4JI6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6E02
1IBLE 4GKJI 2UXBI 1IBKE 2NA2A 4FW9A 4WFTA 2V34A 2VQEE 1RQ0A 4JV5E 4UTGA 1Z5CA 1PVGA 3ADIA 1T4LB 4I3HA 4JYAE 3OTOI 1Z0VA 2LTRA 1MG7A 1NZ0A 4DPXA 2UUAI 4WUBA 1N0UA 1YYWA 2R3VA 1FJGE 4DV1I 2A2CA 4X65E 4JI5I 4YHHI 5LMUE 1FWLA 4DV6I 2R42A 4DV4I 4LF7E 4HXZA 4PRXA 1ELOA 2VQEI 1IBMI 4PRVA 2IHR1 3F0NA 4HACB 4ZVIA 4X66I 2N3HA 4DU7A 2L2MA 4DR1E 2UUBE 4FWGA 4PU9A 4JI3I 5A2QQ 4XTJA 1QZRA 1N33I 4DV4E 1XNQI 4M30A 4DUZE 1K47A 4JI4E 1J5EI 1N0VC 2ZM6I 3GONA 5LMUI 1NHHA 4DV1E 1BKNA 3ZZ0A 3ZZTA 1XMQE 4RPFA 1IBME 4YY3I 2A2DA 3QT8A 4JG4A 4DV2E 4USMA 1ZXNA 1YZ9A 1Z0CA 2RSMA 2LJHA 2B3TB 4JI6E 2HKEA 1Z5AA 4OX9E 4B3MI 4Z7CA 3LLHA 2XEXA 5IT9C 2J7KA 1O0WA 4DR5E 4DR5I 3HTXA 2NPFA 1DARA 1WHQA 1IBLI 4K0KE 3T1YE 2ZM6E 1UILA 1UEKA 3HULA 4DUZI 4GKKE 4DUYE 4B3SE 4DV2I 1ZXMA 2BV3A 1NHIA 3J81C 1Z0WA 4DR3E 4DV5E 3ADLA 1D6TA 1HNXE 1RC7A 3ZKDA 1H72C 2F4VE 4DU8A 1MX0A 4NXME 1FWKA 2HFSA 3J80C 2RTXA 2UUBI 4JI8I 2LJPA 1HR0I 4AQYE 2E1RA 2ZITA 4WYQB 1KIJA 2VF3A 2DB2A 5IWAE 2CZ9A 4KHPE 1Z59A 4LFAI 4M2ZA 2F4VI 2VQFI 1VISA 3WU4A 5CFFE 1T4NA 2HK2A 3PYEA 4DR3I 1HNWI 5BR8E 2NUFA 2BM0A 2MDRA 4MYUA 5IT9Q 5A2QC 2LUPB 2V8PA 4GKJE 4MYTA 2HK3A 1WUUA 3T1YI 1HR0E 2GS8A 1EKZA 1J5EE 4JI6I 2X7IA 4JI7I 4DR7I 5LMNI 4JV5I 5IWAI 1KTVA 2L2KB 2UUCE 4M1KA 3PYFA 1HNWE 2KHXA 1H7SA 4NXNI 4X66E 4URLA 1HNXI 2HHHE 4HYMA 2JY9A 3B8HA 4DV5I 1XNQE 4LF4I 2UXDE 1X48A 1N33E 4NXMI 1KVKA 3LPSA 1I94E 4AQYI 2LRSA 4EMDA 4DV6E 4X62E 3JAMQ 1Z0BA 4JI5E 4DXLA 4X65I 1N34E 4LF9E 4LFCI 1N36E 4FN5A 4Z7YA 3OTOE 4HACA 4DPYA 4DV3I 4X64E 3QT5A 2HFUA 4DKKA 4NXNE 3J80Q 1MU5A 2ZBKB 4JI0E 3PYGA 4DV0E 2UUAE 4LF6I 3J7AM 1B63A 3Q1QA 4JI4I 4DR2I 3J81Q 4R1FA 4B3TI 4B3RI 2NUGA 3V2UC 4LFBI 1FI4A 2JVAA 4DPUA 2UXCI 4WUCA 4LF8I 4B3ME 4OX9I 1NHJA 4DPWA 1HNZE 2BM1A 4X64I 4DV3E 2YT4A 1U2RA 2VQFE 4JI1E 4ED4A 3M6AA 3P1XA 3T1HI 3T1HE 1X47A 3WU3A 3ADJA 1YYKA 4UT4A 4YHHE 1S4EA 3ZZUA 2RS6A 4DUYI 3C4BA 2V2VA 4LFBE 4FWHA 1YYOA 4LF7I 5LMNE 4LF4E 1N34I 4FWDA 4DR6I 4P7AA 2L2NA 2HKJA 2L3CA 2CPNA 1Z5BA 2UXCE 4LF6E 1FJGI 1FKAE 5GMDA 4JI0I 3LNUA 1ZM4A 4DR2E 3VYYA 3B82A 2NUEA 4GKKI 1QU6A 3CWVA 2UU9E 2UU9I 1WHNA 4OOGC 2DIXA 4JI2E 1OJ4A 3QT7A 4LF9I 2LTSA 3H4LA 4DR7E 4B3TE 3PYDA 2WW4A 4DV7I 2V2ZA 1XNRI 4HY1A 4USKA 4X8WA 5FLXQ 4DR1I 1XHKA 3B78A 4DPTA 1XMQI 1J26A 1XMOI 4KQVA 3K1JA 1ZM2A 4DR6E 2DEIA 4LFAE 1S16A 1RREA 3WU5A 4JI1I 1DI2A 1ZM3A 4JI7E 5LL6R 1RR9A 1HNZI 3J7Yp 1N32E 2L3JA 3WU6A 1Z0EA 4LF8E 4DV7E 1STUA 4LF5I 1KKHA 2X36A 1Z0GA 2N3GA 4B3RE 3ZM7A 1EI1A 2RS7A 4JYAI 1FNMA 1Z0TA 1XMOE 2EFGA 2Q2EB 1H73A 3ZKBA 3VYXA 4DR4I 4K0KI 2EZ6A 1H7UA 2UUCI 1UHZA 2LBSB 4KHPI 1T4OA 1GQEA 5GMEA 2B7TA 1IBKI 4LF5E 4DR4E 1ZM9A 1B62A 2E5LE 2E5LI 1PIEA 1N36I 3ADGA 3C4TA 3V5RA 3QT6A 1ZBTA 3D4JA 4DV0I 5L3JA 5BR8I 4P52A 2DEJA 2L33A 3LTOA 4X62I 3K17A 2UXBE 2V2QA 4JI8E 2AJ4A 1PKPA 2B7VA 4LFCE 1X49A 3J7AG 4B3SI 4YY3E 1EA6A 3JAMC 2DMYA 2HHHI 1XNRE 1N32I 2LUQA 2OI2A 1H74A 1I94I 1A6FA 4JI3E 5FLXC 2UXDI 4JI2I 4WUDA
chains in the Genus database with same CATH superfamily
5A69A 2YPNA 4ZYGA 4O4KA 4QNKA 1IBLE 4GKJI 2UXBI 4IS1C 2EMYA 4BBYA 1IBKE 2NA2A 2PO0A 4FW9A 4IS9A 2WBTA 4N4RB 1AAYA 5K36E 4P7DA 4WFTA 2V34A 3PS2A 2VQEE 1RQ0A 4JV5E 4UTGA 3IWCA 2IESA 4OO1F 1Z5CA 1PVGA 2EOHA 2K7IA 1T4LB 3ADIA 1Y5YA 4I3HA 1IMUA 4JYAE 3OTOI 4J8ZA 1Z0VA 4BA2A 2LTRA 1MG7A 1NZ0A 4DPXA 2VESA 1A1LA 2UUAI 2E1MA 4WUBA 1N0UA 2O1VA 2DMIA 1YYWA 2R3VA 1MEYC 1FJGE 5EKWA 2G7HA 4DV1I 2A2CA 4MU3A 4X65E 4JI5I 1X6FA 4YHHI 2ODRC 2VF1A 5LMUE 4F9BB 3C6MA 1FWLA 4DV6I 1YUIA 4IFDB 2R42A 4DV4I 2JXPA 4LF7E 4R2AA 4HXZA 4PRXA 1ELOA 3KZYA 2VQEI 2WBSA 1IBMI 2NN6A 3NZKA 4U3DA 5KL2A 4PRVA 2IHR1 2EJ4A 1YPNA 2Z5CB 3F0NA 2JWOA 3B4TA 4HACB 4R2SA 2O3ZA 1USVA 4ZVIA 1X6EA 4BA1B 2N3HA 2YU5A 1WJPA 3EPLA 4DU7A 2L2MA 4X66I 2LO3A 3HPSA 4DR1E 2M9AA 2UUBE 4FWGA 4PU9A 2YU8A 4JI3I 5A2QQ 2EM4A 4F6NA 2MKDA 1QZRA 4XTJA 2EN4A 2YTQA 1N33I 4F9AB 4DV4E 4M30A 1XNQI 4DUZE 2EPAA 1K47A 4IJDA 4JI4E 5FWKA 3L7ZB 1J5EI 1N0VC 2ZM6I 2GLIA 3GONA 5JEAE 4MU4A 5LMUI 3H1CA 1E3HA 1NHHA 4DV1E 1BKNA 1USUA 3ZZ0A 3ZZTA 1BBGA 1XMQE 4RPFA 2RQLA 3HPZA 3VHTB 5JEAD 1IBME 2EMWA 4YY3I 5DRRA 2A2DA 3QT8A 4NZVA 5AC5A 4DV2E 1Y4SA 4JG4A 1NEIA 4USMA 2PO1B 3AV0A 1ZXNA 2YTDA 1YZ9A 2MC5A 2RSMA 1Z0CA 