4JI6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6E02
2UXCE 4JI8E 2EZ6A 1Z0VA 2LUPB 4DR6E 3HULA 4URLA 3HTXA 1DARA 4X65E 4WFTA 4USMA 1KVKA 3T1YI 1ZXMA 1NHJA 1S16A 5L3JA 5FLXC 4P52A 4DV2E 4NXME 3Q1QA 2KHXA 4JI0E 2F4VI 1N36I 1FWKA 2HK2A 1N33I 1IBME 4DR2I 2HFSA 5GMEA 1Z5CA 1IBLI 4DV0I 1XNRE 3ADLA 4LFCI 1WHNA 4DV6E 4LFBE 2NUFA 4NXNE 2L3CA 1N34I 4LF8I 1HNXI 4OOGC 2CZ9A 3LPSA 2AJ4A 4LF4E 3M6AA 4M1KA 2B3TB 4JI4I 4K0KE 5IWAI 3T1HI 4B3TE 5CFFE 1I94E 4X64I 2V34A 4DUZI 4GKKI 2DEJA 2UUBI 4X62I 3VYXA 4X66E 1T4LB 4M30A 1B63A 1ZM9A 2LUQA 4B3MI 2JY9A 3K17A 1Z59A 2N3HA 4DUYI 2RS6A 1EI1A 2HFUA 1IBKE 1NZ0A 1H73A 4HYMA 1ZBTA 4JI3E 1FJGE 2VQFE 4GKJE 3OTOI 1HR0I 4B3RE 4DV4E 2BM0A 3QT8A 3B82A 3ZZTA 3LLHA 5BR8E 4JI2I 1K47A 2X36A 5LMNI 3J7AG 1H7SA 1YZ9A 3LTOA 2NUGA 2UXCI 1UHZA 2UUAE 3JAMQ 3VYYA 4DR6I 3GONA 4DR1I 4DXLA 1XNQE 3ZKDA 3V2UC 3WU6A 3LNUA 4DV3I 2HKEA 4DR4I 2A2DA 2UXBI 4JI0I 1RQ0A 4LF6E 1IBMI 1J5EE 4LF7E 4PRXA 2HKJA 3K1JA 1H7UA 2UXDI 4AQYE 5IT9Q 1S4EA 1Z0GA 4DV6I 1MU5A 4NXNI 4DR5E 2YT4A 2LJHA 4JI1E 3JAMC 2E5LE 2E1RA 4ED4A 5A2QQ 1X49A 4UT4A 2LRSA 4WYQB 4LFAE 1GQEA 2V2ZA 4DPXA 4DU8A 4DV5E 2NPFA 4HXZA 3ZM7A 1N32I 1Z0TA 4DR7E 4Z7YA 4X66I 2L2KB 4WUBA 2V2VA 3J81C 1RC7A 4JG4A 4B3SI 4FW9A 5IT9C 2B7TA 1U2RA 4KHPE 1HNZI 4JV5I 4HACA 4DV4I 2UU9E 4JI6I 4DR3E 1XMOE 1MG7A 4LF9I 5A2QC 5BR8I 1EKZA 1ZM2A 1WUUA 4M2ZA 4OX9I 1WHQA 1OJ4A 2VQEI 1N0VC 4KQVA 2BV3A 1YYOA 1VISA 3F0NA 3PYEA 2ZM6E 4FWDA 1D6TA 2ZBKB 3ZKBA 4LF5I 4YHHE 1N0UA 1Z0WA 5LMUI 4DV7I 4YY3I 1X48A 4JI5I 4LF6I 2HHHI 2IHR1 1NHIA 1O0WA 4PRVA 2DEIA 3T1YE 2XEXA 2R42A 3B78A 1KKHA 2RSMA 1RREA 4JYAI 1N36E 3PYFA 1FKAE 4PU9A 2DB2A 1KIJA 1Z5BA 1YYKA 2E5LI 4DR2E 4JI8I 4DV0E 4MYUA 4LFAI 4LFCE 2VF3A 4X65I 1N34E 4LF8E 3J7Yp 1QU6A 1UILA 4DV1E 4DV2I 4NXMI 3J80Q 4DR7I 5GMDA 4JI4E 1Z0CA 2B7VA 5IWAE 1XMQE 4USKA 3T1HE 2UUCE 1ZM3A 1Z0EA 1PKPA 4X8WA 4X64E 4DUZE 4WUCA 1XNRI 4R1FA 4GKKE 2LTRA 2UUBE 4X62E 1KTVA 4LFBI 4DR3I 1FWLA 2LJPA 1H74A 2HK3A 4LF4I 2RTXA 2NUEA 1ZXNA 2RS7A 1EA6A 4K0KI 1HR0E 1T4NA 1NHHA 2DMYA 2X7IA 3J80C 4B3TI 1I94I 4JI2E 1H72C 2L2NA 5LMNE 1B62A 1DI2A 1Z0BA 4JI7E 4DKKA 1X47A 1IBKI 2MDRA 4UTGA 4EMDA 4DR1E 4JI3I 4GKJI 4XTJA 2VQFI 1FJGI 4B3RI 1ELOA 4DPUA 2A2CA 3J7AM 3B8HA 4DV3E 4DR4E 2UXBE 1J26A 1A6FA 1YYWA 3C4BA 3ADJA 2ZITA 2WW4A 1RR9A 2UXDE 1UEKA 1Z5AA 2UUAI 2R3VA 2OI2A 1XNQI 2Q2EB 1XHKA 4DV1I 2CPNA 2LTSA 1HNWE 3ZZUA 1PIEA 3D4JA 3V5RA 3WU3A 1XMQI 3CWVA 1J5EI 2UUCI 4LF7I 4HACB 4DPWA 4DU7A 4P7AA 2N3GA 2EFGA 2L3JA 2J7KA 4FN5A 1N32E 4AQYI 2F4VE 4HY1A 2DIXA 5LL6R 3PYDA 1N33E 4DR5I 4B3SE 4JI1I 3ADGA 3P1XA 1IBLE 1HNZE 4JV5E 4DPTA 4JI6E 1QZRA 4DV5I 4LF9E 1HNXE 3ZZ0A 4MYTA 3H4LA 4OX9E 3C4TA 2VQEE 4JI7I 4I3HA 1STUA 3QT7A 3PYGA 2NA2A 2GS8A 3QT5A 4KHPI 2LBSB 1FNMA 2JVAA 4DPYA 3ADIA 4LF5E 1FI4A 4FWGA 4WUDA 2UU9I 3WU4A 1XMOI 4B3ME 5LMUE 4Z7CA 4DUYE 4DV7E 4YY3E 4JI5E 5FLXQ 2HHHE 1T4OA 3J81Q 3OTOE 2V8PA 4FWHA 2V2QA 4ZVIA 1ZM4A 4RPFA 3WU5A 1MX0A 4JYAE 2ZM6I 2L2MA 2L33A 2BM1A 3QT6A 4YHHI 1BKNA 1PVGA 1HNWI
chains in the Genus database with same CATH superfamily
2UXCE 4JI8E 2EZ6A 1VI7A 1Z0VA 5ADZA 2LUPB 2YZTA 4FW7A 4DR6E 3HULA 4URLA 3L00A 5A6AA 2V86A 3HTXA 1E3HA 1DARA 2NN6E 2YU5A 4X65E 2BBGA 4WFTA 2EMBA 1KVKA 2GO3A 4N3OA 2KONA 1YUJA 4USMA 1ZXMA 3T1YI 1NHJA 1S16A 5DRRA 3PS3A 5L3JA 5FLXC 3OMLA 4P52A 3P3GA 4DV2E 4NXME 3Q1QA 2KHXA 4JI0E 2F4VI 2V89A 1Y5YA 1DQ3A 2EMHA 3K6QA 3UHMA 1N36I 1FWKA 2HK2A 1N33I 2PNZB 1IBME 2J65A 1YSAC 5DNXA 2WNRA 1JK2A 4DR2I 3HPZA 2EOEA 2HFSA 2YTFA 5GMEA 4OO1E 1Z5CA 1IBLI 1YUIA 4DV0I 1XNRE 2R76A 4AIDA 5A69A 3ADLA 4LFCI 1WHNA 1ZU1A 4DV6E 4LFBE 2NUFA 2JEBA 4NXNE 2EPRA 2L3CA 5C0XA 4BS9A 2I13A 1N34I 2DLKA 4LF8I 2NN6F 1HNXI 4OOGC 2CZ9A 3LPSA 2WBSA 2AJ4A 2EOSA 2M1SA 2LV2A 4LF4E 3M6AA 3PRYA 1YHCA 4M1KA 2B3TB 4JI4I 2LCEA 3MHHC 2WP8B 4K0KE 5IWAI 2EMCA 5C0XD 3RMPA 3T1HI 1RHYA 4LOMA 3UK3C 2JYAA 2RPCA 4B3TE 5CFFE 1I94E 4X64I 2O3ZA 2V34A 1IQOA 5AE3A 2VE7C 1AH5A 2Z5BB 4DUZI 1KJKA 4GKKI 2AE8A 4IFDA 2DEJA 4IS1C 2UUBI 4AM3A 4OO1F 2MKDA 4X62I 3VYXA 4X66E 2V87A 5A6BA 2ODRC 1T4LB 2EQ1A 4M30A 1B63A 1ZM9A 2LUQA 4B3MI 2JY9A 3THNA 3K17A 1Z59A 4U3BA 2N3HA 1QNTA 4DUYI 2EM7A 2RS6A 2EPOA 1EI1A 2HFUA 3AV0A 2YTJA 1IBKE 3B4TA 1NZ0A 4NBQA 1H73A 4HYMA 4R2SA 2JXPA 1ZBTA 4JI3E 1FJGE 2VQFE 2YRKA 