4DR4E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4E02
2V34A 4B3MI 2HHHI 4JI1I 2UUCI 3PYFA 1UHZA 2B7TA 1B62A 2LUPB 3WU6A 1UILA 2JY9A 4JI4E 1ZXMA 3ADJA 2HK2A 2UXBE 1N36I 2UXDI 2A2DA 1I94I 4JI3I 2ZM6I 4DU7A 3J80Q 4JV5E 1XNRI 4LF7I 5IT9C 4LF5I 4HXZA 3B82A 4LFBE 4DV5E 4Z7CA 1HR0I 2NUEA 2IHR1 4JI0I 2AJ4A 1N0UA 2E1RA 4USKA 4LF9E 4HACB 4AQYI 4B3TE 1IBLE 1KIJA 4X62I 4DUYI 2LUQA 4LFCI 2UXCI 3P1XA 1RREA 3PYGA 4RPFA 2YT4A 3J81C 1Z0VA 1PVGA 1KTVA 4MYUA 1NHIA 1N0VC 2VQFI 1ZBTA 4B3SE 3OTOE 3C4BA 5FLXQ 4DR5I 2L3CA 4HACA 1FI4A 1XNQI 2MDRA 1EA6A 2LTRA 1FJGE 4JI7E 3H4LA 2X7IA 4DR3I 4HY1A 1U2RA 4DUZE 4ED4A 1RR9A 1XMQI 4LF6I 4NXNE 3ZZ0A 4NXME 4P7AA 4DV3E 1HNWE 1N33E 1XMOI 2KHXA 1J5EI 3QT5A 1Z0EA 4WUCA 1MX0A 4JI5E 4X66I 4KQVA 4OX9E 4JI6E 2ZITA 3ADIA 4FN5A 2RTXA 1H74A 2V8PA 1T4OA 2HK3A 4K0KI 3WU5A 2F4VI 4B3RE 2LJHA 2VF3A 2UUAI 4DR1E 3GONA 1ZXNA 2L2NA 1O0WA 1OJ4A 4UTGA 1FNMA 4PU9A 4MYTA 4YHHE 4DR2E 4DR6I 4DR7E 4DPXA 2UUBE 1N32E 3ZM7A 4FWGA 4M1KA 1STUA 4JG4A 3J7AG 4DPWA 4JYAE 2DB2A 1GQEA 4X65I 3T1HE 4LFAE 5CFFE 4DV4I 2V2ZA 4KHPE 2HFUA 4B3ME 2HHHE 4JI1E 2UUCE 4UT4A 1N36E 2UXDE 1I94E 4JI3E 2ZM6E 3F0NA 3WU3A 1XNRE 4LF7E 4LF5E 2A2CA 4URLA 1ZM3A 1HR0E 4JI0E 4FWHA 4PRXA 3B78A 1IBKI 4LF8I 1ZM4A 4DV7I 2L2MA 1HNXI 1HNZI 2RS7A 4GKJI 2HKEA 2HKJA 1Z5CA 4AQYE 4USMA 5IWAI 1ELOA 4X62E 2OI2A 2E5LI 4DR4I 4DUYE 4DV1I 2RSMA 2UXCE 4LFCE 5BR8I 1N34I 2LRSA 2ZBKB 3T1YI 2VQFE 3ZZUA 1RQ0A 4DR5E 2NUFA 3QT8A 2R3VA 2JVAA 1YYKA 1XNQE 2VQEI 5L3JA 3PYDA 5A2QQ 1UEKA 2UU9I 4DR3E 1Z0CA 2L3JA 4ZVIA 4JI2I 2EFGA 5LMNI 4M30A 1VISA 4JI8I 1FWLA 5GMEA 1Z0TA 2V2QA 3ZKBA 4X64I 1XMQE 2CPNA 1WHQA 4LF6E 2LJPA 1A6FA 4LF4I 3V5RA 1PKPA 2DEJA 3ADLA 4DXLA 1XMOE 3VYYA 3J81Q 1Z0WA 1EI1A 4DV2I 3PYEA 3HULA 4I3HA 1J5EE 3Q1QA 1IBMI 3J80C 1J26A 4DV6E 1Z5BA 1ZM2A 4X66E 4DV0I 1QZRA 2X36A 2BM0A 4YY3I 1Z0BA 2BV3A 2HFSA 2N3GA 3LNUA 4GKKI 4K0KE 2F4VE 2UUAE 1H73A 1WUUA 4DU8A 5LMUI 1FWKA 2V2VA 5LL6R 1K47A 1YYWA 4WUDA 1PIEA 4M2ZA 2EZ6A 3JAMQ 1H7UA 2DMYA 4DV6I 2Q2EB 4DR6E 3V2UC 4XTJA 1Z0GA 4EMDA 5FLXC 4JI4I 4FW9A 2UXBI 4X65E 1YZ9A 4Z7YA 2LTSA 3VYXA 1YYOA 4DV4E 4JV5I 2R42A 3C4TA 1MG7A 4FWDA 4LFBI 3K1JA 4DV5I 4R1FA 3WU4A 1S4EA 3CWVA 3LPSA 1H7SA 1D6TA 4LF9I 5A2QC 2RS6A 4B3TI 1DI2A 1IBLI 1Z59A 4X8WA 1KKHA 1IBKE 4LF8E 4DKKA 4DV7E 1HNXE 4B3SI 1HNZE 3OTOI 4GKJE 1ZM9A 4OOGC 5GMDA 5IWAE 2DIXA 3LTOA 4WUBA 2E5LE 4DR4E 4DV1E 5BR8E 2WW4A 1QU6A 2BM1A 3J7AM 1BKNA 3M6AA 3J7Yp 1FJGI 1H72C 4JI7I 1N34E 3T1YE 3B8HA 2CZ9A 1NHHA 5IT9Q 4WYQB 1XHKA 2VQEE 1T4LB 2GS8A 4DUZI 1B63A 2L33A 3ADGA 1X48A 2UU9E 4WFTA 4JI2E 2J7KA 4NXNI 4NXMI 4DV3I 1HNWI 3JAMC 5LMNE 1N33I 4JI8E 4HYMA 2B3TB 2B7VA 2N3HA 4JI5I 3QT6A 4DPTA 1WHNA 4OX9I 4X64E 4JI6I 4DPYA 2NA2A 4LF4E 1DARA 4B3RI 1FKAE 3D4JA 4DV2E 4DR1I 3LLHA 1IBME 1EKZA 4DV0E 1S16A 1Z5AA 3ZZTA 1RC7A 3K17A 4PRVA 4YY3E 4P52A 2NUGA 4YHHI 4DR2I 3HTXA 3ZKDA 4DR7I 1X49A 2UUBI 4GKKE 1N32I 2XEXA 2LBSB 4DPUA 1KVKA 1NZ0A 1T4NA 2NPFA 5LMUE 4JYAI 1MU5A 1X47A 2DEIA 2L2KB 3T1HI 4LFAI 4KHPI 3QT7A 1NHJA
chains in the Genus database with same CATH superfamily
2V34A 5KL2A 2R76A 5ELWA 1WXRA 2HHHI 3UHMA 2EQ3A 4B3MI 4JI1I 1F2IG 2UUCI 3PYFA 2M1SA 1A1IA 1UHZA 2B7TA 1B62A 4FW6A 2WZOA 2LUPB 3WU6A 2J7JA 1UILA 2EMHA 2JY9A 4JI4E 1UBDC 3ADJA 1ZXMA 2HK2A 2UXBE 1N36I 2UXDI 4O4KA 2GO4A 2MDGA 2A2DA 1I94I 4JI3I 2NN6C 3P3CA 2EOEA 2ZM6I 2H36X 2FGGA 3CDIA 3U1KA 4DU7A 3J80Q 4TUGA 4JV5E 2CGEA 1XNRI 4LF7I 1PJSA 5IT9C 4HXZA 1UDQA 3B82A 4LF5I 3MSWA 4R2EA 3JTZA 4LFBE 1A1HA 1NHJA 4DV5E 4OO1C 1USVA 4DR4I 1E3HA 4Z7CA 1HR0I 3IWCA 3DJWA 2NUEA 2IHR1 4JI0I 5A69A 2AJ4A 1N0UA 2E1RA 3M85G 4USKA 4LF9E 2FTXB 3M7ND 2RSIA 4HACB 4AQYI 4B3TE 1R6LA 2M7QA 4O24A 4IZKB 2R1FA 1IBLE 1KIJA 5C0XC 2EWLA 4X62I 4DUYI 1A1JA 2LUQA 4LFCI 4F6MA 2PNZA 3P1XA 1A1GA 2LO3A 2UXCI 1RREA 3B4TA 3PYGA 4LPFA 4R2AA 2YTPA 4RPFA 5K36F 2GPIA 2YT4A 3J81C 1Z0VA 2F1DA 4N3OA 2EOQA 1PVGA 5K36A 1KTVA 2EN3A 3OMLA 4MYUA 1NHIA 4LCFA 2EMFA 1N0VC 2VQFI 1ZBTA 4B3SE 2EORA 3K85A 5KL7A 3OTOE 2O1TA 3C4BA 5FLXQ 4DR5I 2EPPA 5JEAF 4FK5C 2L3CA 4HACA 4J3DA 1FI4A 2VESA 5JEAA 4ZYEA 2EOIA 4IZKA 1P42A 1TN9A 3PS1A 5DRQA 1XNQI 2EM3A 2MDRA 1EA6A 3P76A 3Q6NA 2LTRA 1FJGE 2LV2A 2WP8B 4JI7E 2D9HA 2IERA 3H4LA 4FW5A 2X7IA 4DR3I 1TF6A 1DGCA 1N3GA 3VHTB 4NHRA 3BIDA 4HY1A 4WSGA 3GCMA 