4DR4E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4E02
1KTVA 1XNQI 4DPUA 1RR9A 4DV0I 3T1HE 4DR5I 2R42A 1NZ0A 4MYTA 2L2KB 3ZKDA 3QT6A 4JI4I 4JI6I 4DR2I 4DUZI 4DV1E 4DKKA 4DUYE 5A2QQ 2LTSA 1FI4A 2NPFA 4XTJA 2BM1A 4KQVA 3ZKBA 4WYQB 1WHQA 2A2CA 1XNQE 2IHR1 3QT7A 4X62I 2RTXA 1D6TA 1N32I 1VISA 1FJGI 5L3JA 4JI4E 2L33A 4DR2E 4DUZE 3K1JA 2LBSB 3CWVA 5A2QC 1PVGA 3ZZTA 5IWAI 1Z5CA 1FKAE 4DU7A 1N36I 1S4EA 1ZXMA 2HKEA 1N32E 1FJGE 3JAMC 3ADLA 1X48A 1QZRA 2JVAA 3Q1QA 2UUBI 1H7SA 5IWAE 2GS8A 3J7Yp 1UHZA 1HNWI 1BKNA 2R3VA 5GMEA 2CZ9A 4DV4I 1NHHA 1Z0GA 2RSMA 4LF8I 4B3RE 3T1YI 2NUEA 1UEKA 4PRVA 2VQFE 2UUBE 4I3HA 4LF9I 4JI3I 4EMDA 4JI0E 3J7AG 2V34A 3D4JA 2DEJA 1N34E 2DIXA 1HNWE 2ZM6I 2OI2A 2BM0A 1B63A 3PYGA 4DPTA 4NXNI 1KVKA 2ZITA 4FWHA 1Z0VA 3T1YE 3J80Q 2AJ4A 4R1FA 1N33I 4LF9E 4JI3E 1MG7A 3LNUA 1HNXI 3HTXA 4P7AA 1ZM9A 3PYEA 4B3SI 1XMQE 3F0NA 4LFCI 2LRSA 1KIJA 4DV1I 1X47A 2X7IA 1EKZA 1WUUA 4NXNE 3J81C 2UUAI 1ZBTA 1N33E 5IT9C 2JY9A 1RQ0A 2HFSA 4USMA 4GKKI 4JI2E 1HNXE 1YYOA 1IBMI 4M30A 4OOGC 4B3SE 4LFCE 2L2NA 1KKHA 1NHJA 2ZBKB 2N3GA 4YY3E 3ADGA 2UXDE 4USKA 2UUAE 4JI1I 2V2VA 1Z0BA 4DPXA 2L2MA 4M2ZA 4DV5I 4OX9I 4GKKE 1ZM4A 3ZZUA 4Z7CA 1IBME 2NUGA 2UUCI 1K47A 1QU6A 4DR6I 5GMDA 4YHHI 3WU4A 1I94I 4X66I 4B3TI 1ZXNA 1J26A 4HACA 4JI1E 4LF4I 4JI8E 4LFBI 1T4NA 2L3JA 4DV5E 4OX9E 4X65E 1PKPA 2UUCE 4UTGA 4DR6E 4DR1I 4DPYA 2WW4A 4YHHE 1IBKI 1I94E 1WHNA 4X66E 5FLXQ 2HHHI 4JI7I 4B3RI 2VQFI 2B3TB 2EFGA 4DV6I 4B3TE 4JI0I 3J7AM 5LMUI 4LF4E 1YZ9A 4LFBE 1N34I 2A2DA 4WFTA 3WU6A 1YYWA 1A6FA 4X64I 4JV5E 1PIEA 2EZ6A 3HULA 4P52A 4ZVIA 4DR1E 4JI5I 4GKJI 3C4TA 1IBKE 2F4VE 4JI7E 2HHHE 3OTOE 4WUBA 4DV6E 4JYAI 1FWKA 5LMUE 5LL6R 2NA2A 3ADJA 4DR3I 1UILA 1XMQI 4X64E 1HNZI 3P1XA 2V2QA 3B8HA 4JI5E 4GKJE 3V5RA 2V8PA 4JG4A 2B7VA 3ADIA 4JYAE 2CPNA 4RPFA 1DI2A 4JI2I 2LJHA 2XEXA 4UT4A 1T4LB 2UXCI 2B7TA 4DR3E 3LTOA 4HYMA 1H74A 1HNZE 4HXZA 4YY3I 2X36A 2UXDI 1NHIA 1RREA 3J80C 2RS6A 3LPSA 1MX0A 1T4OA 3WU3A 4LF6I 2L3CA 1N0UA 2UXCE 2KHXA 4HY1A 1Z0CA 2RS7A 4LFAI 1ZM3A 4DV2I 1XNRI 1RC7A 4KHPE 1IBLI 1O0WA 4DR7I 4JI8I 2MDRA 3PYFA 2HFUA 4X65I 4LF6E 4ED4A 4FW9A 4FN5A 3PYDA 3M6AA 4LF5E 4LFAE 1Z0WA 1MU5A 4DV2E 2BV3A 1XNRE 1EI1A 1IBLE 3V2UC 4DV7E 4DR7E 2YT4A 1YYKA 2Q2EB 2UU9I 4DV0E 4DR5E 1H7UA 2NUFA 3JAMQ 1XMOI 4MYUA 4JV5I 4JI6E 2V2ZA 3QT5A 2DB2A 2E5LI 5BR8I 2F4VI 4DU8A 3OTOI 3B82A 1Z0TA 1FNMA 4PRXA 2LUPB 2UU9E 1U2RA 4X62E 1STUA 1S16A 1XMOE 4URLA 4DV3I 2VQEI 5FLXC 2E5LE 5BR8E 1EA6A 2UXBI 1GQEA 1XHKA 3ZZ0A 4DR4I 2DEIA 3WU5A 4DPWA 4X8WA 1N36E 1ZM2A 4DXLA 1H72C 4AQYI 4DV3E 4FWDA 2VQEE 2LUQA 1J5EI 4NXMI 2E1RA 2UXBE 1N0VC 2N3HA 4B3MI 4WUDA 1DARA 4M1KA 2HKJA 4DR4E 4LF7I 3C4BA 5LMNI 3K17A 3LLHA 2HK3A 1Z5AA 4DV4E 4K0KI 4AQYE 1HR0I 4KHPI 3ZM7A 1B62A 1J5EE 4LF8E 5CFFE 4NXME 3VYXA 3J81Q 2LJPA 3B78A 4B3ME 2DMYA 1X49A 1H73A 5IT9Q 1Z59A 3T1HI 4LF7E 1Z5BA 4HACB 3GONA 2J7KA 3H4LA 5LMNE 1OJ4A 2ZM6E 2VF3A 3QT8A 4WUCA 4LF5I 4PU9A 4FWGA 1FWLA 2HK2A 4K0KE 4Z7YA 1Z0EA 3VYYA 1HR0E 4DUYI 1ELOA 4DV7I 2LTRA
chains in the Genus database with same CATH superfamily
2EPRA 1G2DC 2CT1A 2EQ0A 1KTVA 1XNQI 4DPUA 1RR9A 2BA1D 2ODRC 2JE6B 4DV0I 2YTEA 3T1HE 3IWBA 4DR5I 4IFDA 2EPPA 1A1HA 2R42A 1NZ0A 3JU0A 1IMUA 4MYTA 2L2KB 3ZKDA 3QT6A 1PJSA 4JI4I 4JI6I 2E72A 2EM7A 4R2RA 4DR2I 3UK3C 4O24A 2JEBA 4DUZI 1GTKA 2DSYA 4DV1E 2C38B 2EPXA 4DKKA 2PO1B 1NCSA 5C0XC 4DUYE 1PDAA 5A2QQ 2LTSA 1FI4A 2NPFA 2EMGA 2IESA 4XTJA 2BM1A 5DNLA 4BA1B 4KQVA 3ZKBA 4WYQB 1WHQA 2EMLA 5A6BD 2DRPA 1XNQE 2A2CA 3THNA 3KRNA 4OO1A 2JEAB 2EPCA 2IHR1 3QT7A 3QG5C 2YTDA 4AIDA 1YH8A 2RTXA 4X62I 1D6TA 1N32I 1VISA 1FJGI 2WBUA 4WPYA 2VQEI 5L3JA 2EWLA 4JI4E 4IS9A 2L33A 3BF2A 4DR2E 2EPOA 4DUZE 1UDSA 4LPFA 3K1JA 2N8XA 2LBSB 3CWVA 4LCGA 2EN2A 3CDIA 2M9AA 5A2QC 1EH6A 2EMFA 1PVGA 3HQ1A 3ZZTA 5IWAI 2I9IA 1Z5CA 3PS1A 5AE2A 1FKAE 4IFDD 4J3DA 4DU7A 2EPLX 3K85A 1X6FA 4M9VC 2GQ0A 1N36I 2O1UA 4RH8A 1S4EA 2YZTA 1ZXMA 2LV2A 2HKEA 4BA2B 1N32E 2MKNA 1FJGE 3L00A 3JAMC 3ADLA 2EL6A 2DMIA 5KL5A 3HKMA 5JEAF 2ELZA 4ZYGA 1X48A 4NBQA 1RMDA 5KL3A 2JWOA 1BBOA 1QZRA 2YTPA 2LCEA 2JVAA 2EOJA 2YPNA 3ECRA 3Q1QA 2UUBI 4OO1D 1H7SA 4RHBB 5IWAE 4IZKA 2PNZA 2GS8A 4AM3A 3M85G 3L7ZA 2R1FA 4O4KA 3J7Yp 1UHZA 1Y4SA 4KZSA 2CTDA 1BKNA 2R3VA 1HNWI 3M7ND 3VK6A 1XXEA 5GMEA 1AH5A 5IV8B 