4JI6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6E02
2L3CA 4PRVA 4WFTA 4GKJI 2HKJA 3T1YI 3H4LA 4JI7I 1XMQI 4M1KA 4DPYA 3ADJA 3ZKBA 4X62E 1MU5A 1RR9A 4YHHE 2B3TB 1ZXNA 1J5EE 2B7TA 1XNQE 2LRSA 4JV5I 1EKZA 4LF8I 2DB2A 4RPFA 4DV1I 2LUQA 1RC7A 1H72C 2DEJA 4DUYE 3B78A 4DV2I 1YYOA 1RREA 4X62I 3PYEA 2RS7A 4YHHI 1IBKE 3WU4A 2UXDE 1N0VC 2HHHE 2N3HA 2NA2A 5LMUE 3ZZUA 3JAMQ 4B3SE 1N32E 4K0KE 1K47A 1BKNA 1GQEA 4LF7E 3T1HE 3PYDA 4DUYI 4HACA 1N34E 2ZBKB 3HTXA 1FWLA 1MX0A 3LPSA 2EZ6A 4YY3I 2UXDI 1PKPA 2V2ZA 5IWAE 4NXNE 4WYQB 5LMUI 1D6TA 4B3SI 2X36A 4K0KI 4KHPE 4LF7I 3T1HI 3PYFA 1IBLI 1KKHA 2LTRA 2Q2EB 2LJPA 3D4JA 4DV0I 4WUCA 1N0UA 5IWAI 4LF9E 1H7UA 4NXNI 2VQEE 1WHNA 3JAMC 1Z0CA 4P7AA 2V8PA 2UUCI 4KHPI 2F4VI 4OX9E 4DPXA 1Z5BA 2MDRA 4URLA 3GONA 1UHZA 2R3VA 2LTSA 4GKKI 2UXBE 2A2DA 4FWGA 1ZBTA 4DU8A 3V2UC 2VQEI 2NUEA 4AQYE 4LF8E 2V34A 1N36I 4WUDA 4HY1A 4DV1E 1Z0GA 3J81Q 4JI5I 4WUBA 4DV2E 3B8HA 1NHJA 4B3ME 4B3TE 1NZ0A 4OX9I 3J7AM 4DUZI 1QU6A 2UUAE 3P1XA 5FLXQ 2GS8A 2LJHA 4JI4E 4PRXA 2UXBI 4EMDA 4DPWA 4AQYI 1J26A 1FKAE 4P52A 1STUA 4LF9I 2EFGA 2YT4A 4B3MI 4B3TI 4DR5E 4YY3E 1S4EA 4X64I 4FN5A 2UUAI 1Z5AA 1S16A 5LMNI 4DR2E 2RS6A 4XTJA 4DV7E 2L2KB 4DV3I 3WU6A 4JI4I 2VF3A 2HFSA 4HYMA 3M6AA 3OTOE 1IBME 4LFCI 4JI0E 3J81C 1X47A 2HK2A 4FWHA 4ED4A 3ADLA 2HK3A 1IBLE 4LF5E 4DKKA 5BR8E 1FI4A 1ELOA 4DR5I 2KHXA 2J7KA 3QT5A 4DV0E 4ZVIA 4DU7A 1N33I 5FLXC 4MYTA 4DR2I 2ZM6E 4I3HA 4DV7I 4JI6E 3OTOI 1IBMI 4JG4A 1I94E 4JI0I 2UUCE 2F4VE 2XEXA 4JI1E 1Z0BA 4LF5I 2CZ9A 2VQFI 4UT4A 4FW9A 3QT7A 2UXCI 1YYWA 5BR8I 4USMA 4X66E 4DR6E 4DR3I 4DR7E 2X7IA 5A2QQ 4GKKE 1HR0E 2ZITA 2ZM6I 4DPUA 2V2VA 3K1JA 2IHR1 2AJ4A 4LFBE 1U2RA 4JI6I 1KVKA 1N36E 1Z59A 4UTGA 4JYAI 1I94I 2BM1A 4JI5E 1NHIA 4M2ZA 4JI1I 2DMYA 4DR1I 3ZM7A 4DV6I 1ZM2A 1Z5CA 2NPFA 4X66I 4DR6I 2HFUA 2L2NA 4DR7I 3LNUA 1Z0EA 2HKEA 4DUZE 3LTOA 3J7Yp 1EI1A 3K17A 3ZKDA 1HR0I 3C4BA 2L3JA 1DARA 4LFBI 2DEIA 1HNWE 4LFAE 1FJGI 1ZM4A 1X48A 3J80Q 2NUGA 1UILA 4JI8E 2JVAA 1FWKA 3CWVA 2BV3A 5GMEA 1XNRE 4X64E 5A2QC 1YZ9A 5LMNE 5CFFE 5GMDA 4Z7YA 4DV3E 4JI2I 3ADGA 4DV5E 1B63A 1MG7A 2WW4A 4LFCE 2JY9A 2E1RA 4JI3I 1HNWI 4LFAI 4DR4E 5L3JA 1KTVA 2CPNA 1Z0WA 1XMOE 3LLHA 4JI8I 4DV4I 1KIJA 4HXZA 1DI2A 1N33E 1HNXE 1Z0VA 1Z0TA 1XNRI 4PU9A 2V2QA 1UEKA 2B7VA 3HULA 4DV5I 3B82A 1X49A 3Q1QA 4X65E 4DPTA 5IT9Q 3ADIA 4B3RE 4DR4I 3J80C 1ZM9A 1T4OA 1FNMA 2VQFE 1XMOI 2UXCE 1EA6A 4DR3E 1J5EI 2NUFA 2LUPB 3ZZTA 1PIEA 1HNZE 3VYXA 1OJ4A 1HNXI 1XNQI 1WHQA 2L33A 2BM0A 4R1FA 1QZRA 4X65I 4JYAE 2L2MA 2OI2A 1RQ0A 4B3RI 3VYYA 1WUUA 3ZZ0A 4DR1E 3WU5A 2RTXA 4DV6E 1IBKI 3WU3A 2E5LE 4USKA 2HHHI 4M30A 3QT8A 1HNZI 1ZXMA 1PVGA 1O0WA 1XHKA 4KQVA 4FWDA 1YYKA 1N32I 4LF6E 2N3GA 4NXME 2DIXA 1FJGE 1N34I 4LF4E 1NHHA 5IT9C 4X8WA 3PYGA 4MYUA 2RSMA 1ZM3A 2UU9E 2UUBE 2E5LI 3C4TA 3V5RA 2A2CA 4GKJE 4JI2E 3T1YE 1H74A 4OOGC 3J7AG 4JI7E 2LBSB 3QT6A 1XMQE 1T4NA 4LF6I 1VISA 4JI3E 4NXMI 2R42A 5LL6R 4LF4I 1A6FA 1H73A 1H7SA 4HACB 4DXLA 4DV4E 4Z7CA 3F0NA 2UU9I 2UUBI 1B62A 1T4LB 4JV5E
chains in the Genus database with same CATH superfamily
2L3CA 3P3EA 5DRQA 2GO3A 3EPLA 2EOMA 2M9AA 2MDGA 4R2QA 4WFTA 4TUGA 3P3GA 4PRVA 4GKJI 1A1IA 2HKJA 3T1YI 3H4LA 1ZAAC 4HEIA 3F6HA 2EM3A 3LMLA 2Z5BA 5C0XE 4JI7I 4WPYA 1XMQI 5DROA 4O24A 4AIDA 2BA1D 2C38B 4M1KA 3MSWA 4DPYA 4IZJA 2ENCA 3ADJA 3ZKBA 4X62E 1MU5A 1OYRA 1RR9A 4OO1E 4YHHE 1A1GA 2PNMA 2B3TB 1ZXNA 2BB8A 3VK6A 1J5EE 2YSOA 2B7TA 2CT1A 2EMXA 2YTOA 2M1SA 3H09A 1A1JA 2ELZA 1XNQE 3MHSC 2LRSA 4R2AA 2BA0G 2GQ0A 4JV5I 4MU0A 2EL5A 3FIGA 1WXRA 1EKZA 2V89A 4LF8I 2DB2A 3M99B 4RPFA 4IFDE 4MU1A 2VRDA 2PO2B 3L7ZB 4DV1I 2ADRA 2LUQA 1RC7A 3PS2A 1H72C 2DEJA 5C0XB 4DUYE 5AE1A 3B78A 2G7HA 2JEAA 4DV2I 1YYOA 2JEBB 1RREA 5T6JA 1ZR9A 2FV4B 4X62I 3IWBA 4ZYEA 1ZBQA 2LMZA 5JEAB 1XXEA 3PYEA 2EOHA 2RS7A 2YU8A 1IBKE 1RHYA 3NZKA 3WU4A 2UXDE 2CGEA 2V8QB 4YHHI 4MU4A 4OO1B 1N0VC 5FWKA 2HHHE 2EPZA 2N3HA 2BBGA 4LPFA 2NA2A 5LMUE 2EPOA 1G2FC 3ZZUA 1X3CA 2EQ1A 3JAMQ 4LTYA 3M7NG 4B3SE 1N32E 4K0KE 1K47A 1IQSA 1BKNA 4P78A 1GQEA 1UDOA 4MQYA 4LF7E 3T1HE 2L6MA 4AIMA 4IFDB 3TQMA 1Y5YA 5KL6A 1YSAC 3PYDA 4HACA 1N34E 1N3GA 2EMYA 2ZBKB 4DUYI 3HTXA 2DLKA 1FWLA 1MX0A 2WNRB 2WBUA 4R2PA 3RMPA 3LPSA 2EMGA 2EN4A 2EM6A 2EZ6A 4YY3I 5AC5A 2UXDI 2YTGA 5A6AA 4M0VA 1PKPA 2NN6F 2EPKX 