4DV5E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5E02
2A2DA 4JI5E 2NUGA 4NXME 1UEKA 4X62I 2HFSA 2IHR1 4DV4E 4DV7E 2N3GA 2B7TA 4X64E 1H72C 1T4OA 3WU4A 2L2NA 4DR5E 2YT4A 2KHXA 5A2QQ 1I94I 4JI0I 3T1YE 4KHPE 1ZM2A 2L2KB 1FWLA 1N36E 2L3JA 2LBSB 1Z0TA 1U2RA 2B7VA 4JI8E 1FJGI 2UUAI 2RS7A 4K0KI 1DARA 2R3VA 3ZKBA 3QT6A 1XMQI 4LF7E 2ZBKB 1RQ0A 1UILA 4JI1E 4PRVA 4DUZI 4B3RE 4DPXA 4LF5I 4DV2I 2VQEE 2NUEA 1UHZA 2L2MA 2EFGA 2VQEI 4UTGA 2UUBE 4B3MI 4URLA 1XMOI 5IWAE 3J80Q 4YY3E 1IBKI 2B3TB 4YHHE 1O0WA 2UU9E 3ZZUA 2DIXA 2E1RA 3B82A 4DR1E 4LF4E 3J80C 4P52A 2UUCI 4LFAI 4GKJE 4DR7E 1B62A 4GKKI 2UU9I 2UXCI 3B8HA 4LFBI 5FLXC 1HR0E 2Q2EB 2MDRA 1KIJA 4M30A 1N0UA 2GS8A 3K1JA 4M2ZA 3PYDA 2LTSA 2UUBI 1MX0A 2V2ZA 1BKNA 5BR8E 4JYAI 4DUYI 2F4VE 4HACB 3J81C 1Z0BA 4NXMI 4JI5I 3V2UC 1FWKA 1EA6A 4MYUA 4LF8E 3HULA 4DV3I 1Z0VA 2DB2A 5FLXQ 4DV1E 2WW4A 2X7IA 2JY9A 1NHHA 3LTOA 4B3TE 1S4EA 4JI2I 4DPTA 4RPFA 3QT5A 5LMNI 5IT9Q 4WYQB 5A2QC 2CPNA 4AQYI 4X64I 2DEIA 1NHJA 4DV7I 1WUUA 4XTJA 2RS6A 4GKKE 2E5LE 4DR4I 2HHHI 4LF9I 4LFAE 3VYXA 1HNWE 2UXDE 4FWHA 1QU6A 4JI4I 4ED4A 1N33E 1N36I 3V5RA 4DPWA 5LMUI 3OTOI 4X8WA 4DU8A 4USMA 4DR5I 1Z0CA 2ZM6I 4P7AA 2VF3A 5GMDA 3T1HI 4FWDA 4JI3E 4DV2E 4B3RI 1IBLI 1Z0EA 5L3JA 1D6TA 4DV6I 2LRSA 2CZ9A 4DR6I 1T4NA 1Z5CA 4PRXA 3ZZ0A 4Z7CA 1RR9A 4OOGC 1T4LB 3WU3A 4JV5E 1XNQE 2NA2A 1B63A 3M6AA 4OX9E 4NXNE 2UUAE 4K0KE 4DPUA 4HXZA 4DXLA 2BM0A 3K17A 4DV0I 4JI0E 3QT8A 3JAMQ 1IBME 1A6FA 4JI7E 1XHKA 3D4JA 2UXBE 4R1FA 3P1XA 3JAMC 1Z59A 2L3CA 4X62E 2LUQA 1XNRE 1Z0WA 4JI3I 2DMYA 1J5EE 1ZXNA 1ZM4A 1FI4A 2OI2A 1J26A 4DR3E 1FKAE 2A2CA 2HK2A 2V2VA 1Z0GA 2V2QA 4M1KA 2VQFE 4JI6I 4LFCI 3LPSA 3PYFA 1Z5AA 1N34E 1N32E 2LJPA 1HNZE 3ZZTA 4FN5A 2RSMA 3B78A 4LF9E 2E5LI 1H73A 1ZXMA 1XNQI 2X36A 3C4TA 1ELOA 4JI7I 3PYEA 4LF7I 3ADIA 4DR6E 1WHNA 4DU7A 4FW9A 3J81Q 4DR2E 4X65I 3T1HE 5CFFE 1ZM3A 4JI6E 4B3TI 1K47A 1RC7A 1ZM9A 4NXNI 3Q1QA 1H7UA 4ZVIA 1X47A 2DEJA 4DV3E 4LF8I 1N33I 1HNXE 1J5EI 1KKHA 4DV6E 1HNXI 3ZKDA 2F4VI 1WHQA 4PU9A 4B3SI 2XEXA 4DV5I 5BR8I 4HACA 3H4LA 4WFTA 1QZRA 3C4BA 2NUFA 3CWVA 4WUDA 4X65E 1ZBTA 4LFBE 2HKEA 2LTRA 5LMUE 1RREA 1YZ9A 3VYYA 4X66I 1OJ4A 1HNWI 2JVAA 1PKPA 4OX9I 3LLHA 4LF4I 2AJ4A 1X48A 4HYMA 1PIEA 3LNUA 1S16A 4AQYE 4I3HA 4X66E 3J7AM 1N34I 1KVKA 4B3ME 1YYKA 3ZM7A 2HFUA 3ADGA 3OTOE 1XMQE 1STUA 1H7SA 1VISA 4JI4E 2BV3A 3GONA 2HHHE 4DKKA 4DR4E 4Z7YA 2N3HA 2LUPB 1YYOA 3J7Yp 4YY3I 3J7AG 4HY1A 1MG7A 1N32I 1NHIA 5IWAI 4DPYA 1DI2A 2R42A 2L33A 3F0NA 2V34A 3PYGA 4JI2E 1NZ0A 1H74A 1N0VC 1EKZA 4DR7I 4JI1I 4DR3I 3WU6A 4JG4A 2J7KA 2NPFA 4WUCA 4DV5E 4B3SE 4FWGA 1IBKE 4KQVA 5IT9C 3WU5A 2UXBI 1FJGE 3ADJA 4DUYE 2VQFI 4JYAE 2LJHA 1KTVA 1IBMI 4KHPI 4LF5E 3T1YI 2V8PA 2BM1A 5GMEA 2ZITA 4LF6E 1EI1A 4UT4A 1HR0I 4DR2I 5LL6R 2HK3A 2UXDI 2UXCE 4WUBA 4MYTA 1XNRI 4DV4I 2EZ6A 4GKJI 4JV5I 2UUCE 1MU5A 4JI8I 4DR1I 4USKA 4LF6I 5LMNE 3ADLA 4YHHI 1PVGA 1IBLE 1X49A 1I94E 1HNZI 4DV0E 1XMOE 4LFCE 1Z5BA 2ZM6E 2RTXA 4DV1I 3HTXA 1FNMA 4EMDA 1GQEA 2HKJA 4DUZE 3QT7A 1YYWA
chains in the Genus database with same CATH superfamily