2IOPA 2C39B 1P42A 2CZ9A 4BMJA 4DV4I 2BBGA 1Y6ZA 1NHHA 1HK7A 1Z0GA 2EOQA 2RSMA 2EL5A 2EORA 2L92A 1OYRA 4LF8I 4B3RE 3T1YI 2NUEA 5DNYA 1UEKA 4WSGA 3RMPA 5K36D 4PRVA 2VQFE 2UUBE 4I3HA 4LF9I 4JI3I 3F6GA 2BR2A 4FW7A 4JI0E 4FW4A 4EMDA 4ZYDA 2EMBA 2R76A 3J7AG 2JT2A 2V34A 2ENCA 3D4JA 2DEJA 2KOUA 1N34E 2DIXA 2YRHA 5DRRA 1HNWE 2LJUA 2ZM6I 2YU5A 2EOOA 1Y5YA 2OI2A 2M1SA 1B63A 2BM0A 3PYGA 1USVA 1WRJA 2WP8A 4IFDB 2RPCA 4BHBA 1IQOA 2O1WA 4LTYA 5EKWA 1JK2A 4DPTA 4NXNI 4TUIA 5IXMB 1KVKA 2GO4A 2EMHA 2H36X 2ZITA 4FWHA 1Z0VA 4IZJA 3T1YE 2VESA 2YWQA 5T6JA 1X3CA 2AJ4A 4R1FA 4LF9E 3PS3A 4JI3E 3J80Q 1N33I 3IWCA 1MG7A 1Y60A 4FK5C 2EN4A 4F9CB 5KL7A 3LNUA 3KZZA 4F6MA 3BIDA 4OKGA 1HNXI 3HTXA 4P7AA 1ZM9A 2EOSA 2PO2B 1UDNA 3PYEA 4N4RB 1WXRA 5KL6A 1XMQE 4B3SI 1QNTA 3F0NA 4LFCI 4Q35B 1UDOA 2LRSA 1KIJA 3U1KA 4DV1I 1X47A 2X7IA 1EKZA 1WUUA 4NXNE 2YRMA 2YSPA 3J81C 4O5GA 2UUAI 4NZVA 5ELWA 1ZBTA 1N33E 5IT9C 2EOIA 2JY9A 1RQ0A 2PNMA 2HFSA 2L6MA 4USMA 4GKKI 5JEAC 4DMIA 3LMLA 3OMLA 1HNXE 1YYOA 4JI2E 1IBMI 5K36B 1AAYA 4M30A 2RSIA 4OOGC 4ZYEA 4B3SE 2E1MA 2EE8A 2EM2A 1B69A 4LFCE 2NN6A 1MGTA 1ZU1A 2L2NA 1KKHA 1NHJA 2IERA 3DD6A 2ZBKB 1YHCA 2N3GA 4YY3E 3ADGA 4R8OA 2UXDE 2ENHA 4USKA 2UUAE 2MDGA 5KL2A 2PRTA 4JI1I 2V2VA 1Z0BA 4DPXA 2L2MA 3EPJA 4M2ZA 4DV5I 1ZR9A 2ENAA 2M7QA 4OX9I 4GKKE 2C37B 1ZM4A 1DQ3A 4HEIA 1TN9A 3L7ZB 3ZZUA 4F6NA 4Z7CA 1IBME 2PNLA 2NUGA 2EN1A 2UUCI 5DRPA 3K6QA 2EM9A 4F54A 1K47A 2ADRA 1QU6A 4DR6I 2EPAA 5JEAA 2EOHA 2L8TA 5GMDA 2Z5CA 4YHHI 3WU4A 1I94I 4X66I 1N3GA 5DROA 2F1DA 2Z5BA 3M85D 2WNRA 4B3TI 1ZXNA 4ZYHA 1J26A 4HACA 1G2FC 4JI1E 1KYQA 4JI8E 4LF4I 4LFBI 1T4NA 3ZOQB 2L3JA 1KJKA 4IFDF 4DV5E 4OX9E 5C0XA 2BR2B 4MDTA 1NEIA 2NABA 3HXLA 2NN6D 2PO0A 2EOZA 4X65E 1YFHA 1TF3A 1PKPA 4BC9A 2EOYA 4L5NC 2UUCE 4UTGA 2JXPA 2EQ1A 4DR6E 2HJJA 2D9HA 4DR1I 4DPYA 2LMZA 2WW4A 4YHHE 4X9JA 1IBKI 1I94E 1WHNA 4X66E 5FLXQ 2HHHI 1A1FA 4JI7I 4B3RI 1BBGA 3P76A 2VQFI 4OZEA 2GHFA 2B3TB 2EFGA 4DV6I 4B3TE 4JI0I 4OO1F 2YTNA 3J7AM 2EPNA 4MU0A 5LMUI 4LF4E 4R2PA 1YZ9A 4LFBE 1N34I 4GEQB 4WSPA 2BB8A 2A2DA 4WFTA 3PS2A 2ODRD 3WU6A 2EMZA 1YYWA 1PJQA 1A6FA 4MLVA 1E3PA 4X64I 5DRQA 4R2SA 4JV5E 3P06A 2PO1A 2O1TA 1PIEA 2DLQA 2EZ6A 3HULA 4P52A 4ZVIA 1X5WA 2FTXB 4DR1E 4BA1A 2JR1A 5A6AA 3C4TA 1IBKE 3BGHA 2F4VE 4GKJI 4JI7E 2HHHE 3H1CA 2LO3A 4LU9A 1YUIA 2JEAA 3OTOE 3KZYA 5C0XD 4WUBA 5K36F 4DV6E 2VF1A 4JYAI 3MSWA 1FWKA 5LMUE 5LL6R 2B9DA 2NA2A 2EMXA 4MU1A 1EH7A 3ADJA 4GZNC 1A1GA 4DR3I 1UILA 1DGCA 5KL4A 4JI5I 1XMQI 3MHSC 2EM6A 4X64E 1HNZI 2K7IA 1R6MA 3P1XA 3B4TA 3P3CA 4IFDE 2YSOA 2V2QA 3B8HA 4JI5E 2DLKA 1A1LA 2MC6A 4GKJE 1YPNA 4P7DA 1P47A 2JEBB 4BC7A 3GLLA 2EOXA 2EOMA 3V5RA 2V8PA 4JG4A 2B7VA 2EQ3A 4BA2A 3ADIA 2EN7A 4JYAE 2HGHA 2CPNA 1WJPA 4RPFA 1DI2A 4JI2I 1A1IA 2LJHA 1IQSA 2XEXA 4UT4A 1T4LB 2UXCI 2B7TA 4DR3E 3LTOA 4HYMA 4I8OA 4OO1B 2FGGA 3UHMA 2RQLA 1H74A 2EJ4A 5AE3A 1X6EA 2JOBA 2K4VA 4OO1E 5A6JA 1HNZE 2F8BA 3H09A 4HXZA 4M0VA 4WX9A 3KWRA 5ADZA 5A6KA 2EMCA 4FW3A 4YY3I 2X36A 4IFDC 2UXDI 1NHIA 4U3BA 2EMAA 3VHTB 3J80C 1UN6B 1RREA 2RS6A 1UBDC 3F6HA 2WNRB 4HTGA 2EMYA 1USUA 3LPSA 1T38A 1MX0A 2WBTA 1T4OA 4R2EA 2C39A 3WU3A 2L3CA 1N0UA 5A6BA 2UXCE 2KHXA 2O3ZA 4HY1A 1Z0CA 4LF6I 2RS7A 4FW6A 3AUZA 1A1JA 5K36E 2MC5A 4LFAI 1ZM3A 4IZJD 2GO3A 4WXDA 4DV2I 3EPLA 3CDJA 4OO1C 1XNRI 3JTZA 1RC7A 4KHPE 1IBLI 5DNXA 2EM8A 2ELYA 3BBGA 4WXCA 1BB8A 5F3WA 1O0WA 1Z1BA 4LCHA 4R2QA 4R2CA 4DR7I 3C6KA 4BBYA 2MDRA 4JI8I 2EM0A 2LE2A 2M4IA 3IWDA 3PYFA 2HFUA 4IZKB 5AE1A 2PNZB 3NZKA 5A69A 4F9BB 2MKDA 4X65I 1ZAAC 2LVHA 4LF6E 1L4SA 2CVEA 4ED4A 4FW9A 1E3HA 2CG9A 2EPUA 4FN5A 3PYDA 3M6AA 4LF5E 2O1VA 4IS1C 4LFAE 1Z0WA 2EN3A 1MU5A 4DV2E 5K36C 2YU8A 1JK1A 2BA0G 4F2JC 4N3OA 2BV3A 2EM4A 1XNRE 1EI1A 1IBLE 3V2UC 4DV7E 3THOB 1X6HA 5TSEA 5LLQA 1RHYA 4U3DA 4DR7E 2EOFA 2YT4A 3HPZA 1YYKA 2Q2EB 2PO2A 1MEYC 2JYAA 1OYPA 4LOMA 2UU9I 4DV0E 4GQUA 3DF6A 2BA1G 4DR5E 5FWKA 2GLIA 1H7UA 1F2IG 2YTGA 2NUFA 2NN6F 3JAMQ 1XMOI 4MYUA 4JV5I 4JI6E 2V2ZA 4AIMA 2YTQA 3QT5A 3Q6NA 2DB2A 2EN6A 5AC5A 2E5LI 3P3GA 5BR8I 2WP8B 2F4VI 4DU8A 2JE6A 3C6MA 3OTOI 3B82A 1YSAC 1Z0TA 2EMIA 1FNMA 5AC4A 5AASA 4R2AA 4IZJB 5K36A 3EPKA 4PRXA 2LUPB 2JP9A 2UU9E 1U2RA 2EOEA 4X62E 3EQ1A 2JOXA 1STUA 4Q28A 1S16A 5JEAD 2EM3A 4LCFA 2C38A 1XMOE 2V85A 4URLA 2V8QB 2EPZA 1T39A 