4JI6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6E02
1ZBTA 2RS6A 5FLXC 1Z59A 1N0VC 4R1FA 1MU5A 2LUPB 4DR7I 4FWGA 1HNWI 4M2ZA 4DR7E 1HNWE 2LJHA 1GQEA 1Z5AA 4DV0I 4DV0E 4Z7CA 3LNUA 2XEXA 3HTXA 4HY1A 1Z0BA 2A2CA 4JG4A 2YT4A 4M1KA 3GONA 4I3HA 4LF7I 4AQYE 1U2RA 2GS8A 4JI3I 4LF7E 2F4VI 5L3JA 4JI3E 2LBSB 4HACB 2F4VE 4HXZA 4DR3I 2KHXA 3T1HI 4ED4A 4DV2I 3T1HE 4YY3I 3T1YI 4DV2E 4YY3E 3T1YE 3QT7A 4B3TI 4DXLA 4HYMA 2UUCE 1T4LB 1WUUA 2NUEA 1MX0A 4KHPI 3J7Yp 5IT9Q 4KHPE 1KKHA 1H72C 3M6AA 4FN5A 4DU7A 3V2UC 2DEIA 1RR9A 4DUYI 4DUYE 1J26A 4DR6I 4DR6E 4DPTA 2JY9A 1BKNA 4LFAI 4JI1I 3K1JA 4LFAE 4JI1E 1YYWA 4JI2I 2B7TA 4JI2E 3WU5A 3VYYA 2VQFI 3J7AM 2VQFE 4NXNI 2Q2EB 5IT9C 4NXNE 4YHHI 1YYKA 1HNXI 4YHHE 1HNXE 2LRSA 2CPNA 4LF9I 1YZ9A 2OI2A 4LF9E 4DV7I 2UXCI 2R3VA 4DV7E 1ZM3A 2UXCE 4FWDA 4JI0I 4JI0E 1I94I 3PYEA 2LJPA 4DV1I 1I94E 3CWVA 4DV1E 2HKJA 3WU6A 1K47A 1RC7A 4DR4I 2X36A 2V2QA 4DR4E 2HK3A 4PU9A 2BM1A 1IBLI 2UU9I 1IBLE 2L3JA 2N3HA 2UU9E 2DB2A 1N36I 3PYFA 3ZZUA 1N36E 3ZKDA 3C4BA 2ZITA 1ZXMA 2V2VA 4AQYI 1N0UA 3ADLA 2V2ZA 2LUQA 4DR2I 4JYAI 3ZM7A 4JYAE 4DR2E 1FJGI 1FJGE 3V5RA 1Z5CA 1PKPA 4URLA 2UUCI 1X49A 2RTXA 4B3MI 4DV4I 3J7AG 4B3ME 4DV4E 4LF5E 4LFBI 4LFBE 1NHHA 1X48A 1YYOA 1VISA 1Z0EA 4NXME 4X65I 1WHQA 4X65E 2JVAA 2DEJA 1DI2A 1FNMA 4DR5E 2J7KA 3WU3A 1ZM9A 2DMYA 1Z0GA 4WUCA 1XMQI 2LTRA 1XMQE 2BM0A 4JI4I 4WUDA 4JI4E 4DPXA 4DKKA 3J80Q 1XNQI 1XNQE 2VF3A 3P1XA 4MYTA 1ZM2A 4JI5I 1EI1A 1H7UA 4JI5E 1UILA 1RREA 4FWHA 2RSMA 3JAMQ 1D6TA 4DV3I 4LF6I 4DV3E 4LF6E 3QT6A 4OX9I 2UXDI 4EMDA 4OX9E 2UXDE 1NHIA 4UT4A 1T4NA 1S16A 1MG7A 2WW4A 4X66I 2HFSA 4X62E 4X66E 1OJ4A 1Z5BA 1RQ0A 4DPWA 3Q1QA 2B7VA 3J80C 3B82A 4ZVIA 1ELOA 1KTVA 1ZM4A 2ZBKB 4JI6I 4LF4I 4JI6E 4LF4E 2L33A 4JV5I 1KIJA 2IHR1 4FW9A 3JAMC 2EZ6A 3ADIA 4JV5E 1XMOI 1EKZA 4GKKI 1XMOE 4MYUA 5CFFE 4GKKE 1NHJA 4P52A 2HKEA 5GMEA 4DPUA 4GKJI 3QT5A 4GKJE 3ADJA 1H74A 3LTOA 3ZZTA 2MDRA 1S4EA 4K0KI 4DV5I 4K0KE 2L2NA 4DV5E 4DUZI 4USKA 4X64I 2RS7A 1FI4A 5GMDA 4DUZE 4X64E 4WUBA 1X47A 3D4JA 3PYGA 4B3RI 4B3RE 1A6FA 1DARA 3LLHA 4DU8A 4DR1I 3F0NA 4JI7I 4DR1E 1ZXNA 4JI7E 1EA6A 2EFGA 4DV6I 4DV6E 3QT8A 4OOGC 4LF5I 4M30A 2E1RA 4P7AA 5A2QQ 1N33I 4JI8I 1PVGA 1NZ0A 1N33E 4PRVA 4JI8E 3OTOI 1IBMI 4HACA 4NXMI 1Z0TA 3OTOE 1PIEA 1IBME 4DR3E 2HK2A 4RPFA 4DPYA 1T4OA 2NUFA 2VQEI 1QZRA 2ZM6I 4DR5I 2VQEE 2ZM6E 1IBKI 1FWLA 4LFCI 3PYDA 1IBKE 4XTJA 4B3TE 4LFCE 2NUGA 4PRXA 4LF8I 5LMUI 4LF8E 2HFUA 3WU4A 5LMUE 4X8WA 2CZ9A 3VYXA 2L2KB 1Z0CA 1Z0WA 2V8PA 2HHHI 1FWKA 1B62A 4Z7YA 3B8HA 2HHHE 2UXBI 2UXBE 2NPFA 2V34A 1N32I 2BV3A 5BR8I 5A2QC 1N32E 1HNZI 5BR8E 1UHZA 2R42A 1HNZE 3HULA 1XHKA 2N3GA 4WFTA 3J81Q 1H7SA 2B3TB 1UEKA 1KVKA 2UUAI 4X62I 2UUAE 3C4TA 5FLXQ 4KQVA 1HR0I 2AJ4A 1HR0E 4WYQB 1J5EI 1J5EE 1H73A 3ZZ0A 1STUA 2L2MA 1XNRI 3LPSA 1XNRE 2LTSA 3B78A 3K17A 5LMNI 2NA2A 4B3SI 5LMNE 5LL6R 1Z0VA 4B3SE 3ZKBA 2A2DA 2L3CA 5IWAI 2DIXA 5IWAE 2E5LI 4USMA 1N34I 3H4LA 2E5LE 2UUBI 3ADGA 1N34E 3J81C 2UUBE 1FKAE 1O0WA 2X7IA 1B63A 1QU6A 1WHNA 4UTGA
chains in the Genus database with same CATH superfamily
1ZBTA 4Q28A 2RS6A 2PNZA 5FLXC 2EL4A 2EM8A 1Z59A 2PRTA 1HK7A 1N0VC 1A1GA 5K36F 4R1FA 2EMAA 1MU5A 1P42A 2PO0A 2LUPB 5C0XA 4DR7I 4FWGA 2Z5BA 1HNWI 2BR2A 2Z5EA 4M2ZA 4DR7E 4N3OA 1HNWE 5K36A 2EOFA 2LJHA 2CSHA 3CDJA 4U3DA 1GQEA 1Z5AA 2EMCA 3C6MA 3MHHC 4OO1B 2YWQA 5DNLA 4DV0I 4BA1A 2EM2A 4DV0E 4MDTA 4Z7CA 3LNUA 2XEXA 2EM9A 1RMDA 2O1UA 2EM3A 4TUGA 4U3BA 3HTXA 4HY1A 1Z0BA 2A2CA 2JEBB 4JG4A 2YT4A 4M1KA 2KOUA 3GONA 4I3HA 2ELYA 2EPPA 4LF7I 4AQYE 3L00A 4X9JA 2BA1G 1U2RA 2GS8A 4JI3I 4LF7E 2I13A 2F4VI 5L3JA 3IWDA 5JEAF 2EPLX 2LBSB 4JI3E 2F4VE 4HACB 4HXZA 3HPSA 2V86A 4DR3I 2PO2B 3F6HA 2KHXA 1SR9A 4ED4A 3T1HI 4DV2I 2NN6F 1WHNA 2EOIA 3T1HE 4YY3I 3T1YI 4DV2E 1RHYA 2YRMA 5TSEA 4YY3E 3T1YE 3QT7A 2Z5CB 2LJUA 3U1KA 4B3TI 3KZYA 2GQ0A 4DXLA 4HYMA 2UUCE 2E72A 4R2EA 1T4LB 1WUUA 2NUEA 5A6JA 4M0VA 1MX0A 5KL4A 1KYQA 2EMIA 2YSOA 4KHPI 2JR1A 2WZOA 2EOZA 2WBSA 4IFDD 2CT1A 2MKDA 3J7Yp 4KHPE 2GO3A 4L8NA 1YUIA 2JEAA 5IT9Q 1KKHA 2EN6A 2N8XA 2H36X 1H72C 2EM5A 3M6AA 4P7DA 4FN5A 3V2UC 4KZSA 2GLIA 4DU7A 5JEAA 2EMWA 4O5GA 2EPAA 5T6JA 3VHTB 2LMZA 5A6AA 1IMUA 1DGCA 2ODRC 5KL7A 4BHBA 1A1IA 2BA1D 1UN6B 5AC5A 1UDOA 2DEIA 1RR9A 1IQSA 2IOQA 2NN6A 4DUYI 5DRRA 2C38B 4DUYE 