4DR4E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr4E02
4DR4I 4JI6I 4XTJA 1XMQE 3LLHA 5FLXQ 4JI0E 4DV0E 2RSMA 3ADJA 2E5LE 1Z5BA 4DR6E 4JI3I 4LF4E 2NA2A 4JI8I 2L3CA 3VYXA 4DUZI 4WUBA 4AQYE 1WUUA 1N36I 2BM0A 1NHIA 3WU4A 4JI4E 1WHQA 1X48A 2ZM6I 4YHHE 4DV0I 4M2ZA 2E5LI 2MDRA 4DR6I 4LF4I 4HY1A 4KHPE 3M6AA 1H74A 1N0UA 4X64E 2ZITA 2XEXA 2UXCE 1FWKA 4DR2E 1RR9A 1DARA 3B82A 1XNQI 3PYFA 1GQEA 1WHNA 4JI5I 4EMDA 1X47A 2HHHE 4DV1E 4DPXA 2UUAE 1K47A 4KHPI 5LMUE 2N3GA 2RS7A 2L2KB 1FI4A 4P7AA 2UXCI 3J81Q 4DR2I 1HNZE 2N3HA 4DKKA 1ZBTA 4DR3E 2E1RA 4DV1I 4B3MI 4LF7E 4M30A 4X62I 2LUQA 3ZZUA 5LMUI 1Z0BA 4URLA 3ZKDA 5A2QQ 2DEIA 4JYAE 2NPFA 4LFAI 4GKKE 4FWGA 4I3HA 4YY3I 1BKNA 3LNUA 4HYMA 1ZXMA 4WYQB 4PRVA 2NUFA 2L33A 1UHZA 4ED4A 1KTVA 1PVGA 2V2QA 2HKJA 1FNMA 4DUYE 4WUDA 1S4EA 3JAMQ 2LRSA 4JI6E 2KHXA 4JYAI 3PYGA 4GKKI 2WW4A 2B7TA 4JI3E 2HK3A 1N34I 4DPYA 3K1JA 3T1HE 4FWHA 1N32E 4DUZE 4ZVIA 2UXDI 1VISA 2Q2EB 3J7AM 2EZ6A 1QU6A 1IBLI 4DUYI 4NXNI 1H7SA 1N36E 3QT5A 2NUGA 3J80Q 1XNRI 1Z5CA 2ZM6E 1A6FA 2VQFI 1Z0EA 2NUEA 4DV6I 4DV3I 2BM1A 3WU3A 3T1HI 1N32I 4DR7I 2OI2A 1H7UA 4DV2E 2R3VA 3D4JA 2V8PA 2UUBI 4K0KE 5FLXC 1XNQE 1KVKA 3OTOE 4JI5E 4JI2E 2CPNA 4B3RI 2IHR1 1RC7A 1IBMI 2X36A 3GONA 4DPUA 1XMOI 2DMYA 1D6TA 2V2ZA 4DV2I 4MYUA 5LL6R 2CZ9A 1ZM3A 1IBKI 1Z0WA 2LBSB 4JG4A 2HFSA 3HULA 4K0KI 3OTOI 1RREA 4GKJE 4JI2I 2V34A 3LTOA 4B3ME 2DEJA 4X62E 1U2RA 4HACB 2L2NA 4USKA 4DV4E 2L2MA 2UU9I 1ZM4A 3LPSA 4X66I 4USMA 4LFBE 4LFAE 3QT7A 1UILA 4R1FA 4YY3E 1HNXI 2UXBI 4GKJI 2DB2A 1MU5A 1STUA 1H72C 4LF8I 1EI1A 5IT9Q 1YZ9A 4DV7E 4X8WA 3QT8A 4DXLA 4DV4I 1HNWI 3J81C 1J5EE 4LFBI 2V2VA 3H4LA 1FWLA 4JI1I 5CFFE 1N34E 3CWVA 4OOGC 3P1XA 1T4NA 3V5RA 3WU5A 2UXDE 2GS8A 4DV7I 1IBLE 2LTSA 4NXNE 2X7IA 2R42A 4PRXA 3ADLA 2ZBKB 1OJ4A 1RQ0A 1XNRE 1J5EI 1YYOA 4WFTA 4MYTA 3Q1QA 2B7VA 3VYYA 2VQFE 4DV5I 4HACA 4DV6E 4DV3E 1O0WA 4DR7E 4FWDA 4JV5E 3T1YI 2HK2A 1T4LB 1S16A 5BR8E 5GMEA 1MX0A 2UUBE 3JAMC 1B63A 3ZZ0A 1FKAE 3ZM7A 3ZZTA 3C4BA 1XHKA 1QZRA 2JY9A 3QT6A 4DR5I 1EKZA 4B3RE 4P52A 2LTRA 1X49A 2YT4A 1IBME 1XMOE 1I94E 1ZXNA 4JV5I 4WUCA 1N33I 1YYKA 5BR8I 1IBKE 2F4VE 1UEKA 4LFCE 2VQEI 3J80C 5L3JA 1B62A 1H73A 3B78A 2B3TB 1T4OA 1ELOA 4LF9I 2A2DA 4OX9I 1NZ0A 1I94I 2HFUA 4UTGA 4M1KA 2UU9E 2F4VI 1Z59A 4X66E 1Z0GA 4LFCI 1XMQI 4NXME 1NHHA 3C4TA 2UXBE 4JI0I 1HNXE 4X65E 2L3JA 4Z7YA 4JI7E 1Z5AA 5GMDA 2VF3A 4LF8E 5IWAE 1HR0E 4AQYI 3PYDA 1J26A 4PU9A 1N0VC 1HNWE 4JI4I 4NXMI 1ZM2A 4YHHI 4DPTA 4JI1E 4X65I 4JI7I 2JVAA 3J7Yp 5IWAI 4LF6E 1YYWA 4Z7CA 3ZKBA 1HR0I 4X64I 5LMNE 1KKHA 4FW9A 1FJGE 2LJHA 4HXZA 4DV5E 2RTXA 2RS6A 2LUPB 2HHHI 2UUAI 4LF5E 5IT9C 2HKEA 1Z0CA 3K17A 4LF6I 3HTXA 3T1YE 4RPFA 4B3TE 1PIEA 5LMNI 3J7AG 3ADIA 4DU7A 5A2QC 3F0NA 1FJGI 4FN5A 4DR1E 3B8HA 2EFGA 1ZM9A 1Z0TA 1HNZI 1DI2A 4B3SE 4DR5E 1EA6A 4DR3I 1Z0VA 2AJ4A 2A2CA 3V2UC 4LF5I 2LJPA 4LF7I 4UT4A 2UUCE 3PYEA 1N33E 1KIJA 3WU6A 4B3TI 2DIXA 4DR4E 2VQEE 4DR1I 4DU8A 2BV3A 1NHJA 4B3SI 1MG7A 4LF9E 4JI8E 1PKPA 4OX9E 3ADGA 2J7KA 4DPWA 2UUCI 4KQVA
chains in the Genus database with same CATH superfamily
3M85D 2EOYA 4LCFA 4DR4I 4JI6I 4XTJA 2M9AA 1X3CA 1XMQE 2JYAA 2L92A 3Q6NA 2EPRA 3LLHA 4R2CA 4F9AB 5FLXQ 4JI0E 2JXPA 3VK6A 2VE7C 4DV0E 1A1JA 2RSMA 2EQ1A 3ADJA 2E5LE 1JK1A 4DR6E 3BF2A 2EOZA 1Y4SA 1Z5BA 4JI3I 4LF4E 2NN6E 2NA2A 4Q28A 4JI8I 4OO1B 5K36B 2PNZA 2JOXA 2JEAB 2PO1B 3ECRA 2JT2A 2WBSA 2PO2A 2L3CA 2BB8A 3VYXA 4DUZI 1RHYA 4IZJA 5A6AA 2RPCA 1BBOA 2O3ZA 4IFDA 4WUBA 2CSHA 2EOXA 4AQYE 1WUUA 4LOMA 4BHBA 1MEYC 4IZKA 5JEAC 2EQ0A 1N36I 2BM0A 2J7JA 2R1FA 1NHIA 3WU4A 2M1SA 1R6MA 2EWLA 4JI4E 4OO1D 1WHQA 3MHSC 1X48A 2CTDA 3M99B 4MU0A 2EOQA 4YHHE 2ZM6I 4NZVA 3AV0A 5A6JA 4M2ZA 4QNKA 4U3DA 4DV0I 2MDRA 4J3DA 2E5LI 2EPPA 4DR6I 2GHFA 4LF4I 2JP9A 1X6FA 4HY1A 4KHPE 2JE6B 3M6AA 2I9IA 4BHCA 1ZBQA 1H74A 1N0UA 2WP8B 4X64E 2ZITA 4OKGA 2XEXA 2DGCA 2JEBB 1OYSA 2O1VA 2EOEA 3F6HA 2EN1A 4J8ZA 2UXCE 1FWKA 1BB8A 1PJSA 4DR2E 1DARA 1RR9A 5ELWA 1YSAC 3B82A 1XNQI 2YTPA 2CVEA 2Z5BB 3Q6MA 2H36X 1P47A 1GQEA 1WHNA 1KYQA 5ADZA 3PYFA 4EMDA 1X47A 4JI5I 4IS1C 2HHHE 5DNYA 2BBGA 4ZYDA 4DV1E 1UDQA 4DPXA 2UUAE 1K47A 4KHPI 4F2JC 3GLLA 2VF1A 3P76A 3EPJA 2E72A 2YTNA 3THNA 5LMUE 2N3GA 2RS7A 2L2KB 1FI4A 3GCMA 4BS9A 3PS3A 4P7AA 2C37B 3IWBA 4NHRA 2UXCI 2EMKA 2LCEA 4OO1A 3J81Q 