2EPMX 4DV3I 3GMEA 2V89A 1GZ6A 1PJTA 4R03A 5FLXC 4MLQA 2YTJA 2E5LE 1ZBQA 5BR8E 1EA6A 2UXBI 1GQEA 2EP3A 2IOQA 4J8ZA 2VE7C 1XHKA 2C37A 4QNJA 3AV0A 1R6LA 2EL4A 3ZZ0A 1YUJA 5C0XF 4DR4I 4R2DA 3PRYA 2DEIA 4BCAA 4F9AB 1VI7A 3WU5A 4X8WA 2HC5A 4DPWA 1N36E 1ZM2A 2J65A 5EL9A 2A25A 3FIGA 4DXLA 3DJWA 2DGCA 1H72C 4IJDA 2CGEA 4MU4A 1SR9A 2V86A 2WCC3 4AQYI 2V83A 4O43A 4DV3E 4FWDA 4P78A 3TQMA 2VQEE 2LUQA 2YRKA 1J5EI 4NXMI 2NN6B 1OYSA 2E1RA 4MQYA 2UXBE 3U1YA 1N0VC 2N3HA 4B3MI 3P3EA 4WUDA 1DARA 1A1KA 2NN6E 4M1KA 2HKJA 3M99B 4L8NA 4DR4E 3C4BA 4LF7I 5LMNI 3K17A 2Z5EA 3GCMA 2FV4B 2V87A 4BS9A 1TF6A 2EPKX 3LLHA 2HK3A 3M7NG 2CSHA 2AE8A 2YTIA 1Z5AA 4DV4E 4K0KI 4AQYE 1HR0I 1EH8A 2WZOA 1UDQA 4KHPI 3ZM7A 1B62A 1J5EE 4LF8E 5CFFE 4NXME 3VYXA 5JEAB 2LJPA 3J81Q 4BHCA 2EN8A 2WBSA 1LLMC 2Z5CB 4B3ME 3B78A 2DMYA 4ISAA 1X49A 5JEAE 1H73A 5IT9Q 1Z59A 2Z5BB 3EPHA 3Q6MA 2NN6C 2KONA 3HJCA 2J7JA 3MHHC 4LF7E 1Z5BA 3T1HI 4HACB 2I13A 3GONA 4KWYA 2J7KA 3H4LA 5LMNE 1OJ4A 2ZM6E 4TUGA 4QNKA 2V88A 2VF3A 3QT8A 5C0XB 2YTOA 2YTFA 4WUCA 4MU3A 4PU9A 4LF5I 2PO0B 2BA0D 4FWGA 5C0XE 1FWLA 2HK2A 4FW5A 4K0KE 4NHRA 4Z7YA 1Z0EA 2GPIA 3HPSA 3VYYA 1HR0E 2JPAA 2EM5A 2EMKA 2VRDA 2LT7A 4DUYI 1ELOA 4DV7I 2Q8UA 2EMWA 2LTRA 2G7HA 1SFEA 1Y4UA
chains in the Genus database with same CATH topology
1KTVA 1XNQI 4DPUA 1RR9A 2ODRC 4DV0I 3T1HE 3IWBA 4DR5I 2R42A 1NZ0A 3JU0A 4MYTA 2L2KB 3ZKDA 3QT6A 4JI4I 4JI6I 4DR2I 4DUZI 2DSYA 4DV1E 4DKKA 4DUYE 5A2QQ 2LTSA 1FI4A 2NPFA 4XTJA 2BM1A 4KQVA 3ZKBA 4WYQB 1WHQA 2A2CA 1XNQE 2IHR1 3QT7A 4X62I 2RTXA 1D6TA 1N32I 1VISA 1FJGI 4WPYA 5L3JA 2EWLA 4JI4E 2L33A 4DR2E 4DUZE 3K1JA 2LBSB 3CWVA 5A2QC 1PVGA 3ZZTA 3HQ1A 5IWAI 1Z5CA 5AE2A 1FKAE 4DU7A 3K85A 2GQ0A 1N36I 2O1UA 1S4EA 2YZTA 1ZXMA 2HKEA 1N32E 1FJGE 3JAMC 3ADLA 1X48A 2JWOA 1QZRA 2JVAA 3Q1QA 2UUBI 1H7SA 4IZKA 5IWAE 2GS8A 3J7Yp 1UHZA 1Y4SA 4KZSA 1HNWI 1BKNA 2R3VA 3VK6A 5GMEA 2IOPA 2CZ9A 4BMJA 4DV4I 1Y6ZA 1NHHA 1HK7A 1Z0GA 2RSMA 2L92A 4LF8I 4B3RE 3T1YI 2NUEA 5DNYA 1UEKA 3RMPA 4PRVA 2VQFE 2UUBE 4I3HA 4LF9I 4JI3I 3F6GA 4EMDA 4JI0E 3J7AG 2V34A 3D4JA 2DEJA 2KOUA 1N34E 2DIXA 1HNWE 2ZM6I 2OI2A 2M1SA 1B63A 2BM0A 3PYGA 1USVA 2O1WA 4LTYA 4DPTA 4NXNI 4TUIA 1KVKA 2H36X 2ZITA 4FWHA 1Z0VA 4IZJA 3T1YE 5T6JA 2AJ4A 4R1FA 3J80Q 4LF9E 1N33I 4JI3E 3IWCA 1MG7A 4F9CB 3LNUA 1HNXI 3HTXA 4P7AA 1ZM9A 3PYEA 4B3SI 1WXRA 1XMQE 3F0NA 4LFCI 2LRSA 1KIJA 4DV1I 1X47A 2X7IA 1EKZA 1WUUA 4NXNE 3J81C 2UUAI 1ZBTA 1N33E 5IT9C 2JY9A 1RQ0A 2PNMA 2HFSA 2L6MA 4USMA 4GKKI 4DMIA 3LMLA 3OMLA 1HNXE 1YYOA 4JI2E 1IBMI 4M30A 4OOGC 4B3SE 2E1MA 4LFCE 2L2NA 1KKHA 1NHJA 2ZBKB 2N3GA 4YY3E 3ADGA 4R8OA 2UXDE 4USKA 2UUAE 4JI1I 2V2VA 1Z0BA 4DPXA 2L2MA 4M2ZA 4DV5I 2M7QA 4OX9I 4GKKE 1ZM4A 1DQ3A 3ZZUA 4Z7CA 1IBME 2PNLA 2NUGA 2UUCI 3K6QA 4F54A 1K47A 1QU6A 4DR6I 2L8TA 5GMDA 2Z5CA 4YHHI 3WU4A 1I94I 4X66I 2Z5BA 4B3TI 1ZXNA 1J26A 4HACA 4JI1E 4LF4I 4JI8E 4LFBI 1T4NA 3ZOQB 2L3JA 4DV5E 4OX9E 3HXLA 4X65E 1PKPA 4BC9A 4L5NC 2UUCE 4UTGA 4DR6E 4DR1I 4DPYA 2LMZA 2WW4A 4YHHE 1IBKI 1I94E 1WHNA 4X66E 5FLXQ 2HHHI 4JI7I 4B3RI 2VQFI 2B3TB 2EFGA 4DV6I 4B3TE 4JI0I 3J7AM 5LMUI 4LF4E 1YZ9A 4LFBE 1N34I 4GEQB 4WSPA 2A2DA 4WFTA 2ODRD 3WU6A 1YYWA 1A6FA 4X64I 3P06A 4JV5E 2O1TA 1PIEA 2EZ6A 3HULA 4P52A 4ZVIA 2FTXB 4DR1E 4JI5I 2JR1A 4GKJI 3C4TA 1IBKE 2F4VE 4JI7E 2HHHE 4LU9A 3OTOE 4WUBA 4DV6E 2VF1A 4JYAI 3MSWA 1FWKA 5LMUE 5LL6R 2B9DA 2NA2A 3ADJA 4DR3I 1UILA 1XMQI 4X64E 1HNZI 3P1XA 2V2QA 3B8HA 4JI5E 2MC6A 4GKJE 4P7DA 4BC7A 3V5RA 2V8PA 4JG4A 2B7VA 3ADIA 4JYAE 2CPNA 4RPFA 1DI2A 4JI2I 2LJHA 2XEXA 4UT4A 1T4LB 2UXCI 2B7TA 4DR3E 3LTOA 4HYMA 4I8OA 2FGGA 1H74A 5AE3A 2JOBA 2K4VA 1HNZE 2F8BA 3H09A 4HXZA 4M0VA 3KWRA 5ADZA 4YY3I 2X36A 2UXDI 1NHIA 1RREA 3J80C 2RS6A 3F6HA 1USUA 3LPSA 1MX0A 1T4OA 3WU3A 4LF6I 2L3CA 1N0UA 2UXCE 2KHXA 4HY1A 1Z0CA 2RS7A 3AUZA 2MC5A 4LFAI 1ZM3A 4IZJD 4DV2I 1XNRI 3JTZA 1RC7A 4KHPE 1IBLI 5F3WA 1O0WA 4DR7I 4BBYA 2MDRA 4JI8I 2LE2A 2M4IA 3IWDA 3PYFA 2HFUA 4IZKB 5AE1A 4F9BB 4X65I 4LF6E 4ED4A 4FW9A 2CG9A 4FN5A 3PYDA 3M6AA 4LF5E 2O1VA 4LFAE 1Z0WA 1MU5A 4DV2E 4N3OA 2BV3A 1XNRE 1EI1A 1IBLE 3V2UC 4DV7E 4DR7E 2YT4A 3HPZA 1YYKA 2Q2EB 2UU9I 4DV0E 3DF6A 5FWKA 4DR5E 1H7UA 2NUFA 3JAMQ 1XMOI 4MYUA 4JV5I 4JI6E 2V2ZA 3QT5A 3Q6NA 2DB2A 2E5LI 5BR8I 2F4VI 4DU8A 3OTOI 3B82A 1Z0TA 1FNMA 5AASA 