4GKJI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkjI00
2ZITA 1H7SA 3QT7A 1IBLE 2X36A 4EMDA 4HACA 2ZM6I 1XNQE 4DV1I 4PRVA 5GMDA 4DPXA 1WUUA 2VQFI 4DUYI 4DR3I 2R42A 4DR7E 4DV5E 4JV5E 4PRXA 3WU3A 4LFAE 2BM1A 4WUBA 1OJ4A 1B63A 2HK3A 3B82A 4JG4A 1VISA 3LPSA 1Z0BA 1J5EE 4DUZI 1FKAE 4K0KI 5A2QC 3WU5A 2UXBI 4NXNE 2HHHE 4LFBE 4KQVA 3PYGA 4JI6E 2VF3A 1S4EA 4LF7I 1Z0WA 4P52A 4JI5I 4LF4I 1HNZE 1ZM3A 4YHHI 2V34A 3J80Q 4X65E 4DV7I 4GKJE 5LL6R 2UUBI 5LMUE 3J81Q 3QT5A 4LF6I 4FN5A 4X66E 3ZZTA 2VQEI 5IT9C 2UUCI 4JI0I 4AQYI 2CZ9A 2EFGA 4LF5I 4FW9A 3B8HA 4I3HA 1Z0EA 1KVKA 4KHPI 2UU9I 1HNXI 2UXCI 1FJGE 2R3VA 2OI2A 4X62E 5IWAI 1Z5BA 4JI7E 4URLA 3OTOE 4DU7A 4DV4I 1XMQE 4JI1I 3J80C 4M1KA 4DV6I 1Z5CA 4B3ME 4UT4A 1N0UA 1B62A 3ZKBA 1MX0A 3H4LA 1N0VC 1RR9A 1DARA 4DV0E 5LMNI 4OX9E 2UXDI 1HR0E 1K47A 1Z59A 1PKPA 3V2UC 2NPFA 4NXMI 4DR5I 4XTJA 4GKKE 1KTVA 4USKA 5GMEA 4DR4I 1NZ0A 1N34E 3ZZ0A 1EI1A 4X64I 2HKEA 5BR8I 3JAMQ 4JI4I 2A2DA 2UUAI 4DR2E 3LTOA 1IBMI 3T1HE 4DPYA 4LFCE 4JI3I 1HNWE 5L3JA 1A6FA 1NHIA 4HYMA 4DV2E 2HKJA 1ZXMA 2F4VE 4JI8I 4LF8I 4HXZA 4YY3E 4Z7YA 4B3SI 4DR6I 4LF9E 2J7KA 1KKHA 1FI4A 1IBKI 1XMOI 1ZM2A 1PVGA 1MG7A 3JAMC 2ZM6E 4UTGA 4DV1E 1S16A 3HULA 4ED4A 2VQFE 4DUYE 1H7UA 4DR3E 1U2RA 1I94I 1ZXNA 4HY1A 2Q2EB 4B3RI 3V5RA 1H73A 4ZVIA 2X7IA 4JI7I 4DXLA 1N36I 4DUZE 1ELOA 4K0KE 2E5LI 1N33I 2GS8A 1H74A 2UXBE 4R1FA 2A2CA 1N32I 4JI2I 4LF7E 2ZBKB 4JI5E 4LF4E 4B3TI 4DV3I 2V2VA 4YHHE 2HFSA 4DR1I 1XNRI 4DV7E 2AJ4A 4JYAI 1ZM4A 2V8PA 2UUBE 3J81C 1Z5AA 4LF6E 3CWVA 2V2ZA 4MYTA 3T1YI 2VQEE 4PU9A 1IBLI 2UUCE 4JI0E 4AQYE 1Z0VA 4LF5E 1XNQI 4WUDA 4MYUA 3PYFA 4DR7I 4JV5I 4DV5I 2DEIA 3F0NA 4KHPE 2UU9E 1NHJA 1HNXE 4LFAI 2UXCE 3ZM7A 4RPFA 5IWAE 4DV4E 1D6TA 1J5EI 4JI1E 4DV6E 3ZZUA 5A2QQ 2V2QA 4NXNI 2HHHI 4LFBI 1BKNA 2HK2A 4JI6I 4DPUA 5LMNE 1HNZI 2E1RA 2UXDE 1MU5A 4X65I 4GKJI 5LMUI 4NXME 4DR5E 4FWGA 3ZKDA 3K1JA 4X66I 5FLXQ 3J7AM 4DR4E 1Z0GA 5IT9Q 1NHHA 3LNUA 1ZM9A 4WUCA 4X64E 3PYDA 3B78A 5BR8E 3WU4A 4JI4E 2UUAE 2HFUA 1IBME 4DPTA 1KIJA 3Q1QA 4FWDA 4HACB 1FWKA 4JI3E 1FJGI 4X62I 2XEXA 4Z7CA 4DPWA 3OTOI 1XMQI 3QT6A 4JI8E 4LF8E 3GONA 4P7AA 3WU6A 4B3SE 4DR6E 1FNMA 4B3MI 4USMA 3K17A 1IBKE 5FLXC 1XMOE 4DV0I 3QT8A 4OX9I 1HR0I 2BV3A 3PYEA 1I94E 1FWLA 3M6AA 4B3RE 4GKKI 1Z0CA 1N34I 1RREA 2BM0A 1N36E 4DR2I 2E5LE 1N33E 3J7AG 1H72C 3T1HI 2WW4A 4LFCI 1N32E 4JI2E 3D4JA 1XHKA 1HNWI 4FWHA 1PIEA 4B3TE 4DV2I 4DV3E 1UEKA 4DR1E 2F4VI 2LJPA 2DEJA 1XNRE 1Z0TA 4DU8A 1EA6A 4JYAE 4YY3I 4LF9I 1QZRA 3T1YE
chains in the Genus database with same CATH superfamily