1BBGA 5IWAE 2V2ZA 4IZJD 4NXNE 4WYQB 2HGHA 5C0XC 5LMUI 3VHTB 2Z5EA 1TN9A 1D6TA 2L8TA 2C38A 4B3SI 2EM5A 2EPAA 2X36A 3PS1A 4K0KI 4KHPE 4LF7I 3T1HI 2EQ0A 3PYFA 2YSPA 1IBLI 2I9IA 1T39A 2EM0A 1KKHA 2B9DA 2BR2B 2LTRA 4WSPA 2Q2EB 1DQ3A 2LJPA 3D4JA 4DV0I 2GPIA 5DNXA 3HPSA 4WUCA 1N0UA 4FW3A 5IWAI 4LF9E 1H7UA 4NXNI 1AAYA 4IFDC 2VQEE 2DLQA 2ODRD 2PO2A 3L7ZA 3EQ1A 4WX9A 4DMIA 1WHNA 3JAMC 1Z0CA 4P7AA 4GQUA 2V8PA 5C0XA 4O5GA 3C6MA 3EPKA 5DNLA 4RH8A 2JEBA 4O43A 2NN6E 3JTZA 1PDAA 3BF2A 2UUCI 2F4VI 4KHPI 1TF6A 1UDNA 4OX9E 2CTDA 2J65A 4DPXA 5JEAA 2JWOA 1Z5BA 1BB8A 2MDRA 4IJDA 1R6MA 4P7DA 4URLA 3GONA 1E3HA 4OO1A 1UHZA 4MLVA 1GTKA 4BC7A 5IV8B 3L00A 1EH6A 2R3VA 2LTSA 3ZOQB 4GKKI 2RPCA 5A6KA 2UXBE 4L8NA 1OYSA 3EPHA 2A2DA 4FWGA 1ZBTA 4DU8A 2LT7A 4NBQA 3V2UC 2VQEI 4LCGA 2NUEA 4AQYE 4LF8E 2V34A 1N36I 4IFDA 4WUDA 2EPMX 4HY1A 4DV1E 5LLQA 1Z0GA 4IZKB 3J81Q 3BBGA 1UDQA 4JI5I 3M85D 4WUBA 4N4RB 4DV2E 3B8HA 1NHJA 4B3ME 2NN6B 2WNRA 1P47A 4B3TE 1NZ0A 2EM4A 4OX9I 2YU5A 2LO3A 4ZYDA 2YTNA 2JP9A 4FW5A 4MU3A 1IQOA 1IMUA 2M7QA 4ZYGA 4LCHA 4ISAA 3J7AM 1YHCA 1P42A 3U1YA 1QU6A 2UUAE 4DUZI 3P1XA 5FLXQ 2GS8A 2V85A 2LJHA 1QNTA 4JI4E 2EMCA 4PRXA 2PO1B 2UXBI 4EMDA 4TUIA 4HTGA 3JU0A 2O1VA 4DPWA 4AQYI 3KZZA 4BS9A 2EN8A 2WBTA 3Q6MA 1J26A 3PS3A 3K85A 1FKAE 4P52A 1STUA 2BR2A 2BA1G 3THNA 4LF9I 2EFGA 2YT4A 2VF1A 3M85G 4B3MI 2JT2A 1HK7A 5K36C 1KYQA 4B3TI 1RMDA 5KL4A 1Y60A 4DR5E 2EN3A 4YY3E 5C0XD 2MKDA 2N8XA 1S4EA 2YTPA 4X64I 2JOXA 4FN5A 4J8ZA 2UUAI 2PO0B 1S16A 1Z5AA 4ZYHA 4DR2E 2RS6A 5LMNI 4N3OA 4XTJA 4DV7E 2L2KB 4DV3I 3WU6A 2WBSA 2VF3A 5JEAD 4JI4I 2HFSA 1TF3A 4HYMA 3M6AA 3HPZA 3OTOE 2EM9A 4O4KA 4F9AB 1IBME 2MC6A 2YTEA 2NN6C 3GMEA 4LFCI 2R76A 2EMBA 4OO1D 4JI0E 4BA2B 1NCSA 3J81C 5K36F 1X47A 2HK2A 4FWHA 4GZNC 2EPXA 2LJUA 1Y4UA 4ED4A 4I8OA 4F9BB 3ADLA 2HK3A 2JYAA 1IBLE 4LF5E 4IS1C 2DGCA 4DKKA 4NHRA 5BR8E 4IFDD 1FI4A 1ELOA 4U3BA 4DR5I 2KHXA 2J7KA 2A25A 2H36X 4DV0E 3QT5A 4ZVIA 4DU7A 1N33I 2O3ZA 2EOXA 5FLXC 2C39B 4BHCA 3GLLA 4MYTA 4DR2I 2KOUA 2ZM6E 1E3PA 4I3HA 2CVEA 4DV7I 1JK1A 1F2IG 5A69A 4JI6E 4IZKA 3OTOI 2MKNA 1IBMI 4R2DA 4JG4A 1I94E 5EL9A 4JI0I 2JE6B 3U1KA 2UUCE 2NN6A 2F4VE 2XEXA 2EOOA 3QG5C 2EOZA 5A6JA 1X6FA 2EOYA 4JI1E 1Z0BA 1A1LA 2CZ9A 2RSIA 2GO4A 2EMAA 2VQFI 2C37B 4UT4A 4FW9A 3QT7A 2UXCI 4J3DA 1YYWA 5BR8I 4USMA 5K36E 4X66E 2WCC3 4DR6E 4DR3I 4DR7E 2LVHA 2X7IA 1WRJA 5A2QQ 5DNYA 2EWLA 2EPCA 2PO1A 2EM2A 4GKKE 2CSHA 1HR0E 4BA1B 2ZITA 3ECRA 2ZM6I 4DPUA 2V2VA 2EMIA 2IHR1 2AJ4A 3K1JA 4LFBE 1U2RA 4JI6I 1KVKA 1N36E 3MHHC 3CDIA 2YTJA 2EL6A 1Z59A 4UTGA 4JYAI 1I94I 1UN6B 2BM1A 4JI5E 2EMHA 1NHIA 4OZEA 2V86A 4M2ZA 2GLIA 4JI1I 2DMYA 2IERA 4DR1I 3ZM7A 4QNKA 2D9HA 2EE8A 1VI7A 4DV6I 1ZM2A 1OYPA 4AM3A 2NABA 3HJCA 2YTQA 1Z5CA 2MC5A 3HQ1A 2O1TA 2NPFA 2YWQA 3GCMA 2HFUA 2EMZA 4X66I 2PNLA 2PO0A 2L2NA 4DR6I 4DR7I 3LNUA 2YRHA 1Z0EA 4DUZE 1YUJA 2HKEA 3J7Yp 3LTOA 5K36B 3HKMA 1EI1A 2EMKA 4F6NA 3K17A 3ZKDA 1HR0I 4LU9A 2FGGA 3C4BA 4LOMA 2L3JA 3DJWA 1DARA 4F9CB 2EN2A 4BA2A 4LFBI 2V88A 5IXMB 1UDSA 2PNZB 2DEIA 1HNWE 4LFAE 1KJKA 4R2SA 1FJGI 1ZM4A 2EL4A 4R2EA 1X48A 2J7JA 4FW7A 3J80Q 1MEYC 2V87A 2NUGA 4X9JA 1GZ6A 1UILA 2EMLA 1L4SA 4JI8E 1EH7A 2JVAA 1FWKA 2LV2A 3CWVA 2YTDA 4R2RA 2BV3A 1DGCA 5GMEA 1XNRE 2C39A 2NN6D 2EN6A 2EPNA 4X64E 1NEIA 2E1MA 5A2QC 2IESA 1YZ9A 5LMNE 2RQLA 5CFFE 5GMDA 4Z7YA 2YZTA 4DV3E 4BHBA 4JI2I 2R1FA 3ADGA 3DF6A 4WXCA 4DV5E 1UBDC 2HC5A 2AE8A 1B63A 1MG7A 2WW4A 4F6MA 4LFCE 2JY9A 2E1RA 2JE6A 5DRPA 4BCAA 4JI3I 1HNWI 2Q8UA 4LFAI 2GHFA 2JXPA 2ODRC 4KWYA 2JR1A 4DR4E 5L3JA 1KTVA 4BMJA 2C37A 2CPNA 1Z0WA 4LCFA 5JEAE 1YPNA 3LLHA 1XMOE 4JI8I 2ENAA 4DV4I 1EH8A 1YFHA 2VE7C 1KIJA 3DD6A 3H1CA 2EPUA 2DMIA 4IS9A 2EN1A 5AE3A 1Z1BA 2EM8A 4HXZA 1PJSA 2K4VA 1DI2A 1N33E 1HNXE 2ELYA 1Z0VA 3K6QA 1Z0TA 4BA1A 4WXDA 4PU9A 1XNRI 3AV0A 2V2QA 3PRYA 3EPJA 1UEKA 3UHMA 3M7ND 4BC9A 4FK5C 4U3DA 2B7VA 1B69A 2WP8B 3HULA 2K7IA 4DV5I 4Q28A 2EORA 3KWRA 1USUA 3B82A 1X49A 3Q1QA 4X65E 4DPTA 5IT9Q 5KL7A 3ADIA 4B3RE 2CG9A 3J80C 4DR4I 1YH8A 1ZM9A 1T4OA 1FNMA 5EKWA 2VQFE 4RHBB 5KL2A 1XMOI 2EOEA 1YUIA 2YTFA 3BGHA 2UXCE 3AUZA 1G2DC 1WJPA 1EA6A 5K36A 5TSEA 4DR3E 1J5EI 1PJTA 2EN7A 4MLQA 5KL3A 1BBOA 2NUFA 2LUPB 2DRPA 2Z5CB 1PIEA 2EP3A 1HNZE 3ZZTA 3VYXA 2HJJA 1OJ4A 4Q35B 1SR9A 1HNXI 3THOB 5ELWA 1XNQI 5AASA 2FTXB 