4DR6E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr6E02
4OOGC 4HY1A 3T1YE 4R1FA 2ZM6E 4X66I 5LL6R 4B3TE 1ELOA 4DUYE 2VQEE 4B3ME 4JI5I 3HTXA 1Z0BA 1RQ0A 2XEXA 3OTOE 3ZM7A 2V8PA 2UUBI 2N3HA 3LNUA 1N32E 2UXDE 4WUCA 1XNRE 2V2QA 3QT7A 4DPXA 1WUUA 1Z5AA 4UT4A 4AQYE 2UUCI 4M1KA 4DV7I 1J5EI 3WU3A 2NA2A 2RTXA 1QU6A 1A6FA 2E5LE 2CZ9A 2R42A 2UXBI 4LF6E 2UXCI 4UTGA 1I94I 4JI2I 4WUBA 4LFAI 4DUZE 1IBME 1X48A 4DR5I 5IWAI 5A2QC 3P1XA 4WYQB 4JI4I 5LMUE 4K0KI 1NHIA 4GKJI 2X36A 1B63A 2F4VE 3LPSA 3VYYA 1Z5CA 4LFBE 4DPWA 1KKHA 3J7AG 5IT9C 4HACA 4B3RE 4JI0I 4WFTA 4JG4A 1RC7A 4DR7I 4P52A 1HNZI 4DR3I 4DV0E 1T4OA 4LF8E 4JV5E 1MU5A 4NXNE 5LMNE 1XNQI 1HNXE 3WU4A 3ZZTA 2BV3A 4X62E 3JAMC 4DR4E 3LTOA 4M2ZA 4NXME 1IBKI 1X47A 4LF6I 4JI3E 4DV3I 1FWKA 1XMQE 4DR2E 3ADIA 3PYFA 4DUZI 3QT8A 2DMYA 1RREA 1N34I 4B3SI 1FNMA 1H72C 1N33E 3D4JA 2DEJA 4LF7E 4JI7E 2LJPA 4X8WA 2L33A 2OI2A 1EKZA 2RSMA 1HR0E 4JI6I 2KHXA 2X7IA 4LFBI 1H73A 3J81Q 5FLXQ 1ZM3A 4KHPE 2LTSA 4JI8E 2HFSA 2UU9I 2UUAI 2N3GA 4DV4I 4DV2I 4X65E 4XTJA 1XMOI 4DR1E 2LJHA 3WU6A 3PYDA 4FN5A 3QT6A 4DV1I 2HK2A 2NUGA 3GONA 4LF8I 1T4NA 3LLHA 1WHNA 4LFCE 4LF4I 2HHHE 1B62A 1EI1A 3K17A 3VYXA 2LTRA 1HNXI 1HNWE 1FJGE 1Z59A 4JYAI 4DV6E 4OX9E 1UEKA 1PKPA 5BR8I 2A2DA 1VISA 1DI2A 2MDRA 2ZITA 1WHQA 4RPFA 4X64E 1XMQI 2BM1A 1YZ9A 3C4BA 1ZM4A 1Z0WA 3J80Q 3ZKBA 2DB2A 1N36I 4DR6E 3T1YI 2ZM6I 4LF5E 3T1HE 4YHHE 1MG7A 1H7UA 3J7AM 2VQFE 4B3TI 4ED4A 2B7VA 4DUYI 2VQEI 4B3MI 1Z0EA 1H7SA 4PRXA 4X66E 4YY3E 3WU5A 3ADLA 2V2ZA 3OTOI 1Z0VA 2B7TA 4EMDA 1U2RA 3J7Yp 1K47A 4HACB 1N32I 2UXDI 5GMDA 1Z0TA 1EA6A 1XNRI 1N0VC 2UUBE 3B82A 5CFFE 4FWGA 1Z0CA 3PYEA 4AQYI 1STUA 1NHHA 2CPNA 2V2VA 2LUPB 2UUCE 3C4TA 2E5LI 4KQVA 1ZM2A 1J5EE 2RS6A 3M6AA 4HYMA 2BM0A 1UILA 4WUDA 2UXBE 1IBMI 4DKKA 2UXCE 3B8HA 1I94E 4JI2E 2LRSA 5LMUI 1YYWA 4MYUA 4DR5E 5IWAE 1OJ4A 1D6TA 1GQEA 2VF3A 5L3JA 4FWHA 4FWDA 1NHJA 3ZZ0A 4JI4E 5GMEA 4LF9E 4K0KE 2F4VI 2HK3A 4DU8A 4DU7A 5A2QQ 2NUEA 1KVKA 2IHR1 2RS7A 4GKJE 2VQFI 1IBLE 4I3HA 2V34A 2Q2EB 2JVAA 4YY3I 1ZM9A 4B3RI 1KIJA 1QZRA 2DIXA 2E1RA 1RR9A 4DXLA 2HKJA 2J7KA 3H4LA 1FI4A 1H74A 4DV0I 4JI0E 3Q1QA 4JV5I 5IT9Q 4PU9A 4NXNI 4FW9A 2B3TB 4DR7E 1YYKA 5LMNI 3V5RA 3ZKDA 1HNZE 4DR3E 2JY9A 4P7AA 1Z0GA 4URLA 4X62I 1XNQE 4DV5E 4DR4I 2YT4A 1NZ0A 4NXMI 4USKA 4DPYA 1UHZA 1X49A 1FWLA 4JI3I 2L2KB 1XHKA 3ADJA 2EFGA 4DR2I 3K1JA 1IBKE 2GS8A 1BKNA 4DV3E 2WW4A 4GKKE 2HFUA 3JAMQ 4MYTA 1ZBTA 3PYGA 4JI1E 2L2NA 1N33I 4LF7I 1S16A 4JI7I 1N34E 1MX0A 4B3SE 3ADGA 3J81C 5FLXC 4LF9I 2L3CA 1T4LB 4Z7YA 4HXZA 1HR0I 2EZ6A 3HULA 2NUFA 1N0UA 4JI5E 1IBLI 4KHPI 2L3JA 4JI8I 4JI6E 3B78A 3V2UC 2DEIA 2AJ4A 1Z5BA 4X65I 4DR1I 2UU9E 2UUAE 1ZXMA 3QT5A 4ZVIA 1S4EA 4DV4E 2NPFA 2L2MA 4DV2E 2LBSB 1XMOE 4LFCI 2HHHI 4DV7E 4DPUA 1HNWI 1FJGI 4DV1E 4DV6I 4LF4E 4OX9I 4DPTA 1KTVA 4DV5I 4PRVA 1FKAE 1PIEA 3J80C 1J26A 4M30A 4JYAE 3CWVA 5BR8E 1ZXNA 4LFAE 3ZZUA 4X64I 4Z7CA 1PVGA 4USMA 2HKEA 2A2CA 2R3VA 3F0NA 4DR6I 4GKKI 2ZBKB 4LF5I 3T1HI 2LUQA 4YHHI 4JI1I 1YYOA 1O0WA 1DARA 1N36E
chains in the Genus database with same CATH superfamily
3HKMA 4OOGC 2EM0A 4HY1A 1A1KA 3T1YE 4R1FA 2A25A 2ZM6E 2EE8A 2JR1A 3C6KA 4KZSA 2ODRC 4WXDA 1G2FC 4X66I 1IQOA 1E3PA 5LL6R 2EMFA 2I13A 4B3TE 4O4KA 1ELOA 4BC7A 3J80Q 4DUYE 2VQEE 4B3ME 2EL4A 4JI5I 2EOHA 2WNRB 3HTXA 2PNZB 2CT1A 4TUGA 4WX9A 2Z5CA 1Z0BA 1L4SA 1RQ0A 2XEXA 4IZJB 1T38A 2DRPA 2EMAA 3OTOE 3F6GA 2MC6A 3PS3A 2EQ3A 3UK3C 3ZM7A 2V8PA 2UUBI 2N3HA 4IFDC 2JPAA 3LNUA 1N32E 2UXDE 4WUCA 3RMPA 3BIDA 4ZYGA 4LCFA 1XNRE 2EJ4A 1TF6A 2LE2A 2V2QA 2V86A 3DJWA 3QT7A 4DPXA 2EN7A 4IJDA 1WUUA 1Z5AA 3GMEA 4MU0A 4L5NC 2JWOA 2C38A 4UT4A 1A1GA 4AQYE 2UUCI 2EOSA 2VRDA 1JK2A 4M1KA 4LOMA 1A1LA 1USUA 5C0XD 4DV7I 1J5EI 1BBGA 4O24A 1OYRA 3WU3A 4R2SA 2NA2A 2C37B 2RTXA 1Z1BA 1QU6A 4R8OA 4F6NA 1A6FA 2NN6F 4J3DA 2E5LE 2CZ9A 2V88A 2I9IA 1PJSA 3TQMA 2ADRA 2R42A 3L7ZA 2UXBI 3EPLA 3GLLA 4LF6E 2UXCI 2YTEA 2YTGA 4UTGA 1I94I 2R76A 3U1KA 1IQSA 2K4VA 4JI2I 2EPPA 4GZNC 4FW5A 4WXCA 4WUBA 4LFAI 2YU8A 4DUZE 2EOIA 1X48A 1ZR9A 2YRKA 4P7DA 5A2QC 2PRTA 1IBME 2WP8B 5IWAI 4DR5I 4OO1E 3P1XA 1ZU1A 2EPOA 4WYQB 5AASA 5EKWA 4JI4I 3BF2A 5LMUE 2EL6A 2K7IA 2Z5BA 4IZJD 1NHIA 4K0KI 2PO1B 1GTKA 4R2PA 4Q35B 2LJUA 2EN3A 2EPNA 2EM3A 4IZKB 4GKJI 3HPZA 4OZEA 4RHBB 2BA0G 2FGGA 2BR2A 1B63A 