2ZITA 1H7SA 3QT7A 1IBLE 2X36A 4EMDA 4LCHA 2IOPA 4HACA 2JE6B 4MQYA 2ZM6I 1XNQE 4DV1I 1XXEA 4PRVA 5GMDA 4DPXA 1WUUA 2VQFI 4DUYI 4DR3I 2CVEA 2R42A 4DV5E 4DR7E 4JV5E 2O1WA 4PRXA 3WU3A 4LFAE 2BM1A 2JT2A 4WUBA 1OJ4A 1B63A 2HK3A 3B82A 4FW3A 4JG4A 4MU0A 1VISA 3M7NG 3LPSA 5C0XF 4J3DA 1Z0BA 1J5EE 2Z5CB 4DUZI 2PO1A 1FKAE 4K0KI 4IZJD 5A2QC 3WU5A 2UXBI 1Y6ZA 4NXNE 2HHHE 4LFBE 4KQVA 2BA1D 3PYGA 4JI6E 2VF3A 1S4EA 4LF7I 1Z0WA 4LCFA 4P52A 4JI5I 4LF4I 3Q6NA 1HNZE 4AIDA 1ZM3A 4YHHI 2V34A 3J80Q 4X65E 4DV7I 4GKJE 5LL6R 4NBQA 2UUBI 5LMUE 1P42A 2NN6B 3J81Q 3PS1A 3QT5A 4LF6I 4FN5A 4X66E 3ZZTA 2VQEI 5IT9C 4IZKB 2UUCI 4JI0I 4AQYI 2CZ9A 2IOQA 4IFDB 4OO1B 2EFGA 4LF5I 5DRRA 4FW9A 3GCMA 3B8HA 4I3HA 1Z0EA 4OZEA 1KVKA 2BA1G 4KHPI 2UU9I 1HNXI 5DNXA 2UXCI 1FJGE 2R3VA 5C0XA 2OI2A 4X62E 5IWAI 1Z5BA 1E3PA 4JI7E 4URLA 3OTOE 4DU7A 4DV4I 1XMQE 2NN6F 4JI1I 3J80C 4M1KA 4DV6I 4MU1A 2GO4A 1Z5CA 4B3ME 2Z5EA 3PRYA 4UT4A 1N0UA 1B62A 3ZKBA 5JEAB 1MX0A 1OYPA 4IFDF 3H4LA 4OO1F 2WNRB 1N0VC 1RR9A 1DARA 4DV0E 2CG9A 3Q6MA 5ELWA 4N3OA 5LMNI 4OX9E 2UXDI 2C38A 1HR0E 1K47A 1Z59A 1PKPA 3V2UC 4GQUA 2NPFA 4FW5A 4NXMI 4DR5I 2NN6E 5DRPA 3DD6A 4XTJA 4GKKE 1KTVA 4USKA 3L7ZA 5GMEA 5K36B 1Y5YA 4DR4I 1NZ0A 1N34E 3ZZ0A 2JEBA 1EI1A 4X64I 1HK7A 2HKEA 5BR8I 3JAMQ 4JI4I 2A2DA 2UUAI 4QNKA 4DR2E 4OO1E 1E3HA 3LTOA 5JEAF 1IBMI 2VESA 3T1HE 4DPYA 2JEAB 4LFCE 5C0XD 4JI3I 1HNWE 2NN6A 5L3JA 1A6FA 1NHIA 2BR2B 4HYMA 4OO1C 4DV2E 2HKJA 4AM3A 1ZXMA 2F4VE 4JI8I 4LF8I 3P3CA 2WP8B 4HXZA 4FW7A 1UDNA 4YY3E 4Z7YA 5K36F 4B3SI 4DR6I 4OO1A 3M85D 5DNLA 4LPFA 4LF9E 2J7KA 1KKHA 1FI4A 1IBKI 5JEAE 1XMOI 1ZM2A 1PVGA 1MG7A 2AE8A 3JAMC 2ZM6E 4UTGA 4DV1E 1S16A 1Y4UA 2PO0B 3HULA 4ED4A 1Y60A 2VQFE 4DUYE 1H7UA 4DR3E 1U2RA 1I94I 5C0XE 1ZXNA 4HY1A 2F1DA 2Q2EB 4B3RI 1UDQA 3V5RA 1H73A 4ZVIA 5K36E 2PNLA 2X7IA 4JI7I 5JEAA 4DXLA 2WNRA 1N36I 4DUZE 1ELOA 5C0XC 4K0KE 2E5LI 1N33I 2GS8A 3M85G 4U3BA 1H74A 2UXBE 1R6MA 4R1FA 2A2CA 1UDOA 1N32I 1YHCA 2NN6D 4JI2I 4LF7E 2PO1B 2ZBKB 4JI5E 4LF4E 4B3TI 4LOMA 4DV3I 2V2VA 4YHHE 2HFSA 4DR1I 5K36A 1USVA 4FW4A 5EL9A 2J65A 2O3ZA 2C39B 1XNRI 4DV7E 2AJ4A 4JYAI 4OO1D 2JE6A 1ZM4A 2V8PA 2UUBE 4BA1B 3J81C 1Z5AA 2C37B 4LF6E 3CWVA 2V2ZA 4MYTA 3T1YI 2VQEE 5DROA 4PU9A 1IBLI 2UUCE 4JI0E 2JEAA 4AQYE 4MDTA 4QNJA 1Z0VA 4LF5E 1XNQI 4WUDA 4MYUA 3PYFA 4ISAA 2BR2A 4DR7I 4JV5I 4DV5I 2DEIA 3F0NA 3P3GA 2Z5CA 4AIMA 4KHPE 2WP8A 4MU3A 2UU9E 1NHJA 1HNXE 4LFAI 2UXCE 3ZM7A 4RPFA 2O1UA 5IWAE 4U3DA 3HKMA 5JEAD 4DV4E 3NZKA 1D6TA 1J5EI 4JI1E 4IFDE 2Z5BB 4DV6E 3ZZUA 2NN6C 2PNZB 5A2QQ 2V2QA 3P06A 1OYSA 4NXNI 2PO0A 2HHHI 2O1VA 4LFBI 1BKNA 3U1YA 2HK2A 4JI6I 1RHYA 4DPUA 4IFDC 5LMNE 1HNZI 2E1RA 5K36D 3K85A 2UXDE 4IZJB 1MU5A 4X65I 2O1TA 4IZKA 4OKGA 4GKJI 3HJCA 3CDIA 4IFDA 4BA2B 5LMUI 4NXME 4DR5E 2BA0D 4FWGA 2GQ0A 2PO2B 3ZKDA 3K1JA 4X66I 5FLXQ 3J7AM 2C38B 4DR4E 1Z0GA 3PS3A 5IT9Q 1R6LA 1NHHA 3LNUA 1ZM9A 4WUCA 1YH8A 4X64E 3PYDA 3B78A 5BR8E 3WU4A 4JI4E 2UUAE 2HFUA 4FW6A 1IBME 4DPTA 3L7ZB 3GMEA 1KIJA 3Q1QA 4FWDA 5JEAC 2IESA 2C39A 5FWKA 2JEBB 4HACB 1FWKA 4JI3E 