4GKJE 2ENHA 2MC5A 4U3DA 3OTOI 3KWRA 4B3RE 1UDOA 4DV4E 2JEAB 2BM0A 3QT8A 4X9JA 3B82A 3ZZTA 4ZYGA 4IZKA 3LLHA 4RH8A 1N3GA 5BR8E 4HEIA 2IESA 2HGHA 4ISAA 1KYQA 4JI2I 5TSEA 2RSIA 3J7AG 1K47A 2X36A 5ELWA 1YFHA 5LMNI 1H7SA 5JEAA 4NHRA 1YZ9A 3GLLA 1P42A 4R2RA 4BMJA 3LTOA 2NUGA 2EL6A 2BA0D 2UXCI 1UHZA 2EMYA 2UUAE 2JT2A 2EOQA 2V85A 4LCGA 1PJSA 3JAMQ 3VYYA 2V88A 4DR6I 2EPMX 2O1VA 2DMIA 4LU9A 3GONA 4DR1I 4BA2B 4TUGA 4DXLA 1XNQE 3ZKDA 4Q35B 4FW4A 2MDGA 2ENCA 3V2UC 2N8XA 2J7JA 4OO1B 3WU6A 3ZOQB 1Y4UA 2VF1A 3LNUA 4DV3I 2HKEA 4DR4I 2A2DA 2UXBI 2Q8UA 4JI0I 1RQ0A 2BA0G 4IZJA 3HXLA 5IV8B 2ADRA 4LF6E 1WXRA 1IBMI 1J5EE 4LF7E 5F3WA 2YTPA 2HKJA 3K1JA 4PRXA 1HR0I 1H7UA 2UXDI 1YH8A 4WXCA 2PO0A 5K36D 5DNLA 5DRPA 4P78A 4IZJD 2EM6A 4AQYE 1UBDC 5IT9Q 4BA1B 1S4EA 1Z0GA 3AUZA 1EH8A 2CVEA 4DV6I 2EPKX 1MU5A 4R2EA 2C38B 4NXNI 3P3EA 4DR5E 2VRDA 2EOYA 2YT4A 2LJHA 4JI1E 3M85D 1RMDA 4OO1C 3JAMC 4LCFA 4HTGA 1USVA 5K36C 1UN6B 1Z1BA 2O1UA 2E5LE 2E1RA 2EQ3A 2LE2A 1TN9A 2C37A 4ED4A 5C0XE 1EH7A 2HC5A 5A2QQ 1X49A 1X3CA 4AIMA 4UT4A 2LRSA 3P06A 4WYQB 1N32I 1MGTA 3M99B 4LFAE 1G2FC 1GQEA 2G7HA 2V2ZA 3KZZA 3H09A 4DPXA 4DU8A 2DLQA 4DV5E 3F6HA 2YU8A 1A1LA 2NPFA 3M85G 5AE1A 4HXZA 2Z5CA 2EL4A 4F6MA 3ZM7A 1Z0TA 3DF6A 4NZVA 4ZYHA 5AASA 4DR7E 1Y60A 4Z7YA 4X66I 2L2KB 1Y6ZA 2R1FA 4WUBA 4Z7CA 2EOXA 3J81C 5LLQA 1T39A 1RC7A 2V2VA 1UDNA 4JG4A 4B3SI 4IFDE 4BC7A 2EM4A 4FW9A 2NABA 2GQ0A 4OKGA 5KL3A 4F2JC 5IT9C 2B7TA 1U2RA 1OYPA 2EMXA 4KHPE 2M9AA 3P3CA 1HNZI 4RHBB 3MSWA 2IOQA 5C0XF 4JV5I 2GHFA 4MQYA 4HACA 1ZR9A 4DV4I 2UU9E 4JI6I 4DR3E 1XMOE 1NEIA 1MG7A 2MKNA 4LF9I 4O4KA 5A2QC 2EMAA 5BR8I 2C39A 2FV4B 2CG9A 1EKZA 1ZM2A 1WUUA 4M2ZA 4OX9I 1WHQA 1OJ4A 2VQEI 3PS2A 1YPNA 2ODRD 1N0VC 2IOPA 3VK6A 4KQVA 2EN6A 2BV3A 3HPSA 1YYOA 5KL5A 5JEAE 4IFDF 1VISA 3F0NA 2JOBA 3PYEA 2ZM6E 4FWDA 1D6TA 2K4VA 2ZBKB 2YPNA 3ZKBA 3LMLA 2JE6A 4LF5I 2PO2A 4YHHE 5A6JA 1N0UA 2WNRB 1Z0WA 2EM2A 2ELZA 3EPJA 5LMUI 4DV7I 4YY3I 1X48A 2GO4A 1A1GA 4JI5I 2HHHI 4LF6I 2IHR1 1NHIA 1P47A 1O0WA 4R2PA 2KOUA 2EL5A 4PRVA 2DEIA 2JEBB 5C0XB 3U1YA 3T1YE 2BR2A 2YRHA 1B69A 4BC9A 2EOMA 3PS1A 4F9BB 2EPPA 2V83A 3IWCA 2PO1A 1BB8A 2XEXA 5EL9A 2EPZA 1A1JA 2NN6B 1SFEA 2R42A 3B78A 2EM3A 2RSMA 1KKHA 1RREA 4FW5A 2LMZA 4JYAI 1N36E 5JEAF 3PYFA 1FKAE 1X5WA 2JPAA 4PU9A 2DB2A 1X6EA 3M7ND 1KIJA 1Z5BA 4FK5C 1YYKA 4MLQA 2E5LI 4O24A 5FWKA 4DR2E 2EWLA 4F6NA 4JI8I 2DSYA 2HJJA 2MC6A 2PNLA 4DV0E 2EM5A 4MYUA 4LFAI 4LFCE 1BBOA 4IFDB 4OO1D 2VF3A 4X65I 2EN8A 3DJWA 1N34E 1X6FA 1GTKA 4P7DA 4LF8E 3J7Yp 1QU6A 1UILA 2CSHA 2JWOA 3MHSC 4DV1E 4UTGA 3M7NG 4DV2I 4BA1A 4NXMI 5K36A 3J80Q 2K7IA 4DR7I 2EOZA 1X6HA 5GMDA 4JI4E 1WJPA 1Z0CA 2B9DA 4F9AB 2B7VA 1HK7A 2JOXA 5AC4A 5IWAE 2IERA 1XMQE 3L7ZA 2L92A 2WBTA 3T1HE 4USKA 2UUCE 1ZM3A 4R8OA 5IXMB 1Z0EA 1PKPA 2GPIA 1ZAAC 2O1WA 4X8WA 3C6KA 5AE2A 2YTIA 4X64E 2ELYA 1IQSA 4DUZE 2BB8A 4IZKB 4WUCA 1XNRI 4R1FA 4GKKE 2CT1A 2VESA 2LTRA 2LVHA 2UUBE 3P76A 1F2IG 4X62E 1KTVA 2LJUA 4LFBI 2PRTA 2EP3A 4DR3I 2EN2A 3BIDA 2WBUA 2YSOA 1DGCA 1FWLA 5JEAB 2LJPA 1H74A 4M9VC 2HK3A 4O43A 4LF4I 3GCMA 2RTXA 2YTQA 2M4IA 2NUEA 1ZXNA 3HJCA 4ZYEA 4GZNC 2RS7A 1EA6A 2PNZA 4K0KI 1PDAA 1HR0E 4R2DA 3NZKA 2YTNA 1T4NA 1NHHA 2JR1A 1OYRA 2DMYA 2X7IA 2EMGA 3J80C 4B3TI 1I94I 2EMIA 1OYSA 2A25A 4TUIA 4JI2E 1A1KA 2EM9A 3DD6A 2EQ0A 1H72C 2EM8A 3BBGA 2L2NA 4Q28A 3CDJA 1JK1A 5LMNE 4QNJA 4BHCA 1B62A 5DROA 1DI2A 3HQ1A 1Z0BA 2EOJA 4JI7E 1A1HA 4WSPA 1PJQA 1LLMC 4DKKA 2PO0B 1X47A 2FTXB 4MLVA 1IBKI 3VHTB 2MDRA 2H36X 2WP8A 4IS9A 2EMZA 4IJDA 1GZ6A 4R2CA 4DR1E 4MU4A 4MU1A 4EMDA 4JI3I 4GKJI 4XTJA 2VQFI 1NCSA 1FJGI 4B3RI 1ELOA 4DPUA 2EOHA 3ECRA 2A2CA 3J7AM 3K85A 3B8HA 4DV3E 5A6KA 4DR4E 2UXBE 2Z5BA 2C37B 1J26A 1A6FA 2EMKA 4FW6A 4GEQB 1YYWA 1G2DC 1XXEA 4O5GA 4WSGA 1R6MA 3C4BA 3F6GA 3EPKA 2EPAA 1AAYA 3ADJA 4R2QA 4LPFA 4OZEA 2ZITA 2WW4A 1RR9A 2F8BA 2EJ4A 2UXDE 1UEKA 1Z5AA 1SR9A 2UUAI 5KL4A 4BHBA 2EN7A 2Z5CB 2R3VA 3IWDA 2OI2A 1XNQI 2Q2EB 1UDQA 1XHKA 1UDSA 2JEAA 3HKMA 4L5NC 4ZYDA 2CPNA 2EPLX 4DV1I 2LTSA 2NN6A 3IWBA 1HNWE 3ZZUA 2JP9A 2M7QA 4DMIA 4MU3A 1PIEA 4I8OA 3D4JA 3V5RA 3WU3A 1XMQI 3CWVA 1J5EI 2UUCI 4LF7I 5K36E 2EE8A 5DRQA 2LO3A 4HACB 3KZYA 1EH6A 2EPXA 4F54A 4DPWA 4DU7A 3KRNA 4P7AA 2NN6D 4LTYA 2N3GA 2EFGA 5T6JA 2L3JA 2J7KA 4FN5A 2C39B 1N32E 4AQYI 1TF6A 4L8NA 4BA2A 