2NN6D 4LTYA 3MHSC 2JEBA 2NN6C 2A2DA 4JI5E 2NUGA 4NXME 2YRHA 1EH8A 1UEKA 5DNLA 2M9AA 1PJQA 4X62I 4RH8A 2WBSA 2EPLX 2HFSA 2IHR1 2EPKX 4DV4E 1TF6A 4OO1E 1XXEA 4DV7E 2ODRC 2N3GA 2B7TA 4X64E 3EPHA 1H72C 5C0XC 1T4OA 3WU4A 2L2NA 4DR5E 2HC5A 2EQ0A 2JWOA 1P47A 1AAYA 1UBDC 5C0XB 2LE2A 3L7ZB 1G2FC 2YT4A 2KHXA 3C6MA 5A2QQ 1I94I 2EN2A 3T1YE 3NZKA 4JI0I 5AC4A 4KHPE 1ZM2A 2L2KB 3GLLA 1FWLA 1EH7A 2IERA 5KL7A 2L3JA 1N36E 2YTJA 2LBSB 2KONA 2PRTA 1Z0TA 2I13A 1U2RA 4QNJA 2B7VA 3CDIA 2EWLA 2ADRA 2EMAA 1ZR9A 2V85A 4JI8E 3L7ZA 2RS7A 4AIDA 2UUAI 4K0KI 4BBYA 1FJGI 1DARA 2LVHA 2EOQA 2R3VA 3ZKBA 3F6HA 1HK7A 5KL4A 2C39B 2J65A 5TSEA 2YZTA 2WP8A 3QT6A 1XMQI 3VK6A 4LF7E 2ZBKB 1RQ0A 2EM8A 1UILA 4JI1E 4PRVA 4MDTA 4DUZI 2YRKA 4LCGA 4B3RE 2JT2A 2MKNA 4DPXA 2YTQA 4DV2I 1A1FA 4LF5I 2VQEE 4BA2A 2NUEA 2EMFA 1UHZA 2L2MA 2EFGA 2VQEI 2WZOA 4UTGA 3UHMA 1A1KA 2UUBE 1YH8A 4B3MI 3MSWA 2EOIA 4URLA 1XMOI 5IWAE 2HGHA 2LMZA 1DGCA 3J80Q 1LLMC 4YY3E 1X5WA 2G7HA 1IBKI 2YTIA 2B3TB 4YHHE 1O0WA 2UU9E 4OZEA 3ZZUA 2DIXA 5T6JA 2JE6A 4GZNC 2E1RA 3B82A 3K85A 4DR1E 2NABA 3THNA 4LF4E 4R2EA 5EKWA 3KWRA 5K36E 2CSHA 4BHBA 3J80C 4P52A 5C0XA 2UUCI 4LFAI 4GKJE 5DRRA 4DR7E 1B62A 3JTZA 4N3OA 4GKKI 4P78A 4F6MA 2FTXB 3DD6A 3U1KA 2UU9I 2UXCI 4BCAA 1N3GA 3B8HA 2E72A 2RQLA 5FLXC 4LFBI 1HR0E 2C38A 2Q2EB 2VF1A 2MDRA 1KIJA 4M30A 1N0UA 1IQOA 2GS8A 3K1JA 3IWBA 2IOQA 4M2ZA 3PYDA 2EMCA 2LTSA 2NN6A 2UUBI 5K36A 1MX0A 2V2ZA 4IZJD 1BKNA 5BR8E 5JEAD 4JYAI 3P76A 4DUYI 2J7JA 4MLVA 2F4VE 3HKMA 3J81C 4HACB 1KYQA 1Z0BA 2C39A 4JI5I 4NXMI 3V2UC 2EOJA 2YPNA 1FWKA 3L00A 4WSPA 2ENAA 1EA6A 4MYUA 5ELWA 4LF8E 3HULA 1RMDA 4DV3I 2BBGA 4MU3A 1Z0VA 4BA1A 3F6GA 3AUZA 2BA0D 2F1DA 2BR2A 2DB2A 1E3PA 5JEAB 5FLXQ 4DV1E 4IZJB 2VE7C 2EPOA 2CGEA 4IFDC 1BBOA 2WW4A 2JY9A 1NHHA 2X7IA 4B3TE 3LTOA 2DGCA 1S4EA 5DNXA 4IFDD 4OO1C 2EN1A 1A1IA 4JI2I 2EPZA 5KL3A 1IQSA 2RPCA 3H09A 4DPTA 2O3ZA 4RPFA 3QT5A 4R2QA 2C38B 3M85D 2EMZA 4ZYEA 2EM2A 5LMNI 1TN9A 3BGHA 5IT9Q 2EOZA 1PJSA 4WYQB 5IXMB 1USVA 4BA2B 5A2QC 2CPNA 4N4RB 4AQYI 4OO1F 2B9DA 5DNYA 4X64I 1A1JA 2DEIA 4BMJA 1NHJA 1WUUA 4XTJA 4DV7I 2YSPA 2LJUA 2RS6A 4GKKE 2E5LE 2EORA 5JEAC 2HHHI 4DR4I 4LF9I 4LFAE 1OYSA 4FW3A 4OO1A 3VYXA 4WPYA 3VHTB 1HNWE 2UXDE 4FWHA 2R1FA 1QU6A 2K4VA 3LMLA 4IS1C 4MQYA 4JI4I 4ED4A 1N33E 1N36I 1YUIA 3V5RA 4DPWA 4WX9A 5LMUI 1G2DC 1EH6A 4IZKA 2JEAB 4KWYA 3OTOI 4X8WA 2EN4A 2F8BA 4DU8A 4USMA 4DR5I 1Z0CA 1OYPA 2ZM6I 4M9VC 1UDOA 4P7AA 2VF3A 5GMDA 5FWKA 3EQ1A 2BB8A 2ODRD 3T1HI 4FWDA 4JI3E 2EN3A 2BA1D 4DV2E 4J3DA 4B3RI 1IBLI 4LCFA 3UK3C 2DRPA 1Z0EA 5L3JA 1D6TA 4DV6I 3M85G 2LRSA 2CZ9A 4DR6I 3HPZA 4R8OA 4BC9A 1T4NA 1Z5CA 4PRXA 3ZZ0A 1OYRA 2GO3A 4Z7CA 2PNZA 2YTDA 3MHHC 4F9CB 1T4LB 4OOGC 2MC5A 3EPJA 1RR9A 5AC5A 2EOHA 4JV5E 2EOOA 3WU3A 1XNQE 2NN6E 2NA2A 1PJTA 2JEBB 1B63A 2I9IA 2EN8A 3M6AA 4OX9E 4NXNE 2UUAE 4K0KE 4BA1B 5KL2A 3H1CA 4DPUA 2YTEA 4HXZA 2BA0G 4DXLA 4ZYHA 1GZ6A 2EOYA 2BM0A 3K17A 2O1WA 4IS9A 5C0XE 5EL9A 4DV0I 5A6KA 4JI0E 2C37B 5JEAF 3QT8A 4IFDA 3JAMQ 3CDJA 1IBME 3DF6A 1B69A 4P7DA 2CVEA 2MDGA 4O24A 1A6FA 4JI7E 2EM0A 1VI7A 4WXDA 4R2RA 4ZYGA 1XHKA 1QNTA 4AM3A 3D4JA 2K7IA 3PS1A 2UXBE 4R1FA 2KOUA 3P1XA 3ZOQB 4F2JC 4QNKA 3JAMC 2EM9A 1Z59A 2L3CA 4X62E 2LUQA 1XNRE 4TUGA 5DRQA 3HPSA 2DLQA 3P3GA 3PS3A 2EMKA 1Z0WA 4JI3I 2DMYA 2EM6A 4M0VA 2EMHA 2EPMX 4RHBB 1J5EE 1ZXNA 1ZM4A 1FI4A 2YSOA 2OI2A 1J26A 4DR3E 2EMYA 2JYAA 2JXPA 2EPPA 1FKAE 2A2CA 3M99B 2HK2A 3KRNA 2V2VA 4IFDB 2A25A 3GCMA 3PRYA 4Q35B 5K36F 1Z0GA 2V2QA 3Q6NA 4M1KA 1DQ3A 2VQFE 2O1UA 2YTFA 4JI6I 4LFCI 3EPLA 3LPSA 3PYFA 1SR9A 1Z5AA 4R2SA 3FIGA 1N34E 2EL5A 1WRJA 4FW6A 4F9AB 5C0XD 1N32E 2LJPA 1HNZE 3ZZTA 4FN5A 2GLIA 2RSMA 2PNZB 3BIDA 4LF9E 2PO2B 3B78A 3PS2A 4AIMA 3J7AM 2E5LI 5A6BA 2EPUA 1H73A 1ZXMA 1XNQI 4BS9A 1P42A 2X36A 2VRDA 3C4TA 1ELOA 2O1VA 5ADZA 1A1GA 5KL6A 2EOFA 3C6KA 5C0XF 4JI7I 5AASA 3PYEA 2ENHA 1YHCA 3ADIA 4LF7I 4DR6E 