4DR2I 1HNZE 2EM3A 2JEAA 2N3HA 2PO1A 2MC6A 2LMZA 4F6NA 5K36E 1GZ6A 4AIDA 4DKKA 5C0XD 1ZBTA 4AM3A 4DR3E 4HEIA 4P78A 2E1RA 5AE2A 4DV1I 4F9BB 4B3MI 4LF7E 4M30A 4RH8A 2WNRB 4X62I 2LUQA 2DLQA 4U3BA 3ZZUA 2KONA 4MLQA 5LMUI 2YRKA 2EPZA 1Z0BA 5EKWA 1YUIA 1NCSA 4URLA 4IZJB 3ZKDA 5A2QQ 2EPOA 2DEIA 2EE8A 2CG9A 4JYAE 2NPFA 2B9DA 4LFAI 2Z5CB 4GKKE 4FWGA 4I3HA 4YY3I 1BKNA 3LNUA 2JE6A 4HYMA 4IZKB 2WP8A 2EJ4A 1ZXMA 3EPLA 5KL4A 2IOQA 3L00A 4WYQB 3M7ND 3KZZA 2K4VA 4PRVA 1A1IA 1Y6ZA 2NUFA 2EMGA 2L33A 5C0XC 1UHZA 4ED4A 2EL4A 2GPIA 1KTVA 2BA0D 2Z5BA 1PVGA 2V2QA 2HKJA 1FNMA 4DUYE 4WUDA 1IQOA 5JEAB 1S4EA 3JAMQ 2LRSA 4JI6E 2EMBA 2EM0A 3UK3C 2KHXA 4JYAI 1UN6B 3PYGA 4GKKI 2ODRC 2A25A 2WW4A 5C0XA 2YTOA 1YPNA 2B7TA 4JI3E 2EMHA 2EMWA 2HK3A 5EL9A 1N34I 5FWKA 4DPYA 5AC5A 2EMLA 2LV2A 3K1JA 3T1HE 4FWHA 1N32E 1A1LA 3U1KA 4ISAA 2K7IA 4DUZE 2C37A 4ZVIA 5JEAD 4MQYA 2UXDI 1L4SA 4L5NC 1VISA 2F1DA 3M85G 4TUIA 2Q2EB 2EM2A 1EH7A 3RMPA 2EL5A 3J7AM 2EZ6A 1QU6A 1IBLI 2EM8A 4DUYI 4NXNI 1H7SA 2YTGA 1N36E 2ENAA 3QT5A 2NUGA 1AH5A 2N8XA 5A69A 3J80Q 2LO3A 1XNRI 2ENHA 1Z5CA 2ZM6E 3BGHA 1A6FA 2WNRA 4ZYGA 3UHMA 2V89A 3H09A 4R2AA 2NUEA 1E3HA 1Z0EA 2VQFI 2EM5A 2EP3A 3HQ1A 1IQSA 4DV6I 4DV3I 1EH6A 2BM1A 3WU3A 4IJDA 3T1HI 4O24A 1N32I 3GMEA 4DR7I 5DNXA 2OI2A 3QG5C 2EOMA 1H7UA 4DV2E 2Z5CA 4IFDE 2R3VA 3D4JA 5AASA 2DSYA 2V8PA 2UUBI 4HTGA 1TF3A 4ZYHA 2D9HA 4ZYEA 3EPKA 5FLXC 2EPKX 4K0KE 1XNQE 1KVKA 3OTOE 2FV4B 4JI5E 4JI2E 2EL6A 5A6KA 2CPNA 2WCC3 2I13A 4DMIA 2IHR1 2PNMA 4B3RI 1TN9A 2LVHA 5LLQA 2YTIA 1RC7A 5JEAA 3PS2A 2X36A 2YTJA 1A1KA 1OYRA 2NN6F 3GONA 4DPUA 1XMOI 4FW5A 2DMYA 5JEAE 5DNLA 1QNTA 1D6TA 2VESA 5AC4A 2V2ZA 4DV2I 2ENCA 5LL6R 4MYUA 2ELYA 1ZM3A 2CZ9A 1Z0WA 1IBKI 2LBSB 2V83A 4KWYA 4JG4A 1T38A 2HFSA 3HULA 3P06A 4IFDF 1BBGA 4K0KI 3HPZA 1Y4UA 1YHCA 3OTOI 2IESA 2CT1A 1RREA 4GKJE 4WXDA 4JI2I 3P3GA 2V34A 1DQ3A 4MU3A 1A1FA 3LTOA 1G2FC 2MKNA 4B3ME 2DEJA 2GO4A 5KL6A 4X62E 1U2RA 5F3WA 5C0XB 1IBMI 4HACB 2L2NA 2EN3A 4WX9A 4USKA 2R76A 2YU5A 4NBQA 4DV4E 2L2MA 2UU9I 1ZM4A 3LPSA 4X66I 4USMA 1YUJA 4LFBE 4LFAE 3QT7A 2Q8UA 1UILA 4R1FA 4YY3E 1UDOA 1HNXI 4OO1E 4GKJI 2UXBI 2L8TA 3HPSA 2DB2A 1MU5A 1STUA 2O1TA 3K85A 2YSPA 1H72C 2MC5A 4LF8I 4O43A 1EI1A 3HXLA 5IXMB 5IT9Q 1YZ9A 2O1UA 4DV7E 2BA1G 1OYPA 1F2IG 2ODRD 4FW4A 4X8WA 4BCAA 5KL3A 2EPLX 2J65A 3DD6A 3P3CA 3CDJA 4BMJA 3QT8A 1TF6A 4DXLA 4DV4I 2F8BA 3KWRA 1HNWI 3J81C 3LMLA 4FW3A 2EPMX 1J5EE 1USVA 2V2VA 1ZR9A 5DRPA 4LFBI 4R2RA 3H4LA 1LLMC 1FWLA 3M7NG 4LU9A 4JI1I 1PJQA 5CFFE 1N34E 4OOGC 3CWVA 4OO1F 2PO0A 2EM4A 2YRHA 5K36F 2YTFA 3P1XA 1T4NA 2YPNA 1P42A 1Y60A 3V5RA 4MU1A 3WU5A 5AE3A 2UXDE 2GS8A 1E3PA 4DV7I 4WSGA 2IOPA 2Z5EA 1IBLE 2LTSA 1T39A 3BBGA 3IWDA 4NXNE 2X7IA 3DF6A 2YTEA 2R42A 4PRXA 3ADLA 2EPNA 2ZBKB 3DJWA 4WPYA 1OJ4A 1RQ0A 2C39B 1XNRE 4LCHA 1J5EI 2JPAA 4GZNC 3C6MA 4WFTA 1YYOA 4GQUA 4MYTA 3Q1QA 2B7VA 3VYYA 2VQFE 4DV5I 2NN6D 2EN2A 2EMZA 2V85A 2EN8A 4HACA 5C0XE 5DRQA 4DV6E 4DV3E 2EN6A 2EPUA 1O0WA 4DR7E 4FWDA 2DMIA 4JV5E 3T1YI 4WXCA 4BC7A 1N3GA 2RQLA 2HK2A 1YH8A 2O1WA 1T4LB 1X6EA 2EPAA 5BR8E 1S16A 5GMEA 2VRDA 2WZOA 1MX0A 3JAMC 5A6BD 2UUBE 4KZSA 2EORA 2DRPA 1UDSA 1JK2A 1B63A 3ZZ0A 5DROA 1FKAE 3ZM7A 3ZZTA 3C4BA 2FTXB 4IS9A 1XHKA 1QZRA 4F6MA 2JY9A 3QT6A 2JOBA 1EKZA 2YWQA 2WBUA 3TQMA 4B3RE 4P52A 2LTRA 4F9CB 4DR5I 1X49A 2YT4A 1IBME 1XMOE 2NABA 2LE2A 3JTZA 1I94E 2NN6C 4FW7A 1ZXNA 1USUA 4JV5I 4MDTA 2EQ3A 1Z1BA 2C38A 2GQ0A 4WUCA 1YYKA 1SFEA 1N33I 2EMCA 4L8NA 5BR8I 2RSIA 3MHHC 2EMIA 1IBKE 2F4VE 2EM6A 4TUGA 1UEKA 2YRMA 2EM7A 4LFCE 2VQEI 1A1HA 3J80C 4IFDC 5L3JA 1B62A 1H73A 1WJPA 4BC9A 3B78A 2B3TB 2NN6A 1T4OA 2YTQA 1ELOA 3BIDA 1GTKA 4LF9I 2A2DA 1PJTA 4BA2B 4OX9I 4MLVA 4M0VA 3HKMA 1NZ0A 1I94I 2HFUA 2C39A 4UTGA 2PO0B 1B69A 4M1KA 2LJUA 3L7ZB 4BA1A 2EOJA 4F54A 5A6BA 1ZU1A 2UU9E 2F4VI 4R2SA 1Z59A 3ZOQB 4X66E 3C6KA 1A1GA 1Z0GA 1RMDA 4LFCI 1XMQI 4NXME 5K36D 1NHHA 3C4TA 2UXBE 4JI0I 1HNXE 2ADRA 4X65E 2L3JA 4Z7YA 4JI7E 1Z5AA 4O4KA 3P3EA 5GMDA 2AE8A 2EOOA 2VF3A 4LF8E 5IWAE 1G2DC 1HR0E 4R03A 2EM9A 3PRYA 1KJKA 3F6GA 4R2DA 4AQYI 5JEAF 3PYDA 1J26A 2FGGA 4GEQB 4PU9A 3IWCA 1HNWE 1N0VC 3MSWA 5AE1A 2EOSA 4JI4I 4NXMI 5IV8B 2V87A 2YU8A 1ZM2A 2GO3A 4YHHI 2KOUA 3OMLA 4DPTA 3EQ1A 4JI1E 4AIMA 3K6QA 4X65I 2CGEA 1MGTA 3PS1A 2JWOA 1AAYA 2WBTA 4JI7I 2G7HA 