4JI6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji6E02
4NXNI 3C4BA 3V2UC 4LF6I 5LMNI 2L3CA 1ZM4A 2HK2A 1WHNA 1N34I 4X65E 4LF9E 4DR4I 2LUPB 4JI7E 4WUCA 4DPWA 2R42A 3D4JA 4XTJA 4X62I 2CPNA 4LF8I 2VF3A 2CZ9A 4UT4A 4DR5I 3WU3A 1Z0VA 1Z0EA 4X66I 1FWLA 2HKJA 1Z59A 2DB2A 4JG4A 2X36A 4DV4E 4DR3E 2V2VA 3OTOE 4WUBA 4JI4I 2BM1A 2E5LE 2B7TA 1O0WA 2DMYA 2LUQA 3LPSA 5A2QC 3J80C 4B3SE 1Z5CA 4K0KE 4DR4E 4LF9I 4B3RI 1N36E 1Z0WA 1DI2A 2HHHE 4X65I 1K47A 2V8PA 3WU4A 2JY9A 4OX9E 4URLA 4DV5I 1N32E 4LF5I 4JI1E 2RS6A 2BM0A 4LF4I 1STUA 2YT4A 3J7AG 4DR7I 1NHHA 5FLXC 3GONA 4LFAI 2RSMA 4MYTA 1X47A 2UXDE 4JI3I 4NXMI 1GQEA 1N33E 4LF5E 1ZM2A 3QT8A 3T1YI 1XNQI 4YHHE 3J7AM 4JI5E 4JI2E 3ZKBA 2EFGA 2LRSA 2R3VA 4B3RE 4DR2E 4K0KI 4FWDA 4LF7I 2HFSA 2J7KA 5BR8E 3LNUA 1FJGE 4JV5I 3ADJA 1Z0GA 3T1HE 1IBME 1FNMA 1N0VC 3JAMQ 1J5EI 4LF7E 1ZXNA 2E5LI 2Q2EB 4P52A 3ZKDA 2V2ZA 3QT7A 1T4OA 2B7VA 5LL6R 3OTOI 4M2ZA 5IT9C 2VQFI 1PKPA 4YY3E 1S16A 3T1YE 4JYAI 4R1FA 2UXBE 1PVGA 2AJ4A 3PYEA 1NHJA 4FW9A 2ZM6E 2UXDI 5IWAE 3ZZ0A 1XHKA 4DPUA 4B3MI 2NUGA 3LLHA 2L2KB 1UEKA 4DKKA 2LTRA 1WUUA 2A2DA 1HNWE 1S4EA 5A2QQ 1N34E 1N32I 2N3HA 3J7Yp 1X49A 3WU6A 2UUAE 1H72C 4DUZE 4ZVIA 1HNXE 1N36I 4FWGA 3ADLA 5GMDA 2EZ6A 1XMOE 2NA2A 2NPFA 3WU5A 3F0NA 2LBSB 4DV1I 4JI4E 3LTOA 2V2QA 2MDRA 2HFUA 4DV0E 4DV4I 4DR3I 3ADGA 1ZBTA 2RS7A 3PYFA 4B3TI 1VISA 1N0UA 3CWVA 2LJHA 1T4NA 1RQ0A 2A2CA 1YYWA 1Z5BA 4DR5E 1IBMI 3J81Q 2LJPA 1XMOI 3ZM7A 4X62E 1HNZE 1Z0TA 4JI0E 4WYQB 4M30A 1HNXI 4DUZI 3M6AA 3B82A 4Z7CA 3JAMC 3ZZTA 2X7IA 2BV3A 2N3GA 4NXNE 1QZRA 4NXME 1ZM9A 4AQYI 4DR6E 1YYKA 2HKEA 4DV3I 2NUFA 4GKJI 2NUEA 2B3TB 4DR7E 2UUBE 1KVKA 4USMA 1FI4A 1IBKE 4LFCI 1H7SA 2DEIA 2ZM6I 4DPYA 4LF4E 2DEJA 4DV3E 3PYGA 1IBLI 4DV6I 4DUYE 1ZXMA 3ADIA 4YY3I 2GS8A 4EMDA 3V5RA 4OX9I 1T4LB 2VQFE 2HHHI 1MX0A 2VQEE 1XMQE 4FWHA 3P1XA 4JI0I 1HR0E 3H4LA 1YYOA 1HNZI 1H74A 1J5EE 2LTSA 1Z5AA 3B8HA 3T1HI 4JI6E 2L2NA 4HACA 4FN5A 1XNRI 3K17A 4HY1A 4GKKI 3C4TA 1I94E 4DR2I 4PU9A 4DV2E 2KHXA 1H73A 4JI2I 4JI5I 3PYDA 2UXCE 4RPFA 4LFBI 4JI8E 2L3JA 4B3TE 3ZZUA 1YZ9A 2ZBKB 1N33I 4X66E 4LFBE 4HACB 1Z0BA 1OJ4A 4LFAE 2XEXA 2ZITA 1XNRE 1EA6A 1FKAE 4WFTA 2IHR1 4JI7I 1NHIA 4DPTA 3K1JA 4KQVA 2F4VE 4JI1I 3J81C 2VQEI 1RR9A 1KTVA 1KIJA 2UUAI 1B63A 5LMNE 1Z0CA 4MYUA 2F4VI 1KKHA 2DIXA 4B3SI 1HNWI 3VYYA 1EKZA 3B78A 4B3ME 2L2MA 2V34A 2UUBI 5IWAI 4DU8A 1NZ0A 4X64I 4OOGC 4DR1E 4DR6I 4JYAE 4AQYE 1J26A 3Q1QA 4USKA 2UXBI 1U2RA 4I3HA 2UU9E 2L33A 1H7UA 4HXZA 4JI8I 4UTGA 4M1KA 4DU7A 5FLXQ 4DV2I 4DV7I 5IT9Q 1RREA 2UXCI 2UUCI 2RTXA 4LF8E 3J80Q 1I94I 4JV5E 1FJGI 4GKKE 1BKNA 1MG7A 5CFFE 5L3JA 1EI1A 2UUCE 4JI6I 5BR8I 2WW4A 4X8WA 4DV7E 1B62A 1QU6A 1XMQI 1UHZA 4ED4A 3VYXA 1HR0I 1XNQE 2UU9I 4DPXA 1WHQA 3HTXA 5GMEA 4YHHI 4LF6E 3QT5A 3HULA 4DUYI 4Z7YA 4PRXA 1A6FA 4DV6E 1IBLE 4P7AA 1DARA 4DV0I 2JVAA 1ELOA 4X64E 4JI3E 4DR1I 2E1RA 5LMUI 4DV1E 4KHPI 4LFCE 1IBKI 4HYMA 4DXLA 1FWKA 1D6TA 2OI2A 1MU5A 4KHPE 1PIEA 5LMUE 1UILA 2HK3A 3QT6A 4WUDA 1RC7A 4GKJE 1X48A 4PRVA 1ZM3A 4DV5E
chains in the Genus database with same CATH superfamily
5C0XF 4NXNI 1GTKA 3C4BA 3ZOQB 3V2UC 5LMNI 4LF6I 1L4SA 2L3CA 1ZM4A 2HK2A 1WHNA 3KWRA 4BC7A 2JE6B 1N34I 4IJDA 4TUGA 1T38A 3HXLA 1ZBQA 4X65E 4LF9E 4DR4I 2GO3A 2LUPB 2EL5A 4JI7E 2IOQA 4WUCA 2WP8A 4DPWA 1UDOA 4IFDB 4ISAA 2R42A 1NCSA 2CSHA 2ELZA 1YUJA 4AIDA 3D4JA 2VRDA 4LCGA 4AIMA 2PNZA 2NN6B 4XTJA 4TUIA 3U1YA 4X62I 2CPNA 2EN6A 4LF8I 2VF3A 2CZ9A 2E1MA 4UT4A 4DR5I 4OO1F 3DF6A 3WU3A 4BBYA 2YWQA 2ADRA 1Z0VA 1Z0EA 4F9AB 1RMDA 4WXCA 1F2IG 4L5NC 1HK7A 2YTEA 3L7ZA 2EM9A 4X66I 1FWLA 4RHBB 2HKJA 5IXMB 5A6JA 2BBGA 1Z59A 2DB2A 4JG4A 2X36A 4DV4E 3NZKA 2CG9A 2E5LI 4DR3E 2H36X 2V2VA 2PO0A 2YRHA 4PRXA 2ODRC 4FW5A 5DROA 4IFDE 3OTOE 4WUBA 4NHRA 3TQMA 4JI4I 2BM1A 2V83A 2E5LE 3K6QA 2B7TA 4IFDC 1O0WA 1G2FC 2DMYA 1YSAC 2CVEA 2LUQA 3LPSA 4WSPA 5A2QC 3J80C 3GMEA 4B3SE 2EORA 5C0XA 2IERA 1Z5CA 4K0KE 4DR4E 2PO2A 4LF9I 2N8XA 4B3RI 2EMAA 3P3CA 1N36E 1Z0WA 4IZJD 2JR1A 1DI2A 2HHHE 2YTJA 4X65I 4ZYDA 1K47A 2V8PA 2EM6A 3WU4A 4BA2A 2JY9A 4OX9E 2EOOA 4URLA 3HPZA 5A69A 4DV5I 1N32E 3IWDA 1YH8A 4LF5I 2O3ZA 1XXEA 2NABA 4JI1E 3M99B 1SFEA 2RS6A 2BM0A 2C39B 4BMJA 4LF4I 1STUA 2LMZA 4R2PA 2YT4A 5KL4A 2WNRB 2Z5EA 2EQ3A 4O4KA 1ZR9A 3J7AG 2GHFA 3KRNA 4DR7I 1NHHA 5FLXC 2Z5BB 3GONA 2I9IA 3ECRA 5T6JA 4FW3A 4LFAI 4LOMA 1MEYC 2HJJA 3UK3C 3IWBA 2RSMA 2JWOA 5JEAF 4BA2B 4N3OA 4MYTA 1AAYA 3H1CA 1X47A 2UXDE 3PS1A 1A1FA 2IESA 4OO1C 4F9CB 4JI3I 4NXMI 1GQEA 1N33E 4LF5E 5K36B 2FTXB 3OMLA 1ZM2A 2KONA 3QT8A 5K36A 2VESA 3T1YI 2G7HA 1XNQI 1YUIA 1PJQA 3MSWA 1Z1BA 4RH8A 4YHHE 1A1JA 2EN1A 4FW7A 2C38A 4JI5E 4JI2E 2WBSA 2EFGA 2LRSA 4LTYA 4B3RE 4NZVA 2R3VA 2EPNA 2EOMA 4DR2E 4K0KI 3EPLA 3RMPA 4FWDA 4LF7I 2HFSA 3GCMA 4R2DA 2J7KA 5BR8E 1P47A 3LNUA 4OKGA 1FJGE 2BR2A 4JV5I 3ADJA 1Z0GA 3T1HE 2EMIA 2MDGA 2YRKA 1IBME 1UBDC 1FNMA 1USVA 4HTGA 2M4IA 1T39A 1N0VC 3JAMQ 4BS9A 4LF7E 1ZXNA 2VF1A 2Q2EB 4MQYA 2V2ZA 3QT7A 4P52A 3ZKDA 3M85G 1T4OA 2O1WA 3DJWA 3C6MA 4Q28A 2B7VA 5LL6R 3THOB 3CDJA 3OTOI 3MHHC 3VHTB 4M2ZA 2GO4A 5IT9C 2VQFI 4GZNC 2PNMA 4AM3A 2EMKA 1Y4UA 1PKPA 1PJTA 5A6AA 5A6BA 4YY3E 4GQUA 4MU0A 2Z5CA 3HPSA 2EOSA 1S16A 2JEBB 1PDAA 3T1YE 3M7NG 3U1KA 4BA1B 4R1FA 4JYAI 2UXBE 1TF6A 1PVGA 2AJ4A 3PYEA 4Q35B 2EOFA 1NHJA 4R8OA 2V89A 1WJPA 4FW9A 2LE2A 2ZM6E 2HGHA 2L6MA 4IFDA 2UXDI 1BBOA 5IWAE 2L92A 5JEAE 2YU5A 3ZZ0A 2LO3A 5ADZA 4R2SA 1XHKA 4R2RA 4MU4A 4DPUA 4B3MI 2NUGA 3IWCA 2BA0D 3LLHA 4WSGA 4BA1A 2L2KB 2VE7C 2EM4A 2Z5BA 1EH6A 1UEKA 4DKKA 2EN8A 4GEQB 2LTRA 1WUUA 2A2DA 5DRPA 5K36D 2NN6F 2O1TA 1EH8A 2YSPA 4WPYA 1HNWE 5K36F 4MLQA 1S4EA 5AE2A 2C39A 5C0XD 2DSYA 5A2QQ 2YTNA 4BC9A 1N34E 3AV0A 3HQ1A 4O24A 1N32I 2N3HA 3DD6A 3JTZA 3J7Yp 2EJ4A 2V87A 5KL6A 1X49A 3WU6A 2UUAE 1H72C 4DUZE 4ZVIA 1HNXE 2EPPA 1N36I 5DNLA 4FWGA 3ADLA 5GMDA 2EM5A 1AH5A 1A1KA 3AUZA 2EZ6A 1XMOE 2PRTA 4WXDA 2NA2A 2EN4A 1OYSA 2DRPA 2BA1G 2NPFA 3WU5A 3F0NA 5AASA 2WP8B 4IZJB 2ODRD 2LBSB 4BCAA 4DV1I 2EWLA 4JI4E 2EMHA 3BF2A 4F2JC 3LTOA 2V2QA 2MDRA 2HFUA 5FWKA 4O43A 4DV0E 1GZ6A 4J8ZA 2BB8A 2JXPA 2EL6A 4DV4I 2K7IA 1Y60A 4DR3I 3ADGA 3P06A 1JK2A 2F1DA 1ZBTA 2RS7A 1P42A 4IZKB 3PYFA 4B3TI 1VISA 4R2AA 1N0UA 2JEAB 3CWVA 4LCFA 2LJHA 1T4NA 4M9VC 1RQ0A 2B9DA 1KJKA 2A2CA 1YYWA 1Z5BA 2DLQA 4DR5E 3EPHA 5EKWA 5K36E 2EOHA 2DLKA 1YFHA 1IBMI 1TF3A 1IMUA 2LJPA 3J81Q 1XMOI 3ZM7A 2YU8A 4F54A 4X62E 2M1SA 1HNZE 5C0XB 1Z0TA 4IZJA 4JI0E 4KWYA 4WYQB 4FK5C 4M30A 5JEAB 5A6KA 2O1VA 3Q6NA 1HNXI 4DUZI 3L00A 3M6AA 3B82A 4Z7CA 2YPNA 5AC4A 3EPJA 2JOBA 2FV4B 4R2EA 3JAMC 4F6NA 2LVHA 4X9JA 1R6MA 3ZZTA 4P7DA 2HC5A 2X7IA 1BBGA 2JEBA 2BV3A 2J7JA 1UDSA 5C0XE 5KL7A 5KL3A 2N3GA 4NXNE 1QZRA 4NXME 1UDNA 1ZM9A 5DRQA 2PO0B 1YPNA 2EM2A 4DR6E 4AQYI 1YYKA 2HKEA 3BIDA 1UN6B 1USUA 4DV3I 2NUFA 4GKJI 2ENCA 2NUEA 2B3TB 4WX9A 2EPAA 4DR7E 2YTDA 2UUBE 2V86A 4FW4A 1A1GA 4BHBA 1KVKA 2EPCA 3CDIA 4BHCA 4USMA 4ZYEA 1IBKE 4O5GA 2JPAA 1FI4A 4LFCI 2EPKX 2BR2B 1H7SA 2DEIA 2ZM6I 2EMCA 1ZAAC 1QNTA 4DPYA 3ZKBA 2YTGA 3KZYA 3KZZA 4F9BB 2ENHA 4LF4E 4DV3E 2EM3A 2DEJA 3PYGA 5DNXA 1IBLI 3EQ1A 4DV6I 2WBUA 2V8QB 2YRMA 4OO1E 4DUYE 1ZXMA 1N3GA 3ADIA 1Y6ZA 5AE3A 2EL4A 4YY3I 2GS8A 1DQ3A 4EMDA 2EOXA 3V5RA 2D9HA 4OX9I 2EQ0A 4HEIA 1T4LB 5EL9A 2VQFE 2HHHI 2JOXA 1MX0A 1WXRA 2VQEE 1XMQE 1NEIA 3P1XA 4FWHA 4JI0I 1HR0E 2LCEA 2YTQA 2YTIA 1YYOA 2Z5CB 3H4LA 4M0VA 1HNZI 1H74A 1J5EE 2EOYA 2LTSA 1Z5AA 2GQ0A 2EMFA 3B8HA 4LCHA 3T1HI 4DMIA 4JI6E 2EPZA 2L2NA 1DGCA 4FN5A 2F8BA 1OYPA 4HACA 5C0XC 4KZSA 3K17A 1XNRI 2EOZA 4OO1D 4HY1A 4GKKI 3C4TA 2EQ1A 1A1HA 4IS1C 1I94E 1IQOA 3Q6MA 4DR2I 4PU9A 4DV2E 2KHXA 2EMWA 1H73A 2A25A 2WNRA 5A6BD 3PYDA 4JI2I 4JI5I 2UXCE 2LT7A 1X6FA 5TSEA 2EPOA 3THNA 1UDQA 4JI8E 2C37B 4OZEA 2EP3A 4RPFA 3M7ND 2EM7A 4LFBI 1PJSA 2L3JA 4B3TE 4NBQA 3ZZUA 2AE8A 1YZ9A 2C38B 2ZBKB 5LLQA 1N33I 5IV8B 2JYAA 4X66E 2WCC3 4LFBE 4HACB 1Y5YA 1BB8A 1Z0BA 3PS2A 3VK6A 2J65A 4QNKA 2PO1B 3P3EA 2NN6C 1OJ4A 3M85D 2V88A 2CTDA 2YSOA 2EN3A 4U3BA 4LFAE 2XEXA 4J3DA 4OO1B 2NN6A 2ZITA 4FW6A 3C6KA 4N4RB 1XNRE 1X5WA 2RSIA 1FKAE 2EN7A 1EA6A 2CT1A 2CGEA 4WFTA 1YHCA 2PNLA 1JK1A 4R03A 2IHR1 3LMLA 1NHIA 4JI7I 4P78A 3J7AM 4DPTA 1MGTA 3K1JA 4KQVA 2F4VE 2ENAA 3MHSC 4JI1I 2EMXA 4R2CA 3J81C 1TN9A 2Q8UA 5DRRA 2VQEI 1RR9A 1KTVA 4ZYHA 1KIJA 2UUAI 4I8OA 5LMNE 1B63A 1SR9A 2EPXA 3HKMA 2K4VA 4LPFA 2C37A 1Z0CA 5KL2A 2EMBA 2RQLA 4MU3A 1VI7A 1LLMC 2YTPA 4MYUA 5KL5A 2F4VI 3FIGA 1RHYA 3L7ZB 1KKHA 2DIXA 3QG5C 2LV2A 2R76A 4B3SI 3B4TA 1HNWI 2NN6E 1X3CA 3VYYA 3PS3A 2WZOA 1EKZA 2M7QA 3B78A 2EMGA 4B3ME 1R6LA 2L2MA 2V34A 2YTOA 2EMZA 2EMLA 2UUBI 5IWAI 2PO2B 1X6EA 4DU8A 1ZU1A 2PNZB 