2F4VI

30s ribosome + designer antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vI00
2HHHI 4DPYA 1S4EA 1H72C 2R42A 1KVKA 1XMOI 5LMUE 4HACB 4DV0E 1KTVA 2ZBKB 2UXBI 4URLA 3QT5A 1Z0BA 5IT9Q 1ZXMA 1FKAE 3D4JA 4JI1I 2X36A 1MX0A 5A2QQ 2V2QA 2UXDE 3HULA 4MYTA 1XNQI 4DUZE 4JI7I 2R3VA 4DR7I 4K0KE 3B78A 3ZM7A 4DR2I 3QT7A 4LF4I 1XMQE 4LFAE 4DR4E 5BR8I 4JV5E 2UU9E 3ZKDA 4KHPI 4FWHA 1N34I 4JI4E 1Z0WA 3OTOE 4LFCE 1RREA 3WU6A 4B3RE 4YY3E 1HNWI 3JAMQ 4HY1A 4P52A 1N33E 4JI0E 3PYDA 4HXZA 1Z0CA 2E5LI 1KKHA 4ZVIA 2GS8A 4JI5E 1FJGI 1K47A 4B3TE 4DUYE 1Z5CA 4HYMA 4B3ME 3QT8A 3M6AA 2A2DA 1XNRI 1DARA 1VISA 4JI3E 4UT4A 4X62E 3JAMC 2BM0A 4DV4E 2VQFE 2ZM6I 3WU4A 2UXCI 4DV2I 1I94E 3GONA 4LF7I 4WUBA 4YHHI 1Z59A 2HK3A 4UTGA 4NXNI 4AQYE 3J81Q 4DU8A 4JI6E 4MYUA 1H73A 3LPSA 2NPFA 2UUBE 1D6TA 4JI8I 4DV3E 4FW9A 4LF9I 4R1FA 4DV5E 4DR3E 4NXMI 4EMDA 3T1HE 1J5EE 2ZITA 4LF5I 5GMDA 5LMNE 4X66I 2VQEI 4GKJI 2WW4A 4X64I 4PRXA 4LFAI 1RR9A 2X7IA 4Z7CA 3J81C 3WU3A 2UU9I 1U2RA 2J7KA 1N36I 1NHIA 1IBKI 4DV7I 2DEIA 2EFGA 4OX9E 2UUAE 1Z0TA 4YY3I 2F4VI 3ZZTA 2V2ZA 4B3SE 4JYAE 1FWKA 4DR5E 2E1RA 3T1YE 1IBLE 4JI2I 4LF8E 1Z5BA 1HNZI 1HNXI 1ELOA 2BV3A 1S16A 2A2CA 4USMA 5FLXQ 4JI5I 2HHHE 4LFBE 1ZM4A 1A6FA 3K17A 4DXLA 4X65I 1XMOE 3B82A 2UXBE 5IWAI 4DV4I 4GKKI 4JI1E 2HFSA 3H4LA 1ZM2A 3J80Q 1XNQE 3PYGA 1HR0I 1I94I 4DR6I 4DR7E 3CWVA 1KIJA 4DV1I 5FLXC 1NHHA 1PVGA 1N32I 5BR8E 1B63A 2V2VA 3B8HA 4PU9A 4KHPE 3J7AM 3LTOA 2HK2A 1HNWE 2UUCI 2V8PA 3J80C 4DV6I 3Q1QA 4DR1I 5GMEA 1Z5AA 3T1HI 1J5EI 1MU5A 1OJ4A 2V34A 1EA6A 4USKA 2E5LE 3V2UC 3LNUA 1PKPA 1IBME 5LMUI 4DV0I 2OI2A 3WU5A 1XNRE 4DU7A 2UXDI 4OX9I 4HACA 4DUZI 4K0KI 4Z7YA 4ED4A 4B3SI 2LJPA 4JYAI 2HFUA 4DV2E 1XMQI 4LF6E 4DR5I 2HKEA 4DR4I 4LF7E 3T1YI 4JV5I 4YHHE 3ZZ0A 4JI4I 3OTOI 4NXNE 4LFCI 4LFBI 4KQVA 4B3RI 1H74A 1N33I 2BM1A 4DPWA 1UEKA 4FWDA 4JI0I 1WUUA 2CZ9A 4JI8E 4LF9E 3J7AG 4WUCA 1NZ0A 1ZM9A 4DPUA 4NXME 2AJ4A 4LF5E 4B3TI 4DUYI 3PYEA 4FN5A 4X66E 2VQEE 4GKJE 4X64E 4B3MI 2HKJA 4JI3I 3K1JA 4X62I 1Z0EA 3ZZUA 2VQFI 1N36E 1IBKE 2Q2EB 5L3JA 4DV7E 4P7AA 4JI7E 5IT9C 2F4VE 4DPXA 3F0NA 4DR2E 1ZM3A 5A2QC 4LF4E 1PIEA 4DPTA 4JI2E 1B62A 1HNZE 1HNXE 4AQYI 1MG7A 1Z0VA 1N34E 4JI6I 5LL6R 1IBMI 4JG4A 2UUBI 4RPFA 4I3HA 4X65E 4DV3I 1XHKA 2VF3A 4WUDA 4DV5I 1FNMA 4DR3I 5IWAE 1Z0GA 1EI1A 4GKKE 1QZRA 3PYFA 5LMNI 4M1KA 1HR0E 1FJGE 4LF6I 4DR6E 4PRVA 2XEXA 4DV1E 2DEJA 1N0VC 1NHJA 1N32E 3QT6A 2UUAI 2ZM6E 1FI4A 2UXCE 4XTJA 3ZKBA 1H7SA 4FWGA 1BKNA 2UUCE 1IBLI 1FWLA 1ZXNA 4LF8I 1N0UA 4DV6E 4DR1E 3V5RA 1H7UA
chains in the Genus database with same CATH superfamily