2EPKX 1USUA 4F6NA 1OYPA 2RQLA 4IFDE 2DMIA 2O1WA 4MQYA 2EMZA 2ENCA 4ZYHA 4DUZE 1U2RA 4ED4A 2EMAA 5DRPA 1RR9A 2NN6F 4IFDD 2YPNA 1XMQI 5C0XB 4FW3A 1NCSA 2F8BA 2JOBA 2JOXA 2G7HA 4LF6I 4NXNE 3ZZ0A 4NXME 2WP8A 4P7AA 2DLQA 4DV3E 1HNWE 1N33E 2EMCA 2HC5A 2EOJA 1XMOI 4OO1F 4BMJA 4OO1A 2KHXA 2EPMX 5AE3A 2YRKA 3HJCA 1Z0EA 3EQ1A 3QT5A 4WUCA 1MX0A 1J5EI 4AM3A 2EE8A 3UK3C 4JI5E 3DD6A 2EM2A 4X66I 4HTGA 2EPRA 1UN6B 2YTIA 2LE2A 4KQVA 3THOB 4OX9E 3DF6A 2ODRC 3EPJA 4JI6E 2JEBB 2ZITA 1SR9A 2VF1A 5A6KA 1T39A 2RTXA 3ADIA 2YWQA 4FN5A 1RMDA 1H74A 2PO0B 2V8PA 1T4OA 2HK3A 5EL9A 4DMIA 3WU5A 3HKMA 5C0XA 4B3RE 2F4VI 4IFDB 4K0KI 3PRYA 5DNYA 2LJHA 2VF3A 2UUAI 4DR1E 2CG9A 2CSHA 3GONA 1ZXNA 2L2NA 4IS1C 2V85A 1O0WA 4WXCA 1OJ4A 1SFEA 2EN8A 4WX9A 4UTGA 2YTNA 1FNMA 4F2JC 1P47A 4PU9A 5DRRA 2JXPA 4MYTA 4YHHE 4DR2E 3HQ1A 4R8OA 4BA1B 4DR7E 2L8TA 4DPXA 4DR6I 2UUBE 1N32E 4OZEA 3ZM7A 4FWGA 4M1KA 1AH5A 1STUA 5IV8B 1NEIA 5KL4A 2DGCA 4JG4A 2WBUA 3PS3A 3L7ZA 3J7AG 2EMKA 2EM5A 2MKNA 4DPWA 2A25A 4L5NC 5A6BD 4JYAE 1RHYA 1Y60A 2YSPA 5IXMB 2CT1A 2DB2A 1GQEA 4X65I 2JWOA 3HXLA 3T1HE 4LFAE 5CFFE 4KWYA 5T6JA 4DV4I 2V2ZA 4KHPE 2HFUA 1UDSA 4B3ME 3PS2A 2HHHE 4JI1E 2UUCE 4MU3A 2JPAA 2EPCA 2C37B 1EH7A 1GZ6A 2EOZA 2MC6A 4UT4A 3H09A 2DLKA 2BBGA 1N36E 4AIMA 2UXDE 3GLLA 2GO3A 4KZSA 1I94E 4JI3E 2ZM6E 1UDOA 4GZNC 4R2DA 1KJKA 2EPZA 3F0NA 3WU3A 4MLQA 4LF7E 1XNRE 4LF5E 1ZR9A 2EMWA 2YU8A 1YPNA 2BA0G 2A2CA 1WJPA 4URLA 1ZM3A 2EMYA 3Q6MA 1HR0E 4O43A 4M0VA 2YTDA 3VK6A 5AC5A 4JI0E 4FWHA 2EQ0A 3B78A 4PRXA 1IBKI 2JR1A 4LF8I 2LVHA 2DSYA 2EL6A 2EN7A 1ZM4A 4DV7I 2GQ0A 2I9IA 2L2MA 1HNXI 1HNZI 2RS7A 2PO1B 4GKJI 2YTJA 2HKEA 2HKJA 4IS9A 1Z5CA 4AQYE 4USMA 5IWAI 1ZU1A 2EQ1A 4J8ZA 4LU9A 1ELOA 2IESA 4X62E 2NN6E 2OI2A 2E5LI 4DUYE 1LLMC 2RSMA 2UXCE 4LFCE 4DV1I 1Y6ZA 5BR8I 2V8QB 2EOFA 1IMUA 2Z5BB 5ADZA 4O5GA 2EPAA 4OO1E 4BC7A 3ZOQB 1N34I 2LRSA 4NZVA 4X9JA 2ZBKB 3T1YI 4IFDC 2VQFE 3U1YA 3ZZUA 1RQ0A 5DNXA 4F9AB 4DR5E 2NUFA 1VI7A 2LJUA 1YHCA 2R3VA 3QT8A 2B9DA 2PO1A 1Z1BA 3RMPA 2JVAA 2BA1G 1YYKA 1XNQE 2VQEI 2YTFA 4P78A 3H1CA 5L3JA 2O1UA 4GEQB 3PYDA 3KRNA 5A2QQ 3M85D 3TQMA 1UEKA 2UU9I 4DR3E 1Z0CA 2Z5BA 2L3JA 2EM0A 4ISAA 4ZVIA 4JI2I 2CVEA 2EFGA 2E72A 5LMNI 1JK2A 4M30A 2Z5CB 1VISA 4M9VC 5DROA 4JI8I 1OYSA 2WBSA 4Q35B 1FWLA 1L4SA 2PRTA 1QNTA 2C38B 5GMEA 1YUJA 1Z0TA 2PNLA 2EL5A 4BHBA 2V2QA 1IQOA 3ZKBA 1XMQE 4X64I 2CPNA 5KL6A 2EMXA 1WHQA 4LF6E 2YSOA 2LJPA 1A6FA 4MDTA 4LF4I 4BA2B 3KWRA 2AE8A 2C39B 3V5RA 5A6AA 1PKPA 2DEJA 4OKGA 4QNJA 2EOHA 3ADLA 1XMOE 3QG5C 5TSEA 3VYYA 4DXLA 1Z0WA 3J81Q 4BBYA 1EI1A 4DV2I 3PYEA 4LCGA 3HULA 3L00A 1J5EE 4I3HA 3Q1QA 1IBMI 3KZZA 3J80C 1G2DC 2EN1A 2Z5CA 4N4RB 5EKWA 4DV6E 1J26A 1Z5BA 1ZM2A 4X66E 4DV0I 2YTGA 3F6HA 4BS9A 1QZRA 3AUZA 2X36A 4F9BB 2EM4A 2BM0A 4YY3I 4BHCA 1Z0BA 4FW4A 5FWKA 2BV3A 2C38A 4Q28A 2HFSA 2N3GA 1XXEA 3LNUA 1E3PA 4GKKI 4K0KE 2F4VE 4L8NA 2N8XA 1Y4UA 4U3DA 1BBGA 4WXDA 2UUAE 5KL3A 1H73A 4MU0A 3C6MA 1YUIA 1WUUA 2WCC3 3K6QA 2BR2B 2E1MA 1FWKA 2JEBA 1AAYA 2V2VA 4DU8A 5LMUI 1EH6A 2V88A 3MHSC 5LL6R 5KL5A 1YFHA 2HGHA 1YYWA 1K47A 2PO0A 4IFDF 3M7NG 4WUDA 4F9CB 4IFDA 4WSPA 1TF3A 4M2ZA 1PIEA 3KZYA 1A1FA 3HPZA 2EZ6A 3JAMQ 1H7UA 2DMYA 2EPUA 3EPHA 2Q2EB 1BB8A 4DR6E 4DV6I 2V89A 2K7IA 3BGHA 3V2UC 5K36E 4XTJA 1X6EA 4BC9A 1Z0GA 3CDJA 4EMDA 3P3EA 5FLXC 4MU4A 2EMGA 1KYQA 5K36D 2JYAA 4JI4I 2M9AA 5AC4A 4FW9A 2UXBI 4X65E 2Z5EA 1YZ9A 2BR2A 4FW7A 4Z7YA 1YH8A 2LTSA 3VYXA 5JEAE 2V83A 1YYOA 4DV4E 2PNMA 4JV5I 2R42A 2JT2A 3C4TA 1MG7A 4FWDA 2EM6A 4LFBI 3K1JA 2J65A 4DV5I 3BF2A 5JEAD 4R1FA 3WU4A 1T38A 4LOMA 2EN4A 1S4EA 2L92A 3CWVA 3LPSA 1MEYC 1H7SA 2EPLX 3NZKA 2WNRB 2EM8A 2JE6B 2PNZB 2ENHA 2K4VA 1D6TA 4LF9I 5A2QC 2L6MA 3IWBA 2RS6A 2YRMA 1PJQA 2LCEA 2C37A 4B3TI 1DI2A 2VE7C 4RH8A 1B69A 4R2SA 1Z59A 4X8WA 1IBLI 5K36B 2EMBA 2JEAB 2GLIA 4P7DA 2DRPA 2MKDA 4IZJD 1KKHA 4MU1A 4R2QA 1EH8A 1HK7A 3P06A 2WBTA 2FV4B 3JU0A 1IBKE 2EN2A 5A6BA 4LF8E 2KOUA 4DKKA 4DV7E 5JEAB 2EJ4A 2LMZA 2NN6D 1HNXE 4B3SI 1BBOA 1HNZE 2WNRA 3OTOI 4GKJE 1ZM9A 2JE6A 1X6FA 4OOGC 1Y5YA 5GMDA 5IWAE 2DIXA 1DQ3A 3EPKA 3LTOA 2O1VA 5LLQA 4WUBA 2E5LE 4DR4E 4DV1E 4OO1D 4RHBB 5BR8E 5AASA 1QU6A 2ENAA 4I8OA 3ECRA 2LT7A 2BM1A 2WW4A 1MGTA 4WPYA 3J7AM 1BKNA 1PJTA 2YRHA 3IWDA 1OYRA 3M6AA 2JEAA 1G2FC 2IOQA 3J7Yp 1FJGI 1H72C 2PO2B 2GHFA 4BCAA 