  2PNZ B;  4GKK I;  3PRY A;  4B3S E;  2X7I A;  1N0V C;  2BM1 A;  1RRE A;  4IFD C;  4LFB E;  2UUC I;  4YHH I;  5IWA I;  5LL6 R;  3PYD A;  4DU7 A;  4DXL A;  1USU A;  4DPX A;  5LMU E;  3M6A A;  4EMD A;  4LF4 E;  5GME A;  2A2C A;  4X66 I;  5DRO A;  3M7N D;  4LCH A;  1J5E E;  2JEB A;  2Q2E B;  4KQV A;  4Z7C A;  4JI2 E;  1IBK I;  4DR6 I;  5EKW A;  4DV0 I;  4DV2 E;  1ZM4 A;  2CVE A;  4ZVI A;  5C0X C;  1ELO A;  4HXZ A;  2UXC I;  3P06 A;  1XMQ E;  4DU8 A;  2HKJ A;  4JI0 E;  1IBL I;  3HUL A;  5A2Q Q;  1UDS A;  4R1F A;  5C0X F;  2UU9 E;  4J3D A;  2UXD E;  3PS1 A;  4KHP I;  4RPF A;  1YH8 A;  4DV7 E;  1MU5 A;  2HHH E;  3QT6 A;  2PO2 B;  4LF7 E;  1B63 A;  4LF8 I;  3J80 C;  2BR2 A;  4FW5 A;  1Y4U A;  1PKP A;  1P42 A;  3CWV A;  1Z0C A;  2PNL A;  4JI6 E;  2V2Q A;  2NN6 B;  4AQY E;  2IES A;  4AIM A;  5FLX C;  2HK2 A;  3WU5 A;  1OYR A;  4FWG A;  2V2Z A;  4B3M I;  1RHY A;  4X62 I;  2ZM6 I;  1HNZ I;  1ZM3 A;  4DPW A;  4X65 E;  2NN6 E;  1N34 I;  3CDJ A;  4GKJ I;  1UDQ A;  2WW4 A;  4PRX A;  5LMN E; 
#chains in the Genus database with same CATH homology
 1NHH A;  1DAR A;  1QZR A;  2XEX A;  1N36 E;  1N32 I;  2OI2 A;  1I94 E;  3ZM7 A;  2CGE A;  4Z7Y A;  4DUZ I;  4DR4 I;  1Z0E A;  3WU4 A;  4YY3 E;  1Z5C A;  3JAM Q;  1HNW I;  2LJP A;  3T1Y E;  1Z0W A;  5BR8 E;  4DV5 I;  4DR3 I;  1Y4S A;  5A2Q C;  1IBM I;  4WUC A;  4ED4 A;  4FN5 A;  1A6F A;  3LPS A;  2VQF E;  4LF9 I;  3K85 A;  3LNU A;  4K0K I;  3ZKB A;  4LFA E;  1MG7 A;  2UUA E;  4NXN I;  4DR7 E;  4LF6 E;  4B3T I;  2O1U A;  1FWK A;  2R3V A;  1Z0V A;  4DV4 I;  4JI7 E;  1NHI A;  4DV3 E;  4USK A;  4NXM I;  1N33 E;  1H74 A;  1XNQ E;  2BV3 A;  2E5L I;  4DV6 E;  2J7K A;  2Z5B A;  4LFC I;  4USM A;  4P52 A;  2UXB I;  3V2U C;  1HNX E;  4JI8 E;  5FLX Q;  3H4L A;  1FKA E;  4JI3 E;  4JI5 I;  1ZXN A;  3T1H I;  4OX9 E;  3JAM C;  4FW9 A;  2F4V I;  3OTO I;  3F0N A;  1FNM A;  2UUC E;  4YHH E;  1XHK A;  3B82 A;  4LFB I;  1H7U A;  4DR5 E;  4LF5 E;  1FWL A;  4XTJ A;  2VQE E;  4HAC A;  4X66 E;  1VIS A;  2Z5E A;  5LMU I;  1H7S A;  1S4E A;  1IBK E;  4DV0 E;  4DUY E;  2UXC E;  1J5E I;  4JI4 I;  3ZKD A;  1WUU A;  2Z5B B;  3QT7 A;  4DV1 I;  4JI0 I;  4KHP E;  2V34 A;  2UU9 I;  1XMO E;  2VF3 A;  4LF8 E;  1HK7 A;  4N3O A;  4FWH A;  3PYE A;  4DR2 E;  4JI6 I;  1KIJ A;  4X62 E;  1HNZ E;  4DPT A;  2X36 A;  1N34 E;  4WUD A;  1Z0B A;  5L3J A;  4X65 I;  4HAC B;  1XNR I;  2O1V A;  1NHJ A;  1N32 E;  2ZBK B;  1KKH A;  3PYF A;  3QT8 A;  1N36 I;  1I94 I;  3HJC A;  3Q6M A;  1OJ4 A;  2O1T A;  4DV5 E;  4DR3 E;  3GON A;  