4DR6E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr6E02
4LFBE 4DPYA 5FLXC 4X64I 2E1RA 1XMQI 1ZXMA 1T4OA 4JV5E 2V2VA 4USKA 1YYWA 1HNWI 4WUBA 4MYTA 1N33E 4DR5I 4JI5I 3ADLA 4B3MI 1J26A 2ZM6E 3M6AA 4LF7I 1HR0E 1ELOA 3LPSA 4DV7I 2ZITA 4LF9E 4DUZE 4JI1I 4LF6E 3HTXA 4B3RE 4HY1A 3H4LA 1YYKA 2L2KB 4JI0I 1DI2A 1Z0WA 3OTOE 4FN5A 2RTXA 1Z5AA 1UHZA 4LF8E 4YY3I 3JAMC 1XNRI 2VF3A 2E5LE 5LMUI 4LFAI 4DU7A 1XNQI 2AJ4A 4B3SI 1GQEA 2MDRA 4LF5I 1RREA 4LFCI 4JI3I 4DV4I 1XMOE 4JI2E 5LMNE 4HXZA 2J7KA 4NXNE 3JAMQ 4JYAE 2DEIA 1PIEA 2VQFE 4M30A 1YYOA 2NA2A 1H73A 4JI8E 1HNXE 2BM0A 4HYMA 2HHHE 3PYGA 5BR8I 2XEXA 4DR2I 1KTVA 1Z5CA 5IT9C 2UU9E 4OX9E 3J80C 3ZKDA 4NXME 4DR4I 1T4LB 1ZXNA 4Z7YA 4X65E 2EFGA 4P52A 4JI4E 4M2ZA 1IBLI 4JG4A 2OI2A 5IT9Q 3J80Q 5CFFE 1K47A 4DV2I 2CZ9A 2VQEI 5IWAE 3D4JA 4JI7E 2UUAE 3B78A 1NHIA 4DR7E 3B82A 4DV0E 1FI4A 4DUYE 4GKJI 1D6TA 4WYQB 4DR3I 2L2MA 1N36E 1N32E 2UXBE 4DV6I 2F4VE 2N3GA 2V2QA 3WU5A 3B8HA 4KHPI 4DV5E 1Z0VA 1Z5BA 3QT6A 4HACB 3P1XA 4X64E 4DPTA 4X8WA 1XMQE 2DIXA 1NZ0A 1N34E 1DARA 3T1YI 2HK2A 4M1KA 2R3VA 4JI5E 4DR5E 1KVKA 4LF4I 2HKJA 1VISA 4PRXA 1S4EA 4FWGA 4JI6I 4LF7E 1EKZA 5FLXQ 1X48A 4DV7E 1FKAE 1FWKA 4ED4A 4JI1E 1QU6A 1UEKA 1XHKA 4DXLA 4JI0E 5GMEA 2UUCI 1NHHA 3VYYA 4X66I 4DPXA 3ZZ0A 3QT5A 2LJPA 1XNRE 3QT7A 2UUBI 3V5RA 5LMUE 4LFAE 4DV3I 1RQ0A 1FJGI 2ZBKB 1XNQE 2L2NA 4B3SE 3F0NA 4LF5E 3C4BA 4WUCA 4USMA 1H7UA 2UXDI 1PKPA 1HNZI 4OOGC 1IBMI 3QT8A 2A2CA 5BR8E 1IBKI 1ZM9A 4DR2E 4HACA 2RSMA 4WFTA 1STUA 5L3JA 4UTGA 2LRSA 4DR4E 1ZM4A 1EA6A 4DR6I 3J81C 4DV1I 1YZ9A 4AQYE 1HNXI 2HFSA 2HHHI 2X36A 3PYEA 2V8PA 2UXCE 4DPWA 3VYXA 4K0KI 1IBLE 1RC7A 5A2QC 1ZM2A 3PYDA 2DMYA 4DV2E 1I94E 2VQEE 1B62A 4B3TI 3J81Q 1H7SA 4PRVA 3ADGA 2RS6A 1QZRA 1N0VC 4YHHE 4R1FA 1H72C 4ZVIA 2HFUA 1N0UA 1Z0GA 2JVAA 2IHR1 1MU5A 1EI1A 4DR3E 4KQVA 2Q2EB 3LTOA 4DV6E 3WU3A 4GKKI 3HULA 3WU4A 2UUAI 1J5EI 2KHXA 3T1HI 2B7VA 1ZBTA 3C4TA 4KHPE 3LLHA 2BV3A 2LTRA 3PYFA 3ZZUA 2B7TA 1O0WA 3ZZTA 1B63A 4WUDA 1MG7A 3Q1QA 2YT4A 4DR1I 4X62I 1HNWE 2NUFA 4B3ME 1H74A 4LF4E 4LFBI 4XTJA 1X49A 2JY9A 4JI6E 1WHNA 3ADIA 4JV5I 1Z0TA 1N34I 1BKNA 1N33I 3LNUA 2ZM6I 2UUCE 2NUGA 3ZKBA 4MYUA 4X66E 1HR0I 4YY3E 2LUQA 2EZ6A 1U2RA 2DEJA 2UUBE 3J7Yp 4LF9I 4DUZI 2L33A 4LF6I 4I3HA 4B3RI 4DV3E 1FJGE 2BM1A 2WW4A 3GONA 3OTOI 4LFCE 4JI3E 2NUEA 4DV4E 1MX0A 1RR9A 3J7AM 1PVGA 4LF8I 3J7AG 1UILA 2E5LI 4PU9A 3ZM7A 1FWLA 3K1JA 2UXDE 1Z0EA 1HNZE 1Z0CA 2HK3A 2CPNA 2HKEA 3V2UC 2DB2A 1IBME 4URLA 1IBKE 2LUPB 1FNMA 1ZM3A 1XMOI 1WHQA 4JI2I 5LMNI 1Z59A 1OJ4A 4NXNI 3CWVA 2L3JA 4JYAI 4DR6E 1A6FA 2VQFI 4DV1E 4JI8I 4RPFA 2GS8A 1WUUA 4EMDA 1Z0BA 2UU9I 4OX9I 2B3TB 4K0KE 4NXMI 2V34A 2A2DA 2LTSA 4AQYI 3ADJA 4B3TE 4X65I 1T4NA 4Z7CA 4JI4I 2UXCI 4DPUA 1KKHA 4GKJE 5A2QQ 4FW9A 1X47A 4FWDA 2X7IA 5IWAI 1NHJA 1I94I 4JI7I 4GKKE 4YHHI 1J5EE 4DR7I 2L3CA 4DV0I 3K17A 3T1HE 4P7AA 4DUYI 2V2ZA 2LJHA 5LL6R 4FWHA 1N36I 1S16A 2RS7A 2LBSB 4UT4A 1N32I 2UXBI 2NPFA 2F4VI 4DU8A 3WU6A 2N3HA 3T1YE 4DR1E 5GMDA 4DKKA 2R42A 4X62E 1KIJA 4DV5I
chains in the Genus database with same CATH superfamily
3KZZA 1NEIA 4LFBE 2LV2A 2C39B 1ZBQA 4DPYA 2ELYA 2EQ0A 5FLXC 1Y5YA 3PS2A 5AASA 1X6FA 4X64I 2E1RA 2YSOA 4DMIA 1XMQI 1ZXMA 1T4OA 4JV5E 2M1SA 2M4IA 4R03A 2V2VA 2R1FA 4IFDB 4USKA 2O3ZA 2KONA 4LCGA 3B4TA 1IQOA 2WNRB 4F9CB 1YYWA 5DRPA 2EP3A 1YUJA 1HNWI 4WUBA 4MYTA 1N33E 2EM8A 4DR5I 3ADLA 1A1JA 4JI5I 1R6LA 4B3MI 1J26A 3P3GA 1BBOA 2ZM6E 4I8OA 3GMEA 4WSGA 3M6AA 4IFDC 4LF7I 1HR0E 2EN8A 1ELOA 3LPSA 4DV7I 2ZITA 4O4KA 4LF9E 4MQYA 4O5GA 3KZYA 4DUZE 1UDOA 4JI1I 4LF6E 3HTXA 2PO0A 2EPAA 1P47A 4IZJA 4B3RE 4HY1A 4MU1A 5KL7A 3H4LA 4IFDD 3P06A 1ZU1A 2ODRC 2JR1A 2V8QB 3IWCA 1LLMC 2L2KB 1YYKA 5EKWA 4JI0I 4BA1B 4F9AB 4WXCA 2EMCA 1DI2A 1Z0WA 1EH6A 5A6KA 3OTOE 1E3HA 2Z5BB 2RTXA 1Z5AA 4FN5A 1UHZA 4LF8E 1N3GA 1YSAC 4YY3I 2GHFA 5LLQA 3JAMC 1XNRI 2FGGA 2VF3A 1MGTA 4ZYDA 2E5LE 1Z1BA 2ODRD 5LMUI 4LFAI 4U3DA 4DU7A 2EOSA 1XNQI 2JT2A 2AJ4A 4B3SI 1GQEA 2MDRA 2YTJA 3BGHA 5K36B 4LF5I 2EOOA 2V86A 1JK2A 1RREA 4LFCI 4JI3I 4BCAA 3F6HA 2GPIA 4DV4I 1XMOE 5FWKA 3AV0A 4JI2E 4IFDF 5LMNE 4HXZA 2EM3A 2J7KA 4P78A 4NXNE 1UDSA 2FTXB 1T38A 2MC6A 3JAMQ 4JYAE 2DEIA 2JEAB 2GQ0A 5JEAB 1PIEA 2VQFE 4M30A 1YYOA 5K36C 2NA2A 1H73A 4JI8E 4TUGA 3EPKA 2R42A 2BR2A 4NHRA 1HNXE 1X6HA 3JU0A 