2M7QA 2EOEA 1UDNA 1WHNA 1R6LA 2NN6B 4DU7A 3U1YA 5AE1A 4FW9A 3J81Q 1X6EA 4F6NA 2LV2A 4DR2E 3HXLA 4X65I 1A1LA 2GQ0A 3T1HE 5CFFE 3K6QA 2WP8B 2ELZA 1ZM3A 3AV0A 4JI6E 4U3BA 4B3TI 1K47A 4MU1A 4F9BB 2M1SA 1RC7A 2EE8A 1ZM9A 4FW4A 4NXNI 2PO0B 3Q1QA 1H7UA 3THOB 1X6HA 3OMLA 4BC7A 2FGGA 4ZVIA 2EPAA 1NCSA 1X47A 2ENCA 3BBGA 2DEJA 4LOMA 4DV3E 2EMBA 4MU4A 4LF8I 2ELYA 4FK5C 2CTDA 1N33I 1HNXE 1KJKA 1J5EI 1KKHA 2JR1A 1WXRA 2LT7A 2O1TA 5JEAE 2H36X 4DV6E 1HNXI 3M7NG 3ZKDA 2WNRB 1UN6B 2F4VI 2DSYA 1WHQA 2L6MA 3QG5C 4PU9A 4B3SI 4I8OA 2AE8A 2XEXA 4DV5I 5BR8I 4HACA 4OKGA 3H4LA 1ZAAC 4WFTA 1QZRA 2EPNA 3C4BA 2EMLA 2CG9A 2Q8UA 2NUFA 2PNMA 2GHFA 2NN6F 1RHYA 1L4SA 2PO1A 2EQ3A 3CWVA 4U3DA 4WUDA 2V86A 2MKDA 4R03A 1ZBTA 4X65E 2N8XA 2LTRA 4LFBE 2HKEA 5LMUE 2VESA 3M7ND 1RREA 5JEAA 4NZVA 3TQMA 1E3HA 2Z5BA 1YZ9A 2PO2A 2EM7A 3VYYA 1TF3A 4X66I 1OJ4A 2EP3A 2Z5CA 1HNWI 1PKPA 2JVAA 2EPXA 3IWDA 5A6AA 3Q6MA 1YSAC 4GQUA 4OX9I 2PNLA 3LLHA 4LF4I 2AJ4A 1X48A 2YTOA 2Z5CB 4HYMA 1PIEA 3KZYA 1S16A 3LNUA 2YU5A 4AQYE 4I3HA 2JE6B 4FW7A 4WXCA 1BBGA 2E1MA 4NBQA 3P3EA 1ZU1A 2LO3A 4X66E 4LPFA 2YTPA 5LLQA 4X9JA 1N34I 1KVKA 4B3ME 1YYKA 2JOBA 4R2DA 3ZM7A 1Y4SA 1MEYC 2WBTA 5IV8B 1UDQA 1AH5A 2EM3A 2HFUA 1YUJA 3ADGA 2GO4A 5A6BD 2HJJA 2MC6A 3OTOE 3JU0A 4IJDA 2DLKA 4HTGA 1XMQE 1STUA 3EPKA 5K36D 1H7SA 3RMPA 1VISA 2EN7A 5K36C 2DMIA 2BR2B 1T38A 2R76A 4JI4E 2EL6A 5AE3A 1F2IG 2BV3A 3GONA 4R2CA 2HHHE 4MLQA 4DKKA 5KL5A 2N3HA 4DR4E 4Z7YA 1Y5YA 2LUPB 1YYOA 2D9HA 4O4KA 3J7Yp 4YY3I 3J7AG 4HY1A 1MG7A 2WCC3 1N32I 1NHIA 4GEQB 5IWAI 2EOXA 4BHCA 1WJPA 4DPYA 2EQ1A 5K36B 3ECRA 2V8QB 1DI2A 2CT1A 2M4IA 2R42A 2L33A 4FW5A 1IMUA 1Y6ZA 3F0NA 2V34A 3PYGA 2EMGA 4Q28A 1Z1BA 4JI2E 1NZ0A 1H74A 1N0VC 1EKZA 4TUIA 1A1HA 4ZYDA 1T39A 4DR7I 4J8ZA 4L8NA 2EN6A 4JI1I 5DRPA 4DR3I 2EPCA 4JG4A 2J7KA 3WU6A 2EM4A 3GMEA 3BF2A 2WNRA 2NPFA 2V83A 1JK1A 4DV5E 4WUCA 2RSIA 2YTGA 4B3SE 4IZJA 2JP9A 4FWGA 1IBKE 4NHRA 4KQVA 5IT9C 3HQ1A 3IWCA 4IFDE 2EOMA 3KZZA 2EM5A 1Y4UA 3WU5A 2EL4A 1X3CA 2UXBI 2EJ4A 1YFHA 1FJGE 2EMXA 3ADJA 1ZBQA 4MU0A 4DMIA 4DUYE 3P06A 2YTNA 4HEIA 4F54A 2V88A 4JYAE 2C37A 2VQFI 2LJHA 1KTVA 2PO0A 2V87A 2IOPA 3B4TA 2EPRA 1IBMI 1R6MA 4KHPI 4LF5E 3T1YI 2V8PA 1MGTA 2EMIA 2BM1A 2ZITA 2L92A 5GMEA 2EMWA 2LCEA 1X6FA 4LF6E 1EI1A 1UDSA 4UT4A 1HR0I 2PO1B 2JPAA 4DR2I 5LL6R 2HK3A 2IESA 2YWQA 2UXDI 1YPNA 2FV4B 2UXCE 2WBUA 4MYTA 2BA1G 4WUBA 1XNRI 2V89A 4DV4I 1USUA 4OO1D 2EZ6A 2Z5EA 4GKJI 4JV5I 2UUCE 2YU8A 1MU5A 4L5NC 4JI8I 4DR1I 1PDAA 2JOXA 1GTKA 4LCHA 5DROA 1BB8A 5AE2A 4USKA 4LF6I 5LMNE 1SFEA 3ADLA 4ISAA 4O43A 2YRMA 4YHHI 1PVGA 1IBLE 1X49A 5A6JA 1I94E 4R2PA 1HNZI 4DV0E 2EOSA 4LU9A 4KZSA 4R2AA 1XMOE 5A69A 2L8TA 4LFCE 3P3CA 1Z5BA 4IZKB 2JEAA 3HJCA 2ZM6E 2RTXA 4WSGA 2GPIA 4O5GA 1JK2A 3HTXA 4DV1I 3DJWA 1FNMA 1NEIA 4EMDA 1GQEA 1Y60A 2HKJA 4DUZE 2Z5BB 4IFDF 5F3WA 3QT7A 4OO1B 1YYWA
chains in the Genus database with same CATH topology
4LTYA 2A2DA 4JI5E 2NUGA 4NXME 1UEKA 4X62I 2HFSA 2IHR1 4DV4E 4DV7E 2ODRC 2N3GA 2B7TA 4X64E 1H72C 1T4OA 3WU4A 2L2NA 4DR5E 2JWOA 2LE2A 2YT4A 2KHXA 5A2QQ 1I94I 4JI0I 3T1YE 4KHPE 1ZM2A 2L2KB 1FWLA 1N36E 2L3JA 2LBSB 2KONA 1Z0TA 1U2RA 2B7VA 2EWLA 2V85A 4JI8E 1FJGI 2UUAI 2RS7A 4K0KI 4BBYA 1DARA 2R3VA 3ZKBA 3F6HA 1HK7A 2YZTA 3QT6A 1XMQI 3VK6A 4LF7E 2ZBKB 1RQ0A 1UILA 4JI1E 4PRVA 4DUZI 4B3RE 4DPXA 4LF5I 4DV2I 2VQEE 2NUEA 1UHZA 2L2MA 2EFGA 2VQEI 2WZOA 4UTGA 2UUBE 4B3MI 3MSWA 4URLA 1XMOI 5IWAE 2LMZA 3J80Q 4YY3E 2G7HA 1IBKI 2B3TB 4YHHE 1O0WA 2UU9E 