2F4VI

30s ribosome + designer antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vI00
3K1JA 2UXCI 4YY3E 3B82A 5LMUE 1PVGA 2VQFE 1NZ0A 1HNZI 1IBMI 1ZM3A 3ZZUA 3QT6A 3ZM7A 1ELOA 4DUZE 4X64E 5LMNI 3J7AM 3ZKDA 1DARA 4K0KI 1PIEA 3F0NA 4DR1I 2UUAE 1Z59A 1XMOI 3V2UC 4JI3I 4X66E 2F4VE 4XTJA 5LL6R 1H7SA 1XMQE 5IWAI 4B3TI 1KTVA 2V2QA 3PYGA 4JI2E 1HNWE 1MX0A 2CZ9A 4PU9A 4B3RE 3M6AA 3JAMQ 4LF8E 4UT4A 1FJGI 2BM1A 4URLA 4B3MI 2LJPA 1BKNA 4B3SE 3J81C 2UU9I 4OX9E 3QT7A 2V34A 5IT9C 1KIJA 4LF5I 3HULA 2UUBE 4HYMA 1XNQI 4LFCE 1IBKI 4NXME 3JAMC 1N0UA 4KHPI 4GKKE 4AQYE 4JV5I 4JI1E 1WUUA 4DV3I 4FWGA 4I3HA 2A2CA 4JYAI 1MG7A 4HXZA 4DPUA 1I94E 4WUBA 2BM0A 3OTOI 4DR2I 1HNXE 1H7UA 1N34I 2HK3A 4GKJE 2HK2A 1FWLA 4MYTA 1N32E 4B3ME 4FWDA 4NXNE 3GONA 4DV5I 3J80C 3LPSA 1Z0EA 4JI8E 4DPXA 1IBLE 3LTOA 3QT5A 4DR7E 4DR4E 1N33E 2DEJA 4DR5E 2X36A 4DPYA 4RPFA 5BR8I 4PRXA 1Z0VA 4DXLA 1N34E 4GKJI 4HACA 1HNXI 4Z7CA 4DR2E 2VF3A 5A2QC 2HKJA 1D6TA 1FWKA 4JYAE 4X65I 4DR5I 4WUDA 4KQVA 4R1FA 5L3JA 4JV5E 1EA6A 4LFCI 1ZXNA 4JI5E 1S4EA 1NHJA 4JI5I 4X62I 3ZZTA 4WUCA 4UTGA 1NHHA 1ZXMA 1N32I 3B8HA 5IT9Q 1OJ4A 1I94I 4PRVA 2R3VA 1FJGE 1Z5CA 2DEIA 3PYEA 2E5LI 4AQYI 3CWVA 1PKPA 4X65E 1HNWI 4LF7E 1IBKE 2E1RA 4JI1I 4DV3E 1XNQE 1XMQI 4B3TE 2V8PA 5BR8E 2V2VA 2UU9E 4OX9I 4B3SI 4X62E 4DR4I 4LF5E 1IBLI 1B62A 1Z0WA 4DV2E 1N33I 1RR9A 4NXNI 1KVKA 3K17A 1NHIA 2R42A 1Z0CA 2HFUA 2A2DA 4DU8A 5IWAE 5FLXQ 1FNMA 4DV2I 1XNRI 3B78A 2UUCE 3WU5A 3J7AG 5GMEA 4DR1E 4DPWA 4JI3E 1N36I 3ZZ0A 4DV0I 4Z7YA 1IBME 4KHPE 4K0KE 4DUZI 4JI8I 4DV4I 4NXMI 2UUBI 4DV5E 5LMUI 4JI6I 1S16A 2HHHE 3Q1QA 4LF6I 4ZVIA 4DV1I 4DUYI 3T1YE 4DPTA 2BV3A 4LFAI 4EMDA 1J5EE 3OTOE 4USMA 2ZM6E 1KKHA 1MU5A 3LNUA 4GKKI 4JI2I 4M1KA 2F4VI 2ZBKB 4LF4I 4DR6E 1RREA 4FN5A 4LF4E 2NPFA 3WU3A 1U2RA 1EI1A 1HR0I 2UXBE 4X66I 4HY1A 1Z0BA 4FW9A 5FLXC 4DR7I 2ZITA 3WU4A 4LF8I 1HNZE 1VISA 2EFGA 4X64I 1XHKA 2HFSA 4B3RI 1ZM2A 1Z0TA 4P52A 2XEXA 3PYFA 2HHHI 4YHHE 3PYDA 4DV6I 2V2ZA 1XMOE 4DV4E 1FI4A 3D4JA 2X7IA 3H4LA 4MYUA 4JI0I 4JI0E 4JI4E 1ZM4A 4LFBI 5A2QQ 2UXBI 3J80Q 2VQFI 2OI2A 3ZKBA 4YY3I 4HACB 2WW4A 4DV6E 4DR6I 2UUCI 2Q2EB 1FKAE 1B63A 2VQEE 4ED4A 4USKA 3J81Q 1XNRE 1A6FA 3T1HE 1H73A 4P7AA 2UXDI 1Z0GA 4LF9I 4JI7I 2ZM6I 4DV7E 1K47A 4LF9E 2GS8A 1H74A 1Z5AA 4DV7I 3T1HI 1QZRA 4LFAE 4JI7E 2VQEI 4DUYE 4DV1E 3QT8A 1H72C 4JG4A 4JI6E 4DR3E 1HR0E 4DR3I 2AJ4A 4DU7A 4JI4I 2J7KA 4LF7I 2UUAI 1ZM9A 3WU6A 4LFBE 3V5RA 5LMNE 2E5LE 4FWHA 4DV0E 1UEKA 1J5EI 1N36E 5GMDA 2HKEA 2UXDE 4LF6E 2UXCE 1Z5BA 1N0VC 4YHHI 3T1YI
chains in the Genus database with same CATH superfamily