2HHHI 4DPYA 1S4EA 1H72C 2R42A 2PO2A 4GQUA 1KVKA 1XMOI 5LMUE 4HACB 4DV0E 1KTVA 2ZBKB 2UXBI 2C39B 4URLA 3QT5A 1Z0BA 2JT2A 5IT9Q 1ZXMA 1FKAE 3D4JA 4JI1I 2X36A 2C38A 1MX0A 2PO0A 5A2QQ 2V2QA 2UXDE 3HULA 4MYTA 1XNQI 4DUZE 2JEAB 4JI7I 3P3EA 2R3VA 4DR7I 4K0KE 3B78A 3ZM7A 4DR2I 3QT7A 4LF4I 1XMQE 4LFAE 4OO1F 4DR4E 4FW7A 5BR8I 3P76A 2JE6A 4JV5E 1OYSA 5DNXA 5C0XC 2UU9E 3ZKDA 4KHPI 4FWHA 1N34I 4JI4E 1Z0WA 5DRPA 1USVA 1Y60A 3OTOE 5K36C 5C0XB 4OO1D 4LFCE 1RREA 3HJCA 3WU6A 5FWKA 4B3RE 4YY3E 2PO0B 1HNWI 3JAMQ 4HY1A 4P52A 3Q6NA 1N33E 2C37B 2IERA 4JI0E 3PYDA 2PNMA 4HXZA 1Z0CA 3P3GA 2E5LI 4IFDA 1KKHA 4ZVIA 5DRRA 2GS8A 4JI5E 1FJGI 1K47A 2PO1A 5DRQA 4B3TE 4DUYE 1Z5CA 5C0XF 4HYMA 4B3ME 3QT8A 3M6AA 3L7ZA 2A2DA 3NZKA 5C0XE 1XNRI 5K36F 1DARA 4BA2B 1VISA 3GLLA 4JI3E 4UT4A 4X62E 1Y4UA 3JAMC 2BM0A 3GMEA 2NN6A 5C0XD 2VQFE 4DV4E 2ZM6I 3WU4A 4IZJB 2UXCI 2BR2A 4DV2I 3P3CA 1I94E 3DD6A 3GONA 4LF7I 4WUBA 4YHHI 2CVEA 5JEAA 1Z59A 2HK3A 4UTGA 4NXNI 2Z5BA 4LOMA 4AQYE 3J81Q 4DU8A 2O3ZA 4JI6E 2CGEA 5DROA 4MYUA 1H73A 3LPSA 3P06A 2NPFA 2UUBE 1D6TA 4JI8I 4DV3E 1XXEA 4FW9A 2BR2B 4LF9I 3UHMA 5DNLA 2VESA 3B4TA 4R1FA 4DV5E 4OO1A 1UDOA 4DR3E 4IZJD 4NXMI 4MU1A 4EMDA 3T1HE 1J5EE 2ZITA 4LF5I 2AE8A 5GMDA 4IZKB 5LMNE 5EKWA 4X66I 2VQEI 4GKJI 2WW4A 4X64I 2JEBA 1Y4SA 4PRXA 2WNRA 4LFAI 2Z5BB 1RR9A 2X7IA 4Z7CA 3J81C 4IS9A 3WU3A 2UU9I 1U2RA 2J7KA 1N36I 2PNLA 1NHIA 1IBKI 4DV7I 2DEIA 2Z5EA 2EFGA 4OX9E 2UUAE 4MU3A 1Z0TA 4YY3I 2F4VI 3ZZTA 2V2ZA 4B3SE 4JYAE 1Y5YA 3M7NG 2IOPA 1H7UA 4AIDA 1YH8A 2Z5CA 1FWKA 4DR5E 2E1RA 2O1VA 3T1YE 4OZEA 1IBLE 4JI2I 4LF8E 2PO2B 1Z5BA 1HNZI 1HNXI 1ELOA 2BV3A 1S16A 2A2CA 5K36A 3H1CA 4USMA 2CG9A 5FLXQ 4BA1A 4JI5I 2HHHE 4LFBE 4N3OA 4NBQA 1ZM4A 2C38B 1A6FA 2GQ0A 4FW3A 3K17A 4DXLA 4X65I 4OKGA 1XMOE 2BA1G 3B82A 2UXBE 5IWAI 3M7ND 4DV4I 4GKKI 2Z5CB 4FW5A 2HFSA 4JI1E 3H4LA 1ZM2A 3J80Q 3HKMA 1XNQE 2JE6B 3PYGA 4MU4A 1HR0I 1I94I 4DR6I 4DR7E 3CWVA 1KIJA 2IOQA 4DV1I 5FLXC 1R6LA 1NHHA 1PVGA 1UDSA 1N32I 5BR8E 1B63A 2V2VA 3B8HA 4PU9A 4KHPE 2BA1D 1E3PA 4FW6A 3PRYA 4IFDC 3J7AM 3LTOA 2HK2A 1HNWE 4IFDB 2UUCI 3KRNA 2BA0D 2V8PA 3J80C 4DV6I 2PO1B 3Q1QA 4DR1I 4U3DA 5GMEA 1Z5AA 3L7ZB 3T1HI 1J5EI 1MU5A 1OJ4A 2V34A 1EA6A 4USKA 2J65A 2E5LE 3V2UC 2NN6C 5EL9A 3LNUA 1PKPA 1IBME 4AM3A 2PNZA 2NN6B 5LMUI 4DV0I 2OI2A 3PS2A 3WU5A 1XNRE 4DU7A 4IFDF 2O1TA 3PS1A 5JEAC 2O1UA 2UXDI 4IFDE 3CDIA 4OX9I 4HACA 4DUZI 1HK7A 5JEAB 4K0KI 2C39A 4Z7YA 4ED4A 4B3SI 2LJPA 3U1YA 4JYAI 4IFDD 2HFUA 4DV2E 1XMQI 4LF6E 1VI7A 4DR5I 2HKEA 4DR4I 4LF7E 3T1YI 4JV5I 2NN6F 4YHHE 2JEAA 3ZZ0A 4JI4I 2NN6E 3OTOI 4MQYA 4NXNE 4LFCI 4LFBI 4FW4A 4KQVA 4B3RI 1H74A 4OO1B 2NN6D 1N33I 2BM1A 4DPWA 5JEAF 3U1KA 1UEKA 4FWDA 4JI0I 1WUUA 4LCHA 5JEAE 2CZ9A 5C0XA 4JI8E 2JEBB 2WNRB 4LF9E 3GCMA 3J7AG 4WUCA 5JEAD 1NZ0A 1ZM9A 4DPUA 4NXME 2C37A 2AJ4A 4LF5E 4LCGA 4B3TI 4DUYI 3PYEA 4FN5A 4X66E 2VQEE 4GKJE 4X64E 4QNKA 4B3MI 4MDTA 2HKJA 4JI3I 3K1JA 4X62I 4OO1E 1Z0EA 3ZZUA 2VQFI 1N36E 1OYRA 2BA0G 1IBKE 2Q2EB 5L3JA 4DV7E 4P7AA 2WP8A 4JI7E 5IT9C 2F4VE 