3ZZUA 2DIXA 5T6JA 2E1RA 3B82A 3K85A 4DR1E 4LF4E 3KWRA 3J80C 4P52A 2UUCI 4LFAI 4GKJE 4DR7E 1B62A 3JTZA 4N3OA 4GKKI 4P78A 2FTXB 2UU9I 2UXCI 4BCAA 3B8HA 4LFBI 5FLXC 1HR0E 2Q2EB 2VF1A 2MDRA 1KIJA 4M30A 1N0UA 2GS8A 3K1JA 3IWBA 2IOQA 4M2ZA 3PYDA 2LTSA 2UUBI 1MX0A 2V2ZA 4IZJD 1BKNA 5BR8E 4JYAI 4DUYI 2F4VE 3J81C 4HACB 1Z0BA 4NXMI 4JI5I 3V2UC 1FWKA 1EA6A 4WSPA 4MYUA 4LF8E 3HULA 4DV3I 1Z0VA 3F6GA 3AUZA 2DB2A 5FLXQ 4DV1E 4IZJB 2VE7C 2CGEA 2WW4A 2X7IA 2JY9A 1NHHA 3LTOA 4B3TE 1S4EA 4JI2I 3H09A 4DPTA 4RPFA 3QT5A 5LMNI 5IT9Q 4WYQB 1USVA 5A2QC 2CPNA 4AQYI 2B9DA 5DNYA 4X64I 2DEIA 4BMJA 1NHJA 1WUUA 4XTJA 4DV7I 2RS6A 4GKKE 2E5LE 4DR4I 2HHHI 4LF9I 4LFAE 3VYXA 4WPYA 1HNWE 2UXDE 4FWHA 1QU6A 2K4VA 3LMLA 4JI4I 4ED4A 1N33E 1N36I 3V5RA 4DPWA 5LMUI 4IZKA 3OTOI 4X8WA 2F8BA 4DU8A 4USMA 4DR5I 1Z0CA 2ZM6I 4P7AA 2VF3A 5GMDA 5FWKA 2ODRD 3T1HI 4FWDA 4JI3E 4DV2E 4B3RI 1IBLI 1Z0EA 5L3JA 1D6TA 4DV6I 2LRSA 2CZ9A 4DR6I 3HPZA 4R8OA 4BC9A 1T4NA 1Z5CA 4PRXA 3ZZ0A 4Z7CA 4F9CB 1RR9A 4OOGC 2MC5A 1T4LB 3WU3A 4JV5E 1XNQE 2NA2A 1B63A 3M6AA 4OX9E 4NXNE 2UUAE 4K0KE 4DPUA 4HXZA 4DXLA 1GZ6A 2BM0A 3K17A 2O1WA 4DV0I 4JI0E 3QT8A 3JAMQ 1IBME 3DF6A 4P7DA 1A6FA 4JI7E 1XHKA 3D4JA 2UXBE 4R1FA 2KOUA 3P1XA 3ZOQB 3JAMC 1Z59A 2L3CA 4X62E 2LUQA 1XNRE 4TUGA 3HPSA 1Z0WA 4JI3I 2DMYA 1J5EE 4M0VA 1ZXNA 1ZM4A 1FI4A 2OI2A 1J26A 4DR3E 1FKAE 2A2CA 2HK2A 2V2VA 3PRYA 1Z0GA 2V2QA 3Q6NA 4M1KA 1DQ3A 2VQFE 2O1UA 4JI6I 4LFCI 3LPSA 3PYFA 1SR9A 1Z5AA 3FIGA 1N34E 4F9AB 1N32E 2LJPA 1HNZE 3ZZTA 4FN5A 2RSMA 3B78A 4LF9E 2E5LI 1H73A 1ZXMA 1XNQI 4BS9A 2X36A 3C4TA 1ELOA 2O1VA 5ADZA 4JI7I 5AASA 3PYEA 4LF7I 3ADIA 4DR6E 2M7QA 1WHNA 4DU7A 5AE1A 4FW9A 3J81Q 4DR2E 3HXLA 4X65I 2GQ0A 3T1HE 5CFFE 3K6QA 1ZM3A 3AV0A 4JI6E 4B3TI 1K47A 4F9BB 2M1SA 1RC7A 1ZM9A 4NXNI 3Q1QA 1H7UA 3OMLA 4BC7A 2FGGA 4ZVIA 1X47A 2DEJA 4DV3E 4LF8I 1N33I 1HNXE 1J5EI 1KKHA 2JR1A 1WXRA 2O1TA 2H36X 4DV6E 1HNXI 3ZKDA 2F4VI 2DSYA 1WHQA 2L6MA 4PU9A 4B3SI 4I8OA 2XEXA 4DV5I 5BR8I 4HACA 3H4LA 4WFTA 1QZRA 3C4BA 2CG9A 2NUFA 2PNMA 3CWVA 4WUDA 2V86A 4R03A 4X65E 1ZBTA 4LFBE 2HKEA 2LTRA 5LMUE 1RREA 2Z5BA 1YZ9A 3VYYA 4X66I 1OJ4A 2Z5CA 1HNWI 2JVAA 1PKPA 3IWDA 4OX9I 3Q6MA 2PNLA 3LLHA 4LF4I 2AJ4A 1X48A 2Z5CB 4HYMA 1PIEA 3LNUA 1S16A 4AQYE 4I3HA 2E1MA 4X66E 3J7AM 1N34I 1KVKA 4B3ME 1YYKA 2JOBA 3ZM7A 1Y4SA 2HFUA 3ADGA 2MC6A 3OTOE 3JU0A 1XMQE 1STUA 1H7SA 3RMPA 1VISA 4JI4E 5AE3A 2BV3A 3GONA 2HHHE 4DKKA 4DR4E 4Z7YA 2N3HA 2LUPB 1YYOA 3J7Yp 4YY3I 3J7AG 4HY1A 1MG7A 1N32I 1NHIA 4GEQB 5IWAI 4DPYA 2V8QB 1DI2A 2M4IA 2R42A 2L33A 1Y6ZA 3F0NA 2V34A 3PYGA 4Q28A 4JI2E 1NZ0A 1H74A 1N0VC 1EKZA 4TUIA 4DR7I 4J8ZA 4L8NA 4JI1I 4DR3I 3WU6A 4JG4A 2J7KA 2NPFA 2V83A 4WUCA 4DV5E 4B3SE 4IZJA 4FWGA 1IBKE 4KQVA 5IT9C 3HQ1A 3IWCA 1Y4UA 3WU5A 2UXBI 1FJGE 3ADJA 1ZBQA 4DMIA 4DUYE 3P06A 2VQFI 4F54A 2V88A 4JYAE 2LJHA 1KTVA 2V87A 2IOPA 1IBMI 4KHPI 4LF5E 3T1YI 2V8PA 2BM1A 5GMEA 2ZITA 2L92A 4LF6E 1EI1A 4UT4A 1HR0I 4DR2I 5LL6R 2HK3A 2UXDI 2UXCE 2FV4B 4WUBA 4MYTA 1XNRI 2V89A 4DV4I 1USUA 2EZ6A 2Z5EA 4GKJI 4JV5I 2UUCE 1MU5A 4L5NC 4JI8I 4DR1I 2JOXA 5AE2A 4USKA 4LF6I 5LMNE 3ADLA 4YHHI 1PVGA 1IBLE 1X49A 1I94E 1HNZI 4DV0E 4LU9A 4KZSA 1XMOE 2L8TA 4LFCE 1Z5BA 4IZKB 3HJCA 2ZM6E 2RTXA 4DV1I 3HTXA 3DJWA 1FNMA 4EMDA 1GQEA 2HKJA 4DUZE 2Z5BB 5F3WA 3QT7A 1YYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2D A;  4JI5 E;  2NUG A;  4NXM E;  1UEK A;  4X62 I;  2HFS A;  2IHR 1;  4DV4 E;  4DV7 E;  2N3G A;  2B7T A;  4X64 E;  1H72 C;  1T4O A;  