2BR2A 2EMYA 1X6HA 2JVAA 4OO1C 3J7Yp 1PDAA 4QNJA 5K36C 5KL2A 5IWAI 4LF6E 2EMXA 1YYWA 4Z7CA 1Y5YA 3ZKBA 4R2EA 1HR0I 5TSEA 4LCGA 4X64I 5LMNE 1X5WA 1KKHA 4FW9A 3B4TA 2YTDA 2DLKA 4FW6A 3JU0A 2HC5A 2HJJA 2E1MA 2EMAA 1FJGE 4R2PA 5K36A 4BA2A 5KL7A 2LJHA 2C38B 4HXZA 4LTYA 1WXRA 4DV5E 2RTXA 2RS6A 2GLIA 2LUPB 2HHHI 2EOFA 4N3OA 3L7ZA 1WRJA 4O5GA 2EN7A 1UDNA 4LF5E 2BA0G 5IT9C 2UUAI 1Z0CA 2HKEA 3K17A 2ELZA 2NN6B 4LF6I 3HTXA 3T1YE 4M9VC 1VI7A 3NZKA 4RPFA 3U1YA 4B3TE 1PIEA 5LMNI 3J7AG 2PNZB 3H1CA 3VHTB 2YZTA 2EN4A 3ADIA 2PO2B 4FK5C 2MDGA 4DU7A 2PNLA 5A2QC 2BA1D 3F0NA 4N4RB 4R2QA 4IFDB 3KRNA 4FN5A 1FJGI 4DR1E 2EFGA 3B8HA 1Z0TA 1ZM9A 3HJCA 1HNZI 2EOHA 1DI2A 4BA1B 2EPXA 3EPHA 2JR1A 2EOIA 4DR5E 4B3SE 1EA6A 5DRRA 4DR3I 1Z0VA 2AJ4A 1UBDC 1HK7A 2JEBA 2A2CA 3V2UC 4LF5I 2LJPA 4LF7I 2YSOA 4R8OA 4LPFA 2IERA 4UT4A 5T6JA 4IZJD 2UUCE 3PYEA 4IFDD 1N33E 1KIJA 3WU6A 4B3TI 3AUZA 4Q35B 3THOB 1ZAAC 2PRTA 1XXEA 1R6LA 4X9JA 2DIXA 4WSPA 2HGHA 4DR4E 5KL5A 2VQEE 4MU4A 2M7QA 1DGCA 2EMFA 4DR1I 2MKDA 3FIGA 1YFHA 4DU8A 2BV3A 3CDIA 2LT7A 1NEIA 2V86A 1NHJA 4B3SI 4I8OA 1MG7A 1EH8A 2V88A 2L6MA 4JI8E 4LF9E 1PKPA 2V8QB 4OX9E 4OZEA 4P7DA 5C0XF 2EPCA 3ADGA 2J7KA 4DPWA 4RHBB 3KZYA 1IMUA 2M4IA 2UUCI 2BR2B 1SR9A 4BBYA 4KQVA
chains in the Genus database with same CATH topology
4DR4I 4JI6I 4XTJA 1XMQE 2L92A 3Q6NA 4F9AB 3LLHA 5FLXQ 4JI0E 3VK6A 2VE7C 4DV0E 2RSMA 3ADJA 2E5LE 1Y4SA 4DR6E 1Z5BA 4JI3I 4LF4E 2NA2A 4Q28A 4JI8I 2JOXA 2L3CA 3VYXA 4DUZI 4IZJA 4WUBA 4AQYE 1WUUA 4IZKA 1N36I 2BM0A 1NHIA 3WU4A 2M1SA 2EWLA 4JI4E 1WHQA 1X48A 2ZM6I 4YHHE 4DV0I 4M2ZA 3AV0A 2E5LI 2MDRA 4DR6I 4LF4I 4HY1A 4KHPE 3M6AA 1H74A 1ZBQA 1N0UA 4X64E 2ZITA 2XEXA 2O1VA 3F6HA 4J8ZA 2UXCE 1FWKA 4DR2E 1RR9A 1DARA 3B82A 1XNQI 2Z5BB 3Q6MA 2H36X 3PYFA 1GQEA 1WHNA 5ADZA 4JI5I 4EMDA 1X47A 2HHHE 5DNYA 4DV1E 4DPXA 2UUAE 1K47A 4KHPI 2VF1A 5LMUE 2N3GA 1FI4A 2RS7A 2L2KB 4BS9A 4P7AA 3IWBA 2UXCI 3J81Q 4DR2I 1HNZE 2N3HA 2MC6A 2LMZA 1GZ6A 4DKKA 1ZBTA 4DR3E 4P78A 2E1RA 5AE2A 4DV1I 4F9BB 4B3MI 4LF7E 4M30A 4X62I 2LUQA 3ZZUA 2KONA 5LMUI 1Z0BA 4URLA 4IZJB 3ZKDA 5A2QQ 2DEIA 2CG9A 4JYAE 2NPFA 2B9DA 4LFAI 2Z5CB 4GKKE 4FWGA 4I3HA 4YY3I 1BKNA 3LNUA 4IZKB 4HYMA 1ZXMA 2IOQA 4WYQB 2K4VA 4PRVA 1Y6ZA 2NUFA 2L33A 1UHZA 4ED4A 1KTVA 2Z5BA 1PVGA 2V2QA 2HKJA 1FNMA 4DUYE 4WUDA 1S4EA 3JAMQ 2LRSA 4JI6E 2KHXA 4JYAI 3PYGA 4GKKI 2ODRC 2WW4A 2B7TA 4JI3E 2HK3A 1N34I 5FWKA 4DPYA 3K1JA 3T1HE 4FWHA 1N32E 4DUZE 4ZVIA 2UXDI 4L5NC 1VISA 4TUIA 2Q2EB 3RMPA 3J7AM 2EZ6A 1QU6A 1IBLI 4DUYI 4NXNI 1H7SA 1N36E 3QT5A 2NUGA 3J80Q 1XNRI 1Z5CA 2ZM6E 1A6FA 2VQFI 2V89A 3H09A 1Z0EA 2NUEA 3HQ1A 4DV6I 4DV3I 2BM1A 3WU3A 3T1HI 1N32I 4DR7I 2OI2A 1H7UA 2Z5CA 4DV2E 2R3VA 3D4JA 5AASA 2DSYA 2V8PA 2UUBI 5FLXC 4K0KE 1XNQE 1KVKA 3OTOE 2FV4B 4JI5E 4JI2E 2CPNA 2PNMA 4DMIA 2IHR1 4B3RI 1RC7A 1IBMI 2X36A 3GONA 4DPUA 1XMOI 2DMYA 1D6TA 2V2ZA 4DV2I 4MYUA 5LL6R 2CZ9A 1ZM3A 1IBKI 1Z0WA 2LBSB 2V83A 4JG4A 2HFSA 3HULA 3P06A 4K0KI 3HPZA 1Y4UA 3OTOI 1RREA 4GKJE 4JI2I 2V34A 1DQ3A 3LTOA 4B3ME 2DEJA 4X62E 1U2RA 5F3WA 4HACB 2L2NA 4USKA 4DV4E 2L2MA 2UU9I 1ZM4A 3LPSA 4X66I 4USMA 4LFBE 4LFAE 3QT7A 1UILA 4R1FA 4YY3E 1HNXI 2UXBI 4GKJI 2L8TA 3HPSA 2DB2A 1MU5A 1STUA 2O1TA 3K85A 1H72C 2MC5A 4LF8I 1EI1A 3HXLA 5IT9Q 1YZ9A 2O1UA 4DV7E 2ODRD 4X8WA 4BCAA 3QT8A 4DXLA 4DV4I 4BMJA 1HNWI 2F8BA 3KWRA 3J81C 3LMLA 1USVA 1J5EE 4LFBI 2V2VA 3H4LA 1FWLA 4LU9A 4JI1I 5CFFE 1N34E 3CWVA 4OOGC 3P1XA 1T4NA 3V5RA 3WU5A 5AE3A 2UXDE 2GS8A 4DV7I 2IOPA 2Z5EA 1IBLE 2LTSA 4NXNE 3IWDA 2X7IA 3DF6A 2R42A 4PRXA 3ADLA 2ZBKB 3DJWA 4WPYA 1OJ4A 1RQ0A 1XNRE 1J5EI 1YYOA 4WFTA 4MYTA 3Q1QA 2B7VA 3VYYA 2VQFE 4DV5I 2V85A 4HACA 4DV6E 4DV3E 1O0WA 4DR7E 4FWDA 4JV5E 3T1YI 4BC7A 2HK2A 2O1WA 1T4LB 1S16A 5BR8E 5GMEA 2WZOA 1MX0A 3JAMC 2UUBE 4KZSA 1B63A 3ZZ0A 1FKAE 3ZM7A 3ZZTA 3C4BA 2FTXB 1XHKA 1QZRA 2JY9A 3QT6A 2JOBA 1EKZA 4DR5I 4B3RE 4P52A 2LTRA 4F9CB 1X49A 2YT4A 1IBME 1XMOE 2LE2A 3JTZA 1I94E 1ZXNA 1USUA 4JV5I 4WUCA 2GQ0A 1N33I 1YYKA 4L8NA 5BR8I 1IBKE 2F4VE 4TUGA 1UEKA 4LFCE 2VQEI 3J80C 5L3JA 1B62A 1H73A 4BC9A 3B78A 2B3TB 1T4OA 1ELOA 4LF9I 2A2DA 4OX9I 4M0VA 1NZ0A 1I94I 2HFUA 4UTGA 4M1KA 4F54A 2UU9E 2F4VI 1Z59A 3ZOQB 4X66E 1Z0GA 4LFCI 1XMQI 4NXME 1NHHA 3C4TA 2UXBE 4JI0I 1HNXE 4X65E 2L3JA 4Z7YA 4JI7E 1Z5AA 5GMDA 2VF3A 4LF8E 5IWAE 