4DR4E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4E02
2L3CA 1MX0A 1WHNA 3ZZ0A 4USKA 5GMEA 4DV6E 2NUFA 4LF9E 1WHQA 2J7KA 5IWAE 2ZM6I 4ED4A 3PYDA 1Z0EA 3D4JA 1HNXI 3J7AG 2XEXA 1KIJA 1ZM2A 2HHHE 2RSMA 1N0UA 2NUGA 5BR8I 4DV2E 3LPSA 3Q1QA 2N3HA 2DB2A 1XMQE 4LF7E 2DIXA 2HFSA 4LF6E 4LF4E 1YYWA 1FNMA 2UXDI 4JI1I 5FLXC 2L2MA 2L2KB 4LFAE 1FI4A 3J81C 1HNXE 2WW4A 2R3VA 3HULA 2UXDE 2HK2A 4LF4I 1B62A 1Z5BA 2E5LE 3OTOE 2Q2EB 1UILA 1XNQI 3C4BA 1O0WA 4X62I 2IHR1 2DEJA 5BR8E 4DUYI 1XMOI 4JYAE 1ZM9A 4YHHE 4DV7E 2UU9I 1ZM3A 4NXMI 4DR5I 5FLXQ 1Z5CA 2UU9E 4DKKA 2NUEA 4DPTA 1K47A 1MU5A 2ZITA 4MYTA 1NHJA 4X66E 2CPNA 4DPXA 1HR0I 2LUPB 1DI2A 2B7VA 5LL6R 1HNZE 3ZM7A 2JY9A 1J5EI 2OI2A 4OX9I 4LFBE 4JI8E 1IBLI 4DV0I 2LJHA 2RTXA 4B3RI 2A2DA 2UXBE 4DPWA 3K1JA 4GKJI 1N33I 4GKKE 1XNQE 1OJ4A 3T1HE 1IBKE 2NPFA 4UT4A 4LF7I 1FWLA 4JI6E 1FJGI 1PKPA 1YYOA 1EI1A 1I94I 4R1FA 3HTXA 1RQ0A 4JI3I 3B82A 4FWGA 3WU3A 1STUA 4JI0E 2VQFI 4LFAI 4LF5E 3ADGA 2E1RA 4P52A 1Z0CA 2V2VA 4LF9I 5IT9Q 2HK3A 4WYQB 4DXLA 1S4EA 4JV5E 1QU6A 4LFCE 2MDRA 2V2ZA 3JAMQ 1N33E 4DV2I 3M6AA 3QT7A 3P1XA 4HXZA 4B3RE 1N32I 1PIEA 2UUCE 4DR7E 2R42A 4FWHA 4DV1E 1N36I 4AQYI 1H74A 1X49A 2YT4A 2BV3A 5A2QC 1HR0E 2CZ9A 3V2UC 2L3JA 4DR2I 2LJPA 2VF3A 4X65E 1ZM4A 5A2QQ 4DR3E 1KVKA 1X47A 5LMUE 3C4TA 4DR7I 2AJ4A 4NXME 3QT5A 4JI2E 1IBME 3LTOA 3GONA 4DR6I 4DUYE 1XMOE 1Z0BA 2EZ6A 1ZXNA 1T4OA 1MG7A 4DR4I 1PVGA 4UTGA 3JAMC 3QT6A 2UXCI 3OTOI 1VISA 3J80C 2DMYA 4JI4I 2LTRA 3T1YI 4Z7CA 4OOGC 2L33A 4KHPE 1RR9A 3LNUA 1N0VC 3PYEA 2RS6A 1YZ9A 1XNRI 2F4VE 3B78A 1GQEA 5CFFE 3T1HI 1XMQI 4LF8E 3WU4A 4GKKI 4HACB 2UXBI 4YY3I 1D6TA 1T4NA 1IBMI 2UUAI 2V2QA 1EKZA 4B3TI 4OX9E 1QZRA 1HNWE 1Z0TA 3WU5A 3J7AM 4B3SI 4DR2E 2V8PA 1N34E 3ZKBA 1H72C 4MYUA 1B63A 4DR1I 1ZBTA 2HKEA 2B7TA 1T4LB 1Z0VA 4DV5E 2LRSA 2B3TB 4B3TE 2LUQA 4YHHI 4DV7I 2UUAE 3ZZTA 1KTVA 1Z59A 1YYKA 4DR1E 4X62E 3WU6A 4DUZE 4B3MI 4HACA 3V5RA 1N34I 2V34A 1Z0GA 3QT8A 2F4VI 1FKAE 3ADIA 4AQYE 4K0KE 4NXNE 1U2RA 1ELOA 4YY3E 2HFUA 4JI3E 4X64E 4WUCA 5LMNE 4I3HA 1IBKI 2BM1A 1NZ0A 2BM0A 4B3ME 5LMNI 3J80Q 1ZXMA 4X64I 3F0NA 4JI7I 4LF5I 1H7SA 4Z7YA 4WUDA 4EMDA 4ZVIA 4KHPI 4JI8I 4DV5I 3VYYA 4JI5I 4DPUA 1H73A 4DV4I 2ZM6E 5IWAI 2HKJA 4JI6I 3ADLA 2L2NA 4B3SE 2DEIA 1H7UA 1UHZA 4WFTA 4GKJE 2N3GA 1HNWI 2ZBKB 1DARA 4P7AA 1BKNA 5LMUI 1EA6A 1RREA 1X48A 4HYMA 5L3JA 4WUBA 4DU7A 1UEKA 4KQVA 4X65I 1KKHA 1J26A 4DV4E 1XNRE 4JI5E 1NHHA 2X7IA 3LLHA 2LBSB 2EFGA 1WUUA 3ZKDA 4JI7E 2KHXA 4DU8A 4DV3I 3PYFA 3T1YE 2NA2A 4XTJA 4PRXA 4LF8I 2JVAA 4JV5I 4URLA 2RS7A 2E5LI 3VYXA 3H4LA 4DR4E 4JG4A 4FN5A 2A2CA 4PU9A 4RPFA 3ADJA 4DV3E 2HHHI 2X36A 1NHIA 4DV0E 4NXNI 1RC7A 4FWDA 4K0KI 2VQFE 4JI0I 4DR3I 1J5EE 4JI1E 5GMDA 1I94E 4LF6I 4M1KA 4JI4E 2GS8A 4DV6I 1FJGE 2UXCE 4USMA 3PYGA 3J7Yp 4X66I 5IT9C 3CWVA 1FWKA 3ZZUA 4DUZI 2LTSA 4DPYA 2UUBE 4DR6E 1A6FA 4JI2I 1XHKA 1S16A 1N36E 2VQEI 1IBLE 4DV1I 4DR5E 1Z0WA 1Z5AA 2UUCI 3B8HA 2VQEE 4LFBI 3J81Q 1N32E 4M30A 4HY1A 1HNZI 4JYAI 4M2ZA 2UUBI 4X8WA 4PRVA 4FW9A 3K17A 4LFCI
chains in the Genus database with same CATH superfamily
2L3CA 1MX0A 2EPLX 1WHNA 2BA0D 3ZZ0A 4USKA 5GMEA 2L92A 3CDJA 4LOMA 3VHTB 4DV6E 2NUFA 4LF9E 1WHQA 2J7KA 5IWAE 2ZM6I 2GO3A 2CTDA 1YUJA 5IXMB 4BMJA 2K7IA 2R1FA 4ED4A 3PYDA 1MGTA 2O3ZA 1Z0EA 3D4JA 1HNXI 2EL6A 3J7AG 2XEXA 4BA2B 2EOMA 2YTFA 4IZJD 1TF6A 1KIJA 1ZM2A 2HHHE 2JEAB 4BS9A 1OYPA 2RSMA 1N0UA 2NUGA 1Y4UA 5BR8I 4U3DA 2M1SA 4DV2E 2O1VA 3LPSA 2F1DA 4OZEA 2N3HA 2DB2A 2AE8A 3Q1QA 4MDTA 1XMQE 5AASA 3ECRA 4LF7E 4BA1A 2DIXA 4Q28A 4R2PA 2HFSA 3K17A 4LF6E 4LF4E 1YYWA 1FNMA 2UXDI 1ZBQA 2EN2A 4JI1I 4IFDF 2HC5A 5FLXC 4MLQA 2MKNA 2PO1A 2L2MA 2L2KB 1A1IA 2E72A 3KZYA 4LFAE 3J81C 5LLQA 3MSWA 1HNXE 4BHCA 2L8TA 1FI4A 3K85A 3PRYA 2NN6C 2WW4A 2GLIA 2R3VA 3HULA 1ZU1A 2E1MA 2UXDE 5A6BA 2HK2A 2EPZA 4LF4I 2Q8UA 2PO2A 4QNKA 3M85G 4WXDA 1B62A 2C38A 1Z5BA 2E5LE 1P42A 3OTOE 4BHBA 2RPCA 1UILA 1BBGA 2Q2EB 2V89A 1XNQI 5DNLA 4OO1A 3C4BA 1O0WA 4RH8A 2O1WA 4X62I 2IHR1 2DEJA 5BR8E 4DUYI 3PS2A 4JYAE 1XMOI 2WZOA 4LFCI 1X6FA 1ZM9A 3L7ZB 1TF3A 4YHHE 2EM3A 4DV7E 3IWBA 3HJCA 4AIMA 1ZM3A 5JEAF 3H09A 4DR5I 2UU9I 4NXMI 4AM3A 5FLXQ 1Z5CA 2YPNA 2UU9E 2J65A 3DD6A 5EKWA 4DKKA 2NUEA 4DPTA 1X6HA 4FK5C 2YTPA 3KZZA 2BBGA 1K47A 2JR1A 3M85D 1MU5A 2H36X 2ZITA 4MYTA 2V85A 2V86A 