2F4VI

30s ribosome + designer antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vI00
4JI8I 1KVKA 5FLXC 4LF7E 2V2VA 1FWLA 1MU5A 4UT4A 3CWVA 1N0VC 4DR7E 3QT8A 4B3TI 1XMOE 4WUCA 4DV5E 4DV7I 4DR1E 3ZKBA 1ELOA 1XMQE 3WU5A 4XTJA 4JI7E 4X64E 2ZITA 1HNXE 3PYFA 3T1YE 5BR8E 4DR7I 1NHIA 3JAMQ 4HACA 1XMOI 2F4VE 4DV3E 4DV5I 1Z5AA 2ZBKB 4DR1I 5L3JA 1N36E 4NXNE 4HYMA 2HK2A 4HXZA 4MYUA 4OX9E 1ZM4A 1N34E 1XMQI 4DV1E 4X64I 1Z59A 4JI7I 4B3SE 1HNXI 2DEJA 4LF8E 4LFCE 3K17A 2AJ4A 3T1YI 5BR8I 1S4EA 2F4VI 4DV3I 4DR5E 4DUYE 1N36I 4NXNI 1H7UA 2VQEE 4OX9I 3OTOE 4JV5E 1ZM9A 5FLXQ 4DV1I 4B3SI 1PKPA 1Z0EA 4LFCI 4WUDA 3QT6A 1FKAE 1MG7A 1FI4A 4RPFA 4DR5I 4AQYE 4DUYI 4DPYA 4JI0E 2VQEI 3OTOI 3JAMC 1Z0TA 2HKEA 2CZ9A 1KKHA 2BM1A 2V2QA 2UUAE 4FWHA 4AQYI 4Z7YA 2VQFE 1WUUA 4PU9A 4X62E 4JI0I 4X65E 1FWKA 5LL6R 1ZM3A 4DV7E 2UUAI 1UEKA 4DV2E 3QT7A 4JI3E 4I3HA 3J7AM 4LF9I 2VQFI 2E1RA 4X62I 1KIJA 1ZM2A 4LF5E 1Z0GA 4X65I 4B3ME 4FN5A 4GKKE 3ZKDA 4JYAE 1N33I 3J7AG 1H72C 3HULA 5IWAE 2V8PA 1H73A 4FWGA 3LTOA 1NHJA 4DV2I 4JI3I 4DR4E 4URLA 4DUZE 1ZXNA 1HNWE 4LF5I 2BV3A 4B3MI 4GKKI 4DR2E 4NXME 2HK3A 4JYAI 5IWAI 4FW9A 2NPFA 2HKJA 3PYEA 4DR4I 4JI2E 4DUZI 5LMUE 3V5RA 1HNWI 4DV6E 2HHHE 4HACB 4DR2I 4NXMI 2WW4A 1RR9A 2HFSA 1QZRA 4P7AA 2UXBE 1N32E 3B78A 2V2ZA 4JI2I 3J81Q 3H4LA 5LMUI 4DV4E 2UUBE 4KHPE 1BKNA 4DV6I 3WU4A 2HHHI 1N0UA 4DV0I 2X36A 4USKA 4JI1I 4PRVA 3PYGA 1IBKE 1ZXMA 2UUCE 2J7KA 4Z7CA 1I94E 4YY3E 2UXBI 1U2RA 1N32I 3K1JA 4ZVIA 4P52A 4HY1A 4DV4I 3T1HE 2UUBI 4DU8A 4KHPI 2UU9E 1XNQE 1J5EE 3B82A 1MX0A 4JI5I 1IBKI 3GONA 2UUCI 4JI4E 2XEXA 4DPWA 4YHHI 4LF6E 4LF9E 2A2CA 1I94I 4YY3I 2E5LE 4DU7A 4JI6E 1XNRI 1H7SA 3T1HI 1N33E 3Q1QA 1HNZE 2UU9I 1XNQI 2HFUA 1A6FA 1DARA 1J5EI 1Z0VA 3J81C 4M1KA 1NHHA 5A2QQ 4JI4I 4DPXA 3LNUA 2LJPA 1EA6A 4LF6I 4GKJI 3PYDA 2R42A 3J80C 2E5LI 3LPSA 4UTGA 4JI6I 3QT5A 1HNZI 2GS8A 4R1FA 3B8HA 4LF4E 1K47A 5GMDA 4ED4A 2UXCI 1KTVA 1OJ4A 5IT9C 5LMNE 1EI1A 4KQVA 2A2DA 1PVGA 1B63A 3D4JA 4LF7I 1D6TA 4LF4I 1B62A 3ZZTA 5LMNI 4DV0E 1IBLE 1HR0E 4DR3E 4JI1E 3M6AA 5A2QC 4DR6E 2ZM6E 2DEIA 1NZ0A 2VF3A 4EMDA 1Z0CA 2UXDE 1Z5CA 3ZZ0A 4B3RE 1FJGE 3ZZUA 3V2UC 1IBLI 4LFBE 2X7IA 1HR0I 1Z5BA 3J80Q 1FNMA 4JG4A 4DR3I 4LFAE 4DR6I 4USMA 4JI5E 1IBME 1H74A 2R3VA 2ZM6I 4YHHE 4WUBA 1Z0WA 2UXDI 1N34I 1XNRE 4LF8I 4FWDA 4DPTA 4B3RI 4K0KE 5IT9Q 1FJGI 4LFBI 3WU6A 4X66E 2EFGA 4DXLA 1Z0BA 4LFAI 1IBMI 4GKJE 2Q2EB 4JV5I 4MYTA 4K0KI 1VISA 4JI8E 4X66I 1PIEA 3ZM7A 4PRXA 2BM0A 2UXCE 1S16A 2V34A 4DPUA 5GMEA 1XHKA 4B3TE 3F0NA 2OI2A 1RREA 3WU3A
chains in the Genus database with same CATH superfamily