2HHHE 2BM0A 2WBSA 3PYGA 2XEXA 2Z5EA 4HYMA 4DR2I 2CSHA 2JE6B 2C39A 4IFDE 1KTVA 1Z5CA 1WRJA 4HEIA 4L5NC 5IT9C 5KL3A 2YTNA 2UU9E 3J80C 4OX9E 1PJQA 1AH5A 2DGCA 3UHMA 4NXME 3ZKDA 4DR4I 5K36D 1T4LB 1ZXNA 4Z7YA 4IFDA 1P42A 2WNRA 2EN4A 4FW4A 4AM3A 3ZOQB 1USVA 3THNA 4X65E 3EPJA 2HJJA 5JEAD 1IQSA 2ENHA 2EFGA 2Z5CA 2EN7A 4P52A 3C6KA 1JK1A 4JI4E 2LO3A 2NN6B 3C6MA 4M2ZA 3MHSC 2PRTA 1ZAAC 1IBLI 4JG4A 2OI2A 2EPKX 4L8NA 5IT9Q 3J80Q 5CFFE 2DLQA 4F9BB 3QG5C 1K47A 4DV2I 2CZ9A 4IZKB 2BB8A 5KL4A 2VQEI 2EM7A 5IWAE 5K36F 2RPCA 5A69A 3D4JA 5KL6A 4KWYA 4JI7E 4BA1A 2UUAE 3B78A 2YTIA 2Z5BA 4LPFA 2PNMA 3PS1A 1NHIA 1A1KA 4DR7E 3B82A 2O1TA 4DV0E 1UDQA 1FI4A 4DUYE 1TN9A 4AIMA 1EH7A 2EPLX 2NN6D 2MKNA 4GKJI 1WJPA 1D6TA 2L6MA 4WYQB 4GEQB 5K36E 4DR3I 2L2MA 5AC5A 1N36E 2MKDA 3Q6NA 1N32E 2WBUA 4X9JA 2UXBE 2AE8A 2O1UA 2F4VE 2JXPA 3CDJA 4DV6I 2MDGA 3EPLA 2BA0D 2IOPA 5K36A 2F8BA 4R2SA 2N3GA 2V2QA 3WU5A 3B8HA 2EMZA 4N3OA 2YTOA 5JEAE 4KHPI 2WCC3 4DV5E 1Z0VA 2EMXA 1Z5BA 4N4RB 3QT6A 2EOJA 3HKMA 4HACB 2G7HA 2EPPA 2EOXA 1Y4SA 5JEAA 3M85G 2RQLA 3P1XA 4X64E 4DPTA 4X8WA 1XMQE 1PJSA 1DQ3A 2ADRA 3PS3A 2DIXA 4RHBB 1NZ0A 4TUIA 2JE6A 1N34E 2LCEA 1PDAA 2NABA 1DARA 3T1YI 2HK2A 4M1KA 2YU8A 5DNXA 1RHYA 2R3VA 4JI5E 2V88A 4DR5E 1KVKA 4LF4I 2LVHA 2BA1G 2HKJA 1VISA 4PRXA 1S4EA 3M7ND 3H1CA 4FW6A 4FWGA 4AIDA 5IXMB 1OYPA 4JI6I 3AUZA 2EM2A 4LF7E 2NN6E 1EKZA 5FLXQ 3HPSA 4FW7A 2DLKA 1X48A 2EL6A 4P7DA 4DV7E 1FKAE 1FWKA 3DD6A 3L00A 4ED4A 1UDNA 2I9IA 2NN6A 2EOFA 4JI1E 2WZOA 1QU6A 1UEKA 4OO1B 1XHKA 4O24A 2EL5A 1A1GA 4JI0E 5GMEA 4DXLA 1NHHA 5C0XB 2UUCI 3VYYA 3HPZA 4X66I 2EJ4A 2EMBA 4IZKA 4DPXA 4IS1C 2WP8B 3FIGA 3ZZ0A 3QT5A 1ZR9A 2EOMA 1DGCA 2LJPA 2HC5A 1XNRE 3QT7A 3U1KA 2UUBI 3V5RA 2EOYA 2EORA 5LMUE 4LFAE 4WSPA 5AC4A 2PNLA 4OO1C 4Q28A 1RQ0A 2EPMX 2JOXA 4LTYA 3L7ZB 4DV3I 4LCFA 1FJGI 4MDTA 2ZBKB 1OYSA 1XNQE 3VHTB 2L2NA 4R2RA 4B3SE 4BHBA 1X3CA 4FK5C 2EN3A 3F0NA 4LF5E 3P3CA 1L4SA 4OO1D 2M9AA 3C4BA 5C0XD 4WUCA 4U3BA 3GLLA 1AAYA 4USMA 2EN6A 2I13A 2C38B 1A1IA 1H7UA 1SFEA 2EM4A 2UXDI 1PKPA 2EMGA 3BBGA 1HNZI 4OOGC 2VF1A 1IBMI 3QT8A 2A2CA 3PRYA 3P76A 5BR8E 1IBKI 3HQ1A 1T39A 1ZM9A 4DR2E 1UN6B 4R2DA 4HACA 2RSMA 4M0VA 4WFTA 1STUA 2ENAA 5JEAC 2CG9A 3IWBA 4HTGA 5L3JA 2PNZB 4UTGA 2LRSA 4BMJA 4DR4E 5A6JA 1ZM4A 2D9HA 1EA6A 4DR6I 2YZTA 3J81C 4DV1I 1YZ9A 4OO1F 1BBGA 2N8XA 4AQYE 2J65A 5T6JA 2LT7A 2J7JA 5TSEA 1UBDC 2YRMA 1HNXI 2HFSA 1A1HA 2HHHI 3VK6A 2V87A 2X36A 4O43A 1KJKA 1RMDA 3MHHC 2YPNA 3PYEA 3DJWA 2UXCE 2V8PA 4QNJA 4DPWA 3VYXA 4K0KI 1IBLE 1YPNA 1RC7A 4M9VC 4OKGA 2CGEA 5A2QC 2EMIA 5ADZA 2F1DA 2C37B 1ZM2A 4OO1E 3PYDA 2DMYA 4DV2E 5C0XE 1X6EA 1I94E 2VQEE 1B62A 2EMKA 2EPNA 2NN6C 3J81Q 4B3TI 1H7SA 2JOBA 5DROA 4PRVA 3ADGA 3LMLA 1YH8A 2RS6A 4OO1A 5C0XA 3MSWA 1QZRA 2E1MA 1N0VC 5BR8I 4YHHE 5AE3A 4R1FA 1H72C 2EN2A 2IERA 2HGHA 2WP8A 2HFUA 4ZVIA 2PO0B 4QNKA 1N0UA 2V89A 2EQ1A 5JEAF 1R6MA 2EPZA 1Z0GA 2JVAA 2IHR1 3EPHA 4F2JC 1MU5A 2GO3A 1EI1A 3HJCA 2JEBB 4DR3E 5F3WA 2Q2EB 2BBGA 3L7ZA 4KQVA 3LTOA 3U1YA 4DV6E 3WU3A 2DRPA 4ZYEA 4GKKI 3HULA 3M85D 3WU4A 2UUAI 1J5EI 1SR9A 2EQ3A 2YTPA 2KHXA 3T1HI 2B7VA 5ELWA 1ZBTA 3C4TA 3DF6A 4KHPE 4FW5A 3LLHA 2C38A 2BV3A 2LTRA 3PYFA 2JEAA 4BA2B 3CDIA 2EOEA 5AE1A 3ZZUA 2B7TA 5A6BD 2RSIA 1O0WA 3F6GA 3ZZTA 4MLQA 4LOMA 2EE8A 1B63A 2NN6F 2LJUA 3BF2A 4WUDA 2JP9A 2YTFA 1MG7A 3Q1QA 2YT4A 4DR1I 2A25A 4X62I 1HNWE 2V83A 2EM9A 2EOHA 4F6NA 2EM0A 2NUFA 2PNZA 4B3ME 1H74A 2BR2B 4NBQA 1YFHA 4LF4E 4LFBI 4XTJA 1X49A 2CT1A 2JY9A 2EPUA 4BC9A 4JI6E 5IV8B 2BA0G 4LCHA 2E72A 1WHNA 3ADIA 5AE2A 4JV5I 2O1WA 2YWQA 1Z0TA 4ISAA 1USUA 1N34I 1BKNA 3ECRA 1MEYC 3H09A 2EMWA 1N33I 2EPOA 3LNUA 2MC5A 2C37A 4R8OA 3THOB 2UUCE 2NUGA 2ZM6I 3K6QA 3ZKBA 4MYUA 2Z5CB 4X66E 4IS9A 2JWOA 3M99B 1HR0I 4YY3E 2K4VA 1GTKA 2LUQA 3JTZA 2LMZA 2VE7C 4WXDA 2EZ6A 4GQUA 1U2RA 5DNLA 2YTQA 1A1FA 2DEJA 3J7Yp 2UUBE 4LF9I 4MU0A 4DUZI 2CTDA 5C0XC 1EH8A 2L33A 5DNYA 4LF6I 4I3HA 2YTDA 4B3RI 4DV3E 1FJGE 3M7NG 3HXLA 1F2IG 2BM1A 2WW4A 2EPXA 2DSYA 3TQMA 5A6BA 5KL2A 2IESA 3GONA 2EM5A 1GZ6A 1A1LA 4Q35B 4BBYA 1HK7A 3OTOI 4LFCE 4JI3E 2ELZA 3UK3C 4DV4E 2NUEA 1MX0A 1PVGA 1RR9A 3Q6MA 4LF8I 3J7AG 1UILA 2JEBA 2YU5A 1NCSA 2CVEA 4R2EA 2PO2B 2E5LI 2EPRA 2M7QA 4R2QA 4PU9A 3ZM7A 1FWLA 4J3DA 3K1JA 2UXDE 4BC7A 1G2DC 1VI7A 1IMUA 1Z0EA 2EPCA 1KYQA 