2YU5A 1NHJA 5FWKA 2EPOA 4MLVA 4X66E 5DROA 2CPNA 4DPXA 1A1JA 5DNYA 1USUA 5AE1A 1HR0I 2LUPB 5A6BD 1DI2A 2B7VA 5LL6R 4OO1B 4HEIA 4TUGA 2EPKX 1HNZE 3ZM7A 2JY9A 3C6KA 1J5EI 2C38B 2OI2A 4OX9I 5KL6A 4LFBE 2Z5EA 4JI8E 2C39B 2PO2B 4LU9A 5KL4A 2C37A 1IBLI 4DV0I 2LJHA 5C0XE 2RTXA 1Y60A 1KJKA 4LCHA 5DRRA 4B3RI 2A2DA 4N3OA 2UXBE 4DPWA 3K1JA 4J3DA 1BB8A 2EMFA 4GKJI 2YTJA 4GKKE 1N33I 3BIDA 3QG5C 1XNQE 1OJ4A 3T1HE 1IBKE 2NPFA 4UT4A 2JOBA 1ZAAC 4LF7I 4IZKB 1FWLA 2EOJA 4JI6E 4WXCA 2IESA 4U3BA 1FJGI 1PKPA 2EMHA 1YYOA 2YU8A 3BF2A 1EI1A 1I94I 4R1FA 4IFDE 3HTXA 1RQ0A 4JI3I 2EMKA 3M99B 2DLKA 2EM0A 4GZNC 4O24A 3B82A 4FWGA 3WU3A 1STUA 4JI0E 2VQFI 4R8OA 2EPCA 3JTZA 4LFAI 4WSPA 3DJWA 2GPIA 2J7JA 4LCFA 4LF5E 2B9DA 2JEAA 3ADGA 3F6HA 2E1RA 2ODRC 4P52A 1Z0CA 2V2VA 2IOPA 2EPPA 2JXPA 3BBGA 4LF9I 2EN7A 5IT9Q 4ZYGA 4WYQB 1UDQA 2HK3A 2EPXA 4OO1E 2EM6A 1UDNA 4DXLA 2V8QB 4JV5E 2I9IA 1S4EA 2BR2B 4NBQA 1QU6A 3Q6NA 4LFCE 2MDRA 2V2ZA 2VQEI 3EPHA 2EPAA 3JAMQ 1N33E 4DV2I 2O1UA 3M6AA 3QT7A 5TSEA 3P1XA 3ZOQB 1YUIA 4B3RE 3L7ZA 4HXZA 2EJ4A 1N32I 4IS1C 2RSIA 2EOFA 3MHSC 1OYSA 1PIEA 2UUCE 2EN1A 2YZTA 4DR7E 2R42A 4TUIA 4DV1E 4FWHA 1N36I 2LJUA 1PJQA 5K36E 4AQYI 4IJDA 1H74A 2JT2A 2PNMA 2DRPA 1X49A 2YT4A 2MDGA 2BV3A 3HXLA 2PO0B 5A2QC 1R6LA 1HR0E 1GZ6A 3AV0A 4NHRA 2DGCA 2JPAA 2CZ9A 3V2UC 1QNTA 5KL3A 2L3JA 4DR2I 4M0VA 2MKDA 1HK7A 2LJPA 2VF3A 4X65E 1ZM4A 2DSYA 2NN6A 3HKMA 5ELWA 2CGEA 2V83A 2EMZA 2WBUA 2DLQA 4R2QA 2PO1B 2EM2A 5A2QQ 2VF1A 4DR3E 1AH5A 4I8OA 1KVKA 3IWDA 1X47A 5LMUE 2YSPA 2LV2A 2ELYA 3C4TA 5C0XF 4DR7I 2AJ4A 4NXME 3QT5A 4P78A 1A1HA 4R2CA 2GQ0A 2IERA 4JI2E 1IBME 3LTOA 2EMBA 3GONA 2ADRA 4LPFA 4DR6I 1NCSA 4DUYE 3TQMA 1XMOE 1Y4SA 2EN3A 2EZ6A 1Z0BA 5AC5A 1ZXNA 1T4OA 2YTGA 1WRJA 2CSHA 2EQ0A 1MG7A 4DR4I 1JK2A 2KONA 1PVGA 4UTGA 2YSOA 4FW5A 3JAMC 4R2SA 3QT6A 2UXCI 3OTOI 3BGHA 1VISA 1A1FA 4J8ZA 3J80C 2DMYA 4JI4I 3THNA 4BA2A 3U1YA 2EOOA 4FW4A 2LTRA 2YTEA 3T1YI 4Z7CA 2ENAA 5K36B 2PRTA 4OOGC 2I13A 1RMDA 2L33A 4KHPE 2WCC3 2EPMX 1SFEA 3LMLA 3HPZA 2L6MA 2CT1A 1RR9A 1Y6ZA 2VRDA 1N0VC 2RS6A 3DF6A 1YZ9A 2NN6D 3LNUA 3PYEA 1XNRI 2F4VE 2EORA 4OO1F 4MU4A 2GO4A 2EMCA 3B78A 1GQEA 2YTDA 4FW3A 3U1KA 1DQ3A 5CFFE 2LT7A 3T1HI 3M7NG 1XMQI 2WBTA 1WXRA 4OO1C 4LF8E 2LE2A 2HJJA 2YWQA 2JEBB 2M9AA 3H1CA 3WU4A 4GKKI 4WX9A 2BR2A 4HACB 3P06A 2UXBI 4YY3I 1D6TA 1T4NA 1IBMI 2UUAI 3M7ND 2V2QA 1EKZA 2D9HA 4B3TI 1OYRA 5AE3A 1EH8A 2Z5BA 1PDAA 4OX9E 5DRQA 1QZRA 4IFDB 4GEQB 1HNWE 4BCAA 1Z0TA 3WU5A 2F8BA 2YRHA 1XXEA 1G2FC 3K6QA 5KL2A 4AIDA 3J7AM 4B3SI 3VK6A 2Z5CB 4DR2E 1L4SA 2EE8A 2V8PA 2K4VA 1N34E 3ZKBA 1H72C 1EH6A 2NABA 2EOXA 2EM5A 4MYUA 1B63A 3EQ1A 4DR1I 2MC6A 1ZBTA 2HKEA 5AC4A 2B7TA 2LCEA 2V87A 1T4LB 2WP8A 5JEAD 5DNXA 1Z0VA 4DV5E 2LRSA 1UN6B 1IQOA 2B3TB 4NZVA 3EPJA 2LUQA 4B3TE 2NN6B 4YHHI 4DV7I 4QNJA 1NEIA 2V88A 2UUAE 3ZZTA 1KTVA 1Z59A 3GMEA 1YYKA 3B4TA 1RHYA 3HQ1A 2C37B 4DR1E 1USVA 4BA1B 1E3HA 4X62E 2Z5CA 4GQUA 5A6KA 4DUZE 3WU6A 4B3MI 4HACA 4MU3A 3V5RA 1N34I 1UDOA 2V34A 1Z0GA 4FW6A 2YTQA 3P3GA 3QT8A 2EMGA 1P47A 2F4VI 2ENCA 1DGCA 1FKAE 4RHBB 1SR9A 3UK3C 2Z5BB 2EMIA 5C0XC 1YHCA 3ADIA 4N4RB 4AQYE 4BC9A 4IFDD 2A25A 2CVEA 2VE7C 4K0KE 3CDIA 4NXNE 2DMIA 1U2RA 2EPRA 4OKGA 1ELOA 4YY3E 1A1GA 2HFUA 4JI3E 4X64E 4WUCA 2EWLA 5LMNE 2EMLA 4MU0A 4I3HA 1E3PA 2FV4B 1T38A 3JU0A 1IBKI 2JYAA 4X9JA 2BM1A 2EPUA 1NZ0A 2BM0A 4B3ME 5LMNI 2EL5A 3J80Q 1ZXMA 4X64I 2WBSA 2BA1D 3F0NA 4IZJA 4F54A 2EOZA 4JI7I 4KZSA 4LF5I 3RMPA 1UBDC 1H7SA 2CG9A 5IV8B 4WUDA 4Z7YA 2YRKA 4EMDA 4ZVIA 5K36A 1EH7A 4KHPI 4JI8I 2EOEA 4DV5I 1GTKA 3MHHC 3OMLA 3IWCA 4BC7A 4IZKA 5F3WA 2EN6A 3VYYA 2EOIA 4JI5I 4DPUA 1WJPA 1H73A 4DV4I 4WPYA 2ZM6E 5IWAI 1VI7A 1X3CA 4L8NA 2HKJA 2JE6A 2YTIA 2JE6B 2WP8B 4JI6I 3ADLA 1Y5YA 2L2NA 1PJTA 2EN4A 2EMXA 4Q35B 1X6EA 4B3SE 2DEIA 1YPNA 1H7UA 2VESA 1UHZA 4WFTA 2MC5A 5JEAC 4GKJE 2EM8A 2N3GA 5JEAB 2KOUA 4OO1D 4O43A 1AAYA 4MU1A 3EPKA 5K36C 1HNWI 2ELZA 4DMIA 2EOQA 1MEYC 2ZBKB 4IZJB 2EOSA 1YSAC 3UHMA 4O4KA 4R2EA 4ZYEA 4R2RA 1DARA 1BKNA 4P7AA 5K36F 4F9BB 5A6JA 2EM4A 5AE2A 2WNRB 4ZYHA 5A6AA 1EA6A 1B69A 1RREA 5LMUI 1X48A 4HYMA 1KYQA 2EM9A 2PNZA 4IFDA 1ZR9A 2JOXA 3C6MA 3EPLA 5L3JA 3HPSA 4WUBA 1TN9A 4DU7A 2G7HA 1UEKA 2EM7A 2FTXB 4KQVA 4X65I 5K36D 2GHFA 4F6NA 3AUZA 1F2IG 2JEBA 4IS9A 1KKHA 1J26A 3PS3A 4HTGA 2EQ3A 4DV4E 