3K1JA 2UXCI 4YY3E 3B82A 5LMUE 1PVGA 2VQFE 1NZ0A 1HNZI 4AIDA 1IBMI 4MQYA 1ZM3A 2BA1G 3ZZUA 1E3HA 3QT6A 1Y6ZA 3ZM7A 4OKGA 1ELOA 4DUZE 4X64E 5LMNI 3J7AM 3ZKDA 1DARA 4K0KI 1PIEA 3F0NA 4IFDB 4DR1I 2UUAE 1Z59A 1OYPA 1XMOI 3U1KA 3V2UC 4JI3I 4AM3A 4OZEA 4X66E 2F4VE 4XTJA 3GLLA 5LL6R 1H7SA 1XMQE 5IWAI 4B3TI 2PO0A 1KTVA 2V2QA 1VI7A 3PYGA 3Q6NA 4JI2E 1HNWE 2BA1D 1MX0A 2CZ9A 4PU9A 4B3RE 2C38B 4QNKA 3M6AA 3JAMQ 4LF8E 4UT4A 1FJGI 4J3DA 2BM1A 1R6MA 4URLA 4B3MI 2LJPA 4LCHA 4LCFA 1BKNA 4B3SE 3J81C 2UU9I 4OX9E 2Z5BA 3QT7A 2V34A 2PNLA 4FW3A 4FW5A 5IT9C 1KIJA 4MDTA 4LF5I 3HULA 2UUBE 4HYMA 4BA2B 1XNQI 4LFCE 1IBKI 4NXME 3JAMC 1N0UA 3HKMA 2JEBA 4KHPI 2NN6C 4GKKE 3CDIA 4AQYE 4JV5I 4DV3I 1WUUA 4JI1E 4FWGA 4I3HA 4MU1A 2A2CA 4OO1B 4JYAI 1MG7A 2C38A 3NZKA 4HXZA 4DPUA 1I94E 4WUBA 2JE6A 2BM0A 4IZKB 5FWKA 1Y5YA 3H1CA 3OTOI 4DR2I 1HNXE 1H7UA 1N34I 2HK3A 4GKJE 2HK2A 1FWLA 4MYTA 1N32E 4OO1C 4B3ME 2Z5EA 4ISAA 3HJCA 4FWDA 5K36B 4NXNE 3GONA 4DV5I 4FW4A 4IFDE 3J80C 3LPSA 1OYRA 5C0XA 3UHMA 1Y60A 1Z0EA 2PNZB 4JI8E 3PS2A 4DPXA 2C39A 3P3CA 1IBLE 3LTOA 3QT5A 4DR7E 4DR4E 1N33E 2DEJA 4IZKA 4DR5E 2X36A 4DPYA 3GCMA 2WP8B 4RPFA 5BR8I 4PRXA 4N3OA 1UDNA 1YH8A 1Z0VA 4DXLA 4MU3A 1N34E 4GKJI 4HACA 1HNXI 4Z7CA 1YHCA 4DR2E 2VF3A 1Y4SA 5A2QC 2HKJA 2PO1A 1D6TA 1FWKA 4JYAE 4X65I 4DR5I 2BA0G 4WUDA 4KQVA 2J65A 4R1FA 5L3JA 4JV5E 3U1YA 5DNXA 2GO4A 2JEAA 1EA6A 4LFCI 3P06A 4GQUA 5EKWA 2JEAB 1ZXNA 4JI5E 3M7NG 1S4EA 1NHJA 4JI5I 4X62I 2IERA 3ZZTA 4WUCA 4UTGA 1NHHA 1ZXMA 1N32I 3B8HA 1USVA 5IT9Q 1OJ4A 3M7ND 1I94I 4PRVA 4OO1F 2R3VA 1FJGE 1Z5CA 2WNRB 2DEIA 2WNRA 3PYEA 2BR2A 2E5LI 4AQYI 3CWVA 4U3BA 1PKPA 2GQ0A 4X65E 2O1VA 2CG9A 1HNWI 4LF7E 4IFDA 2O1WA 1IBKE 2E1RA 3L7ZB 4JI1I 4DV3E 1XNQE 2Z5CB 4OO1E 2Z5BB 1XMQI 4B3TE 2V8PA 5K36D 5BR8E 2V2VA 5K36E 2UU9E 4OX9I 4B3SI 1P42A 2IOQA 4X62E 4DR4I 4LF5E 1IBLI 1B62A 2NN6A 1OYSA 1Z0WA 2CGEA 4DV2E 5JEAC 3M85G 1N33I 4LPFA 4AIMA 1RR9A 4NXNI 2BR2B 1KVKA 3K17A 1NHIA 2R42A 3KRNA 1Z0CA 2HFUA 2A2DA 4DU8A 5IWAE 5FLXQ 1FNMA 4DV2I 1XNRI 3L7ZA 3B78A 5C0XC 5C0XE 2VESA 2UUCE 1Y4UA 5JEAE 4BA1A 3WU5A 3J7AG 5GMEA 4DR1E 1UDQA 4DPWA 4JI3E 5JEAA 1N36I 3ZZ0A 4DV0I 4Z7YA 2C37A 1IBME 2PNMA 4KHPE 4K0KE 3PS3A 4DUZI 2PO2A 4JI8I 4DV4I 4NXMI 4FW6A 2UUBI 4IZJD 2O1TA 4DV5E 5LMUI 4JI6I 1S16A 2HHHE 3Q1QA 2IOPA 4LF6I 2NN6F 4ZVIA 4DV1I 4DUYI 3T1YE 4DPTA 5K36F 2BV3A 4LOMA 2PO1B 4LFAI 5DRPA 5K36A 4EMDA 1J5EE 3OTOE 4USMA 2ZM6E 3PRYA 2C37B 2F1DA 1KKHA 1MU5A 3LNUA 4IFDF 4GKKI 5ELWA 4JI2I 4M1KA 2F4VI 2ZBKB 4MU4A 4LF4I 4DR6E 1RREA 2AE8A 4FN5A 4LF4E 2NPFA 2GO3A 3WU3A 5JEAF 1U2RA 1EI1A 1HR0I 2CVEA 2UXBE 4X66I 1R6LA 1USUA 4HY1A 1Z0BA 4FW9A 5FLXC 4DR7I 4OO1A 2ZITA 3WU4A 4LF8I 1HNZE 1VISA 2EFGA 4X64I 5C0XB 2O1UA 1XHKA 2HFSA 4IZJA 4IZJB 4U3DA 4B3RI 4NBQA 1ZM2A 3P76A 1Z0TA 1HK7A 4P52A 2XEXA 3PYFA 4IS9A 2HHHI 4YHHE 2WP8A 5JEAB 3PYDA 4DV6I 2V2ZA 1XMOE 4DV4E 1FI4A 3D4JA 2X7IA 2C39B 3H4LA 3P3EA 3Q6MA 3K85A 4MYUA 4JI0I 4JI0E 4JI4E 1ZM4A 4LFBI 5A2QQ 1E3PA 3J80Q 2VQFI 2UXBI 4LCGA 2OI2A 3ZKBA 3CDJA 4YY3I 