4BA2A 5K36B 4DPXA 3F0NA 4DR2E 1RHYA 1UDNA 1ZM3A 2IESA 5A2QC 4LF4E 4BA1B 1PIEA 4DPTA 3K85A 4IZJA 4JI2E 2O1WA 1B62A 1HNZE 1HNXE 4AQYI 1MG7A 1Z0VA 1N34E 4JI6I 5LL6R 1IBMI 1E3HA 3M85G 4QNJA 2GO3A 4JG4A 2UUBI 4U3BA 4RPFA 4I3HA 3Q6MA 4X65E 4DV3I 2WP8B 1XHKA 1R6MA 2VF3A 4WUDA 4DV5I 1FNMA 2F1DA 4MU0A 4DR3I 5IWAE 5K36E 1Z0GA 1EI1A 1YHCA 4GKKE 1QZRA 1P42A 3PYFA 4LPFA 5LMNI 5K36D 4M1KA 4LCFA 1HR0E 4LF6I 1FJGE 4DR6E 4PRVA 2XEXA 4ISAA 1Y6ZA 4DV1E 2DEJA 4AIMA 1N0VC 1NHJA 4IZKA 5ELWA 3M85D 1N32E 2GO4A 3QT6A 2UUAI 2ZM6E 1FI4A 2UXCE 4XTJA 1OYPA 3ZKBA 1H7SA 4FWGA 1BKNA 2UUCE 1IBLI 1FWLA 1ZXNA 4LF8I 1UDQA 1N0UA 4DV6E 2PNZB 4DR1E 1USUA 3V5RA 4J3DA 3CDJA 4OO1C 3PS3A
chains in the Genus database with same CATH topology
2HHHI 4DPYA 1S4EA 1H72C 2R42A 1KVKA 1XMOI 5LMUE 4HACB 4DV0E 1KTVA 2ZBKB 2UXBI 4URLA 3QT5A 1Z0BA 5IT9Q 1ZXMA 1FKAE 3D4JA 4JI1I 2X36A 1MX0A 5A2QQ 2V2QA 2UXDE 3HULA 4MYTA 1XNQI 4DUZE 4JI7I 2R3VA 4DR7I 4K0KE 3B78A 3ZM7A 4DR2I 3QT7A 4LF4I 1XMQE 4LFAE 4DR4E 5BR8I 4JV5E 2UU9E 3ZKDA 4KHPI 4FWHA 1N34I 4JI4E 1Z0WA 1USVA 3OTOE 4LFCE 1RREA 3HJCA 3WU6A 5FWKA 4B3RE 4YY3E 1HNWI 3JAMQ 4HY1A 4P52A 3Q6NA 1N33E 4JI0E 3PYDA 2PNMA 4HXZA 1Z0CA 2E5LI 1KKHA 4ZVIA 2GS8A 4JI5E 1FJGI 1K47A 4B3TE 4DUYE 1Z5CA 4HYMA 4B3ME 3QT8A 3M6AA 2A2DA 1XNRI 1DARA 1VISA 4JI3E 4UT4A 4X62E 1Y4UA 3JAMC 2BM0A 4DV4E 2VQFE 2ZM6I 3WU4A 4IZJB 2UXCI 4DV2I 1I94E 3GONA 4LF7I 4WUBA 4YHHI 1Z59A 2HK3A 4UTGA 4NXNI 2Z5BA 4AQYE 3J81Q 4DU8A 4JI6E 2CGEA 4MYUA 1H73A 3LPSA 3P06A 2NPFA 2UUBE 1D6TA 4JI8I 4DV3E 4FW9A 4LF9I 4R1FA 4DV5E 4DR3E 4IZJD 4NXMI 4EMDA 3T1HE 1J5EE 2ZITA 4LF5I 5GMDA 4IZKB 5LMNE 4X66I 2VQEI 4GKJI 2WW4A 4X64I 1Y4SA 4PRXA 4LFAI 2Z5BB 1RR9A 2X7IA 4Z7CA 3J81C 3WU3A 2UU9I 1U2RA 2J7KA 1N36I 2PNLA 1NHIA 1IBKI 4DV7I 2DEIA 2Z5EA 2EFGA 4OX9E 2UUAE 1Z0TA 4YY3I 2F4VI 3ZZTA 2V2ZA 4B3SE 4JYAE 2IOPA 2Z5CA 1FWKA 4DR5E 2E1RA 2O1VA 3T1YE 1IBLE 4JI2I 4LF8E 1Z5BA 1HNZI 1HNXI 1ELOA 2BV3A 1S16A 2A2CA 4USMA 2CG9A 5FLXQ 4JI5I 2HHHE 4LFBE 4N3OA 1ZM4A 1A6FA 2GQ0A 3K17A 4DXLA 4X65I 1XMOE 3B82A 2UXBE 5IWAI 4DV4I 4GKKI 2Z5CB 4JI1E 2HFSA 3H4LA 1ZM2A 3J80Q 1XNQE 3PYGA 1HR0I 1I94I 4DR6I 4DR7E 3CWVA 1KIJA 2IOQA 4DV1I 5FLXC 1NHHA 1PVGA 1N32I 5BR8E 1B63A 2V2VA 3B8HA 4PU9A 4KHPE 3PRYA 3J7AM 3LTOA 2HK2A 1HNWE 2UUCI 2V8PA 3J80C 4DV6I 3Q1QA 4DR1I 5GMEA 1Z5AA 3T1HI 1J5EI 1MU5A 1OJ4A 2V34A 1EA6A 4USKA 2E5LE 3V2UC 3LNUA 1PKPA 1IBME 5LMUI 4DV0I 2OI2A 3WU5A 1XNRE 4DU7A 2O1TA 2O1UA 2UXDI 4OX9I 4HACA 4DUZI 1HK7A 4K0KI 4Z7YA 4ED4A 4B3SI 2LJPA 4JYAI 2HFUA 4DV2E 1XMQI 4LF6E 4DR5I 2HKEA 4DR4I 4LF7E 3T1YI 4JV5I 4YHHE 3ZZ0A 4JI4I 3OTOI 4NXNE 4LFCI 4LFBI 4KQVA 4B3RI 1H74A 1N33I 2BM1A 4DPWA 1UEKA 4FWDA 4JI0I 1WUUA 2CZ9A 4JI8E 4LF9E 3J7AG 4WUCA 1NZ0A 1ZM9A 4DPUA 4NXME 2AJ4A 4LF5E 4B3TI 4DUYI 3PYEA 4FN5A 4X66E 2VQEE 4GKJE 