1XNRE 2ENHA 1A1LA 4JI5E 5KL7A 3GCMA 5C0XB 4O5GA 2EOHA 2EQ1A 2BA0G 2FGGA 2M7QA 2LO3A 1NHHA 2EMYA 3LLHA 2LBSB 1Z1BA 2EP3A 2X7IA 1JK1A 2EFGA 1A1KA 1WUUA 3ZKDA 5C0XA 2PNZB 4IFDC 5ADZA 4JI7E 2KHXA 2WNRA 4DU8A 4DV3I 3PYFA 3T1YE 3KRNA 4R03A 4MQYA 2NA2A 4XTJA 4PRXA 3P76A 2NN6F 5DRPA 4M9VC 4LF8I 2JVAA 2R76A 2YTOA 1N3GA 4F9CB 2EPNA 4LF6I 4JV5I 4URLA 1PJSA 2RS7A 2YRMA 4L5NC 5KL5A 3VYXA 1R6MA 4DR4E 4KWYA 3H4LA 2E5LI 4JG4A 4LTYA 1LLMC 4FN5A 2A2CA 3NZKA 4PU9A 4RPFA 5T6JA 2ODRD 3ADJA 4DV3E 3PS1A 4FW7A 2N8XA 2HHHI 2X36A 1NHIA 4DV0E 3GLLA 3P3EA 1IMUA 4NXNI 4P7DA 1RC7A 4FWDA 4K0KI 2NN6E 2VQFE 4JI0I 5JEAA 1X5WA 4WSGA 2O1TA 4DR3I 1J5EE 4JI1E 4R2AA 4BBYA 2C39A 5GMDA 1I94E 1G2DC 2HGHA 2IOQA 2JP9A 4JI4E 4R2DA 2GS8A 4M1KA 4ISAA 1FJGE 2RQLA 1UDSA 5C0XD 4DV6I 4F9AB 3FIGA 2UXCE 4USMA 3PYGA 1T39A 3J7Yp 3Q6MA 2YTNA 3L00A 5IT9C 4X66I 3F6GA 3KWRA 4F6MA 4F2JC 3CWVA 5EL9A 1FWKA 3ZZUA 4DUZI 2LTSA 5JEAE 2PNLA 4DPYA 2UUBE 2BB8A 4DR6E 1A6FA 5A69A 2BA1G 4JI2I 1XHKA 1YH8A 2PO0A 2M4IA 2EOYA 1N36E 1IBLE 1S16A 3P3CA 4LCGA 4DR5E 1Z0WA 1Z5AA 4DV1I 3B8HA 2UUCI 2VQEE 4LFBI 2JWOA 3J81Q 1N32E 4M30A 4ZYDA 4HY1A 1HNZI 4JYAI 2LVHA 4M2ZA 1BBOA 2UUBI 4X8WA 2EN8A 1YFHA 1IQSA 2EL4A 3THOB 4PRVA 4FW9A 2LMZA 2EMAA 2EMWA
chains in the Genus database with same CATH topology
2L3CA 1MX0A 1WHNA 3ZZ0A 4USKA 5GMEA 2L92A 4DV6E 2NUFA 4LF9E 1WHQA 2J7KA 5IWAE 2ZM6I 4BMJA 4ED4A 3PYDA 1Z0EA 3D4JA 1HNXI 3J7AG 2XEXA 4IZJD 1KIJA 1ZM2A 2HHHE 4BS9A 2RSMA 1N0UA 2NUGA 1Y4UA 5BR8I 2M1SA 4DV2E 2O1VA 3LPSA 3Q1QA 2N3HA 2DB2A 1XMQE 5AASA 4LF7E 2DIXA 4Q28A 2HFSA 3K17A 4LF6E 4LF4E 1YYWA 1FNMA 2UXDI 1ZBQA 4JI1I 5FLXC 2L2MA 2L2KB 4LFAE 3J81C 1FI4A 3MSWA 1HNXE 3K85A 2L8TA 3PRYA 2WW4A 2R3VA 3HULA 2E1MA 2UXDE 2HK2A 4LF4I 1B62A 1Z5BA 2E5LE 3OTOE 2Q2EB 1UILA 2V89A 1XNQI 3C4BA 1O0WA 4X62I 2O1WA 2IHR1 2DEJA 5BR8E 4DUYI 1XMOI 4JYAE 2WZOA 1ZM9A 4YHHE 4DV7E 3IWBA 3HJCA 2UU9I 1ZM3A 4NXMI 3H09A 4DR5I 5FLXQ 1Z5CA 2UU9E 4DKKA 2NUEA 4DPTA 1K47A 2JR1A 1MU5A 2H36X 2ZITA 4MYTA 2V85A 2V86A 5FWKA 1NHJA 4X66E 2CPNA 4DPXA 5DNYA 1USUA 5AE1A 1HR0I 2LUPB 1DI2A 2B7VA 5LL6R 4TUGA 1HNZE 3ZM7A 2JY9A 1J5EI 2OI2A 4OX9I 4LFBE 2Z5EA 4JI8E 4LU9A 1IBLI 4DV0I 2LJHA 2RTXA 4B3RI 2A2DA 4N3OA 2UXBE 4DPWA 3K1JA 4GKJI 1N33I 4GKKE 1XNQE 1OJ4A 3T1HE 1IBKE 2NPFA 4UT4A 2JOBA 4LF7I 4IZKB 1FWLA 4JI6E 1FJGI 1PKPA 1YYOA 1EI1A 1I94I 4R1FA 3HTXA 1RQ0A 4JI3I 3B82A 4FWGA 3WU3A 1STUA 4JI0E 2VQFI 4R8OA 3JTZA 4LFAI 4WSPA 3DJWA 4LF5E 2B9DA 3ADGA 3F6HA 2E1RA 2ODRC 4P52A 1Z0CA 2V2VA 2IOPA 4LF9I 5IT9Q 2HK3A 4WYQB 4DXLA 2V8QB 4JV5E 1S4EA 1QU6A 3Q6NA 4LFCE 2MDRA 2V2ZA 3JAMQ 1N33E 4DV2I 2O1UA 3M6AA 3QT7A 3P1XA 3ZOQB 4HXZA 4B3RE 1N32I 1PIEA 2UUCE 2YZTA 4DR7E 2R42A 4FWHA 4TUIA 4DV1E 1N36I 4AQYI 1H74A 2PNMA 1X49A 2YT4A 2BV3A 3HXLA 5A2QC 1HR0E 1GZ6A 3AV0A 2CZ9A 3V2UC 2L3JA 4DR2I 4M0VA 2LJPA 1HK7A 2VF3A 4X65E 1ZM4A 2DSYA 2CGEA 2V83A 5A2QQ 2VF1A 4DR3E 4I8OA 1KVKA 3IWDA 1X47A 5LMUE 3C4TA 4DR7I 2AJ4A 4NXME 3QT5A 4P78A 2GQ0A 4JI2E 1IBME 3LTOA 3GONA 4DR6I 4DUYE 1XMOE 1Z0BA 1Y4SA 2EZ6A 1ZXNA 1T4OA 1MG7A 4DR4I 2KONA 1PVGA 4UTGA 3JAMC 3QT6A 2UXCI 3OTOI 1VISA 4J8ZA 3J80C 2DMYA 4JI4I 2LTRA 3T1YI 4Z7CA 4OOGC 2L33A 4KHPE 3LMLA 3HPZA 2L6MA 1RR9A 1Y6ZA 1N0VC 3LNUA 2RS6A 3DF6A 1YZ9A 3PYEA 1XNRI 2F4VE 3B78A 1GQEA 1DQ3A 5CFFE 3T1HI 1XMQI 1WXRA 4LF8E 2LE2A 3WU4A 4GKKI 4HACB 3P06A 2UXBI 4YY3I 1D6TA 1T4NA 1IBMI 2UUAI 2V2QA 1EKZA 4B3TI 5AE3A 2Z5BA 4OX9E 1QZRA 4GEQB 1HNWE 4BCAA 1Z0TA 3WU5A 2F8BA 3K6QA 3J7AM 4B3SI 3VK6A 2Z5CB 4DR2E 2V8PA 2K4VA 1N34E 3ZKBA 1H72C 4MYUA 1B63A 4DR1I 2MC6A 1ZBTA 2HKEA 2B7TA 2V87A 1T4LB 1Z0VA 4DV5E 2LRSA 2B3TB 4B3TE 2LUQA 4YHHI 4DV7I 2V88A 2UUAE 3ZZTA 1KTVA 1Z59A 1YYKA 3HQ1A 4DR1E 1USVA 4X62E 2Z5CA 3WU6A 4DUZE 4B3MI 4HACA 3V5RA 1N34I 2V34A 1Z0GA 3QT8A 2F4VI 1FKAE 1SR9A 2Z5BB 3ADIA 4AQYE 4BC9A 2VE7C 4K0KE 4NXNE 1U2RA 1ELOA 4YY3E 2HFUA 4JI3E 4X64E 4WUCA 2EWLA 5LMNE 4I3HA 2FV4B 3JU0A 1IBKI 2BM1A 1NZ0A 2BM0A 4B3ME 5LMNI 3J80Q 1ZXMA 4X64I 3F0NA 4IZJA 4F54A 4JI7I 4KZSA 4LF5I 3RMPA 1H7SA 2CG9A 4Z7YA 4WUDA 4EMDA 4ZVIA 4KHPI 4JI8I 4DV5I 3OMLA 3IWCA 4BC7A 4IZKA 5F3WA 3VYYA 4JI5I 4DPUA 1H73A 4DV4I 4WPYA 2ZM6E 5IWAI 2HKJA 4L8NA 4JI6I 3ADLA 2L2NA 4B3SE 2DEIA 1H7UA 1UHZA 4WFTA 2MC5A 4GKJE 2N3GA 2KOUA 1HNWI 4DMIA 2ZBKB 4IZJB 1DARA 4P7AA 1BKNA 