1FJGI 4BA1A 4X62I 2C37A 2XEXA 4Z7CA 4DPWA 3OTOI 3H1CA 1XMQI 3QT6A 4JI8E 4LF8E 3GONA 2IERA 4P7AA 3WU6A 5DRQA 1USUA 4B3SE 4DR6E 1FNMA 3P76A 3CDJA 2BA0G 4B3MI 1Y4SA 4USMA 5K36C 3K17A 1IBKE 4LCGA 5FLXC 1XMOE 3P3EA 4DV0I 3B4TA 3QT8A 4OX9I 1HR0I 2BV3A 4IFDD 3PYEA 1I94E 1UDSA 1VI7A 1FWLA 2Z5BA 3KRNA 3M6AA 4B3RE 4GKKI 2PNZA 1Z0CA 1N34I 1RREA 2BM0A 1OYRA 4MU4A 1N36E 4IS9A 4DR2I 2E5LE 1N33E 3J7AG 4IZJA 1H72C 3T1HI 2WW4A 2PNMA 4LFCI 2GO3A 1N32E 2CGEA 4JI2E 3D4JA 4BA2A 1XHKA 3PS2A 1HNWI 4FWHA 1PIEA 4B3TE 3U1KA 4DV2I 2PO2A 1UEKA 3UHMA 4DV3E 3M7ND 4DR1E 2F4VI 2LJPA 2DEJA 1XNRE 1Z0TA 4DU8A 1EA6A 4JYAE 5EKWA 4YY3I 5C0XB 4LF9I 3GLLA 1QZRA 3T1YE
chains in the Genus database with same CATH topology
2ZITA 1H7SA 3QT7A 1IBLE 2X36A 4EMDA 2IOPA 4HACA 2ZM6I 1XNQE 4DV1I 4PRVA 5GMDA 4DPXA 1WUUA 2VQFI 4DUYI 4DR3I 2R42A 4DR7E 4DV5E 4JV5E 2O1WA 4PRXA 3WU3A 4LFAE 2BM1A 4WUBA 1OJ4A 1B63A 2HK3A 3B82A 4JG4A 1VISA 3LPSA 1Z0BA 1J5EE 2Z5CB 4DUZI 1FKAE 4K0KI 4IZJD 5A2QC 3WU5A 2UXBI 1Y6ZA 4NXNE 2HHHE 4LFBE 4KQVA 3PYGA 4JI6E 2VF3A 1S4EA 4LF7I 1Z0WA 4P52A 4JI5I 4LF4I 3Q6NA 1HNZE 1ZM3A 4YHHI 2V34A 3J80Q 4X65E 4DV7I 4GKJE 5LL6R 2UUBI 5LMUE 3J81Q 3QT5A 4LF6I 4FN5A 4X66E 3ZZTA 2VQEI 5IT9C 4IZKB 2UUCI 4JI0I 4AQYI 2CZ9A 2IOQA 2EFGA 4LF5I 4FW9A 3B8HA 4I3HA 1Z0EA 1KVKA 4KHPI 2UU9I 1HNXI 2UXCI 1FJGE 2R3VA 2OI2A 4X62E 5IWAI 1Z5BA 4JI7E 4URLA 3OTOE 4DU7A 4DV4I 1XMQE 4JI1I 3J80C 4M1KA 4DV6I 1Z5CA 4B3ME 2Z5EA 3PRYA 4UT4A 1N0UA 1B62A 3ZKBA 1MX0A 3H4LA 1N0VC 1RR9A 1DARA 4DV0E 2CG9A 3Q6MA 4N3OA 5LMNI 4OX9E 2UXDI 1HR0E 1K47A 1Z59A 1PKPA 3V2UC 2NPFA 4NXMI 4DR5I 4XTJA 4GKKE 1KTVA 4USKA 5GMEA 4DR4I 1NZ0A 1N34E 3ZZ0A 1EI1A 4X64I 1HK7A 2HKEA 5BR8I 3JAMQ 4JI4I 2A2DA 2UUAI 4DR2E 3LTOA 1IBMI 3T1HE 4DPYA 4LFCE 4JI3I 1HNWE 5L3JA 1A6FA 1NHIA 4HYMA 4DV2E 2HKJA 1ZXMA 2F4VE 4JI8I 4LF8I 4HXZA 4YY3E 4Z7YA 4B3SI 4DR6I 4LF9E 2J7KA 1KKHA 1FI4A 1IBKI 1XMOI 1ZM2A 1PVGA 1MG7A 3JAMC 2ZM6E 4UTGA 4DV1E 1S16A 1Y4UA 3HULA 4ED4A 2VQFE 4DUYE 1H7UA 4DR3E 1U2RA 1I94I 1ZXNA 4HY1A 2Q2EB 4B3RI 3V5RA 1H73A 4ZVIA 2PNLA 2X7IA 4JI7I 4DXLA 1N36I 4DUZE 1ELOA 4K0KE 2E5LI 1N33I 2GS8A 1H74A 2UXBE 4R1FA 2A2CA 1N32I 4JI2I 4LF7E 2ZBKB 4JI5E 4LF4E 4B3TI 4DV3I 2V2VA 4YHHE 2HFSA 4DR1I 1USVA 1XNRI 4DV7E 2AJ4A 4JYAI 1ZM4A 2V8PA 2UUBE 3J81C 1Z5AA 4LF6E 3CWVA 2V2ZA 4MYTA 3T1YI 2VQEE 4PU9A 1IBLI 2UUCE 4JI0E 4AQYE 1Z0VA 4LF5E 1XNQI 4WUDA 4MYUA 3PYFA 4DR7I 4JV5I 4DV5I 2DEIA 3F0NA 2Z5CA 4KHPE 2UU9E 1NHJA 1HNXE 4LFAI 2UXCE 3ZM7A 4RPFA 2O1UA 5IWAE 4DV4E 1D6TA 1J5EI 4JI1E 2Z5BB 4DV6E 3ZZUA 5A2QQ 2V2QA 3P06A 4NXNI 2HHHI 2O1VA 4LFBI 1BKNA 2HK2A 4JI6I 4DPUA 5LMNE 1HNZI 2E1RA 3K85A 2UXDE 4IZJB 1MU5A 4X65I 2O1TA 4IZKA 4GKJI 3HJCA 5LMUI 4NXME 4DR5E 4FWGA 2GQ0A 3ZKDA 3K1JA 4X66I 5FLXQ 3J7AM 4DR4E 1Z0GA 5IT9Q 1NHHA 3LNUA 1ZM9A 4WUCA 4X64E 