1HR0E 4R03A 3PRYA 3F6GA 4AQYI 3PYDA 1J26A 2FGGA 4GEQB 4PU9A 3IWCA 1HNWE 1N0VC 3MSWA 5AE1A 4JI4I 4NXMI 2V87A 1ZM2A 4YHHI 2KOUA 3OMLA 4DPTA 4JI1E 4X65I 3K6QA 2CGEA 2JWOA 4JI7I 2G7HA 2JVAA 3J7Yp 5IWAI 4LF6E 1YYWA 4Z7CA 3ZKBA 1HR0I 4X64I 5LMNE 1KKHA 4FW9A 3JU0A 2E1MA 1FJGE 2LJHA 4HXZA 4LTYA 1WXRA 4DV5E 2RTXA 2RS6A 2LUPB 2HHHI 4N3OA 2UUAI 4LF5E 5IT9C 1Z0CA 2HKEA 3K17A 4LF6I 3HTXA 3T1YE 4RPFA 4B3TE 1PIEA 5LMNI 3J7AG 2YZTA 3ADIA 4DU7A 2PNLA 5A2QC 3F0NA 1FJGI 4FN5A 4DR1E 2EFGA 3B8HA 1Z0TA 1ZM9A 3HJCA 1HNZI 1DI2A 2JR1A 4DR5E 4B3SE 1EA6A 4DR3I 1Z0VA 2AJ4A 1HK7A 2A2CA 3V2UC 4LF5I 2LJPA 4LF7I 4R8OA 4UT4A 5T6JA 4IZJD 2UUCE 3PYEA 1N33E 1KIJA 3WU6A 4B3TI 3AUZA 2DIXA 4WSPA 4DR4E 2VQEE 2M7QA 4DR1I 3FIGA 4DU8A 2BV3A 2V86A 1NHJA 4B3SI 4I8OA 1MG7A 2V88A 2L6MA 4JI8E 4LF9E 1PKPA 2V8QB 4OX9E 4P7DA 3ADGA 2J7KA 4DPWA 2M4IA 2UUCI 1SR9A 4BBYA 4KQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 I;  4JI6 I;  4XTJ A;  1XMQ E;  3LLH A;  5FLX Q;  4JI0 E;  4DV0 E;  2RSM A;  3ADJ A;  2E5L E;  1Z5B A;  4DR6 E;  4JI3 I;  4LF4 E;  2NA2 A;  4JI8 I;  2L3C A;  3VYX A;  4DUZ I;  4WUB A;  4AQY E;  1WUU A;  1N36 I;  2BM0 A;  1NHI A;  3WU4 A;  4JI4 E;  1WHQ A;  1X48 A;  2ZM6 I;  4YHH E;  4DV0 I;  4M2Z A;  2E5L I;  2MDR A;  4DR6 I;  4LF4 I;  4HY1 A;  4KHP E;  3M6A A;  1H74 A;  1N0U A;  4X64 E;  2ZIT A;  2XEX A;  2UXC E;  1FWK A;  4DR2 E;  1RR9 A;  1DAR A;  3B82 A;  1XNQ I;  3PYF A;  1GQE A;  1WHN A;  4JI5 I;  4EMD A;  1X47 A;  2HHH E;  4DV1 E;  4DPX A;  2UUA E;  1K47 A;  4KHP I;  5LMU E;  2N3G A;  2RS7 A;  2L2K B;  1FI4 A;  4P7A A;  2UXC I;  3J81 Q;  4DR2 I;  1HNZ E;  2N3H A;  4DKK A;  1ZBT A;  4DR3 E;  2E1R A;  4DV1 I;  4B3M I;  4LF7 E;  4M30 A;  4X62 I;  2LUQ A;  3ZZU A;  5LMU I;  1Z0B A;  4URL A;  3ZKD A;  5A2Q Q;  2DEI A;  4JYA E;  2NPF A;  4LFA I;  4GKK E;  4FWG A;  4I3H A;  4YY3 I;  1BKN A;  3LNU A;  4HYM A;  1ZXM A;  4WYQ B;  4PRV A;  2NUF A;  2L33 A;  1UHZ A;  4ED4 A;  1KTV A;  1PVG A;  2V2Q A;  2HKJ A;  1FNM A;  4DUY E;  4WUD A;  1S4E A;  3JAM Q;  2LRS A;  4JI6 E;  2KHX A;  4JYA I;  3PYG A;  4GKK I;  2WW4 A;  2B7T A;  4JI3 E;  2HK3 A;  1N34 I;  4DPY A;  3K1J A;  3T1H E;  4FWH A;  1N32 E;  4DUZ E;  4ZVI A;  2UXD I;  1VIS A;  2Q2E B;  3J7A M;  2EZ6 A;  1QU6 A;  1IBL I;  4DUY I;  4NXN I;  1H7S A;  1N36 E;  3QT5 A;  2NUG A;  3J80 Q;  1XNR I;  1Z5C A;  2ZM6 E;  1A6F A;  2VQF I;  1Z0E A;  2NUE A;  4DV6 I;  4DV3 I;  2BM1 A;  3WU3 A;  3T1H I;  1N32 I;  4DR7 I;  2OI2 A;  1H7U A;  4DV2 E;  2R3V A;  3D4J A;  2V8P A;  2UUB I;  4K0K E;  5FLX C;  1XNQ E;  1KVK A;  3OTO E;  4JI5 E;  4JI2 E;  2CPN A;  4B3R I;  2IHR 1;  1RC7 A;  1IBM I;  2X36 A;  3GON A;  4DPU A;  1XMO I;  2DMY A;  1D6T A;  2V2Z A;  4DV2 I;  4MYU A;  5LL6 R;  2CZ9 A;  1ZM3 A;  1IBK I;  1Z0W A;  2LBS B;  4JG4 A;  2HFS A;  3HUL A;  4K0K I;  3OTO I;  1RRE A;  4GKJ E;  4JI2 I;  2V34 A;  3LTO A;  4B3M E;  2DEJ A;  4X62 E;  1U2R A;  4HAC B;  2L2N A;  4USK A;  4DV4 E;  2L2M A;  2UU9 I;  1ZM4 A;  3LPS A;  4X66 I;  4USM A;  4LFB E;  4LFA E;  3QT7 A;  1UIL A;  4R1F A;  4YY3 E;  1HNX I;  2UXB I;  4GKJ I;  2DB2 A;  1MU5 A;  1STU A;  1H72 C;  4LF8 I;  1EI1 A;  5IT9 Q;  1YZ9 A;  4DV7 E;  4X8W A;  3QT8 A;  4DXL A;  4DV4 I;  1HNW I;  3J81 C;  1J5E E;  4LFB I;  2V2V A;  3H4L A;  1FWL A;  4JI1 I;  5CFF E;  1N34 E;  3CWV A;  4OOG C;  3P1X A;  1T4N A;  3V5R A;  3WU5 A;  2UXD E;  2GS8 A;  4DV7 I;  1IBL E;  2LTS A;  4NXN E;  2X7I A;  2R42 A;  4PRX A;  3ADL A;  2ZBK B;  1OJ4 A;  1RQ0 A;  1XNR E;  1J5E I;  1YYO A;  4WFT A;  4MYT A;  3Q1Q A;  2B7V A;  3VYY A;  2VQF E;  4DV5 I;  4HAC A;  4DV6 E;  4DV3 E;  1O0W A;  4DR7 E;  4FWD A;  4JV5 E;  3T1Y I;  2HK2 A;  1T4L B;  1S16 A;  5BR8 E;  5GME A;  1MX0 A;  2UUB E;  3JAM C;  1B63 A;  3ZZ0 A;  1FKA E;  3ZM7 A;  3ZZT A;  3C4B A;  1XHK A;  1QZR A;  2JY9 A;  3QT6 A;  4DR5 I;  1EKZ A;  4B3R E;  4P52 A;  2LTR A;  1X49 A;  2YT4 A;  1IBM E;  1XMO E;  1I94 E;  1ZXN A;  4JV5 I;  4WUC A;  1N33 I;  1YYK A;  5BR8 I;  1IBK E;  2F4V E;  1UEK A;  4LFC E;  2VQE I;  3J80 C;  5L3J A;  1B62 A;  1H73 A;  3B78 A;  2B3T B;  1T4O A;  1ELO A;  4LF9 I;  2A2D A;  4OX9 I;  1NZ0 A;  1I94 I;  2HFU A;  4UTG A;  4M1K A;  2UU9 E;  2F4V I;  1Z59 A;  4X66 E;  1Z0G A;  4LFC I;  1XMQ I;  4NXM E;  1NHH A;  3C4T A;  2UXB E;  4JI0 I;  1HNX E;  4X65 E;  2L3J A;  4Z7Y A;  4JI7 E;  1Z5A A;  5GMD A;  2VF3 A;  4LF8 E;  5IWA E;  1HR0 E;  4AQY I;  3PYD A;  1J26 A;  4PU9 A;  1N0V C;  1HNW E;  4JI4 I;  4NXM I;  1ZM2 A;  4YHH I;  4DPT A;  4JI1 E;  4X65 I;  4JI7 I;  2JVA A;  3J7Y p;  5IWA I;  4LF6 E;  1YYW A;  4Z7C A;  3ZKB A;  1HR0 I;  4X64 I;  5LMN E;  1KKH A;  4FW9 A;  1FJG E;  2LJH A;  4HXZ A;  4DV5 E;  2RTX A;  2RS6 A;  2LUP B;  2HHH I;  2UUA I;  4LF5 E;  5IT9 C;  2HKE A;  1Z0C A;  3K17 A;  4LF6 I;  3HTX A;  3T1Y E;  4RPF A;  4B3T E;  1PIE A;  5LMN I;  3J7A G;  3ADI A;  4DU7 A;  5A2Q C;  3F0N A;  1FJG I;  4FN5 A;  4DR1 E;  3B8H A;  2EFG A;  1ZM9 A;  1Z0T A;  1HNZ I;  1DI2 A;  4B3S E;  4DR5 E;  1EA6 A;  4DR3 I;  1Z0V A;  2AJ4 A;  2A2C A;  3V2U C;  4LF5 I;  2LJP A;  4LF7 I;  4UT4 A;  2UUC E;  3PYE A;  1N33 E;  1KIJ A;  3WU6 A;  4B3T I;  2DIX A;  4DR4 E;  2VQE E;  4DR1 I;  4DU8 A;  2BV3 A;  1NHJ A;  4B3S I;  1MG7 A;  4LF9 E;  4JI8 E;  1PKP A;  4OX9 E;  3ADG A;  2J7K A;  4DPW A;  2UUC I;  4KQV A; 
#chains in the Genus database with same CATH topology
 3M85 D;  2EOY A;  4LCF A;  4DR4 I;  4JI6 I;  4XTJ A;  2M9A A;  1X3C A;  1XMQ E;  2JYA A;  2L92 A;  3Q6N A;  2EPR A;  3LLH A;  4R2C A;  4F9A B;  5FLX Q;  4JI0 E;  2JXP A;  3VK6 A;  2VE7 C;  4DV0 E;  1A1J A;  2RSM A;  2EQ1 A;  3ADJ A;  2E5L E;  1JK1 A;  4DR6 E;  3BF2 A;  2EOZ A;  1Y4S A;  1Z5B A;  4JI3 I;  4LF4 E;  2NN6 E;  2NA2 A;  4Q28 A;  4JI8 I;  4OO1 B;  5K36 B;  2PNZ A;  2JOX A;  2JEA B;  2PO1 B;  3ECR A;  2JT2 A;  2WBS A;  2PO2 A;  2L3C A;  2BB8 A;  3VYX A;  4DUZ I;  1RHY A;  4IZJ A;  5A6A A;  2RPC A;  1BBO A;  2O3Z A;  4IFD A;  4WUB A;  2CSH A;  2EOX A;  4AQY E;  1WUU A;  4LOM A;  4BHB A;  1MEY C;  4IZK A;  5JEA C;  2EQ0 A;  1N36 I;  2BM0 A;  2J7J A;  2R1F A;  1NHI A;  3WU4 A;  2M1S A;  1R6M A;  2EWL A;  4JI4 E;  4OO1 D;  1WHQ A;  3MHS C;  1X48 A;  2CTD A;  3M99 B;  4MU0 A;  2EOQ A;  4YHH E;  2ZM6 I;  4NZV A;  3AV0 A;  5A6J A;  4M2Z A;  4QNK A;  4U3D A;  4DV0 I;  2MDR A;  4J3D A;  2E5L I;  2EPP A;  4DR6 I;  2GHF A;  4LF4 I;  2JP9 A;  1X6F A;  4HY1 A;  4KHP E;  2JE6 B;  3M6A A;  2I9I A;  4BHC A;  1ZBQ A;  1H74 A;  1N0U A;  2WP8 B;  4X64 E;  2ZIT A;  4OKG A;  2XEX A;  2DGC A;  2JEB B;  1OYS A;  2O1V A;  2EOE A;  3F6H A;  2EN1 A;  4J8Z A;  2UXC E;  1FWK A;  1BB8 A;  1PJS A;  4DR2 E;  1DAR A;  1RR9 A;  5ELW A;  1YSA C;  3B82 A;  1XNQ I;  2YTP A;  2CVE A;  2Z5B B;  3Q6M A;  2H36 X;  1P47 A;  1GQE A;  1WHN A;  1KYQ A;  5ADZ A;  3PYF A;  4EMD A;  1X47 A;  4JI5 I;  4IS1 C;  2HHH E;  5DNY A;  2BBG A;  4ZYD A;  4DV1 E;  1UDQ A;  4DPX A;  2UUA E;  1K47 A;  4KHP I;  4F2J C;  3GLL A;  2VF1 A;  3P76 A;  3EPJ A;  2E72 A;  2YTN A;  3THN A;  5LMU E;  2N3G A;  2RS7 A;  2L2K B;  1FI4 A;  3GCM A;  4BS9 A;  3PS3 A;  4P7A A;  2C37 B;  3IWB A;  4NHR A;  2UXC I;  2EMK A;  2LCE A;  4OO1 A;  3J81 Q;  4DR2 I;  1HNZ E;  2EM3 A;  2JEA A;  2N3H A;  2PO1 A;  2MC6 A;  2LMZ A;  4F6N A;  5K36 E;  1GZ6 A;  4AID A;  4DKK A;  5C0X D;  1ZBT A;  4AM3 A;  4DR3 E;  4HEI A;  4P78 A;  2E1R A;  5AE2 A;  4DV1 I;  4F9B B;  4B3M I;  4LF7 E;  4M30 A;  4RH8 A;  2WNR B;  4X62 I;  2LUQ A;  2DLQ A;  4U3B A;  3ZZU A;  2KON A;  4MLQ A;  5LMU I;  2YRK A;  2EPZ A;  1Z0B A;  5EKW A;  1YUI A;  1NCS A;  4URL A;  4IZJ B;  3ZKD A;  5A2Q Q;  2EPO A;  2DEI A;  2EE8 A;  2CG9 A;  4JYA E;  2NPF A;  2B9D A;  4LFA I;  2Z5C B;  4GKK E;  4FWG A;  4I3H A;  4YY3 I;  1BKN A;  3LNU A;  2JE6 A;  4HYM A;  4IZK B;  2WP8 A;  2EJ4 A;  1ZXM A;  3EPL A;  5KL4 A;  2IOQ A;  3L00 A;  4WYQ B;  3M7N D;  3KZZ A;  2K4V A;  4PRV A;  1A1I A;  1Y6Z A;  2NUF A;  2EMG A;  2L33 A;  5C0X C;  1UHZ A;  4ED4 A;  2EL4 A;  2GPI A;  1KTV A;  2BA0 D;  2Z5B A;  1PVG A;  2V2Q A;  2HKJ A;  1FNM A;  4DUY E;  4WUD A;  1IQO A;  5JEA B;  1S4E A;  3JAM Q;  2LRS A;  4JI6 E;  2EMB A;  2EM0 A;  3UK3 C;  2KHX A;  4JYA I;  1UN6 B;  3PYG A;  4GKK I;  2ODR C;  2A25 A;  2WW4 A;  5C0X A;  2YTO A;  1YPN A;  2B7T A;  4JI3 E;  2EMH A;  2EMW A;  2HK3 A;  5EL9 A;  1N34 I;  5FWK A;  4DPY A;  5AC5 A;  2EML A;  2LV2 A;  3K1J A;  3T1H E;  4FWH A;  1N32 E;  1A1L A;  3U1K A;  4ISA A;  2K7I A;  4DUZ E;  2C37 A;  4ZVI A;  5JEA D;  4MQY A;  2UXD I;  1L4S