4DR4E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4E02
1KKHA 3J81C 2VQEE 2EZ6A 4LF8I 5LL6R 4XTJA 4HACB 4FWHA 4WUDA 4DV0I 4DUZI 3B8HA 4X64I 3PYEA 4X64E 2VQEI 2B3TB 2NPFA 3T1HI 1XNQE 1ZXMA 4B3ME 1PKPA 2OI2A 3WU5A 4DV3I 2UUCE 1IBKI 1FI4A 4LF4I 4X66I 2HHHE 1T4LB 5L3JA 3T1YI 4NXME 1HNXE 3OTOE 1Z0BA 4M30A 1FJGI 4LFBI 2B7VA 2UUBE 1XHKA 4JYAE 3WU3A 1UHZA 3WU6A 2L2KB 4HACA 1XMOI 4B3RE 2DMYA 1Z0WA 3QT8A 1RC7A 4DPUA 4UT4A 1WHNA 3ZZ0A 1ZBTA 2NUFA 4WFTA 3VYXA 1NHHA 2Q2EB 2R42A 4X65I 4DR6I 4RPFA 4KHPE 4P7AA 4JI7E 4DV4E 1N0UA 1U2RA 1Z0CA 1ZXNA 4Z7CA 2N3HA 4WUBA 2L2NA 3ZZUA 3C4TA 4LF5I 4DU7A 1GQEA 3JAMC 1ELOA 1MG7A 4OX9I 4DPTA 4JV5I 4M1KA 4YHHE 1BKNA 4DR3I 2HKJA 4URLA 2BV3A 4NXMI 4FW9A 1I94I 2LTSA 4DR2E 1STUA 4JYAI 3H4LA 4LF9I 3LLHA 4JI1E 2J7KA 1B63A 4K0KI 1XNRE 5IWAI 2VQFE 3T1YE 2L2MA 4EMDA 2RS7A 1YYOA 4DV2E 4DV0E 4PRVA 4JI1I 4OX9E 4LF9E 5A2QQ 2CPNA 1HR0I 3ADLA 1WHQA 4X8WA 1N36E 4UTGA 2YT4A 1MU5A 4NXNE 4B3SE 4DR1E 4LFAI 2JVAA 1I94E 3ZM7A 5LMUE 4X62E 1FNMA 4PU9A 4JI5E 4JI0I 2UXCI 4JI3I 1X48A 3C4BA 3QT5A 4USKA 4HYMA 4LF6I 2V2ZA 3M6AA 2R3VA 1T4OA 2ZM6E 2F4VE 2UUAE 5LMNI 1Z0TA 1XMQI 3ZKDA 4DR5E 4GKJI 1KTVA 2LJPA 2V8PA 1IBKE 4FWDA 2IHR1 4DR7I 5FLXQ 5IT9Q 2CZ9A 1XNQI 1IBME 1HNXI 2VF3A 3PYGA 1N32E 1ZM9A 4NXNI 2NUGA 4I3HA 4GKKE 2V34A 4AQYE 1HNWE 1VISA 4FN5A 1K47A 4X62I 4DPWA 2HFUA 1H7UA 1Z59A 4WYQB 4YY3E 1RR9A 5GMEA 5A2QC 1FKAE 2DB2A 4GKKI 4B3SI 3LNUA 4DV5E 4JI8I 3PYDA 2L3CA 1KIJA 3GONA 4JI2E 1YYKA 1FWLA 3ADGA 4KHPI 2DIXA 1X49A 4P52A 1QU6A 2V2VA 1N34I 4DV2I 1XMQE 1KVKA 1Z0EA 1Z5CA 4AQYI 1H72C 4LF6E 3K1JA 4K0KE 3HTXA 4DR7E 4DU8A 1DARA 1NZ0A 2XEXA 1N32I 3B82A 2NA2A 1N0VC 2LBSB 2AJ4A 4ZVIA 1ZM4A 2E5LI 1Z5BA 1DI2A 4X65E 1XMOE 4M2ZA 1Z5AA 1MX0A 5FLXC 5IT9C 3HULA 2ZM6I 1H74A 4JI5I 2RS6A 1B62A 2HK3A 2N3GA 4DR6E 2L33A 5LMUI 4DUZE 4FWGA 2RTXA 1NHJA 2EFGA 2UXDE 1ZM3A 1HNZE 4DV6E 3OTOI 3LPSA 4X66E 4LF4E 1D6TA 3J80C 4JI6I 3ADJA 4JI4I 2E1RA 2DEJA 1O0WA 3J7AM 4DV5I 2UXDI 4JG4A 2UU9I 2V2QA 1WUUA 2L3JA 3F0NA 2MDRA 4B3MI 4GKJE 2A2DA 1UILA 4LFCE 2LRSA 1EKZA 4DV1I 5IWAE 1XNRI 4DV4I 4MYUA 4JI7I 4DPXA 2HFSA 1HNZI 4JV5E 1HNWI 5BR8E 2NUEA 2WW4A 1IBLI 3QT6A 1J5EE 4KQVA 1IBMI 3CWVA 4JI0E 4DV7I 2E5LE 3PYFA 3J81Q 4DV7E 3J7AG 4OOGC 4LF5E 4B3TI 4LF7I 4DR5I 1IBLE 4DR1I 1A6FA 3V5RA 1PVGA 2F4VI 2UXBE 4LFBE 1FJGE 2LTRA 4USMA 2RSMA 4JI2I 2X7IA 1EI1A 4JI3E 2X36A 1HR0E 1FWKA 3WU4A 2UUCI 3T1HE 4B3RI 4WUCA 4YY3I 1J26A 1N36I 4DR4I 1S16A 4JI6E 1NHIA 3D4JA 4DR4E 2HKEA 3ZKBA 2BM1A 1H7SA 2VQFI 1YZ9A 2BM0A 4DV6I 1UEKA 2B7TA 2UU9E 3P1XA 4DV3E 1OJ4A 1PIEA 3QT7A 4ED4A 3B78A 2LUQA 1EA6A 4YHHI 4HY1A 4DUYE 4DR2I 1ZM2A 4DPYA 2LUPB 2LJHA 4LF8E 4PRXA 2KHXA 1S4EA 4MYTA 3K17A 1RQ0A 2ZITA 4Z7YA 2JY9A 5CFFE 5GMDA 4DXLA 3JAMQ 3VYYA 3V2UC 1RREA 1T4NA 1N33E 3J80Q 4DKKA 4DR3E 2UXBI 4R1FA 4HXZA 3LTOA 1X47A 4LFCI 1J5EI 5LMNE 1Z0GA 2UUAI 2A2CA 2UXCE 3Q1QA 1Z0VA 3ADIA 5BR8I 2DEIA 3J7Yp 2GS8A 2HK2A 4JI4E 2ZBKB 3ZZTA 1N33I 2HHHI 4LFAE 1N34E 4DUYI 4JI8E 1QZRA 4B3TE 4LF7E 1H73A 2UUBI 1YYWA 4DV1E
chains in the Genus database with same CATH superfamily
1KKHA 3J81C 2EL4A 2VQEE 4IS1C 2EZ6A 1X6FA 2VRDA 1IMUA 3K85A 4LF8I 2NN6C 4OKGA 5LL6R 4IFDE 4XTJA 4HACB 4F6MA 2BA0G 4FWHA 4WUDA 4BA2B 4ZYDA 4DV0I 3VHTB 4DUZI 2BA1D 3B8HA 4X64I 2GQ0A 2YWQA 1IQOA 3PYEA 4O43A 4X64E 1Y4SA 1TN9A 2KONA 2JE6B 2VQEI 5EL9A 3NZKA 2B3TB 2NPFA 2VESA 1GZ6A 2MC6A 1XNQE 1ZXMA 4B3ME 1PKPA 2OI2A 2HJJA 2Z5BB 2UUCE 3WU5A 4DV3I 2EOFA 1AAYA 2YRKA 2MKNA 2O1TA 2M1SA 3HJCA 2GO4A 5C0XD 1IBKI 1FI4A 2EP3A 4L5NC 2EPAA 4LF4I 4X66I 5K36A 4R2DA 2L8TA 2HHHE 2EM7A 1T4LB 1EH6A 2WBSA 4NXME 3P3EA 1HNXE 2JXPA 3PS1A 1NEIA 2J7JA 4IZJA 1A1IA 3OTOE 1Z0BA 2BR2A 4M30A 5A69A 5JEAE 4LFBI 1FJGI 3BGHA 1A1KA 2B7VA 2UUBE 1Y4UA 3UK3C 1Y6ZA 1XHKA 5C0XF 4JYAE 2EN6A 2KOUA 3F6GA 4QNKA 4BS9A 3WU3A 1X5WA 1UHZA 3GLLA 4F9BB 3WU6A 2EM9A 3U1KA 2PNLA 2L2KB 4HACA 2YU8A 2EMWA 1XMOI 4B3RE 5AC5A 3MSWA 2EM8A 4P78A 1OYRA 4BC7A 2DMYA 2C38A 2F8BA 1Z0WA 3QT8A 4AM3A 1RC7A 4DPUA 1DGCA 4UT4A 1WHNA 2EPXA 3ZZ0A 4I8OA 5K36D 3K6QA 1ZBTA 2NUFA 4WFTA 3VYXA 1NHHA 3BIDA 2Q2EB 2ODRD 2R42A 4X65I 4DR6I 3HKMA 2EMXA 4BBYA 1PJQA 2YTFA 4RPFA 4BHBA 2EN2A 2G7HA 4U3DA 4KHPE 4P7AA 4ZYHA 3HXLA 2V89A 4JI7E 4DV4E 1N0UA 1U2RA 1Z0CA 1ZXNA 4X9JA 2IOPA 4Z7CA 2N3HA 4WUBA 2CT1A 2L2NA 3ZZUA 