4DR6E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr6E02
1QU6A 1N36E 2UUAI 3V5RA 2UXDI 4X65E 4FWHA 1Z0TA 1H7SA 2X7IA 1Z0GA 2B7VA 4DV4I 2Q2EB 2IHR1 3C4BA 1HNZE 4FN5A 4DV1E 1HNWI 1H72C 2XEXA 2L2MA 2HK3A 4P52A 3J80Q 2DEIA 3JAMQ 3B8HA 5IWAI 4DV6E 4LFCI 1K47A 2VQEI 4JI3I 5IWAE 1Z59A 4DR2E 4DR5E 2RS6A 4X66E 4JG4A 2ZM6I 2E5LI 2L3CA 3HTXA 4LF8I 1N33I 1Z0WA 4NXNE 1DARA 3PYDA 2DMYA 4DR3E 4DUZI 1A6FA 4JI7I 3J7AG 4M1KA 1HNXI 1N34I 2A2DA 2V34A 1ZM4A 4DV2E 4DR4I 3B78A 4JI8E 4DR4E 1RR9A 2VQFI 4UT4A 1NHIA 2R42A 4HACB 1IBME 4WUBA 5LMUI 1NHJA 2UXCE 1UILA 3P1XA 4JI6E 1XNRE 4JI4E 4DPYA 2J7KA 2EZ6A 4DXLA 4LF9I 4DV0I 4X64E 2NA2A 1PIEA 1WUUA 4DUYE 4WUDA 4JI1I 3K17A 4JI1E 4DV7E 4JI5I 1RREA 3T1HI 5A2QC 5FLXC 4AQYE 3QT5A 4JI2I 1Z0EA 1UHZA 1O0WA 2EFGA 2N3HA 4PU9A 4B3RE 1KIJA 2NUGA 1NZ0A 2NPFA 2JVAA 1I94E 2LJHA 5CFFE 2F4VE 4Z7YA 3GONA 4DPUA 4LFAI 4OOGC 4OX9I 2V2VA 4X8WA 4HXZA 1ZBTA 3J7AM 2L2NA 4KQVA 3QT7A 2DB2A 3V2UC 1N36I 4X65I 4MYUA 4B3ME 4B3TI 4B3TE 1Z5BA 1ZM2A 4K0KE 4P7AA 2RS7A 1FKAE 5BR8E 4JV5E 1HNZI 1DI2A 4DV1I 1ELOA 1ZM3A 3B82A 4DR7E 2BM1A 2ZBKB 3LPSA 4DV3E 1PKPA 4NXME 4WFTA 5IT9C 3WU4A 1N0UA 5LMNE 4DV6I 1HR0E 2L33A 2DIXA 3LLHA 5GMEA 1UEKA 4DR2I 2RSMA 4DR5I 4PRXA 4X66I 4M30A 1X49A 1N32E 1FWLA 4Z7CA 4NXNI 1S4EA 4DR3I 1YYOA 3T1YI 3T1YE 3H4LA 5A2QQ 2YT4A 4GKKE 5FLXQ 4PRVA 1IBKE 4LF6E 1S16A 2CZ9A 4DV2I 3ZKDA 4JI8I 1RC7A 3QT6A 1IBMI 4HYMA 1XHKA 1B63A 3CWVA 2UXCI 4FWDA 2B7TA 2UXBE 2LTSA 2V8PA 4B3SE 1FJGE 4JI6I 1MG7A 2BM0A 1XNRI 4JI4I 2V2ZA 3K1JA 5GMDA 1X48A 1ZXMA 4DV5E 4UTGA 2V2QA 1WHNA 4X64I 3WU6A 1STUA 2X36A 2LRSA 4DUYI 3ADGA 2B3TB 4JYAE 2CPNA 3LNUA 1Z0CA 1RQ0A 4DV7I 4KHPI 4KHPE 3PYFA 4R1FA 3OTOE 3C4TA 4DPWA 2BV3A 1PVGA 4AQYI 4WYQB 2UUBI 4X62E 2UUBE 3ADIA 1YYKA 4B3RI 4YY3E 1H73A 3ZKBA 4RPFA 1XMOE 3PYGA 4DU7A 4ZVIA 2L2KB 1I94I 4LFBE 2OI2A 1X47A 2DEJA 3J81C 1IBLI 2HKJA 2A2CA 1IBLE 2F4VI 3F0NA 1MU5A 3ZZ0A 4DR1E 1FNMA 4GKJE 1YYWA 4WUCA 2R3VA 4URLA 1NHHA 4B3MI 4LF5E 1XNQI 3J7Yp 1XNQE 1Z0BA 4LF7E 1FI4A 4K0KI 4JI0E 3ADJA 5BR8I 4YHHE 2HFSA 4JV5I 3WU5A 4EMDA 1KTVA 3VYXA 2LUQA 1BKNA 2HKEA 4DR7I 4DR6E 2UUAE 3D4JA 2UXDE 2NUEA 1T4NA 2KHXA 4DV3I 4NXMI 2LBSB 5LMNI 1HR0I 2N3GA 1N32I 4DV4E 2ZITA 1Z0VA 1HNWE 2LUPB 4USKA 4ED4A 4GKKI 1WHQA 2VF3A 1ZM9A 1IBKI 4LF6I 2UU9I 1U2RA 4FW9A 2UU9E 3LTOA 2NUFA 1T4LB 2VQEE 4JI3E 4LFCE 1D6TA 1FWKA 2ZM6E 2RTXA 2E5LE 3ADLA 4LF8E 1N33E 4FWGA 1Z5AA 3J81Q 1EKZA 2UXBI 4B3SI 1VISA 2UUCI 1ZXNA 1FJGI 2UUCE 1N0VC 4DUZE 4DPTA 1KVKA 4DV5I 4JI7E 1HNXE 2HHHI 4JYAI 1N34E 2HHHE 3Q1QA 3WU3A 4HACA 2JY9A 4XTJA 4DU8A 4I3HA 2VQFE 1B62A 4LF4I 1T4OA 4LF4E 3OTOI 4DPXA 3ZZUA 5LMUE 1EA6A 2LTRA 5L3JA 3J80C 3JAMC 4X62I 4YY3I 4HY1A 4LF9E 4DV0E 1J5EI 1J5EE 1XMOI 4MYTA 1H74A 4LFBI 4DKKA 2E1RA 5LL6R 2HFUA 2LJPA 1YZ9A 1XMQI 4JI5E 3T1HE 1XMQE 3VYYA 1J26A 1MX0A 2GS8A 5IT9Q 1EI1A 2WW4A 4JI2E 4DR1I 4GKJI 1QZRA 3HULA 1Z5CA 4M2ZA 3QT8A 1H7UA 4LF5I 1OJ4A 2MDRA 4LF7I 3PYEA 2AJ4A 4JI0I 3M6AA 2HK2A 3ZZTA 4YHHI 4LFAE 4OX9E 4USMA 1GQEA 1KKHA 2L3JA 3ZM7A 4DR6I
chains in the Genus database with same CATH superfamily
1QU6A 1N36E 3VK6A 2UUAI 3V5RA 2UXDI 4X65E 4GQUA 1YH8A 1N3GA 3H1CA 4MU1A 2YTIA 4FWHA 2WP8B 2MKDA 2EM8A 1Z0TA 1EH7A 2O1WA 1H7SA 2X7IA 2HJJA 1Z0GA 3BGHA 2B7VA 4DV4I 2EOMA 2YRHA 2Q2EB 5EL9A 2IHR1 1Y60A 2C38A 2EPAA 3QG5C 3L00A 3C4BA 2A25A 1HNZE 4KWYA 4FN5A 4DV1E 2F8BA 1A1IA 1HNWI 5C0XC 1H72C 4BA2A 2XEXA 2L2MA 4N4RB 1ZAAC 2YZTA 1TF6A 2HK3A 2YPNA 4P52A 2ENAA 3J80Q 3UHMA 2DEIA 4FK5C 1R6LA 2DRPA 3JAMQ 3B8HA 2EWLA 2VF1A 5IWAI 4DV6E 4LFCI 1K47A 4HTGA 4IZJB 2VQEI 5IWAE 4JI3I 3M7ND 1Z59A 2EL5A 5F3WA 2BB8A 4DR2E 4NBQA 4DR5E 3MHHC 2JE6A 2CT1A 2RS6A 4X66E 1T39A 3P3GA 4JG4A 2ZM6I 1Y6ZA 2E5LI 2L3CA 3HTXA 3DF6A 4LF8I 1N33I 3IWDA 1Z0WA 4NXNE 1DARA 1AH5A 2EOZA 2EOHA 2DMYA 4DR3E 3PYDA 2PO0B 1E3PA 3AUZA 1VI7A 5JEAD 2EMYA 2PO2A 4R2DA 4DUZI 1A6FA 3DJWA 2EM0A 4JI7I 3J7AG 4WX9A 3Q6NA 4BC7A 1RMDA 2IERA 4M1KA 1HNXI 1N34I 2A2DA 2ELZA 2PNZB 2V34A 1ZM4A 4DV2E 1WRJA 2WZOA 4DR4I 3B78A 4JI8E 4DR4E 3KWRA 2CGEA 3L7ZA 1A1HA 1P42A 2GQ0A 2ODRD 1RR9A 2VQFI 2CG9A 3U1YA 2GPIA 5TSEA 4BHCA 1NHIA 4UT4A 4IFDB 2R42A 4HACB 4DMIA 1IBME 4WUBA 5LMUI 1NHJA 2UXCE 3C6MA 1UILA 3P1XA 1IQOA 2B9DA 2EM9A 4O43A 3EPKA 2EMWA 4JI6E 1XNRE 4JI4E 1KYQA 4DPYA 2J7KA 1EH8A 3H09A 2EZ6A 4DXLA 