1NZ0A 4X64I 4OOGC 2LJUA 1EH7A 2I13A 4DR1E 2EE8A 4DR6I 4JYAE 4AQYE 1J26A 4L8NA 3Q1QA 2R1FA 2EPMX 1KYQA 4MLVA 1A1LA 2EOQA 4IS9A 4USKA 2UXBI 1U2RA 2RPCA 4I3HA 5JEAA 2ELYA 2V85A 2L33A 2UU9E 4R2QA 1H7UA 2MKDA 1G2DC 4HXZA 4JI8I 2EMYA 3H09A 1E3HA 5JEAC 2GPIA 4UTGA 2DMIA 4QNJA 3UHMA 1OYRA 4M1KA 2IOPA 4DU7A 5FLXQ 4DV2I 1X6HA 1RREA 3P3GA 4DV7I 1J5EI 5IT9Q 2UXCI 1B69A 2UUCI 2RTXA 2EOIA 4LF8E 3J80Q 1I94I 2BA1D 4JV5E 1FJGI 4GKKE 1BKNA 1MG7A 1WRJA 1Y4SA 5CFFE 5DNYA 5L3JA 4IZKA 3EPKA 1EI1A 2UUCE 4JI6I 1IQSA 2E72A 5BR8I 2JT2A 4X8WA 2WW4A 4DV7E 1B62A 3HJCA 2DGCA 1QU6A 1XMQI 1UHZA 5ELWA 4ED4A 3VYXA 1A1IA 3K85A 1HR0I 2EOEA 1XNQE 3P76A 2WBTA 2UU9I 4OO1A 4DPXA 5K36C 1WHQA 2EN2A 3HTXA 2EPUA 5GMEA 4YHHI 4LU9A 2FGGA 2JP9A 4LF6E 2O1UA 3HULA 3QT5A 4DUYI 4Z7YA 2PO1A 2YZTA 5AC5A 3GLLA 1A6FA 2EOJA 4ZYGA 4DV6E 1IBLE 4F6MA 4P7AA 4U3DA 1DARA 4DV0I 3BGHA 2JVAA 1ELOA 2EM0A 4X64E 2JE6A 2MKNA 4JI3E 2EM8A 4DR1I 2E1RA 3JU0A 5LMUI 5AE1A 2MC6A 2KOUA 2MC5A 4DV1E 4LFCE 4MU1A 1IBKI 4KHPI 4MDTA 2M9AA 2EPLX 4HYMA 4DXLA 2BA0G 4IFDD 1FWKA 1D6TA 2OI2A 3F6HA 1MU5A 4IFDF 3BBGA 2NN6D 4KHPE 5F3WA 5LMUE 1PIEA 2JEAA 5JEAD 1UILA 2HK3A 2L8TA 3QT6A 4WUDA 1E3PA 1RC7A 4GKJE 1X48A 4PRVA 1ZM3A 3PRYA 3F6GA 2YTFA 4DV5E 2EPRA 2GLIA
chains in the Genus database with same CATH topology
4NXNI 3C4BA 3ZOQB 3V2UC 4LF6I 5LMNI 2L3CA 1ZM4A 2HK2A 1WHNA 3KWRA 4BC7A 1N34I 4TUGA 3HXLA 1ZBQA 4X65E 4LF9E 4DR4I 2LUPB 4JI7E 2IOQA 4WUCA 4DPWA 2R42A 3D4JA 4XTJA 4TUIA 4X62I 2CPNA 4LF8I 2VF3A 2CZ9A 2E1MA 4UT4A 4DR5I 3DF6A 3WU3A 4BBYA 1Z0VA 1Z0EA 4F9AB 4L5NC 1HK7A 4X66I 1FWLA 2HKJA 1Z59A 2DB2A 4JG4A 2X36A 4DV4E 2CG9A 2E5LI 4DR3E 2H36X 2V2VA 2ODRC 3OTOE 4WUBA 4JI4I 2BM1A 2V83A 2E5LE 3K6QA 2B7TA 1O0WA 2DMYA 2LUQA 3LPSA 4WSPA 5A2QC 3J80C 4B3SE 1Z5CA 4K0KE 4DR4E 4LF9I 4B3RI 1N36E 1Z0WA 4IZJD 2JR1A 1DI2A 2HHHE 4X65I 1K47A 2V8PA 3WU4A 2JY9A 4OX9E 4URLA 3HPZA 4DV5I 1N32E 3IWDA 4LF5I 4JI1E 2RS6A 2BM0A 4BMJA 4LF4I 1STUA 2LMZA 2YT4A 2Z5EA 3J7AG 4DR7I 1NHHA 5FLXC 2Z5BB 3GONA 5T6JA 4LFAI 3IWBA 2RSMA 2JWOA 4N3OA 4MYTA 1X47A 2UXDE 4F9CB 4JI3I 4NXMI 1GQEA 1N33E 4LF5E 2FTXB 3OMLA 1ZM2A 2KONA 3QT8A 3T1YI 2G7HA 1XNQI 3MSWA 4YHHE 3J7AM 4JI5E 4JI2E 3ZKBA 2EFGA 2LRSA 4LTYA 4B3RE 2R3VA 4DR2E 4K0KI 3RMPA 4FWDA 4LF7I 2HFSA 2J7KA 5BR8E 3LNUA 1FJGE 4JV5I 3ADJA 1Z0GA 3T1HE 1IBME 1FNMA 1USVA 2M4IA 1N0VC 3JAMQ 1J5EI 4BS9A 4LF7E 1ZXNA 2VF1A 2Q2EB 4P52A 2V2ZA 3QT7A 3ZKDA 1T4OA 2O1WA 3DJWA 4Q28A 2B7VA 5LL6R 3OTOI 4M2ZA 5IT9C 2VQFI 2PNMA 1Y4UA 1PKPA 4YY3E 2Z5CA 3HPSA 1S16A 3T1YE 4JYAI 4R1FA 2UXBE 1PVGA 2AJ4A 3PYEA 1NHJA 4R8OA 2V89A 4FW9A 2LE2A 2ZM6E 2L6MA 2UXDI 5IWAE 2L92A 3ZZ0A 5ADZA 1XHKA 4DPUA 4B3MI 2NUGA 3IWCA 3LLHA 2L2KB 2VE7C 2Z5BA 1UEKA 4DKKA 4GEQB 2LTRA 1WUUA 2A2DA 2O1TA 1HNWE 4WPYA 1S4EA 5AE2A 2DSYA 5A2QQ 4BC9A 1N34E 3AV0A 3HQ1A 1N32I 2N3HA 3JTZA 3J7Yp 2V87A 1X49A 3WU6A 2UUAE 1H72C 4DUZE 4ZVIA 1HNXE 1N36I 4FWGA 3ADLA 5GMDA 3AUZA 2EZ6A 1XMOE 2NA2A 2NPFA 3WU5A 3F0NA 5AASA 4IZJB 2ODRD 2LBSB 4BCAA 4DV1I 2EWLA 4JI4E 3LTOA 2V2QA 2MDRA 2HFUA 5FWKA 4DV0E 1GZ6A 4J8ZA 4DV4I 4DR3I 3ADGA 3P06A 1ZBTA 2RS7A 4IZKB 3PYFA 4B3TI 1VISA 1N0UA 3CWVA 2LJHA 1T4NA 1RQ0A 2B9DA 2A2CA 1YYWA 1Z5BA 4DR5E 1IBMI 3J81Q 2LJPA 1XMOI 3ZM7A 4F54A 4X62E 2M1SA 1HNZE 1Z0TA 4IZJA 4JI0E 4WYQB 4M30A 2O1VA 3Q6NA 1HNXI 4DUZI 3M6AA 3B82A 4Z7CA 2JOBA 2FV4B 3JAMC 3ZZTA 4P7DA 2X7IA 2BV3A 2N3GA 4NXNE 1QZRA 4NXME 1ZM9A 4AQYI 4DR6E 1YYKA 2HKEA 1USUA 4DV3I 2NUFA 4GKJI 2NUEA 2B3TB 4DR7E 2UUBE 2V86A 1KVKA 4USMA 1FI4A 1IBKE 4LFCI 1H7SA 2DEIA 2ZM6I 4DPYA 4LF4E 2DEJA 4F9BB 4DV3E 3PYGA 1IBLI 4DV6I 2V8QB 4DUYE 1ZXMA 3ADIA 1Y6ZA 5AE3A 4YY3I 2GS8A 1DQ3A 4EMDA 3V5RA 4OX9I 1T4LB 2VQFE 2HHHI 2JOXA 1MX0A 1WXRA 2VQEE 1XMQE 3P1XA 4FWHA 4JI0I 1HR0E 3H4LA 1YYOA 2Z5CB 4M0VA 1HNZI 1H74A 1J5EE 2LTSA 1Z5AA 2GQ0A 3B8HA 3T1HI 4DMIA 4JI6E 2L2NA 4HACA 4FN5A 2F8BA 1XNRI 4KZSA 3K17A 4HY1A 4GKKI 3C4TA 1I94E 3Q6MA 4DR2I 4PU9A 4DV2E 2KHXA 1H73A 4JI2I 4JI5I 3PYDA 2UXCE 4RPFA 4LFBI 4JI8E 2L3JA 4B3TE 3ZZUA 1YZ9A 2ZBKB 1N33I 4X66E 4LFBE 4HACB 1Z0BA 3VK6A 1OJ4A 2V88A 4LFAE 2XEXA 2ZITA 1XNRE 1EA6A 1FKAE 2CGEA 4WFTA 2PNLA 4R03A 2IHR1 3LMLA 1NHIA 4JI7I 4P78A 4DPTA 3K1JA 4KQVA 2F4VE 4JI1I 3J81C 2VQEI 1RR9A 1KTVA 1KIJA 2UUAI 4I8OA 5LMNE 1B63A 1SR9A 2K4VA 1Z0CA 4MYUA 2F4VI 3FIGA 1KKHA 