4X64E 4B3MI 2HKJA 4JI3I 3K1JA 4X62I 1Z0EA 3ZZUA 2VQFI 1N36E 1IBKE 2Q2EB 5L3JA 4DV7E 4P7AA 4JI7E 5IT9C 2F4VE 4DPXA 3F0NA 4DR2E 1ZM3A 5A2QC 4LF4E 1PIEA 4DPTA 3K85A 4IZJA 4JI2E 2O1WA 1B62A 1HNZE 1HNXE 4AQYI 1MG7A 1Z0VA 1N34E 4JI6I 5LL6R 1IBMI 4JG4A 2UUBI 4RPFA 4I3HA 3Q6MA 4X65E 4DV3I 1XHKA 2VF3A 4WUDA 4DV5I 1FNMA 4DR3I 5IWAE 1Z0GA 1EI1A 4GKKE 1QZRA 3PYFA 5LMNI 4M1KA 1HR0E 1FJGE 4LF6I 4DR6E 4PRVA 2XEXA 1Y6ZA 4DV1E 2DEJA 1N0VC 1NHJA 4IZKA 1N32E 3QT6A 2UUAI 2ZM6E 1FI4A 2UXCE 4XTJA 3ZKBA 1H7SA 4FWGA 1BKNA 2UUCE 1IBLI 1FWLA 1ZXNA 4LF8I 1N0UA 4DV6E 4DR1E 1USUA 3V5RA 1H7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH I;  4DPY A;  1S4E A;  1H72 C;  2R42 A;  1KVK A;  1XMO I;  5LMU E;  4HAC B;  4DV0 E;  1KTV A;  2ZBK B;  2UXB I;  4URL A;  3QT5 A;  1Z0B A;  5IT9 Q;  1ZXM A;  1FKA E;  3D4J A;  4JI1 I;  2X36 A;  1MX0 A;  5A2Q Q;  2V2Q A;  2UXD E;  3HUL A;  4MYT A;  1XNQ I;  4DUZ E;  4JI7 I;  2R3V A;  4DR7 I;  4K0K E;  3B78 A;  3ZM7 A;  4DR2 I;  3QT7 A;  4LF4 I;  1XMQ E;  4LFA E;  4DR4 E;  5BR8 I;  4JV5 E;  2UU9 E;  3ZKD A;  4KHP I;  4FWH A;  1N34 I;  4JI4 E;  1Z0W A;  3OTO E;  4LFC E;  1RRE A;  3WU6 A;  4B3R E;  4YY3 E;  1HNW I;  3JAM Q;  4HY1 A;  4P52 A;  1N33 E;  4JI0 E;  3PYD A;  4HXZ A;  1Z0C A;  2E5L I;  1KKH A;  4ZVI A;  2GS8 A;  4JI5 E;  1FJG I;  1K47 A;  4B3T E;  4DUY E;  1Z5C A;  4HYM A;  4B3M E;  3QT8 A;  3M6A A;  2A2D A;  1XNR I;  1DAR A;  1VIS A;  4JI3 E;  4UT4 A;  4X62 E;  3JAM C;  2BM0 A;  4DV4 E;  2VQF E;  2ZM6 I;  3WU4 A;  2UXC I;  4DV2 I;  1I94 E;  3GON A;  4LF7 I;  4WUB A;  4YHH I;  1Z59 A;  2HK3 A;  4UTG A;  4NXN I;  4AQY E;  3J81 Q;  4DU8 A;  4JI6 E;  4MYU A;  1H73 A;  3LPS A;  2NPF A;  2UUB E;  1D6T A;  4JI8 I;  4DV3 E;  4FW9 A;  4LF9 I;  4R1F A;  4DV5 E;  4DR3 E;  4NXM I;  4EMD A;  3T1H E;  1J5E E;  2ZIT A;  4LF5 I;  5GMD A;  5LMN E;  4X66 I;  2VQE I;  4GKJ I;  2WW4 A;  4X64 I;  4PRX A;  4LFA I;  1RR9 A;  2X7I A;  4Z7C A;  3J81 C;  3WU3 A;  2UU9 I;  1U2R A;  2J7K A;  1N36 I;  1NHI A;  1IBK I;  4DV7 I;  2DEI A;  2EFG A;  4OX9 E;  2UUA E;  1Z0T A;  4YY3 I;  2F4V I;  3ZZT A;  2V2Z A;  4B3S E;  4JYA E;  1FWK A;  4DR5 E;  2E1R A;  3T1Y E;  1IBL E;  4JI2 I;  4LF8 E;  1Z5B A;  1HNZ I;  1HNX I;  1ELO A;  2BV3 A;  1S16 A;  2A2C A;  4USM A;  5FLX Q;  4JI5 I;  2HHH E;  4LFB E;  1ZM4 A;  1A6F A;  3K17 A;  4DXL A;  4X65 I;  1XMO E;  3B82 A;  2UXB E;  5IWA I;  4DV4 I;  4GKK I;  4JI1 E;  2HFS A;  3H4L A;  1ZM2 A;  3J80 Q;  1XNQ E;  3PYG A;  1HR0 I;  1I94 I;  4DR6 I;  4DR7 E;  3CWV A;  1KIJ A;  4DV1 I;  5FLX C;  1NHH A;  1PVG A;  1N32 I;  5BR8 E;  1B63 A;  2V2V A;  3B8H A;  4PU9 A;  4KHP E;  3J7A M;  3LTO A;  2HK2 A;  1HNW E;  2UUC I;  2V8P A;  3J80 C;  4DV6 I;  3Q1Q A;  4DR1 I;  5GME A;  1Z5A A;  3T1H I;  1J5E I;  1MU5 