A;  4L5N C;  1VIS A;  2F1D A;  3M85 G;  4TUI A;  2Q2E B;  2EM2 A;  1EH7 A;  3RMP A;  2EL5 A;  3J7A M;  2EZ6 A;  1QU6 A;  1IBL I;  2EM8 A;  4DUY I;  4NXN I;  1H7S A;  2YTG A;  1N36 E;  2ENA A;  3QT5 A;  2NUG A;  1AH5 A;  2N8X A;  5A69 A;  3J80 Q;  2LO3 A;  1XNR I;  2ENH A;  1Z5C A;  2ZM6 E;  3BGH A;  1A6F A;  2WNR A;  4ZYG A;  3UHM A;  2V89 A;  3H09 A;  4R2A A;  2NUE A;  1E3H A;  1Z0E A;  2VQF I;  2EM5 A;  2EP3 A;  3HQ1 A;  1IQS A;  4DV6 I;  4DV3 I;  1EH6 A;  2BM1 A;  3WU3 A;  4IJD A;  3T1H I;  4O24 A;  1N32 I;  3GME A;  4DR7 I;  5DNX A;  2OI2 A;  3QG5 C;  2EOM A;  1H7U A;  4DV2 E;  2Z5C A;  4IFD E;  2R3V A;  3D4J A;  5AAS A;  2DSY A;  2V8P A;  2UUB I;  4HTG A;  1TF3 A;  4ZYH A;  2D9H A;  4ZYE A;  3EPK A;  5FLX C;  2EPK X;  4K0K E;  1XNQ E;  1KVK A;  3OTO E;  2FV4 B;  4JI5 E;  4JI2 E;  2EL6 A;  5A6K A;  2CPN A;  2WCC 3;  2I13 A;  4DMI A;  2IHR 1;  2PNM A;  4B3R I;  1TN9 A;  2LVH A;  5LLQ A;  2YTI A;  1RC7 A;  5JEA A;  3PS2 A;  2X36 A;  2YTJ A;  1A1K A;  1OYR A;  2NN6 F;  3GON A;  4DPU A;  1XMO I;  4FW5 A;  2DMY A;  5JEA E;  5DNL A;  1QNT A;  1D6T A;  2VES A;  5AC4 A;  2V2Z A;  4DV2 I;  2ENC A;  5LL6 R;  4MYU A;  2ELY A;  1ZM3 A;  2CZ9 A;  1Z0W A;  1IBK I;  2LBS B;  2V83 A;  4KWY A;  4JG4 A;  1T38 A;  2HFS A;  3HUL A;  3P06 A;  4IFD F;  1BBG A;  4K0K I;  3HPZ A;  1Y4U A;  1YHC A;  3OTO I;  2IES A;  2CT1 A;  1RRE A;  4GKJ E;  4WXD A;  4JI2 I;  3P3G A;  2V34 A;  1DQ3 A;  4MU3 A;  1A1F A;  3LTO A;  1G2F C;  2MKN A;  4B3M E;  2DEJ A;  2GO4 A;  5KL6 A;  4X62 E;  1U2R A;  5F3W A;  5C0X B;  1IBM I;  4HAC B;  2L2N A;  2EN3 A;  4WX9 A;  4USK A;  2R76 A;  2YU5 A;  4NBQ A;  4DV4 E;  2L2M A;  2UU9 I;  1ZM4 A;  3LPS A;  4X66 I;  4USM A;  1YUJ A;  4LFB E;  4LFA E;  3QT7 A;  2Q8U A;  1UIL A;  4R1F A;  4YY3 E;  1UDO A;  1HNX I;  4OO1 E;  4GKJ I;  2UXB I;  2L8T A;  3HPS A;  2DB2 A;  1MU5 A;  1STU A;  2O1T A;  3K85 A;  2YSP A;  1H72 C;  2MC5 A;  4LF8 I;  4O43 A;  1EI1 A;  3HXL A;  5IXM B;  5IT9 Q;  1YZ9 A;  2O1U A;  4DV7 E;  2BA1 G;  1OYP A;  1F2I G;  2ODR D;  4FW4 A;  4X8W A;  4BCA A;  5KL3 A;  2EPL X;  2J65 A;  3DD6 A;  3P3C A;  3CDJ A;  4BMJ A;  3QT8 A;  1TF6 A;  4DXL A;  4DV4 I;  2F8B A;  3KWR A;  1HNW I;  3J81 C;  3LML A;  4FW3 A;  2EPM X;  1J5E E;  1USV A;  2V2V A;  1ZR9 A;  5DRP A;  4LFB I;  4R2R A;  3H4L A;  1LLM C;  1FWL A;  3M7N G;  4LU9 A;  4JI1 I;  1PJQ A;  5CFF E;  1N34 E;  4OOG C;  3CWV A;  4OO1 F;  2PO0 A;  2EM4 A;  2YRH A;  5K36 F;  2YTF A;  3P1X A;  1T4N A;  2YPN A;  1P42 A;  1Y60 A;  3V5R A;  4MU1 A;  3WU5 A;  5AE3 A;  2UXD E;  2GS8 A;  1E3P A;  4DV7 I;  4WSG A;  2IOP A;  2Z5E A;  1IBL E;  2LTS A;  1T39 A;  3BBG A;  3IWD A;  4NXN E;  2X7I A;  3DF6 A;  2YTE A;  2R42 A;  4PRX A;  3ADL A;  2EPN A;  2ZBK B;  3DJW A;  4WPY A;  1OJ4 A;  1RQ0 A;  2C39 B;  1XNR E;  4LCH A;  1J5E I;  2JPA A;  4GZN C;  3C6M A;  4WFT A;  1YYO A;  4GQU A;  4MYT A;  3Q1Q A;  2B7V A;  3VYY A;  2VQF E;  4DV5 I;  2NN6 D;  2EN2 A;  2EMZ A;  2V85 A;  2EN8 A;  4HAC A;  5C0X E;  5DRQ A;  4DV6 E;  4DV3 E;  2EN6 A;  2EPU A;  1O0W A;  4DR7 E;  4FWD A;  2DMI A;  4JV5 E;  3T1Y I;  4WXC A;  4BC7 A;  1N3G A;  2RQL A;  2HK2 A;  1YH8 A;  2O1W A;  1T4L B;  1X6E A;  2EPA A;  5BR8 E;  1S16 A;  5GME A;  2VRD A;  2WZO A;  1MX0 A;  3JAM C;  5A6B D;  2UUB E;  4KZS A;  2EOR A;  2DRP A;  1UDS A;  1JK2 A;  1B63 A;  3ZZ0 A;  5DRO A;  1FKA E;  3ZM7 A;  3ZZT A;  3C4B A;  2FTX B;  4IS9 A;  1XHK A;  1QZR A;  4F6M A;  2JY9 A;  3QT6 A;  2JOB A;  1EKZ A;  2YWQ A;  2WBU A;  3TQM A;  4B3R E;  4P52 A;  2LTR A;  4F9C B;  4DR5 I;  1X49 A;  2YT4 A;  1IBM E;  1XMO E;  2NAB A;  2LE2 A;  3JTZ A;  1I94 E;  2NN6 C;  4FW7 A;  1ZXN A;  1USU A;  4JV5 I;  4MDT A;  2EQ3 A;  1Z1B A;  2C38 A;  2GQ0 A;  4WUC A;  1YYK A;  1SFE A;  1N33 I;  2EMC A;  4L8N A;  5BR8 I;  2RSI A;  3MHH C;  2EMI A;  1IBK E;  2F4V E;  2EM6 A;  4TUG A;  1UEK A;  2YRM A;  2EM7 A;  4LFC E;  2VQE I;  1A1H A;  3J80 C;  4IFD C;  5L3J A;  1B62 A;  1H73 A;  1WJP A;  4BC9 A;  3B78 A;  2B3T B;  2NN6 A;  1T4O A;  2YTQ A;  1ELO A;  3BID A;  1GTK A;  4LF9 I;  2A2D A;  1PJT A;  4BA2 B;  4OX9 I;  4MLV A;  4M0V A;  3HKM A;  1NZ0 A;  1I94 I;  2HFU A;  2C39 A;  4UTG A;  2PO0 B;  1B69 A;  4M1K A;  2LJU A;  3L7Z