4DR4E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4E02
4PU9A 2J7KA 2UXDI 2DB2A 1HNWI 4RPFA 2E1RA 4B3TE 1EKZA 1H74A 4DU8A 4EMDA 3VYYA 2UUBI 1K47A 1XHKA 3ZZUA 2LRSA 2HFUA 4JI0I 4ED4A 1EA6A 3ZM7A 5IWAE 4OX9I 1ZM9A 4DV0I 1I94E 1DI2A 2VQFE 2LBSB 4Z7YA 5LL6R 2A2DA 5LMNI 4NXME 5L3JA 1Z0VA 2V8PA 4URLA 3GONA 2VQFI 1PIEA 2UU9I 4DR7I 2L33A 4B3RI 4DR5I 2V2VA 4LF7I 4X66I 1N36I 1HR0I 4LFBE 4XTJA 2UUAE 1FNMA 2ZM6E 3B78A 2UXCI 1N34E 4FN5A 4PRVA 3ZKDA 2B7VA 4LF9E 2EZ6A 4LFBI 2NUFA 2HHHI 3ADJA 1IBLI 1D6TA 1J5EI 3VYXA 4LFAE 1N34I 1Z0EA 3ZZTA 1YZ9A 1N0VC 4DV6I 1Z5BA 2L3JA 2YT4A 3T1YE 2HFSA 3V5RA 1YYKA 4DV4I 1NHIA 2IHR1 2L2NA 4DR4I 4YHHE 4JI8I 4DV3I 3T1YI 4JI2I 1MG7A 3D4JA 4DXLA 2V2ZA 2E5LE 4K0KI 2VQEI 2X36A 4YHHI 4I3HA 4FWDA 4WFTA 1KIJA 2NUEA 4Z7CA 2RS6A 1NHJA 4DKKA 1WHQA 3ZKBA 2F4VE 4DUZE 3J81C 4JI7E 4LF5I 3J7AM 1RREA 4NXNE 3WU6A 4MYTA 4X8WA 4DUZI 1FWKA 3QT7A 1ZM2A 2ZITA 2UXDE 4NXNI 4B3SI 1KVKA 1HNWE 1Z59A 4WYQB 1X47A 3QT6A 4DPXA 4FWGA 2UUCE 1HNXI 4B3ME 2A2CA 2EFGA 2UUBE 2NUGA 1IBMI 2OI2A 2UUCI 1H72C 4B3MI 4JI0E 3OTOI 3M6AA 4JYAE 4OX9E 4USMA 4DV0E 4DV1E 3WU4A 3ADGA 4JYAI 3ADIA 4JI5I 5LMNE 3C4BA 5GMEA 4AQYE 1YYOA 4DV1I 2NPFA 1U2RA 1GQEA 3B8HA 2UU9E 4JV5E 4DR7E 3F0NA 3LPSA 4B3RE 1QU6A 4DR5E 3CWVA 4LF7E 4X66E 1N36E 1HR0E 4PRXA 4AQYI 2ZBKB 2LUPB 5IT9C 3J7Yp 1MU5A 4JV5I 1RC7A 3J80C 2UXCE 2LTRA 1Z5CA 4FWHA 2HHHE 1IBLE 5GMDA 2L2MA 1J5EE 1KKHA 2RS7A 3H4LA 3J81Q 3K17A 1X48A 1Z5AA 1N33I 4DV6E 4LFCI 4M1KA 4DV5I 2R3VA 4DV4E 2GS8A 1XNRE 1DARA 4DV7I 4DR4E 1T4LB 2HK2A 4JI8E 4DV3E 4JI2E 1FJGI 2B3TB 5A2QC 1ZXNA 1X49A 4UTGA 2UXBI 1EI1A 1XNRI 5BR8E 4X65I 4K0KE 2VQEE 2LJPA 3QT8A 4KQVA 3PYDA 1FKAE 2XEXA 2DMYA 4DR1I 1NHHA 5BR8I 2DEJA 1J26A 4LF5E 2KHXA 4JI3E 2BM1A 2HKJA 1ZXMA 4JI6I 1WUUA 3Q1QA 2B7TA 4P7AA 3V2UC 4B3SE 4JI3I 5LMUE 1ZM4A 1H7UA 2CPNA 1QZRA 1HNXE 1A6FA 1XMQE 4LF6I 2LTSA 2NA2A 3WU3A 1B62A 5LMUI 2Q2EB 1IBME 1XMQI 2LJHA 1IBKI 3OTOE 3PYFA 4YY3E 2WW4A 5IT9Q 2AJ4A 4MYUA 3J80Q 4USKA 4M30A 5FLXC 3B82A 2JVAA 4DV2I 4YY3I 2V34A 4GKJE 4R1FA 1N0UA 4GKKI 4JI5E 4M2ZA 1T4NA 4X64I 1STUA 3LTOA 5CFFE 1XMOE 3T1HI 4GKJI 4DUYE 4OOGC 1WHNA 3ADLA 2RTXA 3J7AG 1HNZE 2VF3A 1ELOA 1XMOI 1N32E 4DUYI 4B3TI 5A2QQ 2BM0A 3LNUA 1RQ0A 4DPWA 4DPUA 1HNZI 2LUQA 1FI4A 1UILA 2BV3A 3QT5A 1N32I 1NZ0A 2CZ9A 2L2KB 1N33E 4LFCE 3C4TA 4DV5E 2HK3A 1ZBTA 4HXZA 1FWLA 2V2QA 5IWAI 4DV7E 4UT4A 4KHPE 4LF8E 1I94I 4JI4E 1PVGA 1FJGE 1S4EA 1Z0BA 4DPYA 2UXBE 4WUBA 1BKNA 4X62E 4X65E 4HYMA 4KHPI 4LF8I 4NXMI 2JY9A 4JI4I 1Z0GA 4DR1E 3JAMQ 1B63A 4X62I 1H7SA 4ZVIA 4DR3E 2UUAI 4LF4E 1O0WA 2ZM6I 1XNQE 4JI6E 1UEKA 4DR6E 3WU5A 5FLXQ 4WUCA 4LF9I 1S16A 4DR3I 4LF4I 4HY1A 4FW9A 4DPTA 1MX0A 1UHZA 1VISA 1XNQI 1T4OA 4LFAI 3LLHA 2DEIA 4JI1E 4DR6I 4LF6E 4HACA 1H73A 1Z0CA 2N3GA 2HKEA 4JG4A 2DIXA 1YYWA 3HULA 3PYGA 4DR2E 4DU7A 4JI1I 1IBKE 1Z0WA 1PKPA 3JAMC 1RR9A 4DR2I 2X7IA 2E5LI 1OJ4A 4HACB 3HTXA 2MDRA 2N3HA 3P1XA 4DV2E 1KTVA 3PYEA 3K1JA 2L3CA 2F4VI 4JI7I 4GKKE 4WUDA 4X64E 1ZM3A 4P52A 3ZZ0A 3T1HE 2RSMA 2R42A 1Z0TA
chains in the Genus database with same CATH superfamily
1B69A 4PU9A 2EM4A 2J7KA 2UXDI 3KWRA 2DB2A 2EMHA 4OZEA 1HNWI 2JOXA 2PNMA 5TSEA 1T39A 1IQOA 4MLQA 4RPFA 2DLKA 4J8ZA 2E1RA 1A1JA 4B3TE 1XXEA 1EKZA 5JEAB 4IFDD 1USUA 3M85G 1Y4UA 3P06A 1H74A 1ZU1A 2WNRA 2ELZA 4DU8A 4EMDA 3VYYA 1E3PA 2NN6E 3IWCA 3LMLA 1JK1A 2UUBI 1E3HA 4BMJA 1K47A 2Z5CA 1XHKA 2EOZA 3ZZUA 2LRSA 3PS2A 2YRMA 2HFUA 4JI0I 1A1HA 2EOOA 5ELWA 2YTEA 4ED4A 2EMLA 4OO1A 1EA6A 2O1VA 2EPRA 4M0VA 1Y5YA 3IWDA 2NN6D 2EN4A 2D9HA 3ZM7A 1X6HA 5IWAE 4OX9I 4RHBB 2IESA 1ZM9A 4DV0I 1I94E 2YTOA 1DI2A 4BC7A 2VQFE 3H09A 2LBSB 2GPIA 4R2QA 2CG9A 2V88A 4QNKA 4Z7YA 3AV0A 5LL6R 2A2DA 5LMNI 4LPFA 3PS1A 3OMLA 4NXME 2YRHA 5L3JA 3MHSC 1Z0VA 1R6MA 1UDOA 2CVEA 2V8PA 3GONA 4URLA 1PIEA 2EPZA 2VQFI 2UU9I 2JEAB 4DR7I 2L33A 4B3RI 3MHHC 2B9DA 4OO1E 4DR5I 2V2VA 4U3DA 1VI7A 4L8NA 2YSOA 4X66I 1N36I 4LF7I 4GZNC 2EQ1A 3BGHA 1NEIA 1HR0I 4M9VC 2FV4B 4LFBE 4XTJA 2UUAE 2M1SA 2DGCA 1FNMA 2GO4A 2ZM6E 2BA1D 3B78A 2UXCI 2BR2A 2PO2B 2EMIA 1N34E 1Y6ZA 4FN5A 4PRVA 3ZKDA 2LO3A 4BA1A 2B7VA 4LF9E 2EZ6A 2EMWA 2EMYA 1YFHA 4U3BA 4LFBI 4KWYA 1WJPA 2NUFA 3ADJA 2HHHI 4OO1D 1IBLI 3GLLA 1D6TA 3UK3C 1J5EI 2EE8A 3VYXA 4LFAE 2O3ZA 2EM6A 4IZJA 2JOBA 1Z0EA 3ZZTA 1N34I 1YZ9A 5C0XC 1N0VC 