2F4VE 4HY1A 4WX9A 2LT7A 2DIXA 4WXDA 1E3PA 5LL6R 4MU0A 3PYDA 2EMWA 5KL6A 5C0XC 2EN3A 1N33E 1PJTA 2YTOA 4DR5I 2BA1D 1ZBQA 4OO1A 4B3SE 4JI1I 3U1KA 5DNYA 2NN6C 4IFDD 3ADGA 1BBGA 4WPYA 3P1XA 4BBYA 1IBLE 1HNZE 5A6BD 2O1TA 5AC5A 3Q6MA 2EPCA 2EN4A 4JV5E 4M0VA 2EOFA 4DPTA 2JE6B 1TF3A 2PO2B 1USUA 4JI6E 3H1CA 1QZRA 1MEYC 4DV5I 1A1IA 1HNXE 4LF9E 3ZZ0A 5K36F 2BA1G 4MYTA 2EMFA 4IFDC 3C6MA 4FW3A 2E72A 4R2AA 3JU0A 2YTDA 2PNMA 2C38A 3H4LA 4OX9E 3C4TA 1L4SA 2VQEE 2GLIA 4J8ZA 3THOB 2YTEA 4JI7I 4I3HA 2D9HA 2BR2B 1STUA 1IMUA 3QT7A 2EMLA 2WZOA 1WRJA 4R03A 3PYGA 2V8QB 4MDTA 2NA2A 2GS8A 3QT5A 2EORA 2PO1B 4KHPI 2LBSB 2WCC3 4GQUA 5JEAD 1FNMA 4BCAA 2JVAA 4DPYA 3ADIA 4LF5E 1FI4A 1Y4SA 2CTDA 2L8TA 2F1DA 4FWGA 2EPUA 4WUDA 2UU9I 2DRPA 3WU4A 2E1MA 2ENAA 1XMOI 2L6MA 4KZSA 4B3ME 2DGCA 2FGGA 2EOIA 2YTGA 5LMUE 4F9CB 2YRMA 4YY3E 4DUYE 3QG5C 4DV7E 4JI5E 2HHHE 2YWQA 5FLXQ 1A1FA 5JEAC 2EN1A 5EKWA 3EPLA 2I9IA 2Z5EA 2YSPA 1T4OA 3BF2A 3OTOE 2V8PA 3J81Q 4FWHA 3EPHA 3JTZA 2V2QA 3GMEA 4ZVIA 2EOOA 1R6LA 1ZM4A 4RPFA 3WU5A 3TQMA 2EPNA 2RQLA 4LCHA 5K36B 1MX0A 3CDIA 5KL7A 3EQ1A 5KL2A 2EM0A 2L2MA 2L33A 4KWYA 1T38A 4JYAE 2ZM6I 4IZJB 2BM1A 4N4RB 2CGEA 3L7ZB 3QT6A 3BGHA 4YHHI 3FIGA 1BKNA 1PVGA 4QNKA 3Q6NA 4J3DA 1HNWI
chains in the Genus database with same CATH topology
2UXCE 4JI8E 2EZ6A 1Z0VA 5ADZA 2LUPB 2YZTA 4DR6E 3HULA 4URLA 3HTXA 2V86A 1DARA 4X65E 4WFTA 4USMA 1KVKA 4N3OA 2KONA 3T1YI 1ZXMA 1NHJA 1S16A 5L3JA 5FLXC 3OMLA 4P52A 4DV2E 4NXME 3Q1QA 2KHXA 4JI0E 2F4VI 2V89A 1N36I 1DQ3A 3K6QA 1FWKA 2HK2A 1N33I 1IBME 4DR2I 3HPZA 2HFSA 5GMEA 1Z5CA 1IBLI 4DV0I 1XNRE 3ADLA 4LFCI 1WHNA 4DV6E 4LFBE 2NUFA 4NXNE 2L3CA 1N34I 4BS9A 4LF8I 1HNXI 4OOGC 2CZ9A 3LPSA 2AJ4A 2M1SA 4LF4E 3M6AA 3PRYA 4M1KA 2B3TB 4JI4I 4K0KE 5IWAI 3RMPA 3T1HI 4B3TE 5CFFE 1I94E 4X64I 2V34A 5AE3A 2VE7C 2Z5BB 4DUZI 4GKKI 2DEJA 2UUBI 4X62I 3VYXA 4X66E 2V87A 2ODRC 1T4LB 4M30A 1B63A 1ZM9A 2LUQA 4B3MI 2JY9A 3K17A 1Z59A 2N3HA 4DUYI 2RS6A 1EI1A 2HFUA 3AV0A 1IBKE 1NZ0A 1H73A 4HYMA 1ZBTA 4JI3E 1FJGE 2VQFE 4GKJE 3OTOI 2MC5A 1HR0I 3KWRA 4B3RE 4DV4E 2BM0A 3QT8A 3B82A 3ZZTA 4IZKA 3LLHA 5BR8E 4JI2I 3J7AG 1K47A 2X36A 5LMNI 1H7SA 1YZ9A 4BMJA 3LTOA 2NUGA 2UXCI 1UHZA 2UUAE 2V85A 3JAMQ 3VYYA 2V88A 4DR6I 2O1VA 4LU9A 3GONA 4DR1I 4TUGA 4DXLA 1XNQE 3ZKDA 3V2UC 3WU6A 3ZOQB 1Y4UA 2VF1A 3LNUA 4DV3I 2HKEA 4DR4I 2A2DA 2UXBI 4JI0I 1RQ0A 4IZJA 3HXLA 4LF6E 1WXRA 1IBMI 1J5EE 4LF7E 5F3WA 4PRXA 2HKJA 3K1JA 1H7UA 2UXDI 4P78A 4IZJD 4AQYE 5IT9Q 1S4EA 1Z0GA 3AUZA 4DV6I 1MU5A 4NXNI 4DR5E 2YT4A 2LJHA 4JI1E 3JAMC 1USVA 2O1UA 2E5LE 2E1RA 2LE2A 4ED4A 5A2QQ 1X49A 4UT4A 2LRSA 3P06A 4WYQB 4LFAE 1GQEA 2G7HA 2V2ZA 3H09A 4DPXA 4DU8A 4DV5E 3F6HA 2NPFA 5AE1A 4HXZA 2Z5CA 3ZM7A 1N32I 1Z0TA 3DF6A 4DR7E 5AASA 4Z7YA 4X66I 2L2KB 1Y6ZA 4WUBA 2V2VA 3J81C 1RC7A 4JG4A 4B3SI 4BC7A 4FW9A 2GQ0A 5IT9C 2B7TA 1U2RA 4KHPE 1HNZI 3MSWA 2IOQA 4JV5I 4HACA 4DV4I 2UU9E 4JI6I 4DR3E 1XMOE 1MG7A 4LF9I 5A2QC 5BR8I 2FV4B 2CG9A 1EKZA 1ZM2A 1WUUA 4M2ZA 4OX9I 1WHQA 1OJ4A 2VQEI 2ODRD 1N0VC 2IOPA 3VK6A 4KQVA 2BV3A 3HPSA 1YYOA 1VISA 3F0NA 2JOBA 3PYEA 2ZM6E 4FWDA 1D6TA 2K4VA 2ZBKB 3ZKBA 3LMLA 4LF5I 4YHHE 1N0UA 1Z0WA 5LMUI 4DV7I 4YY3I 1X48A 4JI5I 4LF6I 2HHHI 2IHR1 1NHIA 1O0WA 2KOUA 4PRVA 2DEIA 3T1YE 4BC9A 4F9BB 2V83A 3IWCA 2XEXA 2R42A 3B78A 1KKHA 2RSMA 1RREA 4JYAI 2LMZA 1N36E 3PYFA 1FKAE 4PU9A 2DB2A 1KIJA 1Z5BA 1YYKA 2E5LI 5FWKA 4DR2E 2EWLA 4JI8I 2DSYA 2MC6A 2PNLA 4DV0E 4MYUA 4LFAI 4LFCE 2VF3A 4X65I 3DJWA 1N34E 4LF8E 4P7DA 3J7Yp 1QU6A 1UILA 2JWOA 4DV1E 4DV2I 4NXMI 3J80Q 4DR7I 5GMDA 4JI4E 1Z0CA 2B9DA 4F9AB 2B7VA 1HK7A 2JOXA 5IWAE 1XMQE 2L92A 3T1HE 4USKA 2UUCE 1ZM3A 4R8OA 1Z0EA 1PKPA 2O1WA 4X8WA 5AE2A 4X64E 4DUZE 4IZKB 4WUCA 1XNRI 4R1FA 4GKKE 2LTRA 2UUBE 4X62E 1KTVA 4LFBI 4DR3I 1FWLA 2LJPA 1H74A 2HK3A 4LF4I 2RTXA 2M4IA 2NUEA 1ZXNA 3HJCA 2RS7A 1EA6A 4K0KI 1HR0E 1T4NA 1NHHA 2JR1A 2DMYA 2X7IA 3J80C 4B3TI 1I94I 4TUIA 4JI2E 1H72C 2L2NA 4Q28A 5LMNE 1B62A 1DI2A 3HQ1A 1Z0BA 4JI7E 4WSPA 4DKKA 1X47A 2FTXB 1IBKI 2MDRA 2H36X 4UTGA 4EMDA 4DR1E 1GZ6A 4JI3I 4GKJI 4XTJA 2VQFI 1FJGI 4B3RI 1ELOA 4DPUA 2A2CA 3J7AM 3K85A 3B8HA 4DV3E 4DR4E 2UXBE 2Z5BA 1J26A 1A6FA 4GEQB 1YYWA 3C4BA 3F6GA 3ADJA 2ZITA 2WW4A 1RR9A 2F8BA 2UXDE 1UEKA 1Z5AA 1SR9A 2UUAI 2Z5CB 2R3VA 3IWDA 2OI2A 1XNQI 2Q2EB 1XHKA 