B;  4BA1 A;  2EOJ A;  4F54 A;  5A6B A;  1ZU1 A;  2UU9 E;  2F4V I;  4R2S A;  1Z59 A;  3ZOQ B;  4X66 E;  3C6K A;  1A1G A;  1Z0G A;  1RMD A;  4LFC I;  1XMQ I;  4NXM E;  5K36 D;  1NHH A;  3C4T A;  2UXB E;  4JI0 I;  1HNX E;  2ADR A;  4X65 E;  2L3J A;  4Z7Y A;  4JI7 E;  1Z5A A;  4O4K A;  3P3E A;  5GMD A;  2AE8 A;  2EOO A;  2VF3 A;  4LF8 E;  5IWA E;  1G2D C;  1HR0 E;  4R03 A;  2EM9 A;  3PRY A;  1KJK A;  3F6G A;  4R2D A;  4AQY I;  5JEA F;  3PYD A;  1J26 A;  2FGG A;  4GEQ B;  4PU9 A;  3IWC A;  1HNW E;  1N0V C;  3MSW A;  5AE1 A;  2EOS A;  4JI4 I;  4NXM I;  5IV8 B;  2V87 A;  2YU8 A;  1ZM2 A;  2GO3 A;  4YHH I;  2KOU A;  3OML A;  4DPT A;  3EQ1 A;  4JI1 E;  4AIM A;  3K6Q A;  4X65 I;  2CGE A;  1MGT A;  3PS1 A;  2JWO A;  1AAY A;  2WBT A;  4JI7 I;  2G7H A;  2BR2 A;  2EMY A;  1X6H A;  2JVA A;  4OO1 C;  3J7Y p;  1PDA A;  4QNJ A;  5K36 C;  5KL2 A;  5IWA I;  4LF6 E;  2EMX A;  1YYW A;  4Z7C A;  1Y5Y A;  3ZKB A;  4R2E A;  1HR0 I;  5TSE A;  4LCG A;  4X64 I;  5LMN E;  1X5W A;  1KKH A;  4FW9 A;  3B4T A;  2YTD A;  2DLK A;  4FW6 A;  3JU0 A;  2HC5 A;  2HJJ A;  2E1M A;  2EMA A;  1FJG E;  4R2P A;  5K36 A;  4BA2 A;  5KL7 A;  2LJH A;  2C38 B;  4HXZ A;  4LTY A;  1WXR A;  4DV5 E;  2RTX A;  2RS6 A;  2GLI A;  2LUP B;  2HHH I;  2EOF A;  4N3O A;  3L7Z A;  1WRJ A;  4O5G A;  2EN7 A;  1UDN A;  4LF5 E;  2BA0 G;  5IT9 C;  2UUA I;  1Z0C A;  2HKE A;  3K17 A;  2ELZ A;  2NN6 B;  4LF6 I;  3HTX A;  3T1Y E;  4M9V C;  1VI7 A;  3NZK A;  4RPF A;  3U1Y A;  4B3T E;  1PIE A;  5LMN I;  3J7A G;  2PNZ B;  3H1C A;  3VHT B;  2YZT A;  2EN4 A;  3ADI A;  2PO2 B;  4FK5 C;  2MDG A;  4DU7 A;  2PNL A;  5A2Q C;  2BA1 D;  3F0N A;  4N4R B;  4R2Q A;  4IFD B;  3KRN A;  4FN5 A;  1FJG I;  4DR1 E;  2EFG A;  3B8H A;  1Z0T A;  1ZM9 A;  3HJC A;  1HNZ I;  2EOH A;  1DI2 A;  4BA1 B;  2EPX A;  3EPH A;  2JR1 A;  2EOI A;  4DR5 E;  4B3S E;  1EA6 A;  5DRR A;  4DR3 I;  1Z0V A;  2AJ4 A;  1UBD C;  1HK7 A;  2JEB A;  2A2C A;  3V2U C;  4LF5 I;  2LJP A;  4LF7 I;  2YSO A;  4R8O A;  4LPF A;  2IER A;  4UT4 A;  5T6J A;  4IZJ D;  2UUC E;  3PYE A;  4IFD D;  1N33 E;  1KIJ A;  3WU6 A;  4B3T I;  3AUZ A;  4Q35 B;  3THO B;  1ZAA C;  2PRT A;  1XXE A;  1R6L A;  4X9J A;  2DIX A;  4WSP A;  2HGH A;  4DR4 E;  5KL5 A;  2VQE E;  4MU4 A;  2M7Q A;  1DGC A;  2EMF A;  4DR1 I;  2MKD A;  3FIG A;  1YFH A;  4DU8 A;  2BV3 A;  3CDI A;  2LT7 A;  1NEI A;  2V86 A;  1NHJ A;  4B3S I;  4I8O A;  1MG7 A;  1EH8 A;  2V88 A;  2L6M A;  4JI8 E;  4LF9 E;  1PKP A;  2V8Q B;  4OX9 E;  4OZE A;  4P7D A;  5C0X F;  2EPC A;  3ADG A;  2J7K A;  4DPW A;  4RHB B;  3KZY A;  1IMU A;  2M4I A;  2UUC I;  2BR2 B;  1SR9 A;  4BBY A;  4KQV A; 
#chains in the Genus database with same CATH homology
 4DR4 I;  4JI6 I;  4XTJ A;  1XMQ E;  2L92 A;  3Q6N A;  4F9A B;  3LLH A;  5FLX Q;  4JI0 E;  3VK6 A;  2VE7 C;  4DV0 E;  2RSM A;  3ADJ A;  2E5L E;  1Y4S A;  4DR6 E;  1Z5B A;  4JI3 I;  4LF4 E;  2NA2 A;  4Q28 A;  4JI8 I;  2JOX A;  2L3C A;  3VYX A;  4DUZ I;  4IZJ A;  4WUB A;  4AQY E;  1WUU A;  4IZK A;  1N36 I;  2BM0 A;  1NHI A;  3WU4 A;  2M1S A;  2EWL A;  4JI4 E;  1WHQ A;  1X48 A;  2ZM6 I;  4YHH E;  4DV0 I;  4M2Z A;  3AV0 A;  2E5L I;  2MDR A;  4DR6 I;  4LF4 I;  4HY1 A;  4KHP E;  3M6A A;  1H74 A;  1ZBQ A;  1N0U A;  4X64 E;  2ZIT A;  2XEX A;  2O1V A;  3F6H A;  4J8Z A;  2UXC E;  1FWK A;  4DR2 E;  1RR9 A;  1DAR A;  3B82 A;  1XNQ I;  2Z5B B;  3Q6M A;  2H36 X;  3PYF A;  1GQE A;  1WHN A;  5ADZ A;  4JI5 I;  4EMD A;  1X47 A;  2HHH E;  5DNY A;  4DV1 E;  4DPX A;  2UUA E;  1K47 A;  4KHP I;  2VF1 A;  5LMU E;  2N3G A;  1FI4 A;  2RS7 A;  2L2K B;  4BS9 A;  4P7A A;  3IWB A;  2UXC I;  3J81 Q;  4DR2 I;  1HNZ E;  2N3H A;  2MC6 A;  2LMZ A;  1GZ6 A;  4DKK A;  1ZBT A;  4DR3 E;  4P78 A;  2E1R A;  5AE2 A;  4DV1 I;  4F9B B;  4B3M I;  4LF7 E;  4M30 A;  4X62 I;  2LUQ A;  3ZZU A;  2KON A;  5LMU I;  1Z0B A;  4URL A;  4IZJ B;  3ZKD A;  5A2Q Q;  2DEI A;  2CG9 A;  4JYA E;  2NPF A;  2B9D A;  4LFA I;  2Z5C B;  4GKK E;  4FWG A;  4I3H A;  4YY3 I;  1BKN A;  3LNU A;  4IZK B;  4HYM A;  1ZXM A;  2IOQ A;  4WYQ B;  2K4V A;  4PRV A;  1Y6Z A;  2NUF A;  2L33 A;  1UHZ A;  4ED4 A;  1KTV A;  2Z5B A;  1PVG A;  2V2Q A;  2HKJ A;  1FNM A;  4DUY E;  4WUD A;  1S4E A;  3JAM Q;  2LRS A;  4JI6 E;  2KHX A;  4JYA