3WU4 A;  2L2N A;  4DR5 E;  2YT4 A;  2KHX A;  5A2Q Q;  1I94 I;  4JI0 I;  3T1Y E;  4KHP E;  1ZM2 A;  2L2K B;  1FWL A;  1N36 E;  2L3J A;  2LBS B;  1Z0T A;  1U2R A;  2B7V A;  4JI8 E;  1FJG I;  2UUA I;  2RS7 A;  4K0K I;  1DAR A;  2R3V A;  3ZKB A;  3QT6 A;  1XMQ I;  4LF7 E;  2ZBK B;  1RQ0 A;  1UIL A;  4JI1 E;  4PRV A;  4DUZ I;  4B3R E;  4DPX A;  4LF5 I;  4DV2 I;  2VQE E;  2NUE A;  1UHZ A;  2L2M A;  2EFG A;  2VQE I;  4UTG A;  2UUB E;  4B3M I;  4URL A;  1XMO I;  5IWA E;  3J80 Q;  4YY3 E;  1IBK I;  2B3T B;  4YHH E;  1O0W A;  2UU9 E;  3ZZU A;  2DIX A;  2E1R A;  3B82 A;  4DR1 E;  4LF4 E;  3J80 C;  4P52 A;  2UUC I;  4LFA I;  4GKJ E;  4DR7 E;  1B62 A;  4GKK I;  2UU9 I;  2UXC I;  3B8H A;  4LFB I;  5FLX C;  1HR0 E;  2Q2E B;  2MDR A;  1KIJ A;  4M30 A;  1N0U A;  2GS8 A;  3K1J A;  4M2Z A;  3PYD A;  2LTS A;  2UUB I;  1MX0 A;  2V2Z A;  1BKN A;  5BR8 E;  4JYA I;  4DUY I;  2F4V E;  4HAC B;  3J81 C;  1Z0B A;  4NXM I;  4JI5 I;  3V2U C;  1FWK A;  1EA6 A;  4MYU A;  4LF8 E;  3HUL A;  4DV3 I;  1Z0V A;  2DB2 A;  5FLX Q;  4DV1 E;  2WW4 A;  2X7I A;  2JY9 A;  1NHH A;  3LTO A;  4B3T E;  1S4E A;  4JI2 I;  4DPT A;  4RPF A;  3QT5 A;  5LMN I;  5IT9 Q;  4WYQ B;  5A2Q C;  2CPN A;  4AQY I;  4X64 I;  2DEI A;  1NHJ A;  4DV7 I;  1WUU A;  4XTJ A;  2RS6 A;  4GKK E;  2E5L E;  4DR4 I;  2HHH I;  4LF9 I;  4LFA E;  3VYX A;  1HNW E;  2UXD E;  4FWH A;  1QU6 A;  4JI4 I;  4ED4 A;  1N33 E;  1N36 I;  3V5R A;  4DPW A;  5LMU I;  3OTO I;  4X8W A;  4DU8 A;  4USM A;  4DR5 I;  1Z0C A;  2ZM6 I;  4P7A A;  2VF3 A;  5GMD A;  3T1H I;  4FWD A;  4JI3 E;  4DV2 E;  4B3R I;  1IBL I;  1Z0E A;  5L3J A;  1D6T A;  4DV6 I;  2LRS A;  2CZ9 A;  4DR6 I;  1T4N A;  1Z5C A;  4PRX A;  3ZZ0 A;  4Z7C A;  1RR9 A;  4OOG C;  1T4L B;  3WU3 A;  4JV5 E;  1XNQ E;  2NA2 A;  1B63 A;  3M6A A;  4OX9 E;  4NXN E;  2UUA E;  4K0K E;  4DPU A;  4HXZ A;  4DXL A;  2BM0 A;  3K17 A;  4DV0 I;  4JI0 E;  3QT8 A;  3JAM Q;  1IBM E;  1A6F A;  4JI7 E;  1XHK A;  3D4J A;  2UXB E;  4R1F A;  3P1X A;  3JAM C;  1Z59 A;  2L3C A;  4X62 E;  2LUQ A;  1XNR E;  1Z0W A;  4JI3 I;  2DMY A;  1J5E E;  1ZXN A;  1ZM4 A;  1FI4 A;  2OI2 A;  1J26 A;  4DR3 E;  1FKA E;  2A2C A;  2HK2 A;  2V2V A;  1Z0G A;  2V2Q A;  4M1K A;  2VQF E;  4JI6 I;  4LFC I;  3LPS A;  3PYF A;  1Z5A A;  1N34 E;  1N32 E;  2LJP A;  1HNZ E;  3ZZT A;  4FN5 A;  2RSM A;  3B78 A;  4LF9 E;  2E5L I;  1H73 A;  1ZXM A;  1XNQ I;  2X36 A;  3C4T A;  1ELO A;  4JI7 I;  3PYE A;  4LF7 I;  3ADI A;  4DR6 E;  1WHN A;  4DU7 A;  4FW9 A;  3J81 Q;  4DR2 E;  4X65 I;  3T1H E;  5CFF E;  1ZM3 A;  4JI6 E;  4B3T I;  1K47 A;  1RC7 A;  1ZM9 A;  4NXN I;  3Q1Q A;  1H7U A;  4ZVI A;  1X47 A;  2DEJ A;  4DV3 E;  4LF8 I;  1N33 I;  1HNX E;  1J5E I;  1KKH A;  4DV6 E;  1HNX I;  3ZKD A;  2F4V I;  1WHQ A;  4PU9 A;  4B3S I;  2XEX A;  4DV5 I;  5BR8 I;  4HAC A;  3H4L A;  4WFT A;  1QZR A;  3C4B A;  2NUF A;  3CWV A;  4WUD A;  4X65 E;  1ZBT A;  4LFB E;  2HKE A;  2LTR A;  5LMU E;  1RRE A;  1YZ9 A;  3VYY A;  4X66 I;  1OJ4 A;  1HNW I;  2JVA A;  1PKP A;  4OX9 I;  3LLH A;  4LF4 I;  2AJ4 A;  1X48 A;  4HYM A;  1PIE A;  3LNU A;  1S16 A;  4AQY E;  4I3H A;  4X66 E;  3J7A M;  1N34 I;  1KVK A;  4B3M E;  1YYK A;  3ZM7 A;  2HFU A;  3ADG A;  3OTO E;  1XMQ E;  1STU A;  1H7S A;  1VIS A;  4JI4 E;  2BV3 A;  3GON A;  2HHH E;  4DKK A;  4DR4 E;  4Z7Y A;  2N3H A;  2LUP B;  1YYO A;  3J7Y p;  4YY3 I;  3J7A G;  4HY1 A;  1MG7 A;  1N32 I;  1NHI A;  5IWA I;  4DPY A;  1DI2 A;  2R42 