2PNLA 3OMLA 2LJHA 2B3TB 4JI6E 1Z5AA 2HKEA 1IQOA 1XXEA 3L00A 2D9HA 4OX9E 1A1IA 4B3MI 2MKNA 2EM8A 4Z7CA 3UHMA 3DJWA 2O1WA 2WP8B 4NBQA 3GCMA 5ELWA 3LLHA 3EPHA 5IT9C 2J7KA 2XEXA 2I13A 1O0WA 2ENCA 4DR5E 4DR5I 3Q1QA 4IFDA 4BA2B 3HTXA 2NPFA 4RH8A 2BA0D 1DARA 1WHQA 2YTGA 3THNA 1IBLI 4K0KE 3T1YE 2EP3A 2EOJA 1UILA 2R1FA 2ZM6E 1UEKA 1P47A 3HULA 4L5NC 1JK1A 2YTPA 4DUZI 4GKKE 1OYSA 2E72A 4R2PA 2GQ0A 2JEAB 1TN9A 4WSGA 2BB8A 2JOBA 3H09A 2PRTA 4FW6A 4DUYE 5AASA 4B3SE 5C0XA 4DV2I 5DRQA 1ZXMA 2BV3A 2EM2A 5TSEA 3J81C 1NHIA 2V88A 2BA1D 2NN6B 5JEAC 2J7JA 4DR3E 4DV5E 5AE2A 1Z0WA 3THOB 3ADLA 2EWLA 2CSHA 1D6TA 3UK3C 1HNXE 1RC7A 5IXMB 3ZKDA 3CDIA 4R2QA 1H72C 2F4VE 3AUZA 3F6HA 2ENAA 4DU8A 1MX0A 2DRPA 2DLQA 4NXME 1FWKA 2CG9A 2HFSA 1X3CA 2EPCA 3J80C 4R03A 2DSYA 2K4VA 2RTXA 4WXDA 2UUBI 4JI8I 5C0XD 2EOEA 3KRNA 2JOXA 2LJPA 2EE8A 1HR0I 4MDTA 5K36F 4AQYE 2V8QB 2E1RA 5A6BD 2EN3A 4FK5C 1UBDC 1R6LA 2ZITA 2M7QA 4WYQB 4ZYHA 1KIJA 2VF3A 3KWRA 2DB2A 4GZNC 5IWAE 2EPKX 2HGHA 2CZ9A 2VE7C 2YTNA 4KHPE 1Z59A 4M2ZA 4LFAI 2C37B 4IFDD 2F4VI 2PO1A 1TF3A 2JT2A 2VQFI 2H36X 3HJCA 2GO3A 5DNXA 4WX9A 2EN6A 4DMIA 1VISA 4IZKA 2F8BA 5AE3A 4L8NA 1Y6ZA 3WU4A 1QNTA 5CFFE 1T4NA 2GO4A 2HK2A 1A1HA 3PYEA 4DR3I 3IWBA 1HNWI 3M99B 4LTYA 5BR8E 2EOOA 3L7ZA 2NUFA 2EL4A 2BM0A 2MDRA 3MSWA 4MYUA 5A2QC 2LUPB 4GQUA 5IT9Q 1ZR9A 2EMHA 5K36B 2RPCA 2R76A 2V8PA 4GKJE 4MYTA 2HK3A 3Q6NA 5JEAA 1WUUA 3T1YI 1HR0E 2GS8A 1EKZA 2EMZA 1J5EE 4JI6I 2X7IA 1OYRA 3MHSC 1UN6B 2FTXB 4BC9A 4JI7I 4DR7I 5LMNI 4JV5I 4F9CB 5IV8B 2CGEA 5IWAI 2EMKA 3EQ1A 1KTVA 2L2KB 2UUCE 4M1KA 3PYFA 4OKGA 2YTFA 1PJTA 1HNWE 3BGHA 2KHXA 1BB8A 4FW5A 1H7SA 4KWYA 2EPOA 4X66E 4NXNI 4URLA 1HNXI 2HHHE 4HYMA 2JY9A 3B8HA 4LPFA 4DV5I 4F6MA 2JE6A 2JYAA 2I9IA 1XNQE 4LF4I 2LJUA 2UXDE 1ZU1A 2EOYA 1X48A 1N33E 4NXMI 1KVKA 2LT7A 2V85A 2V83A 2J65A 2Z5BA 3LPSA 5KL6A 4OO1A 5JEAF 2YRKA 1I94E 2YTJA 5KL3A 4J3DA 4F54A 2EL5A 4AQYI 2LRSA 2EPUA 4EMDA 4DV6E 4X62E 2LV2A 3BIDA 3JAMQ 1Z0BA 4JI5E 4DXLA 4X65I 1N34E 1TF6A 4O5GA 2C38B 3MHHC 4IZJA 3TQMA 2EMLA 1P42A 4LCHA 4R2DA 4LF9E 4MU0A 1UDNA 1T39A 2EM5A 5A6BA 4LFCI 4MLQA 3RMPA 1N36E 1R6MA 4FN5A 2KOUA 4IFDC 2EMFA 4Z7YA 3OTOE 4HACA 4DPYA 3PRYA 4M9VC 4DV3I 4X64E 4BHCA 2EN7A 2EPRA 4KZSA 2YTEA 3QT5A 4AIMA 2HFUA 4BCAA 4DKKA 4NXNE 3J80Q 1WRJA 2JE6B 2LCEA 2HJJA 1MU5A 1HK7A 2BBGA 2ZBKB 4JI0E 2EM9A 3PYGA 2ADRA 2ENHA 3BF2A 4DV0E 1EH6A 2UUAE 4LF6I 3J7AM 3HXLA 2EOFA 1EH8A 2EMCA 2M4IA 2YZTA 4O24A 2EPXA 1BBOA 1B63A 4MU1A 2VRDA 3P76A 4AIDA 4HTGA 2EORA 2EN8A 1YH8A 3K85A 4R1FA 1YHCA 3PS3A 2NUGA 2BR2A 3U1YA 3J81Q 3V2UC 4B3TI 4B3RI 3KZZA 2EM0A 4FW4A 2JEAA 4LFBI 1FI4A 5A6AA 2ELYA 2JVAA 4DPUA 5C0XE 2UXCI 2V87A 4IZJB 4WUCA 4LF8I 2A25A 4B3ME 2KONA 4OX9I 5K36C 1NHJA 2JEBB 4LCGA 4DPWA 3K6QA 1HNZE 2BM1A 4X64I 4DV3E 2FV4B 4NHRA 2YT4A 4TUIA 1U2RA 1PJQA 2NABA 3JTZA 2VQFE 4JI1E 4ED4A 4ZYEA 3M6AA 3P1XA 4DR2I 4RHBB 3T1HI 3T1HE 2V89A 3M85G 1X47A 2PNZB 3WU3A 1Y60A 2NN6C 3ADJA 4LCFA 1VI7A 1YYKA 2Q8UA 4IFDF 3M85D 4UT4A 1NCSA 4YHHE 2NN6E 3GLLA 1S4EA 2B9DA 1T38A 4QNJA 4BMJA 1A1FA 2CTDA 2EPLX 2RS6A 3ZZUA 1UDOA 4DUYI 3C4BA 2C38A 2V2VA 5LLQA 4LFBE 4FWHA 1YYOA 4LF7I 2EOZA 1PJSA 2WNRB 2LMZA 5LMNE 2EOMA 4LF4E 3LMLA 4MQYA 1N34I 2V86A 1AH5A 4FWDA 4N3OA 4DR6I 4TUGA 4P7AA 2EPMX 2L2NA 2HKJA 2PNMA 1OYPA 2L3CA 3VK6A 1KJKA 2Z5CA 2EQ3A 1SR9A 2CPNA 1JK2A 2WP8A 1Z5BA 4OO1D 2UXCE 2GPIA 1RHYA 2EQ1A 4LF6E 4LU9A 1FJGI 3HKMA 4IZKB 1MGTA 1Z1BA 1FKAE 5GMDA 4JI0I 5C0XF 4OO1E 3LNUA 2YSPA 2L6MA 1LLMC 1ZM4A 4DR2E 3VYYA 2C39A 2ODRD 3B82A 2NUEA 3CDJA 1X5WA 2HC5A 4FW3A 4GKKI 1QU6A 3CWVA 2UU9E 2UU9I 4IFDE 3HQ1A 1WHNA 4OOGC 2NN6D 4R8OA 2DIXA 4JI2E 1OJ4A 4FW7A 3QT7A 3FIGA 4LF9I 2BR2B 2LTSA 1E3PA 2EPPA 3H4LA 4DR7E 4R2CA 2WNRA 4B3TE 1KYQA 2DLKA 2JEBA 1IQSA 3PYDA 4OO1C 2EPNA 2CT1A 1WXRA 2V2ZA 2WW4A 2LVHA 4MLVA 5KL4A 2EM6A 4DV7I 3Q6MA 4WSPA 4P78A 2WBUA 3EPJA 4HY1A 1XNRI 2EPZA 2YWQA 4BA1A 4USKA 3P3GA 5A6KA 2BA1G 4X8WA 5DRPA 2PO2B 4R2EA 2IOQA 5FLXQ 1Y4UA 4JI4I 2L92A 2DGCA 4I8OA 5C0XC 4Q35B 2Z5BB 4DR1I 2EQ0A 1L4SA 4LOMA 2PNZA 2YTOA 4U3BA 1X6HA 1A1KA 1XHKA 5AC4A 1ZBQA 1EH7A 1J26A 3B78A 4DPTA 1XMQI 1XMOI 4KQVA 2GHFA 5AE1A 1UDQA 2C37A 3K1JA 2EMBA 5KL5A 1ZM2A 4DR6E 2EL6A 2ELZA 4LFAE 2DEIA 1S16A 2EN1A 1RREA 3WU5A 2YRMA 4JI1I 1DI2A 2FGGA 1B69A 1ZM3A 4JI7E 5KL7A 5LL6R 2EOXA 