2F4VI

30s ribosome + designer antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vI00
1H7SA 4LF7I 4DPXA 4Z7YA 3K1JA 3JAMC 4JI5E 2DEJA 5IWAI 2VF3A 1KTVA 4X66E 2CZ9A 2ZM6I 1KIJA 1S4EA 1ZM3A 4DR2E 3ZZTA 2UUAE 4JI2E 2E1RA 4B3RE 1BKNA 1MU5A 2VQEE 4DR1E 1ZXMA 3J81Q 3WU6A 3T1HE 4HXZA 1MG7A 3LNUA 4JI3I 4LF8I 2UXDI 4DXLA 2V8PA 1J5EE 2V2ZA 2WW4A 2ZM6E 1IBLI 4JI1E 1NHJA 4DV3E 3WU3A 1ZM2A 1K47A 1Z0VA 4LF6I 4USKA 2GS8A 5BR8I 3QT7A 3PYEA 4DR7I 4KHPI 4P7AA 5LMUI 3CWVA 1N32E 1NZ0A 3QT5A 1XMOI 4LFCE 1N33E 3J7AM 4DPWA 1PKPA 4JI4E 1Z0BA 4DV4I 4DR3I 2ZBKB 4NXMI 4URLA 4JI1I 1KVKA 1D6TA 1H7UA 1NHIA 4DR2I 4DV7I 2UUAI 1KKHA 2HK2A 1QZRA 5FLXC 2R3VA 4DUYI 1RREA 1ZM4A 4DUZE 2A2CA 4HACA 4GKJE 5IT9C 3ZZUA 1Z5CA 4WUDA 4DR5E 4DV2I 2UU9I 2HK3A 1J5EI 1Z0GA 1H74A 1PIEA 3LPSA 1N36I 2AJ4A 3PYFA 2EFGA 4X65E 1EI1A 4DR4I 1FJGE 2J7KA 3ZZ0A 4PU9A 2HFUA 1A6FA 4DUYE 4DR6E 4B3TI 4DV2E 4Z7CA 4X64E 1IBME 3ZM7A 1FNMA 5GMDA 4GKJI 4GKKI 4OX9E 4NXME 4JI8I 4B3SE 1N36E 3GONA 4AQYI 2V2VA 1FKAE 4B3ME 3OTOI 3H4LA 4JV5I 2VQFI 4FN5A 4DR7E 3ZKBA 4DR1I 2HFSA 5IT9Q 4K0KI 1Z0WA 4JI2I 3B8HA 4LFCI 2VQEI 4NXNE 4ED4A 2UUCI 4B3TE 4FWHA 4EMDA 2UXBI 1H73A 1N34I 2X7IA 4DV0I 4HACB 3T1YI 4YHHE 3LTOA 1I94I 4I3HA 4UTGA 4PRXA 4JG4A 1FJGI 3Q1QA 1B62A 1HNWE 1N0VC 1XMQI 4LFAI 4DV6I 4LF6E 1HNZI 4HY1A 3WU5A 4JI4I 1Z0TA 4FW9A 1MX0A 1XMOE 1N33I 2BV3A 4LF9I 1HR0I 4JI5I 5IWAE 4ZVIA 4DV4E 4DR3E 2UXCI 1Z0CA 1N34E 4B3MI 1XNRI 2Q2EB 4DUZI 5LMNE 4JI3E 4LF8E 4X62I 4B3RI 3K17A 3V2UC 2UUBI 2F4VE 1FWLA 4JI7E 1IBMI 4WUCA 5A2QQ 4LFAE 4WUBA 1HNZE 4DV5I 4DR5I 1Z5BA 1HR0E 4LF9E 2V2QA 1IBKE 4YY3I 1Z5AA 4DR4E 3OTOE 4PRVA 4LF5I 2VQFE 1EA6A 4LF4I 2BM0A 4KHPE 4DPYA 2UXCE 4JYAI 1ZXNA 4USMA 5BR8E 3F0NA 1H72C 1FI4A 1FWKA 5A2QC 4OX9I 5L3JA 4YHHI 1I94E 1IBLE 3QT8A 4X64I 4JI7I 2HHHI 1Z0EA 4DV7E 1B63A 4JI8E 4B3SI 1XNRE 4DV1I 1UEKA 1DARA 4K0KE 4DPTA 1S16A 4XTJA 1PVGA 4P52A 4JYAE 2XEXA 3V5RA 3J80Q 4DU7A 4DPUA 2UU9E 4LFBE 1ELOA 3PYGA 1XNQI 2E5LE 4HYMA 4X66I 4DV0E 2A2DA 2X36A 1Z59A 2BM1A 3ZKDA 1WUUA 1U2RA 4DR6I 2F4VI 2V34A 1ZM9A 5GMEA 1XHKA 1XMQE 3M6AA 4GKKE 3JAMQ 4DV5E 1N0UA 2LJPA 1VISA 4LF7E 1IBKI 3B78A 3J80C 4LFBI 4AQYE 4JI0I 4JV5E 4UT4A 4FWGA 2R42A 1OJ4A 4X65I 4MYUA 4X62E 3J7AG 4NXNI 5LMUE 2OI2A 2UUCE 3J81C 1N32I 3WU4A 3B82A 4MYTA 5LL6R 4R1FA 2HHHE 1XNQE 3D4JA 4M1KA 4YY3E 2DEIA 2E5LI 1HNXI 4JI6E 3T1YE 2HKEA 4DV1E 4FWDA 4LF4E 4DV3I 4DU8A 1HNWI 4LF5E 3HULA 3T1HI 2UXDE 1RR9A 2NPFA 3QT6A 2UXBE 4KQVA 4JI0E 4JI6I 1NHHA 2ZITA 4RPFA 5LMNI 5FLXQ 1HNXE 3PYDA 2UUBE 2HKJA 4DV6E
chains in the Genus database with same CATH superfamily