4IZJB 4PRXA 2LUPB 2UU9E 1U2RA 4X62E 2JOXA 1STUA 4Q28A 1S16A 1XMOE 2V85A 4URLA 2V8QB 4DV3I 2V89A 1GZ6A 4R03A 5FLXC 2VQEI 2E5LE 1EA6A 1ZBQA 5BR8E 2UXBI 1GQEA 2IOQA 4J8ZA 2VE7C 1XHKA 3AV0A 3ZZ0A 4DR4I 3PRYA 2DEIA 4BCAA 4F9AB 3WU5A 4DPWA 4X8WA 1N36E 1ZM2A 3FIGA 4DXLA 3DJWA 1H72C 2CGEA 1SR9A 2V86A 4AQYI 2V83A 4DV3E 4FWDA 4P78A 2VQEE 2LUQA 1J5EI 4NXMI 2E1RA 2UXBE 1N0VC 2N3HA 4B3MI 4WUDA 1DARA 4M1KA 2HKJA 4L8NA 4DR4E 3C4BA 4LF7I 5LMNI 3K17A 2Z5EA 2FV4B 2V87A 4BS9A 3LLHA 2HK3A 1Z5AA 4DV4E 4K0KI 4AQYE 1HR0I 2WZOA 4KHPI 3ZM7A 1B62A 1J5EE 4LF8E 5CFFE 4NXME 3VYXA 3J81Q 2LJPA 2Z5CB 3B78A 4B3ME 2DMYA 1X49A 1H73A 5IT9Q 1Z59A 2Z5BB 3Q6MA 2KONA 3HJCA 3T1HI 4LF7E 1Z5BA 4HACB 3GONA 2J7KA 3H4LA 5LMNE 1OJ4A 2ZM6E 4TUGA 2V88A 2VF3A 3QT8A 4WUCA 4LF5I 4PU9A 4FWGA 1FWLA 2HK2A 4K0KE 4Z7YA 1Z0EA 3HPSA 3VYYA 1HR0E 4DUYI 1ELOA 4DV7I 2G7HA 2LTRA 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTV A;  1XNQ I;  4DPU A;  1RR9 A;  4DV0 I;  3T1H E;  4DR5 I;  2R42 A;  1NZ0 A;  4MYT A;  2L2K B;  3ZKD A;  3QT6 A;  4JI4 I;  4JI6 I;  4DR2 I;  4DUZ I;  4DV1 E;  4DKK A;  4DUY E;  5A2Q Q;  2LTS A;  1FI4 A;  2NPF A;  4XTJ A;  2BM1 A;  4KQV A;  3ZKB A;  4WYQ B;  1WHQ A;  2A2C A;  1XNQ E;  2IHR 1;  3QT7 A;  4X62 I;  2RTX A;  1D6T A;  1N32 I;  1VIS A;  1FJG I;  5L3J A;  4JI4 E;  2L33 A;  4DR2 E;  4DUZ E;  3K1J A;  2LBS B;  3CWV A;  5A2Q C;  1PVG A;  3ZZT A;  5IWA I;  1Z5C A;  1FKA E;  4DU7 A;  1N36 I;  1S4E A;  1ZXM A;  2HKE A;  1N32 E;  1FJG E;  3JAM C;  3ADL A;  1X48 A;  1QZR A;  2JVA A;  3Q1Q A;  2UUB I;  1H7S A;  5IWA E;  2GS8 A;  3J7Y p;  1UHZ A;  1HNW I;  1BKN A;  2R3V A;  5GME A;  2CZ9 A;  4DV4 I;  1NHH A;  1Z0G A;  2RSM A;  4LF8 I;  4B3R E;  3T1Y I;  2NUE A;  1UEK A;  4PRV A;  2VQF E;  2UUB E;  4I3H A;  4LF9 I;  4JI3 I;  4EMD A;  4JI0 E;  3J7A G;  2V34 A;  3D4J A;  2DEJ A;  1N34 E;  2DIX A;  1HNW E;  2ZM6 I;  2OI2 A;  2BM0 A;  1B63 A;  3PYG A;  4DPT A;  4NXN I;  1KVK A;  2ZIT A;  4FWH A;  1Z0V A;  3T1Y E;  3J80 Q;  2AJ4 A;  4R1F A;  1N33 I;  4LF9 E;  4JI3 E;  1MG7 A;  3LNU A;  1HNX I;  3HTX A;  4P7A A;  1ZM9 A;  3PYE A;  4B3S I;  1XMQ E;  3F0N A;  4LFC I;  2LRS A;  1KIJ A;  4DV1 I;  1X47 A;  2X7I A;  1EKZ A;  1WUU A;  4NXN E;  3J81 C;  2UUA I;  1ZBT A;  1N33 E;  5IT9 C;  2JY9 A;  1RQ0 A;  2HFS A;  4USM A;  4GKK I;  4JI2 E;  1HNX E;  1YYO A;  1IBM I;  4M30 A;  4OOG C;  4B3S E;  4LFC E;  2L2N A;  1KKH A;  1NHJ A;  2ZBK B;  2N3G A;  4YY3 E;  3ADG A;  2UXD E;  4USK A;  2UUA E;  4JI1 I;  2V2V A;  1Z0B A;  4DPX A;  2L2M A;  4M2Z A;  4DV5 I;  4OX9 I;  4GKK E;  1ZM4 A;  3ZZU A;  4Z7C A;  1IBM E;  2NUG A;  2UUC I;  1K47 A;  1QU6 A;  4DR6 I;  5GMD A;  4YHH I;  3WU4 A;  1I94 I;  4X66 I;  4B3T I;  1ZXN A;  1J26 A;  4HAC A;  4JI1 E;  4LF4 I;  4JI8 E;  4LFB I;  1T4N A;  2L3J A;  4DV5 E;  4OX9 E;  4X65 E;  1PKP A;  2UUC E;  4UTG A;  4DR6 E;  4DR1 I;  4DPY A;  2WW4 A;  4YHH E;  1IBK I;  1I94 E;  1WHN A;  4X66 E;  5FLX Q;  2HHH I;  4JI7 I;  4B3R I;  2VQF I;  2B3T B;  2EFG A;  4DV6 I;  4B3T E;  4JI0 I;  3J7A M;  5LMU I;  4LF4 E;  1YZ9 A;  4LFB E;  1N34 I;  2A2D A;  4WFT A;  3WU6 A;  1YYW A;  1A6F A;  4X64 I;  4JV5 E;  1PIE A;  2EZ6 A;  3HUL A;  4P52 A;  4ZVI A;  4DR1 E;  4JI5 I;  4GKJ I;  3C4T A;  1IBK E;  2F4V E;  4JI7 E;  2HHH E;  3OTO E;  4WUB A;  4DV6 E;  4JYA I;  1FWK A;  5LMU E;  5LL6 R;  2NA2 A;  3ADJ A;  4DR3 I;  1UIL A;  1XMQ I;  4X64 E;  1HNZ I;  3P1X A;  2V2Q A;  3B8H A;  4JI5 E;  4GKJ E;  3V5R A;  2V8P A;  4JG4 A;  2B7V A;  3ADI A;  4JYA E;  2CPN A;  4RPF A;  1DI2 A;  4JI2 I;  2LJH A;  2XEX A;  4UT4 A;  1T4L B;  2UXC I;  2B7T A;  4DR3 E;  3LTO A;  4HYM A;  1H74 A;  1HNZ E;  4HXZ A;  4YY3 I;  2X36 A;  2UXD I;  1NHI A;  1RRE A;  3J80 C;  2RS6 A;  3LPS A;  1MX0 A;  1T4O A;  3WU3 A;  4LF6 I;  2L3C A;  1N0U A;  2UXC E;  2KHX A;  4HY1 A;  1Z0C A;  2RS7 A;  4LFA I;  1ZM3 A;  4DV2 I;  1XNR I;  1RC7 A;  4KHP E;  1IBL I;  1O0W A;  4DR7 I;  4JI8 I;  2MDR A;  3PYF A;  2HFU A;  4X65 I;  4LF6 E;  4ED4 A;  4FW9 A;  4FN5 A;  3PYD A;  3M6A A;  4LF5 E;  4LFA E;  1Z0W A;  1MU5 A;  4DV2 E;  2BV3 A;  1XNR E;  1EI1 A;  1IBL E;  3V2U C;  4DV7 E;  4DR7 E;  2YT4 A;  1YYK A;  2Q2E B;  2UU9 I;  4DV0 E;  4DR5 E;  1H7U A;  2NUF A;  3JAM Q;  1XMO I;  