1G2DC 4BHBA 1RR9A 1HNZI 3J7Yp 2WCC3 1N32E 2L3JA 1UDSA 3EPKA 1Z0EA 3WU6A 4LF8E 4BC7A 2EMXA 4DV7E 4F2JC 1STUA 4LF5I 3M7ND 4IZJD 1KKHA 2X36A 1Z0GA 2N3GA 1N3GA 2M1SA 2C39B 3GMEA 3IWDA 4B3RE 1RMDA 3P3EA 1EI1A 2RS7A 2O1TA 3ZM7A 3M7NG 2IERA 4JYAI 4O43A 4X9JA 1FNMA 1Z0TA 1XMOE 2EFGA 2Q2EB 1H73A 3ZKBA 3VYXA 5DNYA 4DR4I 4K0KI 1YFHA 2EZ6A 2Z5EA 2EOQA 1H7UA 5C0XB 3ECRA 2UUCI 1UHZA 4WPYA 2LBSB 4Q28A 4KHPI 2EM7A 2JP9A 1T4OA 1GQEA 5GMEA 2L8TA 2B7TA 1IBKI 1ZAAC 4LF5E 4M0VA 4DR4E 1ZM9A 4ZYDA 2IOPA 4AM3A 1B62A 4OZEA 2E5LE 2E5LI 1PIEA 1PDAA 3JU0A 1N36I 3ADGA 3C4TA 2AE8A 3P06A 3V5RA 1A1GA 4GEQB 3QT6A 2EMGA 1ZBTA 3D4JA 3P3CA 4DV0I 5ADZA 1F2IG 3DF6A 2JPAA 5L3JA 5BR8I 2DEJA 4P52A 2L33A 2LE2A 3LTOA 4OO1B 2YSOA 5JEAB 4X62I 3K17A 2EOSA 3C6KA 3DD6A 5EL9A 5K36A 2EOIA 4ISAA 2UXBE 2V2QA 2JR1A 2CVEA 4JI8E 3F6GA 1G2FC 1YSAC 2EMAA 2BA0G 2EMIA 2N8XA 5K36D 2EN2A 2AJ4A 3ZOQB 1PKPA 1DGCA 2B7VA 4LFCE 1X49A 4HEIA 4BS9A 3J7AG 2PO0B 4B3SI 4YY3E 2EM3A 3JAMC 1EA6A 1A1JA 2DMYA 2F1DA 2MDGA 2O1UA 5DROA 4R2RA 2PO2A 2HHHI 4WXCA 2YRHA 1XNRE 2WZOA 2LUQA 1N32I 1GTKA 1YUJA 2OI2A 1H74A 1SFEA 1GZ6A 3QG5C 5A6JA 3PS1A 2RSIA 3U1KA 1I94I 1A6FA 2NN6F 2MC6A 2YTIA 5F3WA 5DNLA 4JI3E 5T6JA 5FLXC 3BBGA 2UXDI 4JI2I 1DQ3A 4WUDA
chains in the Genus database with same CATH topology
1IBLE 4GKJI 2UXBI 4BBYA 1IBKE 2NA2A 4FW9A 4P7DA 4WFTA 2V34A 2VQEE 1RQ0A 4JV5E 4UTGA 3IWCA 1Z5CA 1PVGA 3ADIA 1T4LB 4I3HA 4JYAE 3OTOI 4J8ZA 1Z0VA 2LTRA 1MG7A 1NZ0A 4DPXA 2UUAI 2E1MA 4WUBA 1N0UA 2O1VA 1YYWA 2R3VA 1FJGE 2G7HA 4DV1I 2A2CA 4X65E 4JI5I 4YHHI 2ODRC 2VF1A 5LMUE 4F9BB 1FWLA 4DV6I 2R42A 4DV4I 4LF7E 4HXZA 4PRXA 1ELOA 2VQEI 1IBMI 4PRVA 2IHR1 2Z5CB 3F0NA 2JWOA 4HACB 1USVA 4ZVIA 4X66I 2N3HA 4DU7A 2L2MA 3HPSA 4DR1E 2UUBE 4FWGA 4PU9A 4JI3I 5A2QQ 4XTJA 1QZRA 1N33I 4F9AB 4DV4E 4M30A 1XNQI 4DUZE 1K47A 4JI4E 5FWKA 1J5EI 1N0VC 2ZM6I 3GONA 5LMUI 1NHHA 4DV1E 1BKNA 1USUA 3ZZ0A 3ZZTA 1XMQE 4RPFA 3HPZA 1IBME 4YY3I 2A2DA 3QT8A 4JG4A 4DV2E 1Y4SA 4USMA 3AV0A 1ZXNA 1YZ9A 1Z0CA 2MC5A 2RSMA 2PNLA 2LJHA 3OMLA 2B3TB 4JI6E 1Z5AA 2HKEA 4OX9E 4B3MI 4Z7CA 3DJWA 2O1WA 3LLHA 2XEXA 5IT9C 2J7KA 1O0WA 4DR5E 4DR5I 3HTXA 2NPFA 1DARA 1WHQA 1IBLI 4K0KE 3T1YE 2ZM6E 1UILA 1UEKA 3HULA 4L5NC 4DUZI 4GKKE 2GQ0A 2JOBA 3H09A 4DUYE 5AASA 4B3SE 4DV2I 1ZXMA 2BV3A 3J81C 1NHIA 2V88A 1Z0WA 4DR3E 4DV5E 5AE2A 3ADLA 2EWLA 1D6TA 1HNXE 1RC7A 3ZKDA 1H72C 2F4VE 3AUZA 3F6HA 4DU8A 1MX0A 4NXME 1FWKA 2HFSA 2CG9A 3J80C 4R03A 2DSYA 2K4VA 2RTXA 2UUBI 4JI8I 2JOXA 2LJPA 1HR0I 4AQYE 2V8QB 2E1RA 2ZITA 2M7QA 4WYQB 1KIJA 2VF3A 3KWRA 2DB2A 5IWAE 2CZ9A 2VE7C 4KHPE 1Z59A 4LFAI 4M2ZA 2F4VI 2VQFI 2H36X 3HJCA 4DMIA 1VISA 4IZKA 2F8BA 5AE3A 4L8NA 1Y6ZA 3WU4A 5CFFE 1T4NA 2HK2A 3PYEA 4DR3I 3IWBA 1HNWI 4LTYA 5BR8E 2NUFA 2BM0A 2MDRA 3MSWA 4MYUA 5A2QC 2LUPB 5IT9Q 2V8PA 4GKJE 4MYTA 2HK3A 3Q6NA 1WUUA 3T1YI 1HR0E 2GS8A 1EKZA 1J5EE 4JI6I 2X7IA 2FTXB 4BC9A 4JI7I 4DR7I 5LMNI 4JV5I 4F9CB 2CGEA 5IWAI 1KTVA 2L2KB 2UUCE 4M1KA 3PYFA 1HNWE 2KHXA 1H7SA 4NXNI 4X66E 4URLA 1HNXI 2HHHE 4HYMA 2JY9A 3B8HA 4DV5I 1XNQE 4LF4I 2UXDE 1X48A 1N33E 4NXMI 1KVKA 2V85A 2V83A 2Z5BA 3LPSA 1I94E 4F54A 4AQYI 2LRSA 4EMDA 4DV6E 4X62E 3JAMQ 1Z0BA 4JI5E 4DXLA 4X65I 1N34E 4IZJA 4LF9E 4LFCI 3RMPA 1N36E 4FN5A 2KOUA 4Z7YA 3OTOE 4HACA 4DPYA 3PRYA 4DV3I 4X64E 4KZSA 3QT5A 2HFUA 4BCAA 4DKKA 4NXNE 3J80Q 1MU5A 1HK7A 2ZBKB 4JI0E 3PYGA 4DV0E 2UUAE 4LF6I 3J7AM 3HXLA 2M4IA 2YZTA 1B63A 3Q1QA 3K85A 4DR2I 3J81Q 4JI4I 4R1FA 4B3TI 4B3RI 2NUGA 3V2UC 4LFBI 1FI4A 2JVAA 4DPUA 2UXCI 2V87A 4IZJB 4WUCA 4LF8I 4B3ME 2KONA 4OX9I 1NHJA 4DPWA 3K6QA 1HNZE 2BM1A 4X64I 4DV3E 2FV4B 2YT4A 4TUIA 1U2RA 3JTZA 2VQFE 4JI1E 4ED4A 3M6AA 3P1XA 3T1HI 3T1HE 2V89A 1X47A 3WU3A 3ADJA 1YYKA 4UT4A 4YHHE 1S4EA 2B9DA 4BMJA 3ZZUA 2RS6A 4DUYI 3C4BA 2V2VA 4LFBE 4FWHA 1YYOA 4LF7I 2LMZA 5LMNE 4LF4E 3LMLA 1N34I 2V86A 4FWDA 4N3OA 4DR6I 4TUGA 4P7AA 2L2NA 2HKJA 2PNMA 2L3CA 3VK6A 2Z5CA 1SR9A 2CPNA 1Z5BA 2UXCE 4LF6E 1FJGI 4LU9A 4IZKB 1FKAE 5GMDA 4JI0I 3LNUA 2L6MA 1ZM4A 4DR2E 3VYYA 2ODRD 3B82A 2NUEA 4GKKI 1QU6A 3CWVA 2UU9E 2UU9I 3HQ1A 1WHNA 4OOGC 4R8OA 2DIXA 4JI2E 1OJ4A 3QT7A 3FIGA 4LF9I 2LTSA 3H4LA 4DR7E 4B3TE 3PYDA 1WXRA 2WW4A 4DV7I 2V2ZA 3Q6MA 4WSPA 4P78A 1XNRI 4HY1A 4USKA 4X8WA 5FLXQ 2IOQA 1Y4UA 2L92A 4I8OA 2Z5BB 4DR1I 1XHKA 3B78A 4DPTA 1XMQI 