A;  1OJ4 A;  2V34 A;  1EA6 A;  4USK A;  2E5L E;  3V2U C;  3LNU A;  1PKP A;  1IBM E;  5LMU I;  4DV0 I;  2OI2 A;  3WU5 A;  1XNR E;  4DU7 A;  2UXD I;  4OX9 I;  4HAC A;  4DUZ I;  4K0K I;  4Z7Y A;  4ED4 A;  4B3S I;  2LJP A;  4JYA I;  2HFU A;  4DV2 E;  1XMQ I;  4LF6 E;  4DR5 I;  2HKE A;  4DR4 I;  4LF7 E;  3T1Y I;  4JV5 I;  4YHH E;  3ZZ0 A;  4JI4 I;  3OTO I;  4NXN E;  4LFC I;  4LFB I;  4KQV A;  4B3R I;  1H74 A;  1N33 I;  2BM1 A;  4DPW A;  1UEK A;  4FWD A;  4JI0 I;  1WUU A;  2CZ9 A;  4JI8 E;  4LF9 E;  3J7A G;  4WUC A;  1NZ0 A;  1ZM9 A;  4DPU A;  4NXM E;  2AJ4 A;  4LF5 E;  4B3T I;  4DUY I;  3PYE A;  4FN5 A;  4X66 E;  2VQE E;  4GKJ E;  4X64 E;  4B3M I;  2HKJ A;  4JI3 I;  3K1J A;  4X62 I;  1Z0E A;  3ZZU A;  2VQF I;  1N36 E;  1IBK E;  2Q2E B;  5L3J A;  4DV7 E;  4P7A A;  4JI7 E;  5IT9 C;  2F4V E;  4DPX A;  3F0N A;  4DR2 E;  1ZM3 A;  5A2Q C;  4LF4 E;  1PIE A;  4DPT A;  4JI2 E;  1B62 A;  1HNZ E;  1HNX E;  4AQY I;  1MG7 A;  1Z0V A;  1N34 E;  4JI6 I;  5LL6 R;  1IBM I;  4JG4 A;  2UUB I;  4RPF A;  4I3H A;  4X65 E;  4DV3 I;  1XHK A;  2VF3 A;  4WUD A;  4DV5 I;  1FNM A;  4DR3 I;  5IWA E;  1Z0G A;  1EI1 A;  4GKK E;  1QZR A;  3PYF A;  5LMN I;  4M1K A;  1HR0 E;  1FJG E;  4LF6 I;  4DR6 E;  4PRV A;  2XEX A;  4DV1 E;  2DEJ A;  1N0V C;  1NHJ A;  1N32 E;  3QT6 A;  2UUA I;  2ZM6 E;  1FI4 A;  2UXC E;  4XTJ A;  3ZKB A;  1H7S A;  4FWG A;  1BKN A;  2UUC E;  1IBL I;  1FWL A;  1ZXN A;  4LF8 I;  1N0U A;  4DV6 E;  4DR1 E;  3V5R A;  1H7U A; 
#chains in the Genus database with same CATH topology
 2HHH I;  4DPY A;  1S4E A;  1H72 C;  2R42 A;  2PO2 A;  4GQU A;  1KVK A;  1XMO I;  5LMU E;  4HAC B;  4DV0 E;  1KTV A;  2ZBK B;  2UXB I;  2C39 B;  4URL A;  3QT5 A;  1Z0B A;  2JT2 A;  5IT9 Q;  1ZXM A;  1FKA E;  3D4J A;  4JI1 I;  2X36 A;  2C38 A;  1MX0 A;  2PO0 A;  5A2Q Q;  2V2Q A;  2UXD E;  3HUL A;  4MYT A;  1XNQ I;  4DUZ E;  2JEA B;  4JI7 I;  3P3E A;  2R3V A;  4DR7 I;  4K0K E;  3B78 A;  3ZM7 A;  4DR2 I;  3QT7 A;  4LF4 I;  1XMQ E;  4LFA E;  4OO1 F;  4DR4 E;  4FW7 A;  5BR8 I;  3P76 A;  2JE6 A;  4JV5 E;  1OYS A;  5DNX A;  5C0X C;  2UU9 E;  3ZKD A;  4KHP I;  4FWH A;  1N34 I;  4JI4 E;  1Z0W A;  5DRP A;  1USV A;  1Y60 A;  3OTO E;  5K36 C;  5C0X B;  4OO1 D;  4LFC E;  1RRE A;  3HJC A;  3WU6 A;  5FWK A;  4B3R E;  4YY3 E;  2PO0 B;  1HNW I;  3JAM Q;  4HY1 A;  4P52 A;  3Q6N A;  1N33 E;  2C37 B;  2IER A;  4JI0 E;  3PYD A;  2PNM A;  4HXZ A;  1Z0C A;  3P3G A;  2E5L I;  4IFD A;  1KKH A;  4ZVI A;  5DRR A;  2GS8 A;  4JI5 E;  1FJG I;  1K47 A;  2PO1 A;  5DRQ A;  4B3T E;  4DUY E;  1Z5C A;  5C0X F;  4HYM A;  4B3M E;  3QT8 A;  3M6A A;  3L7Z A;  2A2D A;  3NZK A;  5C0X E;  1XNR I;  5K36 F;  1DAR A;  4BA2 B;  1VIS A;  3GLL A;  4JI3 E;  4UT4 A;  4X62 E;  1Y4U A;  3JAM C;  2BM0 A;  3GME A;  2NN6 