4F9BB 5AE2A 5LMUI 1EA6A 1RREA 1X48A 4HYMA 2JOXA 5L3JA 3HPSA 4WUBA 4DU7A 2G7HA 1UEKA 2FTXB 4KQVA 4X65I 3AUZA 1KKHA 1J26A 4DV4E 1XNRE 4JI5E 2FGGA 2M7QA 1NHHA 2X7IA 3LLHA 2LBSB 2EFGA 1WUUA 3ZKDA 5ADZA 4JI7E 2KHXA 4DU8A 4DV3I 3PYFA 3T1YE 4R03A 2NA2A 4XTJA 4PRXA 4LF8I 2JVAA 4F9CB 4JV5I 4URLA 2RS7A 2E5LI 4L5NC 3VYXA 3H4LA 4DR4E 4JG4A 4LTYA 4FN5A 2A2CA 4PU9A 4RPFA 5T6JA 2ODRD 3ADJA 4DV3E 2HHHI 2X36A 1NHIA 4DV0E 4NXNI 4P7DA 1RC7A 4FWDA 4K0KI 2VQFE 4JI0I 4DR3I 2O1TA 1J5EE 4JI1E 4BBYA 5GMDA 1I94E 2IOQA 4M1KA 4JI4E 4LF6I 2GS8A 4DV6I 1FJGE 4F9AB 3FIGA 2UXCE 4USMA 3PYGA 3J7Yp 3Q6MA 5IT9C 4X66I 3F6GA 3KWRA 3CWVA 1FWKA 3ZZUA 4DUZI 2LTSA 2PNLA 4DPYA 2UUBE 4DR6E 1A6FA 4JI2I 1XHKA 2M4IA 1N36E 1S16A 1IBLE 2VQEI 4DV1I 4DR5E 1Z0WA 1Z5AA 2UUCI 3B8HA 2VQEE 4LFBI 2JWOA 3J81Q 1N32E 4M30A 4HY1A 1HNZI 4JYAI 4M2ZA 2UUBI 4X8WA 4PRVA 4FW9A 2LMZA 4LFCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3C A;  1MX0 A;  1WHN A;  3ZZ0 A;  4USK A;  5GME A;  4DV6 E;  2NUF A;  4LF9 E;  1WHQ A;  2J7K A;  5IWA E;  2ZM6 I;  4ED4 A;  3PYD A;  1Z0E A;  3D4J A;  1HNX I;  3J7A G;  2XEX A;  1KIJ A;  1ZM2 A;  2HHH E;  2RSM A;  1N0U A;  2NUG A;  5BR8 I;  4DV2 E;  3LPS A;  3Q1Q A;  2N3H A;  2DB2 A;  1XMQ E;  4LF7 E;  2DIX A;  2HFS A;  4LF6 E;  4LF4 E;  1YYW A;  1FNM A;  2UXD I;  4JI1 I;  5FLX C;  2L2M A;  2L2K B;  4LFA E;  1FI4 A;  3J81 C;  1HNX E;  2WW4 A;  2R3V A;  3HUL A;  2UXD E;  2HK2 A;  4LF4 I;  1B62 A;  1Z5B A;  2E5L E;  3OTO E;  2Q2E B;  1UIL A;  1XNQ I;  3C4B A;  1O0W A;  4X62 I;  2IHR 1;  2DEJ A;  5BR8 E;  4DUY I;  1XMO I;  4JYA E;  1ZM9 A;  4YHH E;  4DV7 E;  2UU9 I;  1ZM3 A;  4NXM I;  4DR5 I;  5FLX Q;  1Z5C A;  2UU9 E;  4DKK A;  2NUE A;  4DPT A;  1K47 A;  1MU5 A;  2ZIT A;  4MYT A;  1NHJ A;  4X66 E;  2CPN A;  4DPX A;  1HR0 I;  2LUP B;  1DI2 A;  2B7V A;  5LL6 R;  1HNZ E;  3ZM7 A;  2JY9 A;  1J5E I;  2OI2 A;  4OX9 I;  4LFB E;  4JI8 E;  1IBL I;  4DV0 I;  2LJH A;  2RTX A;  4B3R I;  2A2D A;  2UXB E;  4DPW A;  3K1J A;  4GKJ I;  1N33 I;  4GKK E;  1XNQ E;  1OJ4 A;  3T1H E;  1IBK E;  2NPF A;  4UT4 A;  4LF7 I;  1FWL A;  4JI6 E;  1FJG I;  1PKP A;  1YYO A;  1EI1 A;  1I94 I;  4R1F A;  3HTX A;  1RQ0 A;  4JI3 I;  3B82 A;  4FWG A;  3WU3 A;  1STU A;  4JI0 E;  2VQF I;  4LFA I;  4LF5 E;  3ADG A;  2E1R A;  4P52 A;  1Z0C A;  2V2V A;  4LF9 I;  5IT9 Q;  2HK3 A;  4WYQ B;  4DXL A;  1S4E A;  4JV5 E;  1QU6 A;  4LFC E;  2MDR A;  2V2Z A;  3JAM Q;  1N33 E;  4DV2 I;  3M6A A;  3QT7 A;  3P1X A;  4HXZ A;  4B3R E;  1N32 I;  1PIE A;  2UUC E;  4DR7 E;  2R42 A;  4FWH A;  4DV1 E;  1N36 I;  4AQY I;  1H74 A;  1X49 A;  2YT4 A;  2BV3 A;  5A2Q C;  1HR0 E;  2CZ9 A;  3V2U C;  2L3J A;  4DR2 I;  2LJP A;  2VF3 A;  4X65 E;  1ZM4 A;  5A2Q Q;  4DR3 E;  1KVK A;  1X47 A;  5LMU E;  3C4T A;  4DR7 I;  2AJ4 A;  4NXM E;  3QT5 A;  4JI2 E;  1IBM E;  3LTO A;  3GON A;  4DR6 I;  4DUY E;  1XMO E;  1Z0B A;  2EZ6 A;  1ZXN A;  1T4O A;  1MG7 A;  4DR4 I;  1PVG A;  4UTG A;  3JAM C;  3QT6 A;  2UXC I;  3OTO I;  1VIS A;  3J80 C;  2DMY A;  4JI4 I;  2LTR A;  3T1Y I;  4Z7C A;  4OOG C;  2L33 A;  4KHP E;  1RR9 A;  3LNU A;  1N0V C;  3PYE A;  2RS6 A;  1YZ9 A;  1XNR I;  2F4V E;  3B78 A;  1GQE A;  5CFF E;  3T1H I;  1XMQ I;  4LF8 E;  3WU4 A;  4GKK I;  4HAC B;  2UXB I;  4YY3 I;  1D6T A;  1T4N A;  1IBM I;  2UUA I;  2V2Q A;  1EKZ A;  4B3T I;  4OX9 E;  1QZR A;  1HNW E;  1Z0T A;  3WU5 A;  3J7A M;  4B3S I;  4DR2 E;  2V8P A;  1N34 E;  3ZKB A;  1H72 C;  4MYU A;  1B63 A;  4DR1 I;  1ZBT A;  2HKE A;  2B7T A;  1T4L B;  1Z0V A;  4DV5 E;  2LRS A;  2B3T B;  4B3T E;  2LUQ A;  4YHH I;  4DV7 I;  2UUA E;  3ZZT A;  1KTV A;  1Z59 A;  1YYK A;  4DR1 E;  4X62 E;  3WU6 A;  4DUZ E;  4B3M I;  4HAC A;  3V5R A;  1N34 I;  2V34 A;  1Z0G A;  3QT8 A;  2F4V I;  1FKA E;  3ADI A;  4AQY E;  4K0K E;  4NXN E;  1U2R A;  1ELO A;  4YY3 E;  2HFU A;  4JI3 E;  4X64 E;  4WUC A;  5LMN E;  4I3H A;  1IBK I;  2BM1 A;  1NZ0 A;  2BM0 A;  4B3M E;  5LMN I;  3J80 Q;  1ZXM A;  4X64 I;  3F0N A;  4JI7 I;  4LF5 I;  1H7S A;  4Z7Y A;  4WUD A;  4EMD A;  4ZVI A;  4KHP I;  4JI8 I;  4DV5 I;  3VYY A;  4JI5 I;  4DPU A;  1H73 A;  4DV4 I;  2ZM6 E;  5IWA I;  2HKJ A;  4JI6 I;  3ADL A;  2L2N A;  4B3S E;  2DEI A;  1H7U A;  1UHZ A;  4WFT A;  4GKJ E;  2N3G A;  1HNW I;  2ZBK B;  1DAR