2Z5BA 2AE8A 2NN6E 2PO0B 1KVKA 4JI8I 2PO1A 4AIMA 5FLXC 4LF7E 2V2VA 1FWLA 1MU5A 4UT4A 2IERA 3CWVA 1N0VC 4DR7E 3QT8A 4B3TI 1XMOE 2C38A 4FW4A 4ISAA 5K36D 2BA0G 4WUCA 2PO2B 2Z5BB 4DV5E 4DV7I 4DR1E 4IFDF 3ZKBA 5JEAA 3PS3A 2WP8A 1ELOA 1UDSA 1XMQE 2JE6B 4N3OA 3WU5A 4XTJA 4JI7E 4X64E 2ZITA 4OO1B 1HNXE 4LPFA 3PYFA 3H1CA 3T1YE 5BR8E 4MU3A 4DR7I 1NHIA 2JEAB 3JAMQ 3GLLA 4HACA 1XMOI 2F4VE 3UHMA 5JEAD 4DV3E 4DV5I 1Z5AA 2ZBKB 4BA1B 5L3JA 4DR1I 1N36E 4NXNE 4HYMA 3GCMA 2HK2A 4HXZA 4MYUA 4OX9E 3U1YA 1ZM4A 1N34E 1XMQI 3K85A 4DV1E 4X64I 1Z59A 2CGEA 4JI7I 4B3SE 2JEBA 1HNXI 2DEJA 4LF8E 4LFCE 3K17A 2AJ4A 3T1YI 5BR8I 1S4EA 2F4VI 4DV3I 4DR5E 5JEAE 4DUYE 1N36I 4NXNI 1H7UA 2VQEE 1YH8A 3OTOE 4OX9I 4JV5E 1ZM9A 2JEBB 5FLXQ 4DV1I 2IOPA 4B3SI 2Z5EA 1PKPA 1Z0EA 4LFCI 4WUDA 2NN6F 1Y4UA 3QT6A 1FKAE 1MG7A 1FI4A 4RPFA 4DR5I 4AQYE 4LCGA 4DUYI 4FW3A 2BR2A 3P76A 4DPYA 2IESA 4JI0E 4FW7A 2VQEI 1UDQA 3OTOI 3JAMC 1Z0TA 2HKEA 2CZ9A 1KKHA 2Z5CA 2BM1A 2V2QA 2WNRA 2UUAE 4FWHA 5JEAC 4QNKA 4AQYI 4Z7YA 5EKWA 1WUUA 2VQFE 4PU9A 5ELWA 4X62E 4JI0I 5DNXA 5DROA 4X65E 2GO4A 1FWKA 5LL6R 1ZM3A 4DV7E 4IZJA 3PS1A 2C37B 5K36A 3P3GA 3M85G 1UEKA 2UUAI 3NZKA 2BA1D 3QT7A 4DV2E 4JI3E 4OO1F 3PRYA 4I3HA 3J7AM 1OYPA 4LF9I 4MU0A 1HK7A 2VQFI 2E1RA 4MQYA 4X62I 1KIJA 4BA2B 2O1VA 1ZM2A 4LF5E 1Z0GA 4X65I 4B3ME 4FN5A 4GKKE 3ZKDA 4IZJD 4JYAE 1N33I 3J7AG 1H72C 3HULA 2O1WA 5IWAE 2V8PA 1H73A 2F1DA 2PO1B 4FWGA 5K36B 2GO3A 3LTOA 3CDJA 1NHJA 4DV2I 4JI3I 5C0XF 4DR4E 3HJCA 4MU4A 1Y5YA 4URLA 4DUZE 4MDTA 1ZXNA 2O1UA 1HNWE 1OYSA 4MU1A 5FWKA 4LF5I 2BV3A 5DRPA 1Y60A 2C38B 4B3MI 4DR2E 4NXME 2HK3A 4GKKI 4JYAI 1OYRA 5EL9A 5K36E 5IWAI 3P06A 4FW9A 4J3DA 5JEAB 2WP8B 1R6MA 2NPFA 2HKJA 3PYEA 4DR4I 3M85D 4IFDA 4JI2E 4DUZI 5LMUE 3V5RA 5C0XA 1HNWI 4DV6E 4AM3A 2HHHE 3CDIA 4HACB 4DR2I 4NXMI 1UDOA 2WW4A 1RR9A 3Q6NA 2HFSA 1QZRA 4IFDD 4P7AA 2C39A 2UXBE 3KRNA 5C0XD 3B78A 1N32E 2V2ZA 4JI2I 3J81Q 2PNZA 3H4LA 5LMUI 4DV4E 2UUBE 4KHPE 1BKNA 4DV6I 2O1TA 3WU4A 2HHHI 1N0UA 4DV0I 2X36A 2BA1G 4USKA 4JI1I 4PRVA 3PYGA 5K36C 1IBKE 1ZXMA 3HKMA 2UUCE 2J7KA 3PS2A 4Z7CA 1I94E 4IFDE 4YY3E 2UXBI 1U2RA 1N32I 3K1JA 4ZVIA 4P52A 4HY1A 2O3ZA 4DV4I 3T1HE 2UUBI 3M7NG 1RHYA 4DU8A 4KHPI 2UU9E 1XNQE 4QNJA 1J5EE 4OZEA 3B82A 1MX0A 4JI5I 1IBKI 3GONA 2UUCI 4JI4E 2NN6A 2XEXA 2GQ0A 4DPWA 4YHHI 2BR2B 4LF6E 4LF9E 2A2CA 1I94I 4YY3I 4FW6A 2E5LE 4DU7A 2Z5CB 4JI6E 1XNRI 1H7SA 4LCHA 3T1HI 1N33E 3Q1QA 4U3DA 1HNZE 2UU9I 1XNQI 2HFUA 1VI7A 1A6FA 1DARA 2NN6D 2WNRB 1J5EI 2PO0A 1Z0VA 3J81C 4M1KA 1NHHA 5A2QQ 4JI4I 4DPXA 3LNUA 2LJPA 1EA6A 4IFDC 4LF6I 4GKJI 3PYDA 2R42A 3J80C 2E5LI 3LPSA 4UTGA 1E3HA 4JI6I 1YHCA 3QT5A 5JEAF 2CG9A 1HNZI 2PNMA 4IZJB 3M7ND 2PO2A 2GS8A 4NBQA 4LCFA 3P3EA 4R1FA 3B8HA 4LF4E 1K47A 5GMDA 4ED4A 2UXCI 2JE6A 1KTVA 1OJ4A 4OO1A 3GMEA 5IT9C 4IZKA 1E3PA 5DRQA 5LMNE 2IOQA 1EI1A 2JEAA 4KQVA 2A2DA 1PVGA 1B63A 3D4JA 1XXEA 4BA1A 1Y6ZA 4LF7I 4OO1D 1R6LA 1D6TA 4LF4I 4U3BA 1B62A 4IZKB 3U1KA 3ZZTA 5LMNI 4DV0E 1IBLE 1HR0E 1Y4SA 4DR3E 4JI1E 3M6AA 5A2QC 4DR6E 5DRRA 5DNLA 