5KL5A 4DV6I 1Z5BA 2L3JA 2YT4A 2MC6A 4ZYDA 2EOQA 3T1YE 2HFSA 3P76A 4LCFA 1YYKA 5DRPA 3V5RA 3BIDA 4DV4I 4NHRA 5DNLA 2V83A 1NHIA 1JK2A 3FIGA 5AE1A 2IHR1 2LMZA 2L2NA 2EM0A 4DR4I 4YHHE 2EN3A 4JI8I 4DV3I 3T1YI 4JI2I 1KYQA 2O1TA 4R2DA 2JPAA 2JP9A 1MG7A 3D4JA 4IFDA 3HPZA 2V2ZA 4DXLA 1NCSA 2E5LE 1Y60A 2O1UA 4DR1I 4RH8A 4MU4A 1AH5A 2VQEI 2YTFA 4K0KI 2X36A 4YHHI 4I3HA 4FWDA 4WFTA 2JE6A 4MDTA 1KIJA 2EOEA 2EPCA 2E72A 2NUEA 5JEAF 4Z7CA 2RS6A 1NHJA 4DKKA 1WHQA 3ZKBA 2F4VE 2EM5A 4DUZE 3J81C 1TN9A 4JI7E 4LF5I 1QNTA 1TF3A 3J7AM 5A69A 1RREA 2CSHA 2EM9A 4NXNE 5KL2A 3WU6A 4R2EA 4MYTA 4AIDA 4TUIA 4X8WA 5JEAA 4O5GA 4DUZI 4IZJD 1FWKA 2YTDA 3QT7A 2LCEA 1ZM2A 2ZITA 2UXDE 2CTDA 4NXNI 4B3SI 1KVKA 3H1CA 1HNWE 2ENCA 1Z59A 4IFDE 1MGTA 2RQLA 2JXPA 4WYQB 1X47A 3QT6A 1YSAC 2HGHA 4DPXA 4FWGA 2UUCE 1HNXI 4B3ME 2YPNA 1YHCA 2J65A 2YTGA 4WPYA 3JTZA 4R2RA 4R2SA 3C6KA 1PJTA 2A2CA 2EFGA 4FW5A 4LTYA 2UUBE 1UN6B 2NUGA 4R2CA 1IBMI 2OI2A 2YU8A 2UUCI 1H72C 4B3MI 2DRPA 4JI0E 2KOUA 2EM3A 3OTOI 1UBDC 1GTKA 5JEAE 5AE3A 1PDAA 2MKDA 1X6FA 1UDSA 3M6AA 4FW3A 4GEQB 2DSYA 2O1WA 2HJJA 4JYAE 2MDGA 4O24A 2EMXA 2G7HA 4OX9E 2L92A 4USMA 4J3DA 4DV0E 1A1FA 4MU3A 4DV1E 3WU4A 1A1LA 4F9CB 2MKNA 5C0XB 3ADGA 4DMIA 2JEAA 4JYAI 1N3GA 2EMBA 4R2AA 3ADIA 5JEAD 3ECRA 2NABA 4IJDA 1BBOA 3VHTB 4JI5I 3M7ND 5LMNE 3C4BA 5GMEA 3GMEA 3BF2A 3TQMA 4AQYE 1YYOA 4DV1I 3MSWA 2NPFA 2EPKX 1U2RA 1GQEA 2EPUA 1X5WA 2EJ4A 3EPLA 3F6GA 2UU9E 2WBTA 4JV5E 3B8HA 4DR7E 2PO2A 1G2FC 2WBUA 4IS9A 3F0NA 3LPSA 4B3RE 4BA2A 2JT2A 3M85D 1QU6A 4DR5E 2CGEA 4P78A 1YUJA 2VESA 4LF7E 4X66E 3CWVA 2H36X 1N36E 1HR0E 4PRXA 4AQYI 5K36C 2ZBKB 2LUPB 5IT9C 4WX9A 1X6EA 3J7Yp 1MU5A 2BA1G 1AAYA 3J80C 1RC7A 4JV5I 2EORA 2UXCE 1YH8A 3HXLA 2LTRA 1Z5CA 3U1KA 2IOQA 4FWHA 5LLQA 4O43A 2L8TA 3DJWA 3HJCA 2FTXB 2EN1A 2EOSA 2HHHE 1UDNA 4HTGA 1IBLE 5GMDA 2LT7A 2L2MA 4F9BB 2V8QB 2JWOA 2YTIA 4HEIA 1J5EE 1KKHA 2RS7A 3NZKA 3P3EA 2YRKA 3C6MA 4BA2B 3H4LA 4F2JC 2GLIA 3K17A 3J81Q 1X48A 2PRTA 1Z5AA 1DQ3A 1N33I 3VK6A 4DV6E 1TF6A 4M1KA 4LFCI 4DV5I 4ZYEA 3L7ZB 2EP3A 2I9IA 2R3VA 3ZOQB 4DV4E 2GS8A 1PJSA 1XNRE 1DARA 4DV7I 4FK5C 2VRDA 2L6MA 1OYSA 2BA0G 2NN6C 2PO1B 4DR4E 4R2PA 1T4LB 2HK2A 4JI8E 4DV3E 4JI2E 2WBSA 1FJGI 2B3TB 5A2QC 1ZXNA 1X49A 4UTGA 2UXBI 5A6BA 1EI1A 3DF6A 1UDQA 2EM2A 2Z5EA 2E1MA 5EKWA 1XNRI 2A25A 4LCHA 2EWLA 5BR8E 3Q6MA 5DRQA 4X65I 1X3CA 2YSPA 2VQEE 4K0KE 2LJPA 3QT8A 4KQVA 3PYDA 5K36F 1FKAE 5DNXA 2EN8A 4KZSA 2EM8A 2DMYA 2LJUA 2C38B 2EMCA 2XEXA 4IZKB 4LCGA 4LOMA 2PNZB 2K4VA 1NHHA 2ODRD 4FW6A 5BR8I 5KL6A 1OYPA 1J26A 2DEJA 2VF1A 4LF5E 5DROA 2KHXA 4GQUA 3HPSA 4N3OA 4JI3E 2EOYA 2BM1A 2Q8UA 2V86A 2HKJA 3THOB 1ZXMA 3PRYA 4FW4A 5K36A 2EMZA 4JI6I 2GQ0A 2EMGA 1WUUA 2EPOA 3Q1QA 2EOHA 2EL6A 2B7TA 2KONA 4BHBA 4FW7A 4P7AA 4QNJA 3V2UC 2EQ3A 2ENHA 4B3SE 4X9JA 4JI3I 5LMUE 2C39B 5DNYA 1ZM4A 1GZ6A 1H7UA 4F6NA 1P42A 2R1FA 4P7DA 2CPNA 1LLMC 3CDIA 4OO1C 1QZRA 1HNXE 1A6FA 1XMQE 4LF6I 2LTSA 2NA2A 3EPKA 1HK7A 4MU1A 1B62A 4ZYGA 2EOMA 3WU3A 5C0XF 1DGCA 5LMUI 2Q2EB 5ADZA 2NN6F 3GCMA 1OYRA 1IBME 5K36B 5A6BD 2EPNA 2PO0B 5T6JA 3CDJA 3F6HA 1XMQI 1WRJA 2EPPA 2EPMX 2LJHA 1IBKI 3OTOE 4BHCA 1G2DC 4I8OA 1EH7A 2R76A 3PYFA 4YY3E 2Z5BB 2YTQA 2WW4A 5C0XA 2AJ4A 5IT9Q 4MYUA 3J80Q 1T38A 4USKA 4M30A 5FLXC 2PNLA 3B82A 4MU0A 2JVAA 2EPLX 4DV2I 1PJQA 3IWBA 4YY3I 2V34A 3PS3A 5K36D 1F2IG 2I13A 4GKJE 4WSGA 4R1FA 1N0UA 2C37A 4GKKI 4JI5E 4M2ZA 2DMIA 2EMKA 5KL7A 1T4NA 3RMPA 4X64I 3AUZA 1EH8A 1STUA 2EOFA 3LTOA 2ELYA 2YU5A 5CFFE 1XMOE 3L00A 3T1HI 4GKJI 4DUYE 2NN6B 4OOGC 1ZR9A 1WHNA 3M99B 3K6QA 1YPNA 2AE8A 3ADLA 5AC4A 2N8XA 2RTXA 4OO1F 3J7AG 5C0XE 2WP8B 2EN2A 1HNZE 2EQ0A 1WXRA 2EOIA 2JYAA 4BCAA 2VF3A 2WZOA 2EPXA 1ELOA 1XMOI 1N32E 4DUYI 4B3TI 5A2QQ 2BM0A 2JEBB 3LNUA 3THNA 1RQ0A 2C37B 1A1GA 1RHYA 5DRRA 4DPWA 4DPUA 1HNZI 2LUQA 3KZZA 1UILA 1FI4A 4BS9A 2DLQA 3HQ1A 2EM7A 1R6LA 2BV3A 3L7ZA 3QT5A 5C0XD 1N32I 1NZ0A 2CZ9A 2GHFA 1IMUA 2LV2A 2L2KB 4O4KA 2YWQA 1RMDA 2EN7A 2WNRB 2PO1A 4IFDC 1N33E 4OKGA 2RPCA 4LFCE 5AC5A 3C4TA 4DV5E 3B4TA 2IOPA 2HK3A 1ZBTA 2VE7C 4Q28A 2Z5CB 4HXZA 2ENAA 3DD6A 2ADRA 1FWLA 2V2QA 5IWAI 4DV7E 2IERA 4UT4A 4KHPE 4LF8E 5AE2A 1I94I 4OO1B 4JI4E 1PVGA 3HKMA 1FJGE 1S4EA 1Z0BA 4MQYA 2C38A 4DPYA 4IZKA 2PNZA 2BB8A 2UXBE 1A1IA 2EOXA 4WUBA 1Z1BA 5KL4A 4X62E 1BKNA 4X65E 4HYMA 2GO3A 