3P3CA 1WHQA 3KZYA 2PNZA 1X5WA 2L33A 4WSGA 2EOJA 2EPRA 2YRKA 5ADZA 5AE2A 2BM0A 3F6GA 1QZRA 4OKGA 2Z5BB 4R1FA 4LF5I 2ENHA 2JOBA 4X65I 3IWCA 2L2MA 4JYAE 2IOPA 4GEQB 2OI2A 1RQ0A 1R6LA 1A1KA 5A6BA 4B3RI 3VYYA 3P06A 2DSYA 2EM7A 2L92A 4IZJB 1USVA 1WUUA 3ZZ0A 4DR1E 3BIDA 2KONA 3WU5A 1LLMC 2IOQA 2RTXA 4DV6E 3CDJA 2EOIA 2YRMA 1IBKI 2PRTA 3WU3A 2E5LE 5KL5A 4FW6A 4USKA 2HHHI 2EPLX 4M30A 5AC4A 3QT8A 4MDTA 1AH5A 1ZXMA 1HNZI 1PVGA 4BBYA 4QNJA 1O0WA 4F54A 1XHKA 4M9VC 4FWDA 4KQVA 1YYKA 1N32I 4LF6E 4KZSA 2M4IA 2I13A 2N3GA 2EPPA 1Y6ZA 1X6HA 2LE2A 5JEAC 4NXME 2DIXA 2JPAA 1FJGE 1N34I 5IT9C 1ZU1A 2EJ4A 4LF4E 4X8WA 1NHHA 3P76A 3PYGA 2JEAB 4OO1C 4MYUA 3IWDA 4L5NC 1A1FA 2RSMA 1ZM3A 5F3WA 3C6KA 2UU9E 2UUBE 2O1WA 5C0XF 1SFEA 2EMWA 2E5LI 3C4TA 1PJQA 1X6EA 3UK3C 3V5RA 4R03A 2O1UA 2LCEA 2WP8A 2A2CA 2VESA 4F2JC 5DRRA 4GKJE 4JI2E 2F8BA 3T1YE 1H74A 4OOGC 3J7AG 4FW4A 5JEAF 4JI7E 4R8OA 2LBSB 3QT6A 2F1DA 2V83A 1XMQE 1T4NA 1T38A 5K36D 4OO1F 4LF6I 2WZOA 2YPNA 1VISA 2EOQA 2YTIA 4JI3E 3OMLA 2EMFA 4NXMI 4NZVA 2R42A 4R2CA 5LL6R 4LF4I 1A6FA 1H73A 1H7SA 4HACB 4DXLA 4DV4E 2E72A 1MGTA 3KRNA 1Y4SA 4Z7CA 3F0NA 2EQ3A 2Z5CA 4IFDF 2EOFA 1A1HA 2UU9I 2UUBI 3HXLA 1B62A 3B4TA 2BA0D 3Q6NA 1T4LB 1JK2A 5A6BD 2EOSA 4JV5E
chains in the Genus database with same CATH topology
2L3CA 4TUGA 4PRVA 4WFTA 4GKJI 2HKJA 3T1YI 3H4LA 2Z5BA 3F6HA 3LMLA 4JI7I 4WPYA 1XMQI 4M1KA 3MSWA 4DPYA 4IZJA 3ADJA 3ZKBA 4X62E 1MU5A 1RR9A 4YHHE 2PNMA 2B3TB 1ZXNA 3VK6A 1J5EE 2B7TA 2M1SA 3H09A 1XNQE 2LRSA 2GQ0A 4JV5I 3FIGA 1WXRA 1EKZA 2V89A 4LF8I 2DB2A 4RPFA 4DV1I 2LUQA 1RC7A 1H72C 2DEJA 4DUYE 5AE1A 3B78A 2G7HA 4DV2I 1YYOA 1RREA 5T6JA 2FV4B 4X62I 3IWBA 1ZBQA 2LMZA 3PYEA 2RS7A 4YHHI 1IBKE 3WU4A 2UXDE 2CGEA 2V8QB 1N0VC 5FWKA 2HHHE 2N3HA 2NA2A 5LMUE 3ZZUA 3JAMQ 4LTYA 4B3SE 1N32E 4K0KE 1K47A 1BKNA 4P78A 1GQEA 4LF7E 3T1HE 2L6MA 3PYDA 4DUYI 4HACA 1N34E 2ZBKB 3HTXA 1FWLA 1MX0A 3RMPA 3LPSA 2EZ6A 4YY3I 2UXDI 4IZJD 4M0VA 1PKPA 2V2ZA 5IWAE 4NXNE 4WYQB 5LMUI 2Z5EA 1D6TA 2L8TA 4B3SI 2X36A 4K0KI 4KHPE 4LF7I 3T1HI 3PYFA 1IBLI 1KKHA 2B9DA 2LTRA 4WSPA 2Q2EB 1DQ3A 2LJPA 3D4JA 4DV0I 3HPSA 4WUCA 1N0UA 5IWAI 4LF9E 1H7UA 4NXNI 2VQEE 2ODRD 4DMIA 1WHNA 3JAMC 1Z0CA 4P7AA 2V8PA 2UUCI 4KHPI 3JTZA 2F4VI 4OX9E 4DPXA 2JWOA 1Z5BA 2MDRA 4P7DA 4URLA 3GONA 1UHZA 4BC7A 2R3VA 2LTSA 3ZOQB 4GKKI 2UXBE 4L8NA 2A2DA 4FWGA 1ZBTA 4DU8A 3V2UC 2VQEI 2NUEA 4AQYE 4LF8E 2V34A 1N36I 4WUDA 4HY1A 4DV1E 1Z0GA 4IZKB 3J81Q 4JI5I 4WUBA 4DV2E 3B8HA 1NHJA 4B3ME 4B3TE 1NZ0A 4OX9I 2M7QA 3J7AM 4DUZI 1QU6A 2UUAE 3P1XA 5FLXQ 2GS8A 2V85A 2LJHA 4JI4E 4PRXA 2UXBI 4EMDA 4TUIA 3JU0A 2O1VA 4DPWA 4AQYI 4BS9A 3Q6MA 1J26A 3K85A 1FKAE 4P52A 1STUA 4LF9I 2EFGA 2YT4A 2VF1A 4B3MI 1HK7A 4B3TI 4DR5E 4YY3E 1S4EA 4X64I 2JOXA 4FN5A 4J8ZA 2UUAI 1S16A 1Z5AA 5LMNI 4DR2E 2RS6A 4N3OA 4XTJA 4DV7E 2L2KB 4DV3I 3WU6A 4JI4I 2VF3A 2HFSA 4HYMA 3M6AA 3HPZA 3OTOE 4F9AB 1IBME 4LFCI 2MC6A 4JI0E 3J81C 1X47A 2HK2A 4FWHA 1Y4UA 4ED4A 4I8OA 4F9BB 3ADLA 2HK3A 1IBLE 4LF5E 4DKKA 5BR8E 1FI4A 1ELOA 4DR5I 2KHXA 2J7KA 2H36X 3QT5A 4DV0E 4ZVIA 4DU7A 1N33I 5FLXC 4MYTA 4DR2I 2KOUA 2ZM6E 4I3HA 4DV7I 4JI6E 4IZKA 3OTOI 1IBMI 4JG4A 1I94E 4JI0I 2UUCE 2F4VE 2XEXA 4JI1E 1Z0BA 4LF5I 2CZ9A 2VQFI 4UT4A 4FW9A 3QT7A 2UXCI 1YYWA 5BR8I 4USMA 4X66E 4DR6E 4DR3I 4DR7E 2X7IA 5A2QQ 5DNYA 2EWLA 4GKKE 1HR0E 2ZITA 2ZM6I 4DPUA 2V2VA 3K1JA 2IHR1 2AJ4A 4LFBE 1U2RA 4JI6I 1KVKA 1N36E 1Z59A 4UTGA 4JYAI 1I94I 2BM1A 4JI5E 1NHIA 2V86A 4M2ZA 4JI1I 2DMYA 4DR1I 3ZM7A 4DV6I 1ZM2A 3HJCA 1Z5CA 2O1TA 2MC5A 3HQ1A 2NPFA 4X66I 4DR6I 2HFUA 2PNLA 2L2NA 4DR7I 3LNUA 1Z0EA 2HKEA 4DUZE 3LTOA 3J7Yp 1EI1A 3K17A 3ZKDA 1HR0I 4LU9A 2FGGA 3C4BA 2L3JA 3DJWA 1DARA 4F9CB 4LFBI 2V88A 2DEIA 1HNWE 4LFAE 1FJGI 1ZM4A 1X48A 3J80Q 2V87A 2NUGA 1GZ6A 1UILA 4JI8E 2JVAA 1FWKA 3CWVA 2BV3A 5GMEA 1XNRE 4X64E 2E1MA 5A2QC 1YZ9A 5LMNE 5CFFE 5GMDA 4Z7YA 2YZTA 4DV3E 4JI2I 3ADGA 3DF6A 4DV5E 1B63A 1MG7A 2WW4A 4LFCE 2JY9A 2E1RA 4BCAA 4JI3I 1HNWI 4LFAI 2ODRC 2JR1A 4DR4E 5L3JA 1KTVA 4BMJA 2CPNA 1Z0WA 1XMOE 3LLHA 4JI8I 4DV4I 2VE7C 1KIJA 5AE3A 4HXZA 2K4VA 1DI2A 1N33E 1HNXE 1Z0VA 1Z0TA 3K6QA 1XNRI 4PU9A 3AV0A 2V2QA 3PRYA 1UEKA 4BC9A 2B7VA 3HULA 4DV5I 4Q28A 3KWRA 1USUA 3B82A 1X49A 3Q1QA 4X65E 4DPTA 5IT9Q 3ADIA 4B3RE 2CG9A 4DR4I 3J80C 1ZM9A 1T4OA 1FNMA 2VQFE 1XMOI 