3C4TA 4L8NA 2GO3A 1UN6B 4LF5I 2EMYA 4BHCA 4DU7A 2EPLX 4OO1A 1GQEA 3MHSC 4KZSA 3JAMC 1R6MA 1ELOA 5AE1A 1MG7A 4OX9I 3H1CA 4DPTA 4JV5I 4M1KA 1P42A 4YHHE 1BKNA 3CDJA 4WXDA 2L92A 4DR3I 2HKJA 4URLA 2BV3A 4NXMI 3EPLA 4FW9A 4MU1A 2EL6A 3U1YA 1I94I 4R2SA 2LTSA 2AE8A 4DR2E 1STUA 4JYAI 5JEAD 3H4LA 4LF9I 3AV0A 1QNTA 3LLHA 4JI1E 2J7KA 1B63A 4K0KI 4HTGA 2JEBB 2EPMX 2EOYA 1XNRE 3JU0A 2Z5EA 5IWAI 2VQFE 2BB8A 2L2MA 4O24A 3T1YE 4EMDA 2RS7A 1YYOA 1BBGA 2EPRA 4DV2E 4MU4A 2EM5A 2M4IA 2RQLA 4R2PA 4DV0E 5A6BD 2JP9A 4OX9E 3B4TA 2JWOA 4LF9E 2PO2B 4PRVA 4U3BA 4JI1I 4OO1D 5A2QQ 2CPNA 5DNYA 1HR0I 3ADLA 3THOB 4KWYA 1RHYA 1WHQA 4Q28A 4X8WA 1JK1A 1N36E 2NN6A 4UTGA 1YHCA 4ISAA 2YTEA 4R2EA 2YT4A 1MU5A 3UHMA 4NXNE 4B3SE 2MDGA 2YTGA 5AASA 3P76A 2EM6A 3P3GA 4DR1E 2Z5CA 2J65A 2FV4B 4LFAI 2JVAA 4IJDA 1I94E 3ZM7A 2EMGA 1X6EA 3M85D 5LMUE 4X62E 4OZEA 2MC5A 1YUJA 2EMAA 4LU9A 3M85G 1FNMA 2JEBA 2VE7C 4PU9A 3EPHA 4JI5E 2WNRB 4JI0I 2EM3A 2E1MA 4IFDA 2UXCI 2V86A 4JI3I 1USUA 2M7QA 3EPKA 2Z5BA 4MDTA 1X48A 3C4BA 4LTYA 3QT5A 5EKWA 3HPZA 2PNZA 4USKA 3KRNA 2EE8A 3JTZA 4ZYGA 2NN6D 4HYMA 2LMZA 4LF6I 4GEQB 5K36B 2V2ZA 5IXMB 4MLQA 3M6AA 2R3VA 1T4OA 4FW3A 2ZM6E 4FW4A 2F4VE 1UDOA 3AUZA 4MQYA 2PO0B 2UUAE 5LMNI 1ZR9A 1A1LA 2EQ3A 3H09A 1Z0TA 2NN6B 1XMQI 5DNLA 4J8ZA 4GZNC 1T39A 3ZKDA 4DR5E 4GKJI 1KTVA 2LJPA 2V8PA 1IBKE 2YSOA 1B69A 2FGGA 4FWDA 2IHR1 2ENAA 1JK2A 5L3JA 2JE6A 3T1HI 5FLXQ 2O1WA 4DR7I 5IT9Q 2CZ9A 2K4VA 2I13A 2EN4A 1XNQI 1IBME 1HNXI 2VF3A 3PYGA 5KL3A 2RSIA 4F54A 1N32E 2EQ1A 1ZM9A 4R8OA 2EN1A 2EMFA 2YU5A 2EPNA 4NXNI 2NUGA 4I3HA 2RPCA 4GKKE 2IESA 2YTPA 2V34A 4AQYE 1YPNA 4LCHA 1HNWE 1L4SA 1VISA 4FN5A 2JEAA 1K47A 2EPZA 4NBQA 4DPWA 4X62I 2HFUA 1H7UA 2DMIA 1Z59A 2V88A 2JT2A 4WYQB 2R1FA 4YY3E 5A2QC 1R6LA 1RR9A 5GMEA 4LCGA 2YRHA 3RMPA 4WXCA 1FKAE 2DB2A 2DLQA 4HEIA 2NN6F 3L7ZB 4B3SI 4GKKI 2VF1A 3LNUA 1Z1BA 4DV5E 4JI8I 3PYDA 2L3CA 2A25A 4BMJA 2WP8A 4O5GA 5KL6A 1EH8A 1KIJA 4OO1B 4O4KA 2C37B 3GONA 5C0XB 4JI2E 1YYKA 2N8XA 1FWLA 4F9CB 3ADGA 4KHPI 1Y5YA 2DIXA 2GPIA 5A6BA 1X49A 4P52A 2EJ4A 1QU6A 2DSYA 2YTDA 2V2VA 1N34I 4IZKB 2LJUA 5FWKA 2ELZA 4N4RB 4DV2I 2EM2A 2Q8UA 2YTQA 1XMQE 1MEYC 1KVKA 1Z0EA 2WZOA 2CSHA 1Z5CA 2K7IA 4MU0A 1YSAC 4Q35B 2EPCA 4BA2A 4AQYI 1H72C 4LF6E 3K1JA 4K0KE 3HTXA 3F6HA 5ADZA 4DR7E 1YFHA 3GCMA 2LVHA 4DU8A 1DARA 1NZ0A 1TF3A 4M9VC 3L00A 4F6NA 1PDAA 2ADRA 2XEXA 1N32I 3B82A 2EN3A 2NA2A 1N0VC 2LBSB 2AJ4A 4ZVIA 5A6JA 1ZM4A 3QG5C 2E5LI 1Z5BA 1DI2A 4OO1E 4X65E 2WCC3 1XMOE 4LCFA 4M2ZA 2EOSA 1Z5AA 5TSEA 3PS2A 1MX0A 5FLXC 2LCEA 5IT9C 3HULA 3DD6A 2ZM6I 4R2AA 1H74A 1DQ3A 4IZKA 4JI5I 2RS6A 3TQMA 1B62A 2V85A 2HK3A 2EQ0A 2V83A 2N3GA 2R76A 4DR6E 4BC9A 5JEAC 2EOJA 2L33A 1OYSA 5LMUI 5T6JA 4DUZE 4FWGA 2RTXA 5IV8B 4NHRA 3GMEA 1NHJA 2JPAA 2YTIA 4IZJB 3EPJA 2PRTA 2EFGA 4LPFA 2EOIA 2UXDE 1ZM3A 1HNZE 4FW5A 2PO1B 4DV6E 3OTOI 2EOQA 2MKDA 3LPSA 4FW7A 4M0VA 1X6HA 2ODRC 1N3GA 2EMKA 4X66E 2EPUA 4LF4E 5K36C 2Z5CB 1D6TA 4R2RA 2JOXA 2YTOA 1GTKA 3ZOQB 2O1VA 4QNJA 1IQSA 3J80C 1WRJA 4R03A 4IFDC 2EWLA 5KL4A 2DRPA 3LMLA 4JI6I 3ADJA 4JI4I 2WNRA 5A6KA 2E1RA 2DEJA 5K36E 4WX9A 1O0WA 4GQUA 2JYAA 1RMDA 1LLMC 4DV5I 3J7AM 2UXDI 4JG4A 2UU9I 2V2QA 2EORA 1WUUA 2L3JA 3F0NA 2MDRA 1ZU1A 4AIMA 4B3MI 4GKJE 3P06A 2NABA 2A2DA 1AH5A 1UILA 4LFCE 2BBGA 2LRSA 2ENHA 3ECRA 1EKZA 5IWAE 4DV1I 4DV4I 4MYUA 4JI7I 4NZVA 1BB8A 4DPXA 2HFSA 1XNRI 2JR1A 2O3ZA 1HNZI 4JV5E 1HNWI 4WSPA 2EMIA 2V87A 2GHFA 5BR8E 2EPOA 3C6KA 1UDQA 2F1DA 2EPPA 4J3DA 4BA1A 1PJSA 4BCAA 2BA1G 2LE2A 4DMIA 1ZAAC 3P3CA 5DRQA 2NUEA 2WW4A 4TUIA 1IBLI 4P7DA 2CVEA 2EOXA 3QT6A 1J5EE 1WJPA 2LT7A 2PO2A 4KQVA 1IBMI 3CWVA 4JI0E 4DV7I 2E5LE 1G2DC 3PYFA 4DV7E 3J7AG 3J81Q 5C0XA 4OOGC 2EMHA 3DJWA 4LF5E 3BBGA 2NN6E 4B3TI 2EOEA 2BR2B 4LF7I 4OO1C 3KWRA 4DR5I 1IBLE 3HQ1A 3PS3A 4WPYA 4F2JC 4R2QA 2GLIA 5AC4A 4DR1I 3M7ND 1P47A 1A6FA 3V5RA 1PVGA 2F4VI 2UXBE 1E3HA 1YH8A 1BBOA 2EOHA 1NCSA 4LFBE 1HK7A 1FJGE 2EMZA 2LTRA 1OYPA 4USMA 2RSMA 4JI2I 2X7IA 1EI1A 2JOBA 3IWBA 5F3WA 3L7ZA 3Q6NA 2HC5A 1PJTA 4JI3E 2EPKX 2YRMA 2X36A 1WXRA 1HR0E 5DNXA 2WP8B 3Q6MA 4BA1B 1FWKA 2DLKA 2H36X 1UDNA 2C37A 5A6AA 5DRRA 3WU4A 2UUCI 1E3PA 5C0XC 3T1HE 1USVA 4B3RI 4WUCA 4YY3I 3C6MA 5DROA 1J26A 1N36I 2M9AA 2B9DA 4DR4I 1S16A 1A1FA 4JI6E 1TF6A 1NHIA 3D4JA 4DR4E 2EN8A 4MLVA 2HKEA 4MU3A 