1J26A 4DR6I 5ELWA 3F6GA 5EL9A 4DR6E 4DPTA 2JY9A 1T39A 1ZBQA 4BA2B 1BKNA 1A1FA 1A1KA 2CTDA 4LFAI 4JI1I 3JU0A 3K1JA 3MSWA 4LFAE 3ECRA 2LE2A 4JI1E 3HQ1A 4NBQA 2DLKA 1YYWA 4JI2I 2B7TA 4JI2E 2C39B 3VYYA 2YTIA 3WU5A 1YUJA 2VQFI 2EQ0A 5AE3A 3P06A 1OYSA 2MC6A 5F3WA 1GTKA 2VQFE 3J7AM 2EOHA 4IZJD 2YPNA 4FW5A 4NXNI 4ISAA 1WJPA 2Q2EB 4IFDE 5IT9C 3PS1A 4NXNE 4YHHI 1YYKA 5K36C 3U1YA 1HNXI 4YHHE 1UDQA 1HNXE 2LRSA 2EQ3A 2FGGA 2YTPA 2CPNA 5K36D 1PJSA 4LF9I 4FW7A 4MQYA 1TF6A 1YZ9A 2OI2A 1AH5A 4LF9E 4F6NA 2F1DA 3UHMA 4DV7I 5KL2A 2R3VA 2UXCI 4DV7E 1DQ3A 1ZM3A 5C0XF 2UXCE 4FWDA 2EL6A 2WNRB 4JI0I 4F9BB 1A1LA 2PO1B 2EL5A 2EN7A 4JI0E 2V8QB 4WSGA 1B69A 3FIGA 2LJPA 3PYEA 2C37B 4DV1I 1I94I 4IFDB 1I94E 1KJKA 3CWVA 4DV1E 4L5NC 4M9VC 2HKJA 3WU6A 3MHSC 4IZKB 4MU3A 4AM3A 1Y6ZA 1K47A 4O24A 5EKWA 4R2QA 1RC7A 5JEAC 4DR4I 2X36A 2LV2A 1R6LA 2V2QA 1JK1A 4DR4E 5AE1A 2HK3A 3BF2A 2BM1A 4PU9A 4KWYA 2NN6C 2HJJA 3IWBA 4NZVA 4NHRA 4ZYDA 2RQLA 1IBLI 4MU0A 2L92A 2UU9I 4O43A 2L3JA 1IBLE 1YHCA 3BIDA 5K36E 3PS3A 2N3HA 4OO1F 2EPKX 2UU9E 2IESA 2VESA 5DROA 4AIMA 2DB2A 1N36I 1E3PA 2JP9A 3PYFA 3ZZUA 1WXRA 1N36E 3L7ZB 3ZKDA 1AAYA 4GZNC 2EOXA 4IZJB 1X3CA 1L4SA 3C4BA 2ZITA 3IWCA 1QNTA 1ZXMA 2EOEA 1PDAA 2EM7A 3KZZA 1Y60A 4Q35B 2L8TA 2V2VA 4AQYI 2EPNA 2D9HA 2YTGA 1N0UA 5K36B 1F2IG 3ADLA 2V2ZA 3EPJA 1YSAC 4HTGA 2LUQA 4F54A 4DR2I 4JYAI 2IERA 2JE6B 3ZM7A 4JYAE 4DR2E 1TF3A 4QNJA 1FJGI 4BCAA 2RSIA 4OO1A 1FJGE 3P3EA 3V5RA 2JOBA 1Z5CA 1PKPA 2EE8A 3BGHA 1PJTA 1USUA 4URLA 4HEIA 5IV8B 2UUCI 3TQMA 1X49A 1WRJA 2K7IA 2PO1A 4R2RA 2RTXA 3M99B 2R1FA 4DV4I 4B3MI 5KL5A 2JEBA 4AIDA 3J7AG 4R8OA 4B3ME 4DV4E 4LF5E 3JTZA 2RPCA 4LFBI 2B9DA 4LFBE 4J8ZA 1SFEA 1NHHA 3M85G 4N4RB 2E1MA 1X48A 1YYOA 1VISA 1Z0EA 5JEAB 2KONA 4I8OA 4NXME 2PO2A 4X65I 2ADRA 2DRPA 1WHQA 2EJ4A 3HPZA 4X65E 1Y5YA 4R2PA 2JWOA 2MC5A 2JVAA 4R2AA 2DEJA 2DGCA 1DI2A 2Z5CA 1FNMA 4DR5E 2WBUA 2J7KA 3WU3A 2ODRD 1ZM9A 4ZYHA 2DMYA 2EPCA 1BBOA 5C0XC 1Z0GA 4WUCA 1XMQI 2G7HA 2LTRA 1XMQE 2EORA 2BM0A 4O4KA 4JI4I 3C6KA 4WUDA 4JI4E 5DRPA 4DKKA 4DPXA 3J80Q 1XNQI 5AASA 4IS1C 1XNQE 1X6FA 2VF3A 2V88A 4RPFA 3P1XA 4BHCA 2LT7A 4MYTA 1ZM2A 1EH8A 4TUIA 3PS2A 4JI5I 4WXCA 1EI1A 1H7UA 2IOPA 3M7NG 4JI5E 4GQUA 3HKMA 1UILA 1RREA 2V85A 2ELZA 4FWHA 2RSMA 1X6EA 3JAMQ 3M85D 2C38A 5LLQA 2EM0A 4LCGA 2EMYA 4RHBB 1D6TA 2VF1A 2VRDA 4F9CB 1NCSA 2WP8B 4DV3I 4LF6I 4MLVA 4DV3E 4LF6E 3QT6A 4BA2A 3K6QA 1A1JA 4OX9I 2UXDI 4EMDA 1NEIA 3DF6A 4OX9E 2UXDE 1NHIA 4OO1C 4FW3A 1T4NA 4UT4A 1S16A 3LMLA 3PRYA 1MG7A 2WW4A 4LCFA 4X66I 2C39A 2HFSA 3NZKA 2EPMX 2K4VA 4X62E 3EPKA 2EMXA 4X66E 4IFDF 2EMBA 5AE2A 1OJ4A 1Z5BA 2CGEA 2EP3A 2EN2A 5A6KA 5IXMB 5C0XE 4FK5C 2O1VA 3BBGA 2J65A 1RQ0A 4GEQB 2EPZA 4DPWA 3ZOQB 2B7VA 3J80C 3Q1QA 3B82A 1Y4UA 4ZVIA 1ELOA 4BBYA 4P78A 1KTVA 2EMZA 3CDIA 1ZM4A 4IS9A 2J7JA 2ZBKB 1VI7A 3KWRA 2PNZB 3M7ND 1XXEA 1Y4SA 4JI6I 4LF4I 4BS9A 1G2DC 4JI6E 2V83A 4LF4E 2FV4B 2L33A 4JV5I 1KIJA 5KL3A 5JEAD 2IHR1 3JAMC 4FW9A 2EZ6A 3ADIA 4JV5E 2EN1A 4LPFA 2NABA 1XMOI 1EKZA 2WNRA 2ENCA 4GKKI 2PO0B 2EWLA 1XMOE 5C0XB 2M4IA 4MYUA 2Z5BB 4WPYA 5CFFE 4GKKE 2CVEA 2EMLA 1NHJA 2BR2B 2NN6D 2HKEA 4P52A 3P76A 5GMEA 1Z1BA 1EH6A 2C37A 4DPUA 4GKJI 3QT5A 3EPLA 4IFDA 4GKJE 3ADJA 1MGTA 1H74A 3LTOA 3ZZTA 2MDRA 1S4EA 3GMEA 3DJWA 4BA1B 4K0KI 4DV5I 2LCEA 4K0KE 2O1TA 2BA0G 2JPAA 2F8BA 2L2NA 2EOJA 1X5WA 4DV5E 1A1HA 4USKA 4X64I 4DUZI 2YSPA 2RS7A 1FI4A 2LVHA 5GMDA 4DUZE 4X64E 4WUBA 1X47A 4QNKA 3D4JA 2FTXB 3PYGA 3QG5C 4B3RI 3Q6NA 3GLLA 2DMIA 4B3RE 1A6FA 1DARA 2O1WA 4F6MA 2GO4A 2YTFA 2BBGA 3LLHA 3H09A 3VK6A 3KRNA 1UBDC 1YH8A 4DU8A 2DSYA 4WX9A 2EMKA 4R2SA 4OKGA 4R2DA 5ADZA 1ZR9A 4DR1I 4DMIA 3F0NA 4JI7I 4DR1E 1ZXNA 5JEAE 4JI7E 2DLQA 1X6HA 4NXMI 3THNA 4BMJA 3L7ZA 1EA6A 2EFGA 4LTYA 2Q8UA 4IJDA 4IZJA 2EOMA 2AE8A 4DV6I 2R76A 2NN6E 4DV6E 3QT8A 4OOGC 4LF5I 1BB8A 2YTJA 4M30A 1MEYC 5A6BD 2E1RA 4P7AA 5A2QQ 1N33I 2JYAA 5AC4A 4JI8I 2BA0D 1PVGA 2JEAB 1NZ0A 1N33E 2CG9A 2PNMA 4PRVA 3AUZA 4JI8E 3OTOI 1IBMI 2YRKA 4HACA 1Z0TA 3RMPA 2EMGA 2YU8A 4BC7A 3OTOE 4DR3E 1IBME 1PIEA 2HK2A 2JE6A 4J3DA 2EN4A 2YZTA 3EPHA 4DPYA 1T4OA 2NUFA 4FW4A 2VE7C 1IQOA 2VQEI 1QZRA 2ZM6I 4DR5I 2EN8A 2VQEE 4LU9A 2ZM6E 2NN6B 1IBKI 2EPRA 1FWLA 4LFCI 3PYDA 1ZU1A 2EM4A 1IBKE 2YTEA 3HJCA 4XTJA 4B3TE 4LFCE 2YTDA 2V89A 2EN3A 2HGHA 2NUGA 4PRXA 