5C0XE 4JI7I 1N34E 4R2CA 2EP3A 2MC5A 4R03A 3T1YE 2ADRA 2CZ9A 3B8HA 1NHHA 4IZJB 2NABA 5IT9Q 5C0XD 4LCHA 5AE1A 1IQSA 2YZTA 4HEIA 2EM9A 1PDAA 4WYQB 2EOXA 2V86A 2NN6B 1XHKA 3LMLA 2BA0D 2VQEE 5DNLA 1T4LB 4NBQA 3FIGA 3HPSA 2GS8A 4DUZI 1B63A 2L33A 3ADGA 1X48A 4OO1B 2EOYA 3MHHC 2UU9E 4QNKA 4WFTA 4JI2E 3M99B 2EOMA 1WRJA 1A1LA 2J7KA 2YTEA 2PO2A 4NXNI 4NXMI 2Q8UA 2EPOA 4DV3I 1HNWI 3JAMC 5LMNE 1N33I 2EL4A 2VRDA 3THNA 4JI8E 4R2RA 4IZJA 4HYMA 2B3TB 4F54A 2B7VA 1X5WA 2N3HA 4JI5I 4IJDA 3GMEA 2V87A 3QT6A 2JP9A 2NN6A 4DPTA 3AV0A 2YTOA 1WHNA 2YTQA 4OX9I 4X64E 4ZYGA 1Y4SA 4JI6I 3BBGA 2NA2A 4DPYA 2EMLA 2BB8A 4LF4E 2EOOA 5AE2A 1DARA 4B3RI 1FKAE 3C6KA 3D4JA 2ELZA 4MLVA 2EN6A 1X3CA 2RPCA 4R2PA 4DV2E 1YSAC 2EMIA 2IOPA 2YU5A 5A6JA 4DR1I 3LLHA 1IBME 2BA1D 4U3BA 3P3GA 5C0XF 1EKZA 1GTKA 4DV0E 1S16A 1Z5AA 4BA2A 3ZZTA 1RC7A 2C39A 3K17A 4BA1A 4PRVA 5K36C 4ZYDA 1UDNA 1X6HA 4YY3E 4P52A 4GQUA 1ZBQA 2NUGA 3L7ZB 2ELYA 1R6MA 2KONA 4YHHI 2I13A 2CTDA 4DR2I 3HTXA 3ZKDA 4DR7I 1X49A 2UUBI 4GKKE 1N32I 2XEXA 2EPXA 2LBSB 4DPUA 2O3ZA 1KVKA 2EOSA 1NZ0A 5JEAC 1ZAAC 1T4NA 5F3WA 2NPFA 5LMUE 4JYAI 4LTYA 3F6GA 1JK1A 4AIDA 1MU5A 1X47A 2DEIA 2L2KB 2M4IA 2ODRD 3T1HI 4LFAI 2EM7A 2EPNA 4TUIA 4KHPI 3QT7A 3EPLA 2HJJA 1A1KA
chains in the Genus database with same CATH topology
2V34A 4B3MI 1WXRA 2HHHI 4JI1I 2UUCI 3PYFA 2M1SA 1UHZA 2B7TA 1B62A 2WZOA 2LUPB 3WU6A 1UILA 2JY9A 4JI4E 1ZXMA 3ADJA 2HK2A 2UXBE 1N36I 2UXDI 2A2DA 1I94I 4JI3I 2ZM6I 2H36X 2FGGA 4DU7A 3J80Q 4TUGA 4JV5E 2CGEA 1XNRI 4LF7I 5IT9C 4LF5I 4HXZA 3B82A 3MSWA 3JTZA 4LFBE 1NHJA 4DV5E 1USVA 4Z7CA 1HR0I 3IWCA 3DJWA 2NUEA 2IHR1 4JI0I 2AJ4A 1N0UA 2E1RA 4USKA 4LF9E 2FTXB 4HACB 4AQYI 4B3TE 2M7QA 4IZKB 1IBLE 1KIJA 2EWLA 4X62I 4DUYI 2LUQA 4LFCI 2UXCI 3P1XA 1RREA 3PYGA 4RPFA 2YT4A 3J81C 1Z0VA 4N3OA 1PVGA 1KTVA 3OMLA 4MYUA 1NHIA 1N0VC 2VQFI 1ZBTA 4B3SE 3K85A 3OTOE 2O1TA 3C4BA 5FLXQ 4DR5I 2L3CA 4HACA 1FI4A 1XNQI 4IZKA 2MDRA 1EA6A 3Q6NA 2LTRA 1FJGE 4JI7E 3H4LA 2X7IA 4DR3I 4HY1A 1USUA 2O1WA 1U2RA 4DUZE 4ED4A 1RR9A 1XMQI 2F8BA 2JOBA 2JOXA 2G7HA 4LF6I 4NXNE 3ZZ0A 4NXME 4P7AA 4DV3E 1HNWE 1N33E 1XMOI 4BMJA 2KHXA 5AE3A 3HJCA 1J5EI 3QT5A 1Z0EA 4WUCA 1MX0A 4JI5E 4X66I 2LE2A 4KQVA 4OX9E 3DF6A 2ODRC 4JI6E 2ZITA 1SR9A 2VF1A 3ADIA 4FN5A 2RTXA 1H74A 2V8PA 1T4OA 2HK3A 4K0KI 4DMIA 3WU5A 2F4VI 4B3RE 3PRYA 5DNYA 2LJHA 2VF3A 2UUAI 4DR1E 2CG9A 3GONA 1ZXNA 2L2NA 2V85A 1O0WA 1OJ4A 4UTGA 1FNMA 4PU9A 4MYTA 4YHHE 4DR2E 3HQ1A 4R8OA 4DR6I 4DR7E 2L8TA 4DPXA 2UUBE 1N32E 3ZM7A 4FWGA 4M1KA 1STUA 4JG4A 3J7AG 4DPWA 4L5NC 4JYAE 2DB2A 1GQEA 4X65I 2JWOA 3HXLA 4LFAE 3T1HE 5CFFE 5T6JA 4DV4I 2V2ZA 4KHPE 2HFUA 4B3ME 2HHHE 4JI1E 2UUCE 1GZ6A 2MC6A 4UT4A 3H09A 1N36E 2UXDE 4KZSA 1I94E 4JI3E 2ZM6E 3F0NA 3WU3A 1XNRE 4LF7E 4LF5E 2A2CA 4URLA 1ZM3A 3Q6MA 1HR0E 4M0VA 3VK6A 4JI0E 4FWHA 4PRXA 3B78A 1IBKI 2JR1A 4LF8I 2DSYA 1ZM4A 4DV7I 2GQ0A 2L2MA 1HNXI 1HNZI 2RS7A 4GKJI 2HKEA 2HKJA 1Z5CA 4AQYE 4USMA 5IWAI 4J8ZA 4LU9A 1ELOA 4X62E 2OI2A 2E5LI 4DR4I 4DUYE 4DV1I 2RSMA 2UXCE 4LFCE 5BR8I 1Y6ZA 2V8QB 2Z5BB 5ADZA 4BC7A 3ZOQB 1N34I 2LRSA 2ZBKB 3T1YI 2VQFE 3ZZUA 1RQ0A 4F9AB 4DR5E 2NUFA 3QT8A 2R3VA 2B9DA 3RMPA 2JVAA 1YYKA 1XNQE 2VQEI 4P78A 5L3JA 2O1UA 4GEQB 3PYDA 5A2QQ 1UEKA 2UU9I 4DR3E 1Z0CA 2Z5BA 2L3JA 4ZVIA 4JI2I 2EFGA 5LMNI 4M30A 2Z5CB 1VISA 4JI8I 1FWLA 5GMEA 1Z0TA 2PNLA 2V2QA 3ZKBA 4X64I 1XMQE 2CPNA 1WHQA 4LF6E 2LJPA 1A6FA 4LF4I 3KWRA 3V5RA 1PKPA 2DEJA 3ADLA 4DXLA 1XMOE 3VYYA 3J81Q 1Z0WA 4BBYA 1EI1A 4DV2I 3PYEA 3HULA 4I3HA 1J5EE 3Q1QA 1IBMI 3J80C 2Z5CA 1J26A 1Z5BA 1ZM2A 4X66E 4DV0I 4BS9A 3F6HA 1QZRA 3AUZA 2X36A 4F9BB 2BM0A 4YY3I 1Z0BA 5FWKA 2BV3A 4Q28A 2HFSA 2N3GA 3LNUA 4GKKI 4K0KE 2F4VE 4L8NA 1Y4UA 2UUAE 1H73A 1WUUA 4DU8A 3K6QA 5LMUI 2E1MA 1FWKA 2V2VA 2V88A 5LL6R 1K47A 1YYWA 4WUDA 4F9CB 4WSPA 4M2ZA 1PIEA 3HPZA 2EZ6A 3JAMQ 1H7UA 2DMYA 4DV6I 2Q2EB 4DR6E 2V89A 3V2UC 4XTJA 4BC9A 1Z0GA 4EMDA 5FLXC 4JI4I 4FW9A 2UXBI 4X65E 2Z5EA 1YZ9A 4Z7YA 2LTSA 3VYXA 2V83A 1YYOA 4DV4E 2PNMA 4JV5I 2R42A 3C4TA 1MG7A 4FWDA 4LFBI 3K1JA 4DV5I 4R1FA 3WU4A 1S4EA 3CWVA 2L92A 3LPSA 1H7SA 2K4VA 1D6TA 4LF9I 5A2QC 2L6MA 3IWBA 2RS6A 4B3TI 1DI2A 2VE7C 1IBLI 1Z59A 4X8WA 4P7DA 4IZJD 1KKHA 1HK7A 3P06A 1IBKE 2FV4B 3JU0A 4LF8E 2KOUA 4DKKA 4DV7E 2LMZA 1HNXE 4B3SI 1HNZE 3OTOI 4GKJE 1ZM9A 4OOGC 5GMDA 