4HACB 1RHYA 2NN6E 2WW4A 4DV6E 4DR6I 2UUCI 2Q2EB 1FKAE 1B63A 2VQEE 4ED4A 4USKA 3J81Q 4BA2A 1XNRE 1A6FA 4OO1D 3T1HE 1H73A 2NN6B 5DROA 4P7AA 1UDOA 2UXDI 1Z0GA 5C0XF 5K36C 4LF9I 3B4TA 2PO0B 4JI7I 2JT2A 2ZM6I 4DV7E 3GMEA 1K47A 5DRQA 4LF9E 2GS8A 1H74A 1Z5AA 2PO2B 4DV7I 3T1HI 1QZRA 5EL9A 4LFAE 3P3GA 4IFDD 1XXEA 2IESA 4JI7E 2BA0D 2VQEI 4DUYE 4BA1B 4DV1E 2Z5CA 4IFDC 3QT8A 1H72C 4JG4A 4JI6E 4DR3E 1HR0E 5JEAD 4DR3I 4QNJA 2AJ4A 4DU7A 4JI4I 5C0XD 2J7KA 4LF7I 2UUAI 1ZM9A 3WU6A 3PS1A 2JEBB 4LFBE 3V5RA 5LMNE 2E5LE 4FWHA 4DV0E 1UEKA 2PNZA 1J5EI 1N36E 5DNLA 5GMDA 2HKEA 3DD6A 4FW7A 2JE6B 5DRRA 4MU0A 2UXDE 4LF6E 1UDSA 2UXCE 1Z5BA 1N0VC 2NN6D 4YHHI 3T1YI 2O3ZA 3M85D
chains in the Genus database with same CATH topology
3K1JA 2UXCI 4YY3E 3B82A 5LMUE 1PVGA 2VQFE 1NZ0A 1HNZI 1IBMI 1ZM3A 3ZZUA 3QT6A 1Y6ZA 3ZM7A 1ELOA 4DUZE 4X64E 5LMNI 3J7AM 3ZKDA 1DARA 4K0KI 1PIEA 3F0NA 4DR1I 2UUAE 1Z59A 1XMOI 3V2UC 4JI3I 4X66E 2F4VE 4XTJA 5LL6R 1H7SA 1XMQE 5IWAI 4B3TI 1KTVA 2V2QA 3PYGA 3Q6NA 4JI2E 1HNWE 1MX0A 2CZ9A 4PU9A 4B3RE 3M6AA 3JAMQ 4LF8E 4UT4A 1FJGI 2BM1A 4URLA 4B3MI 2LJPA 1BKNA 4B3SE 3J81C 2UU9I 4OX9E 2Z5BA 3QT7A 2V34A 2PNLA 5IT9C 1KIJA 4LF5I 3HULA 2UUBE 4HYMA 1XNQI 4LFCE 1IBKI 4NXME 3JAMC 1N0UA 4KHPI 4GKKE 4AQYE 4JV5I 4DV3I 1WUUA 4JI1E 4FWGA 4I3HA 2A2CA 4JYAI 1MG7A 4HXZA 4DPUA 1I94E 4WUBA 2BM0A 4IZKB 5FWKA 3OTOI 4DR2I 1HNXE 1H7UA 1N34I 2HK3A 4GKJE 2HK2A 1FWLA 4MYTA 1N32E 4B3ME 2Z5EA 3HJCA 4FWDA 4NXNE 3GONA 4DV5I 3J80C 3LPSA 1Z0EA 4JI8E 4DPXA 1IBLE 3LTOA 3QT5A 4DR7E 4DR4E 1N33E 2DEJA 4IZKA 4DR5E 2X36A 4DPYA 4RPFA 5BR8I 4PRXA 4N3OA 1Z0VA 4DXLA 1N34E 4GKJI 4HACA 1HNXI 4Z7CA 4DR2E 2VF3A 1Y4SA 5A2QC 2HKJA 1D6TA 1FWKA 4JYAE 4X65I 4DR5I 4WUDA 4KQVA 4R1FA 5L3JA 4JV5E 1EA6A 4LFCI 3P06A 1ZXNA 4JI5E 1S4EA 1NHJA 4JI5I 4X62I 3ZZTA 4WUCA 4UTGA 1NHHA 1ZXMA 1N32I 3B8HA 1USVA 5IT9Q 1OJ4A 1I94I 4PRVA 2R3VA 1FJGE 1Z5CA 2DEIA 3PYEA 2E5LI 4AQYI 3CWVA 1PKPA 2GQ0A 4X65E 2O1VA 2CG9A 1HNWI 4LF7E 2O1WA 1IBKE 2E1RA 4JI1I 4DV3E 1XNQE 2Z5CB 2Z5BB 1XMQI 4B3TE 2V8PA 5BR8E 2V2VA 2UU9E 4OX9I 4B3SI 2IOQA 4X62E 4DR4I 4LF5E 1IBLI 1B62A 1Z0WA 2CGEA 4DV2E 1N33I 1RR9A 4NXNI 1KVKA 3K17A 1NHIA 2R42A 1Z0CA 2HFUA 2A2DA 4DU8A 5IWAE 5FLXQ 1FNMA 4DV2I 1XNRI 3B78A 2UUCE 1Y4UA 3WU5A 3J7AG 5GMEA 4DR1E 4DPWA 4JI3E 1N36I 3ZZ0A 4DV0I 4Z7YA 1IBME 2PNMA 4KHPE 4K0KE 4DUZI 4JI8I 4DV4I 4NXMI 2UUBI 4IZJD 2O1TA 4DV5E 5LMUI 4JI6I 1S16A 2HHHE 3Q1QA 2IOPA 4LF6I 4ZVIA 4DV1I 4DUYI 3T1YE 4DPTA 2BV3A 4LFAI 4EMDA 1J5EE 3OTOE 4USMA 2ZM6E 3PRYA 1KKHA 1MU5A 3LNUA 4GKKI 4JI2I 4M1KA 2F4VI 2ZBKB 4LF4I 4DR6E 1RREA 4FN5A 4LF4E 2NPFA 3WU3A 1U2RA 1EI1A 1HR0I 2UXBE 4X66I 1USUA 4HY1A 1Z0BA 4FW9A 5FLXC 4DR7I 2ZITA 3WU4A 4LF8I 1HNZE 1VISA 2EFGA 4X64I 2O1UA 1XHKA 2HFSA 4IZJA 4IZJB 4B3RI 1ZM2A 1Z0TA 1HK7A 4P52A 2XEXA 3PYFA 2HHHI 