3ZOQB 1PDAA 2YTPA 4LF9I 4DV0I 4X64E 3KRNA 2NA2A 2JOBA 4BHBA 1PIEA 4DUYE 1WUUA 4WUDA 2C37B 4JI1I 4WXCA 2YTFA 3JU0A 4R2CA 3K17A 4TUIA 4JI1E 2Z5BB 4OO1B 4DV7E 2KONA 5DNXA 2EN8A 4JI5I 1RREA 2EQ1A 3T1HI 2LE2A 5A2QC 1HK7A 5FLXC 2ELYA 1ZR9A 1EH6A 3B4TA 4AQYE 3QT5A 4LFAI 4JI2I 3ECRA 1DGCA 1Z0EA 2JXPA 2F1DA 1UHZA 1O0WA 2ADRA 2EFGA 2N3HA 1X5WA 2O1UA 1ZU1A 4B3RE 3PS3A 4PU9A 4BA1A 2LMZA 1KIJA 1QNTA 2M4IA 2WCC3 2NUGA 1NZ0A 3MHSC 1MEYC 4FW4A 2NPFA 4WXDA 2JVAA 3HQ1A 1I94E 3P3CA 2O1VA 5K36F 2YTOA 2EMIA 2BA0G 2LJHA 2R76A 4AIMA 4QNKA 5CFFE 4LCHA 4FW6A 2F4VE 4Z7YA 4R03A 3P3EA 2DLQA 5K36C 3GONA 2LO3A 5LLQA 4Q28A 2E1MA 4OOGC 4X9JA 2V2VA 4X8WA 5DRRA 1X3CA 2FGGA 2GLIA 1Y5YA 4OX9I 4L5NC 2LT7A 4HXZA 2I9IA 4IZJD 3EPJA 4OKGA 2EJ4A 1B69A 1ZBTA 1A1JA 3J7AM 2L2NA 4KQVA 3QT7A 4P7DA 2DB2A 4MLVA 4GZNC 3EPHA 3V2UC 1N36I 3IWBA 4X65I 4MYUA 3THOB 2LCEA 1YSAC 4B3ME 4U3BA 1SFEA 4B3TI 2JEAA 4B3TE 3BF2A 1Z5BA 1ZM2A 1OYSA 3K85A 2EMZA 1A1GA 4K0KE 3F6HA 3HJCA 2MC5A 5DROA 5JEAE 5IXMB 4OO1E 2L92A 2EOJA 2FV4B 4P7AA 2RS7A 1FKAE 2NN6B 1OYRA 1JK2A 5BR8E 5DNYA 4JV5E 2JWOA 2HC5A 1HNZI 2PO1A 2LVHA 2L6MA 4I8OA 1DI2A 4DV1I 1ELOA 2ENHA 1ZM3A 3B82A 4DR7E 2EP3A 2BM1A 2ZBKB 3LPSA 2DMIA 4R2RA 5DRPA 4IFDD 4O5GA 4U3DA 4DV3E 4BA2B 1PKPA 2V83A 4WFTA 4NXME 5IT9C 5A6JA 3WU4A 2VE7C 1N0UA 5K36A 5LMNE 4DV6I 1HR0E 2L33A 3C6KA 2DIXA 3LLHA 1L4SA 5GMEA 1UEKA 3EPLA 2RSMA 4DR2I 4DR5I 4PRXA 4X66I 2EN1A 1X49A 4M30A 1N32E 1FWLA 1JK1A 3PRYA 2EPCA 4Z7CA 4NXNI 2BA0D 1IMUA 2EOSA 2L8TA 4O24A 1S4EA 2O3ZA 2EM2A 5A6BA 2BR2A 2JE6B 4DR3I 1YYOA 4P78A 3T1YI 2V87A 3T1YE 3H4LA 3P06A 4OO1D 4R2AA 3HPSA 5A2QQ 2YT4A 4GKKE 4IZJA 2EPRA 2EN6A 4PRVA 2CSHA 5FLXQ 4OZEA 3OMLA 2WNRA 2Z5CA 5JEAF 4OO1F 1IBKE 1P47A 5KL3A 4LF6E 2PO2B 1S16A 4RH8A 2CZ9A 4MU4A 4N3OA 5AE2A 2JOXA 3HPZA 4DPUA 4GEQB 2RPCA 1YUIA 4DV2I 2DSYA 2EPMX 2JT2A 3ZKDA 5JEAC 4JI8I 1RC7A 4HEIA 3LMLA 4ISAA 1AAYA 2PNMA 3UK3C 3QT6A 1IBMI 4HYMA 2NN6E 2Z5EA 3U1KA 3KZYA 1B63A 1XHKA 1UBDC 2C39A 2J7JA 3CWVA 2CTDA 3L7ZB 2B7TA 4FWDA 2UXCI 2UXBE 2LTSA 4DR7I 4MU0A 1NCSA 2V8PA 4B3SE 1FJGE 4JI6I 3TQMA 1MG7A 2BM0A 3PS1A 5C0XB 4JI4I 2V2ZA 3K1JA 5GMDA 1XNRI 1X48A 2EOQA 5AE1A 2ODRC 4IZKA 3BIDA 1ZXMA 4F9CB 4DV5E 2VESA 4UTGA 2ENCA 1WHNA 2V2QA 4X64I 4BS9A 1STUA 4M9VC 3WU6A 1ZBQA 2X36A 2AE8A 2K7IA 2LRSA 4DUYI 2EMBA 2YTDA 2B3TB 3ADGA 4ZYEA 1LLMC 2CPNA 4JYAE 1UN6B 1X6HA 4WSGA 2EL6A 1A1KA 2JPAA 3LNUA 2LV2A 1Z0CA 4FW3A 1BBGA 2MDGA 1RQ0A 1T38A 4DV7I 2DGCA 1XXEA 4WPYA 4KHPI 2M1SA 4KHPE 3PYFA 4R1FA 3OTOE 1R6MA 3C4TA 4NHRA 4DPWA 4MDTA 5KL6A 2BV3A 1PVGA 4AQYI 4WYQB 1NEIA 4J3DA 1YPNA 4R2EA 2KOUA 2UUBI 2JR1A 4X62E 1Y4SA 1TN9A 3GLLA 2UUBE 3ADIA 1YUJA 1OYPA 1YYKA 4LPFA 4B3RI 2FTXB 4YY3E 2EM4A 1H73A 2NN6D 4OO1A 4AIDA 5EKWA 2IOPA 5JEAA 3ZKBA 1F2IG 4RPFA 1XMOE 3FIGA 3PYGA 4DU7A 2EM6A 4ZVIA 2L2KB 2NN6F 1I94I 4LFBE 2OI2A 1X47A 3J81C 2DEJA 3Q6MA 4BA1B 2HKJA 2A2CA 1IBLI 1X6FA 1IBLE 1G2DC 1KJKA 4FW5A 2YWQA 2M7QA 2F4VI 2V85A 2IOQA 3F0NA 2YSPA 2YRMA 1MU5A 4IFDE 4IS1C 1Z1BA 4MU3A 2MKNA 2GO3A 3ZZ0A 2EMHA 4F54A 4DR1E 1FNMA 4GKJE 2G7HA 5C0XE 2VRDA 1GTKA 5A6AA 2EM5A 4F6NA 1YYWA 4QNJA 4WUCA 2R3VA 4URLA 4RHBB 1NHHA 4B3MI 4TUGA 2EN2A 5KL4A 4LF5E 4MQYA 5KL2A 1XNQI 2JEBA 3J7Yp 1XNQE 1Z0BA 4LF7E 1FI4A 4K0KI 2EORA 3PS2A 4F6MA 4JI0E 3ADJA 5AC4A 2IESA 2JEAB 5BR8I 4YHHE 1X6EA 2EOYA 2EPUA 4ZYGA 2HFSA 4JV5I 3MSWA 3WU5A 4EMDA 1KTVA 2EQ0A 1Y4UA 3VYXA 2EMKA 4L8NA 2RSIA 5A6KA 4ZYDA 2LUQA 1E3HA 2C38B 2RQLA 2EMXA 1BKNA 2M9AA 4MLQA 1PJTA 2HKEA 2WP8A 4DR6E 4LCGA 2PO1B 2YU5A 2UUAE 4AM3A 3K6QA 2K4VA 2UXDE 2NUEA 1BB8A 3D4JA 1T4NA 2KHXA 4DV3I 4NZVA 4NXMI 2EMAA 1RHYA 4BBYA 3VHTB 2LBSB 2YTNA 2NN6A 5LMNI 2D9HA 3GMEA 1HR0I 4IFDF 5C0XD 1BBOA 4O4KA 2N3GA 2EN4A 4ZYHA 3GCMA 1N32I 5K36B 4DV4E 5C0XF 4IFDC 2JYAA 2JP9A 1PJSA 2ZITA 1Z0VA 4WSPA 4F9BB 1HNWE 2LUPB 3F6GA 2EPZA 4F2JC 4USKA 2N8XA 4ED4A 2CVEA 4GKKI 1UDOA 2BR2B 5KL7A 1WHQA 2VF3A 1ZM9A 2EPNA 1IBKI 5FWKA 4LF6I 2UU9I 4Q35B 1U2RA 4FW9A 2UU9E 4R2PA 3LTOA 4R2QA 2NUFA 3BBGA 2EOOA 2VQEE 1T4LB 4JI3E 3THNA 4LFCE 2WNRB 2Z5CB 3CDJA 4OO1C 1D6TA 1FWKA 2BBGA 2ZM6E 2RTXA 3EQ1A 2PO0A 2E5LE 2LJUA 4LF8E 3ADLA 1N33E 2O1TA 4R2SA 3P76A 4FWGA 1Z5AA 3J81Q 1EKZA 2UXBI 4BMJA 2PNLA 4B3SI 1VISA 2UUCI 1ZXNA 1FJGI 2UUCE 1SR9A 2C39B 1UDSA 2YTEA 1N0VC 2PNZA 4DUZE 4DPTA 1KVKA 4DV5I 