1H7SA 4LF7I 4DPXA 4Z7YA 3K1JA 3JAMC 4JI5E 2DEJA 5IWAI 2VF3A 1KTVA 5DNLA 4X66E 2CZ9A 2JE6B 2ZM6I 5DROA 1KIJA 1S4EA 1ZM3A 5K36F 4FW5A 4LCHA 4DR2E 3ZZTA 2NN6B 2UUAE 4JI2E 1RHYA 2E1RA 4B3RE 1BKNA 1MU5A 2VQEE 3GMEA 3HKMA 4DR1E 1ZXMA 2PO2A 3J81Q 3WU6A 3T1HE 2WP8A 4HXZA 1Y60A 2F1DA 1MG7A 3LNUA 4JI3I 4LF8I 2UXDI 3Q6NA 4DXLA 2V8PA 1J5EE 2V2ZA 4IFDA 2WW4A 4AM3A 2ZM6E 1IBLI 4JI1E 5DRRA 1NHJA 4DV3E 4BA2A 2CVEA 3WU3A 1ZM2A 1K47A 1Z0VA 4LF6I 4BA1A 4USKA 2GS8A 5BR8I 3QT7A 3PYEA 4DR7I 4KHPI 3P3GA 4P7AA 5LMUI 5K36A 3CWVA 1N32E 2JEBB 1NZ0A 3QT5A 1XMOI 4LFCE 1N33E 3J7AM 4DPWA 1PKPA 4JI4E 1Z0BA 4DV4I 4DR3I 2PO1A 2ZBKB 1YH8A 4NXMI 4AIMA 4URLA 4JI1I 1KVKA 1OYSA 1D6TA 1H7UA 1NHIA 4DR2I 4DV7I 4BA2B 2Z5CB 2PNZA 1KKHA 2PO0B 2HK2A 2UUAI 1QZRA 5FLXC 2R3VA 4IZJD 4DUYI 1RREA 1ZM4A 5JEAF 2O1VA 4DUZE 2A2CA 4IFDB 4HACA 5C0XC 3U1YA 4GKJE 5IT9C 3ZZUA 1Z5CA 5EKWA 3L7ZB 4WUDA 4DR5E 4DV2I 2C39A 2UU9I 2HK3A 1J5EI 4IFDC 1Z0GA 1H74A 1PIEA 1Y5YA 3K85A 3LPSA 3UHMA 4OZEA 1N36I 2AJ4A 3PYFA 1Y6ZA 2EFGA 4IZJB 4X65E 1EI1A 2NN6A 5JEAC 1FJGE 4DR4I 2J7KA 3ZZ0A 4PU9A 2HFUA 4LPFA 1A6FA 4FW7A 4DUYE 5C0XE 3CDIA 3PRYA 2JE6A 3Q6MA 2GQ0A 4DR6E 4IFDF 4B3TI 4DV2E 4Z7CA 3P06A 4X64E 2BA0G 1IBME 3ZM7A 1FNMA 5GMDA 2NN6C 5JEAA 4LOMA 4OX9E 4GKJI 4GKKI 4NXME 4JI8I 4B3SE 1YHCA 1Y4UA 4LCGA 1N36E 3GONA 4AQYI 2V2VA 1FKAE 4B3ME 3OTOI 3H4LA 5C0XD 4JV5I 4OO1D 2VQFI 4FN5A 4DR7E 3ZKBA 4DR1I 2HFSA 3M7NG 4ISAA 5IT9Q 4K0KI 1Z0WA 4JI2I 3B8HA 2NN6F 4IZKA 4LFCI 2VQEI 4NXNE 2C39B 4ED4A 3GLLA 2UUCI 4MU1A 4B3TE 4FWHA 4EMDA 2UXBI 1H73A 4OO1F 1N34I 2X7IA 4DV0I 4HACB 4QNJA 3T1YI 4YHHE 3LTOA 1I94I 4I3HA 2IOPA 4UTGA 4PRXA 4JG4A 1R6LA 3PS2A 2PNZB 1FJGI 3Q1QA 1B62A 1HNWE 1N0VC 4IZJA 1XMQI 4N3OA 4MU4A 3H1CA 4FW6A 4LFAI 4MDTA 2JEAB 4DV6I 4LF6E 1HNZI 1USUA 4HY1A 3WU5A 1UDQA 2PO1B 4OO1C 3CDJA 1UDSA 4JI4I 5DRPA 2JEBA 1Z0TA 4FW9A 1MX0A 1XMOE 1N33I 2BV3A 1HR0I 4JI5I 4LF9I 5IWAE 4ZVIA 4DV4E 4DR3E 5EL9A 2UXCI 1Z0CA 1N34E 4B3MI 2PO0A 1XNRI 2Q2EB 4OO1B 3M85G 4OO1A 5DRQA 3PS1A 4DUZI 5LMNE 4OO1E 4JI3E 4LF8E 4X62I 4B3RI 3K17A 2GO4A 3V2UC 2UUBI 2F4VE 1FWLA 2BR2A 1HK7A 4WUCA 4JI7E 5A2QQ 5ELWA 1IBMI 4LFAE 1XXEA 5JEAD 5K36E 4WUBA 2O1WA 1HNZE 4DV5I 1R6MA 4DR5I 1Z5BA 1HR0E 4LF9E 3NZKA 2PO2B 2V2QA 1IBKE 2JEAA 4YY3I 1Z5AA 4DR4E 4AIDA 4PRVA 3OTOE 4BA1B 5C0XA 2O3ZA 2VQFE 4LF5I 3B4TA 1UDOA 2CG9A 1EA6A 4LF4I 2BM0A 4KHPE 5K36C 4DPYA 2UXCE 4JYAI 2GO3A 1ZXNA 4USMA 4NBQA 5BR8E 3F0NA 1H72C 4U3BA 1FI4A 5K36D 3HJCA 1FWKA 3GCMA 5A2QC 4OX9I 4IS9A 5L3JA 4IFDD 4YHHI 1I94E 1IBLE 3QT8A 4X64I 4JI7I 1USVA 2WP8B 2HHHI 4J3DA 2AE8A 1Z0EA 1OYPA 2WNRB 4DV7E 1B63A 2C38A 4JI8E 4B3SI 1XNRE 3DD6A 4DV1I 1UEKA 2C38B 1DARA 4K0KE 4DPTA 1S16A 2WNRA 4XTJA 1UDNA 1PVGA 4P52A 5JEAB 4JYAE 2O1UA 2XEXA 1OYRA 3V5RA 3J80Q 4DU7A 4DPUA 2VESA 5JEAE 3M7ND 2UU9E 4OKGA 4LFBE 1ELOA 3PYGA 1XNQI 2PNLA 2BA1D 2E5LE 4HYMA 4X66I 4DV0E 2A2DA 2X36A 1Z59A 2BM1A 3ZKDA 1WUUA 1U2RA 5C0XB 3KRNA 4DR6I 2BA1G 2F4VI 2V34A 3PS3A 1ZM9A 5GMEA 1XHKA 1XMQE 2CGEA 1E3PA 3M6AA 4MU0A 4GKKE 2C37A 3JAMQ 