I;  3PYG A;  4GKK I;  2ODR C;  2WW4 A;  2B7T A;  4JI3 E;  2HK3 A;  1N34 I;  5FWK A;  4DPY A;  3K1J A;  3T1H E;  4FWH A;  1N32 E;  4DUZ E;  4ZVI A;  2UXD I;  4L5N C;  1VIS A;  4TUI A;  2Q2E B;  3RMP A;  3J7A M;  2EZ6 A;  1QU6 A;  1IBL I;  4DUY I;  4NXN I;  1H7S A;  1N36 E;  3QT5 A;  2NUG A;  3J80 Q;  1XNR I;  1Z5C A;  2ZM6 E;  1A6F A;  2VQF I;  2V89 A;  3H09 A;  1Z0E A;  2NUE A;  3HQ1 A;  4DV6 I;  4DV3 I;  2BM1 A;  3WU3 A;  3T1H I;  1N32 I;  4DR7 I;  2OI2 A;  1H7U A;  2Z5C A;  4DV2 E;  2R3V A;  3D4J A;  5AAS A;  2DSY A;  2V8P A;  2UUB I;  5FLX C;  4K0K E;  1XNQ E;  1KVK A;  3OTO E;  2FV4 B;  4JI5 E;  4JI2 E;  2CPN A;  2PNM A;  4DMI A;  2IHR 1;  4B3R I;  1RC7 A;  1IBM I;  2X36 A;  3GON A;  4DPU A;  1XMO I;  2DMY A;  1D6T A;  2V2Z A;  4DV2 I;  4MYU A;  5LL6 R;  2CZ9 A;  1ZM3 A;  1IBK I;  1Z0W A;  2LBS B;  2V83 A;  4JG4 A;  2HFS A;  3HUL A;  3P06 A;  4K0K I;  3HPZ A;  1Y4U A;  3OTO I;  1RRE A;  4GKJ E;  4JI2 I;  2V34 A;  1DQ3 A;  3LTO A;  4B3M E;  2DEJ A;  4X62 E;  1U2R A;  5F3W A;  4HAC B;  2L2N A;  4USK A;  4DV4 E;  2L2M A;  2UU9 I;  1ZM4 A;  3LPS A;  4X66 I;  4USM A;  4LFB E;  4LFA E;  3QT7 A;  1UIL A;  4R1F A;  4YY3 E;  1HNX I;  2UXB I;  4GKJ I;  2L8T A;  3HPS A;  2DB2 A;  1MU5 A;  1STU A;  2O1T A;  3K85 A;  1H72 C;  2MC5 A;  4LF8 I;  1EI1 A;  3HXL A;  5IT9 Q;  1YZ9 A;  2O1U A;  4DV7 E;  2ODR D;  4X8W A;  4BCA A;  3QT8 A;  4DXL A;  4DV4 I;  4BMJ A;  1HNW I;  2F8B A;  3KWR A;  3J81 C;  3LML A;  1USV A;  1J5E E;  4LFB I;  2V2V A;  3H4L A;  1FWL A;  4LU9 A;  4JI1 I;  5CFF E;  1N34 E;  3CWV A;  4OOG C;  3P1X A;  1T4N A;  3V5R A;  3WU5 A;  5AE3 A;  2UXD E;  2GS8 A;  4DV7 I;  2IOP A;  2Z5E A;  1IBL E;  2LTS A;  4NXN E;  3IWD A;  2X7I A;  3DF6 A;  2R42 A;  4PRX A;  3ADL A;  2ZBK B;  3DJW A;  4WPY A;  1OJ4 A;  1RQ0 A;  1XNR E;  1J5E I;  1YYO A;  4WFT A;  4MYT A;  3Q1Q A;  2B7V A;  3VYY A;  2VQF E;  4DV5 I;  2V85 A;  4HAC A;  4DV6 E;  4DV3 E;  1O0W A;  4DR7 E;  4FWD A;  4JV5 E;  3T1Y I;  4BC7 A;  2HK2 A;  2O1W A;  1T4L B;  1S16 A;  5BR8 E;  5GME A;  2WZO A;  1MX0 A;  3JAM C;  2UUB E;  4KZS A;  1B63 A;  3ZZ0 A;  1FKA E;  3ZM7 A;  3ZZT A;  3C4B A;  2FTX B;  1XHK A;  1QZR A;  2JY9 A;  3QT6 A;  2JOB A;  1EKZ A;  4DR5 I;  4B3R E;  4P52 A;  2LTR A;  4F9C B;  1X49 A;  2YT4 A;  1IBM E;  1XMO E;  2LE2 A;  3JTZ A;  1I94 E;  1ZXN A;  1USU A;  4JV5 I;  4WUC A;  2GQ0 A;  1N33 I;  1YYK A;  4L8N A;  5BR8 I;  1IBK E;  2F4V E;  4TUG A;  1UEK A;  4LFC E;  2VQE I;  3J80 C;  5L3J A;  1B62 A;  1H73 A;  4BC9 A;  3B78 A;  2B3T B;  1T4O A;  1ELO A;  4LF9 I;  2A2D A;  4OX9 I;  4M0V A;  1NZ0 A;  1I94 I;  2HFU A;  4UTG A;  4M1K A;  4F54 A;  2UU9 E;  2F4V I;  1Z59 A;  3ZOQ B;  4X66 E;  1Z0G A;  4LFC I;  1XMQ I;  4NXM E;  1NHH A;  3C4T A;  2UXB E;  4JI0 I;  1HNX E;  4X65 E;  2L3J A;  4Z7Y A;  4JI7 E;  1Z5A A;  5GMD A;  2VF3 A;  4LF8 E;  5IWA E;  1HR0 E;  4R03 A;  3PRY A;  3F6G A;  4AQY I;  3PYD A;  1J26 A;  2FGG A;  4GEQ B;  4PU9 A;  3IWC A;  1HNW E;  1N0V C;  3MSW A;  5AE1 A;  4JI4 I;  4NXM I;  2V87 A;  1ZM2 A;  4YHH I;  2KOU A;  3OML A;  4DPT A;  4JI1 E;  4X65 I;  3K6Q A;  2CGE A;  2JWO A;  4JI7 I;  2G7H A;  2JVA A;  3J7Y p;  5IWA I;  4LF6 E;  1YYW A;  4Z7C A;  3ZKB A;  1HR0 I;  4X64 I;  5LMN E;  1KKH A;  4FW9 A;  3JU0 A;  2E1M A;  1FJG E;  2LJH A;  4HXZ A;  4LTY A;  1WXR A;  4DV5 E;  2RTX A;  2RS6 A;  2LUP B;  2HHH I;  4N3O A;  2UUA I;  4LF5 E;  5IT9 C;  1Z0C A;  2HKE A;  3K17 A;  4LF6 I;  3HTX A;  3T1Y E;  4RPF A;  4B3T E;  1PIE A;  5LMN I;  3J7A G;  2YZT A;  3ADI A;  4DU7 A;  2PNL A;  5A2Q C;  3F0N A;  1FJG I;  4FN5 A;  4DR1 E;  2EFG A;  3B8H A;  1Z0T A;  1ZM9 A;  3HJC A;  1HNZ I;  1DI2 A;  2JR1 A;  4DR5 E;  4B3S E;  1EA6 A;  4DR3 I;  1Z0V A;  2AJ4 A;  1HK7 A;  2A2C A;  3V2U C;  4LF5 I;  2LJP A;  4LF7 I;  4R8O A;  4UT4 A;  5T6J A;  4IZJ D;  2UUC E;  3PYE A;  1N33 E;  1KIJ A;  3WU6 A;  4B3T I;  3AUZ A;  2DIX A;  4WSP A;  4DR4 E;  2VQE E;  2M7Q A;  4DR1 I;  3FIG A;  4DU8 A;  2BV3 A;  2V86 A;  1NHJ A;  4B3S I;  4I8O A;  1MG7 A;  2V88 A;  2L6M A;  4JI8 E;  4LF9 E;  1PKP A;  2V8Q B;  4OX9 E;  4P7D A;  3ADG A;  2J7K A;  4DPW A;  2M4I A;  2UUC I;  1SR9 A;  4BBY A;  4KQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...