2EMGA 2J65A 4JI7E 1USUA 1WXRA 3NZKA 3IWCA 1HNXE 4IZKB 2HHHI 4JYAI 2EPKX 1N34E 2HHHE 3Q1QA 2BA1D 4IFDA 3WU3A 4HACA 2EOXA 2JY9A 5ELWA 2YU8A 4XTJA 1WJPA 4BCAA 2V88A 4DU8A 4I3HA 2VQFE 3HKMA 3M85G 2PRTA 1B62A 5C0XA 4LF4I 2H36X 1T4OA 4F9AB 4LF4E 5K36E 3OTOI 4DPXA 3ZZUA 2EPXA 5LMUE 1EA6A 2LTRA 5L3JA 4J8ZA 2EPPA 2EOIA 3J80C 2EN7A 5AE3A 3JAMC 2Q8UA 2EMLA 2V8QB 4X62I 2DLKA 2C37A 2R1FA 2YRKA 2GO4A 5KL5A 4YY3I 4HY1A 4LF9E 4DV0E 1J5EI 1J5EE 4IJDA 2Z5BA 3DD6A 1XMOI 2V86A 4MYTA 1H74A 4FW7A 1UDQA 2EM7A 3M99B 1G2FC 4LFBI 4DKKA 1TF3A 2E1RA 5JEAB 5LL6R 4LCFA 2HGHA 2HFUA 1UDNA 1YZ9A 2LJPA 2YTQA 1XMQI 2I13A 2YTGA 4JI5E 4LU9A 3T1HE 1XMQE 3VYYA 2V89A 2WBUA 4KZSA 2NN6C 2EE8A 2EM3A 1J26A 2EN3A 1MX0A 2EMFA 1USVA 2GS8A 5IT9Q 4LTYA 5AC5A 2NABA 1EI1A 2WW4A 4JI2E 2EQ3A 2EL4A 4DR1I 2EOEA 5AASA 4GKJI 1QZRA 1A1LA 4R8OA 3HXLA 3HULA 2WBTA 2YTJA 3KZZA 3M7NG 5K36D 1Z5CA 4M2ZA 1A1FA 3CDIA 5A69A 2EPLX 1IQSA 1DQ3A 2EOFA 3QT8A 1H7UA 4LF5I 3JTZA 2GHFA 1PJQA 1OJ4A 2MDRA 4LF7I 2E72A 3PYEA 4BC9A 2EMCA 5A6BD 2AJ4A 5T6JA 4IS9A 3M6AA 4JI0I 2EPOA 3AV0A 4M0VA 2HK2A 2JEBB 3ZZTA 1YHCA 4LFAE 4YHHI 4OX9E 5IV8B 3RMPA 4LOMA 2YSOA 4USMA 5DNLA 1GQEA 5ADZA 2WBSA 3M85D 1GZ6A 1KKHA 1MGTA 2L3JA 2MC6A 3ZM7A 5DRQA 1YFHA 2BA1G 4DR6I
chains in the Genus database with same CATH topology
1QU6A 1N36E 3VK6A 2UUAI 3V5RA 2UXDI 4X65E 4FWHA 1Z0TA 2O1WA 1H7SA 2X7IA 1Z0GA 2B7VA 4DV4I 2Q2EB 2IHR1 3C4BA 1HNZE 4FN5A 4DV1E 2F8BA 1HNWI 1H72C 2XEXA 2L2MA 2YZTA 2HK3A 4P52A 3J80Q 2DEIA 3JAMQ 3B8HA 2EWLA 2VF1A 5IWAI 4DV6E 4LFCI 1K47A 4IZJB 2VQEI 4JI3I 5IWAE 1Z59A 5F3WA 4DR2E 4DR5E 2RS6A 4X66E 4JG4A 2ZM6I 1Y6ZA 2E5LI 2L3CA 3HTXA 3DF6A 4LF8I 1N33I 3IWDA 1Z0WA 4NXNE 1DARA 3PYDA 2DMYA 4DR3E 3AUZA 4DUZI 1A6FA 3DJWA 4JI7I 3J7AG 3Q6NA 4BC7A 4M1KA 1HNXI 1N34I 2A2DA 2V34A 1ZM4A 4DV2E 2WZOA 4DR4I 3B78A 4JI8E 4DR4E 3KWRA 2CGEA 2GQ0A 2ODRD 1RR9A 2VQFI 2CG9A 4UT4A 1NHIA 2R42A 4HACB 4DMIA 1IBME 4WUBA 5LMUI 1NHJA 2UXCE 1UILA 3P1XA 2B9DA 4JI6E 1XNRE 4JI4E 4DPYA 2J7KA 3H09A 2EZ6A 4DXLA 3ZOQB 4LF9I 4DV0I 4X64E 2NA2A 2JOBA 1PIEA 1WUUA 4DUYE 4WUDA 4JI1I 3K17A 3JU0A 4TUIA 4JI1E 2Z5BB 4DV7E 2KONA 4JI5I 1RREA 3T1HI 2LE2A 5A2QC 1HK7A 5FLXC 4AQYE 3QT5A 4JI2I 1Z0EA 1UHZA 1O0WA 2EFGA 2N3HA 2O1UA 4B3RE 4PU9A 2LMZA 1KIJA 2M4IA 2NUGA 1NZ0A 2NPFA 2JVAA 3HQ1A 1I94E 2O1VA 2LJHA 5CFFE 2F4VE 4Z7YA 4R03A 3GONA 4DPUA 4LFAI 4Q28A 2E1MA 4OOGC 2V2VA 4OX9I 4X8WA 2FGGA 4L5NC 4HXZA 4IZJD 1ZBTA 3J7AM 2L2NA 4KQVA 3QT7A 4P7DA 2DB2A 3V2UC 1N36I 3IWBA 4X65I 4MYUA 4B3ME 4B3TI 4B3TE 1Z5BA 1ZM2A 3K85A 4K0KE 3F6HA 3HJCA 2MC5A 2L92A 2FV4B 4P7AA 2RS7A 1FKAE 5BR8E 5DNYA 4JV5E 2JWOA 1HNZI 2L6MA 4I8OA 1DI2A 4DV1I 1ELOA 1ZM3A 3B82A 4DR7E 2BM1A 2ZBKB 3LPSA 4DV3E 1PKPA 2V83A 4WFTA 4NXME 5IT9C 3WU4A 2VE7C 1N0UA 5LMNE 4DV6I 1HR0E 2L33A 2DIXA 3LLHA 5GMEA 1UEKA 4DR2I 2RSMA 4DR5I 4PRXA 4X66I 4M30A 1X49A 1N32E 1FWLA 3PRYA 4Z7CA 4NXNI 2L8TA 1S4EA 4DR3I 1YYOA 4P78A 3T1YI 2V87A 3T1YE 3H4LA 3P06A 3HPSA 5A2QQ 2YT4A 4GKKE 4IZJA 5FLXQ 4PRVA 3OMLA 2Z5CA 1IBKE 4LF6E 1S16A 2CZ9A 4N3OA 5AE2A 2JOXA 3HPZA 4GEQB 4DV2I 2DSYA 3ZKDA 4JI8I 1RC7A 3LMLA 2PNMA 3QT6A 1IBMI 4HYMA 2Z5EA 1XHKA 1B63A 3CWVA 2UXCI 4FWDA 2B7TA 2UXBE 2LTSA 2V8PA 4B3SE 1FJGE 4JI6I 1MG7A 2BM0A 1XNRI 4JI4I 2V2ZA 3K1JA 5GMDA 1X48A 4IZKA 5AE1A 2ODRC 1ZXMA 4F9CB 4DV5E 4UTGA 2V2QA 1WHNA 4X64I 4BS9A 1STUA 3WU6A 1ZBQA 2X36A 2LRSA 4DUYI 3ADGA 2B3TB 4JYAE 2CPNA 3LNUA 1Z0CA 1RQ0A 4DV7I 4WPYA 4KHPI 2M1SA 4KHPE 3PYFA 4R1FA 3OTOE 3C4TA 4DPWA 2BV3A 1PVGA 4AQYI 4WYQB 2KOUA 2UUBI 2JR1A 4X62E 1Y4SA 2UUBE 3ADIA 1YYKA 4B3RI 2FTXB 4YY3E 1H73A 2IOPA 3ZKBA 4RPFA 1XMOE 3FIGA 3PYGA 4DU7A 4ZVIA 2L2KB 1I94I 4LFBE 2OI2A 1X47A 3J81C 2DEJA 3Q6MA 1IBLI 2HKJA 2A2CA 1IBLE 2M7QA 2F4VI 2V85A 2IOQA 3F0NA 1MU5A 3ZZ0A 4F54A 4DR1E 1FNMA 4GKJE 2G7HA 1YYWA 4WUCA 2R3VA 4URLA 1NHHA 4B3MI 4TUGA 4LF5E 1XNQI 3J7Yp 1XNQE 1Z0BA 4LF7E 1FI4A 4K0KI 4JI0E 3ADJA 5BR8I 4YHHE 2HFSA 4JV5I 3MSWA 3WU5A 4EMDA 1KTVA 1Y4UA 3VYXA 4L8NA 2LUQA 1BKNA 2HKEA 4DR7I 4DR6E 2UUAE 3K6QA 2K4VA 2UXDE 2NUEA 3D4JA 1T4NA 2KHXA 4DV3I 4NXMI 4BBYA 2LBSB 5LMNI 1HR0I 2N3GA 1N32I 4DV4E 2ZITA 1Z0VA 4WSPA 4F9BB 1HNWE 2LUPB 3F6GA 4USKA 4ED4A 4GKKI 1WHQA 2VF3A 1ZM9A 1IBKI 4LF6I 5FWKA 2UU9I 1U2RA 4FW9A 2UU9E 3LTOA 2NUFA 1T4LB 2VQEE 4JI3E 4LFCE 2Z5CB 1D6TA 1FWKA 2ZM6E 2RTXA 2E5LE 3ADLA 4LF8E 1N33E 2O1TA 4FWGA 1Z5AA 3J81Q 1EKZA 2UXBI 4BMJA 2PNLA 4B3SI 1VISA 2UUCI 1ZXNA 1FJGI 2UUCE 1SR9A 1N0VC 4DUZE 4DPTA 1KVKA 4DV5I 4JI7E 1USUA 1WXRA 3IWCA 1HNXE 4IZKB 2HHHI 4JYAI 1N34E 2HHHE 3Q1QA 3WU3A 4HACA 2JY9A 4XTJA 4BCAA 2V88A 4DU8A 4I3HA 2VQFE 1B62A 4LF4I 2H36X 1T4OA 4F9AB 4LF4E 3OTOI 4DPXA 3ZZUA 5LMUE 1EA6A 2LTRA 5L3JA 4J8ZA 3J80C 5AE3A 3JAMC 2V8QB 4X62I 4YY3I 4HY1A 4LF9E 4DV0E 1J5EI 1J5EE 2Z5BA 1XMOI 2V86A 4MYTA 1H74A 4LFBI 4DKKA 2E1RA 5LL6R 2HFUA 2LJPA 1YZ9A 1XMQI 4JI5E 4LU9A 3T1HE 1XMQE 3VYYA 2V89A 4KZSA 1J26A 1MX0A 1USVA 2GS8A 5IT9Q 4LTYA 1EI1A 2WW4A 4JI2E 4DR1I 5AASA 4GKJI 1QZRA 4R8OA 3HXLA 3HULA 1Z5CA 4M2ZA 1DQ3A 3QT8A 1H7UA 4LF5I 3JTZA 1OJ4A 2MDRA 4LF7I 3PYEA 4BC9A 2AJ4A 5T6JA 4JI0I 3M6AA 3AV0A 4M0VA 2HK2A 3ZZTA 4YHHI 4LFAE 4OX9E 3RMPA 4USMA 1GQEA 5ADZA 1GZ6A 1KKHA 2L3JA 2MC6A 3ZM7A 4DR6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU6 A;  1N36 E;  2UUA I;  3V5R A;  2UXD I;  4X65 E;  4FWH A;  1Z0T A;  1H7S A;  2X7I A;  1Z0G A;  2B7V A;  4DV4 I;  2Q2E B;  2IHR 1;  3C4B A;  1HNZ E;  4FN5 A;  4DV1 E;  1HNW I;  1H72 C;  2XEX A;  2L2M A;  2HK3 A;  4P52 A;  3J80 Q;  2DEI A;  3JAM Q;  3B8H A;  5IWA I;  4DV6 E;  4LFC I;  1K47 A;  2VQE I;  4JI3 I;  5IWA E;  1Z59 A;  4DR2 E;  4DR5 E;  2RS6 A;  4X66 E;  4JG4 A;  2ZM6 I;  2E5L I;  2L3C A;  3HTX A;  4LF8 I;  1N33 I;  1Z0W A;  4NXN E;  1DAR A;  3PYD A;  2DMY A;  4DR3 E;  4DUZ I;  1A6F A;  4JI7 I;  3J7A G;  4M1K A;  1HNX I;  1N34 I;  2A2D A;  2V34 A;  1ZM4 A;  4DV2 E;  4DR4 I;  3B78 A;  4JI8 E;  4DR4 E;  1RR9 A;  2VQF I;  4UT4 A;  1NHI A;  2R42 A;  4HAC B;  1IBM E;  4WUB A;  5LMU I;  1NHJ A;  2UXC E;  1UIL A;  3P1X A;  4JI6 E;  1XNR E;  4JI4 E;  4DPY A;  2J7K A;  2EZ6 A;  4DXL A;  4LF9 I;  4DV0 I;  4X64 E;  2NA2 A;  1PIE A;  1WUU A;  4DUY E;  4WUD A;  4JI1 I;  3K17 A;  4JI1 E;  4DV7 E;  4JI5 I;  1RRE A;  3T1H I;  5A2Q C;  5FLX C;  4AQY E;  3QT5 A;  4JI2 I;  1Z0E A;  1UHZ A;  1O0W A;  2EFG A;  2N3H A;  4PU9 A;  4B3R E;  1KIJ A;  2NUG A;  1NZ0 A;  2NPF A;  2JVA A;  1I94 E;  2LJH A;  5CFF E;  2F4V E;  4Z7Y A;  3GON A;  4DPU A;  4LFA I;  4OOG C;  4OX9 I;  2V2V A;  4X8W A;  4HXZ A;  1ZBT A;  3J7A M;  2L2N A;  4KQV A;  3QT7 A;  2DB2 A;  3V2U C;  1N36 I;  4X65 I;  4MYU A;  4B3M E;  4B3T I;  4B3T E;  1Z5B A;  1ZM2 A;  4K0K E;  4P7A A;  2RS7 A;  1FKA E;  5BR8 E;  4JV5 E;  1HNZ I;  1DI2 A;  4DV1 I;  1ELO A;  1ZM3 A;  3B82 A;  4DR7 E;  2BM1 A;  2ZBK B;  3LPS A;  4DV3 E;  1PKP A;  4NXM E;  4WFT A;  5IT9 C;  3WU4 A;  1N0U A;  5LMN E;  4DV6 I;  1HR0 E;  2L33 A;  2DIX A;  3LLH A;  5GME A;  1UEK A;  4DR2 I;  2RSM A;  4DR5 I;  4PRX A;  4X66 I;  4M30 A;  1X49 A;  1N32 E;  1FWL A;  4Z7C A;  4NXN I;  1S4E A;  4DR3 I;  1YYO A;  3T1Y I;  3T1Y E;  3H4L A;  5A2Q Q;  2YT4 A;  4GKK E;  5FLX Q;  4PRV A;  1IBK E;  4LF6 E;  1S16 A;  2CZ9 A;  4DV2 I;  3ZKD A;  4JI8 I;  1RC7 A;  3QT6 A;  1IBM I;  4HYM A;  1XHK A;  1B63 A;  3CWV A;  2UXC I;  4FWD A;  2B7T A;  2UXB E;  2LTS A;  2V8P A;  4B3S E;  1FJG E;  4JI6 I;  1MG7 A;  2BM0 A;  1XNR I;  4JI4 I;  2V2Z A;  3K1J A;  5GMD A;  1X48 A;  1ZXM A;  4DV5 E;  4UTG A;  2V2Q A;  1WHN A;  4X64 I;  3WU6 A;  1STU A;  2X36 A;  2LRS A;  4DUY I;  3ADG A;  2B3T B;  4JYA E;  2CPN A;  3LNU A;  1Z0C A;  1RQ0 A;  4DV7 I;  4KHP I;  4KHP E;  3PYF A;  4R1F A;  3OTO E;  3C4T A;  4DPW A;  2BV3 A;  1PVG A;  4AQY I;  4WYQ B;  2UUB I;  4X62 E;  2UUB E;  3ADI A;  1YYK A;  4B3R I;  4YY3 E;  1H73 A;  3ZKB A;  4RPF A;  1XMO E;  3PYG A;  4DU7 A;  4ZVI A;  2L2K B;  1I94 I;  4LFB E;  2OI2 A;  1X47 A;  2DEJ A;  3J81 C;  1IBL I;  2HKJ A;  2A2C A;  1IBL E;  2F4V I;  3F0N A;  1MU5 A;  3ZZ0 A;  4DR1 E;  1FNM A;  4GKJ E;  1YYW A;  4WUC A;  2R3V A;  4URL A;  1NHH A;  4B3M I;  4LF5 E;  1XNQ I;  3J7Y p;  1XNQ E;  1Z0B A;  4LF7 E;  1FI4 A;  4K0K I;  4JI0 E;  3ADJ A;  5BR8 I;  4YHH E;  2HFS A;  4JV5 I;  3WU5 A;  4EMD A;  1KTV A;  3VYX A;  2LUQ A;  1BKN A;  2HKE A;  4DR7 I;  4DR6 E;  2UUA E;  3D4J A;  2UXD E;  2NUE A;  1T4N A;  2KHX A;  4DV3 I;  4NXM I;  2LBS B;  5LMN I;  1HR0 I;  2N3G A;  1N32 I;  4DV4 E;  2ZIT A;  1Z0V A;  1HNW E;  2LUP B;  4USK A;  4ED4 A;  4GKK I;  1WHQ A;  2VF3 A;  1ZM9 A;  1IBK I;  4LF6 I;  2UU9 I;  1U2R A;  4FW9 A;  