2ZM6E 2DEIA 2NN6C 1NZ0A 2VF3A 4EMDA 1Z0CA 4IFDB 4OO1E 2UXDE 5C0XB 1Z5CA 3ZZ0A 3DD6A 4B3RE 1FJGE 3ZZUA 3V2UC 4GQUA 1IBLI 4LFBE 2X7IA 1Z5BA 3J80Q 1HR0I 1FNMA 4JG4A 4DR3I 4LFAE 4DR6I 4USMA 4JI5E 4LOMA 1IBME 1H74A 2R3VA 2VESA 2ZM6I 4YHHE 2BA0D 2C39B 4WUBA 1Z0WA 3B4TA 2UXDI 5C0XE 1N34I 2PNZB 1XNRE 2JT2A 4LF8I 4FWDA 3L7ZA 4DPTA 4B3RI 4K0KE 5IT9Q 1FJGI 4LFBI 3WU6A 2EFGA 4X66E 4DXLA 4AIDA 1Z0BA 4LFAI 3Q6MA 1IBMI 1UDNA 1USVA 4GKJE 4OO1C 2Q2EB 4FW5A 4JV5I 1P42A 4MYTA 2PNLA 3L7ZB 5K36F 4K0KI 1VISA 4OKGA 4JI8E 4X66I 1PIEA 2C37A 3ZM7A 4PRXA 2NN6B 2J65A 2BM0A 3P3CA 2UXCE 1S16A 2V34A 1USUA 4DPUA 5C0XC 5GMEA 4BA2A 1XHKA 4B3TE 3F0NA 2CVEA 2OI2A 1RREA 3WU3A 4IS9A
chains in the Genus database with same CATH topology
2Z5BA 4JI8I 1KVKA 5FLXC 4LF7E 2V2VA 1FWLA 1MU5A 4UT4A 3CWVA 1N0VC 4DR7E 3QT8A 4B3TI 1XMOE 4WUCA 2Z5BB 4DV5E 4DV7I 4DR1E 3ZKBA 1ELOA 1XMQE 4N3OA 3WU5A 4XTJA 4JI7E 4X64E 2ZITA 1HNXE 3PYFA 3T1YE 5BR8E 4DR7I 1NHIA 3JAMQ 4HACA 1XMOI 2F4VE 4DV3E 4DV5I 1Z5AA 2ZBKB 4DR1I 5L3JA 1N36E 4NXNE 4HYMA 2HK2A 4HXZA 4MYUA 4OX9E 1ZM4A 1N34E 1XMQI 3K85A 4DV1E 4X64I 1Z59A 2CGEA 4JI7I 4B3SE 1HNXI 2DEJA 4LF8E 4LFCE 3K17A 2AJ4A 3T1YI 5BR8I 1S4EA 2F4VI 4DV3I 4DR5E 4DUYE 1N36I 4NXNI 1H7UA 2VQEE 4OX9I 3OTOE 4JV5E 1ZM9A 5FLXQ 4DV1I 2IOPA 4B3SI 2Z5EA 1PKPA 1Z0EA 4LFCI 4WUDA 1Y4UA 3QT6A 1FKAE 1MG7A 1FI4A 4RPFA 4DR5I 4AQYE 4DUYI 4DPYA 4JI0E 2VQEI 3OTOI 3JAMC 1Z0TA 2HKEA 2CZ9A 1KKHA 2Z5CA 2BM1A 2V2QA 2UUAE 4FWHA 4AQYI 4Z7YA 2VQFE 1WUUA 4PU9A 4X62E 4JI0I 4X65E 1FWKA 5LL6R 1ZM3A 4DV7E 4IZJA 2UUAI 1UEKA 4DV2E 3QT7A 4JI3E 3PRYA 4I3HA 3J7AM 4LF9I 1HK7A 2VQFI 2E1RA 4X62I 1KIJA 2O1VA 1ZM2A 4LF5E 1Z0GA 4X65I 4B3ME 4FN5A 4GKKE 3ZKDA 4IZJD 4JYAE 1N33I 3J7AG 1H72C 3HULA 2O1WA 5IWAE 2V8PA 1H73A 4FWGA 3LTOA 4DV2I 1NHJA 4JI3I 4DR4E 3HJCA 4URLA 4DUZE 1ZXNA 2O1UA 1HNWE 5FWKA 4LF5I 2BV3A 4B3MI 4GKKI 4DR2E 4NXME 2HK3A 4JYAI 5IWAI 3P06A 4FW9A 2NPFA 2HKJA 3PYEA 4DR4I 4JI2E 4DUZI 5LMUE 3V5RA 1HNWI 4DV6E 2HHHE 4HACB 4DR2I 4NXMI 2WW4A 1RR9A 3Q6NA 2HFSA 1QZRA 4P7AA 2UXBE 1N32E 3B78A 2V2ZA 4JI2I 3J81Q 3H4LA 5LMUI 4DV4E 2UUBE 4KHPE 1BKNA 4DV6I 3WU4A 2HHHI 1N0UA 4DV0I 2X36A 4USKA 4JI1I 4PRVA 3PYGA 1IBKE 1ZXMA 2UUCE 2J7KA 4Z7CA 1I94E 4YY3E 2UXBI 1U2RA 1N32I 3K1JA 4ZVIA 4P52A 4HY1A 4DV4I 3T1HE 2UUBI 4DU8A 4KHPI 2UU9E 1XNQE 1J5EE 3B82A 1MX0A 4JI5I 1IBKI 3GONA 2UUCI 4JI4E 2XEXA 2GQ0A 4DPWA 4YHHI 4LF6E 4LF9E 2A2CA 1I94I 4YY3I 2E5LE 4DU7A 2Z5CB 4JI6E 1XNRI 1H7SA 3T1HI 1N33E 3Q1QA 1HNZE 2UU9I 1XNQI 2HFUA 1A6FA 1DARA 1J5EI 1Z0VA 3J81C 4M1KA 1NHHA 5A2QQ 4JI4I 4DPXA 3LNUA 2LJPA 1EA6A 4LF6I 4GKJI 3PYDA 2R42A 3J80C 2E5LI 3LPSA 4UTGA 4JI6I 3QT5A 2CG9A 1HNZI 2PNMA 4IZJB 2GS8A 4R1FA 3B8HA 4LF4E 1K47A 5GMDA 4ED4A 2UXCI 1KTVA 1OJ4A 5IT9C 4IZKA 5LMNE 2IOQA 1EI1A 4KQVA 2A2DA 1PVGA 1B63A 3D4JA 1Y6ZA 