3PYDA 3B78A 5BR8E 3WU4A 4JI4E 2UUAE 2HFUA 1IBME 4DPTA 1KIJA 3Q1QA 4FWDA 5FWKA 4HACB 1FWKA 4JI3E 1FJGI 4X62I 2XEXA 4Z7CA 4DPWA 3OTOI 1XMQI 3QT6A 4JI8E 4LF8E 3GONA 4P7AA 3WU6A 1USUA 4B3SE 4DR6E 1FNMA 4B3MI 1Y4SA 4USMA 3K17A 1IBKE 5FLXC 1XMOE 4DV0I 3QT8A 4OX9I 1HR0I 2BV3A 3PYEA 1I94E 1FWLA 2Z5BA 3M6AA 4B3RE 4GKKI 1Z0CA 1N34I 1RREA 2BM0A 1N36E 4DR2I 2E5LE 1N33E 3J7AG 4IZJA 1H72C 3T1HI 2WW4A 2PNMA 4LFCI 1N32E 2CGEA 4JI2E 3D4JA 1XHKA 1HNWI 4FWHA 1PIEA 4B3TE 4DV2I 4DV3E 1UEKA 4DR1E 2F4VI 2LJPA 2DEJA 1XNRE 1Z0TA 4DU8A 1EA6A 4JYAE 4YY3I 4LF9I 1QZRA 3T1YE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  1H7S A;  3QT7 A;  1IBL E;  2X36 A;  4EMD A;  4HAC A;  2ZM6 I;  1XNQ E;  4DV1 I;  4PRV A;  5GMD A;  4DPX A;  1WUU A;  2VQF I;  4DUY I;  4DR3 I;  2R42 A;  4DR7 E;  4DV5 E;  4JV5 E;  4PRX A;  3WU3 A;  4LFA E;  2BM1 A;  4WUB A;  1OJ4 A;  1B63 A;  2HK3 A;  3B82 A;  4JG4 A;  1VIS A;  3LPS A;  1Z0B A;  1J5E E;  4DUZ I;  1FKA E;  4K0K I;  5A2Q C;  3WU5 A;  2UXB I;  4NXN E;  2HHH E;  4LFB E;  4KQV A;  3PYG A;  4JI6 E;  2VF3 A;  1S4E A;  4LF7 I;  1Z0W A;  4P52 A;  4JI5 I;  4LF4 I;  1HNZ E;  1ZM3 A;  4YHH I;  2V34 A;  3J80 Q;  4X65 E;  4DV7 I;  4GKJ E;  5LL6 R;  2UUB I;  5LMU E;  3J81 Q;  3QT5 A;  4LF6 I;  4FN5 A;  4X66 E;  3ZZT A;  2VQE I;  5IT9 C;  2UUC I;  4JI0 I;  4AQY I;  2CZ9 A;  2EFG A;  4LF5 I;  4FW9 A;  3B8H A;  4I3H A;  1Z0E A;  1KVK A;  4KHP I;  2UU9 I;  1HNX I;  2UXC I;  1FJG E;  2R3V A;  2OI2 A;  4X62 E;  5IWA I;  1Z5B A;  4JI7 E;  4URL A;  3OTO E;  4DU7 A;  4DV4 I;  1XMQ E;  4JI1 I;  3J80 C;  4M1K A;  4DV6 I;  1Z5C A;  4B3M E;  4UT4 A;  1N0U A;  1B62 A;  3ZKB A;  1MX0 A;  3H4L A;  1N0V C;  1RR9 A;  1DAR A;  4DV0 E;  5LMN I;  4OX9 E;  2UXD I;  1HR0 E;  1K47 A;  1Z59 A;  1PKP A;  3V2U C;  2NPF A;  4NXM I;  4DR5 I;  4XTJ A;  4GKK E;  1KTV A;  4USK A;  5GME A;  4DR4 I;  1NZ0 A;  1N34 E;  3ZZ0 A;  1EI1 A;  4X64 I;  2HKE A;  5BR8 I;  3JAM Q;  4JI4 I;  2A2D A;  2UUA I;  4DR2 E;  3LTO A;  1IBM I;  3T1H E;  4DPY A;  4LFC E;  4JI3 I;  1HNW E;  5L3J A;  1A6F A;  1NHI A;  4HYM A;  4DV2 E;  2HKJ A;  1ZXM A;  2F4V E;  4JI8 I;  4LF8 I;  4HXZ A;  4YY3 E;  4Z7Y A;  4B3S I;  4DR6 I;  4LF9 E;  2J7K A;  1KKH A;  1FI4 A;  1IBK I;  1XMO I;  1ZM2 A;  1PVG A;  1MG7 A;  3JAM C;  2ZM6 E;  4UTG A;  4DV1 E;  1S16 A;  3HUL A;  4ED4 A;  2VQF E;  4DUY E;  1H7U A;  4DR3 E;  1U2R A;  1I94 I;  1ZXN A;  4HY1 A;  2Q2E B;  4B3R I;  3V5R A;  1H73 A;  4ZVI A;  2X7I A;  4JI7 I;  4DXL A;  1N36 I;  4DUZ E;  1ELO A;  4K0K E;  2E5L I;  1N33 I;  2GS8 A;  1H74 A;  2UXB E;  4R1F A;  2A2C A;  1N32 I;  4JI2 I;  4LF7 E;  2ZBK B;  4JI5 E;  4LF4 E;  4B3T I;  4DV3 I;  2V2V A;  4YHH E;  2HFS A;  4DR1 I;  1XNR I;  4DV7 E;  2AJ4 A;  4JYA I;  1ZM4 A;  2V8P A;  2UUB E;  