2RQLA 2X36A 2F4VE 1Y4UA 3LPSA 2GHFA 3VYYA 4Q28A 3MSWA 4HTGA 1AAYA 1Z5CA 4LFBE 2IESA 2EN1A 4WPYA 2O3ZA 4RH8A 3M85D 5JEAA 4QNJA 4DPWA 1KKHA 2YTJA 2GPIA 1WJPA 1G2DC 1YSAC 4GQUA 3J7AG 5AE3A 5IT9C 5KL5A 3KRNA 4HACA 4B3RE 3MHSC 4ISAA 4OO1B 5A6BD 4BS9A 3M7NG 1VI7A 5DROA 4MDTA 2YSOA 4WFTA 4JG4A 4JI0I 4IFDF 1PDAA 2MDGA 1RC7A 2YWQA 4L8NA 4DR7I 5K36C 4BA1A 1MEYC 4P52A 2C39B 1HNZI 4DR3I 1T4OA 4DV0E 4LF8E 4IS9A 4LCHA 1UDOA 4JV5E 3QG5C 1MU5A 4NXNE 1UDQA 2JEBB 1UN6B 5LMNE 4FW7A 1XNQI 2EM8A 5A6AA 1HNXE 2EWLA 3WU4A 4KWYA 2R1FA 3ZZTA 2BV3A 4X62E 3CDIA 3JAMC 4BMJA 4DR4E 3LTOA 2CSHA 4M2ZA 2CTDA 4NXME 1AH5A 5DNLA 2VF1A 1EH7A 1HK7A 3VK6A 1X47A 1IBKI 4LF6I 4JI3E 4DV3I 1FWKA 1B69A 1Y5YA 2YTFA 1XMQE 4DR2E 4U3DA 2E72A 3ADIA 3PYFA 1A1JA 1R6LA 4DUZI 2EMWA 5K36A 3QT8A 4DR4I 2DMYA 1RREA 2EL5A 1N34I 2JXPA 2JP9A 4B3SI 5KL3A 2ENCA 4FW3A 4OO1D 5KL2A 2MKNA 1FNMA 1H72C 4N3OA 1N33E 3D4JA 4R2QA 2DEJA 4LF7E 2NN6A 4JI7E 2YTDA 5AE1A 2LJPA 4X8WA 3P3EA 2BB8A 2WBUA 2L33A 2IOQA 2EM4A 2OI2A 1EKZA 3NZKA 2EOEA 4M9VC 2RSMA 1HR0E 3ZOQB 4JI6I 1UDSA 1QNTA 2EOXA 2KHXA 2X7IA 4NZVA 2KONA 3K6QA 4LFBI 1H73A 2GO3A 3J81Q 5FLXQ 1ZM3A 4KHPE 2F1DA 2LTSA 4F54A 4JI8E 3H09A 2HFSA 2EN6A 2ELZA 2Z5EA 2EPMX 2Z5CB 2UU9I 2UUAI 5KL6A 2ENHA 2EPUA 2EM9A 2N3GA 4DV4I 2EMZA 4DV2I 1A1FA 5DNXA 4X65E 3EPHA 4XTJA 1KYQA 5TSEA 4DR1E 1XMOI 5K36F 2LJHA 4R2RA 3WU6A 2V89A 2O1VA 2V8QB 1TF3A 3PYDA 3THNA 4FN5A 3QT6A 2F8BA 3KZYA 2HK2A 2NUGA 3GONA 2JT2A 4DV1I 1T4NA 2C38B 4LF8I 3LLHA 1WHNA 3L00A 4LFCE 4LF4I 2HHHE 1B62A 1LLMC 1EI1A 3VYXA 3K17A 1WRJA 2LTRA 1HNWE 1HNXI 1X6HA 1FJGE 1X5WA 2YZTA 1Z59A 2EPRA 4JYAI 3HXLA 4DV6E 4OX9E 4TUIA 1UEKA 1PKPA 5BR8I 2JEAA 2A2DA 2EN4A 4HEIA 1VISA 4IFDA 3L7ZB 5A6JA 1DI2A 2MDRA 5JEAE 2BA1G 3JTZA 2DGCA 2ZITA 1WHQA 1RMDA 2EOOA 2JOXA 4BBYA 1GZ6A 4RPFA 4X64E 1XMQI 3KZZA 3VHTB 2BM1A 5ADZA 2LT7A 1YZ9A 3C4BA 1ZM4A 1YPNA 4ZYEA 1Z0WA 1UBDC 2E1MA 1X3CA 2DLKA 2HGHA 3H1CA 4MU3A 2DB2A 3ZKBA 1N36I 4BA2A 4DR6E 2EOFA 5IXMB 2JE6A 2PNMA 3T1YI 2VE7C 2Z5BB 2ZM6I 4LF5E 3T1HE 2EM6A 4YHHE 2WBSA 1MG7A 2YRMA 4O5GA 5A6KA 2LO3A 1H7UA 3J7AM 5DRQA 1YH8A 2ENAA 4MLVA 2VQFE 2EMGA 3PS1A 5AE2A 2DLQA 2LCEA 2BR2B 3IWDA 4B3TI 2LV2A 3UHMA 2B7VA 4ED4A 1OYPA 3PS2A 2VQEI 4DUYI 4B3MI 1Z0EA 1H7SA 2EPLX 4PRXA 4X66E 3LMLA 4YY3E 1X6FA 2EORA 4LCGA 3WU5A 5IV8B 4R2DA 2GO4A 3ADLA 2PO0A 1USVA 2V2ZA 2WZOA 4BCAA 5JEAB 2EMKA 3OTOI 1Z0VA 2B7TA 1Y60A 2G7HA 4EMDA 1U2RA 3J7Yp 1K47A 3EPKA 1P47A 4R2CA 1NCSA 4HACB 4M0VA 1N32I 2UXDI 5GMDA 2Q8UA 1Z0TA 1EA6A 2EQ0A 1XNRI 4R2AA 1N0VC 3C6MA 2UUBE 3B82A 5CFFE 3P76A 4FWGA 5C0XC 5K36E 1Z0CA 3PYEA 4BA1B 4AQYI 1BBOA 5DNYA 1JK1A 4IFDD 1STUA 1NHHA 2EPCA 2B9DA 3JU0A 2CPNA 2KOUA 2V2VA 2YTPA 2LUPB 2UUCE 2NN6E 3C4TA 1WXRA 2E5LI 4KQVA 3PRYA 3P06A 1ZM2A 4MQYA 3F6HA 1J5EE 2D9HA 5AC4A 4FW4A 2RS6A 3M6AA 4HYMA 2BM0A 2H36X 1UILA 1OYSA 4IS1C 1TN9A 2O1UA 4F9AB 4WUDA 2IERA 2UXBE 1IBMI 4DKKA 1EH6A 2M1SA 2UXCE 3B8HA 1I94E 2WCC3 2V83A 1NEIA 4JI2E 2GLIA 2LRSA 2EPKX 2EOQA 5LMUI 1YYWA 3EPJA 4MYUA 5JEAD 4BHBA 1PJTA 2YTIA 4DR5E 5IWAE 1OJ4A 2BA0D 5C0XA 5K36B 1GQEA 4ZYDA 2EMBA 2CG9A 2PO2A 2EPAA 2VF3A 5L3JA 4FWHA 3IWBA 4FWDA 2DSYA 2MKDA 1NHJA 3ZZ0A 2EMIA 4JI4E 5GMEA 4LF9E 3EQ1A 4K0KE 2F4VI 2YPNA 2HK3A 4DU8A 4DU7A 5A2QQ 2NUEA 1KVKA 4MLQA 2IHR1 2NN6B 1SR9A 2RS7A 1BB8A 4GKJE 2VQFI 2EMYA 5FWKA 2J7JA 1IBLE 2YRHA 2DMIA 4I3HA 2FTXB 4F9CB 2V34A 2AE8A 2Q2EB 4FW6A 2YTQA 3M7ND 2EOYA 2WNRA 2YU5A 4BC9A 2PNZA 2JVAA 4YY3I 1ZM9A 2EMXA 4B3RI 1KIJA 4IZJA 1Y4SA 3DF6A 1QZRA 2DIXA 2E1RA 2HC5A 1YUJA 2EM7A 2RPCA 3M85G 4IFDE 1RR9A 3THOB 2L92A 4DXLA 1D6TA 5A69A 1SFEA 2VESA 2YTNA 1UDNA 3Q6NA 4F9BB 2HKJA 2J7KA 3H4LA 1FI4A 2EN8A 1H74A 2IOPA 4DV0I 2EOZA 2BBGA 4JI0E 3Q1QA 4JV5I 4LPFA 5C0XF 5IT9Q 2EM5A 4PU9A 4NXNI 4FW9A 3AUZA 2B3TB 5AC5A 1YYKA 4DR7E 2PNLA 5LMNI 2V87A 3V5RA 3ZKDA 1DQ3A 1HNZE 4DR3E 2JY9A 1F2IG 4AM3A 1RHYA 4GEQB 5K36D 1MGTA 3CDJA 4OKGA 1YHCA 1Z0GA 4P7AA 4URLA 4NHRA 4X62I 2L6MA 2NABA 3BBGA 1XNQE 5A6BA 4DV5E 2YT4A 4WSPA 1ZAAC 1KJKA 1NZ0A 2C37A 1ZBQA 2GQ0A 5F3WA 4NXMI 4USKA 1A1HA 4DPYA 1UHZA 1X6EA 1X49A 4FK5C 3ECRA 1FWLA 4R03A 2M7QA 4JI3I 2ELYA 2NN6D 2CVEA 5KL4A 4I8OA 2L2KB 2JEAB 1XHKA 3ADJA 2EFGA 4DR2I 4IFDB 3DD6A 3K1JA 2MC5A 1A1IA 5ELWA 1IBKE 4OO1C 4F2JC 2WP8A 2GS8A 2EMHA 3GCMA 1BKNA 4DV3E 2L8TA 2WW4A 4F6MA 5JEAC 