5IWAE 2DIXA 1DQ3A 3LTOA 2O1VA 4WUBA 2E5LE 4DR4E 4DV1E 5BR8E 5AASA 1QU6A 2BM1A 4I8OA 2WW4A 4WPYA 3J7AM 1BKNA 3IWDA 3M6AA 2IOQA 3J7Yp 1FJGI 1H72C 4BCAA 4JI7I 1N34E 2MC5A 4R03A 3T1YE 3B8HA 2CZ9A 1NHHA 4IZJB 5IT9Q 5AE1A 2YZTA 4WYQB 2V86A 1XHKA 3LMLA 2VQEE 1T4LB 3FIGA 3HPSA 2GS8A 4DUZI 1B63A 2L33A 3ADGA 1X48A 2UU9E 4WFTA 4JI2E 2J7KA 4NXNI 4NXMI 4DV3I 1HNWI 3JAMC 5LMNE 1N33I 4JI8E 4IZJA 4HYMA 2B3TB 4F54A 2B7VA 2N3HA 4JI5I 3QT6A 2V87A 4DPTA 3AV0A 1WHNA 4OX9I 4X64E 1Y4SA 4JI6I 4DPYA 2NA2A 4LF4E 5AE2A 1DARA 4B3RI 1FKAE 3D4JA 2IOPA 4DV2E 4DR1I 3LLHA 1IBME 1EKZA 4DV0E 1S16A 1Z5AA 3ZZTA 1RC7A 3K17A 4PRVA 4YY3E 4P52A 1ZBQA 2NUGA 2KONA 4YHHI 4DR2I 3HTXA 3ZKDA 4DR7I 1X49A 2UUBI 4GKKE 1N32I 2XEXA 2LBSB 4DPUA 1KVKA 1NZ0A 1T4NA 5F3WA 2NPFA 5LMUE 4JYAI 4LTYA 3F6GA 1MU5A 1X47A 2DEIA 2L2KB 2M4IA 2ODRD 3T1HI 4LFAI 4TUIA 4KHPI 3QT7A 4DV6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V34 A;  4B3M I;  2HHH I;  4JI1 I;  2UUC I;  3PYF A;  1UHZ A;  2B7T A;  1B62 A;  2LUP B;  3WU6 A;  1UIL A;  2JY9 A;  4JI4 E;  1ZXM A;  3ADJ A;  2HK2 A;  2UXB E;  1N36 I;  2UXD I;  2A2D A;  1I94 I;  4JI3 I;  2ZM6 I;  4DU7 A;  3J80 Q;  4JV5 E;  1XNR I;  4LF7 I;  5IT9 C;  4LF5 I;  4HXZ A;  3B82 A;  4LFB E;  4DV5 E;  4Z7C A;  1HR0 I;  2NUE A;  2IHR 1;  4JI0 I;  2AJ4 A;  1N0U A;  2E1R A;  4USK A;  4LF9 E;  4HAC B;  4AQY I;  4B3T E;  1IBL E;  1KIJ A;  4X62 I;  4DUY I;  2LUQ A;  4LFC I;  2UXC I;  3P1X A;  1RRE A;  3PYG A;  4RPF A;  2YT4 A;  3J81 C;  1Z0V A;  1PVG A;  1KTV A;  4MYU A;  1NHI A;  1N0V C;  2VQF I;  1ZBT A;  4B3S E;  3OTO E;  3C4B A;  5FLX Q;  4DR5 I;  2L3C A;  4HAC A;  1FI4 A;  1XNQ I;  2MDR A;  1EA6 A;  2LTR A;  1FJG E;  4JI7 E;  3H4L A;  2X7I A;  4DR3 I;  4HY1 A;  1U2R A;  4DUZ E;  4ED4 A;  1RR9 A;  1XMQ I;  4LF6 I;  4NXN E;  3ZZ0 A;  4NXM E;  4P7A A;  4DV3 E;  1HNW E;  1N33 E;  1XMO I;  2KHX A;  1J5E I;  3QT5 A;  1Z0E A;  4WUC A;  1MX0 A;  4JI5 E;  4X66 I;  4KQV A;  4OX9 E;  4JI6 E;  2ZIT A;  3ADI A;  4FN5 A;  2RTX A;  1H74 A;  2V8P A;  1T4O A;  2HK3 A;  4K0K I;  3WU5 A;  2F4V I;  4B3R E;  2LJH A;  2VF3 A;  2UUA I;  4DR1 E;  3GON A;  1ZXN A;  2L2N A;  1O0W A;  1OJ4 A;  4UTG A;  1FNM A;  4PU9 A;  4MYT A;  4YHH E;  4DR2 E;  4DR6 I;  4DR7 E;  4DPX A;  2UUB E;  1N32 E;  3ZM7 A;  4FWG A;  4M1K A;  1STU A;  4JG4 A;  3J7A G;  4DPW A;  4JYA E;  2DB2 A;  1GQE A;  4X65 I;  3T1H E;  4LFA E;  5CFF E;  4DV4 I;  2V2Z A;  4KHP E;  2HFU A;  4B3M E;  2HHH E;  4JI1 E;  2UUC E;  4UT4 A;  1N36 E;  2UXD E;  1I94 E;  4JI3 E;  2ZM6 E;  3F0N A;  3WU3 A;  1XNR E;  4LF7 E;  4LF5 E;  2A2C A;  4URL A;  1ZM3 A;  1HR0 E;  4JI0 E;  4FWH A;  4PRX A;  3B78 A;  1IBK I;  4LF8 I;  1ZM4 A;  4DV7 I;  2L2M A;  1HNX I;  1HNZ I;  2RS7 A;  4GKJ I;  2HKE A;  2HKJ A;  1Z5C A;  4AQY E;  4USM A;  5IWA I;  1ELO A;  4X62 E;  2OI2 A;  2E5L I;  4DR4 I;  4DUY E;  4DV1 I;  2RSM A;  2UXC E;  4LFC E;  5BR8 I;  1N34 I;  2LRS A;  2ZBK B;  3T1Y I;  2VQF E;  3ZZU A;  1RQ0 A;  4DR5 E;  2NUF A;  3QT8 A;  2R3V A;  2JVA A;  1YYK A;  1XNQ E;  2VQE I;  5L3J A;  3PYD A;  5A2Q Q;  1UEK A;  2UU9 I;  4DR3 E;  1Z0C A;  2L3J A;  4ZVI A;  4JI2 I;  2EFG A;  5LMN I;  4M30 A;  1VIS A;  4JI8 I;  1FWL A;  5GME A;  1Z0T A;  2V2Q A;  3ZKB A;  4X64 I;  1XMQ E;  2CPN A;  1WHQ A;  4LF6 E;  2LJP A;  1A6F A;  4LF4 I;  3V5R A;  1PKP A;  2DEJ A;  3ADL A;  4DXL A;  1XMO E;  3VYY A;  3J81 Q;  1Z0W A;  1EI1 A;  4DV2 I;  3PYE A;  3HUL A;  4I3H A;  1J5E E;  3Q1Q A;  1IBM I;  3J80 C;  1J26 A;  4DV6 E;  1Z5B A;  1ZM2 A;  4X66 E;  4DV0 I;  1QZR A;  2X36 A;  2BM0 A;  4YY3 I;  1Z0B A;  2BV3 A;  2HFS A;  2N3G A;  3LNU A;  4GKK I;  4K0K E;  2F4V E;  2UUA E;  1H73 A;  1WUU A;  4DU8 A;  5LMU I;  1FWK A;  2V2V A;  5LL6 R;  1K47 A;  1YYW A;  4WUD A;  1PIE A;  4M2Z A;  2EZ6 A;  3JAM Q;  1H7U A;  2DMY A;  4DV6 I;  2Q2E B;  4DR6 E;  3V2U C;  4XTJ A;  1Z0G A;  4EMD A;  5FLX C;  4JI4 I;  4FW9 A;  2UXB I;  4X65 E;  1YZ9 A;  4Z7Y A;  2LTS A;  3VYX A;  1YYO A;  4DV4 E;  4JV5 I;  2R42 A;  3C4T A;  1MG7 A;  4FWD A;  4LFB I;  3K1J A;  4DV5 I;  4R1F A;  3WU4 A;  1S4E A;  3CWV A;  3LPS A;  1H7S A;  1D6T A;  4LF9 I;  5A2Q C;  2RS6 A;  4B3T I;  1DI2 A;  1IBL I;  1Z59 A;  4X8W A;  1KKH A;  1IBK E;  4LF8 E;  4DKK A;  4DV7 E;  