2PNZB 3ZKBA 4IFDF 2BM1A 1H7SA 2C39A 2VQFI 1YZ9A 2EMBA 3VK6A 2BM0A 4DV6I 3EQ1A 1UEKA 2PO0A 2B7TA 2UU9E 3P1XA 5JEAA 4DV3E 1OJ4A 3BF2A 1PIEA 3QT7A 4ED4A 1XXEA 2CGEA 3B78A 2LO3A 2LUQA 1UDSA 2ELYA 4OO1F 1EA6A 2C38B 4IFDD 4FK5C 5KL5A 4IZJD 1A1HA 2EOZA 3IWDA 2EN7A 4YHHI 2YZTA 2EMCA 2YTNA 3FIGA 3DF6A 4HY1A 3IWCA 2WBTA 3MHHC 4DUYE 4DR2I 5DRPA 2DGCA 2D9HA 1ZM2A 2V8QB 4DPYA 2LUPB 1G2FC 5JEAF 2EMLA 2LJHA 5AE2A 4LF8E 4PRXA 2KHXA 2IOQA 1S4EA 5C0XE 4MYTA 4N3OA 3M7NG 1KJKA 1UBDC 3K17A 2CG9A 2JEAB 1RQ0A 2HGHA 5AE3A 2ZITA 2IERA 4Z7YA 2JY9A 5CFFE 4F9AB 3KZYA 1VI7A 2BA0D 4LOMA 2C39B 5GMDA 2I9IA 1A1JA 3VYYA 3V2UC 1RREA 4DXLA 1T4NA 1N33E 3JAMQ 3T1YI 5KL7A 4TUGA 1A1GA 3J80Q 3KZZA 4DKKA 4DR3E 3M99B 2E72A 5ELWA 4WSGA 2EOMA 5JEAB 2CTDA 2EM4A 3CDIA 1SFEA 2YPNA 3THNA 4HXZA 4R1FA 2UXBI 3HPSA 3LTOA 1X47A 4AIDA 2EOOA 5LLQA 2WBUA 4LFCI 4IS9A 1J5EI 2PO1A 1KYQA 5LMNE 1Z0GA 2UUAI 4RHBB 1YUIA 2A2CA 3OMLA 1ZBQA 2PNMA 2UXCE 1EH7A 2EM0A 3Q1QA 2EL5A 4RH8A 1Z0VA 3ADIA 5BR8I 5K36F 2LV2A 2DEIA 3J7Yp 1F2IG 2GS8A 2ENCA 2HK2A 4JI4E 1T38A 2ZBKB 3ZZTA 4ZYEA 1N33I 1MGTA 2HHHI 2YSPA 4LFAE 1N34E 4DUYI 4JI8E 4IFDB 5KL2A 4B3TE 4R2CA 4LF7E 1X3CA 1H73A 1QZRA 2FTXB 2L6MA 4FW6A 1SR9A 2UUBI 2YTJA 1YYWA 4DV1E 1Y60A 2O1UA 3PRYA
chains in the Genus database with same CATH topology
1KKHA 3J81C 2VQEE 2EZ6A 4LF8I 3K85A 5LL6R 4XTJA 4HACB 4FWHA 4WUDA 4DV0I 4DUZI 3B8HA 4X64I 2GQ0A 3PYEA 4X64E 1Y4SA 2KONA 2VQEI 2B3TB 2NPFA 1GZ6A 2MC6A 1XNQE 1ZXMA 4B3ME 1PKPA 2OI2A 2Z5BB 3WU5A 2UUCE 4DV3I 2O1TA 3HJCA 2M1SA 1IBKI 1FI4A 4L5NC 4LF4I 4X66I 2L8TA 2HHHE 1T4LB 5L3JA 3T1YI 4NXME 1HNXE 4IZJA 3OTOE 1Z0BA 4M30A 1FJGI 4LFBI 2B7VA 2UUBE 1Y4UA 1Y6ZA 1XHKA 4JYAE 2KOUA 3F6GA 4BS9A 3WU3A 1UHZA 4F9BB 3WU6A 2PNLA 2L2KB 4HACA 1XMOI 4B3RE 3MSWA 4P78A 4BC7A 2DMYA 2F8BA 1Z0WA 3QT8A 1RC7A 4DPUA 4UT4A 1WHNA 3ZZ0A 4I8OA 3K6QA 1ZBTA 2NUFA 4WFTA 3VYXA 1NHHA 2Q2EB 2R42A 2ODRD 4X65I 4DR6I 4BBYA 4RPFA 2G7HA 4KHPE 4P7AA 3HXLA 2V89A 4JI7E 4DV4E 1N0UA 1U2RA 1Z0CA 1ZXNA 2IOPA 4Z7CA 2N3HA 4WUBA 2L2NA 3ZZUA 3C4TA 4L8NA 4LF5I 4DU7A 1GQEA 4KZSA 3JAMC 1ELOA 5AE1A 1MG7A 4OX9I 4DPTA 4JV5I 4M1KA 4YHHE 1BKNA 2L92A 4DR3I 2HKJA 4URLA 2BV3A 4NXMI 4FW9A 1I94I 2LTSA 4DR2E 1STUA 4JYAI 3H4LA 4LF9I 3AV0A 3LLHA 4JI1E 2J7KA 1B63A 4K0KI 1XNRE 5IWAI 3JU0A 2Z5EA 2VQFE 3T1YE 2L2MA 4EMDA 2RS7A 1YYOA 4DV2E 2M4IA 4DV0E 4PRVA 4JI1I 4OX9E 4LF9E 2JWOA 5A2QQ 2CPNA 5DNYA 1HR0I 3ADLA 1WHQA 4Q28A 4X8WA 1N36E 4UTGA 2YT4A 1MU5A 4NXNE 4B3SE 5AASA 4DR1E 2Z5CA 4LFAI 2FV4B 2JVAA 1I94E 3ZM7A 5LMUE 4X62E 2MC5A 4LU9A 1FNMA 2VE7C 4PU9A 4JI5E 4JI0I 2E1MA 2UXCI 2V86A 4JI3I 1USUA 2M7QA 2Z5BA 1X48A 3C4BA 4LTYA 3QT5A 3HPZA 4USKA 3JTZA 4HYMA 2LMZA 4LF6I 4GEQB 2V2ZA 3M6AA 2R3VA 1T4OA 2ZM6E 2F4VE 3AUZA 2UUAE 5LMNI 3H09A 1Z0TA 1XMQI 4J8ZA 3ZKDA 4DR5E 4GKJI 1KTVA 2LJPA 2V8PA 1IBKE 4FWDA 2FGGA 2IHR1 4DR7I 3T1HI 5FLXQ 2O1WA 5IT9Q 2CZ9A 2K4VA 1XNQI 1IBME 1HNXI 2VF3A 3PYGA 4F54A 1N32E 1ZM9A 4R8OA 4NXNI 2NUGA 4I3HA 4GKKE 2V34A 4AQYE 1HNWE 1VISA 4FN5A 1K47A 4X62I 4DPWA 2HFUA 1H7UA 1Z59A 2V88A 4WYQB 1RR9A 4YY3E 5A2QC 5GMEA 3RMPA 1FKAE 2DB2A 4GKKI 4B3SI 2VF1A 3LNUA 4DV5E 4JI8I 3PYDA 2L3CA 4BMJA 1KIJA 3GONA 4JI2E 1YYKA 1FWLA 4F9CB 3ADGA 4KHPI 2DIXA 1X49A 4P52A 1QU6A 2DSYA 2V2VA 1N34I 4IZKB 5FWKA 4DV2I 1XMQE 1KVKA 1Z0EA 2WZOA 1Z5CA 4AQYI 1H72C 4LF6E 3K1JA 4K0KE 3HTXA 3F6HA 5ADZA 4DR7E 4DU8A 1DARA 1NZ0A 2XEXA 1N32I 3B82A 2NA2A 1N0VC 2LBSB 2AJ4A 4ZVIA 1ZM4A 2E5LI 1Z5BA 1DI2A 4X65E 1XMOE 4M2ZA 1Z5AA 1MX0A 5FLXC 5IT9C 3HULA 2ZM6I 1H74A 1DQ3A 4IZKA 4JI5I 2RS6A 1B62A 2V85A 2HK3A 2V83A 2N3GA 4DR6E 4BC9A 2L33A 5LMUI 5T6JA 4DUZE 4FWGA 2RTXA 1NHJA 4IZJB 2EFGA 2UXDE 1ZM3A 1HNZE 4DV6E 3OTOI 3LPSA 4M0VA 2ODRC 4X66E 4LF4E 2Z5CB 1D6TA 2JOXA 2O1VA 3ZOQB 3J80C 4R03A 2EWLA 3LMLA 4JI6I 3ADJA 4JI4I 2E1RA 2DEJA 1O0WA 3J7AM 4DV5I 2UXDI 4JG4A 2UU9I 2V2QA 1WUUA 2L3JA 3F0NA 2MDRA 4B3MI 4GKJE 3P06A 2A2DA 1UILA 4LFCE 2LRSA 1EKZA 4DV1I 5IWAE 1XNRI 4DV4I 4MYUA 4JI7I 4DPXA 2HFSA 2JR1A 1HNZI 4JV5E 1HNWI 4WSPA 2V87A 5BR8E 4BCAA 2LE2A 4DMIA 2NUEA 2WW4A 4TUIA 1IBLI 4P7DA 3QT6A 1J5EE 4KQVA 1IBMI 3CWVA 4JI0E 4DV7I 2E5LE 3PYFA 3J81Q 4DV7E 3J7AG 4OOGC 3DJWA 4LF5E 4B3TI 4LF7I 3KWRA 4DR5I 1IBLE 3HQ1A 4WPYA 4DR1I 1A6FA 3V5RA 1PVGA 2F4VI 2UXBE 1HK7A 4LFBE 1FJGE 2LTRA 4USMA 2RSMA 4JI2I 2X7IA 