A;  4P7A A;  1BKN A;  5LMU I;  1EA6 A;  1RRE A;  1X48 A;  4HYM A;  5L3J A;  4WUB A;  4DU7 A;  1UEK A;  4KQV A;  4X65 I;  1KKH A;  1J26 A;  4DV4 E;  1XNR E;  4JI5 E;  1NHH A;  2X7I A;  3LLH A;  2LBS B;  2EFG A;  1WUU A;  3ZKD A;  4JI7 E;  2KHX A;  4DU8 A;  4DV3 I;  3PYF A;  3T1Y E;  2NA2 A;  4XTJ A;  4PRX A;  4LF8 I;  2JVA A;  4JV5 I;  4URL A;  2RS7 A;  2E5L I;  3VYX A;  3H4L A;  4DR4 E;  4JG4 A;  4FN5 A;  2A2C A;  4PU9 A;  4RPF A;  3ADJ A;  4DV3 E;  2HHH I;  2X36 A;  1NHI A;  4DV0 E;  4NXN I;  1RC7 A;  4FWD A;  4K0K I;  2VQF E;  4JI0 I;  4DR3 I;  1J5E E;  4JI1 E;  5GMD A;  1I94 E;  4LF6 I;  4M1K A;  4JI4 E;  2GS8 A;  4DV6 I;  1FJG E;  2UXC E;  4USM A;  3PYG A;  3J7Y p;  4X66 I;  5IT9 C;  3CWV A;  1FWK A;  3ZZU A;  4DUZ I;  2LTS A;  4DPY A;  2UUB E;  4DR6 E;  1A6F A;  4JI2 I;  1XHK A;  1S16 A;  1N36 E;  2VQE I;  1IBL E;  4DV1 I;  4DR5 E;  1Z0W A;  1Z5A A;  2UUC I;  3B8H A;  2VQE E;  4LFB I;  3J81 Q;  1N32 E;  4M30 A;  4HY1 A;  1HNZ I;  4JYA I;  4M2Z A;  2UUB I;  4X8W A;  4PRV A;  4FW9 A;  3K17 A;  4LFC I; 
#chains in the Genus database with same CATH topology
 2L3C A;  1MX0 A;  2EPL X;  1WHN A;  2BA0 D;  3ZZ0 A;  4USK A;  5GME A;  2L92 A;  3CDJ A;  4LOM A;  3VHT B;  4DV6 E;  2NUF A;  4LF9 E;  1WHQ A;  2J7K A;  5IWA E;  2ZM6 I;  2GO3 A;  2CTD A;  1YUJ A;  5IXM B;  4BMJ A;  2K7I A;  2R1F A;  4ED4 A;  3PYD A;  1MGT A;  2O3Z A;  1Z0E A;  3D4J A;  1HNX I;  2EL6 A;  3J7A G;  2XEX A;  4BA2 B;  2EOM A;  2YTF A;  4IZJ D;  1TF6 A;  1KIJ A;  1ZM2 A;  2HHH E;  2JEA B;  4BS9 A;  1OYP A;  2RSM A;  1N0U A;  2NUG A;  1Y4U A;  5BR8 I;  4U3D A;  2M1S A;  4DV2 E;  2O1V A;  3LPS A;  2F1D A;  4OZE A;  2N3H A;  2DB2 A;  2AE8 A;  3Q1Q A;  4MDT A;  1XMQ E;  5AAS A;  3ECR A;  4LF7 E;  4BA1 A;  2DIX A;  4Q28 A;  4R2P A;  2HFS A;  3K17 A;  4LF6 E;  4LF4 E;  1YYW A;  1FNM A;  2UXD I;  1ZBQ A;  2EN2 A;  4JI1 I;  4IFD F;  2HC5 A;  5FLX C;  4MLQ A;  2MKN A;  2PO1 A;  2L2M A;  2L2K B;  1A1I A;  2E72 A;  3KZY A;  4LFA E;  3J81 C;  5LLQ A;  3MSW A;  1HNX E;  4BHC A;  2L8T A;  1FI4 A;  3K85 A;  3PRY A;  2NN6 C;  2WW4 A;  2GLI A;  2R3V A;  3HUL A;  1ZU1 A;  2E1M A;  2UXD E;  5A6B A;  2HK2 A;  2EPZ A;  4LF4 I;  2Q8U A;  2PO2 A;  4QNK A;  3M85 G;  4WXD A;  1B62 A;  2C38 A;  1Z5B A;  2E5L E;  1P42 A;  3OTO E;  4BHB A;  2RPC A;  1UIL A;  1BBG A;  2Q2E B;  2V89 A;  1XNQ I;  5DNL A;  4OO1 A;  3C4B A;  1O0W A;  4RH8 A;  2O1W A;  4X62 I;  2IHR 1;  2DEJ A;  5BR8 E;  4DUY I;  3PS2 A;  4JYA E;  1XMO I;  2WZO A;  4LFC I;  1X6F A;  1ZM9 A;  3L7Z B;  1TF3 A;  4YHH E;  2EM3 A;  4DV7 E;  3IWB A;  3HJC A;  4AIM A;  1ZM3 A;  5JEA F;  3H09 A;  4DR5 I;  2UU9 I;  4NXM I;  4AM3 A;  5FLX Q;  1Z5C A;  2YPN A;  2UU9 E;  2J65 A;  3DD6 A;  5EKW A;  4DKK A;  2NUE A;  4DPT A;  1X6H A;  4FK5 C;  2YTP A;  3KZZ A;  2BBG A;  1K47 A;  2JR1 A;  3M85 D;  1MU5 A;  2H36 X;  2ZIT A;  4MYT A;  2V85 A;  2V86 A;  2YU5 A;  1NHJ A;  5FWK A;  2EPO A;  4MLV A;  4X66 E;  5DRO A;  2CPN A;  4DPX A;  1A1J A;  5DNY A;  1USU A;  5AE1 A;  1HR0 I;  2LUP B;  5A6B D;  1DI2 A;  2B7V A;  5LL6 R;  4OO1 B;  4HEI A;  4TUG A;  2EPK X;  1HNZ E;  3ZM7 A;  2JY9 A;  3C6K A;  1J5E I;  2C38 B;  2OI2 A;  4OX9 I;  5KL6 A;  4LFB E;  2Z5E A;  4JI8 E;  2C39 B;  2PO2 B;  4LU9 A;  5KL4 A;  2C37 A;  1IBL I;  4DV0 I;  2LJH A;  5C0X E;  2RTX A;  1Y60 A;  1KJK A;  4LCH A;  5DRR A;  4B3R I;  2A2D A;  4N3O A;  2UXB E;  4DPW A;  3K1J A;  4J3D A;  1BB8 A;  2EMF A;  4GKJ I;  2YTJ A;  4GKK E;  1N33 I;  3BID A;  3QG5 C;  1XNQ E;  1OJ4 A;  3T1H E;  1IBK E;  2NPF A;  4UT4 A;  2JOB A;  1ZAA C;  4LF7 I;  4IZK B;  1FWL A;  2EOJ A;  4JI6 E;  4WXC A;  2IES A;  4U3B A;  1FJG I;  1PKP A;  2EMH A;  1YYO A;  2YU8 A;  3BF2 A;  1EI1 A;  1I94 I;  4R1F A;  4IFD E;  3HTX A;  1RQ0 A;  4JI3 I;  2EMK A;  3M99 B;  2DLK A;  2EM0 A;  4GZN C;  4O24 A;  3B82 A;  4FWG A;  3WU3 A;  1STU A;  4JI0 E;  2VQF I;  4R8O A;  2EPC A;  3JTZ A;  4LFA I;  4WSP A;  3DJW A;  2GPI A;  2J7J A;  4LCF A;  4LF5 E;  2B9D A;  2JEA A;  3ADG A;  3F6H A;  2E1R A;  2ODR C;  4P52 A;  1Z0C A;  2V2V A;  2IOP A;  2EPP A;  2JXP A;  3BBG A;  4LF9 I;  2EN7 A;  5IT9 Q;  4ZYG A;  4WYQ B;  1UDQ A;  2HK3 A;  2EPX A;  4OO1 E;  2EM6 A;  1UDN A;  4DXL A;  2V8Q B;  4JV5 