3KRNA 4LF8I 4NXMI 4KHPI 5JEAC 2EMAA 2JY9A 2V85A 4F6MA 4JI4I 4BC9A 1Z0GA 3U1YA 3Q6NA 2LVHA 1IQSA 4DR1E 5KL3A 3JAMQ 2YTNA 4MLVA 1B63A 4BBYA 5A6AA 2RSIA 4X62I 1H7SA 5EL9A 2YZTA 2BBGA 4ZVIA 1MEYC 2YTJA 4DR3E 2UUAI 4LF4E 2C39A 5FWKA 1O0WA 2WCC3 1XNQE 4WXCA 2ZM6I 2J7JA 4JI6E 1UEKA 2MC5A 1BBGA 3JU0A 4AM3A 3UHMA 4DR6E 3WU5A 5FLXQ 1KJKA 4WUCA 4LF9I 2EL5A 1S16A 2V89A 4DR3I 4LF4I 4HY1A 4IFDF 2M9AA 3EQ1A 4FW9A 4DPTA 1MX0A 1UHZA 1VISA 1XNQI 1SFEA 1T4OA 1YUIA 2F1DA 2PO0A 4LFAI 3LLHA 2FGGA 2BR2B 2DEIA 2K7IA 3KZYA 4JI1E 4DR6I 1EH6A 4IS1C 4Q35B 4LF6E 4HACA 5F3WA 1H73A 1Z0CA 4BA1B 2BA0D 4L5NC 2N3GA 2HKEA 4JG4A 2Z5BA 5A6JA 2DIXA 4F9AB 1YYWA 2M7QA 3K85A 2EN6A 3HULA 3PYGA 4DR2E 4DU7A 2YTPA 4IZJB 4JI1I 1IBKE 2CT1A 1ZBQA 1PKPA 1Z0WA 4TUGA 1BB8A 3BBGA 3P3CA 3JAMC 2F8BA 1RR9A 2EOJA 4DR2I 4N4RB 2X7IA 4R8OA 2E5LI 4ISAA 4AIMA 2LE2A 4WSPA 5AASA 1OJ4A 1SR9A 4HACB 4R03A 5K36E 3HTXA 2MDRA 2JR1A 2EPAA 2N3HA 3P1XA 4LU9A 4DV2E 2V87A 3QG5C 5IXMB 5IV8B 4ZYHA 1KTVA 1ZAAC 3PYEA 4F54A 1USVA 1Y4SA 5A6KA 1L4SA 2NN6A 2HC5A 3K1JA 2L3CA 1A1KA 4NBQA 2F4VI 4IFDB 4NZVA 1P47A 4JI7I 4GKKE 2WP8A 4WUDA 4X64E 1ZM3A 2ODRC 3EPHA 2JE6B 4P52A 3ZZ0A 3P3GA 3T1HE 2EL4A 2EMFA 2RSMA 4WXDA 3EPJA 2JEBA 3M7NG 2M4IA 2R42A 1Z0TA
chains in the Genus database with same CATH topology
4PU9A 2J7KA 2UXDI 3KWRA 2DB2A 1HNWI 2JOXA 2PNMA 4RPFA 4J8ZA 2E1RA 4B3TE 1EKZA 1USUA 1Y4UA 3P06A 1H74A 4DU8A 4EMDA 3VYYA 3IWCA 3LMLA 2UUBI 4BMJA 1K47A 2Z5CA 1XHKA 3ZZUA 2LRSA 2HFUA 4JI0I 4ED4A 1EA6A 2O1VA 4M0VA 3IWDA 3ZM7A 5IWAE 4OX9I 1ZM9A 4DV0I 1I94E 1DI2A 4BC7A 2VQFE 3H09A 2LBSB 2CG9A 2V88A 4Z7YA 3AV0A 5LL6R 2A2DA 5LMNI 3OMLA 4NXME 5L3JA 1Z0VA 2V8PA 4URLA 3GONA 2VQFI 1PIEA 2UU9I 4DR7I 2L33A 4B3RI 2B9DA 4DR5I 2V2VA 4L8NA 4X66I 4LF7I 1N36I 1HR0I 2FV4B 4LFBE 4XTJA 2UUAE 2M1SA 1FNMA 2ZM6E 3B78A 2UXCI 1Y6ZA 1N34E 4FN5A 4PRVA 3ZKDA 2B7VA 4LF9E 2EZ6A 4LFBI 2NUFA 2HHHI 3ADJA 1IBLI 1D6TA 1J5EI 3VYXA 4LFAE 4IZJA 2JOBA 1Z0EA 3ZZTA 1N34I 1YZ9A 1N0VC 4DV6I 1Z5BA 2L3JA 2YT4A 2MC6A 3T1YE 2HFSA 3V5RA 1YYKA 4DV4I 2V83A 1NHIA 3FIGA 5AE1A 2IHR1 2LMZA 2L2NA 4DR4I 4YHHE 4JI8I 4DV3I 3T1YI 4JI2I 2O1TA 1MG7A 3D4JA 3HPZA 2V2ZA 4DXLA 2E5LE 2O1UA 4K0KI 2VQEI 2X36A 4YHHI 4I3HA 4FWDA 4WFTA 1KIJA 2NUEA 4Z7CA 2RS6A 1NHJA 4DKKA 1WHQA 3ZKBA 2F4VE 4DUZE 3J81C 4JI7E 4LF5I 3J7AM 1RREA 4NXNE 3WU6A 4MYTA 4TUIA 4X8WA 4DUZI 4IZJD 1FWKA 3QT7A 1ZM2A 2ZITA 2UXDE 4NXNI 4B3SI 1KVKA 1HNWE 1Z59A 4WYQB 1X47A 3QT6A 4DPXA 4FWGA 2UUCE 1HNXI 4B3ME 4WPYA 3JTZA 2A2CA 2EFGA 4LTYA 2UUBE 2NUGA 1IBMI 2OI2A 2UUCI 1H72C 4B3MI 4JI0E 2KOUA 3OTOI 5AE3A 3M6AA 4GEQB 2DSYA 2O1WA 4JYAE 2G7HA 4OX9E 2L92A 4USMA 4DV0E 4DV1E 3WU4A 4F9CB 3ADGA 4DMIA 4JYAI 3ADIA 4JI5I 5LMNE 3C4BA 5GMEA 4AQYE 1YYOA 4DV1I 3MSWA 2NPFA 1U2RA 1GQEA 3F6GA 2UU9E 4JV5E 3B8HA 4DR7E 3F0NA 3LPSA 4B3RE 1QU6A 4DR5E 2CGEA 4P78A 3CWVA 4LF7E 4X66E 2H36X 1N36E 1HR0E 4PRXA 4AQYI 2ZBKB 2LUPB 5IT9C 3J7Yp 1MU5A 4JV5I 3J80C 1RC7A 2UXCE 3HXLA 2LTRA 1Z5CA 2IOQA 4FWHA 2L8TA 3DJWA 3HJCA 2FTXB 2HHHE 1IBLE 5GMDA 2L2MA 4F9BB 2V8QB 2JWOA 1J5EE 1KKHA 2RS7A 3H4LA 3J81Q 3K17A 1X48A 1Z5AA 1DQ3A 1N33I 3VK6A 4DV6E 4M1KA 4LFCI 4DV5I 2R3VA 3ZOQB 4DV4E 2GS8A 1XNRE 1DARA 4DV7I 2L6MA 4DR4E 1T4LB 2HK2A 4JI8E 4DV3E 4JI2E 1FJGI 2B3TB 5A2QC 1ZXNA 1X49A 4UTGA 2UXBI 1EI1A 3DF6A 2Z5EA 1XNRI 2E1MA 2EWLA 5BR8E 3Q6MA 4X65I 4K0KE 2VQEE 2LJPA 3QT8A 4KQVA 3PYDA 1FKAE 4KZSA 2XEXA 2DMYA 4DR1I 4IZKB 2K4VA 1NHHA 2ODRD 5BR8I 2DEJA 1J26A 2VF1A 4LF5E 2KHXA 4N3OA 3HPSA 4JI3E 2BM1A 2HKJA 2V86A 1ZXMA 3PRYA 4JI6I 2GQ0A 1WUUA 3Q1QA 2B7TA 2KONA 4P7AA 3V2UC 4B3SE 4JI3I 5LMUE 5DNYA 1ZM4A 1GZ6A 1H7UA 4P7DA 2CPNA 1QZRA 1HNXE 1A6FA 1XMQE 4LF6I 2LTSA 2NA2A 1HK7A 3WU3A 1B62A 5LMUI 2Q2EB 5ADZA 1IBME 5T6JA 3F6HA 1XMQI 2LJHA 1IBKI 3OTOE 4I8OA 3PYFA 4YY3E 2Z5BB 2WW4A 5IT9Q 2AJ4A 4MYUA 3J80Q 4USKA 4M30A 5FLXC 2PNLA 3B82A 2JVAA 4DV2I 3IWBA 4YY3I 2V34A 4GKJE 4R1FA 1N0UA 4GKKI 4JI5E 4M2ZA 1T4NA 3RMPA 4X64I 3AUZA 1STUA 3LTOA 5CFFE 1XMOE 3T1HI 4GKJI 4DUYE 4OOGC 1WHNA 3K6QA 3ADLA 2RTXA 3J7AG 1HNZE 1WXRA 4BCAA 2VF3A 2WZOA 1ELOA 1XMOI 1N32E 4DUYI 4B3TI 5A2QQ 2BM0A 3LNUA 1RQ0A 4DPWA 4DPUA 1HNZI 2LUQA 1FI4A 1UILA 4BS9A 2BV3A 3HQ1A 3QT5A 1N32I 1NZ0A 2CZ9A 2L2KB 1N33E 4LFCE 3C4TA 4DV5E 2IOPA 2HK3A 1ZBTA 2VE7C 4Q28A 2Z5CB 4HXZA 1FWLA 2V2QA 5IWAI 