4L5NC 4DV1I 2CPNA 2LTSA 3IWBA 1HNWE 3ZZUA 2M7QA 4DMIA 1PIEA 4I8OA 3D4JA 3V5RA 3WU3A 1XMQI 3CWVA 1J5EI 2UUCI 4LF7I 4HACB 4F54A 4DPWA 4DU7A 4P7AA 4LTYA 2N3GA 2EFGA 5T6JA 2L3JA 2J7KA 4FN5A 1N32E 4AQYI 4L8NA 2F4VE 4HY1A 2DIXA 5LL6R 3PYDA 1N33E 4DR5I 1ZBQA 4B3SE 4JI1I 5DNYA 3ADGA 4WPYA 3P1XA 4BBYA 1IBLE 1HNZE 2O1TA 3Q6MA 4JV5E 4M0VA 4DPTA 1USUA 4JI6E 1QZRA 4DV5I 4LF9E 1HNXE 3ZZ0A 4MYTA 3JU0A 2PNMA 3H4LA 4OX9E 3C4TA 2VQEE 4J8ZA 4JI7I 4I3HA 1STUA 3QT7A 2WZOA 4R03A 3PYGA 2V8QB 2NA2A 2GS8A 3QT5A 4KHPI 2LBSB 1FNMA 4BCAA 2JVAA 4DPYA 3ADIA 4LF5E 1FI4A 1Y4SA 2L8TA 4FWGA 4WUDA 2UU9I 3WU4A 2E1MA 1XMOI 2L6MA 4KZSA 4B3ME 2FGGA 5LMUE 4Z7CA 4F9CB 4DUYE 4YY3E 4DV7E 4JI5E 5FLXQ 2HHHE 2Z5EA 1T4OA 3J81Q 3OTOE 2V8PA 4FWHA 3JTZA 2V2QA 4ZVIA 1ZM4A 4RPFA 3WU5A 1MX0A 4JYAE 2ZM6I 2L2MA 2L33A 4IZJB 2BM1A 2CGEA 3QT6A 4YHHI 3FIGA 1BKNA 1PVGA 3Q6NA 1HNWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC E;  4JI8 E;  2EZ6 A;  1Z0V A;  2LUP B;  4DR6 E;  3HUL A;  4URL A;  3HTX A;  1DAR A;  4X65 E;  4WFT A;  4USM A;  1KVK A;  3T1Y I;  1ZXM A;  1NHJ A;  1S16 A;  5L3J A;  5FLX C;  4P52 A;  4DV2 E;  4NXM E;  3Q1Q A;  2KHX A;  4JI0 E;  2F4V I;  1N36 I;  1FWK A;  2HK2 A;  1N33 I;  1IBM E;  4DR2 I;  2HFS A;  5GME A;  1Z5C A;  1IBL I;  4DV0 I;  1XNR E;  3ADL A;  4LFC I;  1WHN A;  4DV6 E;  4LFB E;  2NUF A;  4NXN E;  2L3C A;  1N34 I;  4LF8 I;  1HNX I;  4OOG C;  2CZ9 A;  3LPS A;  2AJ4 A;  4LF4 E;  3M6A A;  4M1K A;  2B3T B;  4JI4 I;  4K0K E;  5IWA I;  3T1H I;  4B3T E;  5CFF E;  1I94 E;  4X64 I;  2V34 A;  4DUZ I;  4GKK I;  2DEJ A;  2UUB I;  4X62 I;  3VYX A;  4X66 E;  1T4L B;  4M30 A;  1B63 A;  1ZM9 A;  2LUQ A;  4B3M I;  2JY9 A;  3K17 A;  1Z59 A;  2N3H A;  4DUY I;  2RS6 A;  1EI1 A;  2HFU A;  1IBK E;  1NZ0 A;  1H73 A;  4HYM A;  1ZBT A;  4JI3 E;  1FJG E;  2VQF E;  4GKJ E;  3OTO I;  1HR0 I;  4B3R E;  4DV4 E;  2BM0 A;  3QT8 A;  3B82 A;  3ZZT A;  3LLH A;  5BR8 E;  4JI2 I;  1K47 A;  2X36 A;  5LMN I;  3J7A G;  1H7S A;  1YZ9 A;  3LTO A;  2NUG A;  2UXC I;  1UHZ A;  2UUA E;  3JAM Q;  3VYY A;  4DR6 I;  3GON A;  4DR1 I;  4DXL A;  1XNQ E;  3ZKD A;  3V2U C;  3WU6 A;  3LNU A;  4DV3 I;  2HKE A;  4DR4 I;  2A2D A;  2UXB I;  4JI0 I;  1RQ0 A;  4LF6 E;  1IBM I;  1J5E E;  4LF7 E;  4PRX A;  2HKJ A;  3K1J A;  1H7U A;  2UXD I;  4AQY E;  5IT9 Q;  1S4E A;  1Z0G A;  4DV6 I;  1MU5 A;  4NXN I;  4DR5 E;  2YT4 A;  2LJH A;  4JI1 E;  3JAM C;  2E5L E;  2E1R A;  4ED4 A;  5A2Q Q;  1X49 A;  4UT4 A;  2LRS A;  4WYQ B;  4LFA E;  1GQE A;  2V2Z A;  4DPX A;  4DU8 A;  4DV5 E;  2NPF A;  4HXZ A;  3ZM7 A;  1N32 I;  1Z0T A;  4DR7 E;  4Z7Y A;  4X66 I;  2L2K B;  4WUB A;  2V2V A;  3J81 C;  1RC7 A;  4JG4 A;  4B3S I;  4FW9 A;  5IT9 C;  2B7T A;  1U2R A;  4KHP E;  1HNZ I;  4JV5 I;  4HAC A;  4DV4 I;  2UU9 E;  4JI6 I;  4DR3 E;  1XMO E;  1MG7 A;  4LF9 I;  5A2Q C;  5BR8 I;  1EKZ A;  1ZM2 A;  1WUU A;  4M2Z A;  4OX9 I;  1WHQ A;  1OJ4 A;  2VQE I;  1N0V C;  4KQV A;  2BV3 A;  1YYO A;  1VIS A;  3F0N A;  3PYE A;  2ZM6 E;  4FWD A;  1D6T A;  2ZBK B;  3ZKB A;  4LF5 I;  4YHH E;  1N0U A;  1Z0W A;  5LMU I;  4DV7 I;  4YY3 I;  1X48 A;  4JI5 I;  4LF6 I;  2HHH I;  2IHR 1;  1NHI A;  1O0W A;  4PRV A;  2DEI A;  3T1Y E;  2XEX A;  2R42 A;  3B78 A;  1KKH A;  2RSM A;  1RRE A;  4JYA I;  1N36 E;  3PYF A;  1FKA E;  4PU9 A;  2DB2 A;  1KIJ A;  1Z5B A;  1YYK A;  2E5L I;  4DR2 E;  4JI8 I;  4DV0 E;  4MYU A;  4LFA I;  4LFC E;  2VF3 A;  4X65 I;  1N34 E;  4LF8 E;  3J7Y p;  1QU6 A;  1UIL A;  4DV1 E;  4DV2 I;  4NXM I;  3J80 Q;  4DR7 I;  5GMD A;  4JI4 E;  1Z0C A;  2B7V A;  5IWA E;  1XMQ E;  4USK A;  3T1H E;  2UUC E;  1ZM3 A;  1Z0E A;  1PKP A;  4X8W A;  4X64 E;  4DUZ E;  4WUC A;  1XNR I;  4R1F A;  4GKK E;  2LTR A;  2UUB E;  4X62 E;  1KTV A;  4LFB I;  4DR3 I;  1FWL A;  2LJP A;  1H74 A;  2HK3 A;  4LF4 I;  2RTX A;  2NUE A;  1ZXN A;  2RS7 A;  1EA6 A;  4K0K I;  1HR0 E;  1T4N A;  1NHH A;  2DMY A;  2X7I A;  3J80 C;  4B3T I;  1I94 I;  4JI2 E;  1H72 C;  2L2N A;  5LMN E;  1B62 A;  1DI2 A;  1Z0B A;  4JI7 E;  4DKK A;  1X47 A;  1IBK I;  2MDR A;  4UTG A;  4EMD A;  4DR1 E;  4JI3 I;  4GKJ I;  4XTJ A;  2VQF I;  1FJG I;  4B3R I;  1ELO A;  4DPU A;  2A2C A;  3J7A M;  3B8H A;  4DV3 E;  4DR4 E;  2UXB E;  1J26 A;  1A6F A;  1YYW A;  3C4B A;  3ADJ A;  2ZIT