4YHHE 3PYDA 4DV6I 2V2ZA 1XMOE 4DV4E 1FI4A 3D4JA 2X7IA 3H4LA 3Q6MA 3K85A 4MYUA 4JI0I 4JI0E 4JI4E 1ZM4A 4LFBI 5A2QQ 2UXBI 3J80Q 2VQFI 2OI2A 3ZKBA 4YY3I 4HACB 2WW4A 4DV6E 4DR6I 2UUCI 2Q2EB 1FKAE 1B63A 2VQEE 4ED4A 4USKA 3J81Q 1XNRE 1A6FA 3T1HE 1H73A 4P7AA 2UXDI 1Z0GA 4LF9I 4JI7I 2ZM6I 4DV7E 1K47A 4LF9E 2GS8A 1H74A 1Z5AA 4DV7I 3T1HI 1QZRA 4LFAE 4JI7E 2VQEI 4DUYE 4DV1E 2Z5CA 3QT8A 1H72C 4JG4A 4JI6E 4DR3E 1HR0E 4DR3I 2AJ4A 4DU7A 4JI4I 2J7KA 4LF7I 2UUAI 1ZM9A 3WU6A 4LFBE 3V5RA 5LMNE 2E5LE 4FWHA 4DV0E 1UEKA 1J5EI 1N36E 5GMDA 2HKEA 2UXDE 4LF6E 2UXCE 1Z5BA 1N0VC 4YHHI 3T1YI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1J A;  2UXC I;  4YY3 E;  3B82 A;  5LMU E;  1PVG A;  2VQF E;  1NZ0 A;  1HNZ I;  1IBM I;  1ZM3 A;  3ZZU A;  3QT6 A;  3ZM7 A;  1ELO A;  4DUZ E;  4X64 E;  5LMN I;  3J7A M;  3ZKD A;  1DAR A;  4K0K I;  1PIE A;  3F0N A;  4DR1 I;  2UUA E;  1Z59 A;  1XMO I;  3V2U C;  4JI3 I;  4X66 E;  2F4V E;  4XTJ A;  5LL6 R;  1H7S A;  1XMQ E;  5IWA I;  4B3T I;  1KTV A;  2V2Q A;  3PYG A;  4JI2 E;  1HNW E;  1MX0 A;  2CZ9 A;  4PU9 A;  4B3R E;  3M6A A;  3JAM Q;  4LF8 E;  4UT4 A;  1FJG I;  2BM1 A;  4URL A;  4B3M I;  2LJP A;  1BKN A;  4B3S E;  3J81 C;  2UU9 I;  4OX9 E;  3QT7 A;  2V34 A;  5IT9 C;  1KIJ A;  4LF5 I;  3HUL A;  2UUB E;  4HYM A;  1XNQ I;  4LFC E;  1IBK I;  4NXM E;  3JAM C;  1N0U A;  4KHP I;  4GKK E;  4AQY E;  4JV5 I;  4JI1 E;  1WUU A;  4DV3 I;  4FWG A;  4I3H A;  2A2C A;  4JYA I;  1MG7 A;  4HXZ A;  4DPU A;  1I94 E;  4WUB A;  2BM0 A;  3OTO I;  4DR2 I;  1HNX E;  1H7U A;  1N34 I;  2HK3 A;  4GKJ E;  2HK2 A;  1FWL A;  4MYT A;  1N32 E;  4B3M E;  4FWD A;  4NXN E;  3GON A;  4DV5 I;  3J80 C;  3LPS A;  1Z0E A;  4JI8 E;  4DPX A;  1IBL E;  3LTO A;  3QT5 A;  4DR7 E;  4DR4 E;  1N33 E;  2DEJ A;  4DR5 E;  2X36 A;  4DPY A;  4RPF A;  5BR8 I;  4PRX A;  1Z0V A;  4DXL A;  1N34 E;  4GKJ I;  4HAC A;  1HNX I;  4Z7C A;  4DR2 E;  2VF3 A;  5A2Q C;  2HKJ A;  1D6T A;  1FWK A;  4JYA E;  4X65 I;  4DR5 I;  4WUD A;  4KQV A;  4R1F A;  5L3J A;  4JV5 E;  1EA6 A;  4LFC I;  1ZXN A;  4JI5 E;  1S4E A;  1NHJ A;  4JI5 I;  4X62 I;  3ZZT A;  4WUC A;  4UTG A;  1NHH A;  1ZXM A;  1N32 I;  3B8H A;  5IT9 Q;  1OJ4 A;  1I94 I;  4PRV A;  2R3V A;  1FJG E;  1Z5C A;  2DEI A;  3PYE A;  2E5L I;  4AQY I;  3CWV A;  1PKP A;  4X65 E;  1HNW I;  4LF7 E;  1IBK E;  2E1R A;  4JI1 I;  4DV3 E;  1XNQ E;  1XMQ I;  4B3T E;  2V8P A;  5BR8 E;  2V2V A;  2UU9 E;  4OX9 I;  4B3S I;  4X62 E;  4DR4 I;  4LF5 E;  1IBL I;  1B62 A;  1Z0W A;  4DV2 E;  1N33 I;  1RR9 A;  4NXN I;  1KVK A;  3K17 A;  1NHI A;  2R42 A;  1Z0C A;  2HFU A;  2A2D A;  4DU8 A;  5IWA E;  5FLX Q;  1FNM A;  4DV2 I;  1XNR I;  3B78 A;  2UUC E;  3WU5 A;  3J7A G;  5GME A;  4DR1 E;  4DPW A;  4JI3 E;  1N36 I;  3ZZ0 A;  4DV0 I;  4Z7Y A;  1IBM E;  4KHP