4GKKE 2HFUA 3JAMQ 4MYTA 1ZBTA 3PYGA 3Q6MA 4JI1E 2L2NA 4R2EA 2PO1A 1N33I 2V85A 5T6JA 4LF7I 3HPSA 1S16A 4JI7I 4BA2B 1N34E 1MX0A 2JE6B 3IWCA 4B3SE 4IZKA 5DRPA 3ADGA 3J81C 5FLXC 4LF9I 2L3CA 2N8XA 1T4LB 4Z7YA 4ZYHA 4HXZA 2WBTA 1HR0I 4AIDA 2YSPA 2EZ6A 4AIMA 2ODRD 3HULA 3FIGA 1YFHA 2NUFA 1N0UA 4JI5E 1IBLI 4KHPI 1DGCA 2M9AA 2L3JA 4JI8I 4JI6E 3B78A 4N4RB 2PO0B 4NBQA 1PJQA 3BGHA 4OO1A 2DEIA 3V2UC 2AJ4A 1YUIA 3AV0A 2EOMA 2EPZA 4P78A 1Z5BA 2LVHA 1IMUA 4BHCA 4X65I 2EM2A 4DR1I 4J8ZA 2CGEA 2UU9E 2UUAE 1ZXMA 3QT5A 4ZVIA 1XXEA 1S4EA 4DV4E 2NPFA 2L2MA 4DV2E 2C39A 3K85A 2YTOA 2LBSB 3P3GA 2HJJA 4MU4A 1XMOE 4O43A 5C0XE 2EQ1A 2JEBA 4LFCI 2O1TA 1Y6ZA 3HJCA 2HHHI 4MU1A 3M99B 5LLQA 1N3GA 2EMLA 2JOBA 4DV7E 3P3CA 4DPUA 1HNWI 1FJGI 4LTYA 4DV1E 2EN2A 3OMLA 3HQ1A 4DV6I 4LF4E 1E3HA 2BA1D 5KL7A 1KTVA 2JYAA 4DPTA 4OX9I 4DV5I 2NN6C 2LMZA 2O1WA 4WSGA 4PRVA 1FKAE 1PIEA 3J80C 2M4IA 1J26A 4M30A 4JYAE 4LU9A 3CWVA 5DRRA 3KWRA 2EOJA 5BR8E 2EP3A 3B4TA 2J65A 1ZXNA 4LFAE 3ZZUA 2EPXA 4Z7CA 4X64I 2FV4B 3MHHC 1PVGA 4OO1F 1T39A 4QNKA 4USMA 4X9JA 2EMCA 2HKEA 2A2CA 2R3VA 5JEAF 1P42A 4DMIA 3F0NA 5EL9A 1R6MA 1EH8A 4DR6I 4U3BA 4GKKI 3U1YA 2ZBKB 4LF5I 3T1HI 2LUQA 5C0XB 4YHHI 4JI1I 1YYOA 2PO2B 1O0WA 2RSIA 1DARA 1N36E
chains in the Genus database with same CATH topology
4OOGC 4HY1A 3T1YE 4R1FA 2ZM6E 2JR1A 4KZSA 2ODRC 4X66I 5LL6R 4B3TE 1ELOA 4BC7A 4DUYE 2VQEE 4B3ME 4JI5I 3HTXA 4TUGA 2Z5CA 1Z0BA 1RQ0A 2XEXA 4IZJB 3OTOE 3F6GA 2MC6A 3ZM7A 2V8PA 2UUBI 2N3HA 3LNUA 1N32E 2UXDE 4WUCA 3RMPA 1XNRE 2V2QA 2LE2A 2V86A 3DJWA 3QT7A 4DPXA 1WUUA 1Z5AA 4L5NC 2JWOA 4UT4A 4AQYE 2UUCI 4M1KA 1USUA 4DV7I 1J5EI 3WU3A 2NA2A 2RTXA 1QU6A 4R8OA 1A6FA 2E5LE 2CZ9A 2V88A 2R42A 2UXBI 4LF6E 2UXCI 4UTGA 1I94I 2K4VA 4JI2I 4WUBA 4LFAI 4DUZE 1IBME 1X48A 4P7DA 4DR5I 5A2QC 5IWAI 3P1XA 4WYQB 5AASA 4JI4I 5LMUE 4K0KI 2Z5BA 4IZJD 1NHIA 4IZKB 4GKJI 3HPZA 2FGGA 2X36A 1B63A 2F4VE 1Y4UA 3LPSA 3VYYA 4Q28A 3MSWA 1Z5CA 4LFBE 4WPYA 4DPWA 1KKHA 3J7AG 5AE3A 5IT9C 4HACA 4B3RE 4BS9A 4JI0I 4WFTA 4JG4A 1RC7A 4L8NA 4DR7I 4P52A 1HNZI 4DR3I 1T4OA 4DV0E 4LF8E 4JV5E 1MU5A 4NXNE 5LMNE 1XNQI 1HNXE 2EWLA 3WU4A 3ZZTA 2BV3A 4X62E 3JAMC 4BMJA 4DR4E 3LTOA 4M2ZA 4NXME 2VF1A 1HK7A 3VK6A 1X47A 1IBKI 4LF6I 4JI3E 4DV3I 1FWKA 1XMQE 4DR2E 3ADIA 3PYFA 4DUZI 3QT8A 2DMYA 1RREA 1N34I 4B3SI 4N3OA 1FNMA 1H72C 1N33E 3D4JA 2DEJA 4LF7E 4JI7E 5AE1A 2LJPA 4X8WA 2L33A 2IOQA 2OI2A 1EKZA 2RSMA 1HR0E 3ZOQB 4JI6I 2KHXA 2X7IA 2KONA 3K6QA 4LFBI 1H73A 3J81Q 5FLXQ 1ZM3A 4KHPE 2LTSA 4F54A 4JI8E 3H09A 2HFSA 2Z5EA 2Z5CB 2UU9I 2UUAI 2N3GA 4DV4I 4DV2I 4X65E 4XTJA 1XMOI 4DR1E 2LJHA 3WU6A 2V89A 2O1VA 2V8QB 3PYDA 4FN5A 3QT6A 2F8BA 4DV1I 2HK2A 2NUGA 3GONA 4LF8I 1T4NA 3LLHA 1WHNA 4LFCE 4LF4I 2HHHE 1B62A 1EI1A 3K17A 3VYXA 2LTRA 1HNXI 1HNWE 1FJGE 2YZTA 1Z59A 4JYAI 3HXLA 4DV6E 4OX9E 4TUIA 1UEKA 1PKPA 5BR8I 2A2DA 1VISA 1DI2A 2MDRA 3JTZA 2ZITA 1WHQA 2JOXA 4BBYA 1GZ6A 4RPFA 4X64E 1XMQI 2BM1A 5ADZA 1YZ9A 3C4BA 1ZM4A 1Z0WA 3J80Q 2E1MA 3ZKBA 2DB2A 1N36I 4DR6E 2PNMA 3T1YI 2VE7C 2Z5BB 2ZM6I 4LF5E 3T1HE 4YHHE 1MG7A 1H7UA 3J7AM 2VQFE 5AE2A 3IWDA 4B3TI 4ED4A 2B7VA 4DUYI 2VQEI 4B3MI 1Z0EA 1H7SA 4PRXA 4X66E 3LMLA 4YY3E 3WU5A 3ADLA 1USVA 2V2ZA 2WZOA 4BCAA 3OTOI 1Z0VA 2B7TA 2G7HA 4EMDA 1U2RA 3J7Yp 1K47A 4HACB 4M0VA 1N32I 2UXDI 5GMDA 1Z0TA 1EA6A 1XNRI 1N0VC 2UUBE 3B82A 5CFFE 4FWGA 1Z0CA 3PYEA 4AQYI 5DNYA 1STUA 1NHHA 2B9DA 3JU0A 2CPNA 2KOUA 2V2VA 2LUPB 2UUCE 3C4TA 1WXRA 2E5LI 4KQVA 3PRYA 3P06A 1ZM2A 3F6HA 1J5EE 2RS6A 3M6AA 4HYMA 2BM0A 2H36X 1UILA 2O1UA 4F9AB 4WUDA 2UXBE 1IBMI 4DKKA 2M1SA 2UXCE 3B8HA 1I94E 2V83A 4JI2E 2LRSA 5LMUI 1YYWA 4MYUA 4DR5E 5IWAE 1OJ4A 1D6TA 1GQEA 2CG9A 2VF3A 5L3JA 4FWHA 3IWBA 4FWDA 2DSYA 1NHJA 3ZZ0A 4JI4E 5GMEA 4LF9E 4K0KE 2F4VI 2HK3A 4DU8A 4DU7A 5A2QQ 2NUEA 1KVKA 2IHR1 1SR9A 2RS7A 4GKJE 2VQFI 5FWKA 1IBLE 4I3HA 2FTXB 4F9CB 2V34A 2Q2EB 4BC9A 2JVAA 4YY3I 1ZM9A 4B3RI 1KIJA 4IZJA 1Y4SA 3DF6A 1QZRA 2DIXA 2E1RA 1RR9A 2L92A 4DXLA 3Q6NA 4F9BB 2HKJA 2J7KA 3H4LA 1FI4A 1H74A 2IOPA 4DV0I 4JI0E 3Q1QA 4JV5I 5IT9Q 4PU9A 4NXNI 4FW9A 3AUZA 4DR7E 2B3TB 1YYKA 2PNLA 5LMNI 2V87A 3V5RA 3ZKDA 1DQ3A 1HNZE 4DR3E 2JY9A 4GEQB 4P7AA 1Z0GA 4URLA 4X62I 2L6MA 1XNQE 4DV5E 4DR4I 2YT4A 4WSPA 1NZ0A 2GQ0A 1ZBQA 5F3WA 4NXMI 4USKA 4DPYA 1UHZA 1X49A 1FWLA 4R03A 2M7QA 4JI3I 