4DV7E 4UT4A 4KHPE 4LF8E 5AE2A 1I94I 4JI4E 1PVGA 1FJGE 1S4EA 1Z0BA 4DPYA 4IZKA 2UXBE 4WUBA 1BKNA 4X62E 4X65E 4HYMA 4KHPI 4LF8I 4NXMI 2JY9A 2V85A 4JI4I 4BC9A 1Z0GA 3Q6NA 4DR1E 3JAMQ 1B63A 4BBYA 4X62I 1H7SA 2YZTA 4ZVIA 4DR3E 2UUAI 4LF4E 5FWKA 1O0WA 2ZM6I 1XNQE 4JI6E 1UEKA 2MC5A 3JU0A 4DR6E 3WU5A 5FLXQ 4WUCA 4LF9I 1S16A 2V89A 4DR3I 4LF4I 4HY1A 4FW9A 4DPTA 1MX0A 1UHZA 1VISA 1XNQI 1T4OA 4LFAI 3LLHA 2FGGA 2DEIA 4JI1E 4DR6I 4LF6E 4HACA 5F3WA 1H73A 1Z0CA 4L5NC 2N3GA 2HKEA 4JG4A 2Z5BA 3K85A 2DIXA 4F9AB 1YYWA 2M7QA 3HULA 3PYGA 4DR2E 4DU7A 4IZJB 4JI1I 1IBKE 1Z0WA 1ZBQA 1PKPA 4TUGA 3JAMC 2F8BA 1RR9A 4DR2I 2X7IA 4R8OA 2E5LI 2LE2A 4WSPA 5AASA 1OJ4A 1SR9A 4HACB 4R03A 3HTXA 2MDRA 2JR1A 2N3HA 3P1XA 4LU9A 4DV2E 2V87A 1KTVA 3PYEA 4F54A 1USVA 1Y4SA 3K1JA 2L3CA 2F4VI 4JI7I 4GKKE 4WUDA 4X64E 1ZM3A 2ODRC 4P52A 3ZZ0A 3T1HE 2RSMA 2M4IA 2R42A 1Z0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PU9 A;  2J7K A;  2UXD I;  2DB2 A;  1HNW I;  4RPF A;  2E1R A;  4B3T E;  1EKZ A;  1H74 A;  4DU8 A;  4EMD A;  3VYY A;  2UUB I;  1K47 A;  1XHK A;  3ZZU A;  2LRS A;  2HFU A;  4JI0 I;  4ED4 A;  1EA6 A;  3ZM7 A;  5IWA E;  4OX9 I;  1ZM9 A;  4DV0 I;  1I94 E;  1DI2 A;  2VQF E;  2LBS B;  4Z7Y A;  5LL6 R;  2A2D A;  5LMN I;  4NXM E;  5L3J A;  1Z0V A;  2V8P A;  4URL A;  3GON A;  2VQF I;  1PIE A;  2UU9 I;  4DR7 I;  2L33 A;  4B3R I;  4DR5 I;  2V2V A;  4LF7 I;  4X66 I;  1N36 I;  1HR0 I;  4LFB E;  4XTJ A;  2UUA E;  1FNM A;  2ZM6 E;  3B78 A;  2UXC I;  1N34 E;  4FN5 A;  4PRV A;  3ZKD A;  2B7V A;  4LF9 E;  2EZ6 A;  4LFB I;  2NUF A;  2HHH I;  3ADJ A;  1IBL I;  1D6T A;  1J5E I;  3VYX A;  4LFA E;  1N34 I;  1Z0E A;  3ZZT A;  1YZ9 A;  1N0V C;  4DV6 I;  1Z5B A;  2L3J A;  2YT4 A;  3T1Y E;  2HFS A;  3V5R A;  1YYK A;  4DV4 I;  1NHI A;  2IHR 1;  2L2N A;  4DR4 I;  4YHH E;  4JI8 I;  4DV3 I;  3T1Y I;  4JI2 I;  1MG7 A;  3D4J A;  4DXL A;  2V2Z A;  2E5L E;  4K0K I;  2VQE I;  2X36 A;  4YHH I;  4I3H A;  4FWD A;  4WFT A;  1KIJ A;  2NUE A;  4Z7C A;  2RS6 A;  1NHJ A;  4DKK A;  1WHQ A;  3ZKB A;  2F4V E;  4DUZ E;  3J81 C;  4JI7 E;  4LF5 I;  3J7A M;  1RRE A;  4NXN E;  3WU6 A;  4MYT A;  4X8W A;  4DUZ I;  1FWK A;  3QT7 A;  1ZM2 A;  2ZIT A;  2UXD E;  4NXN I;  4B3S I;  1KVK A;  1HNW E;  1Z59 A;  4WYQ B;  1X47 A;  3QT6 A;  4DPX A;  4FWG A;  2UUC E;  1HNX I;  4B3M E;  2A2C A;  2EFG A;  2UUB E;  2NUG A;  1IBM I;  2OI2 A;  2UUC I;  1H72 C;  4B3M I;  4JI0 E;  3OTO I;  3M6A A;  4JYA E;  4OX9 E;  4USM A;  4DV0 E;  4DV1 E;  3WU4 A;  3ADG A;  4JYA I;  3ADI A;  4JI5 I;  5LMN E;  3C4B A;  5GME A;  4AQY E;  1YYO A;  4DV1 I;  2NPF A;  1U2R A;  1GQE A;  3B8H A;  2UU9 E;  4JV5 E;  4DR7 E;  3F0N A;  3LPS A;  4B3R E;  1QU6 A;  4DR5 E;  3CWV A;  4LF7 E;  4X66 E;  1N36 E;  1HR0 E;  4PRX A;  4AQY I;  2ZBK B;  2LUP B;  5IT9 C;  3J7Y p;  1MU5 A;  4JV5 I;  1RC7 A;  3J80 C;  2UXC E;  2LTR A;  1Z5C A;  4FWH A;  2HHH E;  1IBL E;  5GMD A;  2L2M A;  1J5E E;  1KKH A;  2RS7 A;  3H4L A;  3J81 Q;  3K17 A;  1X48 A;  1Z5A A;  1N33 I;  4DV6 E;  4LFC I;  4M1K A;  4DV5 I;  2R3V A;  4DV4 E;  2GS8 A;  1XNR E;  1DAR A;  4DV7 I;  4DR4 E;  1T4L B;  2HK2 A;  4JI8 E;  4DV3 E;  4JI2 E;  1FJG I;  2B3T B;  5A2Q C;  1ZXN A;  1X49 A;  4UTG A;  2UXB I;  1EI1 A;  1XNR I;  5BR8 E;  4X65 I;  4K0K E;  2VQE E;  2LJP A;  3QT8 A;  4KQV A;  3PYD A;  1FKA E;  2XEX A;  2DMY A;  4DR1 I;  1NHH A;  5BR8 I;  2DEJ A;  1J26 A;  4LF5 E;  2KHX A;  4JI3 E;  2BM1 A;  2HKJ A;  1ZXM A;  4JI6 I;  1WUU A;  3Q1Q A;  2B7T A;  4P7A A;  3V2U C;  4B3S E;  4JI3 I;  5LMU E;  1ZM4 A;  1H7U A;  2CPN A;  1QZR A;  1HNX E;  1A6F A;  1XMQ E;  4LF6 I;  2LTS A;  2NA2 A;  3WU3 A;  1B62 A;  5LMU I;  2Q2E B;  1IBM E;  1XMQ I;  2LJH A;  1IBK I;  3OTO E;  3PYF A;  4YY3 E;  2WW4 A;  5IT9 Q;  2AJ4 A;  4MYU A;  3J80 Q;  4USK A;  4M30 A;  5FLX C;  3B82 A;  2JVA A;  4DV2 I;  4YY3 I;  2V34 A;  4GKJ E;  4R1F A;  1N0U A;  4GKK I;  4JI5 E;  4M2Z A;  1T4N A;  4X64 I;  1STU A;  3LTO A;  5CFF E;  1XMO E;  3T1H I;  4GKJ I;  4DUY E;  4OOG C;  1WHN A;  3ADL A;  2RTX A;  3J7A G;  1HNZ E;  2VF3 A;  1ELO A;  1XMO I;  1N32 E;  4DUY I;  4B3T I;  5A2Q Q;  2BM0 A;  3LNU A;  1RQ0 A;  4DPW A;  4DPU A;  1HNZ I;  2LUQ A;  1FI4 A;  1UIL A;  2BV3 A;  3QT5 A;  1N32 I;  1NZ0 A;  2CZ9 A;  