4LF8I 5LMUI 4IFDC 1ZAAC 2EMHA 4LF8E 1UDNA 2HFUA 4MU4A 4ZYGA 5LMUE 3WU4A 5FWKA 5C0XD 3K85A 1YPNA 4X8WA 2HC5A 2EOSA 4F2JC 3VYXA 2CZ9A 2L2KB 3H1CA 1Z0CA 1Z0WA 2V8PA 3UK3C 1G2FC 4MLQA 1FWKA 2HHHI 1B62A 2WCC3 3B8HA 4Z7YA 2HHHE 2UXBI 2PNLA 4ZYEA 2UXBE 2GPIA 2EOOA 2NPFA 4WXDA 1R6MA 2V34A 3AV0A 1PJQA 2I9IA 2M7QA 1N32I 2ENHA 2BV3A 5BR8I 5A2QC 1N32E 4LCHA 1HNZI 2M9AA 1UHZA 5BR8E 2EMFA 2R42A 4R03A 4RH8A 1HNZE 1E3HA 4FW6A 5DRQA 1P47A 3HULA 1XHKA 3Q6MA 3P3GA 2N3GA 2JOXA 1BBGA 4WFTA 1YFHA 2LO3A 3J81Q 2YRHA 1T38A 3B4TA 1H7SA 2B3TB 1UEKA 1KVKA 4F9AB 2UUAI 4OO1D 2M1SA 1JK2A 4X62I 3OMLA 2UUAE 3C4TA 4WSPA 5FLXQ 2BB8A 4KQVA 1HR0I 2JXPA 4R2CA 2YTQA 2AJ4A 2EOQA 1HR0E 1USVA 4WYQB 1OYRA 5DNXA 1J5EI 2EM6A 2O3ZA 1J5EE 2YTNA 1H73A 3ZZ0A 1STUA 2L2MA 1XNRI 2ENAA 2EQ1A 3LPSA 2EPUA 1N3GA 1XNRE 2LTSA 2WP8A 3HXLA 2WBTA 2YTOA 3B78A 2EOYA 5A69A 2JT2A 3K17A 2EPOA 5KL6A 5DNYA 4OZEA 5LMNI 2NA2A 4B3SI 5LMNE 3DD6A 5LL6R 1Z0VA 4B3SE 1EH7A 2YU5A 4OO1E 2MDGA 2GHFA 4BC9A 4MU1A 3ZKBA 2A25A 1UDSA 2L3CA 2A2DA 3P3CA 5IWAI 2DIXA 1GZ6A 5IWAE 2E5LI 2MKNA 4USMA 1N34I 5A6BA 3H4LA 1LLMC 2E5LE 2UUBI 3ADGA 3THOB 1N34E 3J81C 2UUBE 2V87A 1FKAE 1O0WA 3EQ1A 2X7IA 1TN9A 1OYPA 3GCMA 1B63A 2EPXA 4IZKA 1QU6A 2L6MA 4LOMA 4UTGA
chains in the Genus database with same CATH topology
1ZBTA 4Q28A 2RS6A 5FLXC 1Z59A 1HK7A 1N0VC 4R1FA 1MU5A 2LUPB 4DR7I 4FWGA 2Z5BA 1HNWI 2Z5EA 4M2ZA 4DR7E 4N3OA 1HNWE 2LJHA 1GQEA 1Z5AA 4DV0I 4DV0E 4Z7CA 3LNUA 2XEXA 2O1UA 4TUGA 3HTXA 4HY1A 1Z0BA 2A2CA 4JG4A 2YT4A 4M1KA 2KOUA 3GONA 4I3HA 4LF7I 4AQYE 1U2RA 2GS8A 4JI3I 4LF7E 2F4VI 5L3JA 3IWDA 4JI3E 2LBSB 4HACB 2F4VE 4HXZA 3HPSA 2V86A 4DR3I 3F6HA 2KHXA 1SR9A 4ED4A 3T1HI 4DV2I 3T1HE 4YY3I 3T1YI 4DV2E 4YY3E 3T1YE 3QT7A 2Z5CB 4B3TI 2GQ0A 4DXLA 4HYMA 2UUCE 1T4LB 1WUUA 2NUEA 1MX0A 4M0VA 4KHPI 2JR1A 2WZOA 3J7Yp 5IT9Q 4KHPE 4L8NA 1KKHA 1H72C 2H36X 3M6AA 4FN5A 4P7DA 4DU7A 3V2UC 4KZSA 5T6JA 2LMZA 2ODRC 2IOQA 2DEIA 1RR9A 4DUYI 4DUYE 1J26A 4DR6I 3F6GA 4DR6E 4DPTA 2JY9A 1ZBQA 1BKNA 4LFAI 4JI1I 3JU0A 3K1JA 3MSWA 4LFAE 4JI1E 2LE2A 3HQ1A 1YYWA 4JI2I 2B7TA 4JI2E 3WU5A 3VYYA 2VQFI 5AE3A 3P06A 2MC6A 5F3WA 3J7AM 2VQFE 4IZJD 4NXNI 2Q2EB 5IT9C 4NXNE 4YHHI 1YYKA 1HNXI 4YHHE 1HNXE 2LRSA 2FGGA 2CPNA 4LF9I 1YZ9A 2OI2A 4LF9E 4DV7I 2UXCI 2R3VA 4DV7E 1DQ3A 1ZM3A 2UXCE 4FWDA 4JI0I 4F9BB 4JI0E 2V8QB 1I94I 3PYEA 3FIGA 2LJPA 4DV1I 1I94E 3CWVA 4DV1E 4L5NC 2L6MA 2HKJA 3WU6A 4IZKB 1Y6ZA 1K47A 1RC7A 4DR4I 2X36A 2V2QA 4DR4E 5AE1A 2HK3A 4PU9A 2BM1A 3IWBA 1IBLI 2L92A 2UU9I 1IBLE 2L3JA 2N3HA 2UU9E 2DB2A 1N36I 3PYFA 3ZZUA 1WXRA 1N36E 3ZKDA 4IZJB 3C4BA 2ZITA 3IWCA 1ZXMA 2L8TA 2V2VA 4AQYI 1N0UA 3ADLA 2V2ZA 2LUQA 4F54A 4DR2I 4JYAI 3ZM7A 4JYAE 4DR2E 1FJGI 4BCAA 1FJGE 3V5RA 2JOBA 1Z5CA 1PKPA 1USUA 4URLA 2UUCI 1X49A 2RTXA 4B3MI 4DV4I 3J7AG 4R8OA 4B3ME 4DV4E 4LF5E 3JTZA 4LFBI 2B9DA 4LFBE 4J8ZA 1NHHA 2E1MA 1X48A 1YYOA 1VISA 1Z0EA 2KONA 4I8OA 4NXME 4X65I 1WHQA 3HPZA 4X65E 2JWOA 2MC5A 2JVAA 2DEJA 1DI2A 2Z5CA 1FNMA 4DR5E 2J7KA 3WU3A 2ODRD 1ZM9A 2DMYA 1Z0GA 4WUCA 1XMQI 2G7HA 2LTRA 1XMQE 2BM0A 4JI4I 4WUDA 4JI4E 4DPXA 4DKKA 3J80Q 1XNQI 5AASA 1XNQE 2VF3A 2V88A 3P1XA 4MYTA 1ZM2A 4TUIA 4JI5I 1EI1A 1H7UA 2IOPA 4JI5E 1UILA 1RREA 2V85A 4FWHA 2RSMA 3JAMQ 1D6TA 2VF1A 4F9CB 4DV3I 4LF6I 4DV3E 4LF6E 3QT6A 3K6QA 4OX9I 2UXDI 4EMDA 3DF6A 4OX9E 2UXDE 1NHIA 4UT4A 1T4NA 1S16A 3LMLA 3PRYA 1MG7A 2WW4A 4X66I 2HFSA 2K4VA 4X62E 4X66E 2CGEA 5AE2A 1OJ4A 1Z5BA 2O1VA 1RQ0A 4GEQB 4DPWA 3ZOQB 2B7VA 3J80C 3Q1QA 3B82A 1Y4UA 4ZVIA 1ELOA 4BBYA 4P78A 1KTVA 1ZM4A 2ZBKB 3KWRA 1Y4SA 4JI6I 4LF4I 4BS9A 4JI6E 2V83A 4LF4E 2FV4B 2L33A 4JV5I 1KIJA 2IHR1 3JAMC 4FW9A 2EZ6A 3ADIA 4JV5E 1XMOI 1EKZA 4GKKI 2EWLA 1XMOE 2M4IA 4MYUA 2Z5BB 4WPYA 5CFFE 4GKKE 1NHJA 4P52A 2HKEA 5GMEA 4DPUA 4GKJI 3QT5A 4GKJE 3ADJA 1H74A 3LTOA 3ZZTA 2MDRA 1S4EA 4K0KI 3DJWA 4DV5I 4K0KE 2O1TA 2F8BA 2L2NA 4DV5E 4DUZI 4USKA 4X64I 2RS7A 1FI4A 5GMDA 4DUZE 4X64E 4WUBA 1X47A 3D4JA 2FTXB 3PYGA 4B3RI 3Q6NA 4B3RE 1DARA 1A6FA 2O1WA 3LLHA 3VK6A 3H09A 4DU8A 2DSYA 5ADZA 4DR1I 4DMIA 3F0NA 4JI7I 4DR1E 1ZXNA 4JI7E 4BMJA 1EA6A 2EFGA 4LTYA 4IZJA 4DV6I 4DV6E 3QT8A 4OOGC 4LF5I 4M30A 2E1RA 4P7AA 5A2QQ 1N33I 4JI8I 1PVGA 1NZ0A 1N33E 2CG9A 2PNMA 4PRVA 3AUZA 4JI8E 3OTOI 1IBMI 4HACA 4NXMI 1Z0TA 3RMPA 3OTOE 1PIEA 4BC7A 4DR3E 1IBME 