E;  2I9I A;  1S4E A;  2BR2 B;  4NBQ A;  1QU6 A;  3Q6N A;  4LFC E;  2MDR A;  2V2Z A;  2VQE I;  3EPH A;  2EPA A;  3JAM Q;  1N33 E;  4DV2 I;  2O1U A;  3M6A A;  3QT7 A;  5TSE A;  3P1X A;  3ZOQ B;  1YUI A;  4B3R E;  3L7Z A;  4HXZ A;  2EJ4 A;  1N32 I;  4IS1 C;  2RSI A;  2EOF A;  3MHS C;  1OYS A;  1PIE A;  2UUC E;  2EN1 A;  2YZT A;  4DR7 E;  2R42 A;  4TUI A;  4DV1 E;  4FWH A;  1N36 I;  2LJU A;  1PJQ A;  5K36 E;  4AQY I;  4IJD A;  1H74 A;  2JT2 A;  2PNM A;  2DRP A;  1X49 A;  2YT4 A;  2MDG A;  2BV3 A;  3HXL A;  2PO0 B;  5A2Q C;  1R6L A;  1HR0 E;  1GZ6 A;  3AV0 A;  4NHR A;  2DGC A;  2JPA A;  2CZ9 A;  3V2U C;  1QNT A;  5KL3 A;  2L3J A;  4DR2 I;  4M0V A;  2MKD A;  1HK7 A;  2LJP A;  2VF3 A;  4X65 E;  1ZM4 A;  2DSY A;  2NN6 A;  3HKM A;  5ELW A;  2CGE A;  2V83 A;  2EMZ A;  2WBU A;  2DLQ A;  4R2Q A;  2PO1 B;  2EM2 A;  5A2Q Q;  2VF1 A;  4DR3 E;  1AH5 A;  4I8O A;  1KVK A;  3IWD A;  1X47 A;  5LMU E;  2YSP A;  2LV2 A;  2ELY A;  3C4T A;  5C0X F;  4DR7 I;  2AJ4 A;  4NXM E;  3QT5 A;  4P78 A;  1A1H A;  4R2C A;  2GQ0 A;  2IER A;  4JI2 E;  1IBM E;  3LTO A;  2EMB A;  3GON A;  2ADR A;  4LPF A;  4DR6 I;  1NCS A;  4DUY E;  3TQM A;  1XMO E;  1Y4S A;  2EN3 A;  2EZ6 A;  1Z0B A;  5AC5 A;  1ZXN A;  1T4O A;  2YTG A;  1WRJ A;  2CSH A;  2EQ0 A;  1MG7 A;  4DR4 I;  1JK2 A;  2KON A;  1PVG A;  4UTG A;  2YSO A;  4FW5 A;  3JAM C;  4R2S A;  3QT6 A;  2UXC I;  3OTO I;  3BGH A;  1VIS A;  1A1F A;  4J8Z A;  3J80 C;  2DMY A;  4JI4 I;  3THN A;  4BA2 A;  3U1Y A;  2EOO A;  4FW4 A;  2LTR A;  2YTE A;  3T1Y I;  4Z7C A;  2ENA A;  5K36 B;  2PRT A;  4OOG C;  2I13 A;  1RMD A;  2L33 A;  4KHP E;  2WCC 3;  2EPM X;  1SFE A;  3LML A;  3HPZ A;  2L6M A;  2CT1 A;  1RR9 A;  1Y6Z A;  2VRD A;  1N0V C;  2RS6 A;  3DF6 A;  1YZ9 A;  2NN6 D;  3LNU A;  3PYE A;  1XNR I;  2F4V E;  2EOR A;  4OO1 F;  4MU4 A;  2GO4 A;  2EMC A;  3B78 A;  1GQE A;  2YTD A;  4FW3 A;  3U1K A;  1DQ3 A;  5CFF E;  2LT7 A;  3T1H I;  3M7N G;  1XMQ I;  2WBT A;  1WXR A;  4OO1 C;  4LF8 E;  2LE2 A;  2HJJ A;  2YWQ A;  2JEB B;  2M9A A;  3H1C A;  3WU4 A;  4GKK I;  4WX9 A;  2BR2 A;  4HAC B;  3P06 A;  2UXB I;  4YY3 I;  1D6T A;  1T4N A;  1IBM I;  2UUA I;  3M7N D;  2V2Q A;  1EKZ A;  2D9H A;  4B3T I;  1OYR A;  5AE3 A;  1EH8 A;  2Z5B A;  1PDA A;  4OX9 E;  5DRQ A;  1QZR A;  4IFD B;  4GEQ B;  1HNW E;  4BCA A;  1Z0T A;  3WU5 A;  2F8B A;  2YRH A;  1XXE A;  1G2F C;  3K6Q A;  5KL2 A;  4AID A;  3J7A M;  4B3S I;  3VK6 A;  2Z5C B;  4DR2 E;  1L4S A;  2EE8 A;  2V8P A;  2K4V A;  1N34 E;  3ZKB A;  1H72 C;  1EH6 A;  2NAB A;  2EOX A;  2EM5 A;  4MYU A;  1B63 A;  3EQ1 A;  4DR1 I;  2MC6 A;  1ZBT A;  2HKE A;  5AC4 A;  2B7T A;  2LCE A;  2V87 A;  1T4L B;  2WP8 A;  5JEA D;  5DNX A;  1Z0V A;  4DV5 E;  2LRS A;  1UN6 B;  1IQO A;  2B3T B;  4NZV A;  3EPJ A;  2LUQ A;  4B3T E;  2NN6 B;  4YHH I;  4DV7 I;  4QNJ A;  1NEI A;  2V88 A;  2UUA E;  3ZZT A;  1KTV A;  1Z59 A;  3GME A;  1YYK A;  3B4T A;  1RHY A;  3HQ1 A;  2C37 B;  4DR1 E;  1USV A;  4BA1 B;  1E3H A;  4X62 E;  2Z5C A;  4GQU A;  5A6K A;  4DUZ E;  3WU6 A;  4B3M I;  4HAC A;  4MU3 A;  3V5R A;  1N34 I;  1UDO A;  2V34 A;  1Z0G A;  4FW6 A;  2YTQ A;  3P3G A;  3QT8 A;  2EMG A;  1P47 A;  2F4V I;  2ENC A;  1DGC A;  1FKA E;  4RHB B;  1SR9 A;  3UK3 C;  2Z5B B;  2EMI A;  5C0X C;  1YHC A;  3ADI A;  4N4R B;  4AQY E;  4BC9 A;  4IFD D;  2A25 A;  2CVE A;  2VE7 C;  4K0K E;  3CDI A;  4NXN E;  2DMI A;  1U2R A;  2EPR A;  4OKG A;  1ELO A;  4YY3 E;  1A1G A;  2HFU A;  4JI3 E;  4X64 E;  4WUC A;  2EWL A;  5LMN E;  2EML A;  4MU0 A;  4I3H A;  1E3P A;  2FV4 B;  1T38 A;  3JU0 A;  1IBK I;  2JYA A;  4X9J A;  2BM1 A;  2EPU A;  1NZ0 A;  2BM0 A;  4B3M E;  5LMN I;  2EL5 A;  3J80 Q;  1ZXM A;  4X64 I;  2WBS A;  2BA1 D;  3F0N A;  4IZJ A;  4F54 A;  2EOZ A;  4JI7 I;  4KZS A;  4LF5 I;  3RMP A;  1UBD C;  1H7S A;  2CG9 A;  5IV8 B;  4WUD A;  4Z7Y A;  2YRK A;  4EMD A;  4ZVI A;  5K36 A;  1EH7 A;  4KHP I;  4JI8 I;  2EOE A;  4DV5 I;  1GTK A;  3MHH C;  3OML A;  3IWC A;  4BC7 A;  4IZK A;  5F3W A;  2EN6 A;  3VYY A;  2EOI A;  4JI5 I;  4DPU A;  1WJP A;  1H73 A;  4DV4 I;  4WPY A;  2ZM6 E;  5IWA I;  1VI7 A;  1X3C A;  4L8N A;  2HKJ A;  2JE6 A;  2YTI A;  2JE6 B;  2WP8 B;  4JI6 I;  3ADL A;  1Y5Y A;  2L2N A;  1PJT A;  2EN4 A;  2EMX A;  4Q35 