A;  2WW4 A;  1RR9 A;  2UXD E;  1UEK A;  1Z5A A;  2UUA I;  2R3V A;  2OI2 A;  1XNQ I;  2Q2E B;  1XHK A;  4DV1 I;  2CPN A;  2LTS A;  1HNW E;  3ZZU A;  1PIE A;  3D4J A;  3V5R A;  3WU3 A;  1XMQ I;  3CWV A;  1J5E I;  2UUC I;  4LF7 I;  4HAC B;  4DPW A;  4DU7 A;  4P7A A;  2N3G A;  2EFG A;  2L3J A;  2J7K A;  4FN5 A;  1N32 E;  4AQY I;  2F4V E;  4HY1 A;  2DIX A;  5LL6 R;  3PYD A;  1N33 E;  4DR5 I;  4B3S E;  4JI1 I;  3ADG A;  3P1X A;  1IBL E;  1HNZ E;  4JV5 E;  4DPT A;  4JI6 E;  1QZR A;  4DV5 I;  4LF9 E;  1HNX E;  3ZZ0 A;  4MYT A;  3H4L A;  4OX9 E;  3C4T A;  2VQE E;  4JI7 I;  4I3H A;  1STU A;  3QT7 A;  3PYG A;  2NA2 A;  2GS8 A;  3QT5 A;  4KHP I;  2LBS B;  1FNM A;  2JVA A;  4DPY A;  3ADI A;  4LF5 E;  1FI4 A;  4FWG A;  4WUD A;  2UU9 I;  3WU4 A;  1XMO I;  4B3M E;  5LMU E;  4Z7C A;  4DUY E;  4DV7 E;  4YY3 E;  4JI5 E;  5FLX Q;  2HHH E;  1T4O A;  3J81 Q;  3OTO E;  2V8P A;  4FWH A;  2V2Q A;  4ZVI A;  1ZM4 A;  4RPF A;  3WU5 A;  1MX0 A;  4JYA E;  2ZM6 I;  2L2M A;  2L33 A;  2BM1 A;  3QT6 A;  4YHH I;  1BKN A;  1PVG A;  1HNW I; 
#chains in the Genus database with same CATH topology
 2UXC E;  4JI8 E;  2EZ6 A;  1VI7 A;  1Z0V A;  5ADZ A;  2LUP B;  2YZT A;  4FW7 A;  4DR6 E;  3HUL A;  4URL A;  3L00 A;  5A6A A;  2V86 A;  3HTX A;  1E3H A;  1DAR A;  2NN6 E;  2YU5 A;  4X65 E;  2BBG A;  4WFT A;  2EMB A;  1KVK A;  2GO3 A;  4N3O A;  2KON A;  1YUJ A;  4USM A;  1ZXM A;  3T1Y I;  1NHJ A;  1S16 A;  5DRR A;  3PS3 A;  5L3J A;  5FLX C;  3OML A;  4P52 A;  3P3G A;  4DV2 E;  4NXM E;  3Q1Q A;  2KHX A;  4JI0 E;  2F4V I;  2V89 A;  1Y5Y A;  1DQ3 A;  2EMH A;  3K6Q A;  3UHM A;  1N36 I;  1FWK A;  2HK2 A;  1N33 I;  2PNZ B;  1IBM E;  2J65 A;  1YSA C;  5DNX A;  2WNR A;  1JK2 A;  4DR2 I;  3HPZ A;  2EOE A;  2HFS A;  2YTF A;  5GME A;  4OO1 E;  1Z5C A;  1IBL I;  1YUI A;  4DV0 I;  1XNR E;  2R76 A;  4AID A;  5A69 A;  3ADL A;  4LFC I;  1WHN A;  1ZU1 A;  4DV6 E;  4LFB E;  2NUF A;  2JEB A;  4NXN E;  2EPR A;  2L3C A;  5C0X A;  4BS9 A;  2I13 A;  1N34 I;  2DLK A;  4LF8 I;  2NN6 F;  1HNX I;  4OOG C;  2CZ9 A;  3LPS A;  2WBS A;  2AJ4 A;  2EOS A;  2M1S A;  2LV2 A;  4LF4 E;  3M6A A;  3PRY A;  1YHC A;  4M1K A;  2B3T B;  4JI4 I;  2LCE A;  3MHH C;  2WP8 B;  4K0K E;  5IWA I;  2EMC A;  5C0X D;  3RMP A;  3T1H I;  1RHY A;  4LOM A;  3UK3 C;  2JYA A;  2RPC A;  4B3T E;  5CFF E;  1I94 E;  4X64 I;  2O3Z A;  2V34 A;  1IQO A;  5AE3 A;  2VE7 C;  1AH5 A;  2Z5B B;  4DUZ I;  1KJK A;  4GKK I;  2AE8 A;  4IFD A;  2DEJ A;  4IS1 C;  2UUB I;  4AM3 A;  4OO1 F;  2MKD A;  4X62 I;  3VYX A;  4X66 E;  2V87 A;  5A6B A;  2ODR C;  1T4L B;  2EQ1 A;  4M30 A;  1B63 A;  1ZM9 A;  2LUQ A;  4B3M I;  2JY9 A;  3THN A;  3K17 A;  1Z59 A;  4U3B A;  2N3H A;  1QNT A;  4DUY I;  2EM7 A;  2RS6 A;  2EPO A;  1EI1 A;  2HFU A;  3AV0 A;  2YTJ A;  1IBK E;  3B4T A;  1NZ0 A;  4NBQ A;  1H73 A;  4HYM A;  4R2S A;  2JXP A;  1ZBT A;  4JI3 E;  1FJG E;  2VQF E;  2YRK A;  4GKJ E;  2ENH A;  2MC5 A;  4U3D A;  3OTO I;  3KWR A;  4B3R E;  1UDO A;  4DV4 E;  2JEA B;  2BM0 A;  3QT8 A;  4X9J A;  3B82 A;  3ZZT A;  4ZYG A;  4IZK A;  3LLH A;  4RH8 A;  1N3G A;  5BR8 E;  4HEI A;  2IES A;  2HGH A;  4ISA A;  1KYQ A;  4JI2 I;  5TSE A;  2RSI A;  3J7A G;  1K47 A;  2X36 A;  5ELW A;  1YFH A;  5LMN I;  1H7S A;  5JEA A;  4NHR A;  1YZ9 A;  3GLL A;  1P42 A;  4R2R A;  4BMJ A;  3LTO A;  2NUG A;  2EL6 A;  2BA0 D;  2UXC I;  1UHZ A;  2EMY A;  2UUA E;  2JT2 A;  2EOQ A;  2V85 A;  4LCG A;  1PJS A;  3JAM Q;  3VYY A;  2V88 A;  4DR6 I;  2EPM X;  2O1V A;  2DMI A;  4LU9 A;  3GON A;  4DR1 I;  4BA2 B;  4TUG A;  4DXL A;  1XNQ E;  3ZKD A;  4Q35 B;  4FW4 A;  2MDG A;  2ENC A;  3V2U C;  2N8X A;  2J7J A;  4OO1 B;  3WU6 A;  3ZOQ B;  1Y4U A;  2VF1 A;  3LNU A;  4DV3 I;  2HKE A;  4DR4 I;  2A2D A;  2UXB I;  2Q8U A;  4JI0 I;  1RQ0 A;  2BA0 G;  4IZJ A;  3HXL A;  5IV8 B;  2ADR A;  4LF6 E;  1WXR A;  1IBM I;  1J5E E;  4LF7 E;  5F3W A;  2YTP A;  2HKJ A;  3K1J A;  4PRX A;  1HR0 I;  1H7U A;  2UXD I;  1YH8 A;  4WXC A;  2PO0 A;  5K36 D;  5DNL A;  5DRP A;  4P78 A;  4IZJ D;  2EM6 A;  4AQY E;  1UBD C;  5IT9 Q;  4BA1 B;  1S4E A;  1Z0G A;  3AUZ A;  1EH8 A;  2CVE A;  4DV6 I;  2EPK X;  1MU5 A;  4R2E A;  2C38 B;  4NXN I;  3P3E A;  4DR5 E;  2VRD A;  2EOY A;  2YT4 A;  2LJH A;  4JI1 E;  3M85 