2DIXA 4B3SI 1HNWI 3VYYA 2WZOA 1EKZA 2M7QA 3B78A 4B3ME 2L2MA 2V34A 2UUBI 5IWAI 4DU8A 1NZ0A 4X64I 4OOGC 4DR1E 4DR6I 4JYAE 4AQYE 1J26A 4L8NA 3Q1QA 4USKA 2UXBI 1U2RA 4I3HA 2V85A 2UU9E 2L33A 1H7UA 4HXZA 4JI8I 3H09A 4UTGA 4M1KA 2IOPA 4DU7A 5FLXQ 4DV2I 4DV7I 1RREA 5IT9Q 2UXCI 2UUCI 2RTXA 4LF8E 3J80Q 1I94I 4JV5E 1FJGI 4GKKE 1BKNA 1MG7A 1Y4SA 5CFFE 5DNYA 5L3JA 4IZKA 1EI1A 2UUCE 4JI6I 5BR8I 2WW4A 4X8WA 4DV7E 1B62A 3HJCA 1QU6A 1XMQI 1UHZA 4ED4A 3VYXA 3K85A 1HR0I 1XNQE 2UU9I 4DPXA 1WHQA 3HTXA 5GMEA 4YHHI 4LU9A 2FGGA 4LF6E 2O1UA 3HULA 3QT5A 4DUYI 4Z7YA 2YZTA 4PRXA 1A6FA 4DV6E 1IBLE 4P7AA 1DARA 4DV0I 2JVAA 1ELOA 4X64E 4JI3E 4DR1I 2E1RA 3JU0A 5LMUI 5AE1A 2MC6A 2KOUA 2MC5A 4DV1E 4LFCE 1IBKI 4KHPI 4HYMA 4DXLA 1FWKA 1D6TA 2OI2A 3F6HA 1MU5A 4KHPE 5F3WA 5LMUE 1PIEA 1UILA 2HK3A 2L8TA 3QT6A 4WUDA 1RC7A 4GKJE 1X48A 4PRVA 1ZM3A 3PRYA 3F6GA 4DV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN I;  3C4B A;  3V2U C;  4LF6 I;  5LMN I;  2L3C A;  1ZM4 A;  2HK2 A;  1WHN A;  1N34 I;  4X65 E;  4LF9 E;  4DR4 I;  2LUP B;  4JI7 E;  4WUC A;  4DPW A;  2R42 A;  3D4J A;  4XTJ A;  4X62 I;  2CPN A;  4LF8 I;  2VF3 A;  2CZ9 A;  4UT4 A;  4DR5 I;  3WU3 A;  1Z0V A;  1Z0E A;  4X66 I;  1FWL A;  2HKJ A;  1Z59 A;  2DB2 A;  4JG4 A;  2X36 A;  4DV4 E;  4DR3 E;  2V2V A;  3OTO E;  4WUB A;  4JI4 I;  2BM1 A;  2E5L E;  2B7T A;  1O0W A;  2DMY A;  2LUQ A;  3LPS A;  5A2Q C;  3J80 C;  4B3S E;  1Z5C A;  4K0K E;  4DR4 E;  4LF9 I;  4B3R I;  1N36 E;  1Z0W A;  1DI2 A;  2HHH E;  4X65 I;  1K47 A;  2V8P A;  3WU4 A;  2JY9 A;  4OX9 E;  4URL A;  4DV5 I;  1N32 E;  4LF5 I;  4JI1 E;  2RS6 A;  2BM0 A;  4LF4 I;  1STU A;  2YT4 A;  3J7A G;  4DR7 I;  1NHH A;  5FLX C;  3GON A;  4LFA I;  2RSM A;  4MYT A;  1X47 A;  2UXD E;  4JI3 I;  4NXM I;  1GQE A;  1N33 E;  4LF5 E;  1ZM2 A;  3QT8 A;  3T1Y I;  1XNQ I;  4YHH E;  3J7A M;  4JI5 E;  4JI2 E;  3ZKB A;  2EFG A;  2LRS A;  2R3V A;  4B3R E;  4DR2 E;  4K0K I;  4FWD A;  4LF7 I;  2HFS A;  2J7K A;  5BR8 E;  3LNU A;  1FJG E;  4JV5 I;  3ADJ A;  1Z0G A;  3T1H E;  1IBM E;  1FNM A;  1N0V C;  3JAM Q;  1J5E I;  4LF7 E;  1ZXN A;  2E5L I;  2Q2E B;  4P52 A;  3ZKD A;  2V2Z A;  3QT7 A;  1T4O A;  2B7V A;  5LL6 R;  3OTO I;  4M2Z A;  5IT9 C;  2VQF I;  1PKP A;  4YY3 E;  1S16 A;  3T1Y E;  4JYA I;  4R1F A;  2UXB E;  1PVG A;  2AJ4 A;  3PYE A;  1NHJ A;  4FW9 A;  2ZM6 E;  2UXD I;  5IWA E;  3ZZ0 A;  1XHK A;  4DPU A;  4B3M I;  2NUG A;  3LLH A;  2L2K B;  1UEK A;  4DKK A;  2LTR A;  1WUU A;  2A2D A;  1HNW E;  1S4E A;  5A2Q Q;  1N34 E;  1N32 I;  2N3H A;  3J7Y p;  1X49 A;  3WU6 A;  2UUA E;  1H72 C;  4DUZ E;  4ZVI A;  1HNX E;  1N36 I;  4FWG A;  3ADL A;  5GMD A;  2EZ6 A;  1XMO E;  2NA2 A;  2NPF A;  3WU5 A;  3F0N A;  2LBS B;  4DV1 I;  4JI4 E;  3LTO A;  2V2Q A;  2MDR A;  2HFU A;  4DV0 E;  4DV4 I;  4DR3 I;  3ADG A;  1ZBT A;  2RS7 A;  3PYF A;  4B3T I;  1VIS A;  1N0U A;  3CWV A;  2LJH A;  1T4N A;  1RQ0 A;  2A2C A;  1YYW A;  1Z5B A;  4DR5 E;  1IBM I;  3J81 Q;  2LJP A;  1XMO I;  3ZM7 A;  4X62 E;  1HNZ E;  1Z0T A;  4JI0 E;  4WYQ B;  4M30 A;  1HNX I;  4DUZ I;  3M6A A;  3B82 A;  4Z7C A;  3JAM C;  3ZZT A;  2X7I A;  2BV3 A;  2N3G A;  4NXN E;  1QZR A;  4NXM E;  1ZM9 A;  4AQY I;  4DR6 E;  1YYK A;  2HKE A;  4DV3 I;  2NUF A;  4GKJ I;  2NUE A;  2B3T B;  4DR7 E;  2UUB E;  1KVK A;  4USM A;  1FI4 A;  1IBK E;  4LFC I;  1H7S A;  2DEI A;  2ZM6 I;  4DPY A;  4LF4 E;  2DEJ A;  4DV3 E;  3PYG A;  1IBL I;  4DV6 I;  4DUY E;  1ZXM A;  3ADI A;  4YY3 I;  2GS8 A;  4EMD A;  3V5R A;  4OX9 I;  1T4L B;  2VQF E;  2HHH I;  1MX0 A;  2VQE E;  1XMQ E;  4FWH A;  3P1X A;  4JI0 I;  1HR0 E;  3H4L A;  1YYO A;  1HNZ I;  1H74 A;  1J5E E;  2LTS A;  1Z5A A;  3B8H A;  3T1H I;  4JI6 E;  2L2N A;  4HAC A;  4FN5 A;  1XNR I;  3K17 A;  4HY1 A;  4GKK I;  3C4T A;  1I94 E;  4DR2 I;  4PU9 A;  4DV2 E;  2KHX A;  1H73 A;  4JI2 I;  4JI5 I;  3PYD A;  2UXC E;  4RPF A;  4LFB I;  4JI8 E;  2L3J A;  4B3T E;  3ZZU A;  1YZ9 A;  2ZBK B;  1N33 I;  4X66 E;  4LFB E;  4HAC B;  1Z0B A;  1OJ4 A;  4LFA E;  2XEX A;  2ZIT A;  1XNR E;  1EA6 A;  1FKA E;  4WFT A;  2IHR 1;  4JI7 I;  1NHI A;  4DPT A;  3K1J A;  4KQV A;  2F4V E;  4JI1 I;  3J81 C;  2VQE I;  1RR9 A;  1KTV A;  1KIJ A;  2UUA I;  1B63 A;  5LMN E;  1Z0C A;  4MYU A;  2F4V I;  1KKH A;  2DIX A;  4B3S I;  1HNW I;  3VYY A;  1EKZ A;  3B78 A;  4B3M E;  2L2M A;  2V34 A;  2UUB I;  5IWA I;  4DU8 A;  1NZ0 A;  4X64 I;  4OOG C;  4DR1 E;  4DR6 I;  4JYA E;  4AQY E;  1J26 A;  3Q1Q A;  4USK A;  2UXB I;  1U2R A;  4I3H A;  2UU9 E;  2L33 A;  1H7U A;  4HXZ A;  4JI8 I;  4UTG A;  4M1K A;  4DU7 A;  5FLX Q;  4DV2 I;  4DV7 I;  5IT9 Q;  1RRE A;  2UXC I;  2UUC I;  2RTX A;  4LF8 E;  3J80 Q;  1I94 I;  4JV5 E;  1FJG I;  4GKK E;  1BKN A;  1MG7 A;  5CFF E;  5L3J A;  1EI1 A;  2UUC E;  4JI6 I;  5BR8 I;  2WW4 A;  4X8W A;  4DV7 E;  1B62 A;  1QU6 A;  1XMQ I;  1UHZ A;  4ED4 A;  3VYX A;  1HR0 I;  1XNQ E;  2UU9 I;  4DPX A;  1WHQ A;  3HTX A;  5GME A;  4YHH I;  4LF6 E;  3QT5 A;  3HUL A;  4DUY I;  4Z7Y A;  4PRX A;  1A6F A;  4DV6 E;  1IBL E;  4P7A A;  1DAR A;  4DV0 I;  2JVA A;  1ELO A;  4X64 E;  4JI3 E;  4DR1 I;  2E1R A;  5LMU I;  4DV1 E;  4KHP I;  4LFC E;  1IBK I;  4HYM A;  4DXL A;  1FWK A;  1D6T A;  2OI2 A;  1MU5 A;  4KHP E;  1PIE A;  5LMU E;  1UIL A;  2HK3 A;  3QT6 A;  4WUD A;  1RC7 A;  4GKJ E;  1X48 A;  4PRV A;  1ZM3 A;  4DV5 E; 
#chains in the Genus database with same CATH topology
 5C0X F;  4NXN I;  1GTK A;  3C4B A;  3ZOQ B;  3V2U C;  5LMN I;  4LF6 I;  1L4S A;  2L3C A;  1ZM4 A;  2HK2 A;  1WHN A;  3KWR A;  4BC7 A;  2JE6 B;  1N34 I;  4IJD A;  4TUG A;  1T38 A;  3HXL A;  1ZBQ A;  4X65 E;  4LF9 E;  4DR4 I;  2GO3 A;  2LUP B;  2EL5 A;  4JI7 E;  2IOQ A;  4WUC A;  2WP8 A;  4DPW A;  1UDO A;  4IFD B;  4ISA A;  2R42 A;  1NCS A;  2CSH A;  2ELZ A;  1YUJ A;  4AID A;  3D4J A;  2VRD A;  4LCG A;  4AIM A;  2PNZ A;  2NN6 B;  4XTJ A;  4TUI A;  3U1Y A;  4X62 I;  2CPN A;  2EN6 A;  4LF8 I;  2VF3 A;  2CZ9 A;  2E1M A;  4UT4 A;  4DR5 I;  4OO1 F;  3DF6 A;  3WU3 A;  4BBY A;  2YWQ A;  2ADR A;  1Z0V A;  1Z0E A;  4F9A B;  1RMD A;  4WXC A;  1F2I G;  4L5N C;  1HK7 A;  2YTE A;  3L7Z A;  2EM9 A;  4X66 I;  1FWL A;  4RHB B;  2HKJ A;  5IXM B;  5A6J A;  2BBG A;  1Z59 A;  2DB2 A;  4JG4 A;  2X36 A;  4DV4 E;  3NZK A;  2CG9 A;  2E5L I;  4DR3 E;  2H36 X;  2V2V A;  2PO0 A;  2YRH A;  4PRX A;  2ODR C;  4FW5 A;  5DRO A;  4IFD E;  3OTO E;  4WUB A;  4NHR A;  3TQM A;  4JI4 I;  2BM1 A;  2V83 A;  2E5L E;  3K6Q A;  2B7T A;  4IFD C;  1O0W A;  1G2F C;  2DMY A;  1YSA C;  2CVE A;  2LUQ A;  3LPS A;  4WSP A;  5A2Q C;  3J80 C;  3GME A;  4B3S E;  2EOR A;  5C0X A;  2IER A;  1Z5C A;  4K0K E;  4DR4 E;  2PO2 A;  4LF9 I;  2N8X A;  4B3R I;  2EMA A;  3P3C A;  1N36 E;  1Z0W A;  4IZJ D;  2JR1 A;  1DI2 A;  2HHH E;  2YTJ A;  4X65 I;  4ZYD A;  1K47 A;  2V8P A;  2EM6 A;  3WU4 A;  4BA2 A;  2JY9 A;  4OX9 E;  2EOO A;  4URL A;  3HPZ A;  5A69 A;  4DV5 I;  1N32 E;  3IWD A;  1YH8 A;  4LF5 I;  2O3Z A;  1XXE A;  2NAB A;  4JI1 E;  3M99 B;  1SFE A;  2RS6 A;  2BM0 A;  2C39 B;  4BMJ A;  4LF4 I;  1STU A;  2LMZ A;  4R2P A;  2YT4 A;  5KL4 A;  2WNR B;  2Z5E A;  2EQ3 A;  4O4K A;  1ZR9 A;  3J7A G;  2GHF A;  3KRN A;  4DR7 I;  1NHH A;  5FLX C;  2Z5B B;  3GON A;  2I9I A;  3ECR A;  5T6J A;  4FW3 A;  4LFA I;  4LOM A;  1MEY C;  2HJJ A;  3UK3 C;  3IWB A;  2RSM A;  2JWO A;  5JEA F;  4BA2 B;  4N3O A;  4MYT A;  1AAY A;  3H1C A;  1X47 A;  2UXD E;  3PS1 A;  1A1F A;  2IES A;  4OO1 C;  4F9C B;  4JI3 I;  4NXM I;  1GQE A;  1N33 E;  4LF5 E;  5K36 B;  2FTX B;  3OML A;  1ZM2 A;  2KON A;  3QT8 A;  5K36 A;  2VES A;  3T1Y I;  2G7H A;  1XNQ I;  1YUI A;  1PJQ A;  3MSW A;  1Z1B A;  4RH8 A;  4YHH E;  1A1J A;  2EN1 A;  4FW7 A;  2C38 A;  4JI5 E;  4JI2 E;  2WBS A;  2EFG A;  2LRS A;  4LTY A;  4B3R E;  4NZV A;  2R3V A;  2EPN A;  2EOM A;  4DR2 E;  4K0K I;  3EPL A;  3RMP A;  4FWD A;  4LF7 I;  2HFS A;  3GCM A;  4R2D A;  2J7K A;  5BR8 E;  1P47 A;  3LNU A;  4OKG A;  1FJG E;  2BR2 A;  4JV5 I;  3ADJ A;  1Z0G A;  3T1H E;  2EMI A;  2MDG A;  2YRK A;  1IBM E;  1UBD C;  1FNM A;  1USV A;  4HTG A;  2M4I A;  1T39 A;  1N0V C;  3JAM Q;  4BS9 A;  4LF7 E;  1ZXN A;  2VF1 A;  2Q2E B;  4MQY A;  2V2Z A;  3QT7 A;  4P52 A;  3ZKD A;  3M85 G;  1T4O A;  2O1W A;  3DJW A;  3C6M A;  4Q28 A;  2B7V A;  5LL6 R;  3THO B;  3CDJ A;  3OTO I;  3MHH C;  3VHT B;  4M2Z A;  2GO4 A;  5IT9 C;  2VQF I;  4GZN C;  2PNM A;  4AM3 A;  2EMK A;  1Y4U A;  1PKP A;  1PJT A;  5A6A A;  5A6B A;  4YY3 E;  4GQU A;  4MU0 A;  2Z5C A;  3HPS A;  2EOS A;  1S16 A;  2JEB B;  1PDA A;  3T1Y E;  3M7N