3J81 C;  1Z5A A;  4LF6 E;  3CWV A;  2V2Z A;  4MYT A;  3T1Y I;  2VQE E;  4PU9 A;  1IBL I;  2UUC E;  4JI0 E;  4AQY E;  1Z0V A;  4LF5 E;  1XNQ I;  4WUD A;  4MYU A;  3PYF A;  4DR7 I;  4JV5 I;  4DV5 I;  2DEI A;  3F0N A;  4KHP E;  2UU9 E;  1NHJ A;  1HNX E;  4LFA I;  2UXC E;  3ZM7 A;  4RPF A;  5IWA E;  4DV4 E;  1D6T A;  1J5E I;  4JI1 E;  4DV6 E;  3ZZU A;  5A2Q Q;  2V2Q A;  4NXN I;  2HHH I;  4LFB I;  1BKN A;  2HK2 A;  4JI6 I;  4DPU A;  5LMN E;  1HNZ I;  2E1R A;  2UXD E;  1MU5 A;  4X65 I;  4GKJ I;  5LMU I;  4NXM E;  4DR5 E;  4FWG A;  3ZKD A;  3K1J A;  4X66 I;  5FLX Q;  3J7A M;  4DR4 E;  1Z0G A;  5IT9 Q;  1NHH A;  3LNU A;  1ZM9 A;  4WUC A;  4X64 E;  3PYD A;  3B78 A;  5BR8 E;  3WU4 A;  4JI4 E;  2UUA E;  2HFU A;  1IBM E;  4DPT A;  1KIJ A;  3Q1Q A;  4FWD A;  4HAC B;  1FWK A;  4JI3 E;  1FJG I;  4X62 I;  2XEX A;  4Z7C A;  4DPW A;  3OTO I;  1XMQ I;  3QT6 A;  4JI8 E;  4LF8 E;  3GON A;  4P7A A;  3WU6 A;  4B3S E;  4DR6 E;  1FNM A;  4B3M I;  4USM A;  3K17 A;  1IBK E;  5FLX C;  1XMO E;  4DV0 I;  3QT8 A;  4OX9 I;  1HR0 I;  2BV3 A;  3PYE A;  1I94 E;  1FWL A;  3M6A A;  4B3R E;  4GKK I;  1Z0C A;  1N34 I;  1RRE A;  2BM0 A;  1N36 E;  4DR2 I;  2E5L E;  1N33 E;  3J7A G;  1H72 C;  3T1H I;  2WW4 A;  4LFC I;  1N32 E;  4JI2 E;  3D4J A;  1XHK A;  1HNW I;  4FWH A;  1PIE A;  4B3T E;  4DV2 I;  4DV3 E;  1UEK A;  4DR1 E;  2F4V I;  2LJP A;  2DEJ A;  1XNR E;  1Z0T A;  4DU8 A;  1EA6 A;  4JYA E;  4YY3 I;  4LF9 I;  1QZR A;  3T1Y E; 
#chains in the Genus database with same CATH topology
 2ZIT A;  1H7S A;  3QT7 A;  1IBL E;  2X36 A;  4EMD A;  4LCH A;  2IOP A;  4HAC A;  2JE6 B;  4MQY A;  2ZM6 I;  1XNQ E;  4DV1 I;  1XXE A;  4PRV A;  5GMD A;  4DPX A;  1WUU A;  2VQF I;  4DUY I;  4DR3 I;  2CVE A;  2R42 A;  4DV5 E;  4DR7 E;  4JV5 E;  2O1W A;  4PRX A;  3WU3 A;  4LFA E;  2BM1 A;  2JT2 A;  4WUB A;  1OJ4 A;  1B63 A;  2HK3 A;  3B82 A;  4FW3 A;  4JG4 A;  4MU0 A;  1VIS A;  3M7N G;  3LPS A;  5C0X F;  4J3D A;  1Z0B A;  1J5E E;  2Z5C B;  4DUZ I;  2PO1 A;  1FKA E;  4K0K I;  4IZJ D;  5A2Q C;  3WU5 A;  2UXB I;  1Y6Z A;  4NXN E;  2HHH E;  4LFB E;  4KQV A;  2BA1 D;  3PYG A;  4JI6 E;  2VF3 A;  1S4E A;  4LF7 I;  1Z0W A;  4LCF A;  4P52 A;  4JI5 I;  4LF4 I;  3Q6N A;  1HNZ E;  4AID A;  1ZM3 A;  4YHH I;  2V34 A;  3J80 Q;  4X65 E;  4DV7 I;  4GKJ E;  5LL6 R;  4NBQ A;  2UUB I;  5LMU E;  1P42 A;  2NN6 B;  3J81 Q;  3PS1 A;  3QT5 A;  4LF6 I;  4FN5 A;  4X66 E;  3ZZT A;  2VQE I;  5IT9 C;  4IZK B;  2UUC I;  4JI0 I;  4AQY I;  2CZ9 A;  2IOQ A;  4IFD B;  4OO1 B;  2EFG A;  4LF5 I;  5DRR A;  4FW9 A;  3GCM A;  3B8H A;  4I3H A;  1Z0E A;  4OZE A;  1KVK A;  2BA1 G;  4KHP I;  2UU9 I;  1HNX I;  5DNX A;  2UXC I;  1FJG E;  2R3V A;  5C0X A;  2OI2 A;  4X62 E;  5IWA I;  1Z5B A;  1E3P A;  4JI7 E;  4URL A;  3OTO E;  