1HNX E;  4B3S I;  1HNZ E;  3OTO I;  4GKJ E;  1ZM9 A;  4OOG C;  5GMD A;  5IWA E;  2DIX A;  3LTO A;  4WUB A;  2E5L E;  4DR4 E;  4DV1 E;  5BR8 E;  2WW4 A;  1QU6 A;  2BM1 A;  3J7A M;  1BKN A;  3M6A A;  3J7Y p;  1FJG I;  1H72 C;  4JI7 I;  1N34 E;  3T1Y E;  3B8H A;  2CZ9 A;  1NHH A;  5IT9 Q;  4WYQ B;  1XHK A;  2VQE E;  1T4L B;  2GS8 A;  4DUZ I;  1B63 A;  2L33 A;  3ADG A;  1X48 A;  2UU9 E;  4WFT A;  4JI2 E;  2J7K A;  4NXN I;  4NXM I;  4DV3 I;  1HNW I;  3JAM C;  5LMN E;  1N33 I;  4JI8 E;  4HYM A;  2B3T B;  2B7V A;  2N3H A;  4JI5 I;  3QT6 A;  4DPT A;  1WHN A;  4OX9 I;  4X64 E;  4JI6 I;  4DPY A;  2NA2 A;  4LF4 E;  1DAR A;  4B3R I;  1FKA E;  3D4J A;  4DV2 E;  4DR1 I;  3LLH A;  1IBM E;  1EKZ A;  4DV0 E;  1S16 A;  1Z5A A;  3ZZT A;  1RC7 A;  3K17 A;  4PRV A;  4YY3 E;  4P52 A;  2NUG A;  4YHH I;  4DR2 I;  3HTX A;  3ZKD A;  4DR7 I;  1X49 A;  2UUB I;  4GKK E;  1N32 I;  2XEX A;  2LBS B;  4DPU A;  1KVK A;  1NZ0 A;  1T4N A;  2NPF A;  5LMU E;  4JYA I;  1MU5 A;  1X47 A;  2DEI A;  2L2K B;  3T1H I;  4LFA I;  4KHP I;  3QT7 A;  1NHJ A; 
#chains in the Genus database with same CATH topology
 2V34 A;  5KL2 A;  2R76 A;  5ELW A;  1WXR A;  2HHH I;  3UHM A;  2EQ3 A;  4B3M I;  4JI1 I;  1F2I G;  2UUC I;  3PYF A;  2M1S A;  1A1I A;  1UHZ A;  2B7T A;  1B62 A;  4FW6 A;  2WZO A;  2LUP B;  3WU6 A;  2J7J A;  1UIL A;  2EMH A;  2JY9 A;  4JI4 E;  1UBD C;  3ADJ A;  1ZXM A;  2HK2 A;  2UXB E;  1N36 I;  2UXD I;  4O4K A;  2GO4 A;  2MDG A;  2A2D A;  1I94 I;  4JI3 I;  2NN6 C;  3P3C A;  2EOE A;  2ZM6 I;  2H36 X;  2FGG A;  3CDI A;  3U1K A;  4DU7 A;  3J80 Q;  4TUG A;  4JV5 E;  2CGE A;  1XNR I;  4LF7 I;  1PJS A;  5IT9 C;  4HXZ A;  1UDQ A;  3B82 A;  4LF5 I;  3MSW A;  4R2E A;  3JTZ A;  4LFB E;  1A1H A;  1NHJ A;  4DV5 E;  4OO1 C;  1USV A;  4DR4 I;  1E3H A;  4Z7C A;  1HR0 I;  3IWC A;  3DJW A;  2NUE A;  2IHR 1;  4JI0 I;  5A69 A;  2AJ4 A;  1N0U A;  2E1R A;  3M85 G;  4USK A;  4LF9 E;  2FTX B;  3M7N D;  2RSI A;  4HAC B;  4AQY I;  4B3T E;  1R6L A;  2M7Q A;  4O24 A;  4IZK B;  2R1F A;  1IBL E;  1KIJ A;  5C0X C;  2EWL A;  4X62 I;  4DUY I;  1A1J A;  2LUQ A;  4LFC I;  4F6M A;  2PNZ A;  3P1X A;  1A1G A;  2LO3 A;  2UXC I;  1RRE A;  3B4T A;  3PYG A;  4LPF A;  4R2A A;  2YTP A;  4RPF A;  5K36 F;  2GPI A;  2YT4 A;  3J81 C;  1Z0V A;  2F1D A;  4N3O A;  2EOQ A;  1PVG A;  5K36 A;  1KTV A;  2EN3 A;  3OML A;  4MYU A;  1NHI A;  4LCF A;  2EMF A;  1N0V C;  2VQF I;  1ZBT A;  4B3S E;  2EOR A;  3K85 A;  5KL7 A;  3OTO E;  2O1T A;  3C4B A;  5FLX Q;  4DR5 I;  2EPP A;  5JEA F;  4FK5 C;  2L3C A;  4HAC A;  4J3D A;  1FI4 A;  2VES A;  5JEA A;  4ZYE A;  2EOI A;  4IZK A;  1P42 A;  1TN9 A;  3PS1 A;  5DRQ A;  1XNQ I;  2EM3 A;  2MDR A;  1EA6 A;  3P76 A;  3Q6N A;  2LTR A;  1FJG E;  2LV2 A;  2WP8 B;  4JI7 E;  2D9H A;  2IER A;  3H4L A;  4FW5 A;  2X7I A;  4DR3 I;  1TF6 A;  1DGC A;  1N3G A;  3VHT B;  4NHR A;  3BID A;  4HY1 A;  4WSG A;  3GCM A;  2EPK X;  1USU A;  4F6N A;  1OYP A;  2RQL A;  4IFD E;  2DMI A;  2O1W A;  4MQY A;  2EMZ A;  2ENC A;  4ZYH A;  4DUZ E;  1U2R A;  4ED4 A;  2EMA A;  5DRP A;  1RR9 A;  2NN6 F;  4IFD D;  2YPN A;  1XMQ I;  5C0X B;  4FW3 A;  1NCS A;  2F8B A;  2JOB A;  2JOX A;  2G7H A;  4LF6 I;  4NXN E;  3ZZ0 A;  4NXM E;  2WP8 A;  4P7A A;  2DLQ A;  4DV3 E;  1HNW E;  1N33 E;  2EMC A;  2HC5 A;  2EOJ A;  1XMO I;  4OO1 F;  4BMJ A;  4OO1 A;  2KHX A;  2EPM X;  5AE3 A;  2YRK A;  3HJC A;  1Z0E A;  3EQ1 A;  3QT5 A;  4WUC A;  1MX0 A;  1J5E I;  4AM3 A;  2EE8 A;  3UK3 C;  4JI5 E;  3DD6 A;  2EM2 A;  4X66 I;  4HTG A;  2EPR A;  1UN6 B;  2YTI A;  2LE2 A;  4KQV A;  3THO B;  4OX9 E;  3DF6 A;  2ODR C;  3EPJ A;  4JI6 E;  2JEB B;  2ZIT A;  1SR9 A;  2VF1 A;  5A6K A;  1T39 A;  2RTX A;  3ADI A;  2YWQ A;  4FN5 A;  1RMD A;  1H74 A;  2PO0 B;  2V8P A;  1T4O A;  2HK3 A;  5EL9 A;  4DMI A;  3WU5 A;  3HKM A;  5C0X A;  4B3R E;  2F4V I;  4IFD B;  4K0K I;  3PRY A;  5DNY A;  2LJH A;  2VF3 A;  2UUA I;  4DR1 E;  2CG9 A;  2CSH A;  3GON A;  1ZXN A;  2L2N A;  4IS1 C;  2V85 A;  1O0W A;  4WXC A;  1OJ4 A;  1SFE A;  2EN8 A;  4WX9 A;  4UTG A;  2YTN A;  1FNM A;  4F2J C;  1P47 A;  4PU9 A;  5DRR A;  2JXP A;  4MYT A;  4YHH E;  4DR2 E;  3HQ1 A;  4R8O A;  4BA1 B;  4DR7 E;  2L8T A;  4DPX A;  4DR6 I;  2UUB E;  1N32 E;  4OZE A;  3ZM7 