A;  2L33 A;  3F0N A;  2V34 A;  3PYG A;  4JI2 E;  1NZ0 A;  1H74 A;  1N0V C;  1EKZ A;  4DR7 I;  4JI1 I;  4DR3 I;  3WU6 A;  4JG4 A;  2J7K A;  2NPF A;  4WUC A;  4DV5 E;  4B3S E;  4FWG A;  1IBK E;  4KQV A;  5IT9 C;  3WU5 A;  2UXB I;  1FJG E;  3ADJ A;  4DUY E;  2VQF I;  4JYA E;  2LJH A;  1KTV A;  1IBM I;  4KHP I;  4LF5 E;  3T1Y I;  2V8P A;  2BM1 A;  5GME A;  2ZIT A;  4LF6 E;  1EI1 A;  4UT4 A;  1HR0 I;  4DR2 I;  5LL6 R;  2HK3 A;  2UXD I;  2UXC E;  4WUB A;  4MYT A;  1XNR I;  4DV4 I;  2EZ6 A;  4GKJ I;  4JV5 I;  2UUC E;  1MU5 A;  4JI8 I;  4DR1 I;  4USK A;  4LF6 I;  5LMN E;  3ADL A;  4YHH I;  1PVG A;  1IBL E;  1X49 A;  1I94 E;  1HNZ I;  4DV0 E;  1XMO E;  4LFC E;  1Z5B A;  2ZM6 E;  2RTX A;  4DV1 I;  3HTX A;  1FNM A;  4EMD A;  1GQE A;  2HKJ A;  4DUZ E;  3QT7 A;  1YYW A; 
#chains in the Genus database with same CATH topology
 2NN6 D;  4LTY A;  3MHS C;  2JEB A;  2NN6 C;  2A2D A;  4JI5 E;  2NUG A;  4NXM E;  2YRH A;  1EH8 A;  1UEK A;  5DNL A;  2M9A A;  1PJQ A;  4X62 I;  4RH8 A;  2WBS A;  2EPL X;  2HFS A;  2IHR 1;  2EPK X;  4DV4 E;  1TF6 A;  4OO1 E;  1XXE A;  4DV7 E;  2ODR C;  2N3G A;  2B7T A;  4X64 E;  3EPH A;  1H72 C;  5C0X C;  1T4O A;  3WU4 A;  2L2N A;  4DR5 E;  2HC5 A;  2EQ0 A;  2JWO A;  1P47 A;  1AAY A;  1UBD C;  5C0X B;  2LE2 A;  3L7Z B;  1G2F C;  2YT4 A;  2KHX A;  3C6M A;  5A2Q Q;  1I94 I;  2EN2 A;  3T1Y E;  3NZK A;  4JI0 I;  5AC4 A;  4KHP E;  1ZM2 A;  2L2K B;  3GLL A;  1FWL A;  1EH7 A;  2IER A;  5KL7 A;  2L3J A;  1N36 E;  2YTJ A;  2LBS B;  2KON A;  2PRT A;  1Z0T A;  2I13 A;  1U2R A;  4QNJ A;  2B7V A;  3CDI A;  2EWL A;  2ADR A;  2EMA A;  1ZR9 A;  2V85 A;  4JI8 E;  3L7Z A;  2RS7 A;  4AID A;  2UUA I;  4K0K I;  4BBY A;  1FJG I;  1DAR A;  2LVH A;  2EOQ A;  2R3V A;  3ZKB A;  3F6H A;  1HK7 A;  5KL4 A;  2C39 B;  2J65 A;  5TSE A;  2YZT A;  2WP8 A;  3QT6 A;  1XMQ I;  3VK6 A;  4LF7 E;  2ZBK B;  1RQ0 A;  2EM8 A;  1UIL A;  4JI1 E;  4PRV A;  4MDT A;  4DUZ I;  2YRK A;  4LCG A;  4B3R E;  2JT2 A;  2MKN A;  4DPX A;  2YTQ A;  4DV2 I;  1A1F A;  4LF5 I;  2VQE E;  4BA2 A;  2NUE A;  2EMF A;  1UHZ A;  2L2M A;  2EFG A;  2VQE I;  2WZO A;  4UTG A;  3UHM A;  1A1K A;  2UUB E;  1YH8 A;  4B3M I;  3MSW A;  2EOI A;  4URL A;  1XMO I;  5IWA E;  2HGH A;  2LMZ A;  1DGC A;  3J80 Q;  1LLM C;  4YY3 E;  1X5W A;  2G7H A;  1IBK I;  2YTI A;  2B3T B;  4YHH E;  1O0W A;  2UU9 E;  4OZE A;  3ZZU A;  2DIX A;  5T6J A;  2JE6 A;  4GZN C;  2E1R A;  3B82 A;  3K85 A;  4DR1 E;  2NAB A;  3THN A;  4LF4 E;  4R2E A;  5EKW A;  3KWR A;  5K36 E;  2CSH A;  4BHB A;  3J80 C;  4P52 A;  5C0X A;  2UUC I;  4LFA I;  4GKJ E;  5DRR A;  4DR7 E;  1B62 A;  3JTZ A;  4N3O A;  4GKK I;  4P78 A;  4F6M A;  2FTX B;  3DD6 A;  3U1K A;  2UU9 I;  2UXC I;  4BCA A;  1N3G A;  3B8H A;  2E72 A;  2RQL A;  5FLX C;  4LFB I;  1HR0 E;  2C38 A;  2Q2E B;  2VF1 A;  2MDR A;  1KIJ A;  4M30 A;  1N0U A;  1IQO A;  2GS8 A;  3K1J A;  3IWB A;  2IOQ A;  4M2Z A;  3PYD A;  2EMC A;  2LTS A;  2NN6 A;  2UUB I;  5K36 A;  1MX0 A;  2V2Z A;  4IZJ D;  1BKN A;  5BR8 E;  5JEA D;  4JYA I;  3P76 A;  4DUY I;  2J7J A;  4MLV A;  2F4V E;  3HKM A;  3J81 C;  4HAC B;  1KYQ A;  1Z0B A;  2C39 A;  4JI5 I;  4NXM I;  3V2U C;  2EOJ A;  2YPN A;  1FWK A;  3L00 A;  4WSP A;  2ENA A;  1EA6 A;  4MYU A;  5ELW A;  4LF8 E;  3HUL A;  1RMD A;  4DV3 I;  2BBG A;  4MU3 A;  1Z0V A;  4BA1 A;  3F6G A;  3AUZ A;  2BA0 D;  2F1D A;  2BR2 A;  2DB2 A;  1E3P A;  5JEA B;  5FLX Q;  4DV1 E;  4IZJ B;  2VE7 C;  