1EI1A 2JOBA 3IWBA 5F3WA 3Q6NA 4JI3E 2X36A 1WXRA 1HR0E 3Q6MA 1FWKA 2H36X 3WU4A 2UUCI 3T1HE 1USVA 4B3RI 4WUCA 4YY3I 1J26A 1N36I 2B9DA 4DR4I 1S16A 4JI6E 1NHIA 3D4JA 4DR4E 2HKEA 3ZKBA 2BM1A 1H7SA 2VQFI 1YZ9A 3VK6A 2BM0A 4DV6I 1UEKA 2B7TA 2UU9E 3P1XA 4DV3E 1OJ4A 1PIEA 3QT7A 4ED4A 2CGEA 3B78A 2LUQA 1EA6A 4IZJD 3IWDA 4YHHI 2YZTA 3FIGA 3DF6A 4HY1A 3IWCA 4DUYE 4DR2I 1ZM2A 2V8QB 4DPYA 2LUPB 2LJHA 4LF8E 5AE2A 4PRXA 2KHXA 2IOQA 1S4EA 4MYTA 4N3OA 3K17A 2CG9A 1RQ0A 5AE3A 2ZITA 4Z7YA 2JY9A 5CFFE 4F9AB 5GMDA 4DXLA 3JAMQ 3VYYA 3V2UC 1RREA 1T4NA 1N33E 4TUGA 3J80Q 4DKKA 4DR3E 2UXBI 4R1FA 4HXZA 3HPSA 3LTOA 1X47A 4LFCI 1J5EI 5LMNE 1Z0GA 2UUAI 2A2CA 3OMLA 1ZBQA 2PNMA 2UXCE 3Q1QA 1Z0VA 3ADIA 5BR8I 2DEIA 3J7Yp 2GS8A 2HK2A 4JI4E 2ZBKB 3ZZTA 1N33I 2HHHI 4LFAE 1N34E 4DUYI 4JI8E 1QZRA 4B3TE 4LF7E 1H73A 2FTXB 2L6MA 1SR9A 2UUBI 1YYWA 4DV1E 2O1UA 3PRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKH A;  3J81 C;  2VQE E;  2EZ6 A;  4LF8 I;  5LL6 R;  4XTJ A;  4HAC B;  4FWH A;  4WUD A;  4DV0 I;  4DUZ I;  3B8H A;  4X64 I;  3PYE A;  4X64 E;  2VQE I;  2B3T B;  2NPF A;  3T1H I;  1XNQ E;  1ZXM A;  4B3M E;  1PKP A;  2OI2 A;  3WU5 A;  4DV3 I;  2UUC E;  1IBK I;  1FI4 A;  4LF4 I;  4X66 I;  2HHH E;  1T4L B;  5L3J A;  3T1Y I;  4NXM E;  1HNX E;  3OTO E;  1Z0B A;  4M30 A;  1FJG I;  4LFB I;  2B7V A;  2UUB E;  1XHK A;  4JYA E;  3WU3 A;  1UHZ A;  3WU6 A;  2L2K B;  4HAC A;  1XMO I;  4B3R E;  2DMY A;  1Z0W A;  3QT8 A;  1RC7 A;  4DPU A;  4UT4 A;  1WHN A;  3ZZ0 A;  1ZBT A;  2NUF A;  4WFT A;  3VYX A;  1NHH A;  2Q2E B;  2R42 A;  4X65 I;  4DR6 I;  4RPF A;  4KHP E;  4P7A A;  4JI7 E;  4DV4 E;  1N0U A;  1U2R A;  1Z0C A;  1ZXN A;  4Z7C A;  2N3H A;  4WUB A;  2L2N A;  3ZZU A;  3C4T A;  4LF5 I;  4DU7 A;  1GQE A;  3JAM C;  1ELO A;  1MG7 A;  4OX9 I;  4DPT A;  4JV5 I;  4M1K A;  4YHH E;  1BKN A;  4DR3 I;  2HKJ A;  4URL A;  2BV3 A;  4NXM I;  4FW9 A;  1I94 I;  2LTS A;  4DR2 E;  1STU A;  4JYA I;  3H4L A;  4LF9 I;  3LLH A;  4JI1 E;  2J7K A;  1B63 A;  4K0K I;  1XNR E;  5IWA I;  2VQF E;  3T1Y E;  2L2M A;  4EMD A;  2RS7 A;  1YYO A;  4DV2 E;  4DV0 E;  4PRV A;  4JI1 I;  4OX9 E;  4LF9 E;  5A2Q Q;  2CPN A;  1HR0 I;  3ADL A;  1WHQ A;  4X8W A;  1N36 E;  4UTG A;  2YT4 A;  1MU5 A;  4NXN E;  4B3S E;  4DR1 E;  4LFA I;  2JVA A;  1I94 E;  3ZM7 A;  5LMU E;  4X62 E;  1FNM A;  4PU9 A;  4JI5 E;  4JI0 I;  2UXC I;  4JI3 I;  1X48 A;  3C4B A;  3QT5 A;  4USK A;  4HYM A;  4LF6 I;  2V2Z A;  3M6A A;  2R3V A;  1T4O A;  2ZM6 E;  2F4V E;  2UUA E;  5LMN I;  1Z0T A;  1XMQ I;  3ZKD A;  4DR5 E;  4GKJ I;  1KTV A;  2LJP A;  2V8P A;  1IBK E;  4FWD A;  2IHR 1;  4DR7 I;  5FLX Q;  5IT9 Q;  2CZ9 A;  1XNQ I;  1IBM E;  1HNX I;  2VF3 A;  3PYG A;  1N32 E;  1ZM9 A;  4NXN I;  2NUG A;  4I3H A;  4GKK E;  2V34 A;  4AQY E;  1HNW E;  1VIS A;  4FN5 A;  1K47 A;  4X62 I;  4DPW A;  2HFU A;  1H7U A;  1Z59 A;  4WYQ B;  4YY3 E;  1RR9 A;  5GME A;  5A2Q C;  1FKA E;  2DB2 A;  4GKK I;  4B3S I;  3LNU A;  4DV5 E;  4JI8 I;  3PYD A;  2L3C A;  1KIJ A;  3GON A;  4JI2 E;  1YYK A;  1FWL A;  3ADG A;  4KHP I;  2DIX A;  1X49 A;  4P52 A;  1QU6 A;  2V2V A;  1N34 I;  4DV2 I;  1XMQ E;  1KVK A;  1Z0E A;  1Z5C A;  4AQY I;  1H72 C;  4LF6 E;  3K1J A;  4K0K E;  3HTX A;  4DR7 E;  4DU8 A;  1DAR A;  1NZ0 A;  2XEX A;  1N32 I;  3B82 A;  2NA2 A;  1N0V C;  2LBS B;  2AJ4 A;  4ZVI A;  1ZM4 A;  2E5L I;  1Z5B A;  1DI2 A;  4X65 E;  1XMO E;  4M2Z A;  1Z5A A;  1MX0 A;  5FLX C;  5IT9 C;  3HUL A;  2ZM6 I;  1H74 A;  4JI5 I;  2RS6 A;  1B62 A;  2HK3 A;  2N3G A;  4DR6 E;  2L33 A;  5LMU I;  4DUZ E;  4FWG A;  2RTX A;  1NHJ A;  2EFG A;  2UXD E;  1ZM3 A;  1HNZ E;  4DV6 E;  3OTO I;  3LPS A;  4X66 E;  4LF4 E;  1D6T A;  3J80 C;  4JI6 I;  3ADJ A;  4JI4 I;  2E1R A;  2DEJ A;  1O0W A;  3J7A M;  4DV5 I;  2UXD I;  4JG4 A;  2UU9 I;  2V2Q A;  1WUU A;  2L3J A;  3F0N A;  2MDR A;  4B3M I;  4GKJ E;  2A2D A;  1UIL A;  4LFC E;  2LRS A;  1EKZ A;  4DV1 I;  5IWA E;  1XNR I;  4DV4 I;  4MYU A;  4JI7 I;  4DPX A;  2HFS A;  1HNZ I;  4JV5 E;  1HNW I;  5BR8 E;  2NUE A;  2WW4 A;  1IBL I;  3QT6 A;  1J5E E;  4KQV A;  1IBM I;  3CWV A;  4JI0 E;  4DV7 I;  2E5L E;  3PYF A;  3J81 Q;  4DV7 E;  3J7A G;  4OOG C;  4LF5 E;  4B3T I;  4LF7 I;  4DR5 I;  1IBL E;  4DR1 I;  1A6F A;  3V5R A;  1PVG A;  2F4V