G;  3U1K A;  4BA1 B;  4R1F A;  4JYA I;  2UXB E;  1TF6 A;  1PVG A;  2AJ4 A;  3PYE A;  4Q35 B;  2EOF A;  1NHJ A;  4R8O A;  2V89 A;  1WJP A;  4FW9 A;  2LE2 A;  2ZM6 E;  2HGH A;  2L6M A;  4IFD A;  2UXD I;  1BBO A;  5IWA E;  2L92 A;  5JEA E;  2YU5 A;  3ZZ0 A;  2LO3 A;  5ADZ A;  4R2S A;  1XHK A;  4R2R A;  4MU4 A;  4DPU A;  4B3M I;  2NUG A;  3IWC A;  2BA0 D;  3LLH A;  4WSG A;  4BA1 A;  2L2K B;  2VE7 C;  2EM4 A;  2Z5B A;  1EH6 A;  1UEK A;  4DKK A;  2EN8 A;  4GEQ B;  2LTR A;  1WUU A;  2A2D A;  5DRP A;  5K36 D;  2NN6 F;  2O1T A;  1EH8 A;  2YSP A;  4WPY A;  1HNW E;  5K36 F;  4MLQ A;  1S4E A;  5AE2 A;  2C39 A;  5C0X D;  2DSY A;  5A2Q Q;  2YTN A;  4BC9 A;  1N34 E;  3AV0 A;  3HQ1 A;  4O24 A;  1N32 I;  2N3H A;  3DD6 A;  3JTZ A;  3J7Y p;  2EJ4 A;  2V87 A;  5KL6 A;  1X49 A;  3WU6 A;  2UUA E;  1H72 C;  4DUZ E;  4ZVI A;  1HNX E;  2EPP A;  1N36 I;  5DNL A;  4FWG A;  3ADL A;  5GMD A;  2EM5 A;  1AH5 A;  1A1K A;  3AUZ A;  2EZ6 A;  1XMO E;  2PRT A;  4WXD A;  2NA2 A;  2EN4 A;  1OYS A;  2DRP A;  2BA1 G;  2NPF A;  3WU5 A;  3F0N A;  5AAS A;  2WP8 B;  4IZJ B;  2ODR D;  2LBS B;  4BCA A;  4DV1 I;  2EWL A;  4JI4 E;  2EMH A;  3BF2 A;  4F2J C;  3LTO A;  2V2Q A;  2MDR A;  2HFU A;  5FWK A;  4O43 A;  4DV0 E;  1GZ6 A;  4J8Z A;  2BB8 A;  2JXP A;  2EL6 A;  4DV4 I;  2K7I A;  1Y60 A;  4DR3 I;  3ADG A;  3P06 A;  1JK2 A;  2F1D A;  1ZBT A;  2RS7 A;  1P42 A;  4IZK B;  3PYF A;  4B3T I;  1VIS A;  4R2A A;  1N0U A;  2JEA B;  3CWV A;  4LCF A;  2LJH A;  1T4N A;  4M9V C;  1RQ0 A;  2B9D A;  1KJK A;  2A2C A;  1YYW A;  1Z5B A;  2DLQ A;  4DR5 E;  3EPH A;  5EKW A;  5K36 E;  2EOH A;  2DLK A;  1YFH A;  1IBM I;  1TF3 A;  1IMU A;  2LJP A;  3J81 Q;  1XMO I;  3ZM7 A;  2YU8 A;  4F54 A;  4X62 E;  2M1S A;  1HNZ E;  5C0X B;  1Z0T A;  4IZJ A;  4JI0 E;  4KWY A;  4WYQ B;  4FK5 C;  4M30 A;  5JEA B;  5A6K A;  2O1V A;  3Q6N A;  1HNX I;  4DUZ I;  3L00 A;  3M6A A;  3B82 A;  4Z7C A;  2YPN A;  5AC4 A;  3EPJ A;  2JOB A;  2FV4 B;  4R2E A;  3JAM C;  4F6N A;  2LVH A;  4X9J A;  1R6M A;  3ZZT A;  4P7D A;  2HC5 A;  2X7I A;  1BBG A;  2JEB A;  2BV3 A;  2J7J A;  1UDS A;  5C0X E;  5KL7 A;  5KL3 A;  2N3G A;  4NXN E;  1QZR A;  4NXM E;  1UDN A;  1ZM9 A;  5DRQ A;  2PO0 B;  1YPN A;  2EM2 A;  4DR6 E;  4AQY I;  1YYK A;  2HKE A;  3BID A;  1UN6 B;  1USU A;  4DV3 I;  2NUF A;  4GKJ I;  2ENC A;  2NUE A;  2B3T B;  4WX9 A;  2EPA A;  4DR7 E;  2YTD A;  2UUB E;  2V86 A;  4FW4 A;  1A1G A;  4BHB A;  1KVK A;  2EPC A;  3CDI A;  4BHC A;  4USM A;  4ZYE A;  1IBK E;  4O5G A;  2JPA A;  1FI4 A;  4LFC I;  2EPK X;  2BR2 B;  1H7S A;  2DEI A;  2ZM6 I;  2EMC A;  1ZAA C;  1QNT A;  4DPY A;  3ZKB A;  2YTG A;  3KZY A;  3KZZ A;  4F9B B;  2ENH A;  4LF4 E;  4DV3 E;  2EM3 A;  2DEJ A;  3PYG A;  5DNX A;  1IBL I;  3EQ1 A;  4DV6 I;  2WBU A;  2V8Q B;  2YRM A;  4OO1 E;  4DUY E;  1ZXM A;  1N3G A;  3ADI A;  1Y6Z A;  5AE3 A;  2EL4 A;  4YY3 I;  2GS8 A;  1DQ3 A;  4EMD A;  2EOX A;  3V5R A;  2D9H A;  4OX9 I;  2EQ0 A;  4HEI A;  1T4L B;  5EL9 A;  2VQF E;  2HHH I;  2JOX A;  1MX0 A;  1WXR A;  2VQE E;  1XMQ E;  1NEI A;  3P1X A;  4FWH A;  4JI0 I;  1HR0 E;  2LCE A;  2YTQ A;  2YTI A;  1YYO A;  2Z5C B;  3H4L A;  4M0V A;  1HNZ I;  1H74 A;  1J5E E;  2EOY A;  2LTS A;  1Z5A A;  2GQ0 A;  2EMF A;  3B8H A;  4LCH A;  3T1H I;  4DMI A;  4JI6 E;  2EPZ A;  2L2N A;  1DGC A;  4FN5 A;  2F8B A;  1OYP A;  4HAC A;  5C0X C;  4KZS A;  3K17 A;  1XNR I;  2EOZ A;  4OO1 D;  4HY1 A;  4GKK I;  3C4T A;  2EQ1 A;  1A1H A;  4IS1 C;  1I94 E;  1IQO A;  3Q6M A;  4DR2 I;  4PU9 A;  4DV2 E;  2KHX A;  2EMW A;  1H73 A;  2A25 A;  2WNR A;  5A6B D;  3PYD A;  4JI2 I;  4JI5 I;  2UXC E;  2LT7 A;  1X6F A;  5TSE A;  2EPO A;  3THN A;  1UDQ A;  4JI8 E;  2C37 B;  4OZE A;  2EP3 A;  4RPF A;  3M7N D;  2EM7 A;  4LFB I;  1PJS A;  2L3J A;  4B3T E;  4NBQ A;  3ZZU A;  2AE8 A;  1YZ9 A;  2C38 B;  2ZBK B;  5LLQ A;  1N33 I;  5IV8 B;  2JYA A;  4X66 E;  2WCC 3;  4LFB E;  4HAC B;  1Y5Y A;  1BB8 A;  1Z0B A;  3PS2 A;  3VK6 A;  2J65 A;  4QNK A;  2PO1 B;  3P3E A;  2NN6 C;  1OJ4 A;  3M85 D;  2V88 A;  2CTD A;  2YSO A;  2EN3 A;  4U3B A;  4LFA E;  2XEX A;  4J3D A;  4OO1 B;  2NN6 A;  2ZIT A;  4FW6 A;  3C6K A;  4N4R B;  1XNR E;  1X5W A;  2RSI A;  1FKA E;  2EN7 A;  1EA6 A;  2CT1 A;  2CGE A;  4WFT A;  1YHC