2YRKA 1HNZE 2CPNA 2JYAA 1Y6ZA 1Z0CA 2HK3A 2HKEA 3V2UC 2DB2A 2PO1B 3K85A 3EQ1A 1IBME 1YUIA 4URLA 2JPAA 2DMIA 1IBKE 4BA2A 2LUPB 4F54A 5DRRA 2EMYA 1FNMA 1ZM3A 1XMOI 4MU3A 2LE2A 4J8ZA 2L92A 1WHQA 2VRDA 5LMNI 4JI2I 3OMLA 1Z59A 1OJ4A 4NXNI 3CWVA 2EM6A 1TF6A 2EL4A 2L3JA 4JYAI 1QNTA 2Q8UA 4DR6E 2EOIA 1A6FA 5KL5A 2VQFI 1PJTA 4DV1E 4ZYGA 3KRNA 2FV4B 5C0XF 4JI8I 4RPFA 2GS8A 1WUUA 4KZSA 5A6AA 4EMDA 2R76A 4BHCA 1Z0BA 2UU9I 4WPYA 4OX9I 2IOQA 4MLVA 2B3TB 4K0KE 4NXMI 5EL9A 4R2AA 4R2CA 2GLIA 2GO4A 4IJDA 3RMPA 2V34A 2A2DA 4FW3A 3GCMA 3IWDA 2LTSA 4AQYI 1OYRA 3ADJA 4B3TE 1XXEA 4X65I 1E3PA 1T4NA 4Z7CA 3J7AM 4RH8A 4JI4I 2L8TA 3P3EA 2EN1A 2YTEA 4IZJB 2UXCI 4F6MA 2O1VA 4DPUA 1G2FC 1KKHA 1X5WA 2WBTA 4GKJE 1Y4UA 2EMFA 5A2QQ 2EMLA 2H36X 4FW9A 1X47A 4FWDA 2X7IA 2YRHA 4OZEA 5IWAI 2VESA 1NHJA 1I94I 3NZKA 4JI7I 2ENCA 1TF3A 4WX9A 4GZNC 4GKKE 1B69A 4YHHI 2YSPA 1J5EE 5DRQA 4DR7I 2L3CA 4DV0I 1WXRA 2EMAA 3T1HE 3K17A 4P7AA 4DUYI 2V2ZA 2B9DA 2LJHA 2PO2A 2EWLA 4MU4A 5LL6R 2KOUA 4R2PA 1YHCA 4IZJD 4FWHA 4LU9A 2EOZA 1N36I 1S16A 2RS7A 2LBSB 1Y60A 2BA1D 3BIDA 1BB8A 4NZVA 4UT4A 1N32I 3KWRA 2EMHA 4ZYHA 2NPFA 2F4VI 2PO1A 2UXBI 2V85A 2YTGA 4DU8A 3WU6A 2N3HA 3T1YE 4DR1E 5GMDA 2K7IA 4DKKA 4X62E 1KIJA 4DV5I 4BS9A 2EOQA
chains in the Genus database with same CATH topology
4LFBE 1ZBQA 4DPYA 5FLXC 5AASA 4X64I 2E1RA 1XMQI 4DMIA 1ZXMA 1T4OA 4JV5E 2M1SA 2M4IA 4R03A 2V2VA 4USKA 2KONA 4F9CB 1YYWA 1HNWI 4WUBA 4MYTA 1N33E 4DR5I 4JI5I 3ADLA 4B3MI 1J26A 2ZM6E 4I8OA 3M6AA 4LF7I 1HR0E 1ELOA 3LPSA 4DV7I 2ZITA 4LF9E 4DUZE 4JI1I 4LF6E 3HTXA 4IZJA 4B3RE 4HY1A 3H4LA 3P06A 2ODRC 1YYKA 2JR1A 2V8QB 3IWCA 2L2KB 4JI0I 4F9AB 1DI2A 1Z0WA 3OTOE 2Z5BB 4FN5A 2RTXA 1Z5AA 1UHZA 4LF8E 4YY3I 3JAMC 1XNRI 2FGGA 2VF3A 2E5LE 2ODRD 5LMUI 4LFAI 4DU7A 1XNQI 2AJ4A 4B3SI 1GQEA 2MDRA 4LF5I 2V86A 1RREA 4LFCI 4JI3I 4BCAA 3F6HA 4DV4I 1XMOE 5FWKA 3AV0A 4JI2E 5LMNE 4HXZA 2J7KA 4P78A 4NXNE 2FTXB 3JAMQ 2MC6A 4JYAE 2DEIA 2GQ0A 1PIEA 2VQFE 4M30A 1YYOA 2NA2A 1H73A 4JI8E 4TUGA 2R42A 1HNXE 2BM0A 3JU0A 2HHHE 3PYGA 4HYMA 5BR8I 2XEXA 2Z5EA 4DR2I 1KTVA 1Z5CA 4L5NC 5IT9C 2UU9E 4OX9E 3J80C 3ZKDA 4NXME 4DR4I 1T4LB 1ZXNA 4Z7YA 3ZOQB 1USVA 4X65E 2EFGA 2Z5CA 4P52A 4JI4E 4M2ZA 1IBLI 4JG4A 2OI2A 4L8NA 5IT9Q 3J80Q 5CFFE 4F9BB 1K47A 4DV2I 2CZ9A 4IZKB 2VQEI 5IWAE 3D4JA 4JI7E 2UUAE 3B78A 2Z5BA 2PNMA 1NHIA 4DR7E 3B82A 2O1TA 4DV0E 1FI4A 4DUYE 4GKJI 1D6TA 2L6MA 4WYQB 4GEQB 4DR3I 2L2MA 1N36E 3Q6NA 1N32E 2UXBE 4DV6I 2O1UA 2F4VE 2IOPA 2F8BA 2N3GA 2V2QA 3WU5A 3B8HA 4N3OA 4KHPI 4DV5E 1Z0VA 1Z5BA 3QT6A 4HACB 2G7HA 1Y4SA 3P1XA 4X64E 4DPTA 4X8WA 1XMQE 1DQ3A 2DIXA 1NZ0A 4TUIA 1N34E 1DARA 3T1YI 2HK2A 4M1KA 2R3VA 4JI5E 2V88A 4DR5E 1KVKA 4LF4I 2HKJA 1VISA 4PRXA 1S4EA 4FWGA 4JI6I 3AUZA 4LF7E 1EKZA 5FLXQ 3HPSA 1X48A 4DV7E 4P7DA 1FKAE 1FWKA 4ED4A 4JI1E 2WZOA 1QU6A 1UEKA 1XHKA 4DXLA 4JI0E 5GMEA 2UUCI 1NHHA 3VYYA 3HPZA 4X66I 4IZKA 4DPXA 3FIGA 3ZZ0A 3QT5A 2LJPA 1XNRE 3QT7A 2UUBI 3V5RA 5LMUE 4LFAE 4WSPA 2PNLA 4Q28A 2JOXA 1RQ0A 4LTYA 4DV3I 1FJGI 2ZBKB 1XNQE 2L2NA 4B3SE 3F0NA 4LF5E 3C4BA 4WUCA 4USMA 1H7UA 2UXDI 1PKPA 1HNZI 4OOGC 2VF1A 1IBMI 3QT8A 2A2CA 3PRYA 5BR8E 1IBKI 3HQ1A 1ZM9A 4DR2E 4HACA 2RSMA 4M0VA 4WFTA 1STUA 2CG9A 3IWBA 5L3JA 4UTGA 2LRSA 4BMJA 4DR4E 1ZM4A 1EA6A 4DR6I 2YZTA 3J81C 4DV1I 1YZ9A 4AQYE 5T6JA 1HNXI 2HFSA 2HHHI 3VK6A 2V87A 2X36A 3PYEA 3DJWA 2UXCE 2V8PA 4DPWA 3VYXA 4K0KI 1IBLE 1RC7A 2CGEA 5A2QC 5ADZA 1ZM2A 3PYDA 2DMYA 4DV2E 1I94E 2VQEE 1B62A 4B3TI 3J81Q 1H7SA 2JOBA 4PRVA 3ADGA 3LMLA 2RS6A 3MSWA 1QZRA 2E1MA 1N0VC 4YHHE 5AE3A 4R1FA 1H72C 4ZVIA 2HFUA 1N0UA 2V89A 1Z0GA 2JVAA 2IHR1 1MU5A 1EI1A 3HJCA 4DR3E 5F3WA 2Q2EB 4KQVA 3LTOA 4DV6E 3WU3A 4GKKI 3HULA 3WU4A 2UUAI 1J5EI 1SR9A 2KHXA 3T1HI 2B7VA 1ZBTA 3C4TA 3DF6A 4KHPE 3LLHA 2BV3A 2LTRA 3PYFA 5AE1A 3ZZUA 2B7TA 1O0WA 3F6GA 3ZZTA 1B63A 4WUDA 1MG7A 3Q1QA 2YT4A 4DR1I 4X62I 1HNWE 2V83A 2NUFA 4B3ME 1H74A 4LF4E 4LFBI 4XTJA 1X49A 2JY9A 4BC9A 4JI6E 1WHNA 3ADIA 5AE2A 4JV5I 2O1WA 1Z0TA 1USUA 1N34I 1BKNA 3H09A 1N33I 3LNUA 2MC5A 4R8OA 2UUCE 2NUGA 2ZM6I 3K6QA 3ZKBA 4MYUA 2Z5CB 4X66E 2JWOA 1HR0I 4YY3E 2K4VA 2LUQA 3JTZA 2EZ6A 2LMZA 2VE7C 1U2RA 2DEJA 2UUBE 3J7Yp 4LF9I 4DUZI 5DNYA 2L33A 4LF6I 4I3HA 4B3RI 4DV3E 1FJGE 3HXLA 2BM1A 2WW4A 2DSYA 3GONA 1GZ6A 4BBYA 1HK7A 3OTOI 4LFCE 4JI3E 2NUEA 