A;  5C0X D;  2VQF E;  4DV4 E;  2ZM6 I;  3WU4 A;  4IZJ B;  2UXC I;  2BR2 A;  4DV2 I;  3P3C A;  1I94 E;  3DD6 A;  3GON A;  4LF7 I;  4WUB A;  4YHH I;  2CVE A;  5JEA A;  1Z59 A;  2HK3 A;  4UTG A;  4NXN I;  2Z5B A;  4LOM A;  4AQY E;  3J81 Q;  4DU8 A;  2O3Z A;  4JI6 E;  2CGE A;  5DRO A;  4MYU A;  1H73 A;  3LPS A;  3P06 A;  2NPF A;  2UUB E;  1D6T A;  4JI8 I;  4DV3 E;  1XXE A;  4FW9 A;  2BR2 B;  4LF9 I;  3UHM A;  5DNL A;  2VES A;  3B4T A;  4R1F A;  4DV5 E;  4OO1 A;  1UDO A;  4DR3 E;  4IZJ D;  4NXM I;  4MU1 A;  4EMD A;  3T1H E;  1J5E E;  2ZIT A;  4LF5 I;  2AE8 A;  5GMD A;  4IZK B;  5LMN E;  5EKW A;  4X66 I;  2VQE I;  4GKJ I;  2WW4 A;  4X64 I;  2JEB A;  1Y4S A;  4PRX A;  2WNR A;  4LFA I;  2Z5B B;  1RR9 A;  2X7I A;  4Z7C A;  3J81 C;  4IS9 A;  3WU3 A;  2UU9 I;  1U2R A;  2J7K A;  1N36 I;  2PNL A;  1NHI A;  1IBK I;  4DV7 I;  2DEI A;  2Z5E A;  2EFG A;  4OX9 E;  2UUA E;  4MU3 A;  1Z0T A;  4YY3 I;  2F4V I;  3ZZT A;  2V2Z A;  4B3S E;  4JYA E;  1Y5Y A;  3M7N G;  2IOP A;  1H7U A;  4AID A;  1YH8 A;  2Z5C A;  1FWK A;  4DR5 E;  2E1R A;  2O1V A;  3T1Y E;  4OZE A;  1IBL E;  4JI2 I;  4LF8 E;  2PO2 B;  1Z5B A;  1HNZ I;  1HNX I;  1ELO A;  2BV3 A;  1S16 A;  2A2C A;  5K36 A;  3H1C A;  4USM A;  2CG9 A;  5FLX Q;  4BA1 A;  4JI5 I;  2HHH E;  4LFB E;  4N3O A;  4NBQ A;  1ZM4 A;  2C38 B;  1A6F A;  2GQ0 A;  4FW3 A;  3K17 A;  4DXL A;  4X65 I;  4OKG A;  1XMO E;  2BA1 G;  3B82 A;  2UXB E;  5IWA I;  3M7N D;  4DV4 I;  4GKK I;  2Z5C B;  4FW5 A;  2HFS A;  4JI1 E;  3H4L A;  1ZM2 A;  3J80 Q;  3HKM A;  1XNQ E;  2JE6 B;  3PYG A;  4MU4 A;  1HR0 I;  1I94 I;  4DR6 I;  4DR7 E;  3CWV A;  1KIJ A;  2IOQ A;  4DV1 I;  5FLX C;  1R6L A;  1NHH A;  1PVG A;  1UDS A;  1N32 I;  5BR8 E;  1B63 A;  2V2V A;  3B8H A;  4PU9 A;  4KHP E;  2BA1 D;  1E3P A;  4FW6 A;  3PRY A;  4IFD C;  3J7A M;  3LTO A;  2HK2 A;  1HNW E;  4IFD B;  2UUC I;  3KRN A;  2BA0 D;  2V8P A;  3J80 C;  4DV6 I;  2PO1 B;  3Q1Q A;  4DR1 I;  4U3D A;  5GME A;  1Z5A A;  3L7Z B;  3T1H I;  1J5E I;  1MU5 A;  1OJ4 A;  2V34 A;  1EA6 A;  4USK A;  2J65 A;  2E5L E;  3V2U C;  2NN6 C;  5EL9 A;  3LNU A;  1PKP A;  1IBM E;  4AM3 A;  2PNZ A;  2NN6 B;  5LMU I;  4DV0 I;  2OI2 A;  3PS2 A;  3WU5 A;  1XNR E;  4DU7 A;  4IFD F;  2O1T A;  3PS1 A;  5JEA C;  2O1U A;  2UXD I;  4IFD E;  3CDI A;  4OX9 I;  4HAC A;  4DUZ I;  1HK7 A;  5JEA B;  4K0K I;  2C39 A;  4Z7Y A;  4ED4 A;  4B3S I;  2LJP A;  3U1Y A;  4JYA I;  4IFD D;  2HFU A;  4DV2 E;  1XMQ I;  4LF6 E;  1VI7 A;  4DR5 I;  2HKE A;  4DR4 I;  4LF7 E;  3T1Y I;  4JV5 I;  2NN6 F;  4YHH E;  2JEA A;  3ZZ0 A;  4JI4 I;  2NN6 E;  3OTO I;  4MQY A;  4NXN E;  4LFC I;  4LFB I;  4FW4 A;  4KQV A;  4B3R I;  1H74 A;  4OO1 B;  2NN6 D;  1N33 I;  2BM1 A;  4DPW A;  5JEA F;  3U1K A;  1UEK A;  4FWD A;  4JI0 I;  1WUU A;  4LCH