E;  4K0K E;  4DUZ I;  4JI8 I;  4DV4 I;  4NXM I;  2UUB I;  4DV5 E;  5LMU I;  4JI6 I;  1S16 A;  2HHH E;  3Q1Q A;  4LF6 I;  4ZVI A;  4DV1 I;  4DUY I;  3T1Y E;  4DPT A;  2BV3 A;  4LFA I;  4EMD A;  1J5E E;  3OTO E;  4USM A;  2ZM6 E;  1KKH A;  1MU5 A;  3LNU A;  4GKK I;  4JI2 I;  4M1K A;  2F4V I;  2ZBK B;  4LF4 I;  4DR6 E;  1RRE A;  4FN5 A;  4LF4 E;  2NPF A;  3WU3 A;  1U2R A;  1EI1 A;  1HR0 I;  2UXB E;  4X66 I;  4HY1 A;  1Z0B A;  4FW9 A;  5FLX C;  4DR7 I;  2ZIT A;  3WU4 A;  4LF8 I;  1HNZ E;  1VIS A;  2EFG A;  4X64 I;  1XHK A;  2HFS A;  4B3R I;  1ZM2 A;  1Z0T A;  4P52 A;  2XEX A;  3PYF A;  2HHH I;  4YHH E;  3PYD A;  4DV6 I;  2V2Z A;  1XMO E;  4DV4 E;  1FI4 A;  3D4J A;  2X7I A;  3H4L A;  4MYU A;  4JI0 I;  4JI0 E;  4JI4 E;  1ZM4 A;  4LFB I;  5A2Q Q;  2UXB I;  3J80 Q;  2VQF I;  2OI2 A;  3ZKB A;  4YY3 I;  4HAC B;  2WW4 A;  4DV6 E;  4DR6 I;  2UUC I;  2Q2E B;  1FKA E;  1B63 A;  2VQE E;  4ED4 A;  4USK A;  3J81 Q;  1XNR E;  1A6F A;  3T1H E;  1H73 A;  4P7A A;  2UXD I;  1Z0G A;  4LF9 I;  4JI7 I;  2ZM6 I;  4DV7 E;  1K47 A;  4LF9 E;  2GS8 A;  1H74 A;  1Z5A A;  4DV7 I;  3T1H I;  1QZR A;  4LFA E;  4JI7 E;  2VQE I;  4DUY E;  4DV1 E;  3QT8 A;  1H72 C;  4JG4 A;  4JI6 E;  4DR3 E;  1HR0 E;  4DR3 I;  2AJ4 A;  4DU7 A;  4JI4 I;  2J7K A;  4LF7 I;  2UUA I;  1ZM9 A;  3WU6 A;  4LFB E;  3V5R A;  5LMN E;  2E5L E;  4FWH A;  4DV0 E;  1UEK A;  1J5E I;  1N36 E;  5GMD A;  2HKE A;  2UXD E;  4LF6 E;  2UXC E;  1Z5B A;  1N0V C;  4YHH I;  3T1Y I; 
#chains in the Genus database with same CATH topology
 3K1J A;  2UXC I;  4YY3 E;  3B82 A;  5LMU E;  1PVG A;  2VQF E;  1NZ0 A;  1HNZ I;  4AID A;  1IBM I;  4MQY A;  1ZM3 A;  2BA1 G;  3ZZU A;  1E3H A;  3QT6 A;  1Y6Z A;  3ZM7 A;  4OKG A;  1ELO A;  4DUZ E;  4X64 E;  5LMN I;  3J7A M;  3ZKD A;  1DAR A;  4K0K I;  1PIE A;  3F0N A;  4IFD B;  4DR1 I;  2UUA E;  1Z59 A;  1OYP A;  1XMO I;  3U1K A;  3V2U C;  4JI3 I;  4AM3 A;  4OZE A;  4X66 E;  2F4V E;  4XTJ A;  3GLL A;  5LL6 R;  1H7S A;  1XMQ E;  5IWA I;  4B3T I;  2PO0 A;  1KTV A;  2V2Q A;  1VI7 A;  3PYG A;  3Q6N A;  4JI2 E;  1HNW E;  2BA1 D;  1MX0 A;  2CZ9 A;  4PU9 A;  4B3R E;  2C38 B;  4QNK A;  3M6A A;  3JAM Q;  4LF8 E;  4UT4 A;  1FJG I;  4J3D A;  2BM1 A;  1R6M A;  4URL A;  4B3M I;  2LJP A;  4LCH A;  4LCF A;  1BKN A;  4B3S E;  3J81 C;  2UU9 I;  4OX9 E;  2Z5B A;  3QT7 A;  2V34 A;  2PNL A;  4FW3 A;  4FW5 A;  5IT9 C;  1KIJ A;  4MDT A;  4LF5 I;  3HUL A;  2UUB E;  4HYM A;  4BA2 B;  1XNQ I;  4LFC E;  1IBK I;  4NXM E;  3JAM C;  1N0U A;  3HKM A;  2JEB A;  4KHP I;  2NN6 C;  4GKK E;  3CDI A;  4AQY E;  4JV5 I;  4DV3 I;  1WUU A;  4JI1 E;  4FWG A;  4I3H A;  4MU1 A;  2A2C A;  4OO1 B;  4JYA I;  1MG7 A;  2C38 A;  3NZK A;  4HXZ A;  4DPU A;  1I94 E;  4WUB A;  2JE6 A;  2BM0 A;  4IZK B;  5FWK A;  1Y5Y