4LF7I 1D6TA 4LF4I 1B62A 4IZKB 3ZZTA 5LMNI 4DV0E 1IBLE 1HR0E 1Y4SA 4DR3E 4JI1E 3M6AA 5A2QC 4DR6E 2ZM6E 2DEIA 1NZ0A 2VF3A 4EMDA 1Z0CA 2UXDE 1Z5CA 3ZZ0A 4B3RE 1FJGE 3ZZUA 3V2UC 1IBLI 4LFBE 2X7IA 1Z5BA 3J80Q 1HR0I 1FNMA 4JG4A 4DR3I 4LFAE 4DR6I 4USMA 4JI5E 1IBME 1H74A 2R3VA 2ZM6I 4YHHE 4WUBA 1Z0WA 2UXDI 1N34I 1XNRE 4LF8I 4FWDA 4DPTA 4B3RI 4K0KE 5IT9Q 1FJGI 4LFBI 3WU6A 4X66E 2EFGA 4DXLA 1Z0BA 4LFAI 3Q6MA 1IBMI 1USVA 4GKJE 2Q2EB 4JV5I 4MYTA 2PNLA 4K0KI 1VISA 4JI8E 4X66I 1PIEA 3ZM7A 4PRXA 2BM0A 2UXCE 1S16A 2V34A 1USUA 4DPUA 5GMEA 1XHKA 4B3TE 3F0NA 2OI2A 1RREA 3WU3A 2O1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 I;  1KVK A;  5FLX C;  4LF7 E;  2V2V A;  1FWL A;  1MU5 A;  4UT4 A;  3CWV A;  1N0V C;  4DR7 E;  3QT8 A;  4B3T I;  1XMO E;  4WUC A;  4DV5 E;  4DV7 I;  4DR1 E;  3ZKB A;  1ELO A;  1XMQ E;  3WU5 A;  4XTJ A;  4JI7 E;  4X64 E;  2ZIT A;  1HNX E;  3PYF A;  3T1Y E;  5BR8 E;  4DR7 I;  1NHI A;  3JAM Q;  4HAC A;  1XMO I;  2F4V E;  4DV3 E;  4DV5 I;  1Z5A A;  2ZBK B;  4DR1 I;  5L3J A;  1N36 E;  4NXN E;  4HYM A;  2HK2 A;  4HXZ A;  4MYU A;  4OX9 E;  1ZM4 A;  1N34 E;  1XMQ I;  4DV1 E;  4X64 I;  1Z59 A;  4JI7 I;  4B3S E;  1HNX I;  2DEJ A;  4LF8 E;  4LFC E;  3K17 A;  2AJ4 A;  3T1Y I;  5BR8 I;  1S4E A;  2F4V I;  4DV3 I;  4DR5 E;  4DUY E;  1N36 I;  4NXN I;  1H7U A;  2VQE E;  4OX9 I;  3OTO E;  4JV5 E;  1ZM9 A;  5FLX Q;  4DV1 I;  4B3S I;  1PKP A;  1Z0E A;  4LFC I;  4WUD A;  3QT6 A;  1FKA E;  1MG7 A;  1FI4 A;  4RPF A;  4DR5 I;  4AQY E;  4DUY I;  4DPY A;  4JI0 E;  2VQE I;  3OTO I;  3JAM C;  1Z0T A;  2HKE A;  2CZ9 A;  1KKH A;  2BM1 A;  2V2Q A;  2UUA E;  4FWH A;  4AQY I;  4Z7Y A;  2VQF E;  1WUU A;  4PU9 A;  4X62 E;  4JI0 I;  4X65 E;  1FWK A;  5LL6 R;  1ZM3 A;  4DV7 E;  2UUA I;  1UEK A;  4DV2 E;  3QT7 A;  4JI3 E;  4I3H A;  3J7A M;  4LF9 I;  2VQF I;  2E1R A;  4X62 I;  1KIJ A;  1ZM2 A;  4LF5 E;  1Z0G A;  4X65 I;  4B3M E;  4FN5 A;  4GKK E;  3ZKD A;  4JYA E;  1N33 I;  3J7A G;  1H72 C;  3HUL A;  5IWA E;  2V8P A;  1H73 A;  4FWG A;  3LTO A;  1NHJ A;  4DV2 I;  4JI3 I;  4DR4 E;  4URL A;  4DUZ E;  1ZXN A;  1HNW E;  4LF5 I;  2BV3 A;  4B3M I;  4GKK I;  4DR2 E;  4NXM E;  2HK3 A;  4JYA I;  5IWA I;  4FW9 A;  2NPF A;  2HKJ A;  3PYE A;  4DR4 I;  4JI2 E;  4DUZ I;  5LMU E;  3V5R A;  1HNW I;  4DV6 E;  2HHH E;  4HAC B;  4DR2 I;  4NXM I;  2WW4 A;  1RR9 A;  2HFS A;  1QZR A;  4P7A A;  2UXB E;  1N32 E;  3B78 A;  2V2Z A;  4JI2 I;  3J81 Q;  3H4L A;  5LMU I;  4DV4 E;  2UUB E;  4KHP E;  1BKN A;  4DV6 I;  3WU4 A;  2HHH I;  1N0U A;  4DV0 I;  2X36 A;  4USK A;  4JI1 I;  4PRV A;  3PYG A;  1IBK E;  1ZXM A;  2UUC E;  2J7K A;  4Z7C A;  1I94 E;  4YY3 E;  2UXB I;  1U2R A;  1N32 I;  3K1J A;  4ZVI A;  4P52 A;  4HY1 A;  4DV4 I;  3T1H E;  2UUB I;  4DU8 A;  4KHP I;  2UU9 E;  1XNQ E;  1J5E E;  3B82 A;  1MX0 A;  4JI5 I;  1IBK I;  3GON A;  2UUC I;  4JI4 E;  2XEX A;  4DPW A;  4YHH I;  4LF6 E;  4LF9 E;  2A2C A;  1I94 I;  4YY3 I;  2E5L E;  4DU7 A;  4JI6 E;  1XNR I;  1H7S A;  3T1H I;  1N33 E;  3Q1Q A;  1HNZ E;  2UU9 I;  1XNQ I;  2HFU A;  1A6F A;  1DAR A;  1J5E I;  1Z0V A;  3J81 C;  4M1K A;  1NHH A;  5A2Q Q;  4JI4 I;  4DPX A;  3LNU A;  2LJP A;  1EA6 A;  4LF6 I;  4GKJ I;  3PYD A;  2R42 A;  3J80 C;  2E5L I;  3LPS A;  4UTG A;  4JI6 I;  3QT5 A;  1HNZ I;  2GS8 A;  4R1F A;  3B8H A;  4LF4 E;  1K47 A;  5GMD A;  4ED4 A;  2UXC I;  1KTV A;  1OJ4 A;  5IT9 C;  5LMN E;  1EI1 A;  4KQV A;  2A2D A;  1PVG A;  1B63 A;  3D4J A;  4LF7 I;  1D6T A;  4LF4 I;  1B62 A;  3ZZT A;  5LMN I;  4DV0 E;  1IBL E;  1HR0 E;  4DR3 E;  4JI1 E;  3M6A A;  5A2Q C;  4DR6 E;  2ZM6 E;  2DEI A;  1NZ0 A;  2VF3 A;  4EMD A;  1Z0C A;  2UXD E;  1Z5C A;  3ZZ0 A;  4B3R E;  1FJG E;  3ZZU A;  3V2U C;  1IBL I;  4LFB E;  2X7I A;  1HR0 I;  1Z5B A;  3J80 Q;  1FNM A;  4JG4 A;  4DR3 I;  4LFA E;  4DR6 I;  4USM A;  4JI5 E;  1IBM E;  1H74 A;  2R3V A;  2ZM6 I;  4YHH E;  4WUB A;  1Z0W A;  2UXD I;  1N34 I;  1XNR E;  4LF8 I;  4FWD A;  4DPT A;  4B3R I;  4K0K E;  5IT9 Q;  1FJG I;  4LFB I;  3WU6 A;  4X66 E;  2EFG A;  4DXL A;  1Z0B A;  4LFA I;  1IBM I;  4GKJ E;  2Q2E B;  4JV5 I;  4MYT A;  4K0K I;  1VIS A;  4JI8 E;  4X66 I;  1PIE A;  3ZM7 A;  4PRX A;  2BM0 A;  2UXC E;  1S16 A;  2V34 A;  4DPU A;  5GME A;  1XHK A;  4B3T E;  3F0N A;  2OI2 A;  1RRE A;  3WU3 A; 
#chains in the Genus database with same CATH topology
 2Z5B A;  2AE8 A;  2NN6 E;  2PO0 B;  1KVK A;  4JI8 I;  2PO1 A;  4AIM A;  5FLX C;  4LF7 E;  2V2V A;  1FWL A;  1MU5 A;  4UT4 A;  2IER A;  3CWV A;  1N0V C;  4DR7 E;  3QT8 A;  4B3T I;  1XMO E;  2C38 A;  4FW4 A;  4ISA A;  5K36 D;  2BA0 G;  4WUC A;  2PO2 B;  2Z5B B;  4DV5 E;  4DV7 I;  4DR1 E;  4IFD F;  3ZKB A;  5JEA A;  3PS3 A;  2WP8 A;  1ELO A;  1UDS A;  1XMQ E;  2JE6 B;  4N3O A;  3WU5 A;  4XTJ A;  4JI7 E;  4X64 E;  2ZIT A;  4OO1 B;  1HNX E;  4LPF A;  3PYF A;  3H1C A;  3T1Y E;  5BR8 E;  4MU3 A;  4DR7 I;  1NHI A;  2JEA B;  3JAM Q;  3GLL A;  4HAC A;  1XMO I;  2F4V E;  3UHM A;  5JEA D;  4DV3 E;  4DV5 I;  1Z5A A;  2ZBK B;  4BA1 B;  5L3J A;  4DR1 I;  1N36 E;  4NXN E;  4HYM A;  3GCM A;  2HK2 A;  4HXZ A;  4MYU A;  4OX9 E;  3U1Y A;  1ZM4 A;  1N34 E;  1XMQ I;  3K85 A;  4DV1 E;  4X64 I;  1Z59 A;  2CGE A;  4JI7 I;  4B3S E;  2JEB A;  1HNX I;  2DEJ A;  4LF8 E;  4LFC E;  3K17 A;  2AJ4 A;  3T1Y I;  5BR8 I;  1S4E A;  2F4V I;  4DV3 I;  4DR5 E;  5JEA E;  4DUY E;  1N36 I;  4NXN I;  1H7U A;  2VQE E;  1YH8 A;  3OTO E;  4OX9 I;  4JV5 E;  1ZM9 A;  2JEB B;  5FLX Q;  4DV1 I;  2IOP A;  4B3S I;  2Z5E A;  1PKP A;  1Z0E A;  4LFC I;  4WUD A;  2NN6 F;  1Y4U A;  3QT6 A;  1FKA E;  1MG7 A;  1FI4 A;  4RPF