4I8OA 2L2KB 1XHKA 3ADJA 2EFGA 4DR2I 3K1JA 2MC5A 1IBKE 2GS8A 1BKNA 4DV3E 2L8TA 2WW4A 4GKKE 2HFUA 3JAMQ 4MYTA 1ZBTA 3PYGA 3Q6MA 4JI1E 2L2NA 1N33I 2V85A 5T6JA 4LF7I 3HPSA 1S16A 4JI7I 1N34E 1MX0A 3IWCA 4B3SE 4IZKA 3ADGA 3J81C 5FLXC 4LF9I 2L3CA 1T4LB 4Z7YA 4HXZA 1HR0I 2EZ6A 2ODRD 3HULA 3FIGA 2NUFA 1N0UA 4JI5E 1IBLI 4KHPI 2L3JA 4JI8I 4JI6E 3B78A 3V2UC 2DEIA 2AJ4A 3AV0A 4P78A 1Z5BA 4X65I 4DR1I 4J8ZA 2CGEA 2UU9E 2UUAE 1ZXMA 3QT5A 4ZVIA 1S4EA 4DV4E 2NPFA 2L2MA 4DV2E 3K85A 2LBSB 1XMOE 4LFCI 2O1TA 1Y6ZA 3HJCA 2HHHI 2JOBA 4DV7E 4DPUA 1HNWI 1FJGI 4LTYA 4DV1E 3OMLA 3HQ1A 4DV6I 4LF4E 4OX9I 4DPTA 1KTVA 4DV5I 2LMZA 2O1WA 4PRVA 1FKAE 1PIEA 3J80C 2M4IA 1J26A 4M30A 4JYAE 4LU9A 3CWVA 3KWRA 5BR8E 1ZXNA 4LFAE 3ZZUA 4X64I 4Z7CA 2FV4B 1PVGA 4USMA 2HKEA 2A2CA 2R3VA 4DMIA 3F0NA 4DR6I 4GKKI 2ZBKB 4LF5I 3T1HI 2LUQA 4YHHI 4JI1I 1YYOA 1O0WA 1DARA 1N36E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOG C;  4HY1 A;  3T1Y E;  4R1F A;  2ZM6 E;  4X66 I;  5LL6 R;  4B3T E;  1ELO A;  4DUY E;  2VQE E;  4B3M E;  4JI5 I;  3HTX A;  1Z0B A;  1RQ0 A;  2XEX A;  3OTO E;  3ZM7 A;  2V8P A;  2UUB I;  2N3H A;  3LNU A;  1N32 E;  2UXD E;  4WUC A;  1XNR E;  2V2Q A;  3QT7 A;  4DPX A;  1WUU A;  1Z5A A;  4UT4 A;  4AQY E;  2UUC I;  4M1K A;  4DV7 I;  1J5E I;  3WU3 A;  2NA2 A;  2RTX A;  1QU6 A;  1A6F A;  2E5L E;  2CZ9 A;  2R42 A;  2UXB I;  4LF6 E;  2UXC I;  4UTG A;  1I94 I;  4JI2 I;  4WUB A;  4LFA I;  4DUZ E;  1IBM E;  1X48 A;  4DR5 I;  5IWA I;  5A2Q C;  3P1X A;  4WYQ B;  4JI4 I;  5LMU E;  4K0K I;  1NHI A;  4GKJ I;  2X36 A;  1B63 A;  2F4V E;  3LPS A;  3VYY A;  1Z5C A;  4LFB E;  4DPW A;  1KKH A;  3J7A G;  5IT9 C;  4HAC A;  4B3R E;  4JI0 I;  4WFT A;  4JG4 A;  1RC7 A;  4DR7 I;  4P52 A;  1HNZ I;  4DR3 I;  4DV0 E;  1T4O A;  4LF8 E;  4JV5 E;  1MU5 A;  4NXN E;  5LMN E;  1XNQ I;  1HNX E;  3WU4 A;  3ZZT A;  2BV3 A;  4X62 E;  3JAM C;  4DR4 E;  3LTO A;  4M2Z A;  4NXM E;  1IBK I;  1X47 A;  4LF6 I;  4JI3 E;  4DV3 I;  1FWK A;  1XMQ E;  4DR2 E;  3ADI A;  3PYF A;  4DUZ I;  3QT8 A;  2DMY A;  1RRE A;  1N34 I;  4B3S I;  1FNM A;  1H72 C;  1N33 E;  3D4J A;  2DEJ A;  4LF7 E;  4JI7 E;  2LJP A;  4X8W A;  2L33 A;  2OI2 A;  1EKZ A;  2RSM A;  1HR0 E;  4JI6 I;  2KHX A;  2X7I A;  4LFB I;  1H73 A;  3J81 Q;  5FLX Q;  1ZM3 A;  4KHP E;  2LTS A;  4JI8 E;  2HFS A;  2UU9 I;  2UUA I;  2N3G A;  4DV4 I;  4DV2 I;  4X65 E;  4XTJ A;  1XMO I;  4DR1 E;  2LJH A;  3WU6 A;  3PYD A;  4FN5 A;  3QT6 A;  4DV1 I;  2HK2 A;  2NUG A;  3GON A;  4LF8 I;  1T4N A;  3LLH A;  1WHN A;  4LFC E;  4LF4 I;  2HHH E;  1B62 A;  1EI1 A;  3K17 A;  3VYX A;  2LTR A;  1HNX I;  1HNW E;  1FJG E;  1Z59 A;  4JYA I;  4DV6 E;  4OX9 E;  1UEK A;  1PKP A;  5BR8 I;  2A2D A;  1VIS A;  1DI2 A;  2MDR A;  2ZIT A;  1WHQ A;  4RPF A;  4X64 E;  1XMQ I;  2BM1 A;  1YZ9 A;  3C4B A;  1ZM4 A;  1Z0W A;  3J80 Q;  3ZKB A;  2DB2 A;  1N36 I;  4DR6 E;  3T1Y I;  2ZM6 I;  4LF5 E;  3T1H E;  4YHH E;  1MG7 A;  1H7U A;  3J7A M;  2VQF E;  4B3T I;  4ED4 A;  2B7V A;  4DUY I;  2VQE I;  4B3M I;  1Z0E A;  1H7S A;  4PRX A;  4X66 E;  4YY3 E;  3WU5 A;  3ADL A;  2V2Z A;  3OTO I;  1Z0V A;  2B7T A;  4EMD A;  1U2R A;  3J7Y p;  1K47 A;  4HAC B;  1N32 I;  2UXD I;  5GMD A;  1Z0T A;  1EA6 A;  1XNR I;  1N0V C;  2UUB E;  3B82 A;  5CFF E;  4FWG A;  1Z0C A;  3PYE A;  4AQY I;  1STU A;  1NHH A;  2CPN A;  2V2V A;  2LUP B;  2UUC E;  3C4T A;  2E5L I;  4KQV A;  1ZM2 A;  1J5E E;  2RS6 A;  3M6A A;  4HYM A;  2BM0 A;  1UIL A;  4WUD A;  2UXB E;  1IBM I;  4DKK A;  2UXC E;  3B8H A;  1I94 E;  4JI2 E;  2LRS A;  5LMU I;  1YYW A;  4MYU A;  4DR5 E;  5IWA E;  1OJ4 A;  1D6T A;  1GQE A;  2VF3 A;  5L3J A;  4FWH A;  4FWD A;  1NHJ A;  3ZZ0 A;  4JI4 E;  5GME A;  4LF9 E;  4K0K E;  2F4V I;  2HK3 A;  4DU8 A;  4DU7 A;  5A2Q Q;  2NUE A;  1KVK A;  2IHR 1;  2RS7 A;  4GKJ E;  2VQF I;  1IBL E;  4I3H A;  2V34 A;  2Q2E B;  2JVA A;  4YY3 I;  1ZM9 A;  4B3R I;  1KIJ A;  1QZR A;  2DIX A;  2E1R A;  1RR9 A;  4DXL A;  2HKJ A;  2J7K A;  3H4L A;  1FI4 A;  1H74 A;  4DV0 I;  4JI0 E;  3Q1Q A;  4JV5 I;  5IT9 Q;  4PU9 A;  4NXN I;  4FW9 A;  2B3T B;  4DR7 E;  1YYK A;  5LMN I;  3V5R A;  3ZKD A;  1HNZ E;  4DR3 E;  2JY9 A;  4P7A A;  1Z0G A;  4URL A;  4X62 I;  1XNQ E;  4DV5 E;  4DR4 I;  2YT4 A;  1NZ0 A;  4NXM I;  4USK A;  