4MYU A;  4JV5 I;  4JI6 E;  2V2Z A;  3QT5 A;  2DB2 A;  2E5L I;  5BR8 I;  2F4V I;  4DU8 A;  3OTO I;  3B82 A;  1Z0T A;  1FNM A;  4PRX A;  2LUP B;  2UU9 E;  1U2R A;  4X62 E;  1STU A;  1S16 A;  1XMO E;  4URL A;  4DV3 I;  2VQE I;  5FLX C;  2E5L E;  5BR8 E;  1EA6 A;  2UXB I;  1GQE A;  1XHK A;  3ZZ0 A;  4DR4 I;  2DEI A;  3WU5 A;  4DPW A;  4X8W A;  1N36 E;  1ZM2 A;  4DXL A;  1H72 C;  4AQY I;  4DV3 E;  4FWD A;  2VQE E;  2LUQ A;  1J5E I;  4NXM I;  2E1R A;  2UXB E;  1N0V C;  2N3H A;  4B3M I;  4WUD A;  1DAR A;  4M1K A;  2HKJ A;  4DR4 E;  4LF7 I;  3C4B A;  5LMN I;  3K17 A;  3LLH A;  2HK3 A;  1Z5A A;  4DV4 E;  4K0K I;  4AQY E;  1HR0 I;  4KHP I;  3ZM7 A;  1B62 A;  1J5E E;  4LF8 E;  5CFF E;  4NXM E;  3VYX A;  3J81 Q;  2LJP A;  3B78 A;  4B3M E;  2DMY A;  1X49 A;  1H73 A;  5IT9 Q;  1Z59 A;  3T1H I;  4LF7 E;  1Z5B A;  4HAC B;  3GON A;  2J7K A;  3H4L A;  5LMN E;  1OJ4 A;  2ZM6 E;  2VF3 A;  3QT8 A;  4WUC A;  4LF5 I;  4PU9 A;  4FWG A;  1FWL A;  2HK2 A;  4K0K E;  4Z7Y A;  1Z0E A;  3VYY A;  1HR0 E;  4DUY I;  1ELO A;  4DV7 I;  2LTR A; 
#chains in the Genus database with same CATH topology
 2EPR A;  1G2D C;  2CT1 A;  2EQ0 A;  1KTV A;  1XNQ I;  4DPU A;  1RR9 A;  2BA1 D;  2ODR C;  2JE6 B;  4DV0 I;  2YTE A;  3T1H E;  3IWB A;  4DR5 I;  4IFD A;  2EPP A;  1A1H A;  2R42 A;  1NZ0 A;  3JU0 A;  1IMU A;  4MYT A;  2L2K B;  3ZKD A;  3QT6 A;  1PJS A;  4JI4 I;  4JI6 I;  2E72 A;  2EM7 A;  4R2R A;  4DR2 I;  3UK3 C;  4O24 A;  2JEB A;  4DUZ I;  1GTK A;  2DSY A;  4DV1 E;  2C38 B;  2EPX A;  4DKK A;  2PO1 B;  1NCS A;  5C0X C;  4DUY E;  1PDA A;  5A2Q Q;  2LTS A;  1FI4 A;  2NPF A;  2EMG A;  2IES A;  4XTJ A;  2BM1 A;  5DNL A;  4BA1 B;  4KQV A;  3ZKB A;  4WYQ B;  1WHQ A;  2EML A;  5A6B D;  2DRP A;  1XNQ E;  2A2C A;  3THN A;  3KRN A;  4OO1 A;  2JEA B;  2EPC A;  2IHR 1;  3QT7 A;  3QG5 C;  2YTD A;  4AID A;  1YH8 A;  2RTX A;  4X62 I;  1D6T A;  1N32 I;  1VIS A;  1FJG I;  2WBU A;  4WPY A;  2VQE I;  5L3J A;  2EWL A;  4JI4 E;  4IS9 A;  2L33 A;  3BF2 A;  4DR2 E;  2EPO A;  4DUZ E;  1UDS A;  4LPF A;  3K1J A;  2N8X A;  2LBS B;  3CWV A;  4LCG A;  2EN2 A;  3CDI A;  2M9A A;  5A2Q C;  1EH6 A;  2EMF A;  1PVG A;  3HQ1 A;  3ZZT A;  5IWA I;  2I9I A;  1Z5C A;  3PS1 A;  5AE2 A;  1FKA E;  4IFD D;  4J3D A;  4DU7 A;  2EPL X;  3K85 A;  1X6F A;  4M9V C;  2GQ0 A;  1N36 I;  2O1U A;  4RH8 A;  1S4E A;  2YZT A;  1ZXM A;  2LV2 A;  2HKE A;  4BA2 B;  1N32 E;  2MKN A;  1FJG E;  3L00 A;  3JAM C;  3ADL A;  2EL6 A;  2DMI A;  5KL5 A;  3HKM A;  5JEA F;  2ELZ A;  4ZYG A;  1X48 A;  4NBQ A;  1RMD A;  5KL3 A;  2JWO A;  1BBO A;  1QZR A;  2YTP A;  2LCE A;  2JVA A;  2EOJ A;  2YPN A;  3ECR A;  3Q1Q A;  2UUB I;  4OO1 D;  1H7S A;  4RHB B;  5IWA E;  4IZK A;  2PNZ A;  2GS8 A;  4AM3 A;  3M85 G;  3L7Z A;  2R1F A;  4O4K A;  3J7Y p;  1UHZ A;  1Y4S A;  4KZS A;  2CTD A;  1BKN A;  2R3V A;  1HNW I;  3M7N D;  3VK6 A;  1XXE A;  5GME A;  1AH5 A;  5IV8 B;  2IOP A;  2C39 B;  1P42 A;  2CZ9 A;  4BMJ A;  4DV4 I;  2BBG A;  1Y6Z A;  1NHH A;  1HK7 A;  1Z0G A;  2EOQ A;  2RSM A;  2EL5 A;  2EOR A;  2L92 A;  1OYR A;  4LF8 I;  4B3R E;  3T1Y I;  2NUE A;  5DNY A;  1UEK A;  4WSG A;  3RMP A;  5K36 D;  4PRV A;  2VQF E;  2UUB E;  4I3H A;  4LF9 I;  4JI3 I;  3F6G A;  2BR2 A;  4FW7 A;  4JI0 E;  4FW4 A;  4EMD A;  4ZYD A;  2EMB A;  2R76 A;  3J7A G;  2JT2 A;  2V34 A;  2ENC A;  3D4J A;  2DEJ A;  2KOU A;  1N34 E;  2DIX A;  2YRH A;  5DRR A;  1HNW E;  2LJU A;  2ZM6 I;  2YU5 A;  2EOO A;  1Y5Y A;  2OI2 A;  2M1S A;  1B63 A;  2BM0 A;  3PYG A;  1USV A;  1WRJ A;  2WP8 A;  4IFD B;  2RPC A;  4BHB A;  1IQO A;  2O1W A;  4LTY A;  5EKW A;  1JK2 A;  4DPT A;  4NXN I;  4TUI A;  5IXM B;  1KVK A;  2GO4 A;  2EMH A;  2H36 X;  2ZIT A;  4FWH A;  1Z0V A;  4IZJ A;  3T1Y E;  2VES A;  2YWQ A;  5T6J A;  1X3C A;  2AJ4 A;  4R1F A;  4LF9 E;  3PS3 A;  4JI3 E;  3J80 Q;  1N33 I;  3IWC A;  1MG7 A;  1Y60 A;  4FK5 C;  2EN4 A;  4F9C B;  5KL7 A;  3LNU A;  3KZZ A;  4F6M A;  3BID A;  4OKG A;  1HNX I;  3HTX A;  4P7A A;  1ZM9 A;  2EOS A;  2PO2 B;  1UDN A;  3PYE A;  4N4R B;  1WXR A;  5KL6 A;  1XMQ E;  4B3S I;  1QNT A;  3F0N A;  4LFC I;  4Q35 B;  1UDO A;  2LRS A;  1KIJ A;  3U1K A;  4DV1 I;  1X47 A;  2X7I A;  1EKZ A;  1WUU A;  4NXN E;  2YRM A;  2YSP A;  3J81 C;  4O5G A;  