4DU7 A;  4DV4 I;  1XMQ E;  2NN6 F;  4JI1 I;  3J80 C;  4M1K A;  4DV6 I;  4MU1 A;  2GO4 A;  1Z5C A;  4B3M E;  2Z5E A;  3PRY A;  4UT4 A;  1N0U A;  1B62 A;  3ZKB A;  5JEA B;  1MX0 A;  1OYP A;  4IFD F;  3H4L A;  4OO1 F;  2WNR B;  1N0V C;  1RR9 A;  1DAR A;  4DV0 E;  2CG9 A;  3Q6M A;  5ELW A;  4N3O A;  5LMN I;  4OX9 E;  2UXD I;  2C38 A;  1HR0 E;  1K47 A;  1Z59 A;  1PKP A;  3V2U C;  4GQU A;  2NPF A;  4FW5 A;  4NXM I;  4DR5 I;  2NN6 E;  5DRP A;  3DD6 A;  4XTJ A;  4GKK E;  1KTV A;  4USK A;  3L7Z A;  5GME A;  5K36 B;  1Y5Y A;  4DR4 I;  1NZ0 A;  1N34 E;  3ZZ0 A;  2JEB A;  1EI1 A;  4X64 I;  1HK7 A;  2HKE A;  5BR8 I;  3JAM Q;  4JI4 I;  2A2D A;  2UUA I;  4QNK A;  4DR2 E;  4OO1 E;  1E3H A;  3LTO A;  5JEA F;  1IBM I;  2VES A;  3T1H E;  4DPY A;  2JEA B;  4LFC E;  5C0X D;  4JI3 I;  1HNW E;  2NN6 A;  5L3J A;  1A6F A;  1NHI A;  2BR2 B;  4HYM A;  4OO1 C;  4DV2 E;  2HKJ A;  4AM3 A;  1ZXM A;  2F4V E;  4JI8 I;  4LF8 I;  3P3C A;  2WP8 B;  4HXZ A;  4FW7 A;  1UDN A;  4YY3 E;  4Z7Y A;  5K36 F;  4B3S I;  4DR6 I;  4OO1 A;  3M85 D;  5DNL A;  4LPF A;  4LF9 E;  2J7K A;  1KKH A;  1FI4 A;  1IBK I;  5JEA E;  1XMO I;  1ZM2 A;  1PVG A;  1MG7 A;  2AE8 A;  3JAM C;  2ZM6 E;  4UTG A;  4DV1 E;  1S16 A;  1Y4U A;  2PO0 B;  3HUL A;  4ED4 A;  1Y60 A;  2VQF E;  4DUY E;  1H7U A;  4DR3 E;  1U2R A;  1I94 I;  5C0X E;  1ZXN A;  4HY1 A;  2F1D A;  2Q2E B;  4B3R I;  1UDQ A;  3V5R A;  1H73 A;  4ZVI A;  5K36 E;  2PNL A;  2X7I A;  4JI7 I;  5JEA A;  4DXL A;  2WNR A;  1N36 I;  4DUZ E;  1ELO A;  5C0X C;  4K0K E;  2E5L I;  1N33 I;  2GS8 A;  3M85 G;  4U3B A;  1H74 A;  2UXB E;  1R6M A;  4R1F A;  2A2C A;  1UDO A;  1N32 I;  1YHC A;  2NN6 D;  4JI2 I;  4LF7 E;  2PO1 B;  2ZBK B;  4JI5 E;  4LF4 E;  4B3T I;  4LOM A;  4DV3 I;  2V2V A;  4YHH E;  2HFS A;  4DR1 I;  5K36 A;  1USV A;  4FW4 A;  5EL9 A;  2J65 A;  2O3Z A;  2C39 B;  1XNR I;  4DV7 E;  2AJ4 A;  4JYA I;  4OO1 D;  2JE6 A;  1ZM4 A;  2V8P A;  2UUB E;  4BA1 B;  3J81 C;  1Z5A A;  2C37 B;  4LF6 E;  3CWV A;  2V2Z A;  4MYT A;  3T1Y I;  2VQE E;  5DRO A;  4PU9 A;  1IBL I;  2UUC E;  4JI0 E;  2JEA A;  4AQY E;  4MDT A;  4QNJ A;  1Z0V A;  4LF5 E;  1XNQ I;  4WUD A;  4MYU A;  3PYF A;  4ISA A;  2BR2 A;  4DR7 I;  4JV5 I;  4DV5 I;  2DEI A;  3F0N A;  3P3G A;  2Z5C A;  4AIM A;  4KHP E;  2WP8 A;  4MU3 A;  2UU9 E;  1NHJ A;  1HNX E;  4LFA I;  2UXC E;  3ZM7 A;  4RPF A;  2O1U A;  5IWA E;  4U3D A;  3HKM A;  5JEA D;  4DV4 E;  3NZK A;  1D6T A;  1J5E I;  4JI1 E;  4IFD E;  2Z5B B;  4DV6 E;  3ZZU A;  2NN6 C;  2PNZ B;  5A2Q Q;  2V2Q A;  3P06 A;  1OYS A;  4NXN I;  2PO0 A;  2HHH I;  2O1V A;  4LFB I;  1BKN A;  3U1Y A;  2HK2 A;  4JI6 I;  1RHY A;  4DPU A;  4IFD C;  5LMN E;  1HNZ I;  2E1R A;  5K36 D;  3K85 A;  2UXD E;  4IZJ B;  1MU5 A;  4X65 I;  2O1T A;  4IZK A;  4OKG