4DV5E 5C0XF 1N0UA 2LJPA 1VISA 1P42A 2BR2B 3L7ZA 4LF7E 1IBKI 3B78A 3J80C 4LFBI 4IFDE 4AQYE 3P3EA 2IERA 3P76A 4MQYA 4JI0I 2NN6D 4JV5E 4UT4A 4FWGA 4FW3A 2JT2A 2Z5CA 2R42A 2O1TA 1OJ4A 4X65I 1Y4SA 4MYUA 3P3CA 4X62E 2Z5BB 3J7AG 4NXNI 5LMUE 2OI2A 2UUCE 3M85D 3J81C 1N32I 3WU4A 3B82A 4MYTA 5LL6R 4R1FA 2HHHE 1XNQE 3D4JA 5K36B 2NN6E 4M1KA 4YY3E 2DEIA 2E5LI 1HNXI 2Z5BA 3T1YE 4JI6E 2HKEA 4DV1E 4FWDA 4LF4E 4DV3I 4DU8A 2IESA 1HNWI 4LF5E 3HULA 4U3DA 1E3HA 2J65A 3T1HI 2UXDE 5FWKA 1RR9A 2NPFA 2C37B 2Z5EA 4FW4A 4IZKB 3QT6A 2IOQA 3U1KA 1VI7A 2UXBE 4KQVA 4JI0E 4JI6I 1NHHA 2ZITA 4RPFA 4MU3A 5LMNI 5FLXQ 2BA0D 1HNXE 4GQUA 3PYDA 2PNMA 2UUBE 2HKJA 4QNKA 4LCFA 5DNXA 4DV6E
chains in the Genus database with same CATH topology
1H7SA 4LF7I 4DPXA 4Z7YA 3K1JA 3JAMC 4JI5E 2DEJA 5IWAI 2VF3A 1KTVA 4X66E 2CZ9A 2ZM6I 1KIJA 1S4EA 1ZM3A 4DR2E 3ZZTA 2UUAE 4JI2E 2E1RA 4B3RE 1BKNA 1MU5A 2VQEE 4DR1E 1ZXMA 3J81Q 3WU6A 3T1HE 4HXZA 1MG7A 3LNUA 4JI3I 4LF8I 2UXDI 3Q6NA 4DXLA 2V8PA 1J5EE 2V2ZA 2WW4A 2ZM6E 1IBLI 4JI1E 1NHJA 4DV3E 3WU3A 1ZM2A 1K47A 1Z0VA 4LF6I 4USKA 2GS8A 5BR8I 3QT7A 3PYEA 4DR7I 4KHPI 4P7AA 5LMUI 3CWVA 1N32E 1NZ0A 3QT5A 1XMOI 4LFCE 1N33E 3J7AM 4DPWA 1PKPA 4JI4E 1Z0BA 4DV4I 4DR3I 2ZBKB 4NXMI 4URLA 4JI1I 1KVKA 1D6TA 1H7UA 1NHIA 4DR2I 4DV7I 2Z5CB 2UUAI 1KKHA 2HK2A 1QZRA 5FLXC 2R3VA 4IZJD 4DUYI 1RREA 1ZM4A 2O1VA 4DUZE 2A2CA 4HACA 4GKJE 5IT9C 3ZZUA 1Z5CA 4WUDA 4DR5E 4DV2I 2UU9I 2HK3A 1J5EI 1Z0GA 1H74A 1PIEA 3K85A 3LPSA 1N36I 2AJ4A 3PYFA 1Y6ZA 2EFGA 4IZJB 4X65E 1EI1A 4DR4I 1FJGE 2J7KA 3ZZ0A 4PU9A 2HFUA 1A6FA 4DUYE 3PRYA 3Q6MA 2GQ0A 4DR6E 4B3TI 4DV2E 4Z7CA 3P06A 4X64E 1IBME 3ZM7A 1FNMA 5GMDA 4GKJI 4GKKI 4OX9E 4NXME 4JI8I 4B3SE 1Y4UA 1N36E 3GONA 4AQYI 2V2VA 1FKAE 4B3ME 3OTOI 3H4LA 4JV5I 2VQFI 4FN5A 4DR7E 3ZKBA 4DR1I 2HFSA 5IT9Q 4K0KI 1Z0WA 4JI2I 3B8HA 4IZKA 4LFCI 2VQEI 4NXNE 4ED4A 2UUCI 4B3TE 4FWHA 4EMDA 2UXBI 1H73A 1N34I 2X7IA 4DV0I 4HACB 3T1YI 4YHHE 3LTOA 1I94I 4I3HA 2IOPA 4UTGA 4PRXA 4JG4A 1FJGI 3Q1QA 1B62A 1HNWE 1N0VC 4IZJA 1XMQI 4N3OA 4LFAI 4DV6I 4LF6E 1HNZI 1USUA 4HY1A 3WU5A 4JI4I 1Z0TA 4FW9A 1MX0A 1XMOE 1N33I 2BV3A 1HR0I 4JI5I 4LF9I 5IWAE 4ZVIA 4DV4E 4DR3E 2UXCI 1Z0CA 1N34E 4B3MI 1XNRI 2Q2EB 4DUZI 5LMNE 4JI3E 4LF8E 4X62I 4B3RI 3K17A 3V2UC 2UUBI 2F4VE 1FWLA 4JI7E 1HK7A 4WUCA 1IBMI 5A2QQ 4LFAE 4WUBA 2O1WA 1HNZE 4DV5I 4DR5I 1Z5BA 1HR0E 4LF9E 2V2QA 1IBKE 4YY3I 1Z5AA 4DR4E 3OTOE 4PRVA 4LF5I 2VQFE 2CG9A 1EA6A 4LF4I 2BM0A 4KHPE 4DPYA 2UXCE 4JYAI 1ZXNA 4USMA 5BR8E 3F0NA 1H72C 1FI4A 3HJCA 1FWKA 5A2QC 4OX9I 5L3JA 4YHHI 1I94E 1IBLE 3QT8A 4X64I 4JI7I 1USVA 2HHHI 1Z0EA 4DV7E 1B63A 4JI8E 4B3SI 1XNRE 4DV1I 1UEKA 1DARA 4K0KE 4DPTA 1S16A 4XTJA 1PVGA 4P52A 4JYAE 2O1UA 2XEXA 3V5RA 3J80Q 4DU7A 4DPUA 2UU9E 4LFBE 1ELOA 3PYGA 1XNQI 2PNLA 2E5LE 4HYMA 4X66I 4DV0E 2A2DA 2X36A 