2UUA I;  4NZV A;  5ELW A;  1ZBT A;  1N33 E;  5IT9 C;  2EOI A;  2JY9 A;  1RQ0 A;  2PNM A;  2HFS A;  2L6M A;  4USM A;  4GKK I;  5JEA C;  4DMI A;  3LML A;  3OML A;  1HNX E;  1YYO A;  4JI2 E;  1IBM I;  5K36 B;  1AAY A;  4M30 A;  2RSI A;  4OOG C;  4ZYE A;  4B3S E;  2E1M A;  2EE8 A;  2EM2 A;  1B69 A;  4LFC E;  2NN6 A;  1MGT A;  1ZU1 A;  2L2N A;  1KKH A;  1NHJ A;  2IER A;  3DD6 A;  2ZBK B;  1YHC A;  2N3G A;  4YY3 E;  3ADG A;  4R8O A;  2UXD E;  2ENH A;  4USK A;  2UUA E;  2MDG A;  5KL2 A;  2PRT A;  4JI1 I;  2V2V A;  1Z0B A;  4DPX A;  2L2M A;  3EPJ A;  4M2Z A;  4DV5 I;  1ZR9 A;  2ENA A;  2M7Q A;  4OX9 I;  4GKK E;  2C37 B;  1ZM4 A;  1DQ3 A;  4HEI A;  1TN9 A;  3L7Z B;  3ZZU A;  4F6N A;  4Z7C A;  1IBM E;  2PNL A;  2NUG A;  2EN1 A;  2UUC I;  5DRP A;  3K6Q A;  2EM9 A;  4F54 A;  1K47 A;  2ADR A;  1QU6 A;  4DR6 I;  2EPA A;  5JEA A;  2EOH A;  2L8T A;  5GMD A;  2Z5C A;  4YHH I;  3WU4 A;  1I94 I;  4X66 I;  1N3G A;  5DRO A;  2F1D A;  2Z5B A;  3M85 D;  2WNR A;  4B3T I;  1ZXN A;  4ZYH A;  1J26 A;  4HAC A;  1G2F C;  4JI1 E;  1KYQ A;  4JI8 E;  4LF4 I;  4LFB I;  1T4N A;  3ZOQ B;  2L3J A;  1KJK A;  4IFD F;  4DV5 E;  4OX9 E;  5C0X A;  2BR2 B;  4MDT A;  1NEI A;  2NAB A;  3HXL A;  2NN6 D;  2PO0 A;  2EOZ A;  4X65 E;  1YFH A;  1TF3 A;  1PKP A;  4BC9 A;  2EOY A;  4L5N C;  2UUC E;  4UTG A;  2JXP A;  2EQ1 A;  4DR6 E;  2HJJ A;  2D9H A;  4DR1 I;  4DPY A;  2LMZ A;  2WW4 A;  4YHH E;  4X9J A;  1IBK I;  1I94 E;  1WHN A;  4X66 E;  5FLX Q;  2HHH I;  1A1F A;  4JI7 I;  4B3R I;  1BBG A;  3P76 A;  2VQF I;  4OZE A;  2GHF A;  2B3T B;  2EFG A;  4DV6 I;  4B3T E;  4JI0 I;  4OO1 F;  2YTN A;  3J7A M;  2EPN A;  4MU0 A;  5LMU I;  4LF4 E;  4R2P A;  1YZ9 A;  4LFB E;  1N34 I;  4GEQ B;  4WSP A;  2BB8 A;  2A2D A;  4WFT A;  3PS2 A;  2ODR D;  3WU6 A;  2EMZ A;  1YYW A;  1PJQ A;  1A6F A;  4MLV A;  1E3P A;  4X64 I;  5DRQ A;  4R2S A;  4JV5 E;  3P06 A;  2PO1 A;  2O1T A;  1PIE A;  2DLQ A;  2EZ6 A;  3HUL A;  4P52 A;  4ZVI A;  1X5W A;  2FTX B;  4DR1 E;  4BA1 A;  2JR1 A;  5A6A A;  3C4T A;  1IBK E;  3BGH A;  2F4V E;  4GKJ I;  4JI7 E;  2HHH E;  3H1C A;  2LO3 A;  4LU9 A;  1YUI A;  2JEA A;  3OTO E;  3KZY A;  5C0X D;  4WUB A;  5K36 F;  4DV6 E;  2VF1 A;  4JYA I;  3MSW A;  1FWK A;  5LMU E;  5LL6 R;  2B9D A;  2NA2 A;  2EMX A;  4MU1 A;  1EH7 A;  3ADJ A;  4GZN C;  1A1G A;  4DR3 I;  1UIL A;  1DGC A;  5KL4 A;  4JI5 I;  1XMQ I;  3MHS C;  2EM6 A;  4X64 E;  1HNZ I;  2K7I A;  1R6M A;  3P1X A;  3B4T A;  3P3C A;  4IFD E;  2YSO A;  2V2Q A;  3B8H A;  4JI5 E;  2DLK A;  1A1L A;  2MC6 A;  4GKJ E;  1YPN A;  4P7D A;  1P47 A;  2JEB B;  4BC7 A;  3GLL A;  2EOX A;  2EOM A;  3V5R A;  2V8P A;  4JG4 A;  2B7V A;  2EQ3 A;  4BA2 A;  3ADI A;  2EN7 A;  4JYA E;  2HGH A;  2CPN A;  1WJP A;  4RPF A;  1DI2 A;  4JI2 I;  1A1I A;  2LJH A;  1IQS A;  2XEX A;  4UT4 A;  1T4L B;  2UXC I;  2B7T A;  4DR3 E;  3LTO A;  4HYM A;  4I8O A;  4OO1 B;  2FGG A;  3UHM A;  2RQL A;  1H74 A;  2EJ4 A;  5AE3 A;  1X6E A;  2JOB A;  2K4V A;  4OO1 E;  5A6J A;  1HNZ E;  2F8B A;  3H09 A;  4HXZ A;  4M0V A;  4WX9 A;  3KWR A;  5ADZ A;  5A6K A;  2EMC A;  4FW3 A;  4YY3 I;  2X36 A;  4IFD C;  2UXD I;  1NHI A;  4U3B A;  2EMA A;  3VHT B;  3J80 C;  1UN6 B;  1RRE A;  2RS6 A;  1UBD C;  3F6H A;  2WNR B;  4HTG A;  2EMY A;  1USU A;  3LPS A;  1T38 A;  1MX0 A;  2WBT A;  1T4O A;  4R2E A;  2C39 A;  3WU3 A;  2L3C A;  1N0U A;  5A6B A;  2UXC E;  2KHX A;  2O3Z A;  4HY1 A;  1Z0C A;  4LF6 I;  2RS7 A;  4FW6 A;  3AUZ A;  1A1J A;  5K36 E;  2MC5 A;  4LFA I;  1ZM3 A;  4IZJ D;  2GO3 A;  4WXD A;  4DV2 I;  3EPL A;  3CDJ A;  4OO1 C;  1XNR I;  3JTZ A;  1RC7 A;  4KHP E;  1IBL I;  5DNX A;  2EM8 A;  2ELY A;  3BBG A;  4WXC A;  1BB8 A;  5F3W A;  1O0W A;  1Z1B A;  4LCH A;  4R2Q A;  4R2C A;  4DR7 I;  3C6K A;  4BBY A;  2MDR A;  4JI8 I;  2EM0 A;  2LE2 A;  2M4I A;  3IWD A;  3PYF A;  2HFU A;  4IZK B;  5AE1 A;  2PNZ B;  3NZK A;  5A69 A;  4F9B B;  2MKD A;  4X65 I;  1ZAA C;  2LVH A;  4LF6 E;  1L4S A;  2CVE A;  4ED4 A;  4FW9 A;  1E3H A;  2CG9 A;  2EPU A;  4FN5 A;  3PYD A;  3M6A A;  4LF5 E;  2O1V A;  4IS1 C;  4LFA E;  1Z0W A;  2EN3 A;  1MU5 A;  4DV2 E;  5K36 C;  2YU8 A;  1JK1 A;  2BA0 G;  4F2J C;  4N3O A;  2BV3 A;  2EM4 A;  1XNR E;  1EI1 A;  1IBL E;  3V2U C;  4DV7 E;  3THO B;  