2L2K B;  1N33 E;  4LFC E;  3C4T A;  4DV5 E;  2HK3 A;  1ZBT A;  4HXZ A;  1FWL A;  2V2Q A;  5IWA I;  4DV7 E;  4UT4 A;  4KHP E;  4LF8 E;  1I94 I;  4JI4 E;  1PVG A;  1FJG E;  1S4E A;  1Z0B A;  4DPY A;  2UXB E;  4WUB A;  1BKN A;  4X62 E;  4X65 E;  4HYM A;  4KHP I;  4LF8 I;  4NXM I;  2JY9 A;  4JI4 I;  1Z0G A;  4DR1 E;  3JAM Q;  1B63 A;  4X62 I;  1H7S A;  4ZVI A;  4DR3 E;  2UUA I;  4LF4 E;  1O0W A;  2ZM6 I;  1XNQ E;  4JI6 E;  1UEK A;  4DR6 E;  3WU5 A;  5FLX Q;  4WUC A;  4LF9 I;  1S16 A;  4DR3 I;  4LF4 I;  4HY1 A;  4FW9 A;  4DPT A;  1MX0 A;  1UHZ A;  1VIS A;  1XNQ I;  1T4O A;  4LFA I;  3LLH A;  2DEI A;  4JI1 E;  4DR6 I;  4LF6 E;  4HAC A;  1H73 A;  1Z0C A;  2N3G A;  2HKE A;  4JG4 A;  2DIX A;  1YYW A;  3HUL A;  3PYG A;  4DR2 E;  4DU7 A;  4JI1 I;  1IBK E;  1Z0W A;  1PKP A;  3JAM C;  1RR9 A;  4DR2 I;  2X7I A;  2E5L I;  1OJ4 A;  4HAC B;  3HTX A;  2MDR A;  2N3H A;  3P1X A;  4DV2 E;  1KTV A;  3PYE A;  3K1J A;  2L3C A;  2F4V I;  4JI7 I;  4GKK E;  4WUD A;  4X64 E;  1ZM3 A;  4P52 A;  3ZZ0 A;  3T1H E;  2RSM A;  2R42 A;  1Z0T A; 
#chains in the Genus database with same CATH topology
 1B69 A;  4PU9 A;  2EM4 A;  2J7K A;  2UXD I;  3KWR A;  2DB2 A;  2EMH A;  4OZE A;  1HNW I;  2JOX A;  2PNM A;  5TSE A;  1T39 A;  1IQO A;  4MLQ A;  4RPF A;  2DLK A;  4J8Z A;  2E1R A;  1A1J A;  4B3T E;  1XXE A;  1EKZ A;  5JEA B;  4IFD D;  1USU A;  3M85 G;  1Y4U A;  3P06 A;  1H74 A;  1ZU1 A;  2WNR A;  2ELZ A;  4DU8 A;  4EMD A;  3VYY A;  1E3P A;  2NN6 E;  3IWC A;  3LML A;  1JK1 A;  2UUB I;  1E3H A;  4BMJ A;  1K47 A;  2Z5C A;  1XHK A;  2EOZ A;  3ZZU A;  2LRS A;  3PS2 A;  2YRM A;  2HFU A;  4JI0 I;  1A1H A;  2EOO A;  5ELW A;  2YTE A;  4ED4 A;  2EML A;  4OO1 A;  1EA6 A;  2O1V A;  2EPR A;  4M0V A;  1Y5Y A;  3IWD A;  2NN6 D;  2EN4 A;  2D9H A;  3ZM7 A;  1X6H A;  5IWA E;  4OX9 I;  4RHB B;  2IES A;  1ZM9 A;  4DV0 I;  1I94 E;  2YTO A;  1DI2 A;  4BC7 A;  2VQF E;  3H09 A;  2LBS B;  2GPI A;  4R2Q A;  2CG9 A;  2V88 A;  4QNK A;  4Z7Y A;  3AV0 A;  5LL6 R;  2A2D A;  5LMN I;  4LPF A;  3PS1 A;  3OML A;  4NXM E;  2YRH A;  5L3J A;  3MHS C;  1Z0V A;  1R6M A;  1UDO A;  2CVE A;  2V8P A;  3GON A;  4URL A;  1PIE A;  2EPZ A;  2VQF I;  2UU9 I;  2JEA B;  4DR7 I;  2L33 A;  4B3R I;  3MHH C;  2B9D A;  4OO1 E;  4DR5 I;  2V2V A;  4U3D A;  1VI7 A;  4L8N A;  2YSO A;  4X66 I;  1N36 I;  4LF7 I;  4GZN C;  2EQ1 A;  3BGH A;  1NEI A;  1HR0 I;  4M9V C;  2FV4 B;  4LFB E;  4XTJ A;  2UUA E;  2M1S A;  2DGC A;  1FNM A;  2GO4 A;  2ZM6 E;  2BA1 D;  3B78 A;  2UXC I;  2BR2 A;  2PO2 B;  2EMI A;  1N34 E;  1Y6Z A;  4FN5 A;  4PRV A;  3ZKD A;  2LO3 A;  4BA1 A;  2B7V A;  4LF9 E;  2EZ6 A;  2EMW A;  2EMY A;  1YFH A;  4U3B A;  4LFB I;  4KWY A;  1WJP A;  2NUF A;  3ADJ A;  2HHH I;  4OO1 D;  1IBL I;  3GLL A;  1D6T A;  3UK3 C;  1J5E I;  2EE8 A;  3VYX A;  4LFA E;  2O3Z A;  2EM6 A;  4IZJ A;  2JOB A;  1Z0E A;  3ZZT A;  1N34 I;  1YZ9 A;  5C0X C;  1N0V C;  5KL5 A;  4DV6 I;  1Z5B A;  2L3J A;  2YT4 A;  2MC6 A;  4ZYD A;  2EOQ A;  3T1Y E;  2HFS A;  3P76 A;  4LCF A;  1YYK A;  5DRP A;  3V5R A;  3BID A;  4DV4 I;  4NHR A;  5DNL A;  2V83 A;  1NHI A;  1JK2 A;  3FIG A;  5AE1 A;  2IHR 1;  2LMZ A;  2L2N A;  2EM0 A;  4DR4 I;  4YHH E;  2EN3 A;  4JI8 I;  4DV3 I;  3T1Y I;  4JI2 I;  1KYQ A;  2O1T A;  4R2D A;  2JPA A;  2JP9 A;  1MG7 A;  3D4J A;  4IFD A;  3HPZ A;  2V2Z A;  4DXL A;  1NCS A;  2E5L E;  1Y60 A;  2O1U A;  4DR1 I;  4RH8 A;  4MU4 A;  1AH5 A;  2VQE I;  2YTF A;  4K0K I;  2X36 A;  4YHH I;  4I3H A;  4FWD A;  4WFT A;  2JE6 A;  4MDT A;  1KIJ A;  2EOE A;  2EPC A;  2E72 A;  2NUE A;  5JEA F;  4Z7C A;  2RS6 A;  1NHJ A;  4DKK A;  1WHQ A;  3ZKB A;  2F4V E;  2EM5 A;  4DUZ E;  3J81 C;  1TN9 A;  4JI7 E;  4LF5 I;  1QNT A;  1TF3 A;  3J7A M;  5A69 A;  1RRE A;  2CSH A;  2EM9 A;  4NXN E;  5KL2 A;  3WU6 A;  4R2E A;  4MYT A;  4AID A;  4TUI A;  4X8W A;  5JEA A;  4O5G A;  4DUZ I;  4IZJ D;  1FWK A;  2YTD A;  3QT7 A;  2LCE A;  1ZM2 A;  2ZIT A;  2UXD E;  2CTD A;  4NXN I;  4B3S I;  1KVK A;  3H1C A;  1HNW E;  2ENC A;  1Z59 A;  4IFD E;  1MGT A;  2RQL A;  2JXP A;  4WYQ B;  1X47 A;  3QT6 A;  1YSA C;  2HGH A;  4DPX A;  4FWG A;  2UUC E;  1HNX I;  4B3M E;  2YPN A;  1YHC A;  2J65 A;  2YTG A;  4WPY A;  3JTZ A;  4R2R A;  4R2S A;  3C6K A;  1PJT A;  2A2C