A;  4DR5 I;  4AQY E;  4LCG A;  4DUY I;  4FW3 A;  2BR2 A;  3P76 A;  4DPY A;  2IES A;  4JI0 E;  4FW7 A;  2VQE I;  1UDQ A;  3OTO I;  3JAM C;  1Z0T A;  2HKE A;  2CZ9 A;  1KKH A;  2Z5C A;  2BM1 A;  2V2Q A;  2WNR A;  2UUA E;  4FWH A;  5JEA C;  4QNK A;  4AQY I;  4Z7Y A;  5EKW A;  1WUU A;  2VQF E;  4PU9 A;  5ELW A;  4X62 E;  4JI0 I;  5DNX A;  5DRO A;  4X65 E;  2GO4 A;  1FWK A;  5LL6 R;  1ZM3 A;  4DV7 E;  4IZJ A;  3PS1 A;  2C37 B;  5K36 A;  3P3G A;  3M85 G;  1UEK A;  2UUA I;  3NZK A;  2BA1 D;  3QT7 A;  4DV2 E;  4JI3 E;  4OO1 F;  3PRY A;  4I3H A;  3J7A M;  1OYP A;  4LF9 I;  4MU0 A;  1HK7 A;  2VQF I;  2E1R A;  4MQY A;  4X62 I;  1KIJ A;  4BA2 B;  2O1V A;  1ZM2 A;  4LF5 E;  1Z0G A;  4X65 I;  4B3M E;  4FN5 A;  4GKK E;  3ZKD A;  4IZJ D;  4JYA E;  1N33 I;  3J7A G;  1H72 C;  3HUL A;  2O1W A;  5IWA E;  2V8P A;  1H73 A;  2F1D A;  2PO1 B;  4FWG A;  5K36 B;  2GO3 A;  3LTO A;  3CDJ A;  1NHJ A;  4DV2 I;  4JI3 I;  5C0X F;  4DR4 E;  3HJC A;  4MU4 A;  1Y5Y A;  4URL A;  4DUZ E;  4MDT A;  1ZXN A;  2O1U A;  1HNW E;  1OYS A;  4MU1 A;  5FWK A;  4LF5 I;  2BV3 A;  5DRP A;  1Y60 A;  2C38 B;  4B3M I;  4DR2 E;  4NXM E;  2HK3 A;  4GKK I;  4JYA I;  1OYR A;  5EL9 A;  5K36 E;  5IWA I;  3P06 A;  4FW9 A;  4J3D A;  5JEA B;  2WP8 B;  1R6M A;  2NPF A;  2HKJ A;  3PYE A;  4DR4 I;  3M85 D;  4IFD A;  4JI2 E;  4DUZ I;  5LMU E;  3V5R A;  5C0X A;  1HNW I;  4DV6 E;  4AM3 A;  2HHH E;  3CDI A;  4HAC B;  4DR2 I;  4NXM I;  1UDO A;  2WW4 A;  1RR9 A;  3Q6N A;  2HFS A;  1QZR A;  4IFD D;  4P7A A;  2C39 A;  2UXB E;  3KRN A;  5C0X D;  3B78 A;  1N32 E;  2V2Z A;  4JI2 I;  3J81 Q;  2PNZ A;  3H4L A;  5LMU I;  4DV4 E;  2UUB E;  4KHP E;  1BKN A;  4DV6 I;  2O1T A;  3WU4 A;  2HHH I;  1N0U A;  4DV0 I;  2X36 A;  2BA1 G;  4USK A;  4JI1 I;  4PRV A;  3PYG A;  5K36 C;  1IBK E;  1ZXM A;  3HKM A;  2UUC E;  2J7K A;  3PS2 A;  4Z7C A;  1I94 E;  4IFD E;  4YY3 E;  2UXB I;  1U2R A;  1N32 I;  3K1J A;  4ZVI A;  4P52 A;  4HY1 A;  2O3Z A;  4DV4 I;  3T1H E;  2UUB I;  3M7N G;  1RHY A;  4DU8 A;  4KHP I;  2UU9 E;  1XNQ E;  4QNJ A;  1J5E E;  4OZE A;  3B82 A;  1MX0 A;  4JI5 I;  1IBK I;  3GON A;  2UUC I;  4JI4 E;  2NN6 A;  2XEX A;  2GQ0 A;  4DPW A;  4YHH I;  2BR2 B;  4LF6 E;  4LF9 E;  2A2C A;  1I94 I;  4YY3 I;  4FW6 A;  2E5L E;  4DU7 A;  2Z5C B;  4JI6 E;  1XNR I;  1H7S A;  4LCH A;  3T1H I;  1N33 E;  3Q1Q A;  4U3D A;  1HNZ E;  2UU9 I;  1XNQ I;  2HFU A;  1VI7 A;  1A6F A;  1DAR A;  2NN6 D;  2WNR B;  1J5E I;  2PO0 A;  1Z0V A;  3J81 C;  4M1K A;  1NHH A;  5A2Q Q;  4JI4 I;  4DPX A;  3LNU A;  2LJP A;  1EA6 A;  4IFD C;  4LF6 I;  4GKJ I;  3PYD A;  2R42 A;  3J80 C;  2E5L I;  3LPS A;  4UTG A;  1E3H A;  4JI6 I;  1YHC A;  3QT5 A;  5JEA F;  2CG9 A;  1HNZ I;  2PNM A;  4IZJ B;  3M7N D;  2PO2 A;  2GS8 A;  4NBQ A;  4LCF A;  3P3E