A;  3H1C A;  3OTO I;  4DR2 I;  1HNX E;  1H7U A;  1N34 I;  2HK3 A;  4GKJ E;  2HK2 A;  1FWL A;  4MYT A;  1N32 E;  4OO1 C;  4B3M E;  2Z5E A;  4ISA A;  3HJC A;  4FWD A;  5K36 B;  4NXN E;  3GON A;  4DV5 I;  4FW4 A;  4IFD E;  3J80 C;  3LPS A;  1OYR A;  5C0X A;  3UHM A;  1Y60 A;  1Z0E A;  2PNZ B;  4JI8 E;  3PS2 A;  4DPX A;  2C39 A;  3P3C A;  1IBL E;  3LTO A;  3QT5 A;  4DR7 E;  4DR4 E;  1N33 E;  2DEJ A;  4IZK A;  4DR5 E;  2X36 A;  4DPY A;  3GCM A;  2WP8 B;  4RPF A;  5BR8 I;  4PRX A;  4N3O A;  1UDN A;  1YH8 A;  1Z0V A;  4DXL A;  4MU3 A;  1N34 E;  4GKJ I;  4HAC A;  1HNX I;  4Z7C A;  1YHC A;  4DR2 E;  2VF3 A;  1Y4S A;  5A2Q C;  2HKJ A;  2PO1 A;  1D6T A;  1FWK A;  4JYA E;  4X65 I;  4DR5 I;  2BA0 G;  4WUD A;  4KQV A;  2J65 A;  4R1F A;  5L3J A;  4JV5 E;  3U1Y A;  5DNX A;  2GO4 A;  2JEA A;  1EA6 A;  4LFC I;  3P06 A;  4GQU A;  5EKW A;  2JEA B;  1ZXN A;  4JI5 E;  3M7N G;  1S4E A;  1NHJ A;  4JI5 I;  4X62 I;  2IER A;  3ZZT A;  4WUC A;  4UTG A;  1NHH A;  1ZXM A;  1N32 I;  3B8H A;  1USV A;  5IT9 Q;  1OJ4 A;  3M7N D;  1I94 I;  4PRV A;  4OO1 F;  2R3V A;  1FJG E;  1Z5C A;  2WNR B;  2DEI A;  2WNR A;  3PYE A;  2BR2 A;  2E5L I;  4AQY I;  3CWV A;  4U3B A;  1PKP A;  2GQ0 A;  4X65 E;  2O1V A;  2CG9 A;  1HNW I;  4LF7 E;  4IFD A;  2O1W A;  1IBK E;  2E1R A;  3L7Z B;  4JI1 I;  4DV3 E;  1XNQ E;  2Z5C B;  4OO1 E;  2Z5B B;  1XMQ I;  4B3T E;  2V8P A;  5K36 D;  5BR8 E;  2V2V A;  5K36 E;  2UU9 E;  4OX9 I;  4B3S I;  1P42 A;  2IOQ A;  4X62 E;  4DR4 I;  4LF5 E;  1IBL I;  1B62 A;  2NN6 A;  1OYS A;  1Z0W A;  2CGE A;  4DV2 E;  5JEA C;  3M85 G;  1N33 I;  4LPF A;  4AIM A;  1RR9 A;  4NXN I;  2BR2 B;  1KVK A;  3K17 A;  1NHI A;  2R42 A;  3KRN A;  1Z0C A;  2HFU A;  2A2D A;  4DU8 A;  5IWA E;  5FLX Q;  1FNM A;  4DV2 I;  1XNR I;  3L7Z A;  3B78 A;  5C0X C;  5C0X E;  2VES A;  2UUC E;  1Y4U A;  5JEA E;  4BA1 A;  3WU5 A;  3J7A G;  5GME A;  4DR1 E;  1UDQ A;  4DPW A;  4JI3 E;  5JEA A;  1N36 I;  3ZZ0 A;  4DV0 I;  4Z7Y A;  2C37 A;  1IBM E;  2PNM A;  4KHP E;  4K0K E;  3PS3 A;  4DUZ I;  2PO2 A;  4JI8 I;  4DV4 I;  4NXM I;  4FW6 A;  2UUB I;  4IZJ D;  2O1T A;  4DV5 E;  5LMU I;  4JI6 I;  1S16 A;  2HHH E;  3Q1Q A;  2IOP A;  4LF6 I;  2NN6 F;  4ZVI A;  4DV1 I;  4DUY I;  3T1Y E;  4DPT A;  5K36 F;  2BV3 A;  4LOM A;  2PO1 B;  4LFA I;  5DRP A;  5K36 A;  4EMD A;  1J5E E;  3OTO E;  4USM A;  2ZM6 E;  3PRY A;  2C37 B;  2F1D A;  1KKH A;  1MU5 A;  3LNU A;  4IFD F;  4GKK I;  5ELW A;  4JI2 I;  4M1K A;  2F4V I;  2ZBK B;  4MU4 A;  4LF4 I;  4DR6 E;  1RRE A;  2AE8 A;  4FN5 A;  4LF4 E;  2NPF A;  2GO3 A;  3WU3 A;  5JEA F;  1U2R A;  1EI1 A;  1HR0 I;  2CVE A;  2UXB E;  4X66 I;  1R6L A;  1USU A;  4HY1 A;  1Z0B A;  4FW9 A;  5FLX C;  4DR7 I;  4OO1 A;  2ZIT A;  3WU4 A;  4LF8 I;  1HNZ E;  1VIS A;  2EFG A;  4X64 