A;  2EFG A;  4FW5 A;  4LTY A;  2UUB E;  1UN6 B;  2NUG A;  4R2C A;  1IBM I;  2OI2 A;  2YU8 A;  2UUC I;  1H72 C;  4B3M I;  2DRP A;  4JI0 E;  2KOU A;  2EM3 A;  3OTO I;  1UBD C;  1GTK A;  5JEA E;  5AE3 A;  1PDA A;  2MKD A;  1X6F A;  1UDS A;  3M6A A;  4FW3 A;  4GEQ B;  2DSY A;  2O1W A;  2HJJ A;  4JYA E;  2MDG A;  4O24 A;  2EMX A;  2G7H A;  4OX9 E;  2L92 A;  4USM A;  4J3D A;  4DV0 E;  1A1F A;  4MU3 A;  4DV1 E;  3WU4 A;  1A1L A;  4F9C B;  2MKN A;  5C0X B;  3ADG A;  4DMI A;  2JEA A;  4JYA I;  1N3G A;  2EMB A;  4R2A A;  3ADI A;  5JEA D;  3ECR A;  2NAB A;  4IJD A;  1BBO A;  3VHT B;  4JI5 I;  3M7N D;  5LMN E;  3C4B A;  5GME A;  3GME A;  3BF2 A;  3TQM A;  4AQY E;  1YYO A;  4DV1 I;  3MSW A;  2NPF A;  2EPK X;  1U2R A;  1GQE A;  2EPU A;  1X5W A;  2EJ4 A;  3EPL A;  3F6G A;  2UU9 E;  2WBT A;  4JV5 E;  3B8H A;  4DR7 E;  2PO2 A;  1G2F C;  2WBU A;  4IS9 A;  3F0N A;  3LPS A;  4B3R E;  4BA2 A;  2JT2 A;  3M85 D;  1QU6 A;  4DR5 E;  2CGE A;  4P78 A;  1YUJ A;  2VES A;  4LF7 E;  4X66 E;  3CWV A;  2H36 X;  1N36 E;  1HR0 E;  4PRX A;  4AQY I;  5K36 C;  2ZBK B;  2LUP B;  5IT9 C;  4WX9 A;  1X6E A;  3J7Y p;  1MU5 A;  2BA1 G;  1AAY A;  3J80 C;  1RC7 A;  4JV5 I;  2EOR A;  2UXC E;  1YH8 A;  3HXL A;  2LTR A;  1Z5C A;  3U1K A;  2IOQ A;  4FWH A;  5LLQ A;  4O43 A;  2L8T A;  3DJW A;  3HJC A;  2FTX B;  2EN1 A;  2EOS A;  2HHH E;  1UDN A;  4HTG A;  1IBL E;  5GMD A;  2LT7 A;  2L2M A;  4F9B B;  2V8Q B;  2JWO A;  2YTI A;  4HEI A;  1J5E E;  1KKH A;  2RS7 A;  3NZK A;  3P3E A;  2YRK A;  3C6M A;  4BA2 B;  3H4L A;  4F2J C;  2GLI A;  3K17 A;  3J81 Q;  1X48 A;  2PRT A;  1Z5A A;  1DQ3 A;  1N33 I;  3VK6 A;  4DV6 E;  1TF6 A;  4M1K A;  4LFC I;  4DV5 I;  4ZYE A;  3L7Z B;  2EP3 A;  2I9I A;  2R3V A;  3ZOQ B;  4DV4 E;  2GS8 A;  1PJS A;  1XNR E;  1DAR A;  4DV7 I;  4FK5 C;  2VRD A;  2L6M A;  1OYS A;  2BA0 G;  2NN6 C;  2PO1 B;  4DR4 E;  4R2P A;  1T4L B;  2HK2 A;  4JI8 E;  4DV3 E;  4JI2 E;  2WBS A;  1FJG I;  2B3T B;  5A2Q C;  1ZXN A;  1X49 A;  4UTG A;  2UXB I;  5A6B A;  1EI1 A;  3DF6 A;  1UDQ A;  2EM2 A;  2Z5E A;  2E1M A;  5EKW A;  1XNR I;  2A25 A;  4LCH A;  2EWL A;  5BR8 E;  3Q6M A;  5DRQ A;  4X65 I;  1X3C A;  2YSP A;  2VQE E;  4K0K E;  2LJP A;  3QT8 A;  4KQV A;  3PYD A;  5K36 F;  1FKA E;  5DNX A;  2EN8 A;  4KZS A;  2EM8 A;  2DMY A;  2LJU A;  2C38 B;  2EMC A;  2XEX A;  4IZK B;  4LCG A;  4LOM A;  2PNZ B;  2K4V A;  1NHH A;  2ODR D;  4FW6 A;  5BR8 I;  5KL6 A;  1OYP A;  1J26 A;  2DEJ A;  2VF1 A;  4LF5 E;  5DRO A;  2KHX A;  4GQU A;  3HPS A;  4N3O A;  4JI3 E;  2EOY A;  2BM1 A;  2Q8U A;  2V86 A;  2HKJ A;  3THO B;  1ZXM A;  3PRY A;  4FW4 A;  5K36 A;  2EMZ A;  4JI6 I;  2GQ0 A;  2EMG A;  1WUU A;  2EPO A;  3Q1Q A;  2EOH A;  2EL6 A;  2B7T A;  2KON A;  4BHB A;  4FW7 A;  4P7A A;  4QNJ A;  3V2U C;  2EQ3 A;  2ENH A;  4B3S E;  4X9J A;  4JI3 I;  5LMU E;  2C39 B;  5DNY A;  1ZM4 A;  1GZ6 A;  1H7U A;  4F6N A;  1P42 A;  2R1F A;  4P7D A;  2CPN A;  1LLM C;  3CDI A;  4OO1 C;  1QZR A;  1HNX E;  1A6F A;  1XMQ E;  4LF6 I;  2LTS A;  2NA2 A;  3EPK A;  1HK7 A;  4MU1 A;  1B62 A;  4ZYG A;  2EOM A;  3WU3 A;  5C0X F;  1DGC A;  5LMU I;  2Q2E B;  5ADZ A;  2NN6 F;  3GCM A;  1OYR A;  1IBM E;  5K36 B;  5A6B D;  2EPN A;  2PO0 B;  5T6J A;  3CDJ A;  3F6H A;  1XMQ I;  1WRJ A;  2EPP A;  2EPM X;  2LJH A;  1IBK I;  3OTO E;  4BHC A;  1G2D C;  4I8O A;  1EH7 A;  2R76 A;  3PYF A;  4YY3 E;  2Z5B B;  2YTQ A;  2WW4 A;  5C0X A;  2AJ4 A;  5IT9 Q;  4MYU A;  3J80 Q;  1T38 A;  4USK A;  4M30 A;  5FLX C;  2PNL A;  3B82 A;  4MU0 A;  2JVA A;  2EPL X;  4DV2 I;  1PJQ A;  3IWB A;  4YY3 I;  2V34 A;  3PS3 A;  5K36 D;  1F2I G;  2I13 A;  4GKJ E;  4WSG A;  4R1F A;  1N0U A;  2C37 A;  4GKK I;  4JI5 E;  4M2Z A;  2DMI A;  2EMK A;  5KL7 A;  1T4N A;  3RMP A;  4X64 I;  3AUZ A;  1EH8 A;  1STU A;  2EOF A;  3LTO A;  2ELY A;  2YU5 A;  5CFF E;  1XMO E;  3L00 A;  3T1H I;  4GKJ I;  4DUY E;  2NN6 B;  4OOG C;  1ZR9 A;  1WHN A;  3M99 B;  3K6Q A;  1YPN A;  2AE8 A;  3ADL A;  5AC4 A;  2N8X A;  2RTX A;  4OO1 F;  3J7A G;  5C0X E;  2WP8 B;  2EN2 A;  1HNZ E;  2EQ0 A;  1WXR A;  2EOI A;  2JYA A;  4BCA A;  2VF3 A;  2WZO A;  2EPX A;  1ELO A;  1XMO I;  1N32 E;  4DUY I;  4B3T I;  5A2Q Q;  2BM0 A;  2JEB B;  3LNU A;  3THN A;  1RQ0 A;  2C37 B;  1A1G