2HK2A 4RPFA 2YZTA 4DPYA 1T4OA 2NUFA 2VE7C 2VQEI 1QZRA 2ZM6I 4DR5I 2VQEE 4LU9A 2ZM6E 1IBKI 1FWLA 4LFCI 3PYDA 1IBKE 3HJCA 4XTJA 4B3TE 4LFCE 2NUGA 2V89A 4PRXA 4LF8I 5LMUI 4LF8E 2HFUA 5FWKA 3WU4A 5LMUE 3K85A 4X8WA 2CZ9A 3VYXA 2L2KB 1Z0CA 1Z0WA 2V8PA 2HHHI 1FWKA 1B62A 4Z7YA 3B8HA 2HHHE 2UXBI 2PNLA 2UXBE 2NPFA 2V34A 3AV0A 2M7QA 1N32I 2BV3A 5BR8I 5A2QC 1N32E 1HNZI 1UHZA 5BR8E 2R42A 4R03A 1HNZE 3HULA 1XHKA 3Q6MA 2N3GA 2JOXA 4WFTA 3J81Q 1H7SA 2B3TB 1UEKA 1KVKA 4F9AB 2UUAI 2M1SA 4X62I 3OMLA 2UUAE 3C4TA 4WSPA 5FLXQ 4KQVA 1HR0I 2AJ4A 1HR0E 1USVA 4WYQB 1J5EI 1J5EE 1H73A 3ZZ0A 1STUA 2L2MA 1XNRI 3LPSA 1XNRE 2LTSA 3HXLA 3B78A 3K17A 5DNYA 5LMNI 2NA2A 4B3SI 5LMNE 5LL6R 1Z0VA 4B3SE 4BC9A 3ZKBA 2A2DA 2L3CA 5IWAI 2DIXA 1GZ6A 5IWAE 2E5LI 4USMA 1N34I 3H4LA 2E5LE 2UUBI 3ADGA 1N34E 3J81C 2UUBE 2V87A 1FKAE 1O0WA 2X7IA 1B63A 4IZKA 1QU6A 1WHNA 4UTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBT A;  2RS6 A;  5FLX C;  1Z59 A;  1N0V C;  4R1F A;  1MU5 A;  2LUP B;  4DR7 I;  4FWG A;  1HNW I;  4M2Z A;  4DR7 E;  1HNW E;  2LJH A;  1GQE A;  1Z5A A;  4DV0 I;  4DV0 E;  4Z7C A;  3LNU A;  2XEX A;  3HTX A;  4HY1 A;  1Z0B A;  2A2C A;  4JG4 A;  2YT4 A;  4M1K A;  3GON A;  4I3H A;  4LF7 I;  4AQY E;  1U2R A;  2GS8 A;  4JI3 I;  4LF7 E;  2F4V I;  5L3J A;  4JI3 E;  2LBS B;  4HAC B;  2F4V E;  4HXZ A;  4DR3 I;  2KHX A;  3T1H I;  4ED4 A;  4DV2 I;  3T1H E;  4YY3 I;  3T1Y I;  4DV2 E;  4YY3 E;  3T1Y E;  3QT7 A;  4B3T I;  4DXL A;  4HYM A;  2UUC E;  1T4L B;  1WUU A;  2NUE A;  1MX0 A;  4KHP I;  3J7Y p;  5IT9 Q;  4KHP E;  1KKH A;  1H72 C;  3M6A A;  4FN5 A;  4DU7 A;  3V2U C;  2DEI A;  1RR9 A;  4DUY I;  4DUY E;  1J26 A;  4DR6 I;  4DR6 E;  4DPT A;  2JY9 A;  1BKN A;  4LFA I;  4JI1 I;  3K1J A;  4LFA E;  4JI1 E;  1YYW A;  4JI2 I;  2B7T A;  4JI2 E;  3WU5 A;  3VYY A;  2VQF I;  3J7A M;  2VQF E;  4NXN I;  2Q2E B;  5IT9 C;  4NXN E;  4YHH I;  1YYK A;  1HNX I;  4YHH E;  1HNX E;  2LRS A;  2CPN A;  4LF9 I;  1YZ9 A;  2OI2 A;  4LF9 E;  4DV7 I;  2UXC I;  2R3V A;  4DV7 E;  1ZM3 A;  2UXC E;  4FWD A;  4JI0 I;  4JI0 E;  1I94 I;  3PYE A;  2LJP A;  4DV1 I;  1I94 E;  3CWV A;  4DV1 E;  2HKJ A;  3WU6 A;  1K47 A;  1RC7 A;  4DR4 I;  2X36 A;  2V2Q A;  4DR4 E;  2HK3 A;  4PU9 A;  2BM1 A;  1IBL I;  2UU9 I;  1IBL E;  2L3J A;  2N3H A;  2UU9 E;  2DB2 A;  1N36 I;  3PYF A;  3ZZU A;  1N36 E;  3ZKD A;  3C4B A;  2ZIT A;  1ZXM A;  2V2V A;  4AQY I;  1N0U A;  3ADL A;  2V2Z A;  2LUQ A;  4DR2 I;  4JYA I;  3ZM7 A;  4JYA E;  4DR2 E;  1FJG I;  1FJG E;  3V5R A;  1Z5C A;  1PKP A;  4URL A;  2UUC I;  1X49 A;  2RTX A;  4B3M I;  4DV4 I;  3J7A G;  4B3M E;  4DV4 E;  4LF5 E;  4LFB I;  4LFB E;  1NHH A;  1X48 A;  1YYO A;  1VIS A;  1Z0E A;  4NXM E;  4X65 I;  1WHQ A;  4X65 E;  2JVA A;  2DEJ A;  1DI2 A;  1FNM A;  4DR5 E;  2J7K A;  3WU3 A;  1ZM9 A;  2DMY A;  1Z0G A;  4WUC A;  1XMQ I;  2LTR A;  1XMQ E;  2BM0 A;  4JI4 I;  4WUD A;  4JI4 E;  4DPX A;  4DKK A;  3J80 Q;  1XNQ I;  1XNQ E;  2VF3 A;  3P1X A;  4MYT A;  1ZM2 A;  4JI5 I;  1EI1 A;  1H7U A;  4JI5 E;  1UIL A;  1RRE A;  4FWH A;  2RSM A;  3JAM Q;  1D6T A;  4DV3 I;  4LF6 I;  4DV3 E;  4LF6 E;  3QT6 A;  4OX9 I;  2UXD I;  4EMD A;  4OX9 E;  2UXD E;  1NHI A;  4UT4 A;  1T4N A;  1S16 A;  1MG7 A;  2WW4 A;  4X66 I;  2HFS A;  4X62 E;  4X66 E;  1OJ4 A;  1Z5B A;  1RQ0 A;  4DPW A;  3Q1Q A;  2B7V A;  3J80 C;  3B82 A;  4ZVI A;  1ELO A;  1KTV A;  1ZM4 A;  2ZBK B;  4JI6 I;  4LF4 I;  4JI6 E;  4LF4 E;  2L33 A;  4JV5 I;  1KIJ A;  2IHR 1;  4FW9 A;  3JAM C;  2EZ6 A;  3ADI A;  4JV5 E;  1XMO I;  1EKZ A;  4GKK I;  1XMO E;  4MYU A;  5CFF E;  4GKK E;  1NHJ A;  4P52 A;  2HKE A;  5GME A;  4DPU A;  4GKJ I;  3QT5 A;  4GKJ E;  3ADJ A;  1H74 A;  3LTO A;  3ZZT A;  2MDR A;  1S4E A;  4K0K I;  4DV5 I;  4K0K E;  2L2N A;  4DV5 E;  4DUZ I;  4USK A;  4X64 I;  2RS7 A;  1FI4 A;  5GMD A;  4DUZ E;  4X64 E;  4WUB A;  1X47 A;  3D4J A;  3PYG A;  4B3R I;  4B3R E;  1A6F A;  1DAR A;  3LLH A;  4DU8 A;  4DR1 I;  3F0N A;  4JI7 I;  4DR1 E;  1ZXN A;  4JI7 E;  1EA6 A;  2EFG A;  4DV6 I;  4DV6 E;  3QT8 A;  4OOG C;  4LF5 I;  4M30 A;  2E1R A;  4P7A A;  5A2Q Q;  1N33 I;  4JI8 I;  1PVG A;  1NZ0 A;  1N33 E;  4PRV A;  4JI8 E;  3OTO I;  1IBM I;  4HAC A;  4NXM I;  1Z0T A;  3OTO E;  1PIE A;  1IBM E;  4DR3 E;  2HK2 A;  4RPF