1ZBQA 1J26A 1XMOI 4KQVA 5AE1A 3K1JA 1ZM2A 4DR6E 2DEIA 4LFAE 1S16A 1RREA 3WU5A 4JI1I 1DI2A 2FGGA 1ZM3A 4JI7E 5LL6R 1RR9A 1HNZI 3J7Yp 1N32E 2L3JA 3WU6A 1Z0EA 4LF8E 4BC7A 4DV7E 1STUA 4LF5I 4IZJD 1KKHA 2X36A 1Z0GA 2N3GA 2M1SA 3IWDA 4B3RE 3ZM7A 1EI1A 2RS7A 2O1TA 4JYAI 1FNMA 1Z0TA 1XMOE 2EFGA 2Q2EB 1H73A 3ZKBA 3VYXA 5DNYA 4DR4I 4K0KI 2EZ6A 2Z5EA 1H7UA 2UUCI 1UHZA 4WPYA 2LBSB 4Q28A 4KHPI 1T4OA 1GQEA 5GMEA 2L8TA 2B7TA 1IBKI 4LF5E 4M0VA 4DR4E 1ZM9A 2IOPA 1B62A 2E5LE 2E5LI 1PIEA 3JU0A 1N36I 3ADGA 3C4TA 3P06A 3V5RA 4GEQB 3QT6A 1ZBTA 3D4JA 4DV0I 5ADZA 3DF6A 5L3JA 5BR8I 2DEJA 4P52A 2L33A 2LE2A 3LTOA 4X62I 3K17A 2UXBE 2V2QA 2JR1A 4JI8E 3F6GA 2AJ4A 3ZOQB 1PKPA 2B7VA 4LFCE 1X49A 4BS9A 3J7AG 4B3SI 4YY3E 3JAMC 1EA6A 2DMYA 2O1UA 2HHHI 1XNRE 2WZOA 2LUQA 1N32I 2OI2A 1H74A 1GZ6A 1I94I 1A6FA 2MC6A 5F3WA 4JI3E 5T6JA 5FLXC 2UXDI 4JI2I 1DQ3A 4WUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL E;  4GKJ I;  2UXB I;  1IBK E;  2NA2 A;  4FW9 A;  4WFT A;  2V34 A;  2VQE E;  1RQ0 A;  4JV5 E;  4UTG A;  1Z5C A;  1PVG A;  3ADI A;  1T4L B;  4I3H A;  4JYA E;  3OTO I;  1Z0V A;  2LTR A;  1MG7 A;  1NZ0 A;  4DPX A;  2UUA I;  4WUB A;  1N0U A;  1YYW A;  2R3V A;  1FJG E;  4DV1 I;  2A2C A;  4X65 E;  4JI5 I;  4YHH I;  5LMU E;  1FWL A;  4DV6 I;  2R42 A;  4DV4 I;  4LF7 E;  4HXZ A;  4PRX A;  1ELO A;  2VQE I;  1IBM I;  4PRV A;  2IHR 1;  3F0N A;  4HAC B;  4ZVI A;  4X66 I;  2N3H A;  4DU7 A;  2L2M A;  4DR1 E;  2UUB E;  4FWG A;  4PU9 A;  4JI3 I;  5A2Q Q;  4XTJ A;  1QZR A;  1N33 I;  4DV4 E;  1XNQ I;  4M30 A;  4DUZ E;  1K47 A;  4JI4 E;  1J5E I;  1N0V C;  2ZM6 I;  3GON A;  5LMU I;  1NHH A;  4DV1 E;  1BKN A;  3ZZ0 A;  3ZZT A;  1XMQ E;  4RPF A;  1IBM E;  4YY3 I;  2A2D A;  3QT8 A;  4JG4 A;  4DV2 E;  4USM A;  1ZXN A;  1YZ9 A;  1Z0C A;  2RSM A;  2LJH A;  2B3T B;  4JI6 E;  2HKE A;  1Z5A A;  4OX9 E;  4B3M I;  4Z7C A;  3LLH A;  2XEX A;  5IT9 C;  2J7K A;  1O0W A;  4DR5 E;  4DR5 I;  3HTX A;  2NPF A;  1DAR A;  1WHQ A;  1IBL I;  4K0K E;  3T1Y E;  2ZM6 E;  1UIL A;  1UEK A;  3HUL A;  4DUZ I;  4GKK E;  4DUY E;  4B3S E;  4DV2 I;  1ZXM A;  2BV3 A;  1NHI A;  3J81 C;  1Z0W A;  4DR3 E;  4DV5 E;  3ADL A;  1D6T A;  1HNX E;  1RC7 A;  3ZKD A;  1H72 C;  2F4V E;  4DU8 A;  1MX0 A;  4NXM E;  1FWK A;  2HFS A;  3J80 C;  2RTX A;  2UUB I;  4JI8 I;  2LJP A;  1HR0 I;  4AQY E;  2E1R A;  2ZIT A;  4WYQ B;  1KIJ A;  2VF3 A;  2DB2 A;  5IWA E;  2CZ9 A;  4KHP E;  1Z59 A;  4LFA I;  4M2Z A;  2F4V I;  2VQF I;  1VIS A;  3WU4 A;  5CFF E;  1T4N A;  2HK2 A;  3PYE A;  4DR3 I;  1HNW I;  5BR8 E;  2NUF A;  2BM0 A;  2MDR A;  4MYU A;  5IT9 Q;  5A2Q C;  2LUP B;  2V8P A;  4GKJ E;  4MYT A;  2HK3 A;  1WUU A;  3T1Y I;  1HR0 E;  2GS8 A;  1EKZ A;  1J5E E;  4JI6 I;  2X7I A;  4JI7 I;  4DR7 I;  5LMN I;  4JV5 I;  5IWA I;  1KTV A;  2L2K B;  2UUC E;  4M1K A;  3PYF A;  1HNW E;  2KHX A;  1H7S A;  4NXN I;  4X66 E;  4URL A;  1HNX I;  2HHH E;  4HYM A;  2JY9 A;  3B8H A;  4DV5 I;  1XNQ E;  4LF4 I;  2UXD E;  1X48 A;  1N33 E;  4NXM I;  1KVK A;  3LPS A;  1I94 E;  4AQY I;  2LRS A;  4EMD A;  4DV6 E;  4X62 E;  3JAM Q;  1Z0B A;  4JI5 E;  4DXL A;  4X65 I;  1N34 E;  4LF9 E;  4LFC I;  1N36 E;  4FN5 A;  4Z7Y A;  3OTO E;  4HAC A;  4DPY A;  4DV3 I;  4X64 E;  3QT5 A;  2HFU A;  4DKK A;  4NXN E;  3J80 Q;  1MU5 A;  2ZBK B;  4JI0 E;  3PYG A;  4DV0 E;  2UUA E;  4LF6 I;  3J7A M;  1B63 A;  3Q1Q A;  4JI4 I;  4DR2 I;  3J81 Q;  4R1F A;  4B3T I;  4B3R I;  2NUG A;  3V2U C;  4LFB I;  1FI4 A;  2JVA A;  4DPU A;  2UXC I;  4WUC A;  4LF8 I;  4B3M E;  4OX9 I;  1NHJ A;  4DPW A;  1HNZ E;  2BM1 A;  4X64 I;  4DV3 E;  2YT4 A;  1U2R A;  2VQF E;  4JI1 E;  4ED4 A;  3M6A A;  3P1X A;  3T1H I;  3T1H E;  1X47 A;  3WU3 A;  3ADJ A;  1YYK A;  4UT4 A;  4YHH E;  1S4E A;  3ZZU A;  2RS6 A;  4DUY I;  3C4B A;  2V2V A;  4LFB E;  4FWH A;  1YYO A;  4LF7 I;  5LMN E;  4LF4 E;  1N34 I;  4FWD A;  4DR6 I;  4P7A A;  2L2N A;  2HKJ A;  2L3C A;  2CPN A;  1Z5B A;  2UXC E;  4LF6 E;  1FJG I;  1FKA E;  5GMD A;  4JI0 I;  3LNU A;  1ZM4 A;  4DR2 E;  3VYY A;  3B82 A;  2NUE A;  4GKK I;  1QU6 A;  3CWV A;  2UU9 E;  2UU9 I;  1WHN A;  4OOG C;  2DIX A;  4JI2 E;  1OJ4 A;  3QT7 A;  4LF9 I;  2LTS A;  3H4L A;  4DR7 E;  4B3T E;  3PYD A;  2WW4 A;  4DV7 I;  2V2Z A;  1XNR I;  4HY1 A;  4USK A;  4X8W