B;  1X6E A;  4B3S E;  2DEI A;  1YPN A;  1H7U A;  2VES A;  1UHZ A;  4WFT A;  2MC5 A;  5JEA C;  4GKJ E;  2EM8 A;  2N3G A;  5JEA B;  2KOU A;  4OO1 D;  4O43 A;  1AAY A;  4MU1 A;  3EPK A;  5K36 C;  1HNW I;  2ELZ A;  4DMI A;  2EOQ A;  1MEY C;  2ZBK B;  4IZJ B;  2EOS A;  1YSA C;  3UHM A;  4O4K A;  4R2E A;  4ZYE A;  4R2R A;  1DAR A;  1BKN A;  4P7A A;  5K36 F;  4F9B B;  5A6J A;  2EM4 A;  5AE2 A;  2WNR B;  4ZYH A;  5A6A A;  1EA6 A;  1B69 A;  1RRE A;  5LMU I;  1X48 A;  4HYM A;  1KYQ A;  2EM9 A;  2PNZ A;  4IFD A;  1ZR9 A;  2JOX A;  3C6M A;  3EPL A;  5L3J A;  3HPS A;  4WUB A;  1TN9 A;  4DU7 A;  2G7H A;  1UEK A;  2EM7 A;  2FTX B;  4KQV A;  4X65 I;  5K36 D;  2GHF A;  4F6N A;  3AUZ A;  1F2I G;  2JEB A;  4IS9 A;  1KKH A;  1J26 A;  3PS3 A;  4HTG A;  2EQ3 A;  4DV4 E;  1XNR E;  2ENH A;  1A1L A;  4JI5 E;  5KL7 A;  3GCM A;  5C0X B;  4O5G A;  2EOH A;  2EQ1 A;  2BA0 G;  2FGG A;  2M7Q A;  2LO3 A;  1NHH A;  2EMY A;  3LLH A;  2LBS B;  1Z1B A;  2EP3 A;  2X7I A;  1JK1 A;  2EFG A;  1A1K A;  1WUU A;  3ZKD A;  5C0X A;  2PNZ B;  4IFD C;  5ADZ A;  4JI7 E;  2KHX A;  2WNR A;  4DU8 A;  4DV3 I;  3PYF A;  3T1Y E;  3KRN A;  4R03 A;  4MQY A;  2NA2 A;  4XTJ A;  4PRX A;  3P76 A;  2NN6 F;  5DRP A;  4M9V C;  4LF8 I;  2JVA A;  2R76 A;  2YTO A;  1N3G A;  4F9C B;  2EPN A;  4LF6 I;  4JV5 I;  4URL A;  1PJS A;  2RS7 A;  2YRM A;  4L5N C;  5KL5 A;  3VYX A;  1R6M A;  4DR4 E;  4KWY A;  3H4L A;  2E5L I;  4JG4 A;  4LTY A;  1LLM C;  4FN5 A;  2A2C A;  3NZK A;  4PU9 A;  4RPF A;  5T6J A;  2ODR D;  3ADJ A;  4DV3 E;  3PS1 A;  4FW7 A;  2N8X A;  2HHH I;  2X36 A;  1NHI A;  4DV0 E;  3GLL A;  3P3E A;  1IMU A;  4NXN I;  4P7D A;  1RC7 A;  4FWD A;  4K0K I;  2NN6 E;  2VQF E;  4JI0 I;  5JEA A;  1X5W A;  4WSG A;  2O1T A;  4DR3 I;  1J5E E;  4JI1 E;  4R2A A;  4BBY A;  2C39 A;  5GMD A;  1I94 E;  1G2D C;  2HGH A;  2IOQ A;  2JP9 A;  4JI4 E;  4R2D A;  2GS8 A;  4M1K A;  4ISA A;  1FJG E;  2RQL A;  1UDS A;  5C0X D;  4DV6 I;  4F9A B;  3FIG A;  2UXC E;  4USM A;  3PYG A;  1T39 A;  3J7Y p;  3Q6M A;  2YTN A;  3L00 A;  5IT9 C;  4X66 I;  3F6G A;  3KWR A;  4F6M A;  4F2J C;  3CWV A;  5EL9 A;  1FWK A;  3ZZU A;  4DUZ I;  2LTS A;  5JEA E;  2PNL A;  4DPY A;  2UUB E;  2BB8 A;  4DR6 E;  1A6F A;  5A69 A;  2BA1 G;  4JI2 I;  1XHK A;  1YH8 A;  2PO0 A;  2M4I A;  2EOY A;  1N36 E;  1IBL E;  1S16 A;  3P3C A;  4LCG A;  4DR5 E;  1Z0W A;  1Z5A A;  4DV1 I;  3B8H A;  2UUC I;  2VQE E;  4LFB I;  2JWO A;  3J81 Q;  1N32 E;  4M30 A;  4ZYD A;  4HY1 A;  1HNZ I;  4JYA I;  2LVH A;  4M2Z A;  1BBO A;  2UUB I;  4X8W A;  2EN8 A;  1YFH A;  1IQS A;  2EL4 A;  3THO B;  4PRV A;  4FW9 A;  2LMZ A;  2EMA A;  2EMW A; 
#chains in the Genus database with same CATH homology
 2L3C A;  1MX0 A;  1WHN A;  3ZZ0 A;  4USK A;  5GME A;  2L92 A;  4DV6 E;  2NUF A;  4LF9 E;  1WHQ A;  2J7K A;  5IWA E;  2ZM6 I;  4BMJ A;  4ED4 A;  3PYD A;  1Z0E A;  3D4J A;  1HNX I;  3J7A G;  2XEX A;  4IZJ D;  1KIJ A;  1ZM2 A;  2HHH E;  4BS9 A;  2RSM A;  1N0U A;  2NUG A;  1Y4U A;  5BR8 I;  2M1S A;  4DV2 E;  2O1V A;  3LPS A;  3Q1Q A;  2N3H A;  2DB2 A;  1XMQ E;  5AAS A;  4LF7 E;  2DIX A;  4Q28 A;  2HFS A;  3K17 A;  4LF6 E;  4LF4 E;  1YYW A;  1FNM A;  2UXD I;  1ZBQ A;  4JI1 I;  5FLX C;  2L2M A;  2L2K B;  4LFA E;  3J81 C;  1FI4 A;  3MSW A;  1HNX E;  3K85 A;  2L8T A;  3PRY A;  2WW4 A;  2R3V A;  3HUL A;  2E1M A;  2UXD E;  2HK2 A;  4LF4 I;  1B62 A;  1Z5B A;  2E5L E;  3OTO E;  2Q2E B;  1UIL A;  2V89 A;  1XNQ I;  3C4B A;  1O0W A;  4X62 I;  2O1W A;  2IHR 1;  2DEJ A;  5BR8 E;  4DUY I;  1XMO I;  4JYA E;  2WZO A;  1ZM9 A;  4YHH E;  4DV7 E;  3IWB A;  3HJC A;  2UU9 I;  1ZM3 A;  4NXM I;  3H09 A;  4DR5 I;  5FLX Q;  1Z5C A;  2UU9 E;  4DKK A;  2NUE A;  4DPT A;  1K47 A;  2JR1 A;  1MU5 A;  2H36 X;  2ZIT A;  4MYT A;  2V85 A;  2V86 A;  5FWK A;  1NHJ A;  4X66 E;  2CPN A;  4DPX A;  5DNY A;  1USU A;  5AE1 A;  1HR0 I;  2LUP B;  1DI2 A;  2B7V A;  5LL6 R;  4TUG A;  1HNZ E;  3ZM7 A;  2JY9 A;  1J5E I;  2OI2 A;  4OX9 I;  4LFB E;  2Z5E A;  4JI8 E;  4LU9 A;  1IBL I;  4DV0 I;  2LJH A;  2RTX A;  4B3R I;  2A2D A;  4N3O A;  2UXB E;  4DPW A;  3K1J A;  4GKJ I;  1N33 I;  4GKK E;  1XNQ E;  1OJ4 A;  3T1H E;  1IBK E;  2NPF A;  4UT4 A;  2JOB A;  4LF7 I;  4IZK B;  1FWL A;  4JI6 E;  1FJG I;  1PKP