4DV4E 1MX0A 1RR9A 3Q6MA 1PVGA 4LF8I 3J7AM 3J7AG 1UILA 2E5LI 4PU9A 2M7QA 3ZM7A 1FWLA 3K1JA 2UXDE 4BC7A 1Z0EA 1HNZE 1Z0CA 2HK3A 2CPNA 1Y6ZA 2HKEA 3V2UC 2DB2A 3K85A 1IBME 4URLA 1IBKE 2LUPB 4F54A 1FNMA 1ZM3A 1XMOI 2LE2A 4J8ZA 2L92A 1WHQA 4JI2I 5LMNI 3OMLA 1Z59A 1OJ4A 4NXNI 3CWVA 2L3JA 4JYAI 4DR6E 1A6FA 2VQFI 4DV1E 2FV4B 4JI8I 4RPFA 2GS8A 1WUUA 4KZSA 4EMDA 1Z0BA 2UU9I 4WPYA 4OX9I 2IOQA 2B3TB 4K0KE 4NXMI 3RMPA 2V34A 2A2DA 3IWDA 2LTSA 4AQYI 3ADJA 4B3TE 4X65I 1T4NA 4Z7CA 4JI4I 2L8TA 4IZJB 2UXCI 2O1VA 4DPUA 1KKHA 4GKJE 1Y4UA 5A2QQ 2H36X 4FW9A 1X47A 4FWDA 2X7IA 5IWAI 1NHJA 1I94I 4JI7I 4GKKE 4YHHI 1J5EE 4DR7I 2L3CA 4DV0I 1WXRA 3K17A 3T1HE 4P7AA 4DUYI 2V2ZA 2B9DA 2LJHA 2EWLA 5LL6R 2KOUA 4IZJD 4FWHA 4LU9A 1N36I 1S16A 2RS7A 2LBSB 4UT4A 1N32I 2UXBI 3KWRA 2NPFA 2F4VI 2V85A 4DU8A 3WU6A 2N3HA 3T1YE 4DR1E 5GMDA 4DKKA 4X62E 1KIJA 4DV5I 4BS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB E;  4DPY A;  5FLX C;  4X64 I;  2E1R A;  1XMQ I;  1ZXM A;  1T4O A;  4JV5 E;  2V2V A;  4USK A;  1YYW A;  1HNW I;  4WUB A;  4MYT A;  1N33 E;  4DR5 I;  4JI5 I;  3ADL A;  4B3M I;  1J26 A;  2ZM6 E;  3M6A A;  4LF7 I;  1HR0 E;  1ELO A;  3LPS A;  4DV7 I;  2ZIT A;  4LF9 E;  4DUZ E;  4JI1 I;  4LF6 E;  3HTX A;  4B3R E;  4HY1 A;  3H4L A;  1YYK A;  2L2K B;  4JI0 I;  1DI2 A;  1Z0W A;  3OTO E;  4FN5 A;  2RTX A;  1Z5A A;  1UHZ A;  4LF8 E;  4YY3 I;  3JAM C;  1XNR I;  2VF3 A;  2E5L E;  5LMU I;  4LFA I;  4DU7 A;  1XNQ I;  2AJ4 A;  4B3S I;  1GQE A;  2MDR A;  4LF5 I;  1RRE A;  4LFC I;  4JI3 I;  4DV4 I;  1XMO E;  4JI2 E;  5LMN E;  4HXZ A;  2J7K A;  4NXN E;  3JAM Q;  4JYA E;  2DEI A;  1PIE A;  2VQF E;  4M30 A;  1YYO A;  2NA2 A;  1H73 A;  4JI8 E;  1HNX E;  2BM0 A;  4HYM A;  2HHH E;  3PYG A;  5BR8 I;  2XEX A;  4DR2 I;  1KTV A;  1Z5C A;  5IT9 C;  2UU9 E;  4OX9 E;  3J80 C;  3ZKD A;  4NXM E;  4DR4 I;  1T4L B;  1ZXN A;  4Z7Y A;  4X65 E;  2EFG A;  4P52 A;  4JI4 E;  4M2Z A;  1IBL I;  4JG4 A;  2OI2 A;  5IT9 Q;  3J80 Q;  5CFF E;  1K47 A;  4DV2 I;  2CZ9 A;  2VQE I;  5IWA E;  3D4J A;  4JI7 E;  2UUA E;  3B78 A;  1NHI A;  4DR7 E;  3B82 A;  4DV0 E;  1FI4 A;  4DUY E;  4GKJ I;  1D6T A;  4WYQ B;  4DR3 I;  2L2M A;  1N36 E;  1N32 E;  2UXB E;  4DV6 I;  2F4V E;  2N3G A;  2V2Q A;  3WU5 A;  3B8H A;  4KHP I;  4DV5 E;  1Z0V A;  1Z5B A;  3QT6 A;  4HAC B;  3P1X A;  4X64 E;  4DPT A;  4X8W A;  1XMQ E;  2DIX A;  1NZ0 A;  1N34 E;  1DAR A;  3T1Y I;  2HK2 A;  4M1K A;  2R3V A;  4JI5 E;  4DR5 E;  1KVK A;  4LF4 I;  2HKJ A;  1VIS A;  4PRX A;  1S4E A;  4FWG A;  4JI6 I;  4LF7 E;  1EKZ A;  5FLX Q;  1X48 A;  4DV7 E;  1FKA E;  1FWK A;  4ED4 A;  4JI1 E;  1QU6 A;  1UEK A;  1XHK A;  4DXL A;  4JI0 E;  5GME A;  2UUC I;  1NHH A;  3VYY A;  4X66 I;  4DPX A;  3ZZ0 A;  3QT5 A;  2LJP A;  1XNR E;  3QT7 A;  2UUB I;  3V5R A;  5LMU E;  4LFA E;  4DV3 I;  1RQ0 A;  1FJG I;  2ZBK B;  1XNQ E;  2L2N A;  4B3S E;  3F0N A;  4LF5 E;  3C4B A;  4WUC A;  4USM A;  1H7U A;  2UXD I;  1PKP A;  1HNZ I;  4OOG C;  1IBM I;  3QT8 A;  2A2C A;  5BR8 E;  1IBK I;  1ZM9 A;  4DR2 E;  4HAC A;  2RSM A;  4WFT A;  1STU A;  5L3J A;  4UTG A;  2LRS A;  4DR4 E;  1ZM4 A;  1EA6 A;  4DR6 I;  3J81 C;  4DV1 I;  1YZ9 A;  4AQY E;  1HNX I;  2HFS A;  2HHH I;  2X36 A;  3PYE A;  2V8P A;  2UXC E;  4DPW A;  3VYX A;  4K0K I;  1IBL E;  1RC7 A;  5A2Q C;  1ZM2 A;  3PYD A;  2DMY A;  4DV2 E;  1I94 E;  2VQE E;  1B62 A;  4B3T I;  3J81 Q;  1H7S A;  4PRV A;  3ADG A;  2RS6 A;  1QZR A;  1N0V C;  4YHH E;  4R1F A;  1H72 C;  4ZVI A;  2HFU A;  1N0U A;  1Z0G A;  2JVA A;  2IHR 1;  1MU5 A;  1EI1 A;  4DR3 E;  4KQV A;  2Q2E B;  3LTO A;  4DV6 E;  3WU3 A;  4GKK I;  3HUL A;  3WU4 A;  2UUA I;  1J5E I;  2KHX A;  3T1H I;  2B7V A;  1ZBT A;  3C4T A;  4KHP E;  3LLH A;  2BV3 A;  2LTR A;  3PYF A;  3ZZU A;  2B7T A;  1O0W A;  3ZZT A;  1B63 A;  4WUD A;  1MG7 A;  3Q1Q A;  2YT4 A;  4DR1 I;  4X62 I;  1HNW E;  2NUF A;  4B3M E;  1H74 A;  4LF4 E;  4LFB I;  4XTJ A;  1X49 A;  2JY9 A;  4JI6 E;  1WHN A;  3ADI A;  4JV5 I;  1Z0T A;  1N34 I;  1BKN A;  1N33 I;  3LNU A;  2ZM6 I;  2UUC E;  2NUG A;  3ZKB A;  4MYU A;  4X66 E;  1HR0 I;  4YY3 E;  2LUQ A;  2EZ6 A;  1U2R A;  2DEJ A;  2UUB E;  3J7Y p;  4LF9 I;  4DUZ I;  2L33 A;  4LF6 I;  4I3H A;  4B3R I;  4DV3 E;  1FJG E;  2BM1 A;  2WW4 A;  3GON A;  3OTO