I;  5C0X B;  2O1U A;  1XHK A;  2HFS A;  4IZJ A;  4IZJ B;  4U3D A;  4B3R I;  4NBQ A;  1ZM2 A;  3P76 A;  1Z0T A;  1HK7 A;  4P52 A;  2XEX A;  3PYF A;  4IS9 A;  2HHH I;  4YHH E;  2WP8 A;  5JEA B;  3PYD A;  4DV6 I;  2V2Z A;  1XMO E;  4DV4 E;  1FI4 A;  3D4J A;  2X7I A;  2C39 B;  3H4L A;  3P3E A;  3Q6M A;  3K85 A;  4MYU A;  4JI0 I;  4JI0 E;  4JI4 E;  1ZM4 A;  4LFB I;  5A2Q Q;  1E3P A;  3J80 Q;  2VQF I;  2UXB I;  4LCG A;  2OI2 A;  3ZKB A;  3CDJ A;  4YY3 I;  4HAC B;  1RHY A;  2NN6 E;  2WW4 A;  4DV6 E;  4DR6 I;  2UUC I;  2Q2E B;  1FKA E;  1B63 A;  2VQE E;  4ED4 A;  4USK A;  3J81 Q;  4BA2 A;  1XNR E;  1A6F A;  4OO1 D;  3T1H E;  1H73 A;  2NN6 B;  5DRO A;  4P7A A;  1UDO A;  2UXD I;  1Z0G A;  5C0X F;  5K36 C;  4LF9 I;  3B4T A;  2PO0 B;  4JI7 I;  2JT2 A;  2ZM6 I;  4DV7 E;  3GME A;  1K47 A;  5DRQ A;  4LF9 E;  2GS8 A;  1H74 A;  1Z5A A;  2PO2 B;  4DV7 I;  3T1H I;  1QZR A;  5EL9 A;  4LFA E;  3P3G A;  4IFD D;  1XXE A;  2IES A;  4JI7 E;  2BA0 D;  2VQE I;  4DUY E;  4BA1 B;  4DV1 E;  2Z5C A;  4IFD C;  3QT8 A;  1H72 C;  4JG4 A;  4JI6 E;  4DR3 E;  1HR0 E;  5JEA D;  4DR3 I;  4QNJ A;  2AJ4 A;  4DU7 A;  4JI4 I;  5C0X D;  2J7K A;  4LF7 I;  2UUA I;  1ZM9 A;  3WU6 A;  3PS1 A;  2JEB B;  4LFB E;  3V5R A;  5LMN E;  2E5L E;  4FWH A;  4DV0 E;  1UEK A;  2PNZ A;  1J5E I;  1N36 E;  5DNL A;  5GMD A;  2HKE A;  3DD6 A;  4FW7 A;  2JE6 B;  5DRR A;  4MU0 A;  2UXD E;  4LF6 E;  1UDS A;  2UXC E;  1Z5B A;  1N0V C;  2NN6 D;  4YHH I;  3T1Y I;  2O3Z A;  3M85 D; 
#chains in the Genus database with same CATH homology
 3K1J A;  2UXC I;  4YY3 E;  3B82 A;  5LMU E;  1PVG A;  2VQF E;  1NZ0 A;  1HNZ I;  1IBM I;  1ZM3 A;  3ZZU A;  3QT6 A;  1Y6Z A;  3ZM7 A;  1ELO A;  4DUZ E;  4X64 E;  5LMN I;  3J7A M;  3ZKD A;  1DAR A;  4K0K I;  1PIE A;  3F0N A;  4DR1 I;  2UUA E;  1Z59 A;  1XMO I;  3V2U C;  4JI3 I;  4X66 E;  2F4V E;  4XTJ A;  5LL6 R;  1H7S A;  1XMQ E;  5IWA I;  4B3T I;  1KTV A;  2V2Q A;  3PYG A;  3Q6N A;  4JI2 E;  1HNW E;  1MX0 A;  2CZ9 A;  4PU9 A;  4B3R E;  3M6A A;  3JAM Q;  4LF8 E;  4UT4 A;  1FJG I;  2BM1 A;  4URL A;  4B3M I;  2LJP A;  1BKN A;  4B3S E;  3J81 C;  2UU9 I;  4OX9 E;  2Z5B A;  3QT7 A;  2V34 A;  2PNL A;  5IT9 C;  1KIJ A;  4LF5 I;  3HUL A;  2UUB E;  4HYM A;  1XNQ I;  4LFC E;  1IBK I;  4NXM E;  3JAM C;  1N0U A;  4KHP I;  4GKK E;  4AQY E;  4JV5 I;  4DV3 I;  1WUU A;  4JI1 E;  4FWG A;  4I3H A;  2A2C A;  4JYA I;  1MG7 A;  4HXZ A;  4DPU A;  1I94 E;  4WUB A;  2BM0 A;  4IZK B;  5FWK A;  3OTO I;  4DR2 I;  1HNX E;  1H7U A;  1N34 I;  2HK3 A;  4GKJ E;  2HK2 A;  1FWL A;  4MYT A;  1N32 E;  4B3M E;  2Z5E A;  3HJC A;  4FWD A;  4NXN E;  3GON A;  4DV5 I;  3J80 C;  3LPS A;  1Z0E A;  4JI8 E;  4DPX A;  1IBL E;  3LTO A;  3QT5 A;  4DR7 E;  4DR4 E;  1N33 E;  2DEJ A;  4IZK A;  4DR5 E;  2X36 