2UXCE 3AUZA 1EA6A 4DR3E 1J5EI 2NUFA 2LUPB 2Z5CB 3ZZTA 1PIEA 1HNZE 3VYXA 1OJ4A 1HNXI 1SR9A 1XNQI 5AASA 2FTXB 1WHQA 2L33A 5AE2A 2BM0A 5ADZA 4R1FA 3F6GA 1QZRA 2Z5BB 2JOBA 4X65I 3IWCA 2L2MA 4JYAE 2IOPA 4GEQB 2OI2A 1RQ0A 4B3RI 3VYYA 3P06A 2DSYA 2L92A 4IZJB 1USVA 1WUUA 3ZZ0A 4DR1E 3WU5A 2KONA 2IOQA 2RTXA 4DV6E 1IBKI 3WU3A 2E5LE 4USKA 2HHHI 4M30A 3QT8A 1HNZI 1ZXMA 1PVGA 4BBYA 1O0WA 4F54A 1XHKA 4KQVA 4FWDA 1YYKA 1N32I 4LF6E 4KZSA 2M4IA 2N3GA 1Y6ZA 2LE2A 4NXME 2DIXA 1FJGE 1N34I 5IT9C 4LF4E 1NHHA 4X8WA 3PYGA 4MYUA 3IWDA 4L5NC 2RSMA 1ZM3A 5F3WA 2UU9E 2UUBE 2O1WA 2E5LI 3C4TA 3V5RA 4R03A 2O1UA 2A2CA 4GKJE 4JI2E 2F8BA 3T1YE 1H74A 4OOGC 3J7AG 4JI7E 4R8OA 2LBSB 3QT6A 2V83A 1XMQE 1T4NA 4LF6I 2WZOA 1VISA 4JI3E 3OMLA 4NXMI 2R42A 5LL6R 4LF4I 1A6FA 1H73A 1H7SA 4HACB 4DXLA 4DV4E 1Y4SA 4Z7CA 3F0NA 2Z5CA 2UU9I 2UUBI 3HXLA 1B62A 3Q6NA 1T4LB 4JV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3C A;  4PRV A;  4WFT A;  4GKJ I;  2HKJ A;  3T1Y I;  3H4L A;  4JI7 I;  1XMQ I;  4M1K A;  4DPY A;  3ADJ A;  3ZKB A;  4X62 E;  1MU5 A;  1RR9 A;  4YHH E;  2B3T B;  1ZXN A;  1J5E E;  2B7T A;  1XNQ E;  2LRS A;  4JV5 I;  1EKZ A;  4LF8 I;  2DB2 A;  4RPF A;  4DV1 I;  2LUQ A;  1RC7 A;  1H72 C;  2DEJ A;  4DUY E;  3B78 A;  4DV2 I;  1YYO A;  1RRE A;  4X62 I;  3PYE A;  2RS7 A;  4YHH I;  1IBK E;  3WU4 A;  2UXD E;  1N0V C;  2HHH E;  2N3H A;  2NA2 A;  5LMU E;  3ZZU A;  3JAM Q;  4B3S E;  1N32 E;  4K0K E;  1K47 A;  1BKN A;  1GQE A;  4LF7 E;  3T1H E;  3PYD A;  4DUY I;  4HAC A;  1N34 E;  2ZBK B;  3HTX A;  1FWL A;  1MX0 A;  3LPS A;  2EZ6 A;  4YY3 I;  2UXD I;  1PKP A;  2V2Z A;  5IWA E;  4NXN E;  4WYQ B;  5LMU I;  1D6T A;  4B3S I;  2X36 A;  4K0K I;  4KHP E;  4LF7 I;  3T1H I;  3PYF A;  1IBL I;  1KKH A;  2LTR A;  2Q2E B;  2LJP A;  3D4J A;  4DV0 I;  4WUC A;  1N0U A;  5IWA I;  4LF9 E;  1H7U A;  4NXN I;  2VQE E;  1WHN A;  3JAM C;  1Z0C A;  4P7A A;  2V8P A;  2UUC I;  4KHP I;  2F4V I;  4OX9 E;  4DPX A;  1Z5B A;  2MDR A;  4URL A;  3GON A;  1UHZ A;  2R3V A;  2LTS A;  4GKK I;  2UXB E;  2A2D A;  4FWG A;  1ZBT A;  4DU8 A;  3V2U C;  2VQE I;  2NUE A;  4AQY E;  4LF8 E;  2V34 A;  1N36 I;  4WUD A;  4HY1 A;  4DV1 E;  1Z0G A;  3J81 Q;  4JI5 I;  4WUB A;  4DV2 E;  3B8H A;  1NHJ A;  4B3M E;  4B3T E;  1NZ0 A;  4OX9 I;  3J7A M;  4DUZ I;  1QU6 A;  2UUA E;  3P1X A;  5FLX Q;  2GS8 A;  2LJH A;  4JI4 E;  4PRX A;  2UXB I;  4EMD A;  4DPW A;  4AQY I;  1J26 A;  1FKA E;  4P52 A;  1STU A;  4LF9 I;  2EFG A;  2YT4 A;  4B3M I;  4B3T I;  4DR5 E;  4YY3 E;  1S4E A;  4X64 I;  4FN5 A;  2UUA I;  1Z5A A;  1S16 A;  5LMN I;  4DR2 E;  2RS6 A;  4XTJ A;  4DV7 E;  2L2K B;  4DV3 I;  3WU6 A;  4JI4 I;  2VF3 A;  2HFS A;  4HYM A;  3M6A A;  3OTO E;  1IBM E;  4LFC I;  4JI0 E;  3J81 C;  1X47 A;  2HK2 A;  4FWH A;  4ED4 A;  3ADL A;  2HK3 A;  1IBL E;  4LF5 E;  4DKK A;  5BR8 E;  1FI4 A;  1ELO A;  4DR5 I;  2KHX A;  2J7K A;  3QT5 A;  4DV0 E;  4ZVI A;  4DU7 A;  1N33 I;  5FLX C;  4MYT A;  4DR2 I;  2ZM6 E;  4I3H A;  4DV7 I;  4JI6 E;  3OTO I;  1IBM I;  4JG4 A;  1I94 E;  4JI0 I;  2UUC E;  2F4V E;  2XEX A;  4JI1 E;  1Z0B A;  4LF5 I;  2CZ9 A;  2VQF I;  4UT4 A;  4FW9 A;  3QT7 A;  2UXC I;  1YYW A;  5BR8 I;  4USM A;  4X66 E;  4DR6 E;  4DR3 I;  4DR7 E;  2X7I A;  5A2Q Q;  4GKK E;  1HR0 E;  2ZIT A;  2ZM6 I;  4DPU A;  2V2V A;  3K1J A;  2IHR 1;  2AJ4 A;  4LFB E;  1U2R A;  4JI6 I;  1KVK A;  1N36 E;  1Z59 A;  4UTG A;  4JYA I;  1I94 I;  2BM1 A;  4JI5 E;  1NHI A;  4M2Z A;  4JI1 I;  2DMY A;  4DR1 I;  3ZM7 A;  4DV6 I;  1ZM2 A;  1Z5C A;  2NPF A;  4X66 I;  4DR6 I;  2HFU A;  2L2N A;  4DR7 I;  3LNU A;  1Z0E A;  2HKE A;  4DUZ E;  3LTO A;  3J7Y p;  1EI1 A;  3K17 A;  3ZKD A;  1HR0 I;  3C4B A;  2L3J A;  1DAR A;  4LFB I;  2DEI A;  1HNW E;  4LFA E;  1FJG I;  1ZM4 A;  1X48 A;  3J80 Q;  2NUG A;  1UIL A;  4JI8 E;  2JVA A;  1FWK A;  3CWV A;  2BV3 A;  5GME A;  1XNR E;  4X64 E;  5A2Q C;  1YZ9 A;  5LMN E;  5CFF E;  5GMD A;  4Z7Y A;  4DV3 E;  4JI2 I;  3ADG A;  4DV5 E;  1B63 A;  1MG7 A;  2WW4 A;  4LFC E;  2JY9 A;  2E1R A;  4JI3 I;  1HNW I;  4LFA I;  4DR4 E;  5L3J A;  1KTV A;  2CPN A;  1Z0W A;  1XMO E;  3LLH A;  4JI8 I;  4DV4 I;  1KIJ A;  4HXZ A;  1DI2 A;  1N33 E;  1HNX E;  1Z0V A;  1Z0T A;  1XNR I;  4PU9 A;  2V2Q A;  1UEK A;  2B7V A;  3HUL A;  4DV5 