A;  5FLX Q;  4DR1 I;  1XHK A;  3B78 A;  4DPT A;  1XMQ I;  1J26 A;  1XMO I;  4KQV A;  3K1J A;  1ZM2 A;  4DR6 E;  2DEI A;  4LFA E;  1S16 A;  1RRE A;  3WU5 A;  4JI1 I;  1DI2 A;  1ZM3 A;  4JI7 E;  5LL6 R;  1RR9 A;  1HNZ I;  3J7Y p;  1N32 E;  2L3J A;  3WU6 A;  1Z0E A;  4LF8 E;  4DV7 E;  1STU A;  4LF5 I;  1KKH A;  2X36 A;  1Z0G A;  2N3G A;  4B3R E;  3ZM7 A;  1EI1 A;  2RS7 A;  4JYA I;  1FNM A;  1Z0T A;  1XMO E;  2EFG A;  2Q2E B;  1H73 A;  3ZKB A;  3VYX A;  4DR4 I;  4K0K I;  2EZ6 A;  1H7U A;  2UUC I;  1UHZ A;  2LBS B;  4KHP I;  1T4O A;  1GQE A;  5GME A;  2B7T A;  1IBK I;  4LF5 E;  4DR4 E;  1ZM9 A;  1B62 A;  2E5L E;  2E5L I;  1PIE A;  1N36 I;  3ADG A;  3C4T A;  3V5R A;  3QT6 A;  1ZBT A;  3D4J A;  4DV0 I;  5L3J A;  5BR8 I;  4P52 A;  2DEJ A;  2L33 A;  3LTO A;  4X62 I;  3K17 A;  2UXB E;  2V2Q A;  4JI8 E;  2AJ4 A;  1PKP A;  2B7V A;  4LFC E;  1X49 A;  3J7A G;  4B3S I;  4YY3 E;  1EA6 A;  3JAM C;  2DMY A;  2HHH I;  1XNR E;  1N32 I;  2LUQ A;  2OI2 A;  1H74 A;  1I94 I;  1A6F A;  4JI3 E;  5FLX C;  2UXD I;  4JI2 I;  4WUD A; 
#chains in the Genus database with same CATH topology
 5A69 A;  2YPN A;  4ZYG A;  4O4K A;  4QNK A;  1IBL E;  4GKJ I;  2UXB I;  4IS1 C;  2EMY A;  4BBY A;  1IBK E;  2NA2 A;  2PO0 A;  4FW9 A;  4IS9 A;  2WBT A;  4N4R B;  1AAY A;  5K36 E;  4P7D A;  4WFT A;  2V34 A;  3PS2 A;  2VQE E;  1RQ0 A;  4JV5 E;  4UTG A;  3IWC A;  2IES A;  4OO1 F;  1Z5C A;  1PVG A;  2EOH A;  2K7I A;  1T4L B;  3ADI A;  1Y5Y A;  4I3H A;  1IMU A;  4JYA E;  3OTO I;  4J8Z A;  1Z0V A;  4BA2 A;  2LTR A;  1MG7 A;  1NZ0 A;  4DPX A;  2VES A;  1A1L A;  2UUA I;  2E1M A;  4WUB A;  1N0U A;  2O1V A;  2DMI A;  1YYW A;  2R3V A;  1MEY C;  1FJG E;  5EKW A;  2G7H A;  4DV1 I;  2A2C A;  4MU3 A;  4X65 E;  4JI5 I;  1X6F A;  4YHH I;  2ODR C;  2VF1 A;  5LMU E;  4F9B B;  3C6M A;  1FWL A;  4DV6 I;  1YUI A;  4IFD B;  2R42 A;  4DV4 I;  2JXP A;  4LF7 E;  4R2A A;  4HXZ A;  4PRX A;  1ELO A;  3KZY A;  2VQE I;  2WBS A;  1IBM I;  2NN6 A;  3NZK A;  4U3D A;  5KL2 A;  4PRV A;  2IHR 1;  2EJ4 A;  1YPN A;  2Z5C B;  3F0N A;  2JWO A;  3B4T A;  4HAC B;  4R2S A;  2O3Z A;  1USV A;  4ZVI A;  1X6E A;  4BA1 B;  2N3H A;  2YU5 A;  1WJP A;  3EPL A;  4DU7 A;  2L2M A;  4X66 I;  2LO3 A;  3HPS A;  4DR1 E;  2M9A A;  2UUB E;  4FWG A;  4PU9 A;  2YU8 A;  4JI3 I;  5A2Q Q;  2EM4 A;  4F6N A;  2MKD A;  1QZR A;  4XTJ A;  2EN4 A;  2YTQ A;  1N33 I;  4F9A B;  4DV4 E;  4M30 A;  1XNQ I;  4DUZ E;  2EPA A;  1K47 A;  4IJD A;  4JI4 E;  5FWK A;  3L7Z B;  1J5E I;  1N0V C;  2ZM6 I;  2GLI A;  3GON A;  5JEA E;  4MU4 A;  5LMU I;  3H1C A;  1E3H A;  1NHH A;  4DV1 E;  1BKN A;  1USU A;  3ZZ0 A;  3ZZT A;  1BBG A;  1XMQ E;  4RPF A;  2RQL A;  3HPZ A;  3VHT B;  5JEA D;  1IBM E;  2EMW A;  4YY3 I;  5DRR A;  2A2D A;  3QT8 A;  4NZV A;  5AC5 A;  4DV2 E;  1Y4S A;  4JG4 A;  1NEI A;  4USM A;  2PO1 B;  3AV0 A;  1ZXN A;  2YTD A;  1YZ9 A;  2MC5 A;  2RSM A;  1Z0C A;  2PNL A;  3OML A;  2LJH A;  2B3T B;  4JI6 E;  1Z5A A;  2HKE A;  1IQO A;  1XXE A;  3L00 A;  2D9H A;  4OX9 E;  1A1I A;  4B3M I;  2MKN A;  2EM8 A;  4Z7C A;  3UHM A;  3DJW A;  2O1W A;  2WP8 B;  4NBQ A;  3GCM A;  5ELW A;  3LLH A;  3EPH A;  5IT9 C;  2J7K A;  2XEX A;  2I13 A;  1O0W A;  2ENC A;  4DR5 E;  4DR5 I;  3Q1Q A;  4IFD A;  4BA2 B;  3HTX A;  2NPF A;  4RH8 A;  2BA0 D;  1DAR A;  1WHQ A;  2YTG A;  3THN A;  1IBL I;  4K0K E;  3T1Y E;  2EP3 A;  2EOJ A;  1UIL A;  2R1F A;  2ZM6 E;  1UEK A;  1P47 A;  3HUL A;  4L5N C;  1JK1 A;  2YTP A;  4DUZ I;  4GKK E;  1OYS A;  2E72 A;  4R2P A;  2GQ0 A;  2JEA B;  1TN9 A;  4WSG A;  2BB8 A;  2JOB A;  3H09 A;  2PRT A;  4FW6 A;  4DUY E;  5AAS A;  4B3S E;  5C0X A;  4DV2 I;  5DRQ A;  1ZXM A;  2BV3 A;  2EM2 A;  5TSE A;  3J81 C;  1NHI A;  2V88 A;  2BA1 D;  2NN6 B;  5JEA C;  2J7J A;  4DR3 E;  4DV5 E;  5AE2 A;  1Z0W A;  3THO B;  3ADL A;  2EWL A;  2CSH A;  1D6T A;  3UK3 C;  1HNX E;  1RC7 A;  5IXM B;  3ZKD A;  3CDI A;  4R2Q A;  1H72 C;  2F4V E;  3AUZ A;  3F6H A;  2ENA A;  4DU8 A;  1MX0 A;  2DRP A;  2DLQ A;  4NXM E;  1FWK A;  2CG9 A;  2HFS A;  1X3C A;  2EPC A;  3J80 C;  4R03 A;  2DSY A;  2K4V A;  2RTX A;  4WXD A;  2UUB I;  4JI8 I;  5C0X D;  2EOE A;  3KRN A;  2JOX A;  2LJP A;  2EE8 A;  1HR0 I;  4MDT A;  5K36 F;  4AQY E;  2V8Q B;  2E1R A;  5A6B