A;  4DPY A;  1T4O A;  2NUF A;  2VQE I;  1QZR A;  2ZM6 I;  4DR5 I;  2VQE E;  2ZM6 E;  1IBK I;  1FWL A;  4LFC I;  3PYD A;  1IBK E;  4XTJ A;  4B3T E;  4LFC E;  2NUG A;  4PRX A;  4LF8 I;  5LMU I;  4LF8 E;  2HFU A;  3WU4 A;  5LMU E;  4X8W A;  2CZ9 A;  3VYX A;  2L2K B;  1Z0C A;  1Z0W A;  2V8P A;  2HHH I;  1FWK A;  1B62 A;  4Z7Y A;  3B8H A;  2HHH E;  2UXB I;  2UXB E;  2NPF A;  2V34 A;  1N32 I;  2BV3 A;  5BR8 I;  5A2Q C;  1N32 E;  1HNZ I;  5BR8 E;  1UHZ A;  2R42 A;  1HNZ E;  3HUL A;  1XHK A;  2N3G A;  4WFT A;  3J81 Q;  1H7S A;  2B3T B;  1UEK A;  1KVK A;  2UUA I;  4X62 I;  2UUA E;  3C4T A;  5FLX Q;  4KQV A;  1HR0 I;  2AJ4 A;  1HR0 E;  4WYQ B;  1J5E I;  1J5E E;  1H73 A;  3ZZ0 A;  1STU A;  2L2M A;  1XNR I;  3LPS A;  1XNR E;  2LTS A;  3B78 A;  3K17 A;  5LMN I;  2NA2 A;  4B3S I;  5LMN E;  5LL6 R;  1Z0V A;  4B3S E;  3ZKB A;  2A2D A;  2L3C A;  5IWA I;  2DIX A;  5IWA E;  2E5L I;  4USM A;  1N34 I;  3H4L A;  2E5L E;  2UUB I;  3ADG A;  1N34 E;  3J81 C;  2UUB E;  1FKA E;  1O0W A;  2X7I A;  1B63 A;  1QU6 A;  1WHN A;  4UTG A; 
#chains in the Genus database with same CATH topology
 1ZBT A;  4Q28 A;  2RS6 A;  2PNZ A;  5FLX C;  2EL4 A;  2EM8 A;  1Z59 A;  2PRT A;  1HK7 A;  1N0V C;  1A1G A;  5K36 F;  4R1F A;  2EMA A;  1MU5 A;  1P42 A;  2PO0 A;  2LUP B;  5C0X A;  4DR7 I;  4FWG A;  2Z5B A;  1HNW I;  2BR2 A;  2Z5E A;  4M2Z A;  4DR7 E;  4N3O A;  1HNW E;  5K36 A;  2EOF A;  2LJH A;  2CSH A;  3CDJ A;  4U3D A;  1GQE A;  1Z5A A;  2EMC A;  3C6M A;  3MHH C;  4OO1 B;  2YWQ A;  5DNL A;  4DV0 I;  4BA1 A;  2EM2 A;  4DV0 E;  4MDT A;  4Z7C A;  3LNU A;  2XEX A;  2EM9 A;  1RMD A;  2O1U A;  2EM3 A;  4TUG A;  4U3B A;  3HTX A;  4HY1 A;  1Z0B A;  2A2C A;  2JEB B;  4JG4 A;  2YT4 A;  4M1K A;  2KOU A;  3GON A;  4I3H A;  2ELY A;  2EPP A;  4LF7 I;  4AQY E;  3L00 A;  4X9J A;  2BA1 G;  1U2R A;  2GS8 A;  4JI3 I;  4LF7 E;  2I13 A;  2F4V I;  5L3J A;  3IWD A;  5JEA F;  2EPL X;  2LBS B;  4JI3 E;  2F4V E;  4HAC B;  4HXZ A;  3HPS A;  2V86 A;  4DR3 I;  2PO2 B;  3F6H A;  2KHX A;  1SR9 A;  4ED4 A;  3T1H I;  4DV2 I;  2NN6 F;  1WHN A;  2EOI A;  3T1H E;  4YY3 I;  3T1Y I;  4DV2 E;  1RHY A;  2YRM A;  5TSE A;  4YY3 E;  3T1Y E;  3QT7 A;  2Z5C B;  2LJU A;  3U1K A;  4B3T I;  3KZY A;  2GQ0 A;  4DXL A;  4HYM A;  2UUC E;  2E72 A;  4R2E A;  1T4L B;  1WUU A;  2NUE A;  5A6J A;  4M0V A;  1MX0 A;  5KL4 A;  1KYQ A;  2EMI A;  2YSO A;  4KHP I;  2JR1 A;  2WZO A;  2EOZ A;  2WBS A;  4IFD D;  2CT1 A;  2MKD A;  3J7Y p;  4KHP E;  2GO3 A;  4L8N A;  1YUI A;  2JEA A;  5IT9 Q;  1KKH A;  2EN6 A;  2N8X A;  2H36 X;  1H72 C;  2EM5 A;  3M6A A;  4P7D A;  4FN5 A;  3V2U C;  4KZS A;  2GLI A;  4DU7 A;  5JEA A;  2EMW A;  4O5G A;  2EPA A;  5T6J A;  3VHT B;  2LMZ A;  5A6A A;  1IMU A;  1DGC A;  2ODR C;  5KL7 A;  4BHB A;  1A1I A;  2BA1 D;  1UN6 B;  5AC5 A;  1UDO A;  2DEI A;  1RR9 A;  1IQS A;  2IOQ A;  2NN6 A;  4DUY I;  5DRR A;  2C38 B;  4DUY E;  1J26 A;  4DR6 I;  5ELW A;  3F6G A;  5EL9 A;  4DR6 E;  4DPT A;  2JY9 A;  1T39 A;  1ZBQ A;  4BA2 B;  1BKN A;  1A1F A;  1A1K A;  2CTD A;  4LFA I;  4JI1 I;  3JU0 A;  3K1J A;  3MSW A;  4LFA E;  3ECR A;  2LE2 A;  4JI1 E;  3HQ1 A;  4NBQ A;  2DLK A;  1YYW A;  4JI2 I;  2B7T A;  4JI2 E;  2C39 B;  3VYY A;  2YTI A;  3WU5 A;  1YUJ A;  2VQF I;  2EQ0 A;  5AE3 A;  3P06 A;  1OYS A;  2MC6 A;  5F3W A;  1GTK A;  2VQF E;  3J7A M;  2EOH A;  4IZJ D;  2YPN A;  4FW5 A;  4NXN I;  4ISA A;  1WJP A;  2Q2E B;  4IFD E;  5IT9 C;  3PS1 A;  4NXN E;  4YHH I;  1YYK A;  5K36 C;  3U1Y A;  1HNX I;  4YHH E;  1UDQ A;  1HNX E;  2LRS A;  2EQ3 A;  2FGG A;  2YTP A;  2CPN A;  5K36 D;  1PJS A;  4LF9 I;  4FW7 A;  4MQY A;  1TF6 A;  1YZ9 A;  2OI2 A;  1AH5 A;  4LF9 E;  4F6N A;  2F1D A;  3UHM A;  4DV7 I;  5KL2 A;  2R3V A;  2UXC I;  4DV7 E;  1DQ3 A;  1ZM3 A;  5C0X F;  2UXC E;  4FWD A;  2EL6 A;  2WNR B;  4JI0 I;  4F9B B;  1A1L A;  2PO1 B;  2EL5 A;  2EN7 A;  4JI0 E;  2V8Q B;  4WSG A;  1B69 A;  3FIG A;  2LJP A;  3PYE A;  2C37 B;  4DV1 I;  1I94 I;  4IFD B;  1I94 E;  1KJK A;  3CWV A;  4DV1 E;  4L5N C;  4M9V C;  2HKJ A;  3WU6 A;  3MHS C;  4IZK B;  4MU3 A;  4AM3 A;  1Y6Z A;  1K47 A;  4O24 A;  5EKW A;  4R2Q A;  1RC7 A;  5JEA C;  4DR4 I;  2X36 A;  2LV2 A;  1R6L A;  2V2Q A;  1JK1 A;  4DR4 E;  5AE1 A;  2HK3 A;  3BF2 A;  2BM1 A;  4PU9 A;  4KWY A;  2NN6 C;  2HJJ A;  3IWB A;  4NZV A;  4NHR A;  4ZYD A;  2RQL A;  1IBL I;  4MU0 A;  2L92 A;  2UU9 I;  4O43 A;  2L3J A;  1IBL E;  1YHC A;  3BID A;  5K36 E;  3PS3 A;  2N3H A;  4OO1 F;  2EPK X;  2UU9 E;  2IES A;  2VES A;  5DRO A;  4AIM A;  2DB2 A;  1N36 I;  1E3P A;  2JP9 A;  3PYF A;  3ZZU A;  1WXR A;  1N36 E;  3L7Z B;  3ZKD A;  1AAY A;  4GZN C;  2EOX A;  4IZJ B;  1X3C A;  1L4S A;  3C4B A;  2ZIT A;  3IWC A;  1QNT A;  1ZXM A;  2EOE A;  1PDA A;  2EM7 A;  3KZZ A;  1Y60 A;  4Q35 B;  2L8T A;  2V2V A;  4AQY I;  2EPN A;  2D9H A;  2YTG A;  1N0U A;  5K36 B;  1F2I G;  3ADL A;  2V2Z A;  3EPJ A;  1YSA C;  4HTG A;  2LUQ A;  4F54 A;  4DR2 I;  4JYA I;  2IER A;  2JE6 B;  3ZM7 A;  4JYA E;  4DR2 E;  1TF3 A;  4QNJ A;  1FJG I;  4BCA A;  2RSI A;  4OO1 A;  1FJG E;  3P3E A;  3V5R A;  2JOB A;  1Z5C A;  1PKP A;  2EE8 A;  3BGH A;  1PJT A;  1USU A;  4URL A;  4HEI A;  5IV8 B;  2UUC I;  3TQM A;  1X49 A;  1WRJ A;  2K7I A;  2PO1 A;  4R2R A;  2RTX A;  3M99 B;  2R1F A;  4DV4 I;  4B3M I;  5KL5 A;  2JEB A;  4AID A;  3J7A G;  4R8O A;  4B3M E;  4DV4 E;  4LF5 E;  3JTZ A;  2RPC A;  4LFB I;  2B9D A;  4LFB E;  4J8Z A;  1SFE A;  1NHH A;  3M85 G;  4N4R B;  2E1M A;  1X48 A;  1YYO A;  1VIS A;  1Z0E A;  5JEA B;  2KON A;  4I8O A;  4NXM E;  2PO2 A;  4X65 I;  2ADR A;  2DRP A;  1WHQ A;  2EJ4 A;  3HPZ A;  4X65 E;  1Y5Y A;  4R2P A;  2JWO A;  2MC5 A;  2JVA A;  4R2A A;  2DEJ A;  2DGC A;  1DI2 A;  2Z5C A;  1FNM A;  4DR5 E;  2WBU A;  2J7K A;  3WU3 A;  2ODR D;  1ZM9 A;  4ZYH A;  2DMY A;  2EPC A;  1BBO A;  5C0X C;  1Z0G A;  4WUC A;  1XMQ I;  2G7H A;  2LTR A;  1XMQ E;  2EOR A;  2BM0 A;  4O4K A;  4JI4 I;  3C6K A;  4WUD A;  4JI4 E;  5DRP A;  4DKK A;  4DPX A;  3J80 Q;  1XNQ I;  5AAS A;  4IS1 C;  1XNQ E;  1X6F A;  2VF3 A;  2V88 A;  4RPF A;  3P1X A;  4BHC A;  2LT7 A;  4MYT A;  1ZM2 A;  1EH8 A;  4TUI A;  3PS2 A;  4JI5 I;  4WXC A;  1EI1 A;  1H7U A;  2IOP A;  3M7N G;  4JI5 E;  4GQU A;  3HKM A;  1UIL A;  1RRE A;  2V85 A;  2ELZ A;  4FWH A;  2RSM A;  1X6E A;  3JAM Q;  3M85 D;  2C38 A;  5LLQ A;  2EM0 A;  4LCG A;  2EMY A;  4RHB B;  1D6T A;  2VF1 A;  2VRD A;  4F9C B;  1NCS A;  2WP8 B;  4DV3 I;  4LF6 I;  4MLV A;  4DV3 E;  4LF6 E;  3QT6 A;  4BA2 A;  3K6Q A;  1A1J A;  4OX9 I;  2UXD I;  4EMD A;  1NEI A;  3DF6 A;  4OX9 E;  2UXD E;  1NHI A;  4OO1 C;  4FW3 A;  1T4N A;  4UT4 A;  1S16 A;  3LML A;  3PRY A;  1MG7 A;  2WW4 A;  4LCF A;  4X66 I;  2C39 A;  2HFS A;  3NZK A;  2EPM X;  2K4V A;  4X62 E;  3EPK A;  2EMX A;  4X66 E;  4IFD F;  2EMB A;  5AE2 A;  1OJ4 A;  1Z5B A;  2CGE A;  2EP3 A;  2EN2 A;  5A6K A;  5IXM B;  5C0X E;  4FK5 C;  2O1V A;  3BBG A;  2J65 A;  1RQ0 A;  4GEQ B;  2EPZ A;  4DPW A;  3ZOQ B;  2B7V A;  3J80 C;  3Q1Q A;  3B82 A;  1Y4U A;  4ZVI A;  1ELO A;  4BBY A;  4P78 A;  1KTV A;  2EMZ A;  3CDI A;  1ZM4 A;  4IS9 A;  2J7J A;  2ZBK B;  1VI7 A;  3KWR A;  2PNZ B;  3M7N D;  1XXE A;  1Y4S A;  4JI6 I;  4LF4 I;  4BS9 A;  1G2D C;  4JI6 E;  2V83 A;  4LF4 E;  2FV4 B;  2L33 A;  4JV5 I;  1KIJ A;  5KL3 A;  5JEA D;  2IHR 1;  3JAM C;  4FW9 A;  2EZ6 A;  3ADI A;  4JV5 E;  2EN1 A;  4LPF A;  2NAB A;  1XMO I;  1EKZ A;  2WNR A;  2ENC A;  4GKK I;  2PO0 B;  2EWL A;  1XMO E;  5C0X B;  2M4I A;  4MYU A;  2Z5B B;  4WPY A;  5CFF E;  4GKK E;  2CVE A;  2EML A;  1NHJ A;  2BR2 B;  2NN6 D;  2HKE A;  4P52 A;  3P76 A;  5GME A;  1Z1B A;  1EH6 A;  2C37 A;  4DPU A;  4GKJ I;  3QT5 A;  3EPL A;  4IFD A;  4GKJ E;  3ADJ A;  1MGT A;  1H74 A;  3LTO A;  3ZZT A;  2MDR A;  1S4E A;  3GME A;  3DJW A;  4BA1 B;  4K0K I;  4DV5 I;  2LCE A;  4K0K E;  2O1T A;  2BA0 G;  2JPA A;  2F8B A;  2L2N A;  2EOJ A;  1X5W A;  4DV5 E;  1A1H A;  4USK A;  4X64 I;  4DUZ I;  2YSP A;  2RS7 A;  1FI4 A;  2LVH A;  5GMD A;  4DUZ E;  4X64 E;  4WUB A;  1X47 A;  4QNK A;  3D4J A;  2FTX B;  3PYG A;  3QG5 C;  4B3R I;  3Q6N A;  3GLL A;  2DMI A;  4B3R E;  1A6F A;  1DAR A;  2O1W A;  4F6M A;  2GO4 A;  2YTF A;  2BBG A;  3LLH A;  3H09 A;  3VK6 A;  3KRN A;  1UBD C;  1YH8 A;  4DU8 A;  2DSY A;  4WX9 A;  2EMK A;  4R2S A;  4OKG A;  4R2D A;  5ADZ A;  1ZR9 A;  4DR1 I;  4DMI A;  3F0N A;  4JI7 I;  4DR1 E;  1ZXN A;  5JEA E;  4JI7 E;  2DLQ A;  1X6H A;  4NXM I;  3THN A;  4BMJ A;  3L7Z A;  1EA6 A;  2EFG A;  4LTY A;  2Q8U A;  4IJD A;  4IZJ A;  2EOM A;  2AE8 A;  4DV6 I;  2R76 A;  2NN6 E;  4DV6 E;  3QT8 A;  4OOG C;  4LF5 I;  1BB8 A;  2YTJ A;  4M30 A;  1MEY C;  5A6B D;  2E1R A;  4P7A A;  5A2Q Q;  1N33 I;  2JYA A;  5AC4 A;  4JI8 I;  2BA0 D;  1PVG A;  2JEA B;  1NZ0 A;  1N33 E;  2CG9 A;  2PNM A;  4PRV A;  3AUZ A;  4JI8 E;  3OTO I;  1IBM I;  2YRK A;  4HAC A;  1Z0T A;  3RMP A;  2EMG A;  2YU8 A;  4BC7 A;  3OTO E;  4DR3 E;  1IBM E;  1PIE A;  2HK2 A;  2JE6 A;  4J3D A;  2EN4 A;  2YZT A;  3EPH A;  4DPY A;  1T4O A;  2NUF A;  4FW4 A;  2VE7 C;  1IQO A;  2VQE I;  1QZR A;  2ZM6 I;  4DR5 I;  2EN8 A;  2VQE E;  4LU9 A;  2ZM6 E;  2NN6 B;  1IBK I;  2EPR A;  1FWL A;  4LFC I;  3PYD A;  1ZU1 A;  2EM4 A;  1IBK E;  2YTE A;  3HJC A;  4XTJ A;  4B3T E;  4LFC E;  2YTD A;  2V89 A;  2EN3 A;  2HGH A;  2NUG A;  4PRX A;  4LF8 I;  5LMU I;  4IFD C;  1ZAA C;  2EMH A;  4LF8 E;  1UDN A;  2HFU A;  4MU4 A;  4ZYG A;  5LMU E;  3WU4 A;  5FWK A;  5C0X D;  3K85 A;  1YPN A;  4X8W A;  2HC5 A;  2EOS A;  4F2J C;  3VYX A;  2CZ9 A;  2L2K B;  3H1C A;  1Z0C A;  1Z0W A;  2V8P A;  3UK3 C;  1G2F C;  4MLQ A;  1FWK A;  2HHH I;  1B62 A;  2WCC 3;  3B8H A;  4Z7Y A;  2HHH E;  2UXB I;  2PNL A;  4ZYE A;  2UXB E;  2GPI A;  2EOO A;  2NPF A;  4WXD A;  1R6M A;  2V34 A;  3AV0 A;  1PJQ A;  2I9I A;  2M7Q A;  1N32 I;  2ENH A;  2BV3 A;  5BR8 I;  5A2Q C;  1N32 E;  4LCH A;  1HNZ I;  2M9A A;  1UHZ A;  5BR8 E;  2EMF A;  2R42 A;  4R03 A;  4RH8 A;  1HNZ E;  1E3H A;  4FW6 A;  5DRQ A;  1P47 A;  3HUL A;  1XHK A;  3Q6M A;  3P3G A;  2N3G A;  2JOX A;  1BBG A;  4WFT A;  1YFH A;  2LO3 A;  3J81 Q;  2YRH A;  1T38 A;  3B4T A;  1H7S A;  2B3T B;  1UEK A;  1KVK A;  4F9A B;  2UUA I;  4OO1 D;  2M1S A;  1JK2 A;  4X62 I;  3OML A;  2UUA E;  3C4T A;  4WSP A;  5FLX Q;  2BB8 A;  4KQV A;  1HR0 I;  2JXP A;  4R2C A;  2YTQ A;  2AJ4 A;  2EOQ A;  1HR0 E;  1USV A;  4WYQ B;  1OYR A;  5DNX A;  1J5E I;  2EM6 A;  2O3Z A;  1J5E E;  2YTN A;  1H73 A;  3ZZ0 A;  1STU A;  2L2M A;  1XNR I;  2ENA A;  2EQ1 A;  3LPS A;  2EPU A;  1N3G A;  1XNR E;  2LTS A;  2WP8 A;  3HXL A;  2WBT A;  2YTO A;  3B78 A;  2EOY A;  5A69 A;  2JT2 A;  3K17 A;  2EPO A;  5KL6 A;  5DNY A;  4OZE A;  5LMN I;  2NA2 A;  4B3S I;  5LMN E;  3DD6 A;  5LL6 R;  1Z0V A;  4B3S E;  1EH7 A;  2YU5 A;  4OO1 E;  2MDG A;  2GHF A;  4BC9 A;  4MU1 A;  3ZKB A;  2A25 A;  1UDS A;  2L3C A;  2A2D A;  3P3C A;  5IWA I;  2DIX A;  1GZ6 A;  5IWA E;  2E5L I;  2MKN A;  4USM A;  1N34 I;  5A6B A;  3H4L A;  1LLM C;  2E5L E;  2UUB I;  3ADG A;  3THO B;  1N34 E;  3J81 C;  2UUB E;  2V87 A;  1FKA E;  1O0W A;  3EQ1 A;  2X7I A;  1TN9 A;  1OYP A;  3GCM A;  1B63 A;  2EPX A;  4IZK A;  1QU6 A;  2L6M A;  4LOM A;  4UTG A; 
#chains in the Genus database with same CATH homology
 1ZBT A;  4Q28 A;  2RS6 A;  5FLX C;  1Z59 A;  1HK7 A;  1N0V C;  4R1F A;  1MU5 A;  2LUP B;  4DR7 I;  4FWG A;  2Z5B A;  1HNW I;  2Z5E A;  4M2Z A;  4DR7 E;  4N3O A;  1HNW E;  2LJH A;  1GQE A;  1Z5A A;  4DV0 I;  4DV0 E;  4Z7C A;  3LNU A;  2XEX A;  2O1U A;  4TUG A;  3HTX A;  4HY1 A;  1Z0B A;  2A2C A;  4JG4 A;  2YT4 A;  4M1K A;  2KOU A;  3GON A;  4I3H A;  4LF7 I;  4AQY E;  1U2R A;  2GS8 A;  4JI3 I;  4LF7 E;  2F4V I;  5L3J A;  3IWD A;  4JI3 E;  2LBS B;  4HAC B;  2F4V E;  4HXZ A;  3HPS A;  2V86 A;  4DR3 I;  3F6H A;  2KHX A;  1SR9 A;  4ED4 A;  3T1H I;  4DV2 I;  3T1H E;  4YY3 I;  3T1Y I;  4DV2 E;  4YY3 E;  3T1Y E;  3QT7 A;  2Z5C B;  4B3T I;  2GQ0 A;  4DXL A;  4HYM A;  2UUC E;  1T4L B;  1WUU A;  2NUE A;  1MX0 A;  4M0V A;  4KHP I;  2JR1 A;  2WZO A;  3J7Y p;  5IT9 Q;  4KHP E;  4L8N A;  1KKH A;  1H72 C;  2H36 X;  3M6A A;  4FN5 A;  4P7D A;  4DU7 A;  3V2U C;  4KZS A;  5T6J A;  2LMZ A;  2ODR C;  2IOQ A;  2DEI A;  1RR9 A;  4DUY I;  4DUY E;  1J26 A;  4DR6 I;  3F6G A;  4DR6 E;  4DPT A;  2JY9 A;  1ZBQ A;  1BKN A;  4LFA I;  4JI1 I;  3JU0 A;  3K1J A;  3MSW A;  4LFA E;  4JI1 E;  2LE2 A;  3HQ1 A;  1YYW A;  4JI2 I;  2B7T A;  4JI2 E;  3WU5 A;  3VYY A;  2VQF I;  5AE3 A;  3P06 A;  2MC6 A;  5F3W A;  3J7A M;  2VQF E;  4IZJ D;  4NXN I;  2Q2E B;  5IT9 C;  4NXN E;  4YHH I;  1YYK A;  1HNX I;  4YHH E;  1HNX E;  2LRS A;  2FGG A;  2CPN A;  4LF9 I;  1YZ9 A;  2OI2 A;  4LF9 E;  4DV7 I;  2UXC I;  2R3V A;  4DV7 E;  1DQ3 A;  1ZM3 A;  2UXC E;  4FWD A;  4JI0 I;  4F9B B;  4JI0 E;  2V8Q B;  1I94 