I;  3B82 A;  1X49 A;  3Q1Q A;  4X65 E;  4DPT A;  5IT9 Q;  3ADI A;  4B3R E;  4DR4 I;  3J80 C;  1ZM9 A;  1T4O A;  1FNM A;  2VQF E;  1XMO I;  2UXC E;  1EA6 A;  4DR3 E;  1J5E I;  2NUF A;  2LUP B;  3ZZT A;  1PIE A;  1HNZ E;  3VYX A;  1OJ4 A;  1HNX I;  1XNQ I;  1WHQ A;  2L33 A;  2BM0 A;  4R1F A;  1QZR A;  4X65 I;  4JYA E;  2L2M A;  2OI2 A;  1RQ0 A;  4B3R I;  3VYY A;  1WUU A;  3ZZ0 A;  4DR1 E;  3WU5 A;  2RTX A;  4DV6 E;  1IBK I;  3WU3 A;  2E5L E;  4USK A;  2HHH I;  4M30 A;  3QT8 A;  1HNZ I;  1ZXM A;  1PVG A;  1O0W A;  1XHK A;  4KQV A;  4FWD A;  1YYK A;  1N32 I;  4LF6 E;  2N3G A;  4NXM E;  2DIX A;  1FJG E;  1N34 I;  4LF4 E;  1NHH A;  5IT9 C;  4X8W A;  3PYG A;  4MYU A;  2RSM A;  1ZM3 A;  2UU9 E;  2UUB E;  2E5L I;  3C4T A;  3V5R A;  2A2C A;  4GKJ E;  4JI2 E;  3T1Y E;  1H74 A;  4OOG C;  3J7A G;  4JI7 E;  2LBS B;  3QT6 A;  1XMQ E;  1T4N A;  4LF6 I;  1VIS A;  4JI3 E;  4NXM I;  2R42 A;  5LL6 R;  4LF4 I;  1A6F A;  1H73 A;  1H7S A;  4HAC B;  4DXL A;  4DV4 E;  4Z7C A;  3F0N A;  2UU9 I;  2UUB I;  1B62 A;  1T4L B;  4JV5 E; 
#chains in the Genus database with same CATH topology
 2L3C A;  3P3E A;  5DRQ A;  2GO3 A;  3EPL A;  2EOM A;  2M9A A;  2MDG A;  4R2Q A;  4WFT A;  4TUG A;  3P3G A;  4PRV A;  4GKJ I;  1A1I A;  2HKJ A;  3T1Y I;  3H4L A;  1ZAA C;  4HEI A;  3F6H A;  2EM3 A;  3LML A;  2Z5B A;  5C0X E;  4JI7 I;  4WPY A;  1XMQ I;  5DRO A;  4O24 A;  4AID A;  2BA1 D;  2C38 B;  4M1K A;  3MSW A;  4DPY A;  4IZJ A;  2ENC A;  3ADJ A;  3ZKB A;  4X62 E;  1MU5 A;  1OYR A;  1RR9 A;  4OO1 E;  4YHH E;  1A1G A;  2PNM A;  2B3T B;  1ZXN A;  2BB8 A;  3VK6 A;  1J5E E;  2YSO A;  2B7T A;  2CT1 A;  2EMX A;  2YTO A;  2M1S A;  3H09 A;  1A1J A;  2ELZ A;  1XNQ E;  3MHS C;  2LRS A;  4R2A A;  2BA0 G;  2GQ0 A;  4JV5 I;  4MU0 A;  2EL5 A;  3FIG A;  1WXR A;  1EKZ A;  2V89 A;  4LF8 I;  2DB2 A;  3M99 B;  4RPF A;  4IFD E;  4MU1 A;  2VRD A;  2PO2 B;  3L7Z B;  4DV1 I;  2ADR A;  2LUQ A;  1RC7 A;  3PS2 A;  1H72 C;  2DEJ A;  5C0X B;  4DUY E;  5AE1 A;  3B78 A;  2G7H A;  2JEA A;  4DV2 I;  1YYO A;  2JEB B;  1RRE A;  5T6J A;  1ZR9 A;  2FV4 B;  4X62 I;  3IWB A;  4ZYE A;  1ZBQ A;  2LMZ A;  5JEA B;  1XXE A;  3PYE A;  2EOH A;  2RS7 A;  2YU8 A;  1IBK E;  1RHY A;  3NZK A;  3WU4 A;  2UXD E;  2CGE A;  2V8Q B;  4YHH I;  4MU4 A;  4OO1 B;  1N0V C;  5FWK A;  2HHH E;  2EPZ A;  2N3H A;  2BBG A;  4LPF A;  2NA2 A;  5LMU E;  2EPO A;  1G2F C;  3ZZU A;  1X3C A;  2EQ1 A;  3JAM Q;  4LTY A;  3M7N G;  4B3S E;  1N32 E;  4K0K E;  1K47 A;  1IQS A;  1BKN A;  4P78 A;  1GQE A;  1UDO A;  4MQY A;  4LF7 E;  3T1H E;  2L6M A;  4AIM A;  4IFD B;  3TQM A;  1Y5Y A;  5KL6 A;  1YSA C;  3PYD A;  4HAC A;  1N34 E;  1N3G A;  2EMY A;  2ZBK B;  4DUY I;  3HTX A;  2DLK A;  1FWL A;  1MX0 A;  2WNR B;  2WBU A;  4R2P A;  3RMP A;  3LPS A;  2EMG A;  2EN4 A;  2EM6 A;  2EZ6 A;  4YY3 I;  5AC5 A;  2UXD I;  2YTG A;  5A6A A;  4M0V A;  1PKP A;  2NN6 F;  2EPK X;  1BBG A;  5IWA E;  2V2Z A;  4IZJ D;  4NXN E;  4WYQ B;  2HGH A;  5C0X C;  5LMU I;  3VHT B;  2Z5E A;  1TN9 A;  1D6T A;  2L8T A;  2C38 A;  4B3S I;  2EM5 A;  2EPA A;  2X36 A;  3PS1 A;  4K0K I;  4KHP E;  4LF7 I;  3T1H I;  2EQ0 A;  3PYF A;  2YSP A;  1IBL I;  2I9I A;  1T39 A;  2EM0 A;  1KKH A;  2B9D A;  2BR2 B;  2LTR A;  4WSP A;  2Q2E B;  1DQ3 A;  2LJP A;  3D4J A;  4DV0 I;  2GPI A;  5DNX A;  3HPS A;  4WUC A;  1N0U A;  4FW3 A;  5IWA I;  4LF9 E;  1H7U A;  4NXN I;  1AAY A;  4IFD C;  2VQE E;  2DLQ A;  2ODR D;  2PO2 A;  3L7Z A;  3EQ1 A;  4WX9 A;  4DMI A;  1WHN A;  3JAM C;  1Z0C A;  4P7A A;  4GQU A;  2V8P A;  5C0X A;  4O5G A;  3C6M A;  3EPK A;  5DNL A;  4RH8 A;  2JEB A;  4O43 A;  2NN6 E;  3JTZ A;  1PDA A;  3BF2 A;  2UUC I;  2F4V I;  4KHP I;  1TF6 A;  1UDN A;  4OX9 E;  2CTD A;  2J65 A;  4DPX A;  5JEA A;  2JWO A;  1Z5B A;  1BB8 A;  2MDR A;  4IJD A;  1R6M A;  4P7D A;  4URL A;  3GON A;  1E3H A;  4OO1 A;  1UHZ A;  4MLV A;  1GTK A;  4BC7 A;  5IV8 B;  3L00 A;  1EH6 A;  2R3V A;  2LTS A;  3ZOQ B;  4GKK I;  2RPC A;  5A6K A;  2UXB E;  4L8N A;  1OYS A;  3EPH A;  2A2D A;  4FWG A;  1ZBT A;  4DU8 A;  2LT7 A;  4NBQ A;  3V2U C;  2VQE I;  4LCG A;  2NUE A;  4AQY E;  4LF8 E;  2V34 A;  1N36 I;  4IFD A;  4WUD A;  2EPM X;  4HY1 A;  4DV1 E;  5LLQ A;  1Z0G A;  4IZK B;  3J81 Q;  3BBG A;  1UDQ A;  4JI5 I;  3M85 D;  4WUB A;  4N4R B;  4DV2 E;  3B8H A;  1NHJ A;  4B3M E;  2NN6 B;  2WNR A;  1P47 A;  4B3T E;  1NZ0 A;  2EM4 A;  4OX9 I;  2YU5 A;  2LO3 A;  4ZYD A;  2YTN A;  2JP9 A;  4FW5 A;  4MU3 A;  1IQO A;  1IMU A;  2M7Q A;  4ZYG A;  4LCH A;  4ISA A;  3J7A M;  1YHC A;  1P42 A;  3U1Y A;  1QU6 A;  2UUA E;  4DUZ I;  3P1X A;  5FLX Q;  2GS8 A;  2V85 A;  2LJH A;  1QNT A;  4JI4 E;  2EMC A;  4PRX A;  2PO1 B;  2UXB I;  4EMD A;  4TUI A;  4HTG A;  3JU0 A;  2O1V A;  4DPW A;  4AQY I;  3KZZ A;  4BS9 A;  2EN8 A;  2WBT A;  3Q6M A;  1J26 A;  3PS3 A;  3K85 A;  1FKA E;  4P52 A;  1STU A;  2BR2 A;  2BA1 G;  3THN A;  4LF9 I;  2EFG A;  2YT4 A;  2VF1 A;  3M85 G;  4B3M I;  2JT2 A;  1HK7 A;  5K36 C;  1KYQ A;  4B3T I;  1RMD A;  5KL4 A;  1Y60 A;  4DR5 E;  2EN3 A;  4YY3 E;  5C0X D;  2MKD A;  2N8X A;  1S4E A;  2YTP A;  4X64 I;  2JOX A;  4FN5 A;  4J8Z A;  2UUA I;  2PO0 B;  1S16 A;  1Z5A A;  4ZYH A;  4DR2 E;  2RS6 A;  5LMN I;  4N3O A;  4XTJ A;  4DV7 E;  2L2K B;  4DV3 I;  3WU6 A;  2WBS A;  2VF3 A;  5JEA D;  4JI4 I;  2HFS A;  1TF3 A;  4HYM A;  3M6A A;  3HPZ A;  3OTO E;  2EM9 A;  4O4K A;  4F9A B;  1IBM E;  2MC6 A;  2YTE A;  2NN6 C;  3GME A;  4LFC I;  2R76 A;  2EMB A;  4OO1 D;  4JI0 E;  4BA2 B;  1NCS A;  3J81 C;  5K36 F;  1X47 A;  2HK2 A;  4FWH A;  4GZN C;  2EPX A;  2LJU A;  1Y4U A;  4ED4 A;  4I8O A;  4F9B B;  3ADL A;  2HK3 A;  2JYA A;  1IBL E;  4LF5 E;  4IS1 C;  2DGC A;  4DKK A;  4NHR A;  5BR8 E;  4IFD D;  1FI4 A;  1ELO A;  4U3B A;  4DR5 I;  2KHX A;  2J7K A;  2A25 A;  2H36 X;  4DV0 E;  3QT5 A;  4ZVI A;  4DU7 A;  1N33 I;  2O3Z A;  2EOX A;  5FLX C;  2C39 B;  4BHC A;  3GLL A;  4MYT A;  4DR2 I;  2KOU A;  2ZM6 E;  1E3P A;  4I3H A;  2CVE A;  4DV7 I;  1JK1 A;  1F2I G;  5A69 A;  4JI6 E;  4IZK A;  3OTO I;  2MKN A;  1IBM I;  4R2D A;  4JG4 A;  1I94 E;  5EL9 A;  4JI0 I;  2JE6 B;  3U1K A;  2UUC E;  2NN6 A;  2F4V E;  2XEX A;  2EOO A;  3QG5 C;  2EOZ A;  5A6J A;  1X6F A;  2EOY A;  4JI1 E;  1Z0B A;  1A1L A;  2CZ9 A;  2RSI A;  2GO4 A;  2EMA A;  2VQF I;  2C37 B;  4UT4 A;  4FW9 A;  3QT7 A;  2UXC I;  4J3D A;  1YYW A;  5BR8 I;  4USM A;  5K36 E;  4X66 E;  2WCC 3;  4DR6 E;  4DR3 I;  4DR7 E;  2LVH A;  2X7I A;  1WRJ A;  5A2Q Q;  5DNY A;  2EWL A;  2EPC A;  2PO1 A;  2EM2 A;  4GKK E;  2CSH A;  1HR0 E;  4BA1 B;  2ZIT A;  3ECR A;  2ZM6 I;  4DPU A;  2V2V A;  2EMI A;  2IHR 1;  2AJ4 A;  3K1J A;  4LFB E;  1U2R A;  4JI6 I;  1KVK A;  1N36 E;  3MHH C;  3CDI A;  2YTJ A;  2EL6 A;  1Z59 A;  4UTG A;  4JYA I;  1I94 I;  1UN6 B;  2BM1 A;  4JI5 E;  2EMH A;  1NHI A;  4OZE A;  2V86 A;  4M2Z A;  2GLI A;  4JI1 I;  2DMY A;  2IER A;  4DR1 I;  3ZM7 A;  4QNK A;  2D9H A;  2EE8 A;  1VI7 A;  4DV6 I;  1ZM2 A;  1OYP A;  4AM3 A;  2NAB A;  3HJC A;  2YTQ A;  1Z5C A;  2MC5 A;  3HQ1 A;  2O1T A;  2NPF A;  2YWQ A;  3GCM A;  2HFU A;  2EMZ A;  4X66 I;  2PNL A;  2PO0 A;  2L2N A;  4DR6 I;  4DR7 I;  3LNU A;  2YRH A;  1Z0E A;  4DUZ E;  1YUJ A;  2HKE A;  3J7Y p;  3LTO A;  5K36 B;  3HKM A;  1EI1 A;  2EMK A;  4F6N A;  3K17 A;  3ZKD A;  1HR0 I;  4LU9 A;  2FGG A;  3C4B A;  4LOM A;  2L3J A;  3DJW A;  1DAR A;  4F9C B;  2EN2 A;  4BA2 A;  4LFB I;  2V88 A;  5IXM B;  1UDS A;  2PNZ B;  2DEI A;  1HNW E;  4LFA E;  1KJK A;  4R2S A;  1FJG I;  1ZM4 A;  2EL4 A;  4R2E A;  1X48 A;  2J7J A;  4FW7 A;  3J80 Q;  1MEY C;  2V87 A;  2NUG A;  4X9J A;  1GZ6 A;  1UIL A;  2EML A;  1L4S A;  4JI8 E;  1EH7 A;  2JVA A;  1FWK A;  2LV2 A;  3CWV A;  2YTD A;  4R2R A;  2BV3 A;  1DGC A;  5GME A;  1XNR E;  2C39 A;  2NN6 D;  2EN6 A;  2EPN A;  4X64 E;  1NEI A;  2E1M A;  5A2Q C;  2IES A;  1YZ9 A;  5LMN E;  2RQL A;  5CFF E;  5GMD A;  4Z7Y A;  2YZT A;  4DV3 E;  4BHB A;  4JI2 I;  2R1F A;  3ADG A;  3DF6 A;  4WXC A;  4DV5 E;  1UBD C;  2HC5 A;  2AE8 A;  1B63 A;  1MG7 A;  2WW4 A;  4F6M A;  4LFC E;  2JY9 A;  2E1R A;  2JE6 A;  5DRP A;  4BCA A;  4JI3 I;  1HNW I;  2Q8U A;  4LFA I;  2GHF A;  2JXP A;  2ODR C;  4KWY A;  2JR1 A;  4DR4 E;  5L3J A;  1KTV A;  4BMJ A;  2C37 A;  2CPN A;  1Z0W A;  4LCF A;  5JEA E;  1YPN A;  3LLH A;  1XMO E;  4JI8 I;  2ENA A;  4DV4 I;  1EH8 A;  1YFH A;  2VE7 C;  1KIJ A;  3DD6 A;  3H1C A;  2EPU A;  2DMI A;  4IS9 A;  2EN1 A;  5AE3 A;  1Z1B A;  2EM8 A;  4HXZ A;  1PJS A;  2K4V A;  1DI2 A;  1N33 E;  1HNX E;  2ELY A;  1Z0V