D;  1RMD A;  4OO1 C;  3JAM C;  4LCF A;  4HTG A;  1USV A;  5K36 C;  1UN6 B;  1Z1B A;  2O1U A;  2E5L E;  2E1R A;  2EQ3 A;  2LE2 A;  1TN9 A;  2C37 A;  4ED4 A;  5C0X E;  1EH7 A;  2HC5 A;  5A2Q Q;  1X49 A;  1X3C A;  4AIM A;  4UT4 A;  2LRS A;  3P06 A;  4WYQ B;  1N32 I;  1MGT A;  3M99 B;  4LFA E;  1G2F C;  1GQE A;  2G7H A;  2V2Z A;  3KZZ A;  3H09 A;  4DPX A;  4DU8 A;  2DLQ A;  4DV5 E;  3F6H A;  2YU8 A;  1A1L A;  2NPF A;  3M85 G;  5AE1 A;  4HXZ A;  2Z5C A;  2EL4 A;  4F6M A;  3ZM7 A;  1Z0T A;  3DF6 A;  4NZV A;  4ZYH A;  5AAS A;  4DR7 E;  1Y60 A;  4Z7Y A;  4X66 I;  2L2K B;  1Y6Z A;  2R1F A;  4WUB A;  4Z7C A;  2EOX A;  3J81 C;  5LLQ A;  1T39 A;  1RC7 A;  2V2V A;  1UDN A;  4JG4 A;  4B3S I;  4IFD E;  4BC7 A;  2EM4 A;  4FW9 A;  2NAB A;  2GQ0 A;  4OKG A;  5KL3 A;  4F2J C;  5IT9 C;  2B7T A;  1U2R A;  1OYP A;  2EMX A;  4KHP E;  2M9A A;  3P3C A;  1HNZ I;  4RHB B;  3MSW A;  2IOQ A;  5C0X F;  4JV5 I;  2GHF A;  4MQY A;  4HAC A;  1ZR9 A;  4DV4 I;  2UU9 E;  4JI6 I;  4DR3 E;  1XMO E;  1NEI A;  1MG7 A;  2MKN A;  4LF9 I;  4O4K A;  5A2Q C;  2EMA A;  5BR8 I;  2C39 A;  2FV4 B;  2CG9 A;  1EKZ A;  1ZM2 A;  1WUU A;  4M2Z A;  4OX9 I;  1WHQ A;  1OJ4 A;  2VQE I;  3PS2 A;  1YPN A;  2ODR D;  1N0V C;  2IOP A;  3VK6 A;  4KQV A;  2EN6 A;  2BV3 A;  3HPS A;  1YYO A;  5KL5 A;  5JEA E;  4IFD F;  1VIS A;  3F0N A;  2JOB A;  3PYE A;  2ZM6 E;  4FWD A;  1D6T A;  2K4V A;  2ZBK B;  2YPN A;  3ZKB A;  3LML A;  2JE6 A;  4LF5 I;  2PO2 A;  4YHH E;  5A6J A;  1N0U A;  2WNR B;  1Z0W A;  2EM2 A;  2ELZ A;  3EPJ A;  5LMU I;  4DV7 I;  4YY3 I;  1X48 A;  2GO4 A;  1A1G A;  4JI5 I;  2HHH I;  4LF6 I;  2IHR 1;  1NHI A;  1P47 A;  1O0W A;  4R2P A;  2KOU A;  2EL5 A;  4PRV A;  2DEI A;  2JEB B;  5C0X B;  3U1Y A;  3T1Y E;  2BR2 A;  2YRH A;  1B69 A;  4BC9 A;  2EOM A;  3PS1 A;  4F9B B;  2EPP A;  2V83 A;  3IWC A;  2PO1 A;  1BB8 A;  2XEX A;  5EL9 A;  2EPZ A;  1A1J A;  2NN6 B;  1SFE A;  2R42 A;  3B78 A;  2EM3 A;  2RSM A;  1KKH A;  1RRE A;  4FW5 A;  2LMZ A;  4JYA I;  1N36 E;  5JEA F;  3PYF A;  1FKA E;  1X5W A;  2JPA A;  4PU9 A;  2DB2 A;  1X6E A;  3M7N D;  1KIJ A;  1Z5B A;  4FK5 C;  1YYK A;  4MLQ A;  2E5L I;  4O24 A;  5FWK A;  4DR2 E;  2EWL A;  4F6N A;  4JI8 I;  2DSY A;  2HJJ A;  2MC6 A;  2PNL A;  4DV0 E;  2EM5 A;  4MYU A;  4LFA I;  4LFC E;  1BBO A;  4IFD B;  4OO1 D;  2VF3 A;  4X65 I;  2EN8 A;  3DJW A;  1N34 E;  1X6F A;  1GTK A;  4P7D A;  4LF8 E;  3J7Y p;  1QU6 A;  1UIL A;  2CSH A;  2JWO A;  3MHS C;  4DV1 E;  4UTG A;  3M7N G;  4DV2 I;  4BA1 A;  4NXM I;  5K36 A;  3J80 Q;  2K7I A;  4DR7 I;  2EOZ A;  1X6H A;  5GMD A;  4JI4 E;  1WJP A;  1Z0C A;  2B9D A;  4F9A B;  2B7V A;  1HK7 A;  2JOX A;  5AC4 A;  5IWA E;  2IER A;  1XMQ E;  3L7Z A;  2L92 A;  2WBT A;  3T1H E;  4USK A;  2UUC E;  1ZM3 A;  4R8O A;  5IXM B;  1Z0E A;  1PKP A;  2GPI A;  1ZAA C;  2O1W A;  4X8W A;  3C6K A;  5AE2 A;  2YTI A;  4X64 E;  2ELY A;  1IQS A;  4DUZ E;  2BB8 A;  4IZK B;  4WUC A;  1XNR I;  4R1F A;  4GKK E;  2CT1 A;  2VES A;  2LTR A;  2LVH A;  2UUB E;  3P76 A;  1F2I G;  4X62 E;  1KTV A;  2LJU A;  4LFB I;  2PRT A;  2EP3 A;  4DR3 I;  2EN2 A;  3BID A;  2WBU A;  2YSO A;  1DGC A;  1FWL A;  5JEA B;  2LJP A;  1H74 A;  4M9V C;  2HK3 A;  4O43 A;  4LF4 I;  3GCM A;  2RTX A;  2YTQ A;  2M4I A;  2NUE A;  1ZXN A;  3HJC A;  4ZYE A;  4GZN C;  2RS7 A;  1EA6 A;  2PNZ A;  4K0K I;  1PDA A;  1HR0 E;  4R2D A;  3NZK A;  2YTN A;  1T4N A;  1NHH A;  2JR1 A;  1OYR A;  2DMY A;  2X7I A;  2EMG A;  3J80 C;  4B3T I;  1I94 I;  2EMI A;  1OYS A;  2A25 A;  4TUI A;  4JI2 E;  1A1K A;  2EM9 A;  3DD6 A;  2EQ0 A;  1H72 C;  2EM8 A;  3BBG A;  2L2N A;  4Q28 A;  3CDJ A;  1JK1 A;  5LMN E;  4QNJ A;  4BHC A;  1B62 A;  5DRO A;  1DI2 A;  3HQ1 A;  1Z0B A;  2EOJ A;  4JI7 E;  1A1H A;  4WSP A;  1PJQ A;  1LLM C;  4DKK A;  2PO0 B;  1X47 A;  2FTX B;  4MLV A;  1IBK I;  3VHT B;  2MDR A;  2H36 X;  2WP8 A;  4IS9 A;  2EMZ A;  4IJD A;  1GZ6 A;  4R2C A;  4DR1 E;  4MU4 A;  4MU1 A;  4EMD A;  4JI3 I;  4GKJ I;  4XTJ A;  2VQF I;  1NCS A;  1FJG I;  4B3R I;  1ELO A;  4DPU A;  2EOH A;  3ECR A;  2A2C A;  3J7A M;  3K85 A;  3B8H A;  4DV3 E;  5A6K A;  4DR4 E;  2UXB E;  2Z5B A;  2C37 B;  1J26 A;  1A6F A;  2EMK A;  4FW6 A;  4GEQ B;  1YYW A;  1G2D C;  1XXE A;  4O5G A;  4WSG A;  1R6M