2UU9 E;  3LTO A;  2NUF A;  1T4L B;  2VQE E;  4JI3 E;  4LFC E;  1D6T A;  1FWK A;  2ZM6 E;  2RTX A;  2E5L E;  3ADL A;  4LF8 E;  1N33 E;  4FWG A;  1Z5A A;  3J81 Q;  1EKZ A;  2UXB I;  4B3S I;  1VIS A;  2UUC I;  1ZXN A;  1FJG I;  2UUC E;  1N0V C;  4DUZ E;  4DPT A;  1KVK A;  4DV5 I;  4JI7 E;  1HNX E;  2HHH I;  4JYA I;  1N34 E;  2HHH E;  3Q1Q A;  3WU3 A;  4HAC A;  2JY9 A;  4XTJ A;  4DU8 A;  4I3H A;  2VQF E;  1B62 A;  4LF4 I;  1T4O A;  4LF4 E;  3OTO I;  4DPX A;  3ZZU A;  5LMU E;  1EA6 A;  2LTR A;  5L3J A;  3J80 C;  3JAM C;  4X62 I;  4YY3 I;  4HY1 A;  4LF9 E;  4DV0 E;  1J5E I;  1J5E E;  1XMO I;  4MYT A;  1H74 A;  4LFB I;  4DKK A;  2E1R A;  5LL6 R;  2HFU A;  2LJP A;  1YZ9 A;  1XMQ I;  4JI5 E;  3T1H E;  1XMQ E;  3VYY A;  1J26 A;  1MX0 A;  2GS8 A;  5IT9 Q;  1EI1 A;  2WW4 A;  4JI2 E;  4DR1 I;  4GKJ I;  1QZR A;  3HUL A;  1Z5C A;  4M2Z A;  3QT8 A;  1H7U A;  4LF5 I;  1OJ4 A;  2MDR A;  4LF7 I;  3PYE A;  2AJ4 A;  4JI0 I;  3M6A A;  2HK2 A;  3ZZT A;  4YHH I;  4LFA E;  4OX9 E;  4USM A;  1GQE A;  1KKH A;  2L3J A;  3ZM7 A;  4DR6 I; 
#chains in the Genus database with same CATH topology
 1QU6 A;  1N36 E;  3VK6 A;  2UUA I;  3V5R A;  2UXD I;  4X65 E;  4GQU A;  1YH8 A;  1N3G A;  3H1C A;  4MU1 A;  2YTI A;  4FWH A;  2WP8 B;  2MKD A;  2EM8 A;  1Z0T A;  1EH7 A;  2O1W A;  1H7S A;  2X7I A;  2HJJ A;  1Z0G A;  3BGH A;  2B7V A;  4DV4 I;  2EOM A;  2YRH A;  2Q2E B;  5EL9 A;  2IHR 1;  1Y60 A;  2C38 A;  2EPA A;  3QG5 C;  3L00 A;  3C4B A;  2A25 A;  1HNZ E;  4KWY A;  4FN5 A;  4DV1 E;  2F8B A;  1A1I A;  1HNW I;  5C0X C;  1H72 C;  4BA2 A;  2XEX A;  2L2M A;  4N4R B;  1ZAA C;  2YZT A;  1TF6 A;  2HK3 A;  2YPN A;  4P52 A;  2ENA A;  3J80 Q;  3UHM A;  2DEI A;  4FK5 C;  1R6L A;  2DRP A;  3JAM Q;  3B8H A;  2EWL A;  2VF1 A;  5IWA I;  4DV6 E;  4LFC I;  1K47 A;  4HTG A;  4IZJ B;  2VQE I;  5IWA E;  4JI3 I;  3M7N D;  1Z59 A;  2EL5 A;  5F3W A;  2BB8 A;  4DR2 E;  4NBQ A;  4DR5 E;  3MHH C;  2JE6 A;  2CT1 A;  2RS6 A;  4X66 E;  1T39 A;  3P3G A;  4JG4 A;  2ZM6 I;  1Y6Z A;  2E5L I;  2L3C A;  3HTX A;  3DF6 A;  4LF8 I;  1N33 I;  3IWD A;  1Z0W A;  4NXN E;  1DAR A;  1AH5 A;  2EOZ A;  2EOH A;  2DMY A;  4DR3 E;  3PYD A;  2PO0 B;  1E3P A;  3AUZ A;  1VI7 A;  5JEA D;  2EMY A;  2PO2 A;  4R2D A;  4DUZ I;  1A6F A;  3DJW A;  2EM0 A;  4JI7 I;  3J7A G;  4WX9 A;  3Q6N A;  4BC7 A;  1RMD A;  2IER A;  4M1K A;  1HNX I;  1N34 I;  2A2D A;  2ELZ A;  2PNZ B;  2V34 A;  1ZM4 A;  4DV2 E;  1WRJ A;  2WZO A;  4DR4 I;  3B78 A;  4JI8 E;  4DR4 E;  3KWR A;  2CGE A;  3L7Z A;  1A1H A;  1P42 A;  2GQ0 A;  2ODR D;  1RR9 A;  2VQF I;  2CG9 A;  3U1Y A;  2GPI A;  5TSE A;  4BHC A;  1NHI A;  4UT4 A;  4IFD B;  2R42 A;  4HAC B;  4DMI A;  1IBM E;  4WUB A;  5LMU I;  1NHJ A;  2UXC E;  3C6M A;  1UIL A;  3P1X A;  1IQO A;  2B9D A;  2EM9 A;  4O43 A;  3EPK A;  2EMW A;  4JI6 E;  1XNR E;  4JI4 E;  1KYQ A;  4DPY A;  2J7K A;  1EH8 A;  3H09 A;  2EZ6 A;  4DXL A;  3ZOQ B;  1PDA A;  2YTP A;  4LF9 I;  4DV0 I;  4X64 E;  3KRN A;  2NA2 A;  2JOB A;  4BHB A;  1PIE A;  4DUY E;  1WUU A;  4WUD A;  2C37 B;  4JI1 I;  4WXC A;  2YTF A;  3JU0 A;  4R2C A;  3K17 A;  4TUI A;  4JI1 E;  2Z5B B;  4OO1 B;  4DV7 E;  2KON A;  5DNX A;  2EN8 A;  4JI5 I;  1RRE A;  2EQ1 A;  3T1H I;  2LE2 A;  5A2Q C;  1HK7 A;  5FLX C;  2ELY A;  1ZR9 A;  1EH6 A;  3B4T A;  4AQY E;  3QT5 A;  4LFA I;  4JI2 I;  3ECR A;  1DGC A;  1Z0E A;  2JXP A;  2F1D A;  1UHZ A;  1O0W A;  2ADR A;  2EFG A;  2N3H A;  1X5W A;  2O1U A;  1ZU1 A;  4B3R E;  3PS3 A;  4PU9 A;  4BA1 A;  2LMZ A;  1KIJ A;  1QNT A;  2M4I A;  2WCC 3;  2NUG A;  1NZ0 A;  3MHS C;  1MEY C;  4FW4 A;  2NPF A;  4WXD A;  2JVA A;  3HQ1 A;  1I94 E;  3P3C A;  2O1V A;  5K36 F;  2YTO A;  2EMI A;  2BA0 G;  2LJH A;  2R76 A;  4AIM A;  4QNK A;  5CFF E;  4LCH A;  4FW6 A;  2F4V E;  4Z7Y A;  4R03 A;  3P3E A;  2DLQ A;  5K36 C;  3GON A;  2LO3 A;  5LLQ A;  4Q28 A;  2E1M A;  4OOG C;  4X9J A;  2V2V A;  4X8W A;  5DRR A;  1X3C A;  2FGG A;  2GLI A;  1Y5Y A;  4OX9 I;  4L5N C;  2LT7 A;  4HXZ A;  2I9I A;  4IZJ D;  3EPJ A;  4OKG A;  2EJ4 A;  1B69 A;  1ZBT A;  1A1J A;  3J7A M;  2L2N A;  4KQV A;  3QT7 A;  4P7D A;  2DB2 A;  4MLV A;  4GZN C;  3EPH A;  3V2U C;  1N36 I;  3IWB A;  4X65 I;  4MYU A;  3THO B;  2LCE A;  1YSA C;  4B3M E;  4U3B A;  1SFE