A;  5JEA E;  2CZ9 A;  5C0X A;  4JI8 E;  2JEB B;  2WNR B;  4LF9 E;  3GCM A;  3J7A G;  4WUC A;  5JEA D;  1NZ0 A;  1ZM9 A;  4DPU A;  4NXM E;  2C37 A;  2AJ4 A;  4LF5 E;  4LCG A;  4B3T I;  4DUY I;  3PYE A;  4FN5 A;  4X66 E;  2VQE E;  4GKJ E;  4X64 E;  4QNK A;  4B3M I;  4MDT A;  2HKJ A;  4JI3 I;  3K1J A;  4X62 I;  4OO1 E;  1Z0E A;  3ZZU A;  2VQF I;  1N36 E;  1OYR A;  2BA0 G;  1IBK E;  2Q2E B;  5L3J A;  4DV7 E;  4P7A A;  2WP8 A;  4JI7 E;  5IT9 C;  2F4V E;  4BA2 A;  5K36 B;  4DPX A;  3F0N A;  4DR2 E;  1RHY A;  1UDN A;  1ZM3 A;  2IES A;  5A2Q C;  4LF4 E;  4BA1 B;  1PIE A;  4DPT A;  3K85 A;  4IZJ A;  4JI2 E;  2O1W A;  1B62 A;  1HNZ E;  1HNX E;  4AQY I;  1MG7 A;  1Z0V A;  1N34 E;  4JI6 I;  5LL6 R;  1IBM I;  1E3H A;  3M85 G;  4QNJ A;  2GO3 A;  4JG4 A;  2UUB I;  4U3B A;  4RPF A;  4I3H A;  3Q6M A;  4X65 E;  4DV3 I;  2WP8 B;  1XHK A;  1R6M A;  2VF3 A;  4WUD A;  4DV5 I;  1FNM A;  2F1D A;  4MU0 A;  4DR3 I;  5IWA E;  5K36 E;  1Z0G A;  1EI1 A;  1YHC A;  4GKK E;  1QZR A;  1P42 A;  3PYF A;  4LPF A;  5LMN I;  5K36 D;  4M1K A;  4LCF A;  1HR0 E;  4LF6 I;  1FJG E;  4DR6 E;  4PRV A;  2XEX A;  4ISA A;  1Y6Z A;  4DV1 E;  2DEJ A;  4AIM A;  1N0V C;  1NHJ A;  4IZK A;  5ELW A;  3M85 D;  1N32 E;  2GO4 A;  3QT6 A;  2UUA I;  2ZM6 E;  1FI4 A;  2UXC E;  4XTJ A;  1OYP A;  3ZKB A;  1H7S A;  4FWG A;  1BKN A;  2UUC E;  1IBL I;  1FWL A;  1ZXN A;  4LF8 I;  1UDQ A;  1N0U A;  4DV6 E;  2PNZ B;  4DR1 E;  1USU A;  3V5R A;  4J3D A;  3CDJ A;  4OO1 C;  3PS3 A; 
#chains in the Genus database with same CATH homology
 2HHH I;  4DPY A;  1S4E A;  1H72 C;  2R42 A;  1KVK A;  1XMO I;  5LMU E;  4HAC B;  4DV0 E;  1KTV A;  2ZBK B;  2UXB I;  4URL A;  3QT5 A;  1Z0B A;  5IT9 Q;  1ZXM A;  1FKA E;  3D4J A;  4JI1 I;  2X36 A;  1MX0 A;  5A2Q Q;  2V2Q A;  2UXD E;  3HUL A;  4MYT A;  1XNQ I;  4DUZ E;  4JI7 I;  2R3V A;  4DR7 I;  4K0K E;  3B78 A;  3ZM7 A;  4DR2 I;  3QT7 A;  4LF4 I;  1XMQ E;  4LFA E;  4DR4 E;  5BR8 I;  4JV5 E;  2UU9 E;  3ZKD A;  4KHP I;  4FWH A;  1N34 I;  4JI4 E;  1Z0W A;  1USV A;  3OTO E;  4LFC E;  1RRE A;  3HJC A;  3WU6 A;  5FWK A;  4B3R E;  4YY3 E;  1HNW I;  3JAM Q;  4HY1 A;  4P52 A;  3Q6N A;  1N33 E;  4JI0 E;  3PYD A;  2PNM A;  4HXZ A;  1Z0C A;  2E5L I;  1KKH A;  4ZVI A;  2GS8 A;  4JI5 E;  1FJG I;  1K47 A;  4B3T E;  4DUY E;  1Z5C A;  4HYM A;  4B3M E;  3QT8 A;  3M6A A;  2A2D A;  1XNR I;  1DAR A;  1VIS A;  4JI3 E;  4UT4 A;  4X62 E;  1Y4U A;  3JAM C;  2BM0 A;  4DV4 E;  2VQF E;  2ZM6 I;  3WU4 A;  4IZJ B;  2UXC I;  4DV2 I;  1I94 E;  3GON A;  4LF7 I;  4WUB A;  4YHH I;  1Z59 A;  2HK3 A;  4UTG A;  4NXN I;  2Z5B A;  4AQY E;  3J81 Q;  4DU8 A;  4JI6 E;  2CGE A;  4MYU A;  1H73 A;  3LPS A;  3P06 A;  2NPF A;  2UUB E;  1D6T A;  4JI8 I;  4DV3 E;  4FW9 A;  4LF9 I;  4R1F A;  4DV5 E;  4DR3 