A;  2PNL A;  1JK1 A;  4R03 A;  2IHR 1;  3LML A;  1NHI A;  4JI7 I;  4P78 A;  3J7A M;  4DPT A;  1MGT A;  3K1J A;  4KQV A;  2F4V E;  2ENA A;  3MHS C;  4JI1 I;  2EMX A;  4R2C A;  3J81 C;  1TN9 A;  2Q8U A;  5DRR A;  2VQE I;  1RR9 A;  1KTV A;  4ZYH A;  1KIJ A;  2UUA I;  4I8O A;  5LMN E;  1B63 A;  1SR9 A;  2EPX A;  3HKM A;  2K4V A;  4LPF A;  2C37 A;  1Z0C A;  5KL2 A;  2EMB A;  2RQL A;  4MU3 A;  1VI7 A;  1LLM C;  2YTP A;  4MYU A;  5KL5 A;  2F4V I;  3FIG A;  1RHY A;  3L7Z B;  1KKH A;  2DIX A;  3QG5 C;  2LV2 A;  2R76 A;  4B3S I;  3B4T A;  1HNW I;  2NN6 E;  1X3C A;  3VYY A;  3PS3 A;  2WZO A;  1EKZ A;  2M7Q A;  3B78 A;  2EMG A;  4B3M E;  1R6L A;  2L2M A;  2V34 A;  2YTO A;  2EMZ A;  2EML A;  2UUB I;  5IWA I;  2PO2 B;  1X6E A;  4DU8 A;  1ZU1 A;  2PNZ B;  1NZ0 A;  4X64 I;  4OOG C;  2LJU A;  1EH7 A;  2I13 A;  4DR1 E;  2EE8 A;  4DR6 I;  4JYA E;  4AQY E;  1J26 A;  4L8N A;  3Q1Q A;  2R1F A;  2EPM X;  1KYQ A;  4MLV A;  1A1L A;  2EOQ A;  4IS9 A;  4USK A;  2UXB I;  1U2R A;  2RPC A;  4I3H A;  5JEA A;  2ELY A;  2V85 A;  2L33 A;  2UU9 E;  4R2Q A;  1H7U A;  2MKD A;  1G2D C;  4HXZ A;  4JI8 I;  2EMY A;  3H09 A;  1E3H A;  5JEA C;  2GPI A;  4UTG A;  2DMI A;  4QNJ A;  3UHM A;  1OYR A;  4M1K A;  2IOP A;  4DU7 A;  5FLX Q;  4DV2 I;  1X6H A;  1RRE A;  3P3G A;  4DV7 I;  1J5E I;  5IT9 Q;  2UXC I;  1B69 A;  2UUC I;  2RTX A;  2EOI A;  4LF8 E;  3J80 Q;  1I94 I;  2BA1 D;  4JV5 E;  1FJG I;  4GKK E;  1BKN A;  1MG7 A;  1WRJ A;  1Y4S A;  5CFF E;  5DNY A;  5L3J A;  4IZK A;  3EPK A;  1EI1 A;  2UUC E;  4JI6 I;  1IQS A;  2E72 A;  5BR8 I;  2JT2 A;  4X8W A;  2WW4 A;  4DV7 E;  1B62 A;  3HJC A;  2DGC A;  1QU6 A;  1XMQ I;  1UHZ A;  5ELW A;  4ED4 A;  3VYX A;  1A1I A;  3K85 A;  1HR0 I;  2EOE A;  1XNQ E;  3P76 A;  2WBT A;  2UU9 I;  4OO1 A;  4DPX A;  5K36 C;  1WHQ A;  2EN2 A;  3HTX A;  2EPU A;  5GME A;  4YHH I;  4LU9 A;  2FGG A;  2JP9 A;  4LF6 E;  2O1U A;  3HUL A;  3QT5 A;  4DUY I;  4Z7Y A;  2PO1 A;  2YZT A;  5AC5 A;  3GLL A;  1A6F A;  2EOJ A;  4ZYG A;  4DV6 E;  1IBL E;  4F6M A;  4P7A A;  4U3D A;  1DAR A;  4DV0 I;  3BGH A;  2JVA A;  1ELO A;  2EM0 A;  4X64 E;  2JE6 A;  2MKN A;  4JI3 E;  2EM8 A;  4DR1 I;  2E1R A;  3JU0 A;  5LMU I;  5AE1 A;  2MC6 A;  2KOU A;  2MC5 A;  4DV1 E;  4LFC E;  4MU1 A;  1IBK I;  4KHP I;  4MDT A;  2M9A A;  2EPL X;  4HYM A;  4DXL A;  2BA0 G;  4IFD D;  1FWK A;  1D6T A;  2OI2 A;  3F6H A;  1MU5 A;  4IFD F;  3BBG A;  2NN6 D;  4KHP E;  5F3W A;  5LMU E;  1PIE A;  2JEA A;  5JEA D;  1UIL A;  2HK3 A;  2L8T A;  3QT6 A;  4WUD A;  1E3P A;  1RC7 A;  4GKJ E;  1X48 A;  4PRV A;  1ZM3 A;  3PRY A;  3F6G A;  2YTF A;  4DV5 E;  2EPR A;  2GLI A; 
#chains in the Genus database with same CATH homology
 4NXN I;  3C4B A;  3ZOQ B;  3V2U C;  4LF6 I;  5LMN I;  2L3C A;  1ZM4 A;  2HK2 A;  1WHN A;  3KWR A;  4BC7 A;  1N34 I;  4TUG A;  3HXL A;  1ZBQ A;  4X65 E;  4LF9 E;  4DR4 I;  2LUP B;  4JI7 E;  2IOQ A;  4WUC A;  4DPW A;  2R42 A;  3D4J A;  4XTJ A;  4TUI A;  4X62 I;  2CPN A;  4LF8 I;  2VF3 A;  2CZ9 A;  2E1M A;  4UT4 A;  4DR5 I;  3DF6 A;  3WU3 A;  4BBY A;  1Z0V A;  1Z0E A;  4F9A B;  4L5N C;  1HK7 A;  4X66 I;  1FWL A;  2HKJ A;  1Z59 A;  2DB2 A;  4JG4 A;  2X36 A;  4DV4 E;  2CG9 A;  2E5L I;  4DR3 E;  2H36 X;  2V2V A;  2ODR C;  3OTO E;  4WUB A;  4JI4 I;  2BM1 A;  2V83 A;  2E5L E;  3K6Q A;  2B7T A;  1O0W A;  2DMY A;  2LUQ A;  3LPS A;  4WSP A;  5A2Q C;  3J80 C;  4B3S E;  1Z5C A;  4K0K E;  4DR4 E;  4LF9 I;  4B3R I;  1N36 E;  1Z0W A;  4IZJ D;  2JR1 A;  1DI2 A;  2HHH E;  4X65 I;  1K47 A;  2V8P A;  3WU4 A;  2JY9 A;  4OX9 E;  4URL A;  3HPZ A;  4DV5 I;  1N32 E;  3IWD A;  4LF5 I;  4JI1 E;  2RS6 A;  2BM0 A;  4BMJ A;  4LF4 I;  1STU A;  2LMZ A;  2YT4 A;  2Z5E A;  3J7A G;  4DR7 I;  1NHH A;  5FLX C;  2Z5B B;  3GON A;  5T6J A;  4LFA I;  3IWB A;  2RSM A;  2JWO A;  4N3O A;  4MYT A;  1X47 A;  2UXD E;  4F9C B;  4JI3 I;  4NXM I;  1GQE A;  1N33 E;  4LF5 E;  2FTX B;  3OML A;  1ZM2 A;  2KON A;  3QT8 A;  3T1Y I;  2G7H A;  1XNQ I;  3MSW A;  4YHH E;  3J7A M;  4JI5 E;  4JI2 E;  3ZKB A;  2EFG A;  2LRS A;  4LTY A;  4B3R E;  2R3V A;  4DR2 E;  4K0K I;  3RMP A;  4FWD A;  4LF7 I;  2HFS A;  2J7K A;  5BR8 E;  3LNU A;  1FJG E;  4JV5 I;  3ADJ A;  1Z0G A;  3T1H E;  1IBM E;  1FNM A;  1USV A;  2M4I