4DPY A;  1UHZ A;  1X49 A;  1FWL A;  4JI3 I;  2L2K B;  1XHK A;  3ADJ A;  2EFG A;  4DR2 I;  3K1J A;  1IBK E;  2GS8 A;  1BKN A;  4DV3 E;  2WW4 A;  4GKK E;  2HFU A;  3JAM Q;  4MYT A;  1ZBT A;  3PYG A;  4JI1 E;  2L2N A;  1N33 I;  4LF7 I;  1S16 A;  4JI7 I;  1N34 E;  1MX0 A;  4B3S E;  3ADG A;  3J81 C;  5FLX C;  4LF9 I;  2L3C A;  1T4L B;  4Z7Y A;  4HXZ A;  1HR0 I;  2EZ6 A;  3HUL A;  2NUF A;  1N0U A;  4JI5 E;  1IBL I;  4KHP I;  2L3J A;  4JI8 I;  4JI6 E;  3B78 A;  3V2U C;  2DEI A;  2AJ4 A;  1Z5B A;  4X65 I;  4DR1 I;  2UU9 E;  2UUA E;  1ZXM A;  3QT5 A;  4ZVI A;  1S4E A;  4DV4 E;  2NPF A;  2L2M A;  4DV2 E;  2LBS B;  1XMO E;  4LFC I;  2HHH I;  4DV7 E;  4DPU A;  1HNW I;  1FJG I;  4DV1 E;  4DV6 I;  4LF4 E;  4OX9 I;  4DPT A;  1KTV A;  4DV5 I;  4PRV A;  1FKA E;  1PIE A;  3J80 C;  1J26 A;  4M30 A;  4JYA E;  3CWV A;  5BR8 E;  1ZXN A;  4LFA E;  3ZZU A;  4X64 I;  4Z7C A;  1PVG A;  4USM A;  2HKE A;  2A2C A;  2R3V A;  3F0N A;  4DR6 I;  4GKK I;  2ZBK B;  4LF5 I;  3T1H I;  2LUQ A;  4YHH I;  4JI1 I;  1YYO A;  1O0W A;  1DAR A;  1N36 E; 
#chains in the Genus database with same CATH topology
 3HKM A;  4OOG C;  2EM0 A;  4HY1 A;  1A1K A;  3T1Y E;  4R1F A;  2A25 A;  2ZM6 E;  2EE8 A;  2JR1 A;  3C6K A;  4KZS A;  2ODR C;  4WXD A;  1G2F C;  4X66 I;  1IQO A;  1E3P A;  5LL6 R;  2EMF A;  2I13 A;  4B3T E;  4O4K A;  1ELO A;  4BC7 A;  3J80 Q;  4DUY E;  2VQE E;  4B3M E;  2EL4 A;  4JI5 I;  2EOH A;  2WNR B;  3HTX A;  2PNZ B;  2CT1 A;  4TUG A;  4WX9 A;  2Z5C A;  1Z0B A;  1L4S A;  1RQ0 A;  2XEX A;  4IZJ B;  1T38 A;  2DRP A;  2EMA A;  3OTO E;  3F6G A;  2MC6 A;  3PS3 A;  2EQ3 A;  3UK3 C;  3ZM7 A;  2V8P A;  2UUB I;  2N3H A;  4IFD C;  2JPA A;  3LNU A;  1N32 E;  2UXD E;  4WUC A;  3RMP A;  3BID A;  4ZYG A;  4LCF A;  1XNR E;  2EJ4 A;  1TF6 A;  2LE2 A;  2V2Q A;  2V86 A;  3DJW A;  3QT7 A;  4DPX A;  2EN7 A;  4IJD A;  1WUU A;  1Z5A A;  3GME A;  4MU0 A;  4L5N C;  2JWO A;  2C38 A;  4UT4 A;  1A1G A;  4AQY E;  2UUC I;  2EOS A;  2VRD A;  1JK2 A;  4M1K A;  4LOM A;  1A1L A;  1USU A;  5C0X D;  4DV7 I;  1J5E I;  1BBG A;  4O24 A;  1OYR A;  3WU3 A;  4R2S A;  2NA2 A;  2C37 B;  2RTX A;  1Z1B A;  1QU6 A;  4R8O A;  4F6N A;  1A6F A;  2NN6 F;  4J3D A;  2E5L E;  2CZ9 A;  2V88 A;  2I9I A;  1PJS A;  3TQM A;  2ADR A;  2R42 A;  3L7Z A;  2UXB I;  3EPL A;  3GLL A;  4LF6 E;  2UXC I;  2YTE A;  2YTG A;  4UTG A;  1I94 I;  2R76 A;  3U1K A;  1IQS A;  2K4V A;  4JI2 I;  2EPP A;  4GZN C;  4FW5 A;  4WXC A;  4WUB A;  4LFA I;  2YU8 A;  4DUZ E;  2EOI A;  1X48 A;  1ZR9 A;  2YRK A;  4P7D A;  5A2Q C;  2PRT A;  1IBM E;  2WP8 B;  5IWA I;  4DR5 I;  4OO1 E;  3P1X A;  1ZU1 A;  2EPO A;  4WYQ B;  5AAS A;  5EKW A;  4JI4 I;  3BF2 A;  5LMU E;  2EL6 A;  2K7I A;  2Z5B A;  4IZJ D;  1NHI A;  4K0K I;  2PO1 B;  1GTK A;  4R2P A;  4Q35 B;  2LJU A;  2EN3 A;  2EPN A;  2EM3 A;  4IZK B;  4GKJ I;  3HPZ A;  4OZE A;  4RHB B;  2BA0 G;  2FGG A;  2BR2 A;  1B63 A;  2RQL A;  2X36 A;  2F4V E;  1Y4U A;  3LPS A;  2GHF A;  3VYY A;  4Q28 A;  3MSW A;  4HTG A;  1AAY A;  1Z5C A;  4LFB E;  2IES A;  2EN1 A;  4WPY A;  2O3Z A;  4RH8 A;  3M85 D;  5JEA A;  4QNJ A;  4DPW A;  1KKH A;  2YTJ A;  2GPI A;  1WJP A;  1G2D C;  1YSA C;  4GQU A;  3J7A G;  5AE3 A;  5IT9 C;  5KL5 A;  3KRN A;  4HAC A;  4B3R E;  3MHS C;  4ISA A;  4OO1 B;  5A6B D;  4BS9 A;  3M7N G;  1VI7 A;  5DRO A;  4MDT A;  2YSO A;  4WFT A;  4JG4 A;  4JI0 I;  4IFD F;  1PDA A;  2MDG A;  1RC7 A;  2YWQ A;  4L8N A;  4DR7 I;  5K36 C;  4BA1 A;  1MEY C;  4P52 A;  2C39 B;  1HNZ I;  4DR3 I;  1T4O A;  4DV0 E;  4LF8 E;  4IS9 A;  4LCH A;  1UDO A;  4JV5 E;  3QG5 C;  1MU5 A;  4NXN E;  1UDQ A;  2JEB B;  1UN6 B;  5LMN E;  4FW7 A;  1XNQ I;  2EM8 A;  5A6A A;  1HNX E;  2EWL A;  3WU4 A;  4KWY A;  2R1F A;  3ZZT A;  2BV3 A;  4X62 E;  3CDI A;  3JAM C;  4BMJ A;  4DR4 E;  3LTO A;  2CSH A;  4M2Z A;  2CTD A;  4NXM E;  1AH5 A;  5DNL A;  2VF1 A;  1EH7 A;  1HK7 A;  3VK6 A;  1X47 A;  1IBK I;  4LF6 I;  4JI3 E;  4DV3 I;  1FWK A;  1B69 A;  1Y5Y A;  2YTF A;  1XMQ E;  4DR2 E;  4U3D A;  2E72 A;  3ADI A;  3PYF A;  1A1J A;  1R6L A;  4DUZ I;  2EMW A;  5K36 A;  3QT8 A;  4DR4 I;  2DMY A;  1RRE A;  2EL5 A;  1N34 I;  2JXP A;  2JP9 A;  4B3S I;  5KL3 A;  2ENC A;  4FW3 A;  4OO1 D;  5KL2 A;  2MKN A;  1FNM A;  1H72 C;  4N3O