1X6H A;  5TSE A;  5LLQ A;  1RHY A;  4U3D A;  4DR7 E;  2EOF A;  2YT4 A;  3HPZ A;  1YYK A;  2Q2E B;  2PO2 A;  1MEY C;  2JYA A;  1OYP A;  4LOM A;  2UU9 I;  4DV0 E;  4GQU A;  3DF6 A;  2BA1 G;  4DR5 E;  5FWK A;  2GLI A;  1H7U A;  1F2I G;  2YTG A;  2NUF A;  2NN6 F;  3JAM Q;  1XMO I;  4MYU A;  4JV5 I;  4JI6 E;  2V2Z A;  4AIM A;  2YTQ A;  3QT5 A;  3Q6N A;  2DB2 A;  2EN6 A;  5AC5 A;  2E5L I;  3P3G A;  5BR8 I;  2WP8 B;  2F4V I;  4DU8 A;  2JE6 A;  3C6M A;  3OTO I;  3B82 A;  1YSA C;  1Z0T A;  2EMI A;  1FNM A;  5AC4 A;  5AAS A;  4R2A A;  4IZJ B;  5K36 A;  3EPK A;  4PRX A;  2LUP B;  2JP9 A;  2UU9 E;  1U2R A;  2EOE A;  4X62 E;  3EQ1 A;  2JOX A;  1STU A;  4Q28 A;  1S16 A;  5JEA D;  2EM3 A;  4LCF A;  2C38 A;  1XMO E;  2V85 A;  4URL A;  2V8Q B;  2EPZ A;  1T39 A;  2EPM X;  4DV3 I;  3GME A;  2V89 A;  1GZ6 A;  1PJT A;  4R03 A;  5FLX C;  4MLQ A;  2YTJ A;  2E5L E;  1ZBQ A;  5BR8 E;  1EA6 A;  2UXB I;  1GQE A;  2EP3 A;  2IOQ A;  4J8Z A;  2VE7 C;  1XHK A;  2C37 A;  4QNJ A;  3AV0 A;  1R6L A;  2EL4 A;  3ZZ0 A;  1YUJ A;  5C0X F;  4DR4 I;  4R2D A;  3PRY A;  2DEI A;  4BCA A;  4F9A B;  1VI7 A;  3WU5 A;  4X8W A;  2HC5 A;  4DPW A;  1N36 E;  1ZM2 A;  2J65 A;  5EL9 A;  2A25 A;  3FIG A;  4DXL A;  3DJW A;  2DGC A;  1H72 C;  4IJD A;  2CGE A;  4MU4 A;  1SR9 A;  2V86 A;  2WCC 3;  4AQY I;  2V83 A;  4O43 A;  4DV3 E;  4FWD A;  4P78 A;  3TQM A;  2VQE E;  2LUQ A;  2YRK A;  1J5E I;  4NXM I;  2NN6 B;  1OYS A;  2E1R A;  4MQY A;  2UXB E;  3U1Y A;  1N0V C;  2N3H A;  4B3M I;  3P3E A;  4WUD A;  1DAR A;  1A1K A;  2NN6 E;  4M1K A;  2HKJ A;  3M99 B;  4L8N A;  4DR4 E;  3C4B A;  4LF7 I;  5LMN I;  3K17 A;  2Z5E A;  3GCM A;  2FV4 B;  2V87 A;  4BS9 A;  1TF6 A;  2EPK X;  3LLH A;  2HK3 A;  3M7N G;  2CSH A;  2AE8 A;  2YTI A;  1Z5A A;  4DV4 E;  4K0K I;  4AQY E;  1HR0 I;  1EH8 A;  2WZO A;  1UDQ A;  4KHP I;  3ZM7 A;  1B62 A;  1J5E E;  4LF8 E;  5CFF E;  4NXM E;  3VYX A;  5JEA B;  2LJP A;  3J81 Q;  4BHC A;  2EN8 A;  2WBS A;  1LLM C;  2Z5C B;  4B3M E;  3B78 A;  2DMY A;  4ISA A;  1X49 A;  5JEA E;  1H73 A;  5IT9 Q;  1Z59 A;  2Z5B B;  3EPH A;  3Q6M A;  2NN6 C;  2KON A;  3HJC A;  2J7J A;  3MHH C;  4LF7 E;  1Z5B A;  3T1H I;  4HAC B;  2I13 A;  3GON A;  4KWY A;  2J7K A;  3H4L A;  5LMN E;  1OJ4 A;  2ZM6 E;  4TUG A;  4QNK A;  2V88 A;  2VF3 A;  3QT8 A;  5C0X B;  2YTO A;  2YTF A;  4WUC A;  4MU3 A;  4PU9 A;  4LF5 I;  2PO0 B;  2BA0 D;  4FWG A;  5C0X E;  1FWL A;  2HK2 A;  4FW5 A;  4K0K E;  4NHR A;  4Z7Y A;  1Z0E A;  2GPI A;  3HPS A;  3VYY A;  1HR0 E;  2JPA A;  2EM5 A;  2EMK A;  2VRD A;  2LT7 A;  4DUY I;  1ELO A;  4DV7 I;  2Q8U A;  2EMW A;  2LTR A;  2G7H A;  1SFE A;  1Y4U A; 
#chains in the Genus database with same CATH homology
 1KTV A;  1XNQ I;  4DPU A;  1RR9 A;  2ODR C;  4DV0 I;  3T1H E;  3IWB A;  4DR5 I;  2R42 A;  1NZ0 A;  3JU0 A;  4MYT A;  2L2K B;  3ZKD A;  3QT6 A;  4JI4 I;  4JI6 I;  4DR2 I;  4DUZ I;  2DSY A;  4DV1 E;  4DKK A;  4DUY E;  5A2Q Q;  2LTS A;  1FI4 A;  2NPF A;  4XTJ A;  2BM1 A;  4KQV A;  3ZKB A;  4WYQ B;  1WHQ A;  2A2C A;  1XNQ E;  2IHR 1;  3QT7 A;  4X62 I;  2RTX A;  1D6T A;  1N32 I;  1VIS A;  1FJG I;  4WPY A;  5L3J A;  2EWL A;  4JI4 E;  2L33 A;  4DR2 E;  4DUZ E;  3K1J A;  2LBS B;  3CWV A;  5A2Q C;  1PVG A;  3ZZT A;  3HQ1 A;  5IWA I;  1Z5C A;  5AE2 A;  1FKA E;  4DU7 A;  3K85 A;  2GQ0 A;  1N36 I;  2O1U A;  1S4E A;  2YZT A;  1ZXM A;  2HKE A;  1N32 E;  1FJG E;  3JAM C;  3ADL A;  1X48 A;  2JWO A;  1QZR A;  2JVA A;  3Q1Q A;  2UUB I;  1H7S A;  4IZK A;  5IWA E;  2GS8 A;  3J7Y p;  1UHZ A;  1Y4S A;  4KZS A;  1HNW I;  1BKN A;  2R3V A;  3VK6 A;  5GME A;  2IOP A;  2CZ9 A;  4BMJ A;  4DV4 I;  1Y6Z A;  1NHH A;  1HK7 A;  1Z0G A;  2RSM A;  2L92 A;  4LF8 I;  4B3R E;  3T1Y I;  2NUE A;  5DNY A;  1UEK A;  3RMP A;  4PRV A;  2VQF E;  2UUB E;  4I3H A;  4LF9 I;  4JI3 I;  3F6G A;  4EMD A;  4JI0 E;  3J7A G;  2V34 A;  3D4J A;  2DEJ A;  2KOU A;  1N34 E;  2DIX A;  1HNW E;  2ZM6 I;  2OI2 A;  2M1S A;  1B63 A;  2BM0 A;  3PYG A;  1USV A;  2O1W A;  4LTY A;  4DPT A;  4NXN I;  4TUI A;  1KVK A;  2H36 X;  2ZIT A;  4FWH A;  1Z0V A;  4IZJ A;  3T1Y E;  5T6J A;  2AJ4 A;  4R1F A;  3J80 Q;  4LF9 E;  1N33 I;  4JI3 E;  3IWC A;  1MG7 A;  4F9C B;  3LNU A;  1HNX I;  3HTX A;  4P7A A;  1ZM9 A;  3PYE A;  