A;  4B3T I;  2JEA A;  4B3T E;  3BF2 A;  1Z5B A;  1ZM2 A;  1OYS A;  3K85 A;  2EMZ A;  1A1G A;  4K0K E;  3F6H A;  3HJC A;  2MC5 A;  5DRO A;  5JEA E;  5IXM B;  4OO1 E;  2L92 A;  2EOJ A;  2FV4 B;  4P7A A;  2RS7 A;  1FKA E;  2NN6 B;  1OYR A;  1JK2 A;  5BR8 E;  5DNY A;  4JV5 E;  2JWO A;  2HC5 A;  1HNZ I;  2PO1 A;  2LVH A;  2L6M A;  4I8O A;  1DI2 A;  4DV1 I;  1ELO A;  2ENH A;  1ZM3 A;  3B82 A;  4DR7 E;  2EP3 A;  2BM1 A;  2ZBK B;  3LPS A;  2DMI A;  4R2R A;  5DRP A;  4IFD D;  4O5G A;  4U3D A;  4DV3 E;  4BA2 B;  1PKP A;  2V83 A;  4WFT A;  4NXM E;  5IT9 C;  5A6J A;  3WU4 A;  2VE7 C;  1N0U A;  5K36 A;  5LMN E;  4DV6 I;  1HR0 E;  2L33 A;  3C6K A;  2DIX A;  3LLH A;  1L4S A;  5GME A;  1UEK A;  3EPL A;  2RSM A;  4DR2 I;  4DR5 I;  4PRX A;  4X66 I;  2EN1 A;  1X49 A;  4M30 A;  1N32 E;  1FWL A;  1JK1 A;  3PRY A;  2EPC A;  4Z7C A;  4NXN I;  2BA0 D;  1IMU A;  2EOS A;  2L8T A;  4O24 A;  1S4E A;  2O3Z A;  2EM2 A;  5A6B A;  2BR2 A;  2JE6 B;  4DR3 I;  1YYO A;  4P78 A;  3T1Y I;  2V87 A;  3T1Y E;  3H4L A;  3P06 A;  4OO1 D;  4R2A A;  3HPS A;  5A2Q Q;  2YT4 A;  4GKK E;  4IZJ A;  2EPR A;  2EN6 A;  4PRV A;  2CSH A;  5FLX Q;  4OZE A;  3OML A;  2WNR A;  2Z5C A;  5JEA F;  4OO1 F;  1IBK E;  1P47 A;  5KL3 A;  4LF6 E;  2PO2 B;  1S16 A;  4RH8 A;  2CZ9 A;  4MU4 A;  4N3O A;  5AE2 A;  2JOX A;  3HPZ A;  4DPU A;  4GEQ B;  2RPC A;  1YUI A;  4DV2 I;  2DSY A;  2EPM X;  2JT2 A;  3ZKD A;  5JEA C;  4JI8 I;  1RC7 A;  4HEI A;  3LML A;  4ISA A;  1AAY A;  2PNM A;  3UK3 C;  3QT6 A;  1IBM I;  4HYM A;  2NN6 E;  2Z5E A;  3U1K A;  3KZY A;  1B63 A;  1XHK A;  1UBD C;  2C39 A;  2J7J A;  3CWV A;  2CTD A;  3L7Z B;  2B7T A;  4FWD A;  2UXC I;  2UXB E;  2LTS A;  4DR7 I;  4MU0 A;  1NCS A;  2V8P A;  4B3S E;  1FJG E;  4JI6 I;  3TQM A;  1MG7 A;  2BM0 A;  3PS1 A;  5C0X B;  4JI4 I;  2V2Z A;  3K1J A;  5GMD A;  1XNR I;  1X48 A;  2EOQ A;  5AE1 A;  2ODR C;  4IZK A;  3BID A;  1ZXM A;  4F9C B;  4DV5 E;  2VES A;  4UTG A;  2ENC A;  1WHN A;  2V2Q A;  4X64 I;  4BS9 A;  1STU A;  4M9V C;  3WU6 A;  1ZBQ A;  2X36 A;  2AE8 A;  2K7I A;  2LRS A;  4DUY I;  2EMB A;  2YTD A;  2B3T B;  3ADG A;  4ZYE A;  1LLM C;  2CPN A;  4JYA E;  1UN6 B;  1X6H A;  4WSG A;  2EL6 A;  1A1K A;  2JPA A;  3LNU A;  2LV2 A;  1Z0C A;  4FW3 A;  1BBG A;  2MDG A;  1RQ0 A;  1T38 A;  4DV7 I;  2DGC A;  1XXE A;  4WPY A;  4KHP I;  2M1S A;  4KHP E;  3PYF A;  4R1F A;  3OTO E;  1R6M A;  3C4T A;  4NHR A;  4DPW A;  4MDT A;  5KL6 A;  2BV3 A;  1PVG A;  4AQY I;  4WYQ B;  1NEI A;  4J3D A;  1YPN A;  4R2E A;  2KOU A;  2UUB I;  2JR1 A;  4X62 E;  1Y4S A;  1TN9 A;  3GLL A;  2UUB E;  3ADI A;  1YUJ A;  1OYP A;  1YYK A;  4LPF A;  4B3R I;  2FTX B;  4YY3 E;  2EM4 A;  1H73 A;  2NN6 D;  4OO1 A;  4AID A;  5EKW A;  2IOP A;  5JEA A;  3ZKB A;  1F2I G;  4RPF A;  1XMO E;  3FIG A;  3PYG A;  4DU7 A;  2EM6 A;  4ZVI A;  2L2K B;  2NN6 F;  1I94 I;  4LFB E;  2OI2 A;  1X47 A;  3J81 C;  2DEJ A;  3Q6M A;  4BA1 B;  2HKJ A;  2A2C A;  1IBL I;  1X6F A;  1IBL E;  1G2D C;  1KJK A;  4FW5 A;  2YWQ A;  2M7Q A;  2F4V I;  2V85 A;  2IOQ A;  3F0N A;  2YSP A;  2YRM A;  1MU5 A;  4IFD E;  4IS1 C;  1Z1B A;  4MU3 A;  2MKN A;  2GO3 A;  3ZZ0 A;  2EMH A;  4F54 A;  4DR1 E;  1FNM A;  4GKJ E;  2G7H A;  5C0X E;  2VRD A;  1GTK A;  5A6A A;  2EM5 A;  4F6N A;  1YYW A;  4QNJ A;  4WUC A;  2R3V A;  4URL A;  4RHB B;  1NHH A;  4B3M I;  4TUG A;  2EN2 A;  5KL4 A;  4LF5 E;  4MQY A;  5KL2 A;  1XNQ I;  2JEB A;  3J7Y p;  1XNQ E;  1Z0B A;  4LF7 E;  1FI4 A;  4K0K I;  2EOR A;  3PS2 A;  4F6M A;  4JI0 E;  3ADJ A;  5AC4 A;  2IES A;  2JEA B;  5BR8 I;  4YHH E;  1X6E A;  2EOY A;  2EPU A;  4ZYG A;  2HFS A;  4JV5 I;  3MSW A;  3WU5 A;  4EMD A;  1KTV A;  2EQ0 A;  1Y4U A;  3VYX A;  2EMK A;  4L8N A;  2RSI A;  5A6K A;  4ZYD A;  2LUQ A;  1E3H A;  2C38 B;  2RQL A;  2EMX A;  1BKN A;  2M9A A;  4MLQ A;  1PJT A;  2HKE A;  2WP8 A;  4DR6 E;  4LCG A;  2PO1 B;  2YU5 A;  2UUA E;  4AM3 A;  3K6Q A;  2K4V A;  2UXD E;  2NUE A;  1BB8 A;  3D4J A;  1T4N A;  2KHX A;  4DV3 I;  4NZV A;  4NXM I;  2EMA A;  1RHY A;  4BBY A;  3VHT B;  2LBS B;  2YTN A;  2NN6 A;  5LMN I;  2D9H A;  3GME A;  1HR0 I;  4IFD F;  5C0X D;  1BBO A;  4O4K A;  2N3G A;  2EN4 A;  4ZYH A;  3GCM A;  1N32 I;  5K36 B;  4DV4 E;  5C0X F;  4IFD C;  2JYA A;  2JP9 