A;  4GKJ I;  3HJC A;  3CDI A;  4IFD A;  4BA2 B;  5LMU I;  4NXM E;  4DR5 E;  2BA0 D;  4FWG A;  2GQ0 A;  2PO2 B;  3ZKD A;  3K1J A;  4X66 I;  5FLX Q;  3J7A M;  2C38 B;  4DR4 E;  1Z0G A;  3PS3 A;  5IT9 Q;  1R6L A;  1NHH A;  3LNU A;  1ZM9 A;  4WUC A;  1YH8 A;  4X64 E;  3PYD A;  3B78 A;  5BR8 E;  3WU4 A;  4JI4 E;  2UUA E;  2HFU A;  4FW6 A;  1IBM E;  4DPT A;  3L7Z B;  3GME A;  1KIJ A;  3Q1Q A;  4FWD A;  5JEA C;  2IES A;  2C39 A;  5FWK A;  2JEB B;  4HAC B;  1FWK A;  4JI3 E;  1FJG I;  4BA1 A;  4X62 I;  2C37 A;  2XEX A;  4Z7C A;  4DPW A;  3OTO I;  3H1C A;  1XMQ I;  3QT6 A;  4JI8 E;  4LF8 E;  3GON A;  2IER A;  4P7A A;  3WU6 A;  5DRQ A;  1USU A;  4B3S E;  4DR6 E;  1FNM A;  3P76 A;  3CDJ A;  2BA0 G;  4B3M I;  1Y4S A;  4USM A;  5K36 C;  3K17 A;  1IBK E;  4LCG A;  5FLX C;  1XMO E;  3P3E A;  4DV0 I;  3B4T A;  3QT8 A;  4OX9 I;  1HR0 I;  2BV3 A;  4IFD D;  3PYE A;  1I94 E;  1UDS A;  1VI7 A;  1FWL A;  2Z5B A;  3KRN A;  3M6A A;  4B3R E;  4GKK I;  2PNZ A;  1Z0C A;  1N34 I;  1RRE A;  2BM0 A;  1OYR A;  4MU4 A;  1N36 E;  4IS9 A;  4DR2 I;  2E5L E;  1N33 E;  3J7A G;  4IZJ A;  1H72 C;  3T1H I;  2WW4 A;  2PNM A;  4LFC I;  2GO3 A;  1N32 E;  2CGE A;  4JI2 E;  3D4J A;  4BA2 A;  1XHK A;  3PS2 A;  1HNW I;  4FWH A;  1PIE A;  4B3T E;  3U1K A;  4DV2 I;  2PO2 A;  1UEK A;  3UHM A;  4DV3 E;  3M7N D;  4DR1 E;  2F4V I;  2LJP A;  2DEJ A;  1XNR E;  1Z0T A;  4DU8 A;  1EA6 A;  4JYA E;  5EKW A;  4YY3 I;  5C0X B;  4LF9 I;  3GLL A;  1QZR A;  3T1Y E; 
#chains in the Genus database with same CATH homology
 2ZIT A;  1H7S A;  3QT7 A;  1IBL E;  2X36 A;  4EMD A;  2IOP A;  4HAC A;  2ZM6 I;  1XNQ E;  4DV1 I;  4PRV A;  5GMD A;  4DPX A;  1WUU A;  2VQF I;  4DUY I;  4DR3 I;  2R42 A;  4DR7 E;  4DV5 E;  4JV5 E;  2O1W A;  4PRX A;  3WU3 A;  4LFA E;  2BM1 A;  4WUB A;  1OJ4 A;  1B63 A;  2HK3 A;  3B82 A;  4JG4 A;  1VIS A;  3LPS A;  1Z0B A;  1J5E E;  2Z5C B;  4DUZ I;  1FKA E;  4K0K I;  4IZJ D;  5A2Q C;  3WU5 A;  2UXB I;  1Y6Z A;  4NXN E;  2HHH E;  4LFB E;  4KQV A;  3PYG A;  4JI6 E;  2VF3 A;  1S4E A;  4LF7 I;  1Z0W A;  4P52 A;  4JI5 I;  4LF4 I;  3Q6N A;  1HNZ E;  1ZM3 A;  4YHH I;  2V34 A;  3J80 Q;  4X65 E;  4DV7 I;  4GKJ E;  5LL6 R;  2UUB I;  5LMU E;  3J81 Q;  3QT5 A;  4LF6 I;  4FN5 A;  4X66 E;  3ZZT A;  2VQE I;  5IT9 C;  4IZK B;  2UUC I;  4JI0 I;  4AQY I;  2CZ9 A;  2IOQ A;  2EFG A;  4LF5 I;  4FW9 A;  3B8H A;  4I3H A;  1Z0E A;  1KVK A;  4KHP I;  2UU9 I;  1HNX I;  2UXC I;  1FJG E;  2R3V A;  2OI2 A;  4X62 E;  5IWA I;  1Z5B A;  4JI7 E;  4URL A;  3OTO E;  4DU7 A;  4DV4 I;  1XMQ E;  4JI1 I;  3J80 C;  4M1K A;  4DV6 I;  1Z5C A;  4B3M E;  2Z5E A;  3PRY A;  4UT4 A;  1N0U A;  1B62 A;  3ZKB A;  1MX0 A;  3H4L A;  1N0V C;  1RR9 A;  1DAR A;  4DV0 E;  2CG9 A;  3Q6M A;  4N3O A;  5LMN I;  4OX9 E;  