I;  2UXB E;  4LFB E;  1FJG E;  2LTR A;  4USM A;  2RSM A;  4JI2 I;  2X7I A;  1EI1 A;  4JI3 E;  2X36 A;  1HR0 E;  1FWK A;  3WU4 A;  2UUC I;  3T1H E;  4B3R I;  4WUC A;  4YY3 I;  1J26 A;  1N36 I;  4DR4 I;  1S16 A;  4JI6 E;  1NHI A;  3D4J A;  4DR4 E;  2HKE A;  3ZKB A;  2BM1 A;  1H7S A;  2VQF I;  1YZ9 A;  2BM0 A;  4DV6 I;  1UEK A;  2B7T A;  2UU9 E;  3P1X A;  4DV3 E;  1OJ4 A;  1PIE A;  3QT7 A;  4ED4 A;  3B78 A;  2LUQ A;  1EA6 A;  4YHH I;  4HY1 A;  4DUY E;  4DR2 I;  1ZM2 A;  4DPY A;  2LUP B;  2LJH A;  4LF8 E;  4PRX A;  2KHX A;  1S4E A;  4MYT A;  3K17 A;  1RQ0 A;  2ZIT A;  4Z7Y A;  2JY9 A;  5CFF E;  5GMD A;  4DXL A;  3JAM Q;  3VYY A;  3V2U C;  1RRE A;  1T4N A;  1N33 E;  3J80 Q;  4DKK A;  4DR3 E;  2UXB I;  4R1F A;  4HXZ A;  3LTO A;  1X47 A;  4LFC I;  1J5E I;  5LMN E;  1Z0G A;  2UUA I;  2A2C A;  2UXC E;  3Q1Q A;  1Z0V A;  3ADI A;  5BR8 I;  2DEI A;  3J7Y p;  2GS8 A;  2HK2 A;  4JI4 E;  2ZBK B;  3ZZT A;  1N33 I;  2HHH I;  4LFA E;  1N34 E;  4DUY I;  4JI8 E;  1QZR A;  4B3T E;  4LF7 E;  1H73 A;  2UUB I;  1YYW A;  4DV1 E; 
#chains in the Genus database with same CATH topology
 1KKH A;  3J81 C;  2EL4 A;  2VQE E;  4IS1 C;  2EZ6 A;  1X6F A;  2VRD A;  1IMU A;  3K85 A;  4LF8 I;  2NN6 C;  4OKG A;  5LL6 R;  4IFD E;  4XTJ A;  4HAC B;  4F6M A;  2BA0 G;  4FWH A;  4WUD A;  4BA2 B;  4ZYD A;  4DV0 I;  3VHT B;  4DUZ I;  2BA1 D;  3B8H A;  4X64 I;  2GQ0 A;  2YWQ A;  1IQO A;  3PYE A;  4O43 A;  4X64 E;  1Y4S A;  1TN9 A;  2KON A;  2JE6 B;  2VQE I;  5EL9 A;  3NZK A;  2B3T B;  2NPF A;  2VES A;  1GZ6 A;  2MC6 A;  1XNQ E;  1ZXM A;  4B3M E;  1PKP A;  2OI2 A;  2HJJ A;  2Z5B B;  2UUC E;  3WU5 A;  4DV3 I;  2EOF A;  1AAY A;  2YRK A;  2MKN A;  2O1T A;  2M1S A;  3HJC A;  2GO4 A;  5C0X D;  1IBK I;  1FI4 A;  2EP3 A;  4L5N C;  2EPA A;  4LF4 I;  4X66 I;  5K36 A;  4R2D A;  2L8T A;  2HHH E;  2EM7 A;  1T4L B;  1EH6 A;  2WBS A;  4NXM E;  3P3E A;  1HNX E;  2JXP A;  3PS1 A;  1NEI A;  2J7J A;  4IZJ A;  1A1I A;  3OTO E;  1Z0B A;  2BR2 A;  4M30 A;  5A69 A;  5JEA E;  4LFB I;  1FJG I;  3BGH A;  1A1K A;  2B7V A;  2UUB E;  1Y4U A;  3UK3 C;  1Y6Z A;  1XHK A;  5C0X F;  4JYA E;  2EN6 A;  2KOU A;  3F6G A;  4QNK A;  4BS9 A;  3WU3 A;  1X5W A;  1UHZ A;  3GLL A;  4F9B B;  3WU6 A;  2EM9 A;  3U1K A;  2PNL A;  2L2K B;  4HAC A;  2YU8 A;  2EMW A;  1XMO I;  4B3R E;  5AC5 A;  3MSW A;  2EM8 A;  4P78 A;  1OYR A;  4BC7 A;  2DMY A;  2C38 A;  2F8B A;  1Z0W A;  3QT8 A;  4AM3 A;  1RC7 A;  4DPU A;  1DGC A;  4UT4 A;  1WHN A;  2EPX A;  3ZZ0 A;  4I8O A;  5K36 D;  3K6Q A;  1ZBT A;  2NUF A;  4WFT A;  3VYX A;  1NHH A;  3BID A;  2Q2E B;  2ODR D;  2R42 A;  4X65 I;  4DR6 I;  3HKM A;  2EMX A;  4BBY A;  1PJQ A;  2YTF A;  4RPF A;  4BHB A;  2EN2 A;  2G7H A;  4U3D A;  4KHP E;  4P7A A;  4ZYH A;  3HXL A;  2V89 A;  4JI7 E;  4DV4 E;  1N0U A;  1U2R A;  1Z0C A;  1ZXN A;  4X9J A;  2IOP A;  4Z7C A;  2N3H A;  4WUB A;  2CT1 A;  2L2N A;  3ZZU A;  3C4T A;  4L8N A;  2GO3 A;  1UN6 B;  4LF5 I;  2EMY A;  4BHC A;  4DU7 A;  2EPL X;  4OO1 A;  1GQE A;  3MHS C;  4KZS A;  3JAM C;  1R6M A;  1ELO A;  5AE1 A;  1MG7 A;  4OX9 I;  3H1C A;  4DPT A;  4JV5 I;  4M1K A;  1P42 A;  4YHH E;  1BKN A;  3CDJ A;  4WXD A;  2L92 A;  4DR3 I;  2HKJ A;  4URL A;  2BV3 A;  4NXM I;  3EPL A;  4FW9 A;  4MU1 A;  2EL6 A;  3U1Y A;  1I94 I;  4R2S A;  2LTS A;  2AE8 A;  4DR2 E;  1STU A;  4JYA I;  5JEA D;  3H4L A;  4LF9 I;  3AV0 A;  1QNT A;  3LLH A;  4JI1 E;  2J7K A;  1B63 A;  4K0K I;  4HTG A;  2JEB B;  2EPM X;  2EOY A;  1XNR E;  3JU0 A;  2Z5E A;  5IWA I;  2VQF E;  2BB8 A;  2L2M A;  4O24 A;  3T1Y E;  4EMD A;  2RS7 A;  1YYO A;  1BBG A;  2EPR A;  4DV2 E;  4MU4 A;  2EM5 A;  2M4I A;  2RQL A;  4R2P A;  4DV0 E;  5A6B D;  2JP9 A;  4OX9 E;  3B4T A;  2JWO A;  4LF9 E;  2PO2 B;  4PRV A;  4U3B A;  4JI1 I;  4OO1 D;  5A2Q Q;  2CPN A;  5DNY A;  1HR0 I;  3ADL A;  3THO B;  4KWY A;  1RHY A;  1WHQ A;  4Q28 A;  4X8W A;  1JK1 A;  1N36 E;  2NN6 A;  4UTG A;  1YHC A;  4ISA A;  2YTE A;  4R2E A;  2YT4 A;  1MU5 A;  3UHM A;  4NXN E;  4B3S E;  2MDG A;  2YTG A;  5AAS A;  3P76 A;  2EM6 A;  3P3G A;  4DR1 E;  2Z5C A;  2J65 A;  2FV4 B;  4LFA I;  2JVA A;  4IJD A;  1I94 E;  3ZM7 A;  2EMG A;  1X6E A;  3M85 D;  5LMU E;  4X62 E;  4OZE A;  2MC5 A;  1YUJ A;  2EMA A;  4LU9 A;  3M85 