1Z59A 2BM1A 3ZKDA 1WUUA 1U2RA 4DR6I 2F4VI 2V34A 1ZM9A 5GMEA 1XHKA 1XMQE 2CGEA 3M6AA 4GKKE 3JAMQ 4DV5E 1N0UA 2LJPA 1VISA 4LF7E 1IBKI 3B78A 3J80C 4LFBI 4AQYE 4JI0I 4JV5E 4UT4A 4FWGA 2Z5CA 2R42A 2O1TA 1OJ4A 4X65I 1Y4SA 4MYUA 4X62E 2Z5BB 3J7AG 4NXNI 5LMUE 2OI2A 2UUCE 3J81C 1N32I 3WU4A 3B82A 4MYTA 5LL6R 4R1FA 2HHHE 1XNQE 3D4JA 4M1KA 4YY3E 2DEIA 2E5LI 1HNXI 2Z5BA 3T1YE 4JI6E 2HKEA 4DV1E 4FWDA 4LF4E 4DV3I 4DU8A 1HNWI 4LF5E 3HULA 3T1HI 2UXDE 5FWKA 1RR9A 2NPFA 2Z5EA 4IZKB 3QT6A 2IOQA 2UXBE 4KQVA 4JI0E 4JI6I 1NHHA 2ZITA 4RPFA 5LMNI 5FLXQ 1HNXE 3PYDA 2PNMA 2UUBE 2HKJA 4DV6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7S A;  4LF7 I;  4DPX A;  4Z7Y A;  3K1J A;  3JAM C;  4JI5 E;  2DEJ A;  5IWA I;  2VF3 A;  1KTV A;  4X66 E;  2CZ9 A;  2ZM6 I;  1KIJ A;  1S4E A;  1ZM3 A;  4DR2 E;  3ZZT A;  2UUA E;  4JI2 E;  2E1R A;  4B3R E;  1BKN A;  1MU5 A;  2VQE E;  4DR1 E;  1ZXM A;  3J81 Q;  3WU6 A;  3T1H E;  4HXZ A;  1MG7 A;  3LNU A;  4JI3 I;  4LF8 I;  2UXD I;  4DXL A;  2V8P A;  1J5E E;  2V2Z A;  2WW4 A;  2ZM6 E;  1IBL I;  4JI1 E;  1NHJ A;  4DV3 E;  3WU3 A;  1ZM2 A;  1K47 A;  1Z0V A;  4LF6 I;  4USK A;  2GS8 A;  5BR8 I;  3QT7 A;  3PYE A;  4DR7 I;  4KHP I;  4P7A A;  5LMU I;  3CWV A;  1N32 E;  1NZ0 A;  3QT5 A;  1XMO I;  4LFC E;  1N33 E;  3J7A M;  4DPW A;  1PKP A;  4JI4 E;  1Z0B A;  4DV4 I;  4DR3 I;  2ZBK B;  4NXM I;  4URL A;  4JI1 I;  1KVK A;  1D6T A;  1H7U A;  1NHI A;  4DR2 I;  4DV7 I;  2UUA I;  1KKH A;  2HK2 A;  1QZR A;  5FLX C;  2R3V A;  4DUY I;  1RRE A;  1ZM4 A;  4DUZ E;  2A2C A;  4HAC A;  4GKJ E;  5IT9 C;  3ZZU A;  1Z5C A;  4WUD A;  4DR5 E;  4DV2 I;  2UU9 I;  2HK3 A;  1J5E I;  1Z0G A;  1H74 A;  1PIE A;  3LPS A;  1N36 I;  2AJ4 A;  3PYF A;  2EFG A;  4X65 E;  1EI1 A;  4DR4 I;  1FJG E;  2J7K A;  3ZZ0 A;  4PU9 A;  2HFU A;  1A6F A;  4DUY E;  4DR6 E;  4B3T I;  4DV2 E;  4Z7C A;  4X64 E;  1IBM E;  3ZM7 A;  1FNM A;  5GMD A;  4GKJ I;  4GKK I;  4OX9 E;  4NXM E;  4JI8 I;  4B3S E;  1N36 E;  3GON A;  4AQY I;  2V2V A;  1FKA E;  4B3M E;  3OTO I;  3H4L A;  4JV5 I;  2VQF I;  4FN5 A;  4DR7 E;  3ZKB A;  4DR1 I;  2HFS A;  5IT9 Q;  4K0K I;  1Z0W A;  4JI2 I;  3B8H A;  4LFC I;  2VQE I;  4NXN E;  4ED4 A;  2UUC I;  4B3T E;  4FWH A;  4EMD A;  2UXB I;  1H73 A;  1N34 I;  2X7I A;  4DV0 I;  4HAC B;  3T1Y I;  4YHH E;  3LTO A;  1I94 I;  4I3H A;  4UTG A;  4PRX A;  4JG4 A;  1FJG I;  3Q1Q A;  1B62 A;  1HNW E;  1N0V C;  1XMQ I;  4LFA I;  4DV6 I;  4LF6 E;  1HNZ I;  4HY1 A;  3WU5 A;  4JI4 I;  1Z0T A;  4FW9 A;  1MX0 A;  1XMO E;  1N33 I;  2BV3 A;  4LF9 I;  1HR0 I;  4JI5 I;  5IWA E;  4ZVI A;  4DV4 E;  4DR3 E;  2UXC I;  1Z0C A;  1N34 E;  4B3M I;  1XNR I;  2Q2E B;  4DUZ I;  5LMN E;  4JI3 E;  4LF8 E;  4X62 I;  4B3R I;  3K17 A;  3V2U C;  2UUB I;  2F4V E;  1FWL A;  4JI7 E;  1IBM I;  4WUC