A;  1N0V C;  3JAM Q;  1J5E I;  4BS9 A;  4LF7 E;  1ZXN A;  2VF1 A;  2Q2E B;  4P52 A;  2V2Z A;  3QT7 A;  3ZKD A;  1T4O A;  2O1W A;  3DJW A;  4Q28 A;  2B7V A;  5LL6 R;  3OTO I;  4M2Z A;  5IT9 C;  2VQF I;  2PNM A;  1Y4U A;  1PKP A;  4YY3 E;  2Z5C A;  3HPS A;  1S16 A;  3T1Y E;  4JYA I;  4R1F A;  2UXB E;  1PVG A;  2AJ4 A;  3PYE A;  1NHJ A;  4R8O A;  2V89 A;  4FW9 A;  2LE2 A;  2ZM6 E;  2L6M A;  2UXD I;  5IWA E;  2L92 A;  3ZZ0 A;  5ADZ A;  1XHK A;  4DPU A;  4B3M I;  2NUG A;  3IWC A;  3LLH A;  2L2K B;  2VE7 C;  2Z5B A;  1UEK A;  4DKK A;  4GEQ B;  2LTR A;  1WUU A;  2A2D A;  2O1T A;  1HNW E;  4WPY A;  1S4E A;  5AE2 A;  2DSY A;  5A2Q Q;  4BC9 A;  1N34 E;  3AV0 A;  3HQ1 A;  1N32 I;  2N3H A;  3JTZ A;  3J7Y p;  2V87 A;  1X49 A;  3WU6 A;  2UUA E;  1H72 C;  4DUZ E;  4ZVI A;  1HNX E;  1N36 I;  4FWG A;  3ADL A;  5GMD A;  3AUZ A;  2EZ6 A;  1XMO E;  2NA2 A;  2NPF A;  3WU5 A;  3F0N A;  5AAS A;  4IZJ B;  2ODR D;  2LBS B;  4BCA A;  4DV1 I;  2EWL A;  4JI4 E;  3LTO A;  2V2Q A;  2MDR A;  2HFU A;  5FWK A;  4DV0 E;  1GZ6 A;  4J8Z A;  4DV4 I;  4DR3 I;  3ADG A;  3P06 A;  1ZBT A;  2RS7 A;  4IZK B;  3PYF A;  4B3T I;  1VIS A;  1N0U A;  3CWV A;  2LJH A;  1T4N A;  1RQ0 A;  2B9D A;  2A2C A;  1YYW A;  1Z5B A;  4DR5 E;  1IBM I;  3J81 Q;  2LJP A;  1XMO I;  3ZM7 A;  4F54 A;  4X62 E;  2M1S A;  1HNZ E;  1Z0T A;  4IZJ A;  4JI0 E;  4WYQ B;  4M30 A;  2O1V A;  3Q6N A;  1HNX I;  4DUZ I;  3M6A A;  3B82 A;  4Z7C A;  2JOB A;  2FV4 B;  3JAM C;  3ZZT A;  4P7D A;  2X7I A;  2BV3 A;  2N3G A;  4NXN E;  1QZR A;  4NXM E;  1ZM9 A;  4AQY I;  4DR6 E;  1YYK A;  2HKE A;  1USU A;  4DV3 I;  2NUF A;  4GKJ I;  2NUE A;  2B3T B;  4DR7 E;  2UUB E;  2V86 A;  1KVK A;  4USM A;  1FI4 A;  1IBK E;  4LFC I;  1H7S A;  2DEI A;  2ZM6 I;  4DPY A;  4LF4 E;  2DEJ A;  4F9B B;  4DV3 E;  3PYG A;  1IBL I;  4DV6 I;  2V8Q B;  4DUY E;  1ZXM A;  3ADI A;  1Y6Z A;  5AE3 A;  4YY3 I;  2GS8 A;  1DQ3 A;  4EMD A;  3V5R A;  4OX9 I;  1T4L B;  2VQF E;  2HHH I;  2JOX A;  1MX0 A;  1WXR A;  2VQE E;  1XMQ E;  3P1X A;  4FWH A;  4JI0 I;  1HR0 E;  3H4L A;  1YYO A;  2Z5C B;  4M0V A;  1HNZ I;  1H74 A;  1J5E E;  2LTS A;  1Z5A A;  2GQ0 A;  3B8H A;  3T1H I;  4DMI A;  4JI6 E;  2L2N A;  4HAC A;  4FN5 A;  2F8B A;  1XNR I;  4KZS A;  3K17 A;  4HY1 A;  4GKK I;  3C4T A;  1I94 E;  3Q6M A;  4DR2 I;  4PU9 A;  4DV2 E;  2KHX A;  1H73 A;  4JI2 I;  4JI5 I;  3PYD A;  2UXC E;  4RPF A;  4LFB I;  4JI8 E;  2L3J A;  4B3T E;  3ZZU A;  1YZ9 A;  2ZBK B;  1N33 I;  4X66 E;  4LFB E;  4HAC B;  1Z0B A;  3VK6 A;  1OJ4 A;  2V88 A;  4LFA E;  2XEX A;  2ZIT A;  1XNR E;  1EA6 A;  1FKA E;  2CGE A;  4WFT A;  2PNL A;  4R03 A;  2IHR 1;  3LML A;  1NHI A;  4JI7 I;  4P78 A;  4DPT A;  3K1J A;  4KQV A;  2F4V E;  4JI1 I;  3J81 C;  2VQE I;  1RR9 A;  1KTV A;  1KIJ A;  2UUA I;  4I8O A;  5LMN E;  1B63 A;  1SR9 A;  2K4V A;  1Z0C A;  4MYU A;  2F4V I;  3FIG A;  1KKH A;  2DIX A;  4B3S I;  1HNW I;  3VYY A;  2WZO A;  1EKZ A;  2M7Q A;  3B78 A;  4B3M E;  2L2M A;  2V34 A;  2UUB I;  5IWA I;  4DU8 A;  1NZ0 A;  4X64 I;  4OOG C;  4DR1 E;  4DR6 I;  4JYA E;  4AQY E;  1J26 A;  4L8N A;  3Q1Q A;  4USK A;  2UXB I;  1U2R A;  4I3H A;  2V85 A;  2UU9 E;  2L33 A;  1H7U A;  4HXZ A;  4JI8 I;  3H09 A;  4UTG A;  4M1K A;  2IOP A;  4DU7 A;  5FLX Q;  4DV2 I;  4DV7 I;  1RRE A;  5IT9 Q;  2UXC I;  2UUC I;  2RTX A;  4LF8 E;  3J80 Q;  1I94 I;  4JV5 E;  1FJG I;  4GKK E;  1BKN A;  1MG7 A;  1Y4S A;  5CFF E;  5DNY A;  5L3J A;  4IZK A;  1EI1 A;  2UUC E;  4JI6 I;  5BR8 I;  2WW4 A;  4X8W A;  4DV7 E;  1B62 A;  3HJC A;  1QU6 A;  1XMQ I;  1UHZ A;  4ED4 A;  3VYX A;  3K85 A;  1HR0 I;  1XNQ E;  2UU9 I;  4DPX A;  1WHQ A;  3HTX A;  5GME A;  4YHH I;  4LU9 A;  2FGG A;  4LF6 E;  2O1U A;  3HUL A;  3QT5 A;  4DUY I;  4Z7Y A;  2YZT A;  4PRX A;  1A6F A;  4DV6 E;  1IBL E;  4P7A A;  1DAR A;  4DV0 I;  2JVA A;  1ELO A;  4X64 E;  4JI3 E;  4DR1 I;  2E1R A;  3JU0 A;  5LMU I;  5AE1 A;  2MC6 A;  2KOU A;  2MC5 A;  4DV1 E;  4LFC E;  1IBK I;  4KHP I;  4HYM A;  4DXL A;  1FWK A;  1D6T A;  2OI2 A;  3F6H A;  1MU5 A;  4KHP E;  5F3W A;  5LMU E;  1PIE A;  1UIL A;  2HK3 A;  2L8T A;  3QT6 A;  4WUD A;  1RC7 A;  4GKJ E;  1X48 A;  4PRV A;  1ZM3 A;  3PRY A;  3F6G A;  4DV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...