2UXD I;  1HR0 E;  1K47 A;  1Z59 A;  1PKP A;  3V2U C;  2NPF A;  4NXM I;  4DR5 I;  4XTJ A;  4GKK E;  1KTV A;  4USK A;  5GME A;  4DR4 I;  1NZ0 A;  1N34 E;  3ZZ0 A;  1EI1 A;  4X64 I;  1HK7 A;  2HKE A;  5BR8 I;  3JAM Q;  4JI4 I;  2A2D A;  2UUA I;  4DR2 E;  3LTO A;  1IBM I;  3T1H E;  4DPY A;  4LFC E;  4JI3 I;  1HNW E;  5L3J A;  1A6F A;  1NHI A;  4HYM A;  4DV2 E;  2HKJ A;  1ZXM A;  2F4V E;  4JI8 I;  4LF8 I;  4HXZ A;  4YY3 E;  4Z7Y A;  4B3S I;  4DR6 I;  4LF9 E;  2J7K A;  1KKH A;  1FI4 A;  1IBK I;  1XMO I;  1ZM2 A;  1PVG A;  1MG7 A;  3JAM C;  2ZM6 E;  4UTG A;  4DV1 E;  1S16 A;  1Y4U A;  3HUL A;  4ED4 A;  2VQF E;  4DUY E;  1H7U A;  4DR3 E;  1U2R A;  1I94 I;  1ZXN A;  4HY1 A;  2Q2E B;  4B3R I;  3V5R A;  1H73 A;  4ZVI A;  2PNL A;  2X7I A;  4JI7 I;  4DXL A;  1N36 I;  4DUZ E;  1ELO A;  4K0K E;  2E5L I;  1N33 I;  2GS8 A;  1H74 A;  2UXB E;  4R1F A;  2A2C A;  1N32 I;  4JI2 I;  4LF7 E;  2ZBK B;  4JI5 E;  4LF4 E;  4B3T I;  4DV3 I;  2V2V A;  4YHH E;  2HFS A;  4DR1 I;  1USV A;  1XNR I;  4DV7 E;  2AJ4 A;  4JYA I;  1ZM4 A;  2V8P A;  2UUB E;  3J81 C;  1Z5A A;  4LF6 E;  3CWV A;  2V2Z A;  4MYT A;  3T1Y I;  2VQE E;  4PU9 A;  1IBL I;  2UUC E;  4JI0 E;  4AQY E;  1Z0V A;  4LF5 E;  1XNQ I;  4WUD A;  4MYU A;  3PYF A;  4DR7 I;  4JV5 I;  4DV5 I;  2DEI A;  3F0N A;  2Z5C A;  4KHP E;  2UU9 E;  1NHJ A;  1HNX E;  4LFA I;  2UXC E;  3ZM7 A;  4RPF A;  2O1U A;  5IWA E;  4DV4 E;  1D6T A;  1J5E I;  4JI1 E;  2Z5B B;  4DV6 E;  3ZZU A;  5A2Q Q;  2V2Q A;  3P06 A;  4NXN I;  2HHH I;  2O1V A;  4LFB I;  1BKN A;  2HK2 A;  4JI6 I;  4DPU A;  5LMN E;  1HNZ I;  2E1R A;  3K85 A;  2UXD E;  4IZJ B;  1MU5 A;  4X65 I;  2O1T A;  4IZK A;  4GKJ I;  3HJC A;  5LMU I;  4NXM E;  4DR5 E;  4FWG A;  2GQ0 A;  3ZKD A;  3K1J A;  4X66 I;  5FLX Q;  3J7A M;  4DR4 E;  1Z0G A;  5IT9 Q;  1NHH A;  3LNU A;  1ZM9 A;  4WUC A;  4X64 E;  3PYD A;  3B78 A;  5BR8 E;  3WU4 A;  4JI4 E;  2UUA E;  2HFU A;  1IBM E;  4DPT A;  1KIJ A;  3Q1Q A;  4FWD A;  5FWK A;  4HAC B;  1FWK A;  4JI3 E;  1FJG I;  4X62 I;  2XEX A;  4Z7C A;  4DPW A;  3OTO I;  1XMQ I;  3QT6 A;  4JI8 E;  4LF8 E;  3GON A;  4P7A A;  3WU6 A;  1USU A;  4B3S E;  4DR6 E;  1FNM A;  4B3M I;  1Y4S A;  4USM A;  3K17 A;  1IBK E;  5FLX C;  1XMO E;  4DV0 I;  3QT8 A;  4OX9 I;  1HR0 I;  2BV3 A;  3PYE A;  1I94 E;  1FWL A;  2Z5B A;  3M6A A;  4B3R E;  4GKK I;  1Z0C A;  1N34 I;  1RRE A;  2BM0 A;  1N36 E;  4DR2 I;  2E5L E;  1N33 E;  3J7A G;  4IZJ A;  1H72 C;  3T1H I;  2WW4 A;  2PNM A;  4LFC I;  1N32 E;  2CGE A;  4JI2 E;  3D4J A;  1XHK A;  1HNW I;  4FWH A;  1PIE A;  4B3T E;  4DV2 I;  4DV3 E;  1UEK A;  4DR1 E;  2F4V I;  2LJP A;  2DEJ A;  1XNR E;  1Z0T A;  4DU8 A;  1EA6 A;  4JYA E;  4YY3 I;  4LF9 I;  1QZR A;  3T1Y E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...