A;  5A2Q Q;  4LFA E;  4WUB A;  1HNZ E;  4DV5 I;  4DR5 I;  1Z5B A;  1HR0 E;  4LF9 E;  2V2Q A;  1IBK E;  4YY3 I;  1Z5A A;  4DR4 E;  3OTO E;  4PRV A;  4LF5 I;  2VQF E;  1EA6 A;  4LF4 I;  2BM0 A;  4KHP E;  4DPY A;  2UXC E;  4JYA I;  1ZXN A;  4USM A;  5BR8 E;  3F0N A;  1H72 C;  1FI4 A;  1FWK A;  5A2Q C;  4OX9 I;  5L3J A;  4YHH I;  1I94 E;  1IBL E;  3QT8 A;  4X64 I;  4JI7 I;  2HHH I;  1Z0E A;  4DV7 E;  1B63 A;  4JI8 E;  4B3S I;  1XNR E;  4DV1 I;  1UEK A;  1DAR A;  4K0K E;  4DPT A;  1S16 A;  4XTJ A;  1PVG A;  4P52 A;  4JYA E;  2XEX A;  3V5R A;  3J80 Q;  4DU7 A;  4DPU A;  2UU9 E;  4LFB E;  1ELO A;  3PYG A;  1XNQ I;  2E5L E;  4HYM A;  4X66 I;  4DV0 E;  2A2D A;  2X36 A;  1Z59 A;  2BM1 A;  3ZKD A;  1WUU A;  1U2R A;  4DR6 I;  2F4V I;  2V34 A;  1ZM9 A;  5GME A;  1XHK A;  1XMQ E;  3M6A A;  4GKK E;  3JAM Q;  4DV5 E;  1N0U A;  2LJP A;  1VIS A;  4LF7 E;  1IBK I;  3B78 A;  3J80 C;  4LFB I;  4AQY E;  4JI0 I;  4JV5 E;  4UT4 A;  4FWG A;  2R42 A;  1OJ4 A;  4X65 I;  4MYU A;  4X62 E;  3J7A G;  4NXN I;  5LMU E;  2OI2 A;  2UUC E;  3J81 C;  1N32 I;  3WU4 A;  3B82 A;  4MYT A;  5LL6 R;  4R1F A;  2HHH E;  1XNQ E;  3D4J A;  4M1K A;  4YY3 E;  2DEI A;  2E5L I;  1HNX I;  4JI6 E;  3T1Y E;  2HKE A;  4DV1 E;  4FWD A;  4LF4 E;  4DV3 I;  4DU8 A;  1HNW I;  4LF5 E;  3HUL A;  3T1H I;  2UXD E;  1RR9 A;  2NPF A;  3QT6 A;  2UXB E;  4KQV A;  4JI0 E;  4JI6 I;  1NHH A;  2ZIT A;  4RPF A;  5LMN I;  5FLX Q;  1HNX E;  3PYD A;  2UUB E;  2HKJ A;  4DV6 E; 
#chains in the Genus database with same CATH topology
 1H7S A;  4LF7 I;  4DPX A;  4Z7Y A;  3K1J A;  3JAM C;  4JI5 E;  2DEJ A;  5IWA I;  2VF3 A;  1KTV A;  5DNL A;  4X66 E;  2CZ9 A;  2JE6 B;  2ZM6 I;  5DRO A;  1KIJ A;  1S4E A;  1ZM3 A;  5K36 F;  4FW5 A;  4LCH A;  4DR2 E;  3ZZT A;  2NN6 B;  2UUA E;  4JI2 E;  1RHY A;  2E1R A;  4B3R E;  1BKN A;  1MU5 A;  2VQE E;  3GME A;  3HKM A;  4DR1 E;  1ZXM A;  2PO2 A;  3J81 Q;  3WU6 A;  3T1H E;  2WP8 A;  4HXZ A;  1Y60 A;  2F1D A;  1MG7 A;  3LNU A;  4JI3 I;  4LF8 I;  2UXD I;  3Q6N A;  4DXL A;  2V8P A;  1J5E E;  2V2Z A;  4IFD A;  2WW4 A;  4AM3 A;  2ZM6 E;  1IBL I;  4JI1 E;  5DRR A;  1NHJ A;  4DV3 E;  4BA2 A;  2CVE A;  3WU3 A;  1ZM2 A;  1K47 A;  1Z0V A;  4LF6 I;  4BA1 A;  4USK A;  2GS8 A;  5BR8 I;  3QT7 A;  3PYE A;  4DR7 I;  4KHP I;  3P3G A;  4P7A A;  5LMU I;  5K36 A;  3CWV A;  1N32 E;  2JEB B;  1NZ0 A;  3QT5 A;  1XMO I;  4LFC E;  1N33 E;  3J7A M;  4DPW A;  1PKP A;  4JI4 E;  1Z0B A;  4DV4 I;  4DR3 I;  2PO1 A;  2ZBK B;  1YH8 A;  4NXM I;  4AIM A;  4URL A;  4JI1 I;  1KVK A;  1OYS A;  1D6T A;  1H7U A;  1NHI A;  4DR2 I;  4DV7 I;  4BA2 B;  2Z5C B;  2PNZ A;  1KKH A;  2PO0 B;  2HK2 A;  2UUA I;  1QZR A;  5FLX C;  2R3V A;  4IZJ D;  4DUY I;  1RRE A;  1ZM4 A;  5JEA F;  2O1V A;  4DUZ E;  2A2C A;  4IFD