D;  2EN3 A;  4FK5 C;  1UBD C;  1R6L A;  2ZIT A;  2M7Q A;  4WYQ B;  4ZYH A;  1KIJ A;  2VF3 A;  3KWR A;  2DB2 A;  4GZN C;  5IWA E;  2EPK X;  2HGH A;  2CZ9 A;  2VE7 C;  2YTN A;  4KHP E;  1Z59 A;  4M2Z A;  4LFA I;  2C37 B;  4IFD D;  2F4V I;  2PO1 A;  1TF3 A;  2JT2 A;  2VQF I;  2H36 X;  3HJC A;  2GO3 A;  5DNX A;  4WX9 A;  2EN6 A;  4DMI A;  1VIS A;  4IZK A;  2F8B A;  5AE3 A;  4L8N A;  1Y6Z A;  3WU4 A;  1QNT A;  5CFF E;  1T4N A;  2GO4 A;  2HK2 A;  1A1H A;  3PYE A;  4DR3 I;  3IWB A;  1HNW I;  3M99 B;  4LTY A;  5BR8 E;  2EOO A;  3L7Z A;  2NUF A;  2EL4 A;  2BM0 A;  2MDR A;  3MSW A;  4MYU A;  5A2Q C;  2LUP B;  4GQU A;  5IT9 Q;  1ZR9 A;  2EMH A;  5K36 B;  2RPC A;  2R76 A;  2V8P A;  4GKJ E;  4MYT A;  2HK3 A;  3Q6N A;  5JEA A;  1WUU A;  3T1Y I;  1HR0 E;  2GS8 A;  1EKZ A;  2EMZ A;  1J5E E;  4JI6 I;  2X7I A;  1OYR A;  3MHS C;  1UN6 B;  2FTX B;  4BC9 A;  4JI7 I;  4DR7 I;  5LMN I;  4JV5 I;  4F9C B;  5IV8 B;  2CGE A;  5IWA I;  2EMK A;  3EQ1 A;  1KTV A;  2L2K B;  2UUC E;  4M1K A;  3PYF A;  4OKG A;  2YTF A;  1PJT A;  1HNW E;  3BGH A;  2KHX A;  1BB8 A;  4FW5 A;  1H7S A;  4KWY A;  2EPO A;  4X66 E;  4NXN I;  4URL A;  1HNX I;  2HHH E;  4HYM A;  2JY9 A;  3B8H A;  4LPF A;  4DV5 I;  4F6M A;  2JE6 A;  2JYA A;  2I9I A;  1XNQ E;  4LF4 I;  2LJU A;  2UXD E;  1ZU1 A;  2EOY A;  1X48 A;  1N33 E;  4NXM I;  1KVK A;  2LT7 A;  2V85 A;  2V83 A;  2J65 A;  2Z5B A;  3LPS A;  5KL6 A;  4OO1 A;  5JEA F;  2YRK A;  1I94 E;  2YTJ A;  5KL3 A;  4J3D A;  4F54 A;  2EL5 A;  4AQY I;  2LRS A;  2EPU A;  4EMD A;  4DV6 E;  4X62 E;  2LV2 A;  3BID A;  3JAM Q;  1Z0B A;  4JI5 E;  4DXL A;  4X65 I;  1N34 E;  1TF6 A;  4O5G A;  2C38 B;  3MHH C;  4IZJ A;  3TQM A;  2EML A;  1P42 A;  4LCH A;  4R2D A;  4LF9 E;  4MU0 A;  1UDN A;  1T39 A;  2EM5 A;  5A6B A;  4LFC I;  4MLQ A;  3RMP A;  1N36 E;  1R6M A;  4FN5 A;  2KOU A;  4IFD C;  2EMF A;  4Z7Y A;  3OTO E;  4HAC A;  4DPY A;  3PRY A;  4M9V C;  4DV3 I;  4X64 E;  4BHC A;  2EN7 A;  2EPR A;  4KZS A;  2YTE A;  3QT5 A;  4AIM A;  2HFU A;  4BCA A;  4DKK A;  4NXN E;  3J80 Q;  1WRJ A;  2JE6 B;  2LCE A;  2HJJ A;  1MU5 A;  1HK7 A;  2BBG A;  2ZBK B;  4JI0 E;  2EM9 A;  3PYG A;  2ADR A;  2ENH A;  3BF2 A;  4DV0 E;  1EH6 A;  2UUA E;  4LF6 I;  3J7A M;  3HXL A;  2EOF A;  1EH8 A;  2EMC A;  2M4I A;  2YZT A;  4O24 A;  2EPX A;  1BBO A;  1B63 A;  4MU1 A;  2VRD A;  3P76 A;  4AID A;  4HTG A;  2EOR A;  2EN8 A;  1YH8 A;  3K85 A;  4R1F A;  1YHC A;  3PS3 A;  2NUG A;  2BR2 A;  3U1Y A;  3J81 Q;  3V2U C;  4B3T I;  4B3R I;  3KZZ A;  2EM0 A;  4FW4 A;  2JEA A;  4LFB I;  1FI4 A;  5A6A A;  2ELY A;  2JVA A;  4DPU A;  5C0X E;  2UXC I;  2V87 A;  4IZJ B;  4WUC A;  4LF8 I;  2A25 A;  4B3M E;  2KON A;  4OX9 I;  5K36 C;  1NHJ A;  2JEB B;  4LCG A;  4DPW A;  3K6Q A;  1HNZ E;  2BM1 A;  4X64 I;  4DV3 E;  2FV4 B;  4NHR A;  2YT4 A;  4TUI A;  1U2R A;  1PJQ A;  2NAB A;  3JTZ A;  2VQF E;  4JI1 E;  4ED4 A;  4ZYE A;  3M6A A;  3P1X A;  4DR2 I;  4RHB B;  3T1H I;  3T1H E;  2V89 A;  3M85 G;  1X47 A;  2PNZ B;  3WU3 A;  1Y60 A;  2NN6 C;  3ADJ A;  4LCF A;  1VI7 A;  1YYK A;  2Q8U A;  4IFD F;  3M85 D;  4UT4 A;  1NCS A;  4YHH E;  2NN6 E;  3GLL A;  1S4E A;  2B9D A;  1T38 A;  4QNJ A;  4BMJ A;  1A1F A;  2CTD A;  2EPL X;  2RS6 A;  3ZZU A;  1UDO A;  4DUY I;  3C4B A;  2C38 A;  2V2V A;  5LLQ A;  4LFB E;  4FWH A;  1YYO A;  4LF7 I;  2EOZ A;  1PJS A;  2WNR B;  2LMZ A;  5LMN E;  2EOM A;  4LF4 E;  3LML A;  4MQY A;  1N34 I;  2V86 A;  1AH5 A;  4FWD A;  4N3O A;  4DR6 I;  4TUG A;  4P7A A;  2EPM X;  2L2N A;  2HKJ A;  2PNM A;  1OYP A;  2L3C A;  3VK6 A;  1KJK A;  2Z5C A;  2EQ3 A;  1SR9 A;  2CPN A;  1JK2 A;  2WP8 A;  1Z5B A;  4OO1 D;  2UXC E;  2GPI A;  1RHY A;  2EQ1 A;  4LF6 E;  4LU9 A;  1FJG I;  3HKM A;  4IZK B;  1MGT A;  1Z1B A;  1FKA E;  5GMD A;  4JI0 I;  5C0X F;  4OO1 E;  3LNU A;  2YSP A;  2L6M A;  1LLM C;  1ZM4 A;  4DR2 E;  3VYY A;  2C39 A;  2ODR D;  3B82 A;  2NUE A;  3CDJ A;  1X5W A;  2HC5 A;  4FW3 A;  4GKK I;  1QU6 A;  3CWV A;  2UU9 E;  2UU9 I;  4IFD E;  3HQ1 A;  1WHN A;  4OOG C;  2NN6 D;  4R8O A;  2DIX A;  4JI2 E;  1OJ4 A;  4FW7 A;  3QT7 A;  3FIG A;  4LF9 I;  2BR2 B;  2LTS A;  1E3P A;  2EPP A;  3H4L A;  4DR7 E;  4R2C A;  2WNR A;  4B3T E;  1KYQ A;  2DLK A;  2JEB A;  1IQS A;  3PYD A;  4OO1 