A;  4FWG A;  4M1K A;  1AH5 A;  1STU A;  5IV8 B;  1NEI A;  5KL4 A;  2DGC A;  4JG4 A;  2WBU A;  3PS3 A;  3L7Z A;  3J7A G;  2EMK A;  2EM5 A;  2MKN A;  4DPW A;  2A25 A;  4L5N C;  5A6B D;  4JYA E;  1RHY A;  1Y60 A;  2YSP A;  5IXM B;  2CT1 A;  2DB2 A;  1GQE A;  4X65 I;  2JWO A;  3HXL A;  3T1H E;  4LFA E;  5CFF E;  4KWY A;  5T6J A;  4DV4 I;  2V2Z A;  4KHP E;  2HFU A;  1UDS A;  4B3M E;  3PS2 A;  2HHH E;  4JI1 E;  2UUC E;  4MU3 A;  2JPA A;  2EPC A;  2C37 B;  1EH7 A;  1GZ6 A;  2EOZ A;  2MC6 A;  4UT4 A;  3H09 A;  2DLK A;  2BBG A;  1N36 E;  4AIM A;  2UXD E;  3GLL A;  2GO3 A;  4KZS A;  1I94 E;  4JI3 E;  2ZM6 E;  1UDO A;  4GZN C;  4R2D A;  1KJK A;  2EPZ A;  3F0N A;  3WU3 A;  4MLQ A;  4LF7 E;  1XNR E;  4LF5 E;  1ZR9 A;  2EMW A;  2YU8 A;  1YPN A;  2BA0 G;  2A2C A;  1WJP A;  4URL A;  1ZM3 A;  2EMY A;  3Q6M A;  1HR0 E;  4O43 A;  4M0V A;  2YTD A;  3VK6 A;  5AC5 A;  4JI0 E;  4FWH A;  2EQ0 A;  3B78 A;  4PRX A;  1IBK I;  2JR1 A;  4LF8 I;  2LVH A;  2DSY A;  2EL6 A;  2EN7 A;  1ZM4 A;  4DV7 I;  2GQ0 A;  2I9I A;  2L2M A;  1HNX I;  1HNZ I;  2RS7 A;  2PO1 B;  4GKJ I;  2YTJ A;  2HKE A;  2HKJ A;  4IS9 A;  1Z5C A;  4AQY E;  4USM A;  5IWA I;  1ZU1 A;  2EQ1 A;  4J8Z A;  4LU9 A;  1ELO A;  2IES A;  4X62 E;  2NN6 E;  2OI2 A;  2E5L I;  4DUY E;  1LLM C;  2RSM A;  2UXC E;  4LFC E;  4DV1 I;  1Y6Z A;  5BR8 I;  2V8Q B;  2EOF A;  1IMU A;  2Z5B B;  5ADZ A;  4O5G A;  2EPA A;  4OO1 E;  4BC7 A;  3ZOQ B;  1N34 I;  2LRS A;  4NZV A;  4X9J A;  2ZBK B;  3T1Y I;  4IFD C;  2VQF E;  3U1Y A;  3ZZU A;  1RQ0 A;  5DNX A;  4F9A B;  4DR5 E;  2NUF A;  1VI7 A;  2LJU A;  1YHC A;  2R3V A;  3QT8 A;  2B9D A;  2PO1 A;  1Z1B A;  3RMP A;  2JVA A;  2BA1 G;  1YYK A;  1XNQ E;  2VQE I;  2YTF A;  4P78 A;  3H1C A;  5L3J A;  2O1U A;  4GEQ B;  3PYD A;  3KRN A;  5A2Q Q;  3M85 D;  3TQM A;  1UEK A;  2UU9 I;  4DR3 E;  1Z0C A;  2Z5B A;  2L3J A;  2EM0 A;  4ISA A;  4ZVI A;  4JI2 I;  2CVE A;  2EFG A;  2E72 A;  5LMN I;  1JK2 A;  4M30 A;  2Z5C B;  1VIS A;  4M9V C;  5DRO A;  4JI8 I;  1OYS A;  2WBS A;  4Q35 B;  1FWL A;  1L4S A;  2PRT A;  1QNT A;  2C38 B;  5GME A;  1YUJ A;  1Z0T A;  2PNL A;  2EL5 A;  4BHB A;  2V2Q A;  1IQO A;  3ZKB A;  1XMQ E;  4X64 I;  2CPN A;  5KL6 A;  2EMX A;  1WHQ A;  4LF6 E;  2YSO A;  2LJP A;  1A6F A;  4MDT A;  4LF4 I;  4BA2 B;  3KWR A;  2AE8 A;  2C39 B;  3V5R A;  5A6A A;  1PKP A;  2DEJ A;  4OKG A;  4QNJ A;  2EOH A;  3ADL A;  1XMO E;  3QG5 C;  5TSE A;  3VYY A;  4DXL A;  1Z0W A;  3J81 Q;  4BBY A;  1EI1 A;  4DV2 I;  3PYE A;  4LCG A;  3HUL A;  3L00 A;  1J5E E;  4I3H A;  3Q1Q A;  1IBM I;  3KZZ A;  3J80 C;  1G2D C;  2EN1 A;  2Z5C A;  4N4R B;  5EKW A;  4DV6 E;  1J26 A;  1Z5B A;  1ZM2 A;  4X66 E;  4DV0 I;  2YTG A;  3F6H A;  4BS9 A;  1QZR A;  3AUZ A;  2X36 A;  4F9B B;  2EM4 A;  2BM0 A;  4YY3 I;  4BHC A;  1Z0B A;  4FW4 A;  5FWK A;  2BV3 A;  2C38 A;  4Q28 A;  2HFS A;  2N3G A;  1XXE A;  3LNU A;  1E3P A;  4GKK I;  4K0K E;  2F4V E;  4L8N A;  2N8X A;  1Y4U A;  4U3D A;  1BBG A;  4WXD A;  2UUA E;  5KL3 A;  1H73 A;  4MU0 A;  3C6M A;  1YUI A;  1WUU A;  2WCC 3;  3K6Q A;  2BR2 B;  2E1M A;  1FWK A;  2JEB A;  1AAY A;  2V2V A;  4DU8 A;  5LMU I;  1EH6 A;  2V88 A;  3MHS C;  5LL6 R;  5KL5 A;  1YFH A;  2HGH A;  1YYW A;  1K47 A;  2PO0 A;  4IFD F;  3M7N G;  4WUD A;  4F9C B;  4IFD A;  4WSP A;  1TF3 A;  4M2Z A;  1PIE A;  3KZY A;  1A1F A;  3HPZ A;  2EZ6 A;  3JAM Q;  1H7U A;  2DMY A;  2EPU A;  3EPH A;  2Q2E B;  1BB8 A;  4DR6 E;  4DV6 I;  2V89 A;  2K7I A;  3BGH A;  3V2U C;  5K36 E;  4XTJ A;  1X6E A;  4BC9 A;  1Z0G A;  3CDJ A;  4EMD A;  3P3E A;  5FLX C;  4MU4 A;  2EMG A;  1KYQ A;  5K36 D;  2JYA A;  4JI4 I;  2M9A A;  5AC4 A;  4FW9 A;  2UXB I;  4X65 E;  2Z5E A;  1YZ9 A;  2BR2 A;  4FW7 A;  4Z7Y A;  1YH8 A;  2LTS A;  3VYX A;  5JEA E;  2V83 A;  1YYO A;  4DV4 E;  2PNM A;  4JV5 I;  2R42 A;  2JT2 A;  3C4T A;  1MG7 A;  4FWD A;  2EM6 A;  4LFB I;  3K1J A;  2J65 A;  4DV5 I;  3BF2 A;  5JEA D;  4R1F A;  3WU4 A;  1T38 A;  4LOM A;  2EN4 A;  1S4E A;  2L92 A;  3CWV A;  3LPS A;  1MEY C;  1H7S A;  2EPL X;  3NZK A;  2WNR B;  2EM8 A;  2JE6 B;  2PNZ B;  2ENH A;  2K4V A;  1D6T A;  4LF9 I;  5A2Q C;  2L6M A;  3IWB A;  2RS6 A;  2YRM A;  1PJQ A;  2LCE A;  2C37 A;  4B3T I;  1DI2 A;  2VE7 C;  4RH8 A;  1B69 A;  4R2S