1IBM E;  1Z59 A;  5BR8 I;  2BM0 A;  4UT4 A;  4DR1 I;  4JV5 I;  4LF9 E;  4WUB A;  4I3H A;  3B78 A;  2PNM A;  4K0K E;  2EFG A;  4NXN E;  1Z0T A;  2HFU A;  4HYM A;  4DPY A;  4JI1 I;  4MYT A;  1FJG I;  4B3T E;  3ZZT A;  2UUA I;  4B3R I;  2UUB I;  4DR7 I;  2DEI A;  4HY1 A;  4URL A;  1KTV A;  2HK3 A;  4JYA I;  3WU3 A;  1D6T A;  2E5L E;  1N33 I;  4PRV A;  1U2R A;  2CZ9 A;  4M1K A;  1XNQ I;  2UXB E;  1KVK A;  1HR0 E;  2Z5C B;  1HNX I;  3ZZU A;  4X64 I;  1UEK A;  3T1H E;  3J7A G;  1BKN A;  4GKK E;  2F4V E;  3K17 A;  2IOP A;  5IWA E;  3OTO E;  4B3S I;  2E1R A;  5FWK A;  4FWD A;  2GQ0 A;  3J81 C;  4LF4 I;  4DR6 E;  2CG9 A;  1EI1 A;  4JI2 I;  1IBL E;  4DV2 I;  4DR5 I;  4LF5 I;  4IZJ B;  2VQE I;  5IT9 C;  1XMQ I;  1N0U A;  1PIE A;  1EA6 A;  4JI4 E;  4DV1 E;  2UXD I;  3Q1Q A;  4DUY I;  2GS8 A;  1USV A;  4PU9 A;  4DV7 I;  2HHH I;  4LF7 I;  1MX0 A;  4IZK A;  3QT5 A;  1XMO I;  4AQY I;  4B3M E;  2ZM6 E;  1K47 A;  2V2V A;  1Y6Z A;  4GKJ E;  1H72 C;  1Z5B A;  1ZM9 A;  4DR2 I;  3B8H A;  3Q6N A;  1ZM2 A;  5LMN I;  1FI4 A;  4JG4 A;  4DUZ E;  4DPU A;  4DR4 E;  3J7A M;  1XNR E;  2NPF A;  1HNW E;  2Z5C A;  2DEJ A;  4YY3 I;  3V5R A;  3T1Y I;  2HKE A;  2HFS A;  1B62 A;  1NZ0 A;  4IZJ D;  2IOQ A;  5GMD A;  3J81 Q;  3PYG A;  2ZIT A;  2R42 A;  4P7A A;  2VQF I;  4DR1 E;  4IZK B;  4JV5 E;  1H73 A;  1Z5A A;  5IT9 Q;  4LFA I;  4DV4 E;  1Z0G A;  2AJ4 A;  4LF6 I;  1RR9 A;  3D4J A;  2A2D A;  4NXM E;  4JI1 E;  4IZJ A;  1FJG E;  4B3R E;  4JI7 I;  4DV3 I;  1PVG A;  2UUB E;  3K1J A;  3WU6 A;  2V8P A;  4LFC E;  4JYA E;  4DV6 I;  3J80 Q;  4JI5 E;  4JI8 I;  1ZXM A;  4MYU A;  4UTG A;  4JI3 I;  1S16 A;  3ZZ0 A;  4X64 E;  4OX9 I;  1HR0 I;  2O1W A;  3LTO A;  4GKK I;  3PRY A;  4B3S E;  2X7I A;  1N0V C;  2BM1 A;  1RRE A;  4LFB E;  2UUC I;  4YHH I;  5IWA I;  5LL6 R;  3PYD A;  4DU7 A;  4DXL A;  1USU A;  4DPX A;  5LMU E;  3M6A A;  4EMD A;  4LF4 E;  5GME A;  2A2C A;  4X66 I;  1J5E E;  2Q2E B;  4KQV A;  4Z7C A;  4JI2 E;  1IBK I;  4DR6 I;  4DV0 I;  4DV2 E;  1ZM4 A;  4ZVI A;  1ELO A;  4HXZ A;  2UXC I;  3P06 A;  1XMQ E;  4DU8 A;  2HKJ A;  4JI0 E;  1IBL I;  3HUL A;  5A2Q Q;  4R1F A;  2UU9 E;  2UXD E;  4KHP I;  4RPF A;  4DV7 E;  1MU5 A;  2HHH E;  3QT6 A;  4LF7 E;  1B63 A;  4LF8 I;  3J80 C;  1Y4U A;  1PKP A;  3CWV A;  1Z0C A;  2PNL A;  4JI6 E;  2V2Q A;  4AQY E;  5FLX C;  2HK2 A;  3WU5 A;  4FWG A;  2V2Z A;  4B3M I;  4X62 I;  2ZM6 I;  1HNZ I;  1ZM3 A;  4DPW A;  4X65 E;  1N34 I;  4GKJ I;  2WW4 A;  4PRX A;  5LMN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...