A;  3C4B A;  3F6G A;  3EPK A;  2EPA A;  1AAY A;  3ADJ A;  4R2Q A;  4LPF A;  4OZE A;  2ZIT A;  2WW4 A;  1RR9 A;  2F8B A;  2EJ4 A;  2UXD E;  1UEK A;  1Z5A A;  1SR9 A;  2UUA I;  5KL4 A;  4BHB A;  2EN7 A;  2Z5C B;  2R3V A;  3IWD A;  2OI2 A;  1XNQ I;  2Q2E B;  1UDQ A;  1XHK A;  1UDS A;  2JEA A;  3HKM A;  4L5N C;  4ZYD A;  2CPN A;  2EPL X;  4DV1 I;  2LTS A;  2NN6 A;  3IWB A;  1HNW E;  3ZZU A;  2JP9 A;  2M7Q A;  4DMI A;  4MU3 A;  1PIE A;  4I8O A;  3D4J A;  3V5R A;  3WU3 A;  1XMQ I;  3CWV A;  1J5E I;  2UUC I;  4LF7 I;  5K36 E;  2EE8 A;  5DRQ A;  2LO3 A;  4HAC B;  3KZY A;  1EH6 A;  2EPX A;  4F54 A;  4DPW A;  4DU7 A;  3KRN A;  4P7A A;  2NN6 D;  4LTY A;  2N3G A;  2EFG A;  5T6J A;  2L3J A;  2J7K A;  4FN5 A;  2C39 B;  1N32 E;  4AQY I;  1TF6 A;  4L8N A;  4BA2 A;  2F4V E;  4HY1 A;  4WX9 A;  2LT7 A;  2DIX A;  4WXD A;  1E3P A;  5LL6 R;  4MU0 A;  3PYD A;  2EMW A;  5KL6 A;  5C0X C;  2EN3 A;  1N33 E;  1PJT A;  2YTO A;  4DR5 I;  2BA1 D;  1ZBQ A;  4OO1 A;  4B3S E;  4JI1 I;  3U1K A;  5DNY A;  2NN6 C;  4IFD D;  3ADG A;  1BBG A;  4WPY A;  3P1X A;  4BBY A;  1IBL E;  1HNZ E;  5A6B D;  2O1T A;  5AC5 A;  3Q6M A;  2EPC A;  2EN4 A;  4JV5 E;  4M0V A;  2EOF A;  4DPT A;  2JE6 B;  1TF3 A;  2PO2 B;  1USU A;  4JI6 E;  3H1C A;  1QZR A;  1MEY C;  4DV5 I;  1A1I A;  1HNX E;  4LF9 E;  3ZZ0 A;  5K36 F;  2BA1 G;  4MYT A;  2EMF A;  4IFD C;  3C6M A;  4FW3 A;  2E72 A;  4R2A A;  3JU0 A;  2YTD A;  2PNM A;  2C38 A;  3H4L A;  4OX9 E;  3C4T A;  1L4S A;  2VQE E;  2GLI A;  4J8Z A;  3THO B;  2YTE A;  4JI7 I;  4I3H A;  2D9H A;  2BR2 B;  1STU A;  1IMU A;  3QT7 A;  2EML A;  2WZO A;  1WRJ A;  4R03 A;  3PYG A;  2V8Q B;  4MDT A;  2NA2 A;  2GS8 A;  3QT5 A;  2EOR A;  2PO1 B;  4KHP I;  2LBS B;  2WCC 3;  4GQU A;  5JEA D;  1FNM A;  4BCA A;  2JVA A;  4DPY A;  3ADI A;  4LF5 E;  1FI4 A;  1Y4S A;  2CTD A;  2L8T A;  2F1D A;  4FWG A;  2EPU A;  4WUD A;  2UU9 I;  2DRP A;  3WU4 A;  2E1M A;  2ENA A;  1XMO I;  2L6M A;  4KZS A;  4B3M E;  2DGC A;  2FGG A;  2EOI A;  2YTG A;  5LMU E;  4F9C B;  2YRM A;  4YY3 E;  4DUY E;  3QG5 C;  4DV7 E;  4JI5 E;  2HHH E;  2YWQ A;  5FLX Q;  1A1F A;  5JEA C;  2EN1 A;  5EKW A;  3EPL A;  2I9I A;  2Z5E A;  2YSP A;  1T4O A;  3BF2 A;  3OTO E;  2V8P A;  3J81 Q;  4FWH A;  3EPH A;  3JTZ A;  2V2Q A;  3GME A;  4ZVI A;  2EOO A;  1R6L A;  1ZM4 A;  4RPF A;  3WU5 A;  3TQM A;  2EPN A;  2RQL A;  4LCH A;  5K36 B;  1MX0 A;  3CDI A;  5KL7 A;  3EQ1 A;  5KL2 A;  2EM0 A;  2L2M A;  2L33 A;  4KWY A;  1T38 A;  4JYA E;  2ZM6 I;  4IZJ B;  2BM1 A;  4N4R B;  2CGE A;  3L7Z B;  3QT6 A;  3BGH A;  4YHH I;  3FIG A;  1BKN A;  1PVG A;  4QNK A;  3Q6N A;  4J3D A;  1HNW I; 
#chains in the Genus database with same CATH homology
 2UXC E;  4JI8 E;  2EZ6 A;  1Z0V A;  5ADZ A;  2LUP B;  2YZT A;  4DR6 E;  3HUL A;  4URL A;  3HTX A;  2V86 A;  1DAR A;  4X65 E;  4WFT A;  4USM A;  1KVK A;  4N3O A;  2KON A;  3T1Y I;  1ZXM A;  1NHJ A;  1S16 A;  5L3J A;  5FLX C;  3OML A;  4P52 A;  4DV2 E;  4NXM E;  3Q1Q A;  2KHX A;  4JI0 E;  2F4V I;  2V89 A;  1N36 I;  1DQ3 A;  3K6Q A;  1FWK A;  2HK2 A;  1N33 I;  1IBM E;  4DR2 I;  3HPZ A;  2HFS A;  5GME A;  1Z5C A;  1IBL I;  4DV0 I;  1XNR E;  3ADL A;  4LFC I;  1WHN A;  4DV6 E;  4LFB E;  2NUF A;  4NXN E;  2L3C A;  1N34 I;  4BS9 A;  4LF8 I;  1HNX I;  4OOG C;  2CZ9 A;  3LPS A;  2AJ4 A;  2M1S A;  4LF4 E;  3M6A A;  3PRY A;  4M1K A;  2B3T B;  4JI4 I;  4K0K E;  5IWA I;  3RMP A;  3T1H I;  4B3T E;  5CFF E;  1I94 E;  4X64 I;  2V34 A;  5AE3 A;  2VE7 C;  2Z5B B;  4DUZ I;  4GKK I;  2DEJ A;  2UUB I;  4X62 I;  3VYX A;  4X66 E;  2V87 A;  2ODR C;  1T4L B;  4M30 A;  1B63 A;  1ZM9 A;  2LUQ A;  4B3M I;  2JY9 A;  3K17 A;  1Z59 A;  2N3H A;  4DUY I;  2RS6 A;  1EI1 A;  2HFU A;  3AV0 A;  1IBK E;  1NZ0 A;  1H73 A;  4HYM A;  1ZBT A;  4JI3 E;  1FJG E;  2VQF E;  4GKJ E;  3OTO I;  2MC5 A;  1HR0 I;  3KWR A;  4B3R E;  4DV4 E;  2BM0 A;  3QT8 A;  3B82 A;  3ZZT A;  4IZK A;  3LLH A;  5BR8 E;  4JI2 I;  3J7A G;  1K47 A;  2X36 A;  5LMN I;  1H7S A;  1YZ9 A;  4BMJ A;  3LTO A;  2NUG A;  2UXC I;  1UHZ A;  2UUA E;  2V85 A;  3JAM Q;  3VYY A;  2V88 A;  4DR6 I;  2O1V A;  4LU9 A;  3GON A;  4DR1 I;  4TUG A;  4DXL A;  1XNQ E;  3ZKD A;  3V2U C;  3WU6 A;  3ZOQ B;  1Y4U A;  2VF1 A;  3LNU A;  4DV3 I;  2HKE