A;  3K6Q A;  1Z0T A;  4BA1 A;  4WXD A;  4PU9 A;  1XNR I;  3AV0 A;  2V2Q A;  3PRY A;  3EPJ A;  1UEK A;  3UHM A;  3M7N D;  4BC9 A;  4FK5 C;  4U3D A;  2B7V A;  1B69 A;  2WP8 B;  3HUL A;  2K7I A;  4DV5 I;  4Q28 A;  2EOR A;  3KWR A;  1USU A;  3B82 A;  1X49 A;  3Q1Q A;  4X65 E;  4DPT A;  5IT9 Q;  5KL7 A;  3ADI A;  4B3R E;  2CG9 A;  3J80 C;  4DR4 I;  1YH8 A;  1ZM9 A;  1T4O A;  1FNM A;  5EKW A;  2VQF E;  4RHB B;  5KL2 A;  1XMO I;  2EOE A;  1YUI A;  2YTF A;  3BGH A;  2UXC E;  3AUZ A;  1G2D C;  1WJP A;  1EA6 A;  5K36 A;  5TSE A;  4DR3 E;  1J5E I;  1PJT A;  2EN7 A;  4MLQ A;  5KL3 A;  1BBO A;  2NUF A;  2LUP B;  2DRP A;  2Z5C B;  1PIE A;  2EP3 A;  1HNZ E;  3ZZT A;  3VYX A;  2HJJ A;  1OJ4 A;  4Q35 B;  1SR9 A;  1HNX I;  3THO B;  5ELW A;  1XNQ I;  5AAS A;  2FTX B;  3P3C A;  1WHQ A;  3KZY A;  2PNZ A;  1X5W A;  2L33 A;  4WSG A;  2EOJ A;  2EPR A;  2YRK A;  5ADZ A;  5AE2 A;  2BM0 A;  3F6G A;  1QZR A;  4OKG A;  2Z5B B;  4R1F A;  4LF5 I;  2ENH A;  2JOB A;  4X65 I;  3IWC A;  2L2M A;  4JYA E;  2IOP A;  4GEQ B;  2OI2 A;  1RQ0 A;  1R6L A;  1A1K A;  5A6B A;  4B3R I;  3VYY A;  3P06 A;  2DSY A;  2EM7 A;  2L92 A;  4IZJ B;  1USV A;  1WUU A;  3ZZ0 A;  4DR1 E;  3BID A;  2KON A;  3WU5 A;  1LLM C;  2IOQ A;  2RTX A;  4DV6 E;  3CDJ A;  2EOI A;  2YRM A;  1IBK I;  2PRT A;  3WU3 A;  2E5L E;  5KL5 A;  4FW6 A;  4USK A;  2HHH I;  2EPL X;  4M30 A;  5AC4 A;  3QT8 A;  4MDT A;  1AH5 A;  1ZXM A;  1HNZ I;  1PVG A;  4BBY A;  4QNJ A;  1O0W A;  4F54 A;  1XHK A;  4M9V C;  4FWD A;  4KQV A;  1YYK A;  1N32 I;  4LF6 E;  4KZS A;  2M4I A;  2I13 A;  2N3G A;  2EPP A;  1Y6Z A;  1X6H A;  2LE2 A;  5JEA C;  4NXM E;  2DIX A;  2JPA A;  1FJG E;  1N34 I;  5IT9 C;  1ZU1 A;  2EJ4 A;  4LF4 E;  4X8W A;  1NHH A;  3P76 A;  3PYG A;  2JEA B;  4OO1 C;  4MYU A;  3IWD A;  4L5N C;  1A1F A;  2RSM A;  1ZM3 A;  5F3W A;  3C6K A;  2UU9 E;  2UUB E;  2O1W A;  5C0X F;  1SFE A;  2EMW A;  2E5L I;  3C4T A;  1PJQ A;  1X6E A;  3UK3 C;  3V5R A;  4R03 A;  2O1U A;  2LCE A;  2WP8 A;  2A2C A;  2VES A;  4F2J C;  5DRR A;  4GKJ E;  4JI2 E;  2F8B A;  3T1Y E;  1H74 A;  4OOG C;  3J7A G;  4FW4 A;  5JEA F;  4JI7 E;  4R8O A;  2LBS B;  3QT6 A;  2F1D A;  2V83 A;  1XMQ E;  1T4N A;  1T38 A;  5K36 D;  4OO1 F;  4LF6 I;  2WZO A;  2YPN A;  1VIS A;  2EOQ A;  2YTI A;  4JI3 E;  3OML A;  2EMF A;  4NXM I;  4NZV A;  2R42 A;  4R2C A;  5LL6 R;  4LF4 I;  1A6F A;  1H73 A;  1H7S A;  4HAC B;  4DXL A;  4DV4 E;  2E72 A;  1MGT A;  3KRN A;  1Y4S A;  4Z7C A;  3F0N A;  2EQ3 A;  2Z5C A;  4IFD F;  2EOF A;  1A1H A;  2UU9 I;  2UUB I;  3HXL A;  1B62 A;  3B4T A;  2BA0 D;  3Q6N A;  1T4L B;  1JK2 A;  5A6B D;  2EOS A;  4JV5 E; 
#chains in the Genus database with same CATH homology
 2L3C A;  4TUG A;  4PRV A;  4WFT A;  4GKJ I;  2HKJ A;  3T1Y I;  3H4L A;  2Z5B A;  3F6H A;  3LML A;  4JI7 I;  4WPY A;  1XMQ I;  4M1K A;  3MSW A;  4DPY A;  4IZJ A;  3ADJ A;  3ZKB A;  4X62 E;  1MU5 A;  1RR9 A;  4YHH E;  2PNM A;  2B3T B;  1ZXN A;  3VK6 A;  1J5E E;  2B7T A;  2M1S A;  3H09 A;  1XNQ E;  2LRS A;  2GQ0 A;  4JV5 I;  3FIG A;  1WXR A;  1EKZ A;  2V89 A;  4LF8 I;  2DB2 A;  4RPF A;  4DV1 I;  2LUQ A;  1RC7 A;  1H72 C;  2DEJ A;  4DUY E;  5AE1 A;  3B78 A;  2G7H A;  4DV2 I;  1YYO A;  1RRE A;  5T6J A;  2FV4 B;  4X62 I;  3IWB A;  1ZBQ A;  2LMZ A;  3PYE A;  2RS7 A;  4YHH I;  1IBK E;  3WU4 A;  2UXD E;  2CGE A;  2V8Q B;  1N0V C;  5FWK A;  2HHH E;  2N3H A;  2NA2 A;  5LMU E;  3ZZU A;  3JAM Q;  4LTY A;  4B3S E;  1N32 E;  4K0K E;  1K47 A;  1BKN A;  4P78 A;  1GQE A;  4LF7 E;  3T1H E;  2L6M A;  3PYD A;  4DUY I;  4HAC A;  1N34 E;  2ZBK B;  3HTX A;  1FWL A;  1MX0 A;  3RMP A;  3LPS A;  2EZ6 A;  4YY3 I;  2UXD I;  4IZJ D;  4M0V A;  1PKP A;  2V2Z A;  5IWA E;  4NXN E;  4WYQ B;  5LMU I;  2Z5E A;  1D6T A;  2L8T A;  4B3S I;  2X36 A;  4K0K I;  4KHP E;  4LF7 I;  3T1H I;  3PYF A;  1IBL I;  1KKH A;  2B9D A;  2LTR A;  4WSP A;  2Q2E B;  1DQ3 A;  2LJP A;  3D4J A;  4DV0 I;  3HPS A;  4WUC A;  1N0U A;  5IWA I;  4LF9 E;  1H7U A;  4NXN I;  2VQE E;  2ODR D;  4DMI A;  1WHN A;  3JAM C;  1Z0C A;  4P7A A;  2V8P A;  2UUC I;  4KHP I;  3JTZ A;  2F4V I;  4OX9 E;  4DPX A;  2JWO A;  1Z5B A;  2MDR A;  4P7D A;  4URL A;  3GON A;  1UHZ A;  4BC7 A;  2R3V A;  2LTS A;  3ZOQ B;  4GKK I;  2UXB E;  4L8N