A;  1N33 E;  3D4J A;  4R2Q A;  2DEJ A;  4LF7 E;  2NN6 A;  4JI7 E;  2YTD A;  5AE1 A;  2LJP A;  4X8W A;  3P3E A;  2BB8 A;  2WBU A;  2L33 A;  2IOQ A;  2EM4 A;  2OI2 A;  1EKZ A;  3NZK A;  2EOE A;  4M9V C;  2RSM A;  1HR0 E;  3ZOQ B;  4JI6 I;  1UDS A;  1QNT A;  2EOX A;  2KHX A;  2X7I A;  4NZV A;  2KON A;  3K6Q A;  4LFB I;  1H73 A;  2GO3 A;  3J81 Q;  5FLX Q;  1ZM3 A;  4KHP E;  2F1D A;  2LTS A;  4F54 A;  4JI8 E;  3H09 A;  2HFS A;  2EN6 A;  2ELZ A;  2Z5E A;  2EPM X;  2Z5C B;  2UU9 I;  2UUA I;  5KL6 A;  2ENH A;  2EPU A;  2EM9 A;  2N3G A;  4DV4 I;  2EMZ A;  4DV2 I;  1A1F A;  5DNX A;  4X65 E;  3EPH A;  4XTJ A;  1KYQ A;  5TSE A;  4DR1 E;  1XMO I;  5K36 F;  2LJH A;  4R2R A;  3WU6 A;  2V89 A;  2O1V A;  2V8Q B;  1TF3 A;  3PYD A;  3THN A;  4FN5 A;  3QT6 A;  2F8B A;  3KZY A;  2HK2 A;  2NUG A;  3GON A;  2JT2 A;  4DV1 I;  1T4N A;  2C38 B;  4LF8 I;  3LLH A;  1WHN A;  3L00 A;  4LFC E;  4LF4 I;  2HHH E;  1B62 A;  1LLM C;  1EI1 A;  3VYX A;  3K17 A;  1WRJ A;  2LTR A;  1HNW E;  1HNX I;  1X6H A;  1FJG E;  1X5W A;  2YZT A;  1Z59 A;  2EPR A;  4JYA I;  3HXL A;  4DV6 E;  4OX9 E;  4TUI A;  1UEK A;  1PKP A;  5BR8 I;  2JEA A;  2A2D A;  2EN4 A;  4HEI A;  1VIS A;  4IFD A;  3L7Z B;  5A6J A;  1DI2 A;  2MDR A;  5JEA E;  2BA1 G;  3JTZ A;  2DGC A;  2ZIT A;  1WHQ A;  1RMD A;  2EOO A;  2JOX A;  4BBY A;  1GZ6 A;  4RPF A;  4X64 E;  1XMQ I;  3KZZ A;  3VHT B;  2BM1 A;  5ADZ A;  2LT7 A;  1YZ9 A;  3C4B A;  1ZM4 A;  1YPN A;  4ZYE A;  1Z0W A;  1UBD C;  2E1M A;  1X3C A;  2DLK A;  2HGH A;  3H1C A;  4MU3 A;  2DB2 A;  3ZKB A;  1N36 I;  4BA2 A;  4DR6 E;  2EOF A;  5IXM B;  2JE6 A;  2PNM A;  3T1Y I;  2VE7 C;  2Z5B B;  2ZM6 I;  4LF5 E;  3T1H E;  2EM6 A;  4YHH E;  2WBS A;  1MG7 A;  2YRM A;  4O5G A;  5A6K A;  2LO3 A;  1H7U A;  3J7A M;  5DRQ A;  1YH8 A;  2ENA A;  4MLV A;  2VQF E;  2EMG A;  3PS1 A;  5AE2 A;  2DLQ A;  2LCE A;  2BR2 B;  3IWD A;  4B3T I;  2LV2 A;  3UHM A;  2B7V A;  4ED4 A;  1OYP A;  3PS2 A;  2VQE I;  4DUY I;  4B3M I;  1Z0E A;  1H7S A;  2EPL X;  4PRX A;  4X66 E;  3LML A;  4YY3 E;  1X6F A;  2EOR A;  4LCG A;  3WU5 A;  5IV8 B;  4R2D A;  2GO4 A;  3ADL A;  2PO0 A;  1USV A;  2V2Z A;  2WZO A;  4BCA A;  5JEA B;  2EMK A;  3OTO I;  1Z0V A;  2B7T A;  1Y60 A;  2G7H A;  4EMD A;  1U2R A;  3J7Y p;  1K47 A;  3EPK A;  1P47 A;  4R2C A;  1NCS A;  4HAC B;  4M0V A;  1N32 I;  2UXD I;  5GMD A;  2Q8U A;  1Z0T A;  1EA6 A;  2EQ0 A;  1XNR I;  4R2A A;  1N0V C;  3C6M A;  2UUB E;  3B82 A;  5CFF E;  3P76 A;  4FWG A;  5C0X C;  5K36 E;  1Z0C A;  3PYE A;  4BA1 B;  4AQY I;  1BBO A;  5DNY A;  1JK1 A;  4IFD D;  1STU A;  1NHH A;  2EPC A;  2B9D A;  3JU0 A;  2CPN A;  2KOU A;  2V2V A;  2YTP A;  2LUP B;  2UUC E;  2NN6 E;  3C4T A;  1WXR A;  2E5L I;  4KQV A;  3PRY A;  3P06 A;  1ZM2 A;  4MQY A;  3F6H A;  1J5E E;  2D9H A;  5AC4 A;  4FW4 A;  2RS6 A;  3M6A A;  4HYM A;  2BM0 A;  2H36 X;  1UIL A;  1OYS A;  4IS1 C;  1TN9 A;  2O1U A;  4F9A B;  4WUD A;  2IER A;  2UXB E;  1IBM I;  4DKK A;  1EH6 A;  2M1S A;  2UXC E;  3B8H A;  1I94 E;  2WCC 3;  2V83 A;  1NEI A;  4JI2 E;  2GLI A;  2LRS A;  2EPK X;  2EOQ A;  5LMU I;  1YYW A;  3EPJ A;  4MYU A;  5JEA D;  4BHB A;  1PJT A;  2YTI A;  4DR5 E;  5IWA E;  1OJ4 A;  2BA0 D;  5C0X A;  5K36 B;  1GQE A;  4ZYD A;  2EMB A;  2CG9 A;  2PO2 A;  2EPA A;  2VF3 A;  5L3J A;  4FWH A;  3IWB A;  4FWD A;  2DSY A;  2MKD A;  1NHJ A;  3ZZ0 A;  2EMI A;  4JI4 E;  5GME A;  4LF9 E;  3EQ1 A;  4K0K E;  2F4V I;  2YPN A;  2HK3 A;  4DU8 A;  4DU7 A;  5A2Q Q;  2NUE A;  1KVK A;  4MLQ A;  2IHR 1;  2NN6 B;  1SR9 A;  2RS7 A;  1BB8 A;  4GKJ E;  2VQF I;  2EMY A;  5FWK A;  2J7J A;  1IBL E;  2YRH A;  2DMI A;  4I3H A;  2FTX B;  4F9C B;  2V34 A;  2AE8 A;  2Q2E B;  4FW6 A;  2YTQ A;  3M7N D;  2EOY A;  2WNR A;  2YU5 A;  4BC9 A;  2PNZ A;  2JVA A;  4YY3 I;  1ZM9 A;  2EMX A;  4B3R I;  1KIJ A;  4IZJ A;  1Y4S A;  3DF6 A;  1QZR A;  2DIX A;  2E1R A;  2HC5 A;  1YUJ A;  2EM7 A;  2RPC A;  3M85 G;  4IFD E;  1RR9 A;  3THO B;  2L92 A;  4DXL A;  1D6T A;  5A69 A;  1SFE A;  2VES A;  2YTN A;  1UDN A;  3Q6N A;  4F9B B;  2HKJ A;  2J7K A;  3H4L A;  1FI4 A;  2EN8 A;  1H74 A;  2IOP A;  4DV0 I;  2EOZ A;  2BBG A;  4JI0 E;  3Q1Q A;  4JV5 I;  4LPF A;  5C0X F;  5IT9 Q;  2EM5 A;  4PU9 A;  4NXN I;  4FW9 A;  3AUZ A;  2B3T