I;  3PYE A;  3FIG A;  2LJP A;  4DV1 I;  1I94 E;  3CWV A;  4DV1 E;  4L5N C;  2L6M A;  2HKJ A;  3WU6 A;  4IZK B;  1Y6Z A;  1K47 A;  1RC7 A;  4DR4 I;  2X36 A;  2V2Q A;  4DR4 E;  5AE1 A;  2HK3 A;  4PU9 A;  2BM1 A;  3IWB A;  1IBL I;  2L92 A;  2UU9 I;  1IBL E;  2L3J A;  2N3H A;  2UU9 E;  2DB2 A;  1N36 I;  3PYF A;  3ZZU A;  1WXR A;  1N36 E;  3ZKD A;  4IZJ B;  3C4B A;  2ZIT A;  3IWC A;  1ZXM A;  2L8T A;  2V2V A;  4AQY I;  1N0U A;  3ADL A;  2V2Z A;  2LUQ A;  4F54 A;  4DR2 I;  4JYA I;  3ZM7 A;  4JYA E;  4DR2 E;  1FJG I;  4BCA A;  1FJG E;  3V5R A;  2JOB A;  1Z5C A;  1PKP A;  1USU A;  4URL A;  2UUC I;  1X49 A;  2RTX A;  4B3M I;  4DV4 I;  3J7A G;  4R8O A;  4B3M E;  4DV4 E;  4LF5 E;  3JTZ A;  4LFB I;  2B9D A;  4LFB E;  4J8Z A;  1NHH A;  2E1M A;  1X48 A;  1YYO A;  1VIS A;  1Z0E A;  2KON A;  4I8O A;  4NXM E;  4X65 I;  1WHQ A;  3HPZ A;  4X65 E;  2JWO A;  2MC5 A;  2JVA A;  2DEJ A;  1DI2 A;  2Z5C A;  1FNM A;  4DR5 E;  2J7K A;  3WU3 A;  2ODR D;  1ZM9 A;  2DMY A;  1Z0G A;  4WUC A;  1XMQ I;  2G7H A;  2LTR A;  1XMQ E;  2BM0 A;  4JI4 I;  4WUD A;  4JI4 E;  4DPX A;  4DKK A;  3J80 Q;  1XNQ I;  5AAS A;  1XNQ E;  2VF3 A;  2V88 A;  3P1X A;  4MYT A;  1ZM2 A;  4TUI A;  4JI5 I;  1EI1 A;  1H7U A;  2IOP A;  4JI5 E;  1UIL A;  1RRE A;  2V85 A;  4FWH A;  2RSM A;  3JAM Q;  1D6T A;  2VF1 A;  4F9C B;  4DV3 I;  4LF6 I;  4DV3 E;  4LF6 E;  3QT6 A;  3K6Q A;  4OX9 I;  2UXD I;  4EMD A;  3DF6 A;  4OX9 E;  2UXD E;  1NHI A;  4UT4 A;  1T4N A;  1S16 A;  3LML A;  3PRY A;  1MG7 A;  2WW4 A;  4X66 I;  2HFS A;  2K4V A;  4X62 E;  4X66 E;  2CGE A;  5AE2 A;  1OJ4 A;  1Z5B A;  2O1V A;  1RQ0 A;  4GEQ B;  4DPW A;  3ZOQ B;  2B7V A;  3J80 C;  3Q1Q A;  3B82 A;  1Y4U A;  4ZVI A;  1ELO A;  4BBY A;  4P78 A;  1KTV A;  1ZM4 A;  2ZBK B;  3KWR A;  1Y4S A;  4JI6 I;  4LF4 I;  4BS9 A;  4JI6 E;  2V83 A;  4LF4 E;  2FV4 B;  2L33 A;  4JV5 I;  1KIJ A;  2IHR 1;  3JAM C;  4FW9 A;  2EZ6 A;  3ADI A;  4JV5 E;  1XMO I;  1EKZ A;  4GKK I;  2EWL A;  1XMO E;  2M4I A;  4MYU A;  2Z5B B;  4WPY A;  5CFF E;  4GKK E;  1NHJ A;  4P52 A;  2HKE A;  5GME A;  4DPU A;  4GKJ I;  3QT5 A;  4GKJ E;  3ADJ A;  1H74 A;  3LTO A;  3ZZT A;  2MDR A;  1S4E A;  4K0K I;  3DJW A;  4DV5 I;  4K0K E;  2O1T A;  2F8B A;  2L2N A;  4DV5 E;  4DUZ I;  4USK A;  4X64 I;  2RS7 A;  1FI4 A;  5GMD A;  4DUZ E;  4X64 E;  4WUB A;  1X47 A;  3D4J A;  2FTX B;  3PYG A;  4B3R I;  3Q6N A;  4B3R E;  1DAR A;  1A6F A;  2O1W A;  3LLH A;  3VK6 A;  3H09 A;  4DU8 A;  2DSY A;  5ADZ A;  4DR1 I;  4DMI A;  3F0N A;  4JI7 I;  4DR1 E;  1ZXN A;  4JI7 E;  4BMJ A;  1EA6 A;  2EFG A;  4LTY A;  4IZJ A;  4DV6 I;  4DV6 E;  3QT8 A;  4OOG C;  4LF5 I;  4M30 A;  2E1R A;  4P7A A;  5A2Q Q;  1N33 I;  4JI8 I;  1PVG A;  1NZ0 A;  1N33 E;  2CG9 A;  2PNM A;  4PRV A;  3AUZ A;  4JI8 E;  3OTO I;  1IBM I;  4HAC A;  4NXM I;  1Z0T A;  3RMP A;  3OTO E;  1PIE A;  4BC7 A;  4DR3 E;  1IBM E;  2HK2 A;  4RPF A;  2YZT A;  4DPY A;  1T4O A;  2NUF A;  2VE7 C;  2VQE I;  1QZR A;  2ZM6 I;  4DR5 I;  2VQE E;  4LU9 A;  2ZM6 E;  1IBK I;  1FWL A;  4LFC I;  3PYD A;  1IBK E;  3HJC A;  4XTJ A;  4B3T E;  4LFC E;  2NUG A;  2V89 A;  4PRX A;  4LF8 I;  5LMU I;  4LF8 E;  2HFU A;  5FWK A;  3WU4 A;  5LMU E;  3K85 A;  4X8W A;  2CZ9 A;  3VYX A;  2L2K B;  1Z0C A;  1Z0W A;  2V8P A;  2HHH I;  1FWK A;  1B62 A;  4Z7Y A;  3B8H A;  2HHH E;  2UXB I;  2PNL A;  2UXB E;  2NPF A;  2V34 A;  3AV0 A;  2M7Q A;  1N32 I;  2BV3 A;  5BR8 I;  5A2Q C;  1N32 E;  1HNZ I;  1UHZ A;  5BR8 E;  2R42 A;  4R03 A;  1HNZ E;  3HUL A;  1XHK A;  3Q6M A;  2N3G A;  2JOX A;  4WFT A;  3J81 Q;  1H7S A;  2B3T B;  1UEK A;  1KVK A;  4F9A B;  2UUA I;  2M1S A;  4X62 I;  3OML A;  2UUA E;  3C4T A;  4WSP A;  5FLX Q;  4KQV A;  1HR0 I;  2AJ4 A;  1HR0 E;  1USV A;  4WYQ B;  1J5E I;  1J5E E;  1H73 A;  3ZZ0 A;  1STU A;  2L2M A;  1XNR I;  3LPS A;  1XNR E;  2LTS A;  3HXL A;  3B78 A;  3K17 A;  5DNY A;  5LMN I;  2NA2 A;  4B3S I;  5LMN E;  5LL6 R;  1Z0V A;  4B3S E;  4BC9 A;  3ZKB A;  2A2D A;  2L3C A;  5IWA I;  2DIX A;  1GZ6 A;  5IWA E;  2E5L I;  4USM A;  1N34 I;  3H4L A;  2E5L E;  2UUB I;  3ADG A;  1N34 E;  3J81 C;  2UUB E;  2V87 A;  1FKA E;  1O0W A;  2X7I A;  1B63 A;  4IZK A;  1QU6 A;  1WHN A;  4UTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...