A;  4R1F A;  3B8H A;  4LF4 E;  1K47 A;  5GMD A;  4ED4 A;  2UXC I;  2JE6 A;  1KTV A;  1OJ4 A;  4OO1 A;  3GME A;  5IT9 C;  4IZK A;  1E3P A;  5DRQ A;  5LMN E;  2IOQ A;  1EI1 A;  2JEA A;  4KQV A;  2A2D A;  1PVG A;  1B63 A;  3D4J A;  1XXE A;  4BA1 A;  1Y6Z A;  4LF7 I;  4OO1 D;  1R6L A;  1D6T A;  4LF4 I;  4U3B A;  1B62 A;  4IZK B;  3U1K A;  3ZZT A;  5LMN I;  4DV0 E;  1IBL E;  1HR0 E;  1Y4S A;  4DR3 E;  4JI1 E;  3M6A A;  5A2Q C;  4DR6 E;  5DRR A;  5DNL A;  2ZM6 E;  2DEI A;  2NN6 C;  1NZ0 A;  2VF3 A;  4EMD A;  1Z0C A;  4IFD B;  4OO1 E;  2UXD E;  5C0X B;  1Z5C A;  3ZZ0 A;  3DD6 A;  4B3R E;  1FJG E;  3ZZU A;  3V2U C;  4GQU A;  1IBL I;  4LFB E;  2X7I A;  1Z5B A;  3J80 Q;  1HR0 I;  1FNM A;  4JG4 A;  4DR3 I;  4LFA E;  4DR6 I;  4USM A;  4JI5 E;  4LOM A;  1IBM E;  1H74 A;  2R3V A;  2VES A;  2ZM6 I;  4YHH E;  2BA0 D;  2C39 B;  4WUB A;  1Z0W A;  3B4T A;  2UXD I;  5C0X E;  1N34 I;  2PNZ B;  1XNR E;  2JT2 A;  4LF8 I;  4FWD A;  3L7Z A;  4DPT A;  4B3R I;  4K0K E;  5IT9 Q;  1FJG I;  4LFB I;  3WU6 A;  2EFG A;  4X66 E;  4DXL A;  4AID A;  1Z0B A;  4LFA I;  3Q6M A;  1IBM I;  1UDN A;  1USV A;  4GKJ E;  4OO1 C;  2Q2E B;  4FW5 A;  4JV5 I;  1P42 A;  4MYT A;  2PNL A;  3L7Z B;  5K36 F;  4K0K I;  1VIS A;  4OKG A;  4JI8 E;  4X66 I;  1PIE A;  2C37 A;  3ZM7 A;  4PRX A;  2NN6 B;  2J65 A;  2BM0 A;  3P3C A;  2UXC E;  1S16 A;  2V34 A;  1USU A;  4DPU A;  5C0X C;  5GME A;  4BA2 A;  1XHK A;  4B3T E;  3F0N A;  2CVE A;  2OI2 A;  1RRE A;  3WU3 A;  4IS9 A; 
#chains in the Genus database with same CATH homology
 2Z5B A;  4JI8 I;  1KVK A;  5FLX C;  4LF7 E;  2V2V A;  1FWL A;  1MU5 A;  4UT4 A;  3CWV A;  1N0V C;  4DR7 E;  3QT8 A;  4B3T I;  1XMO E;  4WUC A;  2Z5B B;  4DV5 E;  4DV7 I;  4DR1 E;  3ZKB A;  1ELO A;  1XMQ E;  4N3O A;  3WU5 A;  4XTJ A;  4JI7 E;  4X64 E;  2ZIT A;  1HNX E;  3PYF A;  3T1Y E;  5BR8 E;  4DR7 I;  1NHI A;  3JAM Q;  4HAC A;  1XMO I;  2F4V E;  4DV3 E;  4DV5 I;  1Z5A A;  2ZBK B;  4DR1 I;  5L3J A;  1N36 E;  4NXN E;  4HYM A;  2HK2 A;  4HXZ A;  4MYU A;  4OX9 E;  1ZM4 A;  1N34 E;  1XMQ I;  3K85 A;  4DV1 E;  4X64 I;  1Z59 A;  2CGE A;  4JI7 I;  4B3S E;  1HNX I;  2DEJ A;  4LF8 E;  4LFC E;  3K17 A;  2AJ4 A;  3T1Y I;  5BR8 I;  1S4E A;  2F4V I;  4DV3 I;  4DR5 E;  4DUY E;  1N36 I;  4NXN I;  1H7U A;  2VQE E;  4OX9 I;  3OTO E;  4JV5 E;  1ZM9 A;  5FLX Q;  4DV1 I;  2IOP A;  4B3S I;  2Z5E A;  1PKP A;  1Z0E A;  4LFC I;  4WUD A;  1Y4U A;  3QT6 A;  1FKA E;  1MG7 A;  1FI4 A;  4RPF A;  4DR5 I;  4AQY E;  4DUY I;  4DPY A;  4JI0 E;  2VQE I;  3OTO I;  3JAM C;  1Z0T A;  2HKE A;  2CZ9 A;  1KKH A;  2Z5C A;  2BM1 A;  2V2Q A;  2UUA E;  4FWH A;  4AQY I;  4Z7Y A;  2VQF E;  1WUU A;  4PU9 A;  4X62 E;  4JI0 I;  4X65 E;  1FWK A;  5LL6 R;  1ZM3 A;  4DV7 E;  4IZJ A;  2UUA I;  1UEK A;  4DV2 