2EPO A;  2CGE A;  4IFD C;  1BBO A;  2WW4 A;  2JY9 A;  1NHH A;  2X7I A;  4B3T E;  3LTO A;  2DGC A;  1S4E A;  5DNX A;  4IFD D;  4OO1 C;  2EN1 A;  1A1I A;  4JI2 I;  2EPZ A;  5KL3 A;  1IQS A;  2RPC A;  3H09 A;  4DPT A;  2O3Z A;  4RPF A;  3QT5 A;  4R2Q A;  2C38 B;  3M85 D;  2EMZ A;  4ZYE A;  2EM2 A;  5LMN I;  1TN9 A;  3BGH A;  5IT9 Q;  2EOZ A;  1PJS A;  4WYQ B;  5IXM B;  1USV A;  4BA2 B;  5A2Q C;  2CPN A;  4N4R B;  4AQY I;  4OO1 F;  2B9D A;  5DNY A;  4X64 I;  1A1J A;  2DEI A;  4BMJ A;  1NHJ A;  1WUU A;  4XTJ A;  4DV7 I;  2YSP A;  2LJU A;  2RS6 A;  4GKK E;  2E5L E;  2EOR A;  5JEA C;  2HHH I;  4DR4 I;  4LF9 I;  4LFA E;  1OYS A;  4FW3 A;  4OO1 A;  3VYX A;  4WPY A;  3VHT B;  1HNW E;  2UXD E;  4FWH A;  2R1F A;  1QU6 A;  2K4V A;  3LML A;  4IS1 C;  4MQY A;  4JI4 I;  4ED4 A;  1N33 E;  1N36 I;  1YUI A;  3V5R A;  4DPW A;  4WX9 A;  5LMU I;  1G2D C;  1EH6 A;  4IZK A;  2JEA B;  4KWY A;  3OTO I;  4X8W A;  2EN4 A;  2F8B A;  4DU8 A;  4USM A;  4DR5 I;  1Z0C A;  1OYP A;  2ZM6 I;  4M9V C;  1UDO A;  4P7A A;  2VF3 A;  5GMD A;  5FWK A;  3EQ1 A;  2BB8 A;  2ODR D;  3T1H I;  4FWD A;  4JI3 E;  2EN3 A;  2BA1 D;  4DV2 E;  4J3D A;  4B3R I;  1IBL I;  4LCF A;  3UK3 C;  2DRP A;  1Z0E A;  5L3J A;  1D6T A;  4DV6 I;  3M85 G;  2LRS A;  2CZ9 A;  4DR6 I;  3HPZ A;  4R8O A;  4BC9 A;  1T4N A;  1Z5C A;  4PRX A;  3ZZ0 A;  1OYR A;  2GO3 A;  4Z7C A;  2PNZ A;  2YTD A;  3MHH C;  4F9C B;  1T4L B;  4OOG C;  2MC5 A;  3EPJ A;  1RR9 A;  5AC5 A;  2EOH A;  4JV5 E;  2EOO A;  3WU3 A;  1XNQ E;  2NN6 E;  2NA2 A;  1PJT A;  2JEB B;  1B63 A;  2I9I A;  2EN8 A;  3M6A A;  4OX9 E;  4NXN E;  2UUA E;  4K0K E;  4BA1 B;  5KL2 A;  3H1C A;  4DPU A;  2YTE A;  4HXZ A;  2BA0 G;  4DXL A;  4ZYH A;  1GZ6 A;  2EOY A;  2BM0 A;  3K17 A;  2O1W A;  4IS9 A;  5C0X E;  5EL9 A;  4DV0 I;  5A6K A;  4JI0 E;  2C37 B;  5JEA F;  3QT8 A;  4IFD A;  3JAM Q;  3CDJ A;  1IBM E;  3DF6 A;  1B69 A;  4P7D A;  2CVE A;  2MDG A;  4O24 A;  1A6F A;  4JI7 E;  2EM0 A;  1VI7 A;  4WXD A;  4R2R A;  4ZYG A;  1XHK A;  1QNT A;  4AM3 A;  3D4J A;  2K7I A;  3PS1 A;  2UXB E;  4R1F A;  2KOU A;  3P1X A;  3ZOQ B;  4F2J C;  4QNK A;  3JAM C;  2EM9 A;  1Z59 A;  2L3C A;  4X62 E;  2LUQ A;  1XNR E;  4TUG A;  5DRQ A;  3HPS A;  2DLQ A;  3P3G A;  3PS3 A;  2EMK A;  1Z0W A;  4JI3 I;  2DMY A;  2EM6 A;  4M0V A;  2EMH A;  2EPM X;  4RHB B;  1J5E E;  1ZXN A;  1ZM4 A;  1FI4 A;  2YSO A;  2OI2 A;  1J26 A;  4DR3 E;  2EMY A;  2JYA A;  2JXP A;  2EPP A;  1FKA E;  2A2C A;  3M99 B;  2HK2 A;  3KRN A;  2V2V A;  4IFD B;  2A25 A;  3GCM A;  3PRY A;  4Q35 B;  5K36 F;  1Z0G A;  2V2Q A;  3Q6N A;  4M1K A;  1DQ3 A;  2VQF E;  2O1U A;  2YTF A;  4JI6 I;  4LFC I;  3EPL A;  3LPS A;  3PYF A;  1SR9 A;  1Z5A A;  4R2S A;  3FIG A;  1N34 E;  2EL5 A;  1WRJ A;  4FW6 A;  4F9A B;  5C0X D;  1N32 E;  2LJP A;  1HNZ E;  3ZZT A;  4FN5 A;  2GLI A;  2RSM A;  2PNZ B;  3BID A;  4LF9 E;  2PO2 B;  3B78 A;  3PS2 A;  4AIM A;  3J7A M;  2E5L I;  5A6B A;  2EPU A;  1H73 A;  1ZXM A;  1XNQ I;  4BS9 A;  1P42 A;  2X36 A;  2VRD A;  3C4T A;  1ELO A;  2O1V A;  5ADZ A;  1A1G A;  5KL6 A;  2EOF A;  3C6K A;  5C0X F;  4JI7 I;  5AAS A;  3PYE A;  2ENH A;  1YHC A;  3ADI A;  4LF7 I;  4DR6 E;  2M7Q A;  2EOE A;  1UDN A;  1WHN A;  1R6L A;  2NN6 B;  4DU7 A;  3U1Y A;  5AE1 A;  4FW9 A;  3J81 Q;  1X6E A;  4F6N A;  2LV2 A;  4DR2 E;  3HXL A;  4X65 I;  1A1L A;  2GQ0 A;  3T1H E;  5CFF E;  3K6Q A;  2WP8 B;  2ELZ A;  1ZM3 A;  3AV0 A;  4JI6 E;  4U3B A;  4B3T