A;  1Z59 A;  4X8W A;  1IBL I;  5K36 B;  2EMB A;  2JEA B;  2GLI A;  4P7D A;  2DRP A;  2MKD A;  4IZJ D;  1KKH A;  4MU1 A;  4R2Q A;  1EH8 A;  1HK7 A;  3P06 A;  2WBT A;  2FV4 B;  3JU0 A;  1IBK E;  2EN2 A;  5A6B A;  4LF8 E;  2KOU A;  4DKK A;  4DV7 E;  5JEA B;  2EJ4 A;  2LMZ A;  2NN6 D;  1HNX E;  4B3S I;  1BBO A;  1HNZ E;  2WNR A;  3OTO I;  4GKJ E;  1ZM9 A;  2JE6 A;  1X6F A;  4OOG C;  1Y5Y A;  5GMD A;  5IWA E;  2DIX A;  1DQ3 A;  3EPK A;  3LTO A;  2O1V A;  5LLQ A;  4WUB A;  2E5L E;  4DR4 E;  4DV1 E;  4OO1 D;  4RHB B;  5BR8 E;  5AAS A;  1QU6 A;  2ENA A;  4I8O A;  3ECR A;  2LT7 A;  2BM1 A;  2WW4 A;  1MGT A;  4WPY A;  3J7A M;  1BKN A;  1PJT A;  2YRH A;  3IWD A;  1OYR A;  3M6A A;  2JEA A;  1G2F C;  2IOQ A;  3J7Y p;  1FJG I;  1H72 C;  2PO2 B;  2GHF A;  4BCA A;  5C0X E;  4JI7 I;  1N34 E;  4R2C A;  2EP3 A;  2MC5 A;  4R03 A;  3T1Y E;  2ADR A;  2CZ9 A;  3B8H A;  1NHH A;  4IZJ B;  2NAB A;  5IT9 Q;  5C0X D;  4LCH A;  5AE1 A;  1IQS A;  2YZT A;  4HEI A;  2EM9 A;  1PDA A;  4WYQ B;  2EOX A;  2V86 A;  2NN6 B;  1XHK A;  3LML A;  2BA0 D;  2VQE E;  5DNL A;  1T4L B;  4NBQ A;  3FIG A;  3HPS A;  2GS8 A;  4DUZ I;  1B63 A;  2L33 A;  3ADG A;  1X48 A;  4OO1 B;  2EOY A;  3MHH C;  2UU9 E;  4QNK A;  4WFT A;  4JI2 E;  3M99 B;  2EOM A;  1WRJ A;  1A1L A;  2J7K A;  2YTE A;  2PO2 A;  4NXN I;  4NXM I;  2Q8U A;  2EPO A;  4DV3 I;  1HNW I;  3JAM C;  5LMN E;  1N33 I;  2EL4 A;  2VRD A;  3THN A;  4JI8 E;  4R2R A;  4IZJ A;  4HYM A;  2B3T B;  4F54 A;  2B7V A;  1X5W A;  2N3H A;  4JI5 I;  4IJD A;  3GME A;  2V87 A;  3QT6 A;  2JP9 A;  2NN6 A;  4DPT A;  3AV0 A;  2YTO A;  1WHN A;  2YTQ A;  4OX9 I;  4X64 E;  4ZYG A;  1Y4S A;  4JI6 I;  3BBG A;  2NA2 A;  4DPY A;  2EML A;  2BB8 A;  4LF4 E;  2EOO A;  5AE2 A;  1DAR A;  4B3R I;  1FKA E;  3C6K A;  3D4J A;  2ELZ A;  4MLV A;  2EN6 A;  1X3C A;  2RPC A;  4R2P A;  4DV2 E;  1YSA C;  2EMI A;  2IOP A;  2YU5 A;  5A6J A;  4DR1 I;  3LLH A;  1IBM E;  2BA1 D;  4U3B A;  3P3G A;  5C0X F;  1EKZ A;  1GTK A;  4DV0 E;  1S16 A;  1Z5A A;  4BA2 A;  3ZZT A;  1RC7 A;  2C39 A;  3K17 A;  4BA1 A;  4PRV A;  5K36 C;  4ZYD A;  1UDN A;  1X6H A;  4YY3 E;  4P52 A;  4GQU A;  1ZBQ A;  2NUG A;  3L7Z B;  2ELY A;  1R6M A;  2KON A;  4YHH I;  2I13 A;  2CTD A;  4DR2 I;  3HTX A;  3ZKD A;  4DR7 I;  1X49 A;  2UUB I;  4GKK E;  1N32 I;  2XEX A;  2EPX A;  2LBS B;  4DPU A;  2O3Z A;  1KVK A;  2EOS A;  1NZ0 A;  5JEA C;  1ZAA C;  1T4N A;  5F3W A;  2NPF A;  5LMU E;  4JYA I;  4LTY A;  3F6G A;  1JK1 A;  4AID A;  1MU5 A;  1X47 A;  2DEI A;  2L2K B;  2M4I A;  2ODR D;  3T1H I;  4LFA I;  2EM7 A;  2EPN A;  4TUI A;  4KHP I;  3QT7 A;  3EPL A;  2HJJ A;  1A1K A; 
#chains in the Genus database with same CATH homology
 2V34 A;  4B3M I;  1WXR A;  2HHH I;  4JI1 I;  2UUC I;  3PYF A;  2M1S A;  1UHZ A;  2B7T A;  1B62 A;  2WZO A;  2LUP B;  3WU6 A;  1UIL A;  2JY9 A;  4JI4 E;  1ZXM A;  3ADJ A;  2HK2 A;  2UXB E;  1N36 I;  2UXD I;  2A2D A;  1I94 I;  4JI3 I;  2ZM6 I;  2H36 X;  2FGG A;  4DU7 A;  3J80 Q;  4TUG A;  4JV5 E;  2CGE A;  1XNR I;  4LF7 I;  5IT9 C;  4LF5 I;  4HXZ A;  3B82 A;  3MSW A;  3JTZ A;  4LFB E;  1NHJ A;  4DV5 E;  1USV A;  4Z7C A;  1HR0 I;  3IWC A;  3DJW A;  2NUE A;  2IHR 1;  4JI0 I;  2AJ4 A;  1N0U A;  2E1R A;  4USK A;  4LF9 E;  2FTX B;  4HAC B;  4AQY I;  4B3T E;  2M7Q A;  4IZK B;  1IBL E;  1KIJ A;  2EWL A;  4X62 I;  4DUY I;  2LUQ A;  4LFC I;  2UXC I;  3P1X A;  1RRE A;  3PYG A;  4RPF A;  2YT4 A;  3J81 C;  1Z0V A;  4N3O A;  1PVG A;  1KTV A;  3OML A;  4MYU A;  1NHI A;  1N0V C;  2VQF I;  1ZBT A;  4B3S E;  3K85 A;  3OTO E;  2O1T A;  3C4B A;  5FLX Q;  4DR5 I;  2L3C A;  4HAC A;  1FI4 A;  1XNQ I;  4IZK A;  2MDR A;  1EA6 A;  3Q6N A;  2LTR A;  1FJG E;  4JI7 E;  3H4L A;  2X7I A;  4DR3 I;  4HY1 A;  1USU A;  2O1W A;  1U2R A;  4DUZ E;  4ED4 A;  1RR9 A;  1XMQ I;  2F8B A;  2JOB A;  2JOX A;  2G7H A;  4LF6 I;  4NXN E;  3ZZ0 A;  4NXM E;  4P7A A;  4DV3 E;  1HNW E;  1N33 E;  1XMO I;  4BMJ A;  2KHX A;  5AE3 A;  3HJC A;  1J5E I;  3QT5 A;  1Z0E A;  4WUC A;  1MX0 A;  4JI5 E;  4X66 I;  2LE2 A;  4KQV A;  4OX9 E;  3DF6 A;  2ODR C;  4JI6 E;  2ZIT A;  1SR9 A;  2VF1 A;  3ADI A;  4FN5 A;  2RTX A;  1H74 A;  2V8P A;  1T4O A;  2HK3 A;  4K0K I;  4DMI A;  3WU5 A;  2F4V I;  4B3R E;  3PRY A;  5DNY