G;  1FNM A;  2JEB A;  2VE7 C;  4PU9 A;  3EPH A;  4JI5 E;  2WNR B;  4JI0 I;  2EM3 A;  2E1M A;  4IFD A;  2UXC I;  2V86 A;  4JI3 I;  1USU A;  2M7Q A;  3EPK A;  2Z5B A;  4MDT A;  1X48 A;  3C4B A;  4LTY A;  3QT5 A;  5EKW A;  3HPZ A;  2PNZ A;  4USK A;  3KRN A;  2EE8 A;  3JTZ A;  4ZYG A;  2NN6 D;  4HYM A;  2LMZ A;  4LF6 I;  4GEQ B;  5K36 B;  2V2Z A;  5IXM B;  4MLQ A;  3M6A A;  2R3V A;  1T4O A;  4FW3 A;  2ZM6 E;  4FW4 A;  2F4V E;  1UDO A;  3AUZ A;  4MQY A;  2PO0 B;  2UUA E;  5LMN I;  1ZR9 A;  1A1L A;  2EQ3 A;  3H09 A;  1Z0T A;  2NN6 B;  1XMQ I;  5DNL A;  4J8Z A;  4GZN C;  1T39 A;  3ZKD A;  4DR5 E;  4GKJ I;  1KTV A;  2LJP A;  2V8P A;  1IBK E;  2YSO A;  1B69 A;  2FGG A;  4FWD A;  2IHR 1;  2ENA A;  1JK2 A;  5L3J A;  2JE6 A;  3T1H I;  5FLX Q;  2O1W A;  4DR7 I;  5IT9 Q;  2CZ9 A;  2K4V A;  2I13 A;  2EN4 A;  1XNQ I;  1IBM E;  1HNX I;  2VF3 A;  3PYG A;  5KL3 A;  2RSI A;  4F54 A;  1N32 E;  2EQ1 A;  1ZM9 A;  4R8O A;  2EN1 A;  2EMF A;  2YU5 A;  2EPN A;  4NXN I;  2NUG A;  4I3H A;  2RPC A;  4GKK E;  2IES A;  2YTP A;  2V34 A;  4AQY E;  1YPN A;  4LCH A;  1HNW E;  1L4S A;  1VIS A;  4FN5 A;  2JEA A;  1K47 A;  2EPZ A;  4NBQ A;  4DPW A;  4X62 I;  2HFU A;  1H7U A;  2DMI A;  1Z59 A;  2V88 A;  2JT2 A;  4WYQ B;  2R1F A;  4YY3 E;  5A2Q C;  1R6L A;  1RR9 A;  5GME A;  4LCG A;  2YRH A;  3RMP A;  4WXC A;  1FKA E;  2DB2 A;  2DLQ A;  4HEI A;  2NN6 F;  3L7Z B;  4B3S I;  4GKK I;  2VF1 A;  3LNU A;  1Z1B A;  4DV5 E;  4JI8 I;  3PYD A;  2L3C A;  2A25 A;  4BMJ A;  2WP8 A;  4O5G A;  5KL6 A;  1EH8 A;  1KIJ A;  4OO1 B;  4O4K A;  2C37 B;  3GON A;  5C0X B;  4JI2 E;  1YYK A;  2N8X A;  1FWL A;  4F9C B;  3ADG A;  4KHP I;  1Y5Y A;  2DIX A;  2GPI A;  5A6B A;  1X49 A;  4P52 A;  2EJ4 A;  1QU6 A;  2DSY A;  2YTD A;  2V2V A;  1N34 I;  4IZK B;  2LJU A;  5FWK A;  2ELZ A;  4N4R B;  4DV2 I;  2EM2 A;  2Q8U A;  2YTQ A;  1XMQ E;  1MEY C;  1KVK A;  1Z0E A;  2WZO A;  2CSH A;  1Z5C A;  2K7I A;  4MU0 A;  1YSA C;  4Q35 B;  2EPC A;  4BA2 A;  4AQY I;  1H72 C;  4LF6 E;  3K1J A;  4K0K E;  3HTX A;  3F6H A;  5ADZ A;  4DR7 E;  1YFH A;  3GCM A;  2LVH A;  4DU8 A;  1DAR A;  1NZ0 A;  1TF3 A;  4M9V C;  3L00 A;  4F6N A;  1PDA A;  2ADR A;  2XEX A;  1N32 I;  3B82 A;  2EN3 A;  2NA2 A;  1N0V C;  2LBS B;  2AJ4 A;  4ZVI A;  5A6J A;  1ZM4 A;  3QG5 C;  2E5L I;  1Z5B A;  1DI2 A;  4OO1 E;  4X65 E;  2WCC 3;  1XMO E;  4LCF A;  4M2Z A;  2EOS A;  1Z5A A;  5TSE A;  3PS2 A;  1MX0 A;  5FLX C;  2LCE A;  5IT9 C;  3HUL A;  3DD6 A;  2ZM6 I;  4R2A A;  1H74 A;  1DQ3 A;  4IZK A;  4JI5 I;  2RS6 A;  3TQM A;  1B62 A;  2V85 A;  2HK3 A;  2EQ0 A;  2V83 A;  2N3G A;  2R76 A;  4DR6 E;  4BC9 A;  5JEA C;  2EOJ A;  2L33 A;  1OYS A;  5LMU I;  5T6J A;  4DUZ E;  4FWG A;  2RTX A;  5IV8 B;  4NHR A;  3GME A;  1NHJ A;  2JPA A;  2YTI A;  4IZJ B;  3EPJ A;  2PRT A;  2EFG A;  4LPF A;  2EOI A;  2UXD E;  1ZM3 A;  1HNZ E;  4FW5 A;  2PO1 B;  4DV6 E;  3OTO I;  2EOQ A;  2MKD A;  3LPS A;  4FW7 A;  4M0V A;  1X6H A;  2ODR C;  1N3G A;  2EMK A;  4X66 E;  2EPU A;  4LF4 E;  5K36 C;  2Z5C B;  1D6T A;  4R2R A;  2JOX A;  2YTO A;  1GTK A;  3ZOQ B;  2O1V A;  4QNJ A;  1IQS A;  3J80 C;  1WRJ A;  4R03 A;  4IFD C;  2EWL A;  5KL4 A;  2DRP A;  3LML A;  4JI6 I;  3ADJ A;  4JI4 I;  2WNR A;  5A6K A;  2E1R A;  2DEJ A;  5K36 E;  4WX9 A;  1O0W A;  4GQU A;  2JYA A;  1RMD A;  1LLM C;  4DV5 I;  3J7A M;  2UXD I;  4JG4 A;  2UU9 I;  2V2Q A;  2EOR A;  1WUU A;  2L3J A;  3F0N A;  2MDR A;  1ZU1 A;  4AIM A;  4B3M I;  4GKJ E;  3P06 A;  2NAB A;  2A2D A;  1AH5 A;  1UIL A;  4LFC E;  2BBG A;  2LRS A;  2ENH A;  3ECR A;  1EKZ A;  5IWA E;  4DV1 I;  4DV4 I;  4MYU A;  4JI7 I;  4NZV A;  1BB8 A;  4DPX A;  2HFS A;  1XNR I;  2JR1 A;  2O3Z A;  1HNZ I;  4JV5 E;  1HNW I;  4WSP A;  2EMI A;  2V87 A;  2GHF A;  5BR8 E;  2EPO A;  3C6K A;  1UDQ A;  2F1D A;  2EPP A;  4J3D A;  4BA1 A;  1PJS A;  4BCA A;  2BA1 G;  2LE2 A;  4DMI A;  1ZAA C;  3P3C A;  5DRQ A;  2NUE A;  2WW4 A;  4TUI A;  1IBL I;  4P7D A;  2CVE A;  2EOX A;  3QT6 A;  1J5E E;  1WJP A;  2LT7 A;  2PO2 A;  4KQV A;  1IBM I;  3CWV A;  4JI0 E;  4DV7 I;  2E5L E;  1G2D C;  3PYF A;  4DV7 E;  3J7A G;  3J81 Q;  5C0X A;  4OOG C;  2EMH A;  3DJW A;  4LF5 E;  3BBG A;  2NN6 E;  4B3T I;  2EOE A;  2BR2 B;  4LF7 I;  4OO1 C;  3KWR A;  4DR5 