B;  5AC5 A;  1YYK A;  4DR7 E;  2PNL A;  5LMN I;  2V87 A;  3V5R A;  3ZKD A;  1DQ3 A;  1HNZ E;  4DR3 E;  2JY9 A;  1F2I G;  4AM3 A;  1RHY A;  4GEQ B;  5K36 D;  1MGT A;  3CDJ A;  4OKG A;  1YHC A;  1Z0G A;  4P7A A;  4URL A;  4NHR A;  4X62 I;  2L6M A;  2NAB A;  3BBG A;  1XNQ E;  5A6B A;  4DV5 E;  2YT4 A;  4WSP A;  1ZAA C;  1KJK A;  1NZ0 A;  2C37 A;  1ZBQ A;  2GQ0 A;  5F3W A;  4NXM I;  4USK A;  1A1H A;  4DPY A;  1UHZ A;  1X6E A;  1X49 A;  4FK5 C;  3ECR A;  1FWL A;  4R03 A;  2M7Q A;  4JI3 I;  2ELY A;  2NN6 D;  2CVE A;  5KL4 A;  4I8O A;  2L2K B;  2JEA B;  1XHK A;  3ADJ A;  2EFG A;  4DR2 I;  4IFD B;  3DD6 A;  3K1J A;  2MC5 A;  1A1I A;  5ELW A;  1IBK E;  4OO1 C;  4F2J C;  2WP8 A;  2GS8 A;  2EMH A;  3GCM A;  1BKN A;  4DV3 E;  2L8T A;  2WW4 A;  4F6M A;  5JEA C;  4GKK E;  2HFU A;  3JAM Q;  4MYT A;  1ZBT A;  3PYG A;  3Q6M A;  4JI1 E;  2L2N A;  4R2E A;  2PO1 A;  1N33 I;  2V85 A;  5T6J A;  4LF7 I;  3HPS A;  1S16 A;  4JI7 I;  4BA2 B;  1N34 E;  1MX0 A;  2JE6 B;  3IWC A;  4B3S E;  4IZK A;  5DRP A;  3ADG A;  3J81 C;  5FLX C;  4LF9 I;  2L3C A;  2N8X A;  1T4L B;  4Z7Y A;  4ZYH A;  4HXZ A;  2WBT A;  1HR0 I;  4AID A;  2YSP A;  2EZ6 A;  4AIM A;  2ODR D;  3HUL A;  3FIG A;  1YFH A;  2NUF A;  1N0U A;  4JI5 E;  1IBL I;  4KHP I;  1DGC A;  2M9A A;  2L3J A;  4JI8 I;  4JI6 E;  3B78 A;  4N4R B;  2PO0 B;  4NBQ A;  1PJQ A;  3BGH A;  4OO1 A;  2DEI A;  3V2U C;  2AJ4 A;  1YUI A;  3AV0 A;  2EOM A;  2EPZ A;  4P78 A;  1Z5B A;  2LVH A;  1IMU A;  4BHC A;  4X65 I;  2EM2 A;  4DR1 I;  4J8Z A;  2CGE A;  2UU9 E;  2UUA E;  1ZXM A;  3QT5 A;  4ZVI A;  1XXE A;  1S4E A;  4DV4 E;  2NPF A;  2L2M A;  4DV2 E;  2C39 A;  3K85 A;  2YTO A;  2LBS B;  3P3G A;  2HJJ A;  4MU4 A;  1XMO E;  4O43 A;  5C0X E;  2EQ1 A;  2JEB A;  4LFC I;  2O1T A;  1Y6Z A;  3HJC A;  2HHH I;  4MU1 A;  3M99 B;  5LLQ A;  1N3G A;  2EML A;  2JOB A;  4DV7 E;  3P3C A;  4DPU A;  1HNW I;  1FJG I;  4LTY A;  4DV1 E;  2EN2 A;  3OML A;  3HQ1 A;  4DV6 I;  4LF4 E;  1E3H A;  2BA1 D;  5KL7 A;  1KTV A;  2JYA A;  4DPT A;  4OX9 I;  4DV5 I;  2NN6 C;  2LMZ A;  2O1W A;  4WSG A;  4PRV A;  1FKA E;  1PIE A;  3J80 C;  2M4I A;  1J26 A;  4M30 A;  4JYA E;  4LU9 A;  3CWV A;  5DRR A;  3KWR A;  2EOJ A;  5BR8 E;  2EP3 A;  3B4T A;  2J65 A;  1ZXN A;  4LFA E;  3ZZU A;  2EPX A;  4Z7C A;  4X64 I;  2FV4 B;  3MHH C;  1PVG A;  4OO1 F;  1T39 A;  4QNK A;  4USM A;  4X9J A;  2EMC A;  2HKE A;  2A2C A;  2R3V A;  5JEA F;  1P42 A;  4DMI A;  3F0N A;  5EL9 A;  1R6M A;  1EH8 A;  4DR6 I;  4U3B A;  4GKK I;  3U1Y A;  2ZBK B;  4LF5 I;  3T1H I;  2LUQ A;  5C0X B;  4YHH I;  4JI1 I;  1YYO A;  2PO2 B;  1O0W A;  2RSI A;  1DAR A;  1N36 E; 
#chains in the Genus database with same CATH homology
 4OOG C;  4HY1 A;  3T1Y E;  4R1F A;  2ZM6 E;  2JR1 A;  4KZS A;  2ODR C;  4X66 I;  5LL6 R;  4B3T E;  1ELO A;  4BC7 A;  4DUY E;  2VQE E;  4B3M E;  4JI5 I;  3HTX A;  4TUG A;  2Z5C A;  1Z0B A;  1RQ0 A;  2XEX A;  4IZJ B;  3OTO E;  3F6G A;  2MC6 A;  3ZM7 A;  2V8P A;  2UUB I;  2N3H A;  3LNU A;  1N32 E;  2UXD E;  4WUC A;  3RMP A;  1XNR E;  2V2Q A;  2LE2 A;  2V86 A;  3DJW A;  3QT7 A;  4DPX A;  1WUU A;  1Z5A A;  4L5N C;  2JWO A;  4UT4 A;  4AQY E;  2UUC I;  4M1K A;  1USU A;  4DV7 I;  1J5E I;  3WU3 A;  2NA2 A;  2RTX A;  1QU6 A;  4R8O A;  1A6F A;  2E5L E;  2CZ9 A;  2V88 A;  2R42 A;  2UXB I;  4LF6 E;  2UXC I;  4UTG A;  1I94 I;  2K4V A;  4JI2 I;  4WUB A;  4LFA I;  4DUZ E;  1IBM E;  1X48 A;  4P7D A;  4DR5 I;  5A2Q C;  5IWA I;  3P1X A;  4WYQ B;  5AAS A;  4JI4 I;  5LMU E;  4K0K I;  2Z5B A;  4IZJ D;  1NHI A;  4IZK B;  4GKJ I;  3HPZ A;  2FGG A;  2X36 A;  1B63 A;  2F4V E;  1Y4U A;  3LPS A;  3VYY A;  4Q28 A;  3MSW A;  1Z5C A;  4LFB E;  4WPY A;  4DPW A;  1KKH A;  3J7A G;  5AE3 A;  5IT9 C;  4HAC A;  4B3R E;  4BS9 A;  4JI0 I;  4WFT A;  4JG4 A;  1RC7 A;  4L8N A;  4DR7 I;  4P52 A;  1HNZ I;  4DR3 I;  1T4O A;  4DV0 E;  4LF8 E;  4JV5 E;  1MU5 A;  4NXN E;  5LMN E;  1XNQ I;  1HNX E;  2EWL A;  3WU4 A;  3ZZT A;  2BV3 A;  4X62 E;  3JAM C;  4BMJ A;  4DR4 E;  3LTO A;  4M2Z A;  4NXM E;  2VF1 A;  1HK7 A;  3VK6 A;  1X47 A;  1IBK I;  4LF6 I;  4JI3 E;  4DV3 I;  1FWK A;  1XMQ E;  4DR2 E;  3ADI A;  3PYF A;  4DUZ I;  3QT8 A;  2DMY A;  1RRE A;  1N34 I;  4B3S I;  4N3O A;  1FNM A;  1H72 C;  1N33 