I;  4LFC E;  4JI3 E;  2NUE A;  4DV4 E;  1MX0 A;  1RR9 A;  3J7A M;  1PVG A;  4LF8 I;  3J7A G;  1UIL A;  2E5L I;  4PU9 A;  3ZM7 A;  1FWL A;  3K1J A;  2UXD E;  1Z0E A;  1HNZ E;  1Z0C A;  2HK3 A;  2CPN A;  2HKE A;  3V2U C;  2DB2 A;  1IBM E;  4URL A;  1IBK E;  2LUP B;  1FNM A;  1ZM3 A;  1XMO I;  1WHQ A;  4JI2 I;  5LMN I;  1Z59 A;  1OJ4 A;  4NXN I;  3CWV A;  2L3J A;  4JYA I;  4DR6 E;  1A6F A;  2VQF I;  4DV1 E;  4JI8 I;  4RPF A;  2GS8 A;  1WUU A;  4EMD A;  1Z0B A;  2UU9 I;  4OX9 I;  2B3T B;  4K0K E;  4NXM I;  2V34 A;  2A2D A;  2LTS A;  4AQY I;  3ADJ A;  4B3T E;  4X65 I;  1T4N A;  4Z7C A;  4JI4 I;  2UXC I;  4DPU A;  1KKH A;  4GKJ E;  5A2Q Q;  4FW9 A;  1X47 A;  4FWD A;  2X7I A;  5IWA I;  1NHJ A;  1I94 I;  4JI7 I;  4GKK E;  4YHH I;  1J5E E;  4DR7 I;  2L3C A;  4DV0 I;  3K17 A;  3T1H E;  4P7A A;  4DUY I;  2V2Z A;  2LJH A;  5LL6 R;  4FWH A;  1N36 I;  1S16 A;  2RS7 A;  2LBS B;  4UT4 A;  1N32 I;  2UXB I;  2NPF A;  2F4V I;  4DU8 A;  3WU6 A;  2N3H A;  3T1Y E;  4DR1 E;  5GMD A;  4DKK A;  2R42 A;  4X62 E;  1KIJ A;  4DV5 I; 
#chains in the Genus database with same CATH topology
 3KZZ A;  1NEI A;  4LFB E;  2LV2 A;  2C39 B;  1ZBQ A;  4DPY A;  2ELY A;  2EQ0 A;  5FLX C;  1Y5Y A;  3PS2 A;  5AAS A;  1X6F A;  4X64 I;  2E1R A;  2YSO A;  4DMI A;  1XMQ I;  1ZXM A;  1T4O A;  4JV5 E;  2M1S A;  2M4I A;  4R03 A;  2V2V A;  2R1F A;  4IFD B;  4USK A;  2O3Z A;  2KON A;  4LCG A;  3B4T A;  1IQO A;  2WNR B;  4F9C B;  1YYW A;  5DRP A;  2EP3 A;  1YUJ A;  1HNW I;  4WUB A;  4MYT A;  1N33 E;  2EM8 A;  4DR5 I;  3ADL A;  1A1J A;  4JI5 I;  1R6L A;  4B3M I;  1J26 A;  3P3G A;  1BBO A;  2ZM6 E;  4I8O A;  3GME A;  4WSG A;  3M6A A;  4IFD C;  4LF7 I;  1HR0 E;  2EN8 A;  1ELO A;  3LPS A;  4DV7 I;  2ZIT A;  4O4K A;  4LF9 E;  4MQY A;  4O5G A;  3KZY A;  4DUZ E;  1UDO A;  4JI1 I;  4LF6 E;  3HTX A;  2PO0 A;  2EPA A;  1P47 A;  4IZJ A;  4B3R E;  4HY1 A;  4MU1 A;  5KL7 A;  3H4L A;  4IFD D;  3P06 A;  1ZU1 A;  2ODR C;  2JR1 A;  2V8Q B;  3IWC A;  1LLM C;  2L2K B;  1YYK A;  5EKW A;  4JI0 I;  4BA1 B;  4F9A B;  4WXC A;  2EMC A;  1DI2 A;  1Z0W A;  1EH6 A;  5A6K A;  3OTO E;  1E3H A;  2Z5B B;  2RTX A;  1Z5A A;  4FN5 A;  1UHZ A;  4LF8 E;  1N3G A;  1YSA C;  4YY3 I;  2GHF A;  5LLQ A;  3JAM C;  1XNR I;  2FGG A;  2VF3 A;  1MGT A;  4ZYD A;  2E5L E;  1Z1B A;  2ODR D;  5LMU I;  4LFA I;  4U3D A;  4DU7 A;  2EOS A;  1XNQ I;  2JT2 A;  2AJ4 A;  4B3S I;  1GQE A;  2MDR A;  2YTJ A;  3BGH A;  5K36 B;  4LF5 I;  2EOO A;  2V86 A;  1JK2 A;  1RRE A;  4LFC I;  4JI3 I;  4BCA A;  3F6H A;  2GPI A;  4DV4 I;  1XMO E;  5FWK A;  3AV0 A;  4JI2 E;  4IFD F;  5LMN E;  4HXZ A;  2EM3 A;  2J7K A;  4P78 A;  4NXN E;  1UDS A;  2FTX B;  1T38 A;  2MC6 A;  3JAM Q;  4JYA E;  2DEI A;  2JEA B;  2GQ0 A;  5JEA B;  1PIE A;  2VQF E;  4M30 A;  1YYO A;  5K36 C;  2NA2 A;  1H73 A;  4JI8 E;  4TUG A;  3EPK A;  2R42 A;  2BR2 A;  4NHR A;  1HNX E;  1X6H A;  3JU0 A;  2HHH E;  2BM0 A;  2WBS A;  3PYG A;  2XEX A;  2Z5E A;  4HYM A;  4DR2 I;  2CSH A;  2JE6 B;  2C39 A;  4IFD E;  1KTV A;  1Z5C A;  1WRJ A;  4HEI A;  4L5N C;  5IT9 C;  5KL3 A;  2YTN A;  2UU9 E;  3J80 C;  4OX9 E;  1PJQ A;  1AH5 A;  2DGC A;  3UHM A;  4NXM E;  3ZKD A;  4DR4 I;  5K36 D;  1T4L B;  1ZXN A;  4Z7Y A;  4IFD A;  1P42 A;  2WNR A;  2EN4 A;  4FW4 A;  4AM3 A;  3ZOQ B;  1USV A;  3THN A;  4X65 E;  3EPJ A;  2HJJ A;  5JEA D;  1IQS A;  2ENH A;  2EFG A;  2Z5C A;  2EN7 A;  4P52 A;  3C6K A;  1JK1 A;  4JI4 E;  2LO3 A;  2NN6 B;  3C6M A;  4M2Z A;  3MHS C;  2PRT A;  1ZAA C;  1IBL I;  4JG4 A;  2OI2 A;  2EPK X;  4L8N A;  5IT9 Q;  3J80 Q;  5CFF E;  2DLQ A;  4F9B B;  3QG5 C;  1K47 A;  4DV2 I;  2CZ9 A;  4IZK B;  2BB8 A;  5KL4 A;  2VQE I;  2EM7 A;  5IWA E;  5K36 F;  2RPC A;  5A69 A;  3D4J A;  5KL6 A;  4KWY A;  4JI7 E;  4BA1 A;  2UUA E;  3B78 A;  2YTI A;  2Z5B A;  4LPF A;  2PNM A;  3PS1 A;  1NHI A;  1A1K A;  4DR7 E;  3B82 A;  2O1T A;  4DV0 E;  1UDQ A;  1FI4 A;  4DUY E;  1TN9 A;  4AIM A;  1EH7 A;  2EPL X;  2NN6 D;  2MKN A;  4GKJ I;  1WJP A;  1D6T A;  2L6M A;  4WYQ B;  4GEQ B;  5K36 E;  4DR3 I;  2L2M A;  5AC5 A;  1N36 E;  2MKD A;  3Q6N A;  1N32 E;  2WBU A;  4X9J A;  2UXB E;  2AE8 A;  2O1U A;  2F4V E;  2JXP A;  3CDJ A;  4DV6 I;  2MDG A;  3EPL A;  2BA0 D;  2IOP A;  5K36 A;  2F8B