A;  1PJS A;  2ZIT A;  1Z0V A;  4WSP A;  4F9B B;  1HNW E;  2LUP B;  3F6G A;  2EPZ A;  4F2J C;  4USK A;  2N8X A;  4ED4 A;  2CVE A;  4GKK I;  1UDO A;  2BR2 B;  5KL7 A;  1WHQ A;  2VF3 A;  1ZM9 A;  2EPN A;  1IBK I;  5FWK A;  4LF6 I;  2UU9 I;  4Q35 B;  1U2R A;  4FW9 A;  2UU9 E;  4R2P A;  3LTO A;  4R2Q A;  2NUF A;  3BBG A;  2EOO A;  2VQE E;  1T4L B;  4JI3 E;  3THN A;  4LFC E;  2WNR B;  2Z5C B;  3CDJ A;  4OO1 C;  1D6T A;  1FWK A;  2BBG A;  2ZM6 E;  2RTX A;  3EQ1 A;  2PO0 A;  2E5L E;  2LJU A;  4LF8 E;  3ADL A;  1N33 E;  2O1T A;  4R2S A;  3P76 A;  4FWG A;  1Z5A A;  3J81 Q;  1EKZ A;  2UXB I;  4BMJ A;  2PNL A;  4B3S I;  1VIS A;  2UUC I;  1ZXN A;  1FJG I;  2UUC E;  1SR9 A;  2C39 B;  1UDS A;  2YTE A;  1N0V C;  2PNZ A;  4DUZ E;  4DPT A;  1KVK A;  4DV5 I;  2EMG A;  2J65 A;  4JI7 E;  1USU A;  1WXR A;  3NZK A;  3IWC A;  1HNX E;  4IZK B;  2HHH I;  4JYA I;  2EPK X;  1N34 E;  2HHH E;  3Q1Q A;  2BA1 D;  4IFD A;  3WU3 A;  4HAC A;  2EOX A;  2JY9 A;  5ELW A;  2YU8 A;  4XTJ A;  1WJP A;  4BCA A;  2V88 A;  4DU8 A;  4I3H A;  2VQF E;  3HKM A;  3M85 G;  2PRT A;  1B62 A;  5C0X A;  4LF4 I;  2H36 X;  1T4O A;  4F9A B;  4LF4 E;  5K36 E;  3OTO I;  4DPX A;  3ZZU A;  2EPX A;  5LMU E;  1EA6 A;  2LTR A;  5L3J A;  4J8Z A;  2EPP A;  2EOI A;  3J80 C;  2EN7 A;  5AE3 A;  3JAM C;  2Q8U A;  2EML A;  2V8Q B;  4X62 I;  2DLK A;  2C37 A;  2R1F A;  2YRK A;  2GO4 A;  5KL5 A;  4YY3 I;  4HY1 A;  4LF9 E;  4DV0 E;  1J5E I;  1J5E E;  4IJD A;  2Z5B A;  3DD6 A;  1XMO I;  2V86 A;  4MYT A;  1H74 A;  4FW7 A;  1UDQ A;  2EM7 A;  3M99 B;  1G2F C;  4LFB I;  4DKK A;  1TF3 A;  2E1R A;  5JEA B;  5LL6 R;  4LCF A;  2HGH A;  2HFU A;  1UDN A;  1YZ9 A;  2LJP A;  2YTQ A;  1XMQ I;  2I13 A;  2YTG A;  4JI5 E;  4LU9 A;  3T1H E;  1XMQ E;  3VYY A;  2V89 A;  2WBU A;  4KZS A;  2NN6 C;  2EE8 A;  2EM3 A;  1J26 A;  2EN3 A;  1MX0 A;  2EMF A;  1USV A;  2GS8 A;  5IT9 Q;  4LTY A;  5AC5 A;  2NAB A;  1EI1 A;  2WW4 A;  4JI2 E;  2EQ3 A;  2EL4 A;  4DR1 I;  2EOE A;  5AAS A;  4GKJ I;  1QZR A;  1A1L A;  4R8O A;  3HXL A;  3HUL A;  2WBT A;  2YTJ A;  3KZZ A;  3M7N G;  5K36 D;  1Z5C A;  4M2Z A;  1A1F A;  3CDI A;  5A69 A;  2EPL X;  1IQS A;  1DQ3 A;  2EOF A;  3QT8 A;  1H7U A;  4LF5 I;  3JTZ A;  2GHF A;  1PJQ A;  1OJ4 A;  2MDR A;  4LF7 I;  2E72 A;  3PYE A;  4BC9 A;  2EMC A;  5A6B D;  2AJ4 A;  5T6J A;  4IS9 A;  3M6A A;  4JI0 I;  2EPO A;  3AV0 A;  4M0V A;  2HK2 A;  2JEB B;  3ZZT A;  1YHC A;  4LFA E;  4YHH I;  4OX9 E;  5IV8 B;  3RMP A;  4LOM A;  2YSO A;  4USM A;  5DNL A;  1GQE A;  5ADZ A;  2WBS A;  3M85 D;  1GZ6 A;  1KKH A;  1MGT A;  2L3J A;  2MC6 A;  3ZM7 A;  5DRQ A;  1YFH A;  2BA1 G;  4DR6 I; 
#chains in the Genus database with same CATH homology
 1QU6 A;  1N36 E;  3VK6 A;  2UUA I;  3V5R A;  2UXD I;  4X65 E;  4FWH A;  1Z0T A;  2O1W A;  1H7S A;  2X7I A;  1Z0G A;  2B7V A;  4DV4 I;  2Q2E B;  2IHR 1;  3C4B A;  1HNZ E;  4FN5 A;  4DV1 E;  2F8B A;  1HNW I;  1H72 C;  2XEX A;  2L2M A;  2YZT A;  2HK3 A;  4P52 A;  3J80 Q;  2DEI A;  3JAM Q;  3B8H A;  2EWL A;  2VF1 A;  5IWA I;  4DV6 E;  4LFC I;  1K47 A;  4IZJ B;  2VQE I;  4JI3 I;  5IWA E;  1Z59 A;  5F3W A;  4DR2 E;  4DR5 E;  2RS6 A;  4X66 E;  4JG4 A;  2ZM6 I;  1Y6Z A;  2E5L I;  2L3C A;  3HTX A;  3DF6 A;  4LF8 I;  1N33 I;  3IWD A;  1Z0W A;  4NXN E;  1DAR A;  3PYD A;  2DMY A;  4DR3 E;  3AUZ A;  4DUZ I;  1A6F A;  3DJW A;  4JI7 I;  3J7A G;  3Q6N A;  4BC7 A;  4M1K A;  1HNX I;  1N34 I;  2A2D A;  2V34 A;  1ZM4 A;  4DV2 E;  2WZO A;  4DR4 I;  3B78 A;  4JI8 E;  4DR4 E;  3KWR A;  2CGE A;  2GQ0 A;  2ODR D;  1RR9 A;  2VQF I;  2CG9 A;  4UT4 A;  1NHI A;  2R42 A;  4HAC B;  4DMI A;  1IBM E;  4WUB A;  5LMU I;  1NHJ A;  2UXC E;  1UIL A;  3P1X A;  2B9D A;  4JI6 E;  1XNR E;  4JI4 E;  4DPY A;  2J7K A;  3H09 A;  2EZ6 A;  4DXL A;  3ZOQ B;  4LF9 I;  4DV0 I;  4X64 E;  2NA2 A;  2JOB A;  1PIE A;  1WUU A;  4DUY E;  4WUD A;  4JI1 I;  3K17 A;  3JU0 A;  4TUI A;  4JI1 E;  2Z5B B;  4DV7 E;  2KON A;  4JI5 I;  1RRE A;  3T1H I;  2LE2 A;  5A2Q C;  1HK7 A;  5FLX C;  4AQY E;  3QT5 A;  4JI2 I;  1Z0E A;  1UHZ A;  1O0W A;  2EFG A;  2N3H A;  2O1U A;  4B3R E;  4PU9 A;  2LMZ A;  1KIJ A;  2M4I A;  2NUG A;  1NZ0 A;  2NPF A;  2JVA A;  3HQ1 A;  1I94 E;  2O1V A;  2LJH A;  5CFF E;  2F4V E;  4Z7Y A;  4R03 