E;  3D4J A;  2DEJ A;  4LF7 E;  4JI7 E;  5AE1 A;  2LJP A;  4X8W A;  2L33 A;  2IOQ A;  2OI2 A;  1EKZ A;  2RSM A;  1HR0 E;  3ZOQ B;  4JI6 I;  2KHX A;  2X7I A;  2KON A;  3K6Q A;  4LFB I;  1H73 A;  3J81 Q;  5FLX Q;  1ZM3 A;  4KHP E;  2LTS A;  4F54 A;  4JI8 E;  3H09 A;  2HFS A;  2Z5E A;  2Z5C B;  2UU9 I;  2UUA I;  2N3G A;  4DV4 I;  4DV2 I;  4X65 E;  4XTJ A;  1XMO I;  4DR1 E;  2LJH A;  3WU6 A;  2V89 A;  2O1V A;  2V8Q B;  3PYD A;  4FN5 A;  3QT6 A;  2F8B A;  4DV1 I;  2HK2 A;  2NUG A;  3GON A;  4LF8 I;  1T4N A;  3LLH A;  1WHN A;  4LFC E;  4LF4 I;  2HHH E;  1B62 A;  1EI1 A;  3K17 A;  3VYX A;  2LTR A;  1HNX I;  1HNW E;  1FJG E;  2YZT A;  1Z59 A;  4JYA I;  3HXL A;  4DV6 E;  4OX9 E;  4TUI A;  1UEK A;  1PKP A;  5BR8 I;  2A2D A;  1VIS A;  1DI2 A;  2MDR A;  3JTZ A;  2ZIT A;  1WHQ A;  2JOX A;  4BBY A;  1GZ6 A;  4RPF A;  4X64 E;  1XMQ I;  2BM1 A;  5ADZ A;  1YZ9 A;  3C4B A;  1ZM4 A;  1Z0W A;  3J80 Q;  2E1M A;  3ZKB A;  2DB2 A;  1N36 I;  4DR6 E;  2PNM A;  3T1Y I;  2VE7 C;  2Z5B B;  2ZM6 I;  4LF5 E;  3T1H E;  4YHH E;  1MG7 A;  1H7U A;  3J7A M;  2VQF E;  5AE2 A;  3IWD A;  4B3T I;  4ED4 A;  2B7V A;  4DUY I;  2VQE I;  4B3M I;  1Z0E A;  1H7S A;  4PRX A;  4X66 E;  3LML A;  4YY3 E;  3WU5 A;  3ADL A;  1USV A;  2V2Z A;  2WZO A;  4BCA A;  3OTO I;  1Z0V A;  2B7T A;  2G7H A;  4EMD A;  1U2R A;  3J7Y p;  1K47 A;  4HAC B;  4M0V A;  1N32 I;  2UXD I;  5GMD A;  1Z0T A;  1EA6 A;  1XNR I;  1N0V C;  2UUB E;  3B82 A;  5CFF E;  4FWG A;  1Z0C A;  3PYE A;  4AQY I;  5DNY A;  1STU A;  1NHH A;  2B9D A;  3JU0 A;  2CPN A;  2KOU A;  2V2V A;  2LUP B;  2UUC E;  3C4T A;  1WXR A;  2E5L I;  4KQV A;  3PRY A;  3P06 A;  1ZM2 A;  3F6H A;  1J5E E;  2RS6 A;  3M6A A;  4HYM A;  2BM0 A;  2H36 X;  1UIL A;  2O1U A;  4F9A B;  4WUD A;  2UXB E;  1IBM I;  4DKK A;  2M1S A;  2UXC E;  3B8H A;  1I94 E;  2V83 A;  4JI2 E;  2LRS A;  5LMU I;  1YYW A;  4MYU A;  4DR5 E;  5IWA E;  1OJ4 A;  1D6T A;  1GQE A;  2CG9 A;  2VF3 A;  5L3J A;  4FWH A;  3IWB A;  4FWD A;  2DSY A;  1NHJ A;  3ZZ0 A;  4JI4 E;  5GME A;  4LF9 E;  4K0K E;  2F4V I;  2HK3 A;  4DU8 A;  4DU7 A;  5A2Q Q;  2NUE A;  1KVK A;  2IHR 1;  1SR9 A;  2RS7 A;  4GKJ E;  2VQF I;  5FWK A;  1IBL E;  4I3H A;  2FTX B;  4F9C B;  2V34 A;  2Q2E B;  4BC9 A;  2JVA A;  4YY3 I;  1ZM9 A;  4B3R I;  1KIJ A;  4IZJ A;  1Y4S A;  3DF6 A;  1QZR A;  2DIX A;  2E1R A;  1RR9 A;  2L92 A;  4DXL A;  3Q6N A;  4F9B B;  2HKJ A;  2J7K A;  3H4L A;  1FI4 A;  1H74 A;  2IOP A;  4DV0 I;  4JI0 E;  3Q1Q A;  4JV5 I;  5IT9 Q;  4PU9 A;  4NXN I;  4FW9 A;  3AUZ A;  4DR7 E;  2B3T B;  1YYK A;  2PNL A;  5LMN I;  2V87 A;  3V5R A;  3ZKD A;  1DQ3 A;  1HNZ E;  4DR3 E;  2JY9 A;  4GEQ B;  4P7A A;  1Z0G A;  4URL A;  4X62 I;  2L6M A;  1XNQ E;  4DV5 E;  4DR4 I;  2YT4 A;  4WSP A;  1NZ0 A;  2GQ0 A;  1ZBQ A;  5F3W A;  4NXM I;  4USK A;  4DPY A;  1UHZ A;  1X49 A;  1FWL A;  4R03 A;  2M7Q A;  4JI3 I;  4I8O A;  2L2K B;  1XHK A;  3ADJ A;  2EFG A;  4DR2 I;  3K1J A;  2MC5 A;  1IBK E;  2GS8 A;  1BKN A;  4DV3 E;  2L8T A;  2WW4 A;  4GKK E;  2HFU A;  3JAM Q;  4MYT A;  1ZBT A;  3PYG A;  3Q6M A;  4JI1 E;  2L2N A;  1N33 I;  2V85 A;  5T6J A;  4LF7 I;  3HPS A;  1S16 A;  4JI7 I;  1N34 E;  1MX0 A;  3IWC A;  4B3S E;  4IZK A;  3ADG A;  3J81 C;  5FLX C;  4LF9 I;  2L3C A;  1T4L B;  4Z7Y A;  4HXZ A;  1HR0 I;  2EZ6 A;  2ODR D;  3HUL A;  3FIG A;  2NUF A;  1N0U A;  4JI5 E;  1IBL I;  4KHP I;  2L3J A;  4JI8 I;  4JI6 E;  3B78 A;  3V2U C;  2DEI A;  2AJ4 A;  3AV0 A;  4P78 A;  1Z5B A;  4X65 I;  4DR1 I;  4J8Z A;  2CGE A;  2UU9 E;  2UUA E;  1ZXM A;  3QT5 A;  4ZVI A;  1S4E A;  4DV4 E;  2NPF A;  2L2M A;  4DV2 E;  3K85 A;  2LBS B;  1XMO E;  4LFC I;  2O1T A;  1Y6Z A;  3HJC A;  2HHH I;  2JOB A;  4DV7 E;  4DPU A;  1HNW I;  1FJG I;  4LTY A;  4DV1 E;  3OML A;  3HQ1 A;  4DV6 I;  4LF4 E;  4OX9 I;  4DPT A;  1KTV A;  4DV5 I;  2LMZ A;  2O1W A;  4PRV A;  1FKA E;  1PIE A;  3J80 C;  2M4I A;  1J26 A;  4M30 A;  4JYA E;  4LU9 A;  3CWV A;  3KWR A;  5BR8 E;  1ZXN A;  4LFA E;  3ZZU A;  4X64 I;  4Z7C A;  2FV4 B;  1PVG A;  4USM A;  2HKE A;  2A2C A;  2R3V A;  4DMI A;  3F0N A;  4DR6 I;  4GKK I;  2ZBK B;  4LF5 I;  3T1H I;  2LUQ A;  4YHH I;  4JI1 I;  1YYO A;  1O0W A;  1DAR A;  1N36 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...