A;  4DR4 I;  2A2D A;  2UXB I;  4JI0 I;  1RQ0 A;  4IZJ A;  3HXL A;  4LF6 E;  1WXR A;  1IBM I;  1J5E E;  4LF7 E;  5F3W A;  4PRX A;  2HKJ A;  3K1J A;  1H7U A;  2UXD I;  4P78 A;  4IZJ D;  4AQY E;  5IT9 Q;  1S4E A;  1Z0G A;  3AUZ A;  4DV6 I;  1MU5 A;  4NXN I;  4DR5 E;  2YT4 A;  2LJH A;  4JI1 E;  3JAM C;  1USV A;  2O1U A;  2E5L E;  2E1R A;  2LE2 A;  4ED4 A;  5A2Q Q;  1X49 A;  4UT4 A;  2LRS A;  3P06 A;  4WYQ B;  4LFA E;  1GQE A;  2G7H A;  2V2Z A;  3H09 A;  4DPX A;  4DU8 A;  4DV5 E;  3F6H A;  2NPF A;  5AE1 A;  4HXZ A;  2Z5C A;  3ZM7 A;  1N32 I;  1Z0T A;  3DF6 A;  4DR7 E;  5AAS A;  4Z7Y A;  4X66 I;  2L2K B;  1Y6Z A;  4WUB A;  2V2V A;  3J81 C;  1RC7 A;  4JG4 A;  4B3S I;  4BC7 A;  4FW9 A;  2GQ0 A;  5IT9 C;  2B7T A;  1U2R A;  4KHP E;  1HNZ I;  3MSW A;  2IOQ A;  4JV5 I;  4HAC A;  4DV4 I;  2UU9 E;  4JI6 I;  4DR3 E;  1XMO E;  1MG7 A;  4LF9 I;  5A2Q C;  5BR8 I;  2FV4 B;  2CG9 A;  1EKZ A;  1ZM2 A;  1WUU A;  4M2Z A;  4OX9 I;  1WHQ A;  1OJ4 A;  2VQE I;  2ODR D;  1N0V C;  2IOP A;  3VK6 A;  4KQV A;  2BV3 A;  3HPS A;  1YYO A;  1VIS A;  3F0N A;  2JOB A;  3PYE A;  2ZM6 E;  4FWD A;  1D6T A;  2K4V A;  2ZBK B;  3ZKB A;  3LML A;  4LF5 I;  4YHH E;  1N0U A;  1Z0W A;  5LMU I;  4DV7 I;  4YY3 I;  1X48 A;  4JI5 I;  4LF6 I;  2HHH I;  2IHR 1;  1NHI A;  1O0W A;  2KOU A;  4PRV A;  2DEI A;  3T1Y E;  4BC9 A;  4F9B B;  2V83 A;  3IWC A;  2XEX A;  2R42 A;  3B78 A;  1KKH A;  2RSM A;  1RRE A;  4JYA I;  2LMZ A;  1N36 E;  3PYF A;  1FKA E;  4PU9 A;  2DB2 A;  1KIJ A;  1Z5B A;  1YYK A;  2E5L I;  5FWK A;  4DR2 E;  2EWL A;  4JI8 I;  2DSY A;  2MC6 A;  2PNL A;  4DV0 E;  4MYU A;  4LFA I;  4LFC E;  2VF3 A;  4X65 I;  3DJW A;  1N34 E;  4LF8 E;  4P7D A;  3J7Y p;  1QU6 A;  1UIL A;  2JWO A;  4DV1 E;  4DV2 I;  4NXM I;  3J80 Q;  4DR7 I;  5GMD A;  4JI4 E;  1Z0C A;  2B9D A;  4F9A B;  2B7V A;  1HK7 A;  2JOX A;  5IWA E;  1XMQ E;  2L92 A;  3T1H E;  4USK A;  2UUC E;  1ZM3 A;  4R8O A;  1Z0E A;  1PKP A;  2O1W A;  4X8W A;  5AE2 A;  4X64 E;  4DUZ E;  4IZK B;  4WUC A;  1XNR I;  4R1F A;  4GKK E;  2LTR A;  2UUB E;  4X62 E;  1KTV A;  4LFB I;  4DR3 I;  1FWL A;  2LJP A;  1H74 A;  2HK3 A;  4LF4 I;  2RTX A;  2M4I A;  2NUE A;  1ZXN A;  3HJC A;  2RS7 A;  1EA6 A;  4K0K I;  1HR0 E;  1T4N A;  1NHH A;  2JR1 A;  2DMY A;  2X7I A;  3J80 C;  4B3T I;  1I94 I;  4TUI A;  4JI2 E;  1H72 C;  2L2N A;  4Q28 A;  5LMN E;  1B62 A;  1DI2 A;  3HQ1 A;  1Z0B A;  4JI7 E;  4WSP A;  4DKK A;  1X47 A;  2FTX B;  1IBK I;  2MDR A;  2H36 X;  4UTG A;  4EMD A;  4DR1 E;  1GZ6 A;  4JI3 I;  4GKJ I;  4XTJ A;  2VQF I;  1FJG I;  4B3R I;  1ELO A;  4DPU A;  2A2C A;  3J7A M;  3K85 A;  3B8H A;  4DV3 E;  4DR4 E;  2UXB E;  2Z5B A;  1J26 A;  1A6F A;  4GEQ B;  1YYW A;  3C4B A;  3F6G A;  3ADJ A;  2ZIT A;  2WW4 A;  1RR9 A;  2F8B A;  2UXD E;  1UEK A;  1Z5A A;  1SR9 A;  2UUA I;  2Z5C B;  2R3V A;  3IWD A;  2OI2 A;  1XNQ I;  2Q2E B;  1XHK A;  4L5N C;  4DV1 I;  2CPN A;  2LTS A;  3IWB A;  1HNW E;  3ZZU A;  2M7Q A;  4DMI A;  1PIE A;  4I8O A;  3D4J A;  3V5R A;  3WU3 A;  1XMQ I;  3CWV A;  1J5E I;  2UUC I;  4LF7 I;  4HAC B;  4F54 A;  4DPW A;  4DU7 A;  4P7A A;  4LTY A;  2N3G A;  2EFG A;  5T6J A;  2L3J A;  2J7K A;  4FN5 A;  1N32 E;  4AQY I;  4L8N A;  2F4V E;  4HY1 A;  2DIX A;  5LL6 R;  3PYD A;  1N33 E;  4DR5 I;  1ZBQ A;  4B3S E;  4JI1 I;  5DNY A;  3ADG A;  4WPY A;  3P1X A;  4BBY A;  1IBL E;  1HNZ E;  2O1T A;  3Q6M A;  4JV5 E;  4M0V A;  4DPT A;  1USU A;  4JI6 E;  1QZR A;  4DV5 I;  4LF9 E;  1HNX E;  3ZZ0 A;  4MYT A;  3JU0 A;  2PNM A;  3H4L A;  4OX9 E;  3C4T A;  2VQE E;  4J8Z A;  4JI7 I;  4I3H A;  1STU A;  3QT7 A;  2WZO A;  4R03 A;  3PYG A;  2V8Q B;  2NA2 A;  2GS8 A;  3QT5 A;  4KHP I;  2LBS B;  1FNM A;  4BCA A;  2JVA A;  4DPY A;  3ADI A;  4LF5 E;  1FI4 A;  1Y4S A;  2L8T A;  4FWG A;  4WUD A;  2UU9 I;  3WU4 A;  2E1M A;  1XMO I;  2L6M A;  4KZS A;  4B3M E;  2FGG A;  5LMU E;  4Z7C A;  4F9C B;  4DUY E;  4YY3 E;  4DV7 E;  4JI5 E;  5FLX Q;  2HHH E;  2Z5E A;  1T4O A;  3J81 Q;  3OTO E;  2V8P A;  4FWH A;  3JTZ A;  2V2Q A;  4ZVI A;  1ZM4 A;  4RPF A;  3WU5 A;  1MX0 A;  4JYA E;  2ZM6 I;  2L2M A;  2L33 A;  4IZJ B;  2BM1 A;  2CGE A;  3QT6 A;  4YHH I;  3FIG A;  1BKN A;  1PVG A;  3Q6N A;  1HNW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...