A;  2A2D A;  4FWG A;  1ZBT A;  4DU8 A;  3V2U C;  2VQE I;  2NUE A;  4AQY E;  4LF8 E;  2V34 A;  1N36 I;  4WUD A;  4HY1 A;  4DV1 E;  1Z0G A;  4IZK B;  3J81 Q;  4JI5 I;  4WUB A;  4DV2 E;  3B8H A;  1NHJ A;  4B3M E;  4B3T E;  1NZ0 A;  4OX9 I;  2M7Q A;  3J7A M;  4DUZ I;  1QU6 A;  2UUA E;  3P1X A;  5FLX Q;  2GS8 A;  2V85 A;  2LJH A;  4JI4 E;  4PRX A;  2UXB I;  4EMD A;  4TUI A;  3JU0 A;  2O1V A;  4DPW A;  4AQY I;  4BS9 A;  3Q6M A;  1J26 A;  3K85 A;  1FKA E;  4P52 A;  1STU A;  4LF9 I;  2EFG A;  2YT4 A;  2VF1 A;  4B3M I;  1HK7 A;  4B3T I;  4DR5 E;  4YY3 E;  1S4E A;  4X64 I;  2JOX A;  4FN5 A;  4J8Z A;  2UUA I;  1S16 A;  1Z5A A;  5LMN I;  4DR2 E;  2RS6 A;  4N3O A;  4XTJ A;  4DV7 E;  2L2K B;  4DV3 I;  3WU6 A;  4JI4 I;  2VF3 A;  2HFS A;  4HYM A;  3M6A A;  3HPZ A;  3OTO E;  4F9A B;  1IBM E;  4LFC I;  2MC6 A;  4JI0 E;  3J81 C;  1X47 A;  2HK2 A;  4FWH A;  1Y4U A;  4ED4 A;  4I8O A;  4F9B B;  3ADL A;  2HK3 A;  1IBL E;  4LF5 E;  4DKK A;  5BR8 E;  1FI4 A;  1ELO A;  4DR5 I;  2KHX A;  2J7K A;  2H36 X;  3QT5 A;  4DV0 E;  4ZVI A;  4DU7 A;  1N33 I;  5FLX C;  4MYT A;  4DR2 I;  2KOU A;  2ZM6 E;  4I3H A;  4DV7 I;  4JI6 E;  4IZK A;  3OTO I;  1IBM I;  4JG4 A;  1I94 E;  4JI0 I;  2UUC E;  2F4V E;  2XEX A;  4JI1 E;  1Z0B A;  4LF5 I;  2CZ9 A;  2VQF I;  4UT4 A;  4FW9 A;  3QT7 A;  2UXC I;  1YYW A;  5BR8 I;  4USM A;  4X66 E;  4DR6 E;  4DR3 I;  4DR7 E;  2X7I A;  5A2Q Q;  5DNY A;  2EWL A;  4GKK E;  1HR0 E;  2ZIT A;  2ZM6 I;  4DPU A;  2V2V A;  3K1J A;  2IHR 1;  2AJ4 A;  4LFB E;  1U2R A;  4JI6 I;  1KVK A;  1N36 E;  1Z59 A;  4UTG A;  4JYA I;  1I94 I;  2BM1 A;  4JI5 E;  1NHI A;  2V86 A;  4M2Z A;  4JI1 I;  2DMY A;  4DR1 I;  3ZM7 A;  4DV6 I;  1ZM2 A;  3HJC A;  1Z5C A;  2O1T A;  2MC5 A;  3HQ1 A;  2NPF A;  4X66 I;  4DR6 I;  2HFU A;  2PNL A;  2L2N A;  4DR7 I;  3LNU A;  1Z0E A;  2HKE A;  4DUZ E;  3LTO A;  3J7Y p;  1EI1 A;  3K17 A;  3ZKD A;  1HR0 I;  4LU9 A;  2FGG A;  3C4B A;  2L3J A;  3DJW A;  1DAR A;  4F9C B;  4LFB I;  2V88 A;  2DEI A;  1HNW E;  4LFA E;  1FJG I;  1ZM4 A;  1X48 A;  3J80 Q;  2V87 A;  2NUG A;  1GZ6 A;  1UIL A;  4JI8 E;  2JVA A;  1FWK A;  3CWV A;  2BV3 A;  5GME A;  1XNR E;  4X64 E;  2E1M A;  5A2Q C;  1YZ9 A;  5LMN E;  5CFF E;  5GMD A;  4Z7Y A;  2YZT A;  4DV3 E;  4JI2 I;  3ADG A;  3DF6 A;  4DV5 E;  1B63 A;  1MG7 A;  2WW4 A;  4LFC E;  2JY9 A;  2E1R A;  4BCA A;  4JI3 I;  1HNW I;  4LFA I;  2ODR C;  2JR1 A;  4DR4 E;  5L3J A;  1KTV A;  4BMJ A;  2CPN A;  1Z0W A;  1XMO E;  3LLH A;  4JI8 I;  4DV4 I;  2VE7 C;  1KIJ A;  5AE3 A;  4HXZ A;  2K4V A;  1DI2 A;  1N33 E;  1HNX E;  1Z0V A;  1Z0T A;  3K6Q A;  1XNR I;  4PU9 A;  3AV0 A;  2V2Q A;  3PRY A;  1UEK A;  4BC9 A;  2B7V A;  3HUL A;  4DV5 I;  4Q28 A;  3KWR A;  1USU A;  3B82 A;  1X49 A;  3Q1Q A;  4X65 E;  4DPT A;  5IT9 Q;  3ADI A;  4B3R E;  2CG9 A;  4DR4 I;  3J80 C;  1ZM9 A;  1T4O A;  1FNM A;  2VQF E;  1XMO I;  2UXC E;  3AUZ A;  1EA6 A;  4DR3 E;  1J5E I;  2NUF A;  2LUP B;  2Z5C B;  3ZZT A;  1PIE A;  1HNZ E;  3VYX A;  1OJ4 A;  1HNX I;  1SR9 A;  1XNQ I;  5AAS A;  2FTX B;  1WHQ A;  2L33 A;  5AE2 A;  2BM0 A;  5ADZ A;  4R1F A;  3F6G A;  1QZR A;  2Z5B B;  2JOB A;  4X65 I;  3IWC A;  2L2M A;  4JYA E;  2IOP A;  4GEQ B;  2OI2 A;  1RQ0 A;  4B3R I;  3VYY A;  3P06 A;  2DSY A;  2L92 A;  4IZJ B;  1USV A;  1WUU A;  3ZZ0 A;  4DR1 E;  3WU5 A;  2KON A;  2IOQ A;  2RTX A;  4DV6 E;  1IBK I;  3WU3 A;  2E5L E;  4USK A;  2HHH I;  4M30 A;  3QT8 A;  1HNZ I;  1ZXM A;  1PVG A;  4BBY A;  1O0W A;  4F54 A;  1XHK A;  4KQV A;  4FWD A;  1YYK A;  1N32 I;  4LF6 E;  4KZS A;  2M4I A;  2N3G A;  1Y6Z A;  2LE2 A;  4NXM E;  2DIX A;  1FJG E;  1N34 I;  5IT9 C;  4LF4 E;  1NHH A;  4X8W A;  3PYG A;  4MYU A;  3IWD A;  4L5N C;  2RSM A;  1ZM3 A;  5F3W A;  2UU9 E;  2UUB E;  2O1W A;  2E5L I;  3C4T A;  3V5R A;  4R03 A;  2O1U A;  2A2C A;  4GKJ E;  4JI2 E;  2F8B A;  3T1Y E;  1H74 A;  4OOG C;  3J7A G;  4JI7 E;  4R8O A;  2LBS B;  3QT6 A;  2V83 A;  1XMQ E;  1T4N A;  4LF6 I;  2WZO A;  1VIS A;  4JI3 E;  3OML A;  4NXM I;  2R42 A;  5LL6 R;  4LF4 I;  1A6F A;  1H73 A;  1H7S A;  4HAC B;  4DXL A;  4DV4 E;  1Y4S A;  4Z7C A;  3F0N A;  2Z5C A;  2UU9 I;  2UUB I;  3HXL A;  1B62 A;  3Q6N A;  1T4L B;  4JV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...