A;  2LJH A;  2VF3 A;  2UUA I;  4DR1 E;  2CG9 A;  3GON A;  1ZXN A;  2L2N A;  2V85 A;  1O0W A;  1OJ4 A;  4UTG A;  1FNM A;  4PU9 A;  4MYT A;  4YHH E;  4DR2 E;  3HQ1 A;  4R8O A;  4DR6 I;  4DR7 E;  2L8T A;  4DPX A;  2UUB E;  1N32 E;  3ZM7 A;  4FWG A;  4M1K A;  1STU A;  4JG4 A;  3J7A G;  4DPW A;  4L5N C;  4JYA E;  2DB2 A;  1GQE A;  4X65 I;  2JWO A;  3HXL A;  4LFA E;  3T1H E;  5CFF E;  5T6J A;  4DV4 I;  2V2Z A;  4KHP E;  2HFU A;  4B3M E;  2HHH E;  4JI1 E;  2UUC E;  1GZ6 A;  2MC6 A;  4UT4 A;  3H09 A;  1N36 E;  2UXD E;  4KZS A;  1I94 E;  4JI3 E;  2ZM6 E;  3F0N A;  3WU3 A;  1XNR E;  4LF7 E;  4LF5 E;  2A2C A;  4URL A;  1ZM3 A;  3Q6M A;  1HR0 E;  4M0V A;  3VK6 A;  4JI0 E;  4FWH A;  4PRX A;  3B78 A;  1IBK I;  2JR1 A;  4LF8 I;  2DSY A;  1ZM4 A;  4DV7 I;  2GQ0 A;  2L2M A;  1HNX I;  1HNZ I;  2RS7 A;  4GKJ I;  2HKE A;  2HKJ A;  1Z5C A;  4AQY E;  4USM A;  5IWA I;  4J8Z A;  4LU9 A;  1ELO A;  4X62 E;  2OI2 A;  2E5L I;  4DR4 I;  4DUY E;  4DV1 I;  2RSM A;  2UXC E;  4LFC E;  5BR8 I;  1Y6Z A;  2V8Q B;  2Z5B B;  5ADZ A;  4BC7 A;  3ZOQ B;  1N34 I;  2LRS A;  2ZBK B;  3T1Y I;  2VQF E;  3ZZU A;  1RQ0 A;  4F9A B;  4DR5 E;  2NUF A;  3QT8 A;  2R3V A;  2B9D A;  3RMP A;  2JVA A;  1YYK A;  1XNQ E;  2VQE I;  4P78 A;  5L3J A;  2O1U A;  4GEQ B;  3PYD A;  5A2Q Q;  1UEK A;  2UU9 I;  4DR3 E;  1Z0C A;  2Z5B A;  2L3J A;  4ZVI A;  4JI2 I;  2EFG A;  5LMN I;  4M30 A;  2Z5C B;  1VIS A;  4JI8 I;  1FWL A;  5GME A;  1Z0T A;  2PNL A;  2V2Q A;  3ZKB A;  4X64 I;  1XMQ E;  2CPN A;  1WHQ A;  4LF6 E;  2LJP A;  1A6F A;  4LF4 I;  3KWR A;  3V5R A;  1PKP A;  2DEJ A;  3ADL A;  4DXL A;  1XMO E;  3VYY A;  3J81 Q;  1Z0W A;  4BBY A;  1EI1 A;  4DV2 I;  3PYE A;  3HUL A;  4I3H A;  1J5E E;  3Q1Q A;  1IBM I;  3J80 C;  2Z5C A;  1J26 A;  1Z5B A;  1ZM2 A;  4X66 E;  4DV0 I;  4BS9 A;  3F6H A;  1QZR A;  3AUZ A;  2X36 A;  4F9B B;  2BM0 A;  4YY3 I;  1Z0B A;  5FWK A;  2BV3 A;  4Q28 A;  2HFS A;  2N3G A;  3LNU A;  4GKK I;  4K0K E;  2F4V E;  4L8N A;  1Y4U A;  2UUA E;  1H73 A;  1WUU A;  4DU8 A;  3K6Q A;  5LMU I;  2E1M A;  1FWK A;  2V2V A;  2V88 A;  5LL6 R;  1K47 A;  1YYW A;  4WUD A;  4F9C B;  4WSP A;  4M2Z A;  1PIE A;  3HPZ A;  2EZ6 A;  3JAM Q;  1H7U A;  2DMY A;  4DV6 I;  2Q2E B;  4DR6 E;  2V89 A;  3V2U C;  4XTJ A;  4BC9 A;  1Z0G A;  4EMD A;  5FLX C;  4JI4 I;  4FW9 A;  2UXB I;  4X65 E;  2Z5E A;  1YZ9 A;  4Z7Y A;  2LTS A;  3VYX A;  2V83 A;  1YYO A;  4DV4 E;  2PNM A;  4JV5 I;  2R42 A;  3C4T A;  1MG7 A;  4FWD A;  4LFB I;  3K1J A;  4DV5 I;  4R1F A;  3WU4 A;  1S4E A;  3CWV A;  2L92 A;  3LPS A;  1H7S A;  2K4V A;  1D6T A;  4LF9 I;  5A2Q C;  2L6M A;  3IWB A;  2RS6 A;  4B3T I;  1DI2 A;  2VE7 C;  1IBL I;  1Z59 A;  4X8W A;  4P7D A;  4IZJ D;  1KKH A;  1HK7 A;  3P06 A;  1IBK E;  2FV4 B;  3JU0 A;  4LF8 E;  2KOU A;  4DKK A;  4DV7 E;  2LMZ A;  1HNX E;  4B3S I;  1HNZ E;  3OTO I;  4GKJ E;  1ZM9 A;  4OOG C;  5GMD A;  5IWA E;  2DIX A;  1DQ3 A;  3LTO A;  2O1V A;  4WUB A;  2E5L E;  4DR4 E;  4DV1 E;  5BR8 E;  5AAS A;  1QU6 A;  2BM1 A;  4I8O A;  2WW4 A;  4WPY A;  3J7A M;  1BKN A;  3IWD A;  3M6A A;  2IOQ A;  3J7Y p;  1FJG I;  1H72 C;  4BCA A;  4JI7 I;  1N34 E;  2MC5 A;  4R03 A;  3T1Y E;  3B8H A;  2CZ9 A;  1NHH A;  4IZJ B;  5IT9 Q;  5AE1 A;  2YZT A;  4WYQ B;  2V86 A;  1XHK A;  3LML A;  2VQE E;  1T4L B;  3FIG A;  3HPS A;  2GS8 A;  4DUZ I;  1B63 A;  2L33 A;  3ADG A;  1X48 A;  2UU9 E;  4WFT A;  4JI2 E;  2J7K A;  4NXN I;  4NXM I;  4DV3 I;  1HNW I;  3JAM C;  5LMN E;  1N33 I;  4JI8 E;  4IZJ A;  4HYM A;  2B3T B;  4F54 A;  2B7V A;  2N3H A;  4JI5 I;  3QT6 A;  2V87 A;  4DPT A;  3AV0 A;  1WHN A;  4OX9 I;  4X64 E;  1Y4S A;  4JI6 I;  4DPY A;  2NA2 A;  4LF4 E;  5AE2 A;  1DAR A;  4B3R I;  1FKA E;  3D4J A;  2IOP A;  4DV2 E;  4DR1 I;  3LLH A;  1IBM E;  1EKZ A;  4DV0 E;  1S16 A;  1Z5A A;  3ZZT A;  1RC7 A;  3K17 A;  4PRV A;  4YY3 E;  4P52 A;  1ZBQ A;  2NUG A;  2KON A;  4YHH I;  4DR2 I;  3HTX A;  3ZKD A;  4DR7 I;  1X49 A;  2UUB I;  4GKK E;  1N32 I;  2XEX A;  2LBS B;  4DPU A;  1KVK A;  1NZ0 A;  1T4N A;  5F3W A;  2NPF A;  5LMU E;  4JYA I;  4LTY A;  3F6G A;  1MU5 A;  1X47 A;  2DEI A;  2L2K B;  2M4I A;  2ODR D;  3T1H I;  4LFA I;  4TUI A;  4KHP I;  3QT7 A;  4DV6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...