A;  3GON A;  4DPU A;  4LFA I;  4Q28 A;  2E1M A;  4OOG C;  2V2V A;  4OX9 I;  4X8W A;  2FGG A;  4L5N C;  4HXZ A;  4IZJ D;  1ZBT A;  3J7A M;  2L2N A;  4KQV A;  3QT7 A;  4P7D A;  2DB2 A;  3V2U C;  1N36 I;  3IWB A;  4X65 I;  4MYU A;  4B3M E;  4B3T I;  4B3T E;  1Z5B A;  1ZM2 A;  3K85 A;  4K0K E;  3F6H A;  3HJC A;  2MC5 A;  2L92 A;  2FV4 B;  4P7A A;  2RS7 A;  1FKA E;  5BR8 E;  5DNY A;  4JV5 E;  2JWO A;  1HNZ I;  2L6M A;  4I8O A;  1DI2 A;  4DV1 I;  1ELO A;  1ZM3 A;  3B82 A;  4DR7 E;  2BM1 A;  2ZBK B;  3LPS A;  4DV3 E;  1PKP A;  2V83 A;  4WFT A;  4NXM E;  5IT9 C;  3WU4 A;  2VE7 C;  1N0U A;  5LMN E;  4DV6 I;  1HR0 E;  2L33 A;  2DIX A;  3LLH A;  5GME A;  1UEK A;  4DR2 I;  2RSM A;  4DR5 I;  4PRX A;  4X66 I;  4M30 A;  1X49 A;  1N32 E;  1FWL A;  3PRY A;  4Z7C A;  4NXN I;  2L8T A;  1S4E A;  4DR3 I;  1YYO A;  4P78 A;  3T1Y I;  2V87 A;  3T1Y E;  3H4L A;  3P06 A;  3HPS A;  5A2Q Q;  2YT4 A;  4GKK E;  4IZJ A;  5FLX Q;  4PRV A;  3OML A;  2Z5C A;  1IBK E;  4LF6 E;  1S16 A;  2CZ9 A;  4N3O A;  5AE2 A;  2JOX A;  3HPZ A;  4GEQ B;  4DV2 I;  2DSY A;  3ZKD A;  4JI8 I;  1RC7 A;  3LML A;  2PNM A;  3QT6 A;  1IBM I;  4HYM A;  2Z5E A;  1XHK A;  1B63 A;  3CWV A;  2UXC I;  4FWD A;  2B7T A;  2UXB E;  2LTS A;  2V8P A;  4B3S E;  1FJG E;  4JI6 I;  1MG7 A;  2BM0 A;  1XNR I;  4JI4 I;  2V2Z A;  3K1J A;  5GMD A;  1X48 A;  4IZK A;  5AE1 A;  2ODR C;  1ZXM A;  4F9C B;  4DV5 E;  4UTG A;  2V2Q A;  1WHN A;  4X64 I;  4BS9 A;  1STU A;  3WU6 A;  1ZBQ A;  2X36 A;  2LRS A;  4DUY I;  3ADG A;  2B3T B;  4JYA E;  2CPN A;  3LNU A;  1Z0C A;  1RQ0 A;  4DV7 I;  4WPY A;  4KHP I;  2M1S A;  4KHP E;  3PYF A;  4R1F A;  3OTO E;  3C4T A;  4DPW A;  2BV3 A;  1PVG A;  4AQY I;  4WYQ B;  2KOU A;  2UUB I;  2JR1 A;  4X62 E;  1Y4S A;  2UUB E;  3ADI A;  1YYK A;  4B3R I;  2FTX B;  4YY3 E;  1H73 A;  2IOP A;  3ZKB A;  4RPF A;  1XMO E;  3FIG A;  3PYG A;  4DU7 A;  4ZVI A;  2L2K B;  1I94 I;  4LFB E;  2OI2 A;  1X47 A;  3J81 C;  2DEJ A;  3Q6M A;  1IBL I;  2HKJ A;  2A2C A;  1IBL E;  2M7Q A;  2F4V I;  2V85 A;  2IOQ A;  3F0N A;  1MU5 A;  3ZZ0 A;  4F54 A;  4DR1 E;  1FNM A;  4GKJ E;  2G7H A;  1YYW A;  4WUC A;  2R3V A;  4URL A;  1NHH A;  4B3M I;  4TUG A;  4LF5 E;  1XNQ I;  3J7Y p;  1XNQ E;  1Z0B A;  4LF7 E;  1FI4 A;  4K0K I;  4JI0 E;  3ADJ A;  5BR8 I;  4YHH E;  2HFS A;  4JV5 I;  3MSW A;  3WU5 A;  4EMD A;  1KTV A;  1Y4U A;  3VYX A;  4L8N A;  2LUQ A;  1BKN A;  2HKE A;  4DR7 I;  4DR6 E;  2UUA E;  3K6Q A;  2K4V A;  2UXD E;  2NUE A;  3D4J A;  1T4N A;  2KHX A;  4DV3 I;  4NXM I;  4BBY A;  2LBS B;  5LMN I;  1HR0 I;  2N3G A;  1N32 I;  4DV4 E;  2ZIT A;  1Z0V A;  4WSP A;  4F9B B;  1HNW E;  2LUP B;  3F6G A;  4USK A;  4ED4 A;  4GKK I;  1WHQ A;  2VF3 A;  1ZM9 A;  1IBK I;  4LF6 I;  5FWK A;  2UU9 I;  1U2R A;  4FW9 A;  2UU9 E;  3LTO A;  2NUF A;  1T4L B;  2VQE E;  4JI3 E;  4LFC E;  2Z5C B;  1D6T A;  1FWK A;  2ZM6 E;  2RTX A;  2E5L E;  3ADL A;  4LF8 E;  1N33 E;  2O1T A;  4FWG A;  1Z5A A;  3J81 Q;  1EKZ A;  2UXB I;  4BMJ A;  2PNL A;  4B3S I;  1VIS A;  2UUC I;  1ZXN A;  1FJG I;  2UUC E;  1SR9 A;  1N0V C;  4DUZ E;  4DPT A;  1KVK A;  4DV5 I;  4JI7 E;  1USU A;  1WXR A;  3IWC A;  1HNX E;  4IZK B;  2HHH I;  4JYA I;  1N34 E;  2HHH E;  3Q1Q A;  3WU3 A;  4HAC A;  2JY9 A;  4XTJ A;  4BCA A;  2V88 A;  4DU8 A;  4I3H A;  2VQF E;  1B62 A;  4LF4 I;  2H36 X;  1T4O A;  4F9A B;  4LF4 E;  3OTO I;  4DPX A;  3ZZU A;  5LMU E;  1EA6 A;  2LTR A;  5L3J A;  4J8Z A;  3J80 C;  5AE3 A;  3JAM C;  2V8Q B;  4X62 I;  4YY3 I;  4HY1 A;  4LF9 E;  4DV0 E;  1J5E I;  1J5E E;  2Z5B A;  1XMO I;  2V86 A;  4MYT A;  1H74 A;  4LFB I;  4DKK A;  2E1R A;  5LL6 R;  2HFU A;  2LJP A;  1YZ9 A;  1XMQ I;  4JI5 E;  4LU9 A;  3T1H E;  1XMQ E;  3VYY A;  2V89 A;  4KZS A;  1J26 A;  1MX0 A;  1USV A;  2GS8 A;  5IT9 Q;  4LTY A;  1EI1 A;  2WW4 A;  4JI2 E;  4DR1 I;  5AAS A;  4GKJ I;  1QZR A;  4R8O A;  3HXL A;  3HUL A;  1Z5C A;  4M2Z A;  1DQ3 A;  3QT8 A;  1H7U A;  4LF5 I;  3JTZ A;  1OJ4 A;  2MDR A;  4LF7 I;  3PYE A;  4BC9 A;  2AJ4 A;  5T6J A;  4JI0 I;  3M6A A;  3AV0 A;  4M0V A;  2HK2 A;  3ZZT A;  4YHH I;  4LFA E;  4OX9 E;  3RMP A;  4USM A;  1GQE A;  5ADZ A;  1GZ6 A;  1KKH A;  2L3J A;  2MC6 A;  3ZM7 A;  4DR6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...