B;  4HAC A;  5C0X C;  3U1Y A;  4GKJ E;  5IT9 C;  3ZZU A;  1Z5C A;  5EKW A;  3L7Z B;  4WUD A;  4DR5 E;  4DV2 I;  2C39 A;  2UU9 I;  2HK3 A;  1J5E I;  4IFD C;  1Z0G A;  1H74 A;  1PIE A;  1Y5Y A;  3K85 A;  3LPS A;  3UHM A;  4OZE A;  1N36 I;  2AJ4 A;  3PYF A;  1Y6Z A;  2EFG A;  4IZJ B;  4X65 E;  1EI1 A;  2NN6 A;  5JEA C;  1FJG E;  4DR4 I;  2J7K A;  3ZZ0 A;  4PU9 A;  2HFU A;  4LPF A;  1A6F A;  4FW7 A;  4DUY E;  5C0X E;  3CDI A;  3PRY A;  2JE6 A;  3Q6M A;  2GQ0 A;  4DR6 E;  4IFD F;  4B3T I;  4DV2 E;  4Z7C A;  3P06 A;  4X64 E;  2BA0 G;  1IBM E;  3ZM7 A;  1FNM A;  5GMD A;  2NN6 C;  5JEA A;  4LOM A;  4OX9 E;  4GKJ I;  4GKK I;  4NXM E;  4JI8 I;  4B3S E;  1YHC A;  1Y4U A;  4LCG A;  1N36 E;  3GON A;  4AQY I;  2V2V A;  1FKA E;  4B3M E;  3OTO I;  3H4L A;  5C0X D;  4JV5 I;  4OO1 D;  2VQF I;  4FN5 A;  4DR7 E;  3ZKB A;  4DR1 I;  2HFS A;  3M7N G;  4ISA A;  5IT9 Q;  4K0K I;  1Z0W A;  4JI2 I;  3B8H A;  2NN6 F;  4IZK A;  4LFC I;  2VQE I;  4NXN E;  2C39 B;  4ED4 A;  3GLL A;  2UUC I;  4MU1 A;  4B3T E;  4FWH A;  4EMD A;  2UXB I;  1H73 A;  4OO1 F;  1N34 I;  2X7I A;  4DV0 I;  4HAC B;  4QNJ A;  3T1Y I;  4YHH E;  3LTO A;  1I94 I;  4I3H A;  2IOP A;  4UTG A;  4PRX A;  4JG4 A;  1R6L A;  3PS2 A;  2PNZ B;  1FJG I;  3Q1Q A;  1B62 A;  1HNW E;  1N0V C;  4IZJ A;  1XMQ I;  4N3O A;  4MU4 A;  3H1C A;  4FW6 A;  4LFA I;  4MDT A;  2JEA B;  4DV6 I;  4LF6 E;  1HNZ I;  1USU A;  4HY1 A;  3WU5 A;  1UDQ A;  2PO1 B;  4OO1 C;  3CDJ A;  1UDS A;  4JI4 I;  5DRP A;  2JEB A;  1Z0T A;  4FW9 A;  1MX0 A;  1XMO E;  1N33 I;  2BV3 A;  1HR0 I;  4JI5 I;  4LF9 I;  5IWA E;  4ZVI A;  4DV4 E;  4DR3 E;  5EL9 A;  2UXC I;  1Z0C A;  1N34 E;  4B3M I;  2PO0 A;  1XNR I;  2Q2E B;  4OO1 B;  3M85 G;  4OO1 A;  5DRQ A;  3PS1 A;  4DUZ I;  5LMN E;  4OO1 E;  4JI3 E;  4LF8 E;  4X62 I;  4B3R I;  3K17 A;  2GO4 A;  3V2U C;  2UUB I;  2F4V E;  1FWL A;  2BR2 A;  1HK7 A;  4WUC A;  4JI7 E;  5A2Q Q;  5ELW A;  1IBM I;  4LFA E;  1XXE A;  5JEA D;  5K36 E;  4WUB A;  2O1W A;  1HNZ E;  4DV5 I;  1R6M A;  4DR5 I;  1Z5B A;  1HR0 E;  4LF9 E;  3NZK A;  2PO2 B;  2V2Q A;  1IBK E;  2JEA A;  4YY3 I;  1Z5A A;  4DR4 E;  4AID A;  4PRV A;  3OTO E;  4BA1 B;  5C0X A;  2O3Z A;  2VQF E;  4LF5 I;  3B4T A;  1UDO A;  2CG9 A;  1EA6 A;  4LF4 I;  2BM0 A;  4KHP E;  5K36 C;  4DPY A;  2UXC E;  4JYA I;  2GO3 A;  1ZXN A;  4USM A;  4NBQ A;  5BR8 E;  3F0N A;  1H72 C;  4U3B A;  1FI4 A;  5K36 D;  3HJC A;  1FWK A;  3GCM A;  5A2Q C;  4OX9 I;  4IS9 A;  5L3J A;  4IFD D;  4YHH I;  1I94 E;  1IBL E;  3QT8 A;  4X64 I;  4JI7 I;  1USV A;  2WP8 B;  2HHH I;  4J3D A;  2AE8 A;  1Z0E A;  1OYP A;  2WNR B;  4DV7 E;  1B63 A;  2C38 A;  4JI8 E;  4B3S I;  1XNR E;  3DD6 A;  4DV1 I;  1UEK A;  2C38 B;  1DAR A;  4K0K E;  4DPT A;  1S16 A;  2WNR A;  4XTJ A;  1UDN A;  1PVG