4B3S I;  1WXR A;  1XMQ E;  3F0N A;  4LFC I;  2LRS A;  1KIJ A;  4DV1 I;  1X47 A;  2X7I A;  1EKZ A;  1WUU A;  4NXN E;  3J81 C;  2UUA I;  1ZBT A;  1N33 E;  5IT9 C;  2JY9 A;  1RQ0 A;  2PNM A;  2HFS A;  2L6M A;  4USM A;  4GKK I;  4DMI A;  3LML A;  3OML A;  1HNX E;  1YYO A;  4JI2 E;  1IBM I;  4M30 A;  4OOG C;  4B3S E;  2E1M A;  4LFC E;  2L2N A;  1KKH A;  1NHJ A;  2ZBK B;  2N3G A;  4YY3 E;  3ADG A;  4R8O A;  2UXD E;  4USK A;  2UUA E;  4JI1 I;  2V2V A;  1Z0B A;  4DPX A;  2L2M A;  4M2Z A;  4DV5 I;  2M7Q A;  4OX9 I;  4GKK E;  1ZM4 A;  1DQ3 A;  3ZZU A;  4Z7C A;  1IBM E;  2PNL A;  2NUG A;  2UUC I;  3K6Q A;  4F54 A;  1K47 A;  1QU6 A;  4DR6 I;  2L8T A;  5GMD A;  2Z5C A;  4YHH I;  3WU4 A;  1I94 I;  4X66 I;  2Z5B A;  4B3T I;  1ZXN A;  1J26 A;  4HAC A;  4JI1 E;  4LF4 I;  4JI8 E;  4LFB I;  1T4N A;  3ZOQ B;  2L3J A;  4DV5 E;  4OX9 E;  3HXL A;  4X65 E;  1PKP A;  4BC9 A;  4L5N C;  2UUC E;  4UTG A;  4DR6 E;  4DR1 I;  4DPY A;  2LMZ A;  2WW4 A;  4YHH E;  1IBK I;  1I94 E;  1WHN A;  4X66 E;  5FLX Q;  2HHH I;  4JI7 I;  4B3R I;  2VQF I;  2B3T B;  2EFG A;  4DV6 I;  4B3T E;  4JI0 I;  3J7A M;  5LMU I;  4LF4 E;  1YZ9 A;  4LFB E;  1N34 I;  4GEQ B;  4WSP A;  2A2D A;  4WFT A;  2ODR D;  3WU6 A;  1YYW A;  1A6F A;  4X64 I;  3P06 A;  4JV5 E;  2O1T A;  1PIE A;  2EZ6 A;  3HUL A;  4P52 A;  4ZVI A;  2FTX B;  4DR1 E;  4JI5 I;  2JR1 A;  4GKJ I;  3C4T A;  1IBK E;  2F4V E;  4JI7 E;  2HHH E;  4LU9 A;  3OTO E;  4WUB A;  4DV6 E;  2VF1 A;  4JYA I;  3MSW A;  1FWK A;  5LMU E;  5LL6 R;  2B9D A;  2NA2 A;  3ADJ A;  4DR3 I;  1UIL A;  1XMQ I;  4X64 E;  1HNZ I;  3P1X A;  2V2Q A;  3B8H A;  4JI5 E;  2MC6 A;  4GKJ E;  4P7D A;  4BC7 A;  3V5R A;  2V8P A;  4JG4 A;  2B7V A;  3ADI A;  4JYA E;  2CPN A;  4RPF A;  1DI2 A;  4JI2 I;  2LJH A;  2XEX A;  4UT4 A;  1T4L B;  2UXC I;  2B7T A;  4DR3 E;  3LTO A;  4HYM A;  4I8O A;  2FGG A;  1H74 A;  5AE3 A;  2JOB A;  2K4V A;  1HNZ E;  2F8B A;  3H09 A;  4HXZ A;  4M0V A;  3KWR A;  5ADZ A;  4YY3 I;  2X36 A;  2UXD I;  1NHI A;  1RRE A;  3J80 C;  2RS6 A;  3F6H A;  1USU A;  3LPS A;  1MX0 A;  1T4O A;  3WU3 A;  4LF6 I;  2L3C A;  1N0U A;  2UXC E;  2KHX A;  4HY1 A;  1Z0C A;  2RS7 A;  3AUZ A;  2MC5 A;  4LFA I;  1ZM3 A;  4IZJ D;  4DV2 I;  1XNR I;  3JTZ A;  1RC7 A;  4KHP E;  1IBL I;  5F3W A;  1O0W A;  4DR7 I;  4BBY A;  2MDR A;  4JI8 I;  2LE2 A;  2M4I A;  3IWD A;  3PYF A;  2HFU A;  4IZK B;  5AE1 A;  4F9B B;  4X65 I;  4LF6 E;  4ED4 A;  4FW9 A;  2CG9 A;  4FN5 A;  3PYD A;  3M6A A;  4LF5 E;  2O1V A;  4LFA E;  1Z0W A;  1MU5 A;  4DV2 E;  4N3O A;  2BV3 A;  1XNR E;  1EI1 A;  1IBL E;  3V2U C;  4DV7 E;  4DR7 E;  2YT4 A;  3HPZ A;  1YYK A;  2Q2E B;  2UU9 I;  4DV0 E;  3DF6 A;  5FWK A;  4DR5 E;  1H7U A;  2NUF A;  3JAM Q;  1XMO I;  4MYU A;  4JV5 I;  4JI6 E;  2V2Z A;  3QT5 A;  3Q6N A;  2DB2 A;  2E5L I;  5BR8 I;  2F4V I;  4DU8 A;  3OTO I;  3B82 A;  1Z0T A;  1FNM A;  5AAS A;  4IZJ B;  4PRX A;  2LUP B;  2UU9 E;  1U2R A;  4X62 E;  2JOX A;  1STU A;  4Q28 A;  1S16 A;  1XMO E;  2V85 A;  4URL A;  2V8Q B;  4DV3 I;  2V89 A;  1GZ6 A;  4R03 A;  5FLX C;  2VQE I;  2E5L E;  1EA6 A;  1ZBQ A;  5BR8 E;  2UXB I;  1GQE A;  2IOQ A;  4J8Z A;  2VE7 C;  1XHK A;  3AV0 A;  3ZZ0 A;  4DR4 I;  3PRY A;  2DEI A;  4BCA A;  4F9A B;  3WU5 A;  4DPW A;  4X8W A;  1N36 E;  1ZM2 A;  3FIG A;  4DXL A;  3DJW A;  1H72 C;  2CGE A;  1SR9 A;  2V86 A;  4AQY I;  2V83 A;  4DV3 E;  4FWD A;  4P78 A;  2VQE E;  2LUQ A;  1J5E I;  4NXM I;  2E1R A;  2UXB E;  1N0V C;  2N3H A;  4B3M I;  4WUD A;  1DAR A;  4M1K A;  2HKJ A;  4L8N A;  4DR4 E;  3C4B A;  4LF7 I;  5LMN I;  3K17 A;  2Z5E A;  2FV4 B;  2V87 A;  4BS9 A;  3LLH A;  2HK3 A;  1Z5A A;  4DV4 E;  4K0K I;  4AQY E;  1HR0 I;  2WZO A;  4KHP I;  3ZM7 A;  1B62 A;  1J5E E;  4LF8 E;  5CFF E;  4NXM E;  3VYX A;  3J81 Q;  2LJP A;  2Z5C B;  3B78 A;  4B3M E;  2DMY A;  1X49 A;  1H73 A;  5IT9 Q;  1Z59 A;  2Z5B B;  3Q6M A;  2KON A;  3HJC A;  3T1H I;  4LF7 E;  1Z5B A;  4HAC B;  3GON A;  2J7K A;  3H4L A;  5LMN E;  1OJ4 A;  2ZM6 E;  4TUG A;  2V88 A;  2VF3 A;  3QT8 A;  4WUC A;  4LF5 I;  4PU9 A;  4FWG A;  1FWL A;  2HK2 A;  4K0K E;  4Z7Y A;  1Z0E A;  3HPS A;  3VYY A;  1HR0 E;  4DUY I;  1ELO A;  4DV7 I;  2G7H A;  2LTR A;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...