I;  1IBL E;  3HQ1 A;  3PS3 A;  4WPY A;  4F2J C;  4R2Q A;  2GLI A;  5AC4 A;  4DR1 I;  3M7N D;  1P47 A;  1A6F A;  3V5R A;  1PVG A;  2F4V I;  2UXB E;  1E3H A;  1YH8 A;  1BBO A;  2EOH A;  1NCS A;  4LFB E;  1HK7 A;  1FJG E;  2EMZ A;  2LTR A;  1OYP A;  4USM A;  2RSM A;  4JI2 I;  2X7I A;  1EI1 A;  2JOB A;  3IWB A;  5F3W A;  3L7Z A;  3Q6N A;  2HC5 A;  1PJT A;  4JI3 E;  2EPK X;  2YRM A;  2X36 A;  1WXR A;  1HR0 E;  5DNX A;  2WP8 B;  3Q6M A;  4BA1 B;  1FWK A;  2DLK A;  2H36 X;  1UDN A;  2C37 A;  5A6A A;  5DRR A;  3WU4 A;  2UUC I;  1E3P A;  5C0X C;  3T1H E;  1USV A;  4B3R I;  4WUC A;  4YY3 I;  3C6M A;  5DRO A;  1J26 A;  1N36 I;  2M9A A;  2B9D A;  4DR4 I;  1S16 A;  1A1F A;  4JI6 E;  1TF6 A;  1NHI A;  3D4J A;  4DR4 E;  2EN8 A;  4MLV A;  2HKE A;  4MU3 A;  2PNZ B;  3ZKB A;  4IFD F;  2BM1 A;  1H7S A;  2C39 A;  2VQF I;  1YZ9 A;  2EMB A;  3VK6 A;  2BM0 A;  4DV6 I;  3EQ1 A;  1UEK A;  2PO0 A;  2B7T A;  2UU9 E;  3P1X A;  5JEA A;  4DV3 E;  1OJ4 A;  3BF2 A;  1PIE A;  3QT7 A;  4ED4 A;  1XXE A;  2CGE A;  3B78 A;  2LO3 A;  2LUQ A;  1UDS A;  2ELY A;  4OO1 F;  1EA6 A;  2C38 B;  4IFD D;  4FK5 C;  5KL5 A;  4IZJ D;  1A1H A;  2EOZ A;  3IWD A;  2EN7 A;  4YHH I;  2YZT A;  2EMC A;  2YTN A;  3FIG A;  3DF6 A;  4HY1 A;  3IWC A;  2WBT A;  3MHH C;  4DUY E;  4DR2 I;  5DRP A;  2DGC A;  2D9H A;  1ZM2 A;  2V8Q B;  4DPY A;  2LUP B;  1G2F C;  5JEA F;  2EML A;  2LJH A;  5AE2 A;  4LF8 E;  4PRX A;  2KHX A;  2IOQ A;  1S4E A;  5C0X E;  4MYT A;  4N3O A;  3M7N G;  1KJK A;  1UBD C;  3K17 A;  2CG9 A;  2JEA B;  1RQ0 A;  2HGH A;  5AE3 A;  2ZIT A;  2IER A;  4Z7Y A;  2JY9 A;  5CFF E;  4F9A B;  3KZY A;  1VI7 A;  2BA0 D;  4LOM A;  2C39 B;  5GMD A;  2I9I A;  1A1J A;  3VYY A;  3V2U C;  1RRE A;  4DXL A;  1T4N A;  1N33 E;  3JAM Q;  3T1Y I;  5KL7 A;  4TUG A;  1A1G A;  3J80 Q;  3KZZ A;  4DKK A;  4DR3 E;  3M99 B;  2E72 A;  5ELW A;  4WSG A;  2EOM A;  5JEA B;  2CTD A;  2EM4 A;  3CDI A;  1SFE A;  2YPN A;  3THN A;  4HXZ A;  4R1F A;  2UXB I;  3HPS A;  3LTO A;  1X47 A;  4AID A;  2EOO A;  5LLQ A;  2WBU A;  4LFC I;  4IS9 A;  1J5E I;  2PO1 A;  1KYQ A;  5LMN E;  1Z0G A;  2UUA I;  4RHB B;  1YUI A;  2A2C A;  3OML A;  1ZBQ A;  2PNM A;  2UXC E;  1EH7 A;  2EM0 A;  3Q1Q A;  2EL5 A;  4RH8 A;  1Z0V A;  3ADI A;  5BR8 I;  5K36 F;  2LV2 A;  2DEI A;  3J7Y p;  1F2I G;  2GS8 A;  2ENC A;  2HK2 A;  4JI4 E;  1T38 A;  2ZBK B;  3ZZT A;  4ZYE A;  1N33 I;  1MGT A;  2HHH I;  2YSP A;  4LFA E;  1N34 E;  4DUY I;  4JI8 E;  4IFD B;  5KL2 A;  4B3T E;  4R2C A;  4LF7 E;  1X3C A;  1H73 A;  1QZR A;  2FTX B;  2L6M A;  4FW6 A;  1SR9 A;  2UUB I;  2YTJ A;  1YYW A;  4DV1 E;  1Y60 A;  2O1U A;  3PRY A; 
#chains in the Genus database with same CATH homology
 1KKH A;  3J81 C;  2VQE E;  2EZ6 A;  4LF8 I;  3K85 A;  5LL6 R;  4XTJ A;  4HAC B;  4FWH A;  4WUD A;  4DV0 I;  4DUZ I;  3B8H A;  4X64 I;  2GQ0 A;  3PYE A;  4X64 E;  1Y4S A;  2KON A;  2VQE I;  2B3T B;  2NPF A;  1GZ6 A;  2MC6 A;  1XNQ E;  1ZXM A;  4B3M E;  1PKP A;  2OI2 A;  2Z5B B;  3WU5 A;  2UUC E;  4DV3 I;  2O1T A;  3HJC A;  2M1S A;  1IBK I;  1FI4 A;  4L5N C;  4LF4 I;  4X66 I;  2L8T A;  2HHH E;  1T4L B;  5L3J A;  3T1Y I;  4NXM E;  1HNX E;  4IZJ A;  3OTO E;  1Z0B A;  4M30 A;  1FJG I;  4LFB I;  2B7V A;  2UUB E;  1Y4U A;  1Y6Z A;  1XHK A;  4JYA E;  2KOU A;  3F6G A;  4BS9 A;  3WU3 A;  1UHZ A;  4F9B B;  3WU6 A;  2PNL A;  2L2K B;  4HAC A;  1XMO I;  4B3R E;  3MSW A;  4P78 A;  4BC7 A;  2DMY A;  2F8B A;  1Z0W A;  3QT8 A;  1RC7 A;  4DPU A;  4UT4 A;  1WHN A;  3ZZ0 A;  4I8O A;  3K6Q A;  1ZBT A;  2NUF A;  4WFT A;  3VYX A;  1NHH A;  2Q2E B;  2R42 A;  2ODR D;  4X65 I;  4DR6 I;  4BBY A;  4RPF A;  2G7H A;  4KHP E;  4P7A A;  3HXL A;  2V89 A;  4JI7 E;  4DV4 E;  1N0U A;  1U2R A;  1Z0C A;  1ZXN A;  2IOP A;  4Z7C A;  2N3H A;  4WUB A;  2L2N A;  3ZZU A;  3C4T A;  4L8N A;  4LF5 I;  4DU7 A;  1GQE A;  4KZS A;  3JAM C;  1ELO A;  5AE1 A;  1MG7 A;  4OX9 I;  4DPT A;  4JV5 I;  4M1K A;  4YHH E;  1BKN A;  2L92 A;  4DR3 I;  2HKJ A;  4URL A;  2BV3 A;  4NXM I;  4FW9 A;  1I94 I;  2LTS A;  4DR2 E;  1STU A;  4JYA I;  3H4L A;  4LF9 I;  3AV0 A;  3LLH A;  4JI1 E;  2J7K A;  1B63 A;  4K0K I;  1XNR E;  5IWA I;  3JU0 A;  2Z5E A;  2VQF E;  3T1Y E;  2L2M A;  4EMD A;  2RS7 A;  1YYO A;  4DV2 E;  2M4I