A;  4P52 A;  5JEA B;  4JYA E;  2O1U A;  2XEX A;  1OYR A;  3V5R A;  3J80 Q;  4DU7 A;  4DPU A;  2VES A;  5JEA E;  3M7N D;  2UU9 E;  4OKG A;  4LFB E;  1ELO A;  3PYG A;  1XNQ I;  2PNL A;  2BA1 D;  2E5L E;  4HYM A;  4X66 I;  4DV0 E;  2A2D A;  2X36 A;  1Z59 A;  2BM1 A;  3ZKD A;  1WUU A;  1U2R A;  5C0X B;  3KRN A;  4DR6 I;  2BA1 G;  2F4V I;  2V34 A;  3PS3 A;  1ZM9 A;  5GME A;  1XHK A;  1XMQ E;  2CGE A;  1E3P A;  3M6A A;  4MU0 A;  4GKK E;  2C37 A;  3JAM Q;  4DV5 E;  5C0X F;  1N0U A;  2LJP A;  1VIS A;  1P42 A;  2BR2 B;  3L7Z A;  4LF7 E;  1IBK I;  3B78 A;  3J80 C;  4LFB I;  4IFD E;  4AQY E;  3P3E A;  2IER A;  3P76 A;  4MQY A;  4JI0 I;  2NN6 D;  4JV5 E;  4UT4 A;  4FWG A;  4FW3 A;  2JT2 A;  2Z5C A;  2R42 A;  2O1T A;  1OJ4 A;  4X65 I;  1Y4S A;  4MYU A;  3P3C A;  4X62 E;  2Z5B B;  3J7A G;  4NXN I;  5LMU E;  2OI2 A;  2UUC E;  3M85 D;  3J81 C;  1N32 I;  3WU4 A;  3B82 A;  4MYT A;  5LL6 R;  4R1F A;  2HHH E;  1XNQ E;  3D4J A;  5K36 B;  2NN6 E;  4M1K A;  4YY3 E;  2DEI A;  2E5L I;  1HNX I;  2Z5B A;  3T1Y E;  4JI6 E;  2HKE A;  4DV1 E;  4FWD A;  4LF4 E;  4DV3 I;  4DU8 A;  2IES A;  1HNW I;  4LF5 E;  3HUL A;  4U3D A;  1E3H A;  2J65 A;  3T1H I;  2UXD E;  5FWK A;  1RR9 A;  2NPF A;  2C37 B;  2Z5E A;  4FW4 A;  4IZK B;  3QT6 A;  2IOQ A;  3U1K A;  1VI7 A;  2UXB E;  4KQV A;  4JI0 E;  4JI6 I;  1NHH A;  2ZIT A;  4RPF A;  4MU3 A;  5LMN I;  5FLX Q;  2BA0 D;  1HNX E;  4GQU A;  3PYD A;  2PNM A;  2UUB E;  2HKJ A;  4QNK A;  4LCF A;  5DNX A;  4DV6 E; 
#chains in the Genus database with same CATH homology
 1H7S A;  4LF7 I;  4DPX A;  4Z7Y A;  3K1J A;  3JAM C;  4JI5 E;  2DEJ A;  5IWA I;  2VF3 A;  1KTV A;  4X66 E;  2CZ9 A;  2ZM6 I;  1KIJ A;  1S4E A;  1ZM3 A;  4DR2 E;  3ZZT A;  2UUA E;  4JI2 E;  2E1R A;  4B3R E;  1BKN A;  1MU5 A;  2VQE E;  4DR1 E;  1ZXM A;  3J81 Q;  3WU6 A;  3T1H E;  4HXZ A;  1MG7 A;  3LNU A;  4JI3 I;  4LF8 I;  2UXD I;  3Q6N A;  4DXL A;  2V8P A;  1J5E E;  2V2Z A;  2WW4 A;  2ZM6 E;  1IBL I;  4JI1 E;  1NHJ A;  4DV3 E;  3WU3 A;  1ZM2 A;  1K47 A;  1Z0V A;  4LF6 I;  4USK A;  2GS8 A;  5BR8 I;  3QT7 A;  3PYE A;  4DR7 I;  4KHP I;  4P7A A;  5LMU I;  3CWV A;  1N32 E;  1NZ0 A;  3QT5 A;  1XMO I;  4LFC E;  1N33 E;  3J7A M;  4DPW A;  1PKP A;  4JI4 E;  1Z0B A;  4DV4 I;  4DR3 I;  2ZBK B;  4NXM I;  4URL A;  4JI1 I;  1KVK A;  1D6T A;  1H7U A;  1NHI A;  4DR2 I;  4DV7 I;  2Z5C B;  2UUA I;  1KKH A;  2HK2 A;  1QZR A;  5FLX C;  2R3V A;  4IZJ D;  4DUY I;  1RRE A;  1ZM4 A;  2O1V A;  4DUZ E;  2A2C A;  4HAC A;  4GKJ E;  5IT9 C;  3ZZU A;  1Z5C A;  4WUD A;  4DR5 E;  4DV2 I;  2UU9 I;  2HK3 A;  1J5E I;  1Z0G A;  1H74 A;  1PIE A;  3K85 A;  3LPS A;  1N36 I;  2AJ4 A;  3PYF A;  1Y6Z A;  2EFG A;  4IZJ B;  4X65 E;  1EI1 A;  4DR4 I;  1FJG E;  2J7K A;  3ZZ0 A;  4PU9 A;  2HFU A;  1A6F