A;  4R2S A;  2N3G A;  2V2Q A;  3WU5 A;  3B8H A;  2EMZ A;  4N3O A;  2YTO A;  5JEA E;  4KHP I;  2WCC 3;  4DV5 E;  1Z0V A;  2EMX A;  1Z5B A;  4N4R B;  3QT6 A;  2EOJ A;  3HKM A;  4HAC B;  2G7H A;  2EPP A;  2EOX A;  1Y4S A;  5JEA A;  3M85 G;  2RQL A;  3P1X A;  4X64 E;  4DPT A;  4X8W A;  1XMQ E;  1PJS A;  1DQ3 A;  2ADR A;  3PS3 A;  2DIX A;  4RHB B;  1NZ0 A;  4TUI A;  2JE6 A;  1N34 E;  2LCE A;  1PDA A;  2NAB A;  1DAR A;  3T1Y I;  2HK2 A;  4M1K A;  2YU8 A;  5DNX A;  1RHY A;  2R3V A;  4JI5 E;  2V88 A;  4DR5 E;  1KVK A;  4LF4 I;  2LVH A;  2BA1 G;  2HKJ A;  1VIS A;  4PRX A;  1S4E A;  3M7N D;  3H1C A;  4FW6 A;  4FWG A;  4AID A;  5IXM B;  1OYP A;  4JI6 I;  3AUZ A;  2EM2 A;  4LF7 E;  2NN6 E;  1EKZ A;  5FLX Q;  3HPS A;  4FW7 A;  2DLK A;  1X48 A;  2EL6 A;  4P7D A;  4DV7 E;  1FKA E;  1FWK A;  3DD6 A;  3L00 A;  4ED4 A;  1UDN A;  2I9I A;  2NN6 A;  2EOF A;  4JI1 E;  2WZO A;  1QU6 A;  1UEK A;  4OO1 B;  1XHK A;  4O24 A;  2EL5 A;  1A1G A;  4JI0 E;  5GME A;  4DXL A;  1NHH A;  5C0X B;  2UUC I;  3VYY A;  3HPZ A;  4X66 I;  2EJ4 A;  2EMB A;  4IZK A;  4DPX A;  4IS1 C;  2WP8 B;  3FIG A;  3ZZ0 A;  3QT5 A;  1ZR9 A;  2EOM A;  1DGC A;  2LJP A;  2HC5 A;  1XNR E;  3QT7 A;  3U1K A;  2UUB I;  3V5R A;  2EOY A;  2EOR A;  5LMU E;  4LFA E;  4WSP A;  5AC4 A;  2PNL A;  4OO1 C;  4Q28 A;  1RQ0 A;  2EPM X;  2JOX A;  4LTY A;  3L7Z B;  4DV3 I;  4LCF A;  1FJG I;  4MDT A;  2ZBK B;  1OYS A;  1XNQ E;  3VHT B;  2L2N A;  4R2R A;  4B3S E;  4BHB A;  1X3C A;  4FK5 C;  2EN3 A;  3F0N A;  4LF5 E;  3P3C A;  1L4S A;  4OO1 D;  2M9A A;  3C4B A;  5C0X D;  4WUC A;  4U3B A;  3GLL A;  1AAY A;  4USM A;  2EN6 A;  2I13 A;  2C38 B;  1A1I A;  1H7U A;  1SFE A;  2EM4 A;  2UXD I;  1PKP A;  2EMG A;  3BBG A;  1HNZ I;  4OOG C;  2VF1 A;  1IBM I;  3QT8 A;  2A2C A;  3PRY A;  3P76 A;  5BR8 E;  1IBK I;  3HQ1 A;  1T39 A;  1ZM9 A;  4DR2 E;  1UN6 B;  4R2D A;  4HAC A;  2RSM A;  4M0V A;  4WFT A;  1STU A;  2ENA A;  5JEA C;  2CG9 A;  3IWB A;  4HTG A;  5L3J A;  2PNZ B;  4UTG A;  2LRS A;  4BMJ A;  4DR4 E;  5A6J A;  1ZM4 A;  2D9H A;  1EA6 A;  4DR6 I;  2YZT A;  3J81 C;  4DV1 I;  1YZ9 A;  4OO1 F;  1BBG A;  2N8X A;  4AQY E;  2J65 A;  5T6J A;  2LT7 A;  2J7J A;  5TSE A;  1UBD C;  2YRM A;  1HNX I;  2HFS A;  1A1H A;  2HHH I;  3VK6 A;  2V87 A;  2X36 A;  4O43 A;  1KJK A;  1RMD A;  3MHH C;  2YPN A;  3PYE A;  3DJW A;  2UXC E;  2V8P A;  4QNJ A;  4DPW A;  3VYX A;  4K0K I;  1IBL E;  1YPN A;  1RC7 A;  4M9V C;  4OKG A;  2CGE A;  5A2Q C;  2EMI A;  5ADZ A;  2F1D A;  2C37 B;  1ZM2 A;  4OO1 E;  3PYD A;  2DMY A;  4DV2 E;  5C0X E;  1X6E A;  1I94 E;  2VQE E;  1B62 A;  2EMK A;  2EPN A;  2NN6 C;  3J81 Q;  4B3T I;  1H7S A;  2JOB A;  5DRO A;  4PRV A;  3ADG A;  3LML A;  1YH8 A;  2RS6 A;  4OO1 A;  5C0X A;  3MSW A;  1QZR A;  2E1M A;  1N0V C;  5BR8 I;  4YHH E;  5AE3 A;  4R1F A;  1H72 C;  2EN2 A;  2IER A;  2HGH A;  2WP8 A;  2HFU A;  4ZVI A;  2PO0 B;  4QNK A;  1N0U A;  2V89 A;  2EQ1 A;  5JEA F;  1R6M A;  2EPZ A;  1Z0G A;  2JVA A;  2IHR 1;  3EPH A;  4F2J C;  1MU5 A;  2GO3 A;  1EI1 A;  3HJC A;  2JEB B;  4DR3 E;  5F3W A;  2Q2E B;  2BBG A;  3L7Z A;  4KQV A;  3LTO A;  3U1Y A;  4DV6 E;  3WU3 A;  2DRP A;  4ZYE A;  4GKK I;  3HUL A;  3M85 D;  3WU4 A;  2UUA I;  1J5E I;  1SR9 A;  2EQ3 A;  2YTP A;  2KHX A;  3T1H I;  2B7V A;  5ELW A;  1ZBT A;  3C4T A;  3DF6 A;  4KHP E;  4FW5 A;  3LLH A;  2C38 A;  2BV3 A;  2LTR A;  3PYF A;  2JEA A;  4BA2 B;  3CDI A;  2EOE A;  5AE1 A;  3ZZU A;  2B7T A;  5A6B D;  2RSI A;  1O0W A;  3F6G A;  3ZZT A;  4MLQ A;  4LOM A;  2EE8 A;  1B63 A;  2NN6 F;  2LJU A;  3BF2 A;  4WUD A;  2JP9 A;  2YTF A;  1MG7 A;  3Q1Q A;  2YT4 A;  4DR1 I;  2A25 A;  4X62 I;  1HNW E;  2V83 A;  2EM9 A;  2EOH A;  4F6N A;  2EM0 A;  2NUF A;  2PNZ A;  4B3M E;  1H74 A;  2BR2 B;  4NBQ A;  1YFH A;  4LF4 E;  4LFB I;  4XTJ A;  1X49 A;  2CT1 A;  2JY9 A;  2EPU A;  4BC9 A;  4JI6 E;  5IV8 B;  2BA0 G;  4LCH A;  2E72 A;  1WHN A;  3ADI A;  5AE2 A;  4JV5 I;  2O1W A;  2YWQ A;  1Z0T A;  4ISA A;  1USU A;  1N34 I;  1BKN A;  3ECR A;  1MEY C;  3H09 A;  2EMW A;  1N33 I;  2EPO A;  3LNU A;  2MC5 A;  2C37 A;  4R8O A;  3THO B;  2UUC E;  2NUG A;  2ZM6 I;  3K6Q A;  3ZKB A;  4MYU A;  2Z5C B;  4X66 E;  4IS9 A;  2JWO A;  3M99 B;  1HR0 I;  4YY3 E;  2K4V A;  1GTK