C;  2EPN A;  2CT1 A;  1WXR A;  2V2Z A;  2WW4 A;  2LVH A;  4MLV A;  5KL4 A;  2EM6 A;  4DV7 I;  3Q6M A;  4WSP A;  4P78 A;  2WBU A;  3EPJ A;  4HY1 A;  1XNR I;  2EPZ A;  2YWQ A;  4BA1 A;  4USK A;  3P3G A;  5A6K A;  2BA1 G;  4X8W A;  5DRP A;  2PO2 B;  4R2E A;  2IOQ A;  5FLX Q;  1Y4U A;  4JI4 I;  2L92 A;  2DGC A;  4I8O A;  5C0X C;  4Q35 B;  2Z5B B;  4DR1 I;  2EQ0 A;  1L4S A;  4LOM A;  2PNZ A;  2YTO A;  4U3B A;  1X6H A;  1A1K A;  1XHK A;  5AC4 A;  1ZBQ A;  1EH7 A;  1J26 A;  3B78 A;  4DPT A;  1XMQ I;  1XMO I;  4KQV A;  2GHF A;  5AE1 A;  1UDQ A;  2C37 A;  3K1J A;  2EMB A;  5KL5 A;  1ZM2 A;  4DR6 E;  2EL6 A;  2ELZ A;  4LFA E;  2DEI A;  1S16 A;  2EN1 A;  1RRE A;  3WU5 A;  2YRM A;  4JI1 I;  1DI2 A;  2FGG A;  1B69 A;  1ZM3 A;  4JI7 E;  5KL7 A;  5LL6 R;  2EOX A;  1G2D C;  4BHB A;  1RR9 A;  1HNZ I;  3J7Y p;  2WCC 3;  1N32 E;  2L3J A;  1UDS A;  3EPK A;  1Z0E A;  3WU6 A;  4LF8 E;  4BC7 A;  2EMX A;  4DV7 E;  4F2J C;  1STU A;  4LF5 I;  3M7N D;  4IZJ D;  1KKH A;  2X36 A;  1Z0G A;  2N3G A;  1N3G A;  2M1S A;  2C39 B;  3GME A;  3IWD A;  4B3R E;  1RMD A;  3P3E A;  1EI1 A;  2RS7 A;  2O1T A;  3ZM7 A;  3M7N G;  2IER A;  4JYA I;  4O43 A;  4X9J A;  1FNM A;  1Z0T A;  1XMO E;  2EFG A;  2Q2E B;  1H73 A;  3ZKB A;  3VYX A;  5DNY A;  4DR4 I;  4K0K I;  1YFH A;  2EZ6 A;  2Z5E A;  2EOQ A;  1H7U A;  5C0X B;  3ECR A;  2UUC I;  1UHZ A;  4WPY A;  2LBS B;  4Q28 A;  4KHP I;  2EM7 A;  2JP9 A;  1T4O A;  1GQE A;  5GME A;  2L8T A;  2B7T A;  1IBK I;  1ZAA C;  4LF5 E;  4M0V A;  4DR4 E;  1ZM9 A;  4ZYD A;  2IOP A;  4AM3 A;  1B62 A;  4OZE A;  2E5L E;  2E5L I;  1PIE A;  1PDA A;  3JU0 A;  1N36 I;  3ADG A;  3C4T A;  2AE8 A;  3P06 A;  3V5R A;  1A1G A;  4GEQ B;  3QT6 A;  2EMG A;  1ZBT A;  3D4J A;  3P3C A;  4DV0 I;  5ADZ A;  1F2I G;  3DF6 A;  2JPA A;  5L3J A;  5BR8 I;  2DEJ A;  4P52 A;  2L33 A;  2LE2 A;  3LTO A;  4OO1 B;  2YSO A;  5JEA B;  4X62 I;  3K17 A;  2EOS A;  3C6K A;  3DD6 A;  5EL9 A;  5K36 A;  2EOI A;  4ISA A;  2UXB E;  2V2Q A;  2JR1 A;  2CVE A;  4JI8 E;  3F6G A;  1G2F C;  1YSA C;  2EMA A;  2BA0 G;  2EMI A;  2N8X A;  5K36 D;  2EN2 A;  2AJ4 A;  3ZOQ B;  1PKP A;  1DGC A;  2B7V A;  4LFC E;  1X49 A;  4HEI A;  4BS9 A;  3J7A G;  2PO0 B;  4B3S I;  4YY3 E;  2EM3 A;  3JAM C;  1EA6 A;  1A1J A;  2DMY A;  2F1D A;  2MDG A;  2O1U A;  5DRO A;  4R2R A;  2PO2 A;  2HHH I;  4WXC A;  2YRH A;  1XNR E;  2WZO A;  2LUQ A;  1N32 I;  1GTK A;  1YUJ A;  2OI2 A;  1H74 A;  1SFE A;  1GZ6 A;  3QG5 C;  5A6J A;  3PS1 A;  2RSI A;  3U1K A;  1I94 I;  1A6F A;  2NN6 F;  2MC6 A;  2YTI A;  5F3W A;  5DNL A;  4JI3 E;  5T6J A;  5FLX C;  3BBG A;  2UXD I;  4JI2 I;  1DQ3 A;  4WUD A; 
#chains in the Genus database with same CATH homology
 1IBL E;  4GKJ I;  2UXB I;  4BBY A;  1IBK E;  2NA2 A;  4FW9 A;  4P7D A;  4WFT A;  2V34 A;  2VQE E;  1RQ0 A;  4JV5 E;  4UTG A;  3IWC A;  1Z5C A;  1PVG A;  3ADI A;  1T4L B;  4I3H A;  4JYA E;  3OTO I;  4J8Z A;  1Z0V A;  2LTR A;  1MG7 A;  1NZ0 A;  4DPX A;  2UUA I;  2E1M A;  4WUB A;  1N0U A;  2O1V A;  1YYW A;  2R3V A;  1FJG E;  2G7H A;  4DV1 I;  2A2C A;  4X65 E;  4JI5 I;  4YHH I;  2ODR C;  2VF1 A;  5LMU E;  4F9B B;  1FWL A;  4DV6 I;  2R42 A;  4DV4 I;  4LF7 E;  4HXZ A;  4PRX A;  1ELO A;  2VQE I;  1IBM I;  4PRV A;  2IHR 1;  2Z5C B;  3F0N A;  2JWO A;  4HAC B;  1USV A;  4ZVI A;  4X66 I;  2N3H A;  4DU7 A;  2L2M A;  3HPS A;  4DR1 E;  2UUB E;  4FWG A;  4PU9 A;  4JI3 I;  5A2Q Q;  4XTJ A;  1QZR A;  1N33 I;  4F9A B;  4DV4 E;  4M30 A;  1XNQ I;  4DUZ E;  1K47 A;  4JI4 E;  5FWK A;  1J5E I;  1N0V C;  2ZM6 I;  3GON A;  5LMU I;  1NHH A;  4DV1 E;  1BKN A;  1USU A;  3ZZ0 A;  3ZZT A;  1XMQ E;  4RPF A;  3HPZ A;  1IBM E;  4YY3 I;  2A2D A;  3QT8 A;  4JG4 A;  4DV2 E;  1Y4S A;  4USM A;  3AV0 A;  1ZXN A;  1YZ9 A;  1Z0C A;  2MC5 A;  2RSM A;  2PNL A;  2LJH A;  3OML A;  2B3T B;  4JI6 E;  1Z5A A;  2HKE A;  4OX9 E;  4B3M I;  4Z7C A;  3DJW A;  2O1W A;  3LLH A;  2XEX A;  5IT9 C;  2J7K A;  1O0W A;  4DR5 E;  4DR5 I;  3HTX A;  2NPF A;  1DAR A;  1WHQ A;  1IBL I;  4K0K E;  3T1Y E;  2ZM6 E;  1UIL A;  1UEK A;  3HUL A;  4L5N C;  4DUZ I;  4GKK E;  2GQ0 A;  2JOB A;  3H09 A;  4DUY E;  5AAS A;  4B3S E;  4DV2 I;  1ZXM A;  2BV3 A;  3J81 C;  1NHI A;  2V88 A;  1Z0W A;  4DR3 E;  4DV5 E;  5AE2 A;  3ADL