E;  3QT7 A;  4JI3 E;  3PRY A;  4I3H A;  3J7A M;  4LF9 I;  1HK7 A;  2VQF I;  2E1R A;  4X62 I;  1KIJ A;  2O1V A;  1ZM2 A;  4LF5 E;  1Z0G A;  4X65 I;  4B3M E;  4FN5 A;  4GKK E;  3ZKD A;  4IZJ D;  4JYA E;  1N33 I;  3J7A G;  1H72 C;  3HUL A;  2O1W A;  5IWA E;  2V8P A;  1H73 A;  4FWG A;  3LTO A;  4DV2 I;  1NHJ A;  4JI3 I;  4DR4 E;  3HJC A;  4URL A;  4DUZ E;  1ZXN A;  2O1U A;  1HNW E;  5FWK A;  4LF5 I;  2BV3 A;  4B3M I;  4GKK I;  4DR2 E;  4NXM E;  2HK3 A;  4JYA I;  5IWA I;  3P06 A;  4FW9 A;  2NPF A;  2HKJ A;  3PYE A;  4DR4 I;  4JI2 E;  4DUZ I;  5LMU E;  3V5R A;  1HNW I;  4DV6 E;  2HHH E;  4HAC B;  4DR2 I;  4NXM I;  2WW4 A;  1RR9 A;  3Q6N A;  2HFS A;  1QZR A;  4P7A A;  2UXB E;  1N32 E;  3B78 A;  2V2Z A;  4JI2 I;  3J81 Q;  3H4L A;  5LMU I;  4DV4 E;  2UUB E;  4KHP E;  1BKN A;  4DV6 I;  3WU4 A;  2HHH I;  1N0U A;  4DV0 I;  2X36 A;  4USK A;  4JI1 I;  4PRV A;  3PYG A;  1IBK E;  1ZXM A;  2UUC E;  2J7K A;  4Z7C A;  1I94 E;  4YY3 E;  2UXB I;  1U2R A;  1N32 I;  3K1J A;  4ZVI A;  4P52 A;  4HY1 A;  4DV4 I;  3T1H E;  2UUB I;  4DU8 A;  4KHP I;  2UU9 E;  1XNQ E;  1J5E E;  3B82 A;  1MX0 A;  4JI5 I;  1IBK I;  3GON A;  2UUC I;  4JI4 E;  2XEX A;  2GQ0 A;  4DPW A;  4YHH I;  4LF6 E;  4LF9 E;  2A2C A;  1I94 I;  4YY3 I;  2E5L E;  4DU7 A;  2Z5C B;  4JI6 E;  1XNR I;  1H7S A;  3T1H I;  1N33 E;  3Q1Q A;  1HNZ E;  2UU9 I;  1XNQ I;  2HFU A;  1A6F A;  1DAR A;  1J5E I;  1Z0V A;  3J81 C;  4M1K A;  1NHH A;  5A2Q Q;  4JI4 I;  4DPX A;  3LNU A;  2LJP A;  1EA6 A;  4LF6 I;  4GKJ I;  3PYD A;  2R42 A;  3J80 C;  2E5L I;  3LPS A;  4UTG A;  4JI6 I;  3QT5 A;  2CG9 A;  1HNZ I;  2PNM A;  4IZJ B;  2GS8 A;  4R1F A;  3B8H A;  4LF4 E;  1K47 A;  5GMD A;  4ED4 A;  2UXC I;  1KTV A;  1OJ4 A;  5IT9 C;  4IZK A;  5LMN E;  2IOQ A;  1EI1 A;  4KQV A;  2A2D A;  1PVG A;  1B63 A;  3D4J A;  1Y6Z A;  4LF7 I;  1D6T A;  4LF4 I;  1B62 A;  4IZK B;  3ZZT A;  5LMN I;  4DV0 E;  1IBL E;  1HR0 E;  1Y4S A;  4DR3 E;  4JI1 E;  3M6A A;  5A2Q C;  4DR6 E;  2ZM6 E;  2DEI A;  1NZ0 A;  2VF3 A;  4EMD A;  1Z0C A;  2UXD E;  1Z5C A;  3ZZ0 A;  4B3R E;  1FJG E;  3ZZU A;  3V2U C;  1IBL I;  4LFB E;  2X7I A;  1Z5B A;  3J80 Q;  1HR0 I;  1FNM A;  4JG4 A;  4DR3 I;  4LFA E;  4DR6 I;  4USM A;  4JI5 E;  1IBM E;  1H74 A;  2R3V A;  2ZM6 I;  4YHH E;  4WUB A;  1Z0W A;  2UXD I;  1N34 I;  1XNR E;  4LF8 I;  4FWD A;  4DPT A;  4B3R I;  4K0K E;  5IT9 Q;  1FJG I;  4LFB I;  3WU6 A;  4X66 E;  2EFG A;  4DXL A;  1Z0B A;  4LFA I;  3Q6M A;  1IBM I;  1USV A;  4GKJ E;  2Q2E B;  4JV5 I;  4MYT A;  2PNL A;  4K0K I;  1VIS A;  4JI8 E;  4X66 I;  1PIE A;  3ZM7 A;  4PRX A;  2BM0 A;  2UXC E;  1S16 A;  2V34 A;  1USU A;  4DPU A;  5GME A;  1XHK A;  4B3T E;  3F0N A;  2OI2 A;  1RRE A;  3WU3 A;  2O1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...