A;  1RHY A;  5DRR A;  4DPW A;  4DPU A;  1HNZ I;  2LUQ A;  3KZZ A;  1UIL A;  1FI4 A;  4BS9 A;  2DLQ A;  3HQ1 A;  2EM7 A;  1R6L A;  2BV3 A;  3L7Z A;  3QT5 A;  5C0X D;  1N32 I;  1NZ0 A;  2CZ9 A;  2GHF A;  1IMU A;  2LV2 A;  2L2K B;  4O4K A;  2YWQ A;  1RMD A;  2EN7 A;  2WNR B;  2PO1 A;  4IFD C;  1N33 E;  4OKG A;  2RPC A;  4LFC E;  5AC5 A;  3C4T A;  4DV5 E;  3B4T A;  2IOP A;  2HK3 A;  1ZBT A;  2VE7 C;  4Q28 A;  2Z5C B;  4HXZ A;  2ENA A;  3DD6 A;  2ADR A;  1FWL A;  2V2Q A;  5IWA I;  4DV7 E;  2IER A;  4UT4 A;  4KHP E;  4LF8 E;  5AE2 A;  1I94 I;  4OO1 B;  4JI4 E;  1PVG A;  3HKM A;  1FJG E;  1S4E A;  1Z0B A;  4MQY A;  2C38 A;  4DPY A;  4IZK A;  2PNZ A;  2BB8 A;  2UXB E;  1A1I A;  2EOX A;  4WUB A;  1Z1B A;  5KL4 A;  4X62 E;  1BKN A;  4X65 E;  4HYM A;  2GO3 A;  3KRN A;  4LF8 I;  4NXM I;  4KHP I;  5JEA C;  2EMA A;  2JY9 A;  2V85 A;  4F6M A;  4JI4 I;  4BC9 A;  1Z0G A;  3U1Y A;  3Q6N A;  2LVH A;  1IQS A;  4DR1 E;  5KL3 A;  3JAM Q;  2YTN A;  4MLV A;  1B63 A;  4BBY A;  5A6A A;  2RSI A;  4X62 I;  1H7S A;  5EL9 A;  2YZT A;  2BBG A;  4ZVI A;  1MEY C;  2YTJ A;  4DR3 E;  2UUA I;  4LF4 E;  2C39 A;  5FWK A;  1O0W A;  2WCC 3;  1XNQ E;  4WXC A;  2ZM6 I;  2J7J A;  4JI6 E;  1UEK A;  2MC5 A;  1BBG A;  3JU0 A;  4AM3 A;  3UHM A;  4DR6 E;  3WU5 A;  5FLX Q;  1KJK A;  4WUC A;  4LF9 I;  2EL5 A;  1S16 A;  2V89 A;  4DR3 I;  4LF4 I;  4HY1 A;  4IFD F;  2M9A A;  3EQ1 A;  4FW9 A;  4DPT A;  1MX0 A;  1UHZ A;  1VIS A;  1XNQ I;  1SFE A;  1T4O A;  1YUI A;  2F1D A;  2PO0 A;  4LFA I;  3LLH A;  2FGG A;  2BR2 B;  2DEI A;  2K7I A;  3KZY A;  4JI1 E;  4DR6 I;  1EH6 A;  4IS1 C;  4Q35 B;  4LF6 E;  4HAC A;  5F3W A;  1H73 A;  1Z0C A;  4BA1 B;  2BA0 D;  4L5N C;  2N3G A;  2HKE A;  4JG4 A;  2Z5B A;  5A6J A;  2DIX A;  4F9A B;  1YYW A;  2M7Q A;  3K85 A;  2EN6 A;  3HUL A;  3PYG A;  4DR2 E;  4DU7 A;  2YTP A;  4IZJ B;  4JI1 I;  1IBK E;  2CT1 A;  1ZBQ A;  1PKP A;  1Z0W A;  4TUG A;  1BB8 A;  3BBG A;  3P3C A;  3JAM C;  2F8B A;  1RR9 A;  2EOJ A;  4DR2 I;  4N4R B;  2X7I A;  4R8O A;  2E5L I;  4ISA A;  4AIM A;  2LE2 A;  4WSP A;  5AAS A;  1OJ4 A;  1SR9 A;  4HAC B;  4R03 A;  5K36 E;  3HTX A;  2MDR A;  2JR1 A;  2EPA A;  2N3H A;  3P1X A;  4LU9 A;  4DV2 E;  2V87 A;  3QG5 C;  5IXM B;  5IV8 B;  4ZYH A;  1KTV A;  1ZAA C;  3PYE A;  4F54 A;  1USV A;  1Y4S A;  5A6K A;  1L4S A;  2NN6 A;  2HC5 A;  3K1J A;  2L3C A;  1A1K A;  4NBQ A;  2F4V I;  4IFD B;  4NZV A;  1P47 A;  4JI7 I;  4GKK E;  2WP8 A;  4WUD A;  4X64 E;  1ZM3 A;  2ODR C;  3EPH A;  2JE6 B;  4P52 A;  3ZZ0 A;  3P3G A;  3T1H E;  2EL4 A;  2EMF A;  2RSM A;  4WXD A;  3EPJ A;  2JEB A;  3M7N G;  2M4I A;  2R42 A;  1Z0T A; 
#chains in the Genus database with same CATH homology
 4PU9 A;  2J7K A;  2UXD I;  3KWR A;  2DB2 A;  1HNW I;  2JOX A;  2PNM A;  4RPF A;  4J8Z A;  2E1R A;  4B3T E;  1EKZ A;  1USU A;  1Y4U A;  3P06 A;  1H74 A;  4DU8 A;  4EMD A;  3VYY A;  3IWC A;  3LML A;  2UUB I;  4BMJ A;  1K47 A;  2Z5C A;  1XHK A;  3ZZU A;  2LRS A;  2HFU A;  4JI0 I;  4ED4 A;  1EA6 A;  2O1V A;  4M0V A;  3IWD A;  3ZM7 A;  5IWA E;  4OX9 I;  1ZM9 A;  4DV0 I;  1I94 E;  1DI2 A;  4BC7 A;  2VQF E;  3H09 A;  2LBS B;  2CG9 A;  2V88 A;  4Z7Y A;  3AV0 A;  5LL6 R;  2A2D A;  5LMN I;  3OML A;  4NXM E;  5L3J A;  1Z0V A;  2V8P A;  4URL A;  3GON A;  2VQF I;  1PIE A;  2UU9 I;  4DR7 I;  2L33 A;  4B3R I;  2B9D A;  4DR5 I;  2V2V A;  4L8N A;  4X66 I;  4LF7 I;  1N36 I;  1HR0 I;  2FV4 B;  4LFB E;  4XTJ A;  2UUA E;  2M1S A;  1FNM A;  2ZM6 E;  3B78 A;  2UXC I;  1Y6Z A;  1N34 E;  4FN5 A;  4PRV A;  3ZKD A;  2B7V A;  4LF9 E;  2EZ6 A;  4LFB I;  2NUF A;  2HHH I;  3ADJ A;  1IBL I;  1D6T A;  1J5E I;  3VYX A;  4LFA E;  4IZJ A;  2JOB A;  1Z0E A;  3ZZT A;  1N34 I;  1YZ9 A;  1N0V C;  4DV6 I;  1Z5B A;  2L3J A;  2YT4 A;  2MC6 A;  3T1Y E;  2HFS A;  3V5R A;  1YYK A;  4DV4 I;  2V83 A;  1NHI A;  3FIG A;  5AE1 A;  2IHR 1;  2LMZ A;  2L2N A;  4DR4 I;  4YHH E;  4JI8 I;  4DV3 I;  3T1Y I;  4JI2 I;  2O1T A;  1MG7 A;  3D4J A;  3HPZ A;  2V2Z A;  4DXL A;  2E5L E;  2O1U A;  4K0K I;  2VQE I;  2X36 A;  4YHH I;  4I3H A;  4FWD A;  4WFT A;  1KIJ A;  2NUE A;  4Z7C A;  2RS6 A;  1NHJ A;  4DKK A;  1WHQ A;  3ZKB A;  2F4V E;  4DUZ E;  3J81 C;  4JI7 E;  4LF5 I;  3J7A M;  1RRE A;  4NXN E;  3WU6 A;  4MYT