A;  4DPY A;  4RPF A;  5BR8 I;  4PRX A;  4N3O A;  1Z0V A;  4DXL A;  1N34 E;  4GKJ I;  4HAC A;  1HNX I;  4Z7C A;  4DR2 E;  2VF3 A;  1Y4S A;  5A2Q C;  2HKJ A;  1D6T A;  1FWK A;  4JYA E;  4X65 I;  4DR5 I;  4WUD A;  4KQV A;  4R1F A;  5L3J A;  4JV5 E;  1EA6 A;  4LFC I;  3P06 A;  1ZXN A;  4JI5 E;  1S4E A;  1NHJ A;  4JI5 I;  4X62 I;  3ZZT A;  4WUC A;  4UTG A;  1NHH A;  1ZXM A;  1N32 I;  3B8H A;  1USV A;  5IT9 Q;  1OJ4 A;  1I94 I;  4PRV A;  2R3V A;  1FJG E;  1Z5C A;  2DEI A;  3PYE A;  2E5L I;  4AQY I;  3CWV A;  1PKP A;  2GQ0 A;  4X65 E;  2O1V A;  2CG9 A;  1HNW I;  4LF7 E;  2O1W A;  1IBK E;  2E1R A;  4JI1 I;  4DV3 E;  1XNQ E;  2Z5C B;  2Z5B B;  1XMQ I;  4B3T E;  2V8P A;  5BR8 E;  2V2V A;  2UU9 E;  4OX9 I;  4B3S I;  2IOQ A;  4X62 E;  4DR4 I;  4LF5 E;  1IBL I;  1B62 A;  1Z0W A;  2CGE A;  4DV2 E;  1N33 I;  1RR9 A;  4NXN I;  1KVK A;  3K17 A;  1NHI A;  2R42 A;  1Z0C A;  2HFU A;  2A2D A;  4DU8 A;  5IWA E;  5FLX Q;  1FNM A;  4DV2 I;  1XNR I;  3B78 A;  2UUC E;  1Y4U A;  3WU5 A;  3J7A G;  5GME A;  4DR1 E;  4DPW A;  4JI3 E;  1N36 I;  3ZZ0 A;  4DV0 I;  4Z7Y A;  1IBM E;  2PNM A;  4KHP E;  4K0K E;  4DUZ I;  4JI8 I;  4DV4 I;  4NXM I;  2UUB I;  4IZJ D;  2O1T A;  4DV5 E;  5LMU I;  4JI6 I;  1S16 A;  2HHH E;  3Q1Q A;  2IOP A;  4LF6 I;  4ZVI A;  4DV1 I;  4DUY I;  3T1Y E;  4DPT A;  2BV3 A;  4LFA I;  4EMD A;  1J5E E;  3OTO E;  4USM A;  2ZM6 E;  3PRY A;  1KKH A;  1MU5 A;  3LNU A;  4GKK I;  4JI2 I;  4M1K A;  2F4V I;  2ZBK B;  4LF4 I;  4DR6 E;  1RRE A;  4FN5 A;  4LF4 E;  2NPF A;  3WU3 A;  1U2R A;  1EI1 A;  1HR0 I;  2UXB E;  4X66 I;  1USU A;  4HY1 A;  1Z0B A;  4FW9 A;  5FLX C;  4DR7 I;  2ZIT A;  3WU4 A;  4LF8 I;  1HNZ E;  1VIS A;  2EFG A;  4X64 I;  2O1U A;  1XHK A;  2HFS A;  4IZJ A;  4IZJ B;  4B3R I;  1ZM2 A;  1Z0T A;  1HK7 A;  4P52 A;  2XEX A;  3PYF A;  2HHH I;  4YHH E;  3PYD A;  4DV6 I;  2V2Z A;  1XMO E;  4DV4 E;  1FI4 A;  3D4J A;  2X7I A;  3H4L A;  3Q6M A;  3K85 A;  4MYU A;  4JI0 I;  4JI0 E;  4JI4 E;  1ZM4 A;  4LFB I;  5A2Q Q;  2UXB I;  3J80 Q;  2VQF I;  2OI2 A;  3ZKB A;  4YY3 I;  4HAC B;  2WW4 A;  4DV6 E;  4DR6 I;  2UUC I;  2Q2E B;  1FKA E;  1B63 A;  2VQE E;  4ED4 A;  4USK A;  3J81 Q;  1XNR E;  1A6F A;  3T1H E;  1H73 A;  4P7A A;  2UXD I;  1Z0G A;  4LF9 I;  4JI7 I;  2ZM6 I;  4DV7 E;  1K47 A;  4LF9 E;  2GS8 A;  1H74 A;  1Z5A A;  4DV7 I;  3T1H I;  1QZR A;  4LFA E;  4JI7 E;  2VQE I;  4DUY E;  4DV1 E;  2Z5C A;  3QT8 A;  1H72 C;  4JG4 A;  4JI6 E;  4DR3 E;  1HR0 E;  4DR3 I;  2AJ4 A;  4DU7 A;  4JI4 I;  2J7K A;  4LF7 I;  2UUA I;  1ZM9 A;  3WU6 A;  4LFB E;  3V5R A;  5LMN E;  2E5L E;  4FWH A;  4DV0 E;  1UEK A;  1J5E I;  1N36 E;  5GMD A;  2HKE A;  2UXD E;  4LF6 E;  2UXC E;  1Z5B A;  1N0V C;  4YHH I;  3T1Y I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...