A;  4DUY E;  3PRY A;  3Q6M A;  2GQ0 A;  4DR6 E;  4B3T I;  4DV2 E;  4Z7C A;  3P06 A;  4X64 E;  1IBM E;  3ZM7 A;  1FNM A;  5GMD A;  4GKJ I;  4GKK I;  4OX9 E;  4NXM E;  4JI8 I;  4B3S E;  1Y4U A;  1N36 E;  3GON A;  4AQY I;  2V2V A;  1FKA E;  4B3M E;  3OTO I;  3H4L A;  4JV5 I;  2VQF I;  4FN5 A;  4DR7 E;  3ZKB A;  4DR1 I;  2HFS A;  5IT9 Q;  4K0K I;  1Z0W A;  4JI2 I;  3B8H A;  4IZK A;  4LFC I;  2VQE I;  4NXN E;  4ED4 A;  2UUC I;  4B3T E;  4FWH A;  4EMD A;  2UXB I;  1H73 A;  1N34 I;  2X7I A;  4DV0 I;  4HAC B;  3T1Y I;  4YHH E;  3LTO A;  1I94 I;  4I3H A;  2IOP A;  4UTG A;  4PRX A;  4JG4 A;  1FJG I;  3Q1Q A;  1B62 A;  1HNW E;  1N0V C;  4IZJ A;  1XMQ I;  4N3O A;  4LFA I;  4DV6 I;  4LF6 E;  1HNZ I;  1USU A;  4HY1 A;  3WU5 A;  4JI4 I;  1Z0T A;  4FW9 A;  1MX0 A;  1XMO E;  1N33 I;  2BV3 A;  1HR0 I;  4JI5 I;  4LF9 I;  5IWA E;  4ZVI A;  4DV4 E;  4DR3 E;  2UXC I;  1Z0C A;  1N34 E;  4B3M I;  1XNR I;  2Q2E B;  4DUZ I;  5LMN E;  4JI3 E;  4LF8 E;  4X62 I;  4B3R I;  3K17 A;  3V2U C;  2UUB I;  2F4V E;  1FWL A;  4JI7 E;  1HK7 A;  4WUC A;  1IBM I;  5A2Q Q;  4LFA E;  4WUB A;  2O1W A;  1HNZ E;  4DV5 I;  4DR5 I;  1Z5B A;  1HR0 E;  4LF9 E;  2V2Q A;  1IBK E;  4YY3 I;  1Z5A A;  4DR4 E;  3OTO E;  4PRV A;  4LF5 I;  2VQF E;  2CG9 A;  1EA6 A;  4LF4 I;  2BM0 A;  4KHP E;  4DPY A;  2UXC E;  4JYA I;  1ZXN A;  4USM A;  5BR8 E;  3F0N A;  1H72 C;  1FI4 A;  3HJC A;  1FWK A;  5A2Q C;  4OX9 I;  5L3J A;  4YHH I;  1I94 E;  1IBL E;  3QT8 A;  4X64 I;  4JI7 I;  1USV A;  2HHH I;  1Z0E A;  4DV7 E;  1B63 A;  4JI8 E;  4B3S I;  1XNR E;  4DV1 I;  1UEK A;  1DAR A;  4K0K E;  4DPT A;  1S16 A;  4XTJ A;  1PVG A;  4P52 A;  4JYA E;  2O1U A;  2XEX A;  3V5R A;  3J80 Q;  4DU7 A;  4DPU A;  2UU9 E;  4LFB E;  1ELO A;  3PYG A;  1XNQ I;  2PNL A;  2E5L E;  4HYM A;  4X66 I;  4DV0 E;  2A2D A;  2X36 A;  1Z59 A;  2BM1 A;  3ZKD A;  1WUU A;  1U2R A;  4DR6 I;  2F4V I;  2V34 A;  1ZM9 A;  5GME A;  1XHK A;  1XMQ E;  2CGE A;  3M6A A;  4GKK E;  3JAM Q;  4DV5 E;  1N0U A;  2LJP A;  1VIS A;  4LF7 E;  1IBK I;  3B78 A;  3J80 C;  4LFB I;  4AQY E;  4JI0 I;  4JV5 E;  4UT4 A;  4FWG A;  2Z5C A;  2R42 A;  2O1T A;  1OJ4 A;  4X65 I;  1Y4S A;  4MYU A;  4X62 E;  2Z5B B;  3J7A G;  4NXN I;  5LMU E;  2OI2 A;  2UUC E;  3J81 C;  1N32 I;  3WU4 A;  3B82 A;  4MYT A;  5LL6 R;  4R1F A;  2HHH E;  1XNQ E;  3D4J A;  4M1K A;  4YY3 E;  2DEI A;  2E5L I;  1HNX I;  2Z5B A;  3T1Y E;  4JI6 E;  2HKE A;  4DV1 E;  4FWD A;  4LF4 E;  4DV3 I;  4DU8 A;  1HNW I;  4LF5 E;  3HUL A;  3T1H I;  2UXD E;  5FWK A;  1RR9 A;  2NPF A;  2Z5E A;  4IZK B;  3QT6 A;  2IOQ A;  2UXB E;  4KQV A;  4JI0 E;  4JI6 I;  1NHH A;  2ZIT A;  4RPF A;  5LMN I;  5FLX Q;  1HNX E;  3PYD A;  2PNM A;  2UUB E;  2HKJ A;  4DV6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...