A;  1YYO A;  1EI1 A;  1I94 I;  4R1F A;  3HTX A;  1RQ0 A;  4JI3 I;  3B82 A;  4FWG A;  3WU3 A;  1STU A;  4JI0 E;  2VQF I;  4R8O A;  3JTZ A;  4LFA I;  4WSP A;  3DJW A;  4LF5 E;  2B9D A;  3ADG A;  3F6H A;  2E1R A;  2ODR C;  4P52 A;  1Z0C A;  2V2V A;  2IOP A;  4LF9 I;  5IT9 Q;  2HK3 A;  4WYQ B;  4DXL A;  2V8Q B;  4JV5 E;  1S4E A;  1QU6 A;  3Q6N A;  4LFC E;  2MDR A;  2V2Z A;  3JAM Q;  1N33 E;  4DV2 I;  2O1U A;  3M6A A;  3QT7 A;  3P1X A;  3ZOQ B;  4HXZ A;  4B3R E;  1N32 I;  1PIE A;  2UUC E;  2YZT A;  4DR7 E;  2R42 A;  4FWH A;  4TUI A;  4DV1 E;  1N36 I;  4AQY I;  1H74 A;  2PNM A;  1X49 A;  2YT4 A;  2BV3 A;  3HXL A;  5A2Q C;  1HR0 E;  1GZ6 A;  3AV0 A;  2CZ9 A;  3V2U C;  2L3J A;  4DR2 I;  4M0V A;  2LJP A;  1HK7 A;  2VF3 A;  4X65 E;  1ZM4 A;  2DSY A;  2CGE A;  2V83 A;  5A2Q Q;  2VF1 A;  4DR3 E;  4I8O A;  1KVK A;  3IWD A;  1X47 A;  5LMU E;  3C4T A;  4DR7 I;  2AJ4 A;  4NXM E;  3QT5 A;  4P78 A;  2GQ0 A;  4JI2 E;  1IBM E;  3LTO A;  3GON A;  4DR6 I;  4DUY E;  1XMO E;  1Z0B A;  1Y4S A;  2EZ6 A;  1ZXN A;  1T4O A;  1MG7 A;  4DR4 I;  2KON A;  1PVG A;  4UTG A;  3JAM C;  3QT6 A;  2UXC I;  3OTO I;  1VIS A;  4J8Z A;  3J80 C;  2DMY A;  4JI4 I;  2LTR A;  3T1Y I;  4Z7C A;  4OOG C;  2L33 A;  4KHP E;  3LML A;  3HPZ A;  2L6M A;  1RR9 A;  1Y6Z A;  1N0V C;  3LNU A;  2RS6 A;  3DF6 A;  1YZ9 A;  3PYE A;  1XNR I;  2F4V E;  3B78 A;  1GQE A;  1DQ3 A;  5CFF E;  3T1H I;  1XMQ I;  1WXR A;  4LF8 E;  2LE2 A;  3WU4 A;  4GKK I;  4HAC B;  3P06 A;  2UXB I;  4YY3 I;  1D6T A;  1T4N A;  1IBM I;  2UUA I;  2V2Q A;  1EKZ A;  4B3T I;  5AE3 A;  2Z5B A;  4OX9 E;  1QZR A;  4GEQ B;  1HNW E;  4BCA A;  1Z0T A;  3WU5 A;  2F8B A;  3K6Q A;  3J7A M;  4B3S I;  3VK6 A;  2Z5C B;  4DR2 E;  2V8P A;  2K4V A;  1N34 E;  3ZKB A;  1H72 C;  4MYU A;  1B63 A;  4DR1 I;  2MC6 A;  1ZBT A;  2HKE A;  2B7T A;  2V87 A;  1T4L B;  1Z0V A;  4DV5 E;  2LRS A;  2B3T B;  4B3T E;  2LUQ A;  4YHH I;  4DV7 I;  2V88 A;  2UUA E;  3ZZT A;  1KTV A;  1Z59 A;  1YYK A;  3HQ1 A;  4DR1 E;  1USV A;  4X62 E;  2Z5C A;  3WU6 A;  4DUZ E;  4B3M I;  4HAC A;  3V5R A;  1N34 I;  2V34 A;  1Z0G A;  3QT8 A;  2F4V I;  1FKA E;  1SR9 A;  2Z5B B;  3ADI A;  4AQY E;  4BC9 A;  2VE7 C;  4K0K E;  4NXN E;  1U2R A;  1ELO A;  4YY3 E;  2HFU A;  4JI3 E;  4X64 E;  4WUC A;  2EWL A;  5LMN E;  4I3H A;  2FV4 B;  3JU0 A;  1IBK I;  2BM1 A;  1NZ0 A;  2BM0 A;  4B3M E;  5LMN I;  3J80 Q;  1ZXM A;  4X64 I;  3F0N A;  4IZJ A;  4F54 A;  4JI7 I;  4KZS A;  4LF5 I;  3RMP A;  1H7S A;  2CG9 A;  4Z7Y A;  4WUD A;  4EMD A;  4ZVI A;  4KHP I;  4JI8 I;  4DV5 I;  3OML A;  3IWC A;  4BC7 A;  4IZK A;  5F3W A;  3VYY A;  4JI5 I;  4DPU A;  1H73 A;  4DV4 I;  4WPY A;  2ZM6 E;  5IWA I;  2HKJ A;  4L8N A;  4JI6 I;  3ADL A;  2L2N A;  4B3S E;  2DEI A;  1H7U A;  1UHZ A;  4WFT A;  2MC5 A;  4GKJ E;  2N3G A;  2KOU A;  1HNW I;  4DMI A;  2ZBK B;  4IZJ B;  1DAR A;  4P7A A;  1BKN A;  4F9B B;  5AE2 A;  5LMU I;  1EA6 A;  1RRE A;  1X48 A;  4HYM A;  2JOX A;  5L3J A;  3HPS A;  4WUB A;  4DU7 A;  2G7H A;  1UEK A;  2FTX B;  4KQV A;  4X65 I;  3AUZ A;  1KKH A;  1J26 A;  4DV4 E;  1XNR E;  4JI5 E;  2FGG A;  2M7Q A;  1NHH A;  2X7I A;  3LLH A;  2LBS B;  2EFG A;  1WUU A;  3ZKD A;  5ADZ A;  4JI7 E;  2KHX A;  4DU8 A;  4DV3 I;  3PYF A;  3T1Y E;  4R03 A;  2NA2 A;  4XTJ A;  4PRX A;  4LF8 I;  2JVA A;  4F9C B;  4JV5 I;  4URL A;  2RS7 A;  2E5L I;  4L5N C;  3VYX A;  3H4L A;  4DR4 E;  4JG4 A;  4LTY A;  4FN5 A;  2A2C A;  4PU9 A;  4RPF A;  5T6J A;  2ODR D;  3ADJ A;  4DV3 E;  2HHH I;  2X36 A;  1NHI A;  4DV0 E;  4NXN I;  4P7D A;  1RC7 A;  4FWD A;  4K0K I;  2VQF E;  4JI0 I;  4DR3 I;  2O1T A;  1J5E E;  4JI1 E;  4BBY A;  5GMD A;  1I94 E;  2IOQ A;  4M1K A;  4JI4 E;  4LF6 I;  2GS8 A;  4DV6 I;  1FJG E;  4F9A B;  3FIG A;  2UXC E;  4USM A;  3PYG A;  3J7Y p;  3Q6M A;  5IT9 C;  4X66 I;  3F6G A;  3KWR A;  3CWV A;  1FWK A;  3ZZU A;  4DUZ I;  2LTS A;  2PNL A;  4DPY A;  2UUB E;  4DR6 E;  1A6F A;  4JI2 I;  1XHK A;  2M4I A;  1N36 E;  1S16 A;  1IBL E;  2VQE I;  4DV1 I;  4DR5 E;  1Z0W A;  1Z5A A;  2UUC I;  3B8H A;  2VQE E;  4LFB I;  2JWO A;  3J81 Q;  1N32 E;  4M30 A;  4HY1 A;  1HNZ I;  4JYA I;  4M2Z A;  2UUB I;  4X8W A;  4PRV A;  4FW9 A;  2LMZ A;  4LFC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...