A;  2EWL A;  1D6T A;  1HNX E;  1RC7 A;  3ZKD A;  1H72 C;  2F4V E;  3AUZ A;  3F6H A;  4DU8 A;  1MX0 A;  4NXM E;  1FWK A;  2HFS A;  2CG9 A;  3J80 C;  4R03 A;  2DSY A;  2K4V A;  2RTX A;  2UUB I;  4JI8 I;  2JOX A;  2LJP A;  1HR0 I;  4AQY E;  2V8Q B;  2E1R A;  2ZIT A;  2M7Q A;  4WYQ B;  1KIJ A;  2VF3 A;  3KWR A;  2DB2 A;  5IWA E;  2CZ9 A;  2VE7 C;  4KHP E;  1Z59 A;  4LFA I;  4M2Z A;  2F4V I;  2VQF I;  2H36 X;  3HJC A;  4DMI A;  1VIS A;  4IZK A;  2F8B A;  5AE3 A;  4L8N A;  1Y6Z A;  3WU4 A;  5CFF E;  1T4N A;  2HK2 A;  3PYE A;  4DR3 I;  3IWB A;  1HNW I;  4LTY A;  5BR8 E;  2NUF A;  2BM0 A;  2MDR A;  3MSW A;  4MYU A;  5A2Q C;  2LUP B;  5IT9 Q;  2V8P A;  4GKJ E;  4MYT A;  2HK3 A;  3Q6N A;  1WUU A;  3T1Y I;  1HR0 E;  2GS8 A;  1EKZ A;  1J5E E;  4JI6 I;  2X7I A;  2FTX B;  4BC9 A;  4JI7 I;  4DR7 I;  5LMN I;  4JV5 I;  4F9C B;  2CGE A;  5IWA I;  1KTV A;  2L2K B;  2UUC E;  4M1K A;  3PYF A;  1HNW E;  2KHX A;  1H7S A;  4NXN I;  4X66 E;  4URL A;  1HNX I;  2HHH E;  4HYM A;  2JY9 A;  3B8H A;  4DV5 I;  1XNQ E;  4LF4 I;  2UXD E;  1X48 A;  1N33 E;  4NXM I;  1KVK A;  2V85 A;  2V83 A;  2Z5B A;  3LPS A;  1I94 E;  4F54 A;  4AQY I;  2LRS A;  4EMD A;  4DV6 E;  4X62 E;  3JAM Q;  1Z0B A;  4JI5 E;  4DXL A;  4X65 I;  1N34 E;  4IZJ A;  4LF9 E;  4LFC I;  3RMP A;  1N36 E;  4FN5 A;  2KOU A;  4Z7Y A;  3OTO E;  4HAC A;  4DPY A;  3PRY A;  4DV3 I;  4X64 E;  4KZS A;  3QT5 A;  2HFU A;  4BCA A;  4DKK A;  4NXN E;  3J80 Q;  1MU5 A;  1HK7 A;  2ZBK B;  4JI0 E;  3PYG A;  4DV0 E;  2UUA E;  4LF6 I;  3J7A M;  3HXL A;  2M4I A;  2YZT A;  1B63 A;  3Q1Q A;  3K85 A;  4DR2 I;  3J81 Q;  4JI4 I;  4R1F A;  4B3T I;  4B3R I;  2NUG A;  3V2U C;  4LFB I;  1FI4 A;  2JVA A;  4DPU A;  2UXC I;  2V87 A;  4IZJ B;  4WUC A;  4LF8 I;  4B3M E;  2KON A;  4OX9 I;  1NHJ A;  4DPW A;  3K6Q A;  1HNZ E;  2BM1 A;  4X64 I;  4DV3 E;  2FV4 B;  2YT4 A;  4TUI A;  1U2R A;  3JTZ A;  2VQF E;  4JI1 E;  4ED4 A;  3M6A A;  3P1X A;  3T1H I;  3T1H E;  2V89 A;  1X47 A;  3WU3 A;  3ADJ A;  1YYK A;  4UT4 A;  4YHH E;  1S4E A;  2B9D A;  4BMJ A;  3ZZU A;  2RS6 A;  4DUY I;  3C4B A;  2V2V A;  4LFB E;  4FWH A;  1YYO A;  4LF7 I;  2LMZ A;  5LMN E;  4LF4 E;  3LML A;  1N34 I;  2V86 A;  4FWD A;  4N3O A;  4DR6 I;  4TUG A;  4P7A A;  2L2N A;  2HKJ A;  2PNM A;  2L3C A;  3VK6 A;  2Z5C A;  1SR9 A;  2CPN A;  1Z5B A;  2UXC E;  4LF6 E;  1FJG I;  4LU9 A;  4IZK B;  1FKA E;  5GMD A;  4JI0 I;  3LNU A;  2L6M A;  1ZM4 A;  4DR2 E;  3VYY A;  2ODR D;  3B82 A;  2NUE A;  4GKK I;  1QU6 A;  3CWV A;  2UU9 E;  2UU9 I;  3HQ1 A;  1WHN A;  4OOG C;  4R8O A;  2DIX A;  4JI2 E;  1OJ4 A;  3QT7 A;  3FIG A;  4LF9 I;  2LTS A;  3H4L A;  4DR7 E;  4B3T E;  3PYD A;  1WXR A;  2WW4 A;  4DV7 I;  2V2Z A;  3Q6M A;  4WSP A;  4P78 A;  1XNR I;  4HY1 A;  4USK A;  4X8W A;  5FLX Q;  2IOQ A;  1Y4U A;  2L92 A;  4I8O A;  2Z5B B;  4DR1 I;  1XHK A;  3B78 A;  4DPT A;  1XMQ I;  1ZBQ A;  1J26 A;  1XMO I;  4KQV A;  5AE1 A;  3K1J A;  1ZM2 A;  4DR6 E;  2DEI A;  4LFA E;  1S16 A;  1RRE A;  3WU5 A;  4JI1 I;  1DI2 A;  2FGG A;  1ZM3 A;  4JI7 E;  5LL6 R;  1RR9 A;  1HNZ I;  3J7Y p;  1N32 E;  2L3J A;  3WU6 A;  1Z0E A;  4LF8 E;  4BC7 A;  4DV7 E;  1STU A;  4LF5 I;  4IZJ D;  1KKH A;  2X36 A;  1Z0G A;  2N3G A;  2M1S A;  3IWD A;  4B3R E;  3ZM7 A;  1EI1 A;  2RS7 A;  2O1T A;  4JYA I;  1FNM A;  1Z0T A;  1XMO E;  2EFG A;  2Q2E B;  1H73 A;  3ZKB A;  3VYX A;  5DNY A;  4DR4 I;  4K0K I;  2EZ6 A;  2Z5E A;  1H7U A;  2UUC I;  1UHZ A;  4WPY A;  2LBS B;  4Q28 A;  4KHP I;  1T4O A;  1GQE A;  5GME A;  2L8T A;  2B7T A;  1IBK I;  4LF5 E;  4M0V A;  4DR4 E;  1ZM9 A;  2IOP A;  1B62 A;  2E5L E;  2E5L I;  1PIE A;  3JU0 A;  1N36 I;  3ADG A;  3C4T A;  3P06 A;  3V5R A;  4GEQ B;  3QT6 A;  1ZBT A;  3D4J A;  4DV0 I;  5ADZ A;  3DF6 A;  5L3J A;  5BR8 I;  2DEJ A;  4P52 A;  2L33 A;  2LE2 A;  3LTO A;  4X62 I;  3K17 A;  2UXB E;  2V2Q A;  2JR1 A;  4JI8 E;  3F6G A;  2AJ4 A;  3ZOQ B;  1PKP A;  2B7V A;  4LFC E;  1X49 A;  4BS9 A;  3J7A G;  4B3S I;  4YY3 E;  3JAM C;  1EA6 A;  2DMY A;  2O1U A;  2HHH I;  1XNR E;  2WZO A;  2LUQ A;  1N32 I;  2OI2 A;  1H74 A;  1GZ6 A;  1I94 I;  1A6F A;  2MC6 A;  5F3W A;  4JI3 E;  5T6J A;  5FLX C;  2UXD I;  4JI2 I;  1DQ3 A;  4WUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...