A;  4DV0 E;  4PRV A;  4JI1 I;  4OX9 E;  4LF9 E;  2JWO A;  5A2Q Q;  2CPN A;  5DNY A;  1HR0 I;  3ADL A;  1WHQ A;  4Q28 A;  4X8W A;  1N36 E;  4UTG A;  2YT4 A;  1MU5 A;  4NXN E;  4B3S E;  5AAS A;  4DR1 E;  2Z5C A;  4LFA I;  2FV4 B;  2JVA A;  1I94 E;  3ZM7 A;  5LMU E;  4X62 E;  2MC5 A;  4LU9 A;  1FNM A;  2VE7 C;  4PU9 A;  4JI5 E;  4JI0 I;  2E1M A;  2UXC I;  2V86 A;  4JI3 I;  1USU A;  2M7Q A;  2Z5B A;  1X48 A;  3C4B A;  4LTY A;  3QT5 A;  3HPZ A;  4USK A;  3JTZ A;  4HYM A;  2LMZ A;  4LF6 I;  4GEQ B;  2V2Z A;  3M6A A;  2R3V A;  1T4O A;  2ZM6 E;  2F4V E;  3AUZ A;  2UUA E;  5LMN I;  3H09 A;  1Z0T A;  1XMQ I;  4J8Z A;  3ZKD A;  4DR5 E;  4GKJ I;  1KTV A;  2LJP A;  2V8P A;  1IBK E;  4FWD A;  2FGG A;  2IHR 1;  4DR7 I;  3T1H I;  5FLX Q;  2O1W A;  5IT9 Q;  2CZ9 A;  2K4V A;  1XNQ I;  1IBM E;  1HNX I;  2VF3 A;  3PYG A;  4F54 A;  1N32 E;  1ZM9 A;  4R8O A;  4NXN I;  2NUG A;  4I3H A;  4GKK E;  2V34 A;  4AQY E;  1HNW E;  1VIS A;  4FN5 A;  1K47 A;  4X62 I;  4DPW A;  2HFU A;  1H7U A;  1Z59 A;  2V88 A;  4WYQ B;  1RR9 A;  4YY3 E;  5A2Q C;  5GME A;  3RMP A;  1FKA E;  2DB2 A;  4GKK I;  4B3S I;  2VF1 A;  3LNU A;  4DV5 E;  4JI8 I;  3PYD A;  2L3C A;  4BMJ A;  1KIJ A;  3GON A;  4JI2 E;  1YYK A;  1FWL A;  4F9C B;  3ADG A;  4KHP I;  2DIX A;  1X49 A;  4P52 A;  1QU6 A;  2DSY A;  2V2V A;  1N34 I;  4IZK B;  5FWK A;  4DV2 I;  1XMQ E;  1KVK A;  1Z0E A;  2WZO A;  1Z5C A;  4AQY I;  1H72 C;  4LF6 E;  3K1J A;  4K0K E;  3HTX A;  3F6H A;  5ADZ A;  4DR7 E;  4DU8 A;  1DAR A;  1NZ0 A;  2XEX A;  1N32 I;  3B82 A;  2NA2 A;  1N0V C;  2LBS B;  2AJ4 A;  4ZVI A;  1ZM4 A;  2E5L I;  1Z5B A;  1DI2 A;  4X65 E;  1XMO E;  4M2Z A;  1Z5A A;  1MX0 A;  5FLX C;  5IT9 C;  3HUL A;  2ZM6 I;  1H74 A;  1DQ3 A;  4IZK A;  4JI5 I;  2RS6 A;  1B62 A;  2V85 A;  2HK3 A;  2V83 A;  2N3G A;  4DR6 E;  4BC9 A;  2L33 A;  5LMU I;  5T6J A;  4DUZ E;  4FWG A;  2RTX A;  1NHJ A;  4IZJ B;  2EFG A;  2UXD E;  1ZM3 A;  1HNZ E;  4DV6 E;  3OTO I;  3LPS A;  4M0V A;  2ODR C;  4X66 E;  4LF4 E;  2Z5C B;  1D6T A;  2JOX A;  2O1V A;  3ZOQ B;  3J80 C;  4R03 A;  2EWL A;  3LML A;  4JI6 I;  3ADJ A;  4JI4 I;  2E1R A;  2DEJ A;  1O0W A;  3J7A M;  4DV5 I;  2UXD I;  4JG4 A;  2UU9 I;  2V2Q A;  1WUU A;  2L3J A;  3F0N A;  2MDR A;  4B3M I;  4GKJ E;  3P06 A;  2A2D A;  1UIL A;  4LFC E;  2LRS A;  1EKZ A;  4DV1 I;  5IWA E;  1XNR I;  4DV4 I;  4MYU A;  4JI7 I;  4DPX A;  2HFS A;  2JR1 A;  1HNZ I;  4JV5 E;  1HNW I;  4WSP A;  2V87 A;  5BR8 E;  4BCA A;  2LE2 A;  4DMI A;  2NUE A;  2WW4 A;  4TUI A;  1IBL I;  4P7D A;  3QT6 A;  1J5E E;  4KQV A;  1IBM I;  3CWV A;  4JI0 E;  4DV7 I;  2E5L E;  3PYF A;  3J81 Q;  4DV7 E;  3J7A G;  4OOG C;  3DJW A;  4LF5 E;  4B3T I;  4LF7 I;  3KWR A;  4DR5 I;  1IBL E;  3HQ1 A;  4WPY A;  4DR1 I;  1A6F A;  3V5R A;  1PVG A;  2F4V I;  2UXB E;  1HK7 A;  4LFB E;  1FJG E;  2LTR A;  4USM A;  2RSM A;  4JI2 I;  2X7I A;  1EI1 A;  2JOB A;  3IWB A;  5F3W A;  3Q6N A;  4JI3 E;  2X36 A;  1WXR A;  1HR0 E;  3Q6M A;  1FWK A;  2H36 X;  3WU4 A;  2UUC I;  3T1H E;  1USV A;  4B3R I;  4WUC A;  4YY3 I;  1J26 A;  1N36 I;  2B9D A;  4DR4 I;  1S16 A;  4JI6 E;  1NHI A;  3D4J A;  4DR4 E;  2HKE A;  3ZKB A;  2BM1 A;  1H7S A;  2VQF I;  1YZ9 A;  3VK6 A;  2BM0 A;  4DV6 I;  1UEK A;  2B7T A;  2UU9 E;  3P1X A;  4DV3 E;  1OJ4 A;  1PIE A;  3QT7 A;  4ED4 A;  2CGE A;  3B78 A;  2LUQ A;  1EA6 A;  4IZJ D;  3IWD A;  4YHH I;  2YZT A;  3FIG A;  3DF6 A;  4HY1 A;  3IWC A;  4DUY E;  4DR2 I;  1ZM2 A;  2V8Q B;  4DPY A;  2LUP B;  2LJH A;  4LF8 E;  5AE2 A;  4PRX A;  2KHX A;  2IOQ A;  1S4E A;  4MYT A;  4N3O A;  3K17 A;  2CG9 A;  1RQ0 A;  5AE3 A;  2ZIT A;  4Z7Y A;  2JY9 A;  5CFF E;  4F9A B;  5GMD A;  4DXL A;  3JAM Q;  3VYY A;  3V2U C;  1RRE A;  1T4N A;  1N33 E;  4TUG A;  3J80 Q;  4DKK A;  4DR3 E;  2UXB I;  4R1F A;  4HXZ A;  3HPS A;  3LTO A;  1X47 A;  4LFC I;  1J5E I;  5LMN E;  1Z0G A;  2UUA I;  2A2C A;  3OML A;  1ZBQ A;  2PNM A;  2UXC E;  3Q1Q A;  1Z0V A;  3ADI A;  5BR8 I;  2DEI A;  3J7Y p;  2GS8 A;  2HK2 A;  4JI4 E;  2ZBK B;  3ZZT A;  1N33 I;  2HHH I;  4LFA E;  1N34 E;  4DUY I;  4JI8 E;  1QZR A;  4B3T E;  4LF7 E;  1H73 A;  2FTX B;  2L6M A;  1SR9 A;  2UUB I;  1YYW A;  4DV1 E;  2O1U A;  3PRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...