A;  2LUQ A;  3JTZ A;  2LMZ A;  2VE7 C;  4WXD A;  2EZ6 A;  4GQU A;  1U2R A;  5DNL A;  2YTQ A;  1A1F A;  2DEJ A;  3J7Y p;  2UUB E;  4LF9 I;  4MU0 A;  4DUZ I;  2CTD A;  5C0X C;  1EH8 A;  2L33 A;  5DNY A;  4LF6 I;  4I3H A;  2YTD A;  4B3R I;  4DV3 E;  1FJG E;  3M7N G;  3HXL A;  1F2I G;  2BM1 A;  2WW4 A;  2EPX A;  2DSY A;  3TQM A;  5A6B A;  5KL2 A;  2IES A;  3GON A;  2EM5 A;  1GZ6 A;  1A1L A;  4Q35 B;  4BBY A;  1HK7 A;  3OTO I;  4LFC E;  4JI3 E;  2ELZ A;  3UK3 C;  4DV4 E;  2NUE A;  1MX0 A;  1PVG A;  1RR9 A;  3Q6M A;  4LF8 I;  3J7A G;  1UIL A;  2JEB A;  2YU5 A;  1NCS A;  2CVE A;  4R2E A;  2PO2 B;  2E5L I;  2EPR A;  2M7Q A;  4R2Q A;  4PU9 A;  3ZM7 A;  1FWL A;  4J3D A;  3K1J A;  2UXD E;  4BC7 A;  1G2D C;  1VI7 A;  1IMU A;  1Z0E A;  2EPC A;  1KYQ A;  2YRK A;  1HNZ E;  2CPN A;  2JYA A;  1Y6Z A;  1Z0C A;  2HK3 A;  2HKE A;  3V2U C;  2DB2 A;  2PO1 B;  3K85 A;  3EQ1 A;  1IBM E;  1YUI A;  4URL A;  2JPA A;  2DMI A;  1IBK E;  4BA2 A;  2LUP B;  4F54 A;  5DRR A;  2EMY A;  1FNM A;  1ZM3 A;  1XMO I;  4MU3 A;  2LE2 A;  4J8Z A;  2L92 A;  1WHQ A;  2VRD A;  5LMN I;  4JI2 I;  3OML A;  1Z59 A;  1OJ4 A;  4NXN I;  3CWV A;  2EM6 A;  1TF6 A;  2EL4 A;  2L3J A;  4JYA I;  1QNT A;  2Q8U A;  4DR6 E;  2EOI A;  1A6F A;  5KL5 A;  2VQF I;  1PJT A;  4DV1 E;  4ZYG A;  3KRN A;  2FV4 B;  5C0X F;  4JI8 I;  4RPF A;  2GS8 A;  1WUU A;  4KZS A;  5A6A A;  4EMD A;  2R76 A;  4BHC A;  1Z0B A;  2UU9 I;  4WPY A;  4OX9 I;  2IOQ A;  4MLV A;  2B3T B;  4K0K E;  4NXM I;  5EL9 A;  4R2A A;  4R2C A;  2GLI A;  2GO4 A;  4IJD A;  3RMP A;  2V34 A;  2A2D A;  4FW3 A;  3GCM A;  3IWD A;  2LTS A;  4AQY I;  1OYR A;  3ADJ A;  4B3T E;  1XXE A;  4X65 I;  1E3P A;  1T4N A;  4Z7C A;  3J7A M;  4RH8 A;  4JI4 I;  2L8T A;  3P3E A;  2EN1 A;  2YTE A;  4IZJ B;  2UXC I;  4F6M A;  2O1V A;  4DPU A;  1G2F C;  1KKH A;  1X5W A;  2WBT A;  4GKJ E;  1Y4U A;  2EMF A;  5A2Q Q;  2EML A;  2H36 X;  4FW9 A;  1X47 A;  4FWD A;  2X7I A;  2YRH A;  4OZE A;  5IWA I;  2VES A;  1NHJ A;  1I94 I;  3NZK A;  4JI7 I;  2ENC A;  1TF3 A;  4WX9 A;  4GZN C;  4GKK E;  1B69 A;  4YHH I;  2YSP A;  1J5E E;  5DRQ A;  4DR7 I;  2L3C A;  4DV0 I;  1WXR A;  2EMA A;  3T1H E;  3K17 A;  4P7A A;  4DUY I;  2V2Z A;  2B9D A;  2LJH A;  2PO2 A;  2EWL A;  4MU4 A;  5LL6 R;  2KOU A;  4R2P A;  1YHC A;  4IZJ D;  4FWH A;  4LU9 A;  2EOZ A;  1N36 I;  1S16 A;  2RS7 A;  2LBS B;  1Y60 A;  2BA1 D;  3BID A;  1BB8 A;  4NZV A;  4UT4 A;  1N32 I;  3KWR A;  2EMH A;  4ZYH A;  2NPF A;  2F4V I;  2PO1 A;  2UXB I;  2V85 A;  2YTG A;  4DU8 A;  3WU6 A;  2N3H A;  3T1Y E;  4DR1 E;  5GMD A;  2K7I A;  4DKK A;  4X62 E;  1KIJ A;  4DV5 I;  4BS9 A;  2EOQ A; 
#chains in the Genus database with same CATH homology
 4LFB E;  1ZBQ A;  4DPY A;  5FLX C;  5AAS A;  4X64 I;  2E1R A;  1XMQ I;  4DMI A;  1ZXM A;  1T4O A;  4JV5 E;  2M1S A;  2M4I A;  4R03 A;  2V2V A;  4USK A;  2KON A;  4F9C B;  1YYW A;  1HNW I;  4WUB A;  4MYT A;  1N33 E;  4DR5 I;  4JI5 I;  3ADL A;  4B3M I;  1J26 A;  2ZM6 E;  4I8O A;  3M6A A;  4LF7 I;  1HR0 E;  1ELO A;  3LPS A;  4DV7 I;  2ZIT A;  4LF9 E;  4DUZ E;  4JI1 I;  4LF6 E;  3HTX A;  4IZJ A;  4B3R E;  4HY1 A;  3H4L A;  3P06 A;  2ODR C;  1YYK A;  2JR1 A;  2V8Q B;  3IWC A;  2L2K B;  4JI0 I;  4F9A B;  1DI2 A;  1Z0W A;  3OTO E;  2Z5B B;  4FN5 A;  2RTX A;  1Z5A A;  1UHZ A;  4LF8 E;  4YY3 I;  3JAM C;  1XNR I;  2FGG A;  2VF3 A;  2E5L E;  2ODR D;  5LMU I;  4LFA I;  4DU7 A;  1XNQ I;  2AJ4 A;  4B3S I;  1GQE A;  2MDR A;  4LF5 I;  2V86 A;  1RRE A;  4LFC I;  4JI3 I;  4BCA A;  3F6H A;  4DV4 I;  1XMO E;  5FWK A;  3AV0 A;  4JI2 E;  5LMN E;  4HXZ A;  2J7K A;  4P78 A;  4NXN E;  2FTX B;  3JAM Q;  2MC6 A;  4JYA E;  2DEI A;  2GQ0 A;  1PIE A;  2VQF E;  4M30 A;  1YYO A;  2NA2 A;  1H73 A;  4JI8 E;  4TUG A;  2R42 A;  1HNX E;  2BM0 A;  3JU0 A;  2HHH E;  3PYG A;  4HYM A;  5BR8 I;  2XEX A;  2Z5E A;  4DR2 I;  1KTV A;  1Z5C A;  4L5N C;  5IT9 C;  2UU9 E;  4OX9 E;  3J80 C;  3ZKD A;  4NXM E;  4DR4 I;  1T4L B;  1ZXN A;  4Z7Y A;  3ZOQ B;  1USV A;  4X65 E;  2EFG A;  2Z5C A;  4P52 A;  4JI4 E;  4M2Z A;  1IBL I;  4JG4 A;  2OI2 A;  4L8N A;  5IT9 Q;  3J80 Q;  5CFF E;  4F9B B;  1K47 A;  4DV2 I;  2CZ9 A;  4IZK B;  2VQE I;  5IWA E;  3D4J A;  4JI7 E;  2UUA E;  3B78 A;  2Z5B A;  2PNM A;  1NHI