E;  4IZJ D;  4NXM I;  4EMD A;  3T1H E;  1J5E E;  2ZIT A;  4LF5 I;  5GMD A;  4IZK B;  5LMN E;  4X66 I;  2VQE I;  4GKJ I;  2WW4 A;  4X64 I;  1Y4S A;  4PRX A;  4LFA I;  2Z5B B;  1RR9 A;  2X7I A;  4Z7C A;  3J81 C;  3WU3 A;  2UU9 I;  1U2R A;  2J7K A;  1N36 I;  2PNL A;  1NHI A;  1IBK I;  4DV7 I;  2DEI A;  2Z5E A;  2EFG A;  4OX9 E;  2UUA E;  1Z0T A;  4YY3 I;  2F4V I;  3ZZT A;  2V2Z A;  4B3S E;  4JYA E;  2IOP A;  2Z5C A;  1FWK A;  4DR5 E;  2E1R A;  2O1V A;  3T1Y E;  1IBL E;  4JI2 I;  4LF8 E;  1Z5B A;  1HNZ I;  1HNX I;  1ELO A;  2BV3 A;  1S16 A;  2A2C A;  4USM A;  2CG9 A;  5FLX Q;  4JI5 I;  2HHH E;  4LFB E;  4N3O A;  1ZM4 A;  1A6F A;  2GQ0 A;  3K17 A;  4DXL A;  4X65 I;  1XMO E;  3B82 A;  2UXB E;  5IWA I;  4DV4 I;  4GKK I;  2Z5C B;  4JI1 E;  2HFS A;  3H4L A;  1ZM2 A;  3J80 Q;  1XNQ E;  3PYG A;  1HR0 I;  1I94 I;  4DR6 I;  4DR7 E;  3CWV A;  1KIJ A;  2IOQ A;  4DV1 I;  5FLX C;  1NHH A;  1PVG A;  1N32 I;  5BR8 E;  1B63 A;  2V2V A;  3B8H A;  4PU9 A;  4KHP E;  3PRY A;  3J7A M;  3LTO A;  2HK2 A;  1HNW E;  2UUC I;  2V8P A;  3J80 C;  4DV6 I;  3Q1Q A;  4DR1 I;  5GME A;  1Z5A A;  3T1H I;  1J5E I;  1MU5 A;  1OJ4 A;  2V34 A;  1EA6 A;  4USK A;  2E5L E;  3V2U C;  3LNU A;  1PKP A;  1IBM E;  5LMU I;  4DV0 I;  2OI2 A;  3WU5 A;  1XNR E;  4DU7 A;  2O1T A;  2O1U A;  2UXD I;  4OX9 I;  4HAC A;  4DUZ I;  1HK7 A;  4K0K I;  4Z7Y A;  4ED4 A;  4B3S I;  2LJP A;  4JYA I;  2HFU A;  4DV2 E;  1XMQ I;  4LF6 E;  4DR5 I;  2HKE A;  4DR4 I;  4LF7 E;  3T1Y I;  4JV5 I;  4YHH E;  3ZZ0 A;  4JI4 I;  3OTO I;  4NXN E;  4LFC I;  4LFB I;  4KQV A;  4B3R I;  1H74 A;  1N33 I;  2BM1 A;  4DPW A;  1UEK A;  4FWD A;  4JI0 I;  1WUU A;  2CZ9 A;  4JI8 E;  4LF9 E;  3J7A G;  4WUC A;  1NZ0 A;  1ZM9 A;  4DPU A;  4NXM E;  2AJ4 A;  4LF5 E;  4B3T I;  4DUY I;  3PYE A;  4FN5 A;  4X66 E;  2VQE E;  4GKJ E;  4X64 E;  4B3M I;  2HKJ A;  4JI3 I;  3K1J A;  4X62 I;  1Z0E A;  3ZZU A;  2VQF I;  1N36 E;  1IBK E;  2Q2E B;  5L3J A;  4DV7 E;  4P7A A;  4JI7 E;  5IT9 C;  2F4V E;  4DPX A;  3F0N A;  4DR2 E;  1ZM3 A;  5A2Q C;  4LF4 E;  1PIE A;  4DPT A;  3K85 A;  4IZJ A;  4JI2 E;  2O1W A;  1B62 A;  1HNZ E;  1HNX E;  4AQY I;  1MG7 A;  1Z0V A;  1N34 E;  4JI6 I;  5LL6 R;  1IBM I;  4JG4 A;  2UUB I;  4RPF A;  4I3H A;  3Q6M A;  4X65 E;  4DV3 I;  1XHK A;  2VF3 A;  4WUD A;  4DV5 I;  1FNM A;  4DR3 I;  5IWA E;  1Z0G A;  1EI1 A;  4GKK E;  1QZR A;  3PYF A;  5LMN I;  4M1K A;  1HR0 E;  1FJG E;  4LF6 I;  4DR6 E;  4PRV A;  2XEX A;  1Y6Z A;  4DV1 E;  2DEJ A;  1N0V C;  1NHJ A;  4IZK A;  1N32 E;  3QT6 A;  2UUA I;  2ZM6 E;  1FI4 A;  2UXC E;  4XTJ A;  3ZKB A;  1H7S A;  4FWG A;  1BKN A;  2UUC E;  1IBL I;  1FWL A;  1ZXN A;  4LF8 I;  1N0U A;  4DV6 E;  4DR1 E;  1USU A;  3V5R A;  1H7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...