A;  4TUI A;  4X8W A;  4DUZ I;  4IZJ D;  1FWK A;  3QT7 A;  1ZM2 A;  2ZIT A;  2UXD E;  4NXN I;  4B3S I;  1KVK A;  1HNW E;  1Z59 A;  4WYQ B;  1X47 A;  3QT6 A;  4DPX A;  4FWG A;  2UUC E;  1HNX I;  4B3M E;  4WPY A;  3JTZ A;  2A2C A;  2EFG A;  4LTY A;  2UUB E;  2NUG A;  1IBM I;  2OI2 A;  2UUC I;  1H72 C;  4B3M I;  4JI0 E;  2KOU A;  3OTO I;  5AE3 A;  3M6A A;  4GEQ B;  2DSY A;  2O1W A;  4JYA E;  2G7H A;  4OX9 E;  2L92 A;  4USM A;  4DV0 E;  4DV1 E;  3WU4 A;  4F9C B;  3ADG A;  4DMI A;  4JYA I;  3ADI A;  4JI5 I;  5LMN E;  3C4B A;  5GME A;  4AQY E;  1YYO A;  4DV1 I;  3MSW A;  2NPF A;  1U2R A;  1GQE A;  3F6G A;  2UU9 E;  4JV5 E;  3B8H A;  4DR7 E;  3F0N A;  3LPS A;  4B3R E;  1QU6 A;  4DR5 E;  2CGE A;  4P78 A;  3CWV A;  4LF7 E;  4X66 E;  2H36 X;  1N36 E;  1HR0 E;  4PRX A;  4AQY I;  2ZBK B;  2LUP B;  5IT9 C;  3J7Y p;  1MU5 A;  4JV5 I;  3J80 C;  1RC7 A;  2UXC E;  3HXL A;  2LTR A;  1Z5C A;  2IOQ A;  4FWH A;  2L8T A;  3DJW A;  3HJC A;  2FTX B;  2HHH E;  1IBL E;  5GMD A;  2L2M A;  4F9B B;  2V8Q B;  2JWO A;  1J5E E;  1KKH A;  2RS7 A;  3H4L A;  3J81 Q;  3K17 A;  1X48 A;  1Z5A A;  1DQ3 A;  1N33 I;  3VK6 A;  4DV6 E;  4M1K A;  4LFC I;  4DV5 I;  2R3V A;  3ZOQ B;  4DV4 E;  2GS8 A;  1XNR E;  1DAR A;  4DV7 I;  2L6M A;  4DR4 E;  1T4L B;  2HK2 A;  4JI8 E;  4DV3 E;  4JI2 E;  1FJG I;  2B3T B;  5A2Q C;  1ZXN A;  1X49 A;  4UTG A;  2UXB I;  1EI1 A;  3DF6 A;  2Z5E A;  1XNR I;  2E1M A;  2EWL A;  5BR8 E;  3Q6M A;  4X65 I;  4K0K E;  2VQE E;  2LJP A;  3QT8 A;  4KQV A;  3PYD A;  1FKA E;  4KZS A;  2XEX A;  2DMY A;  4DR1 I;  4IZK B;  2K4V A;  1NHH A;  2ODR D;  5BR8 I;  2DEJ A;  1J26 A;  2VF1 A;  4LF5 E;  2KHX A;  4N3O A;  3HPS A;  4JI3 E;  2BM1 A;  2HKJ A;  2V86 A;  1ZXM A;  3PRY A;  4JI6 I;  2GQ0 A;  1WUU A;  3Q1Q A;  2B7T A;  2KON A;  4P7A A;  3V2U C;  4B3S E;  4JI3 I;  5LMU E;  5DNY A;  1ZM4 A;  1GZ6 A;  1H7U A;  4P7D A;  2CPN A;  1QZR A;  1HNX E;  1A6F A;  1XMQ E;  4LF6 I;  2LTS A;  2NA2 A;  1HK7 A;  3WU3 A;  1B62 A;  5LMU I;  2Q2E B;  5ADZ A;  1IBM E;  5T6J A;  3F6H A;  1XMQ I;  2LJH A;  1IBK I;  3OTO E;  4I8O A;  3PYF A;  4YY3 E;  2Z5B B;  2WW4 A;  5IT9 Q;  2AJ4 A;  4MYU A;  3J80 Q;  4USK A;  4M30 A;  5FLX C;  2PNL A;  3B82 A;  2JVA A;  4DV2 I;  3IWB A;  4YY3 I;  2V34 A;  4GKJ E;  4R1F A;  1N0U A;  4GKK I;  4JI5 E;  4M2Z A;  1T4N A;  3RMP A;  4X64 I;  3AUZ A;  1STU A;  3LTO A;  5CFF E;  1XMO E;  3T1H I;  4GKJ I;  4DUY E;  4OOG C;  1WHN A;  3K6Q A;  3ADL A;  2RTX A;  3J7A G;  1HNZ E;  1WXR A;  4BCA A;  2VF3 A;  2WZO A;  1ELO A;  1XMO I;  1N32 E;  4DUY I;  4B3T I;  5A2Q Q;  2BM0 A;  3LNU A;  1RQ0 A;  4DPW A;  4DPU A;  1HNZ I;  2LUQ A;  1FI4 A;  1UIL A;  4BS9 A;  2BV3 A;  3HQ1 A;  3QT5 A;  1N32 I;  1NZ0 A;  2CZ9 A;  2L2K B;  1N33 E;  4LFC E;  3C4T A;  4DV5 E;  2IOP A;  2HK3 A;  1ZBT A;  2VE7 C;  4Q28 A;  2Z5C B;  4HXZ A;  1FWL A;  2V2Q A;  5IWA I;  4DV7 E;  4UT4 A;  4KHP E;  4LF8 E;  5AE2 A;  1I94 I;  4JI4 E;  1PVG A;  1FJG E;  1S4E A;  1Z0B A;  4DPY A;  4IZK A;  2UXB E;  4WUB A;  1BKN A;  4X62 E;  4X65 E;  4HYM A;  4KHP I;  4LF8 I;  4NXM I;  2JY9 A;  2V85 A;  4JI4 I;  4BC9 A;  1Z0G A;  3Q6N A;  4DR1 E;  3JAM Q;  1B63 A;  4BBY A;  4X62 I;  1H7S A;  2YZT A;  4ZVI A;  4DR3 E;  2UUA I;  4LF4 E;  5FWK A;  1O0W A;  2ZM6 I;  1XNQ E;  4JI6 E;  1UEK A;  2MC5 A;  3JU0 A;  4DR6 E;  3WU5 A;  5FLX Q;  4WUC A;  4LF9 I;  1S16 A;  2V89 A;  4DR3 I;  4LF4 I;  4HY1 A;  4FW9 A;  4DPT A;  1MX0 A;  1UHZ A;  1VIS A;  1XNQ I;  1T4O A;  4LFA I;  3LLH A;  2FGG A;  2DEI A;  4JI1 E;  4DR6 I;  4LF6 E;  4HAC A;  5F3W A;  1H73 A;  1Z0C A;  4L5N C;  2N3G A;  2HKE A;  4JG4 A;  2Z5B A;  3K85 A;  2DIX A;  4F9A B;  1YYW A;  2M7Q A;  3HUL A;  3PYG A;  4DR2 E;  4DU7 A;  4IZJ B;  4JI1 I;  1IBK E;  1Z0W A;  1ZBQ A;  1PKP A;  4TUG A;  3JAM C;  2F8B A;  1RR9 A;  4DR2 I;  2X7I A;  4R8O A;  2E5L I;  2LE2 A;  4WSP A;  5AAS A;  1OJ4 A;  1SR9 A;  4HAC B;  4R03 A;  3HTX A;  2MDR A;  2JR1 A;  2N3H A;  3P1X A;  4LU9 A;  4DV2 E;  2V87 A;  1KTV A;  3PYE A;  4F54 A;  1USV A;  1Y4S A;  3K1J A;  2L3C A;  2F4V I;  4JI7 I;  4GKK E;  4WUD A;  4X64 E;  1ZM3 A;  2ODR C;  4P52 A;  3ZZ0 A;  3T1H E;  2RSM A;  2M4I A;  2R42 A;  1Z0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...