A;  4DR7 E;  3B82 A;  2O1T A;  4DV0 E;  1FI4 A;  4DUY E;  4GKJ I;  1D6T A;  2L6M A;  4WYQ B;  4GEQ B;  4DR3 I;  2L2M A;  1N36 E;  3Q6N A;  1N32 E;  2UXB E;  4DV6 I;  2O1U A;  2F4V E;  2IOP A;  2F8B A;  2N3G A;  2V2Q A;  3WU5 A;  3B8H A;  4N3O A;  4KHP I;  4DV5 E;  1Z0V A;  1Z5B A;  3QT6 A;  4HAC B;  2G7H A;  1Y4S A;  3P1X A;  4X64 E;  4DPT A;  4X8W A;  1XMQ E;  1DQ3 A;  2DIX A;  1NZ0 A;  4TUI A;  1N34 E;  1DAR A;  3T1Y I;  2HK2 A;  4M1K A;  2R3V A;  4JI5 E;  2V88 A;  4DR5 E;  1KVK A;  4LF4 I;  2HKJ A;  1VIS A;  4PRX A;  1S4E A;  4FWG A;  4JI6 I;  3AUZ A;  4LF7 E;  1EKZ A;  5FLX Q;  3HPS A;  1X48 A;  4DV7 E;  4P7D A;  1FKA E;  1FWK A;  4ED4 A;  4JI1 E;  2WZO A;  1QU6 A;  1UEK A;  1XHK A;  4DXL A;  4JI0 E;  5GME A;  2UUC I;  1NHH A;  3VYY A;  3HPZ A;  4X66 I;  4IZK A;  4DPX A;  3FIG A;  3ZZ0 A;  3QT5 A;  2LJP A;  1XNR E;  3QT7 A;  2UUB I;  3V5R A;  5LMU E;  4LFA E;  4WSP A;  2PNL A;  4Q28 A;  2JOX A;  1RQ0 A;  4LTY A;  4DV3 I;  1FJG I;  2ZBK B;  1XNQ E;  2L2N A;  4B3S E;  3F0N A;  4LF5 E;  3C4B A;  4WUC A;  4USM A;  1H7U A;  2UXD I;  1PKP A;  1HNZ I;  4OOG C;  2VF1 A;  1IBM I;  3QT8 A;  2A2C A;  3PRY A;  5BR8 E;  1IBK I;  3HQ1 A;  1ZM9 A;  4DR2 E;  4HAC A;  2RSM A;  4M0V A;  4WFT A;  1STU A;  2CG9 A;  3IWB A;  5L3J A;  4UTG A;  2LRS A;  4BMJ A;  4DR4 E;  1ZM4 A;  1EA6 A;  4DR6 I;  2YZT A;  3J81 C;  4DV1 I;  1YZ9 A;  4AQY E;  5T6J A;  1HNX I;  2HFS A;  2HHH I;  3VK6 A;  2V87 A;  2X36 A;  3PYE A;  3DJW A;  2UXC E;  2V8P A;  4DPW A;  3VYX A;  4K0K I;  1IBL E;  1RC7 A;  2CGE A;  5A2Q C;  5ADZ A;  1ZM2 A;  3PYD A;  2DMY A;  4DV2 E;  1I94 E;  2VQE E;  1B62 A;  4B3T I;  3J81 Q;  1H7S A;  2JOB A;  4PRV A;  3ADG A;  3LML A;  2RS6 A;  3MSW A;  1QZR A;  2E1M A;  1N0V C;  4YHH E;  5AE3 A;  4R1F A;  1H72 C;  4ZVI A;  2HFU A;  1N0U A;  2V89 A;  1Z0G A;  2JVA A;  2IHR 1;  1MU5 A;  1EI1 A;  3HJC A;  4DR3 E;  5F3W A;  2Q2E B;  4KQV A;  3LTO A;  4DV6 E;  3WU3 A;  4GKK I;  3HUL A;  3WU4 A;  2UUA I;  1J5E I;  1SR9 A;  2KHX A;  3T1H I;  2B7V A;  1ZBT A;  3C4T A;  3DF6 A;  4KHP E;  3LLH A;  2BV3 A;  2LTR A;  3PYF A;  5AE1 A;  3ZZU A;  2B7T A;  1O0W A;  3F6G A;  3ZZT A;  1B63 A;  4WUD A;  1MG7 A;  3Q1Q A;  2YT4 A;  4DR1 I;  4X62 I;  1HNW E;  2V83 A;  2NUF A;  4B3M E;  1H74 A;  4LF4 E;  4LFB I;  4XTJ A;  1X49 A;  2JY9 A;  4BC9 A;  4JI6 E;  1WHN A;  3ADI A;  5AE2 A;  4JV5 I;  2O1W A;  1Z0T A;  1USU A;  1N34 I;  1BKN A;  3H09 A;  1N33 I;  3LNU A;  2MC5 A;  4R8O A;  2UUC E;  2NUG A;  2ZM6 I;  3K6Q A;  3ZKB A;  4MYU A;  2Z5C B;  4X66 E;  2JWO A;  1HR0 I;  4YY3 E;  2K4V A;  2LUQ A;  3JTZ A;  2EZ6 A;  2LMZ A;  2VE7 C;  1U2R A;  2DEJ A;  2UUB E;  3J7Y p;  4LF9 I;  4DUZ I;  5DNY A;  2L33 A;  4LF6 I;  4I3H A;  4B3R I;  4DV3 E;  1FJG E;  3HXL A;  2BM1 A;  2WW4 A;  2DSY A;  3GON A;  1GZ6 A;  4BBY A;  1HK7 A;  3OTO I;  4LFC E;  4JI3 E;  2NUE A;  4DV4 E;  1MX0 A;  1RR9 A;  3Q6M A;  1PVG A;  4LF8 I;  3J7A M;  3J7A G;  1UIL A;  2E5L I;  4PU9 A;  2M7Q A;  3ZM7 A;  1FWL A;  3K1J A;  2UXD E;  4BC7 A;  1Z0E A;  1HNZ E;  1Z0C A;  2HK3 A;  2CPN A;  1Y6Z A;  2HKE A;  3V2U C;  2DB2 A;  3K85 A;  1IBM E;  4URL A;  1IBK E;  2LUP B;  4F54 A;  1FNM A;  1ZM3 A;  1XMO I;  2LE2 A;  4J8Z A;  2L92 A;  1WHQ A;  4JI2 I;  5LMN I;  3OML A;  1Z59 A;  1OJ4 A;  4NXN I;  3CWV A;  2L3J A;  4JYA I;  4DR6 E;  1A6F A;  2VQF I;  4DV1 E;  2FV4 B;  4JI8 I;  4RPF A;  2GS8 A;  1WUU A;  4KZS A;  4EMD A;  1Z0B A;  2UU9 I;  4WPY A;  4OX9 I;  2IOQ A;  2B3T B;  4K0K E;  4NXM I;  3RMP A;  2V34 A;  2A2D A;  3IWD A;  2LTS A;  4AQY I;  3ADJ A;  4B3T E;  4X65 I;  1T4N A;  4Z7C A;  4JI4 I;  2L8T A;  4IZJ B;  2UXC I;  2O1V A;  4DPU A;  1KKH A;  4GKJ E;  1Y4U A;  5A2Q Q;  2H36 X;  4FW9 A;  1X47 A;  4FWD A;  2X7I A;  5IWA I;  1NHJ A;  1I94 I;  4JI7 I;  4GKK E;  4YHH I;  1J5E E;  4DR7 I;  2L3C A;  4DV0 I;  1WXR A;  3K17 A;  3T1H E;  4P7A A;  4DUY I;  2V2Z A;  2B9D A;  2LJH A;  2EWL A;  5LL6 R;  2KOU A;  4IZJ D;  4FWH A;  4LU9 A;  1N36 I;  1S16 A;  2RS7 A;  2LBS B;  4UT4 A;  1N32 I;  2UXB I;  3KWR A;  2NPF A;  2F4V I;  2V85 A;  4DU8 A;  3WU6 A;  2N3H A;  3T1Y E;  4DR1 E;  5GMD A;  4DKK A;  4X62 E;  1KIJ A;  4DV5 I;  4BS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...