I;  1K47 A;  4MU1 A;  4F9B B;  2M1S A;  1RC7 A;  2EE8 A;  1ZM9 A;  4FW4 A;  4NXN I;  2PO0 B;  3Q1Q A;  1H7U A;  3THO B;  1X6H A;  3OML A;  4BC7 A;  2FGG A;  4ZVI A;  2EPA A;  1NCS A;  1X47 A;  2ENC A;  3BBG A;  2DEJ A;  4LOM A;  4DV3 E;  2EMB A;  4MU4 A;  4LF8 I;  2ELY A;  4FK5 C;  2CTD A;  1N33 I;  1HNX E;  1KJK A;  1J5E I;  1KKH A;  2JR1 A;  1WXR A;  2LT7 A;  2O1T A;  5JEA E;  2H36 X;  4DV6 E;  1HNX I;  3M7N G;  3ZKD A;  2WNR B;  1UN6 B;  2F4V I;  2DSY A;  1WHQ A;  2L6M A;  3QG5 C;  4PU9 A;  4B3S I;  4I8O A;  2AE8 A;  2XEX A;  4DV5 I;  5BR8 I;  4HAC A;  4OKG A;  3H4L A;  1ZAA C;  4WFT A;  1QZR A;  2EPN A;  3C4B A;  2EML A;  2CG9 A;  2Q8U A;  2NUF A;  2PNM A;  2GHF A;  2NN6 F;  1RHY A;  1L4S A;  2PO1 A;  2EQ3 A;  3CWV A;  4U3D A;  4WUD A;  2V86 A;  2MKD A;  4R03 A;  1ZBT A;  4X65 E;  2N8X A;  2LTR A;  4LFB E;  2HKE A;  5LMU E;  2VES A;  3M7N D;  1RRE A;  5JEA A;  4NZV A;  3TQM A;  1E3H A;  2Z5B A;  1YZ9 A;  2PO2 A;  2EM7 A;  3VYY A;  1TF3 A;  4X66 I;  1OJ4 A;  2EP3 A;  2Z5C A;  1HNW I;  1PKP A;  2JVA A;  2EPX A;  3IWD A;  5A6A A;  3Q6M A;  1YSA C;  4GQU A;  4OX9 I;  2PNL A;  3LLH A;  4LF4 I;  2AJ4 A;  1X48 A;  2YTO A;  2Z5C B;  4HYM A;  1PIE A;  3KZY A;  1S16 A;  3LNU A;  2YU5 A;  4AQY E;  4I3H A;  2JE6 B;  4FW7 A;  4WXC A;  1BBG A;  2E1M A;  4NBQ A;  3P3E A;  1ZU1 A;  2LO3 A;  4X66 E;  4LPF A;  2YTP A;  5LLQ A;  4X9J A;  1N34 I;  1KVK A;  4B3M E;  1YYK A;  2JOB A;  4R2D A;  3ZM7 A;  1Y4S A;  1MEY C;  2WBT A;  5IV8 B;  1UDQ A;  1AH5 A;  2EM3 A;  2HFU A;  1YUJ A;  3ADG A;  2GO4 A;  5A6B D;  2HJJ A;  2MC6 A;  3OTO E;  3JU0 A;  4IJD A;  2DLK A;  4HTG A;  1XMQ E;  1STU A;  3EPK A;  5K36 D;  1H7S A;  3RMP A;  1VIS A;  2EN7 A;  5K36 C;  2DMI A;  2BR2 B;  1T38 A;  2R76 A;  4JI4 E;  2EL6 A;  5AE3 A;  1F2I G;  2BV3 A;  3GON A;  4R2C A;  2HHH E;  4MLQ A;  4DKK A;  5KL5 A;  2N3H A;  4DR4 E;  4Z7Y A;  1Y5Y A;  2LUP B;  1YYO A;  2D9H A;  4O4K A;  3J7Y p;  4YY3 I;  3J7A G;  4HY1 A;  1MG7 A;  2WCC 3;  1N32 I;  1NHI A;  4GEQ B;  5IWA I;  2EOX A;  4BHC A;  1WJP A;  4DPY A;  2EQ1 A;  5K36 B;  3ECR A;  2V8Q B;  1DI2 A;  2CT1 A;  2M4I A;  2R42 A;  2L33 A;  4FW5 A;  1IMU A;  1Y6Z A;  3F0N A;  2V34 A;  3PYG A;  2EMG A;  4Q28 A;  1Z1B A;  4JI2 E;  1NZ0 A;  1H74 A;  1N0V C;  1EKZ A;  4TUI A;  1A1H A;  4ZYD A;  1T39 A;  4DR7 I;  4J8Z A;  4L8N A;  2EN6 A;  4JI1 I;  5DRP A;  4DR3 I;  2EPC A;  4JG4 A;  2J7K A;  3WU6 A;  2EM4 A;  3GME A;  3BF2 A;  2WNR A;  2NPF A;  2V83 A;  1JK1 A;  4DV5 E;  4WUC A;  2RSI A;  2YTG A;  4B3S E;  4IZJ A;  2JP9 A;  4FWG A;  1IBK E;  4NHR A;  4KQV A;  5IT9 C;  3HQ1 A;  3IWC A;  4IFD E;  2EOM A;  3KZZ A;  2EM5 A;  1Y4U A;  3WU5 A;  2EL4 A;  1X3C A;  2UXB I;  2EJ4 A;  1YFH A;  1FJG E;  2EMX A;  3ADJ A;  1ZBQ A;  4MU0 A;  4DMI A;  4DUY E;  3P06 A;  2YTN A;  4HEI A;  4F54 A;  2V88 A;  4JYA E;  2C37 A;  2VQF I;  2LJH A;  1KTV A;  2PO0 A;  2V87 A;  2IOP A;  3B4T A;  2EPR A;  1IBM I;  1R6M A;  4KHP I;  4LF5 E;  3T1Y I;  2V8P A;  1MGT A;  2EMI A;  2BM1 A;  2ZIT A;  2L92 A;  5GME A;  2EMW A;  2LCE A;  1X6F A;  4LF6 E;  1EI1 A;  1UDS A;  4UT4 A;  1HR0 I;  2PO1 B;  2JPA A;  4DR2 I;  5LL6 R;  2HK3 A;  2IES A;  2YWQ A;  2UXD I;  1YPN A;  2FV4 B;  2UXC E;  2WBU A;  4MYT A;  2BA1 G;  4WUB A;  1XNR I;  2V89 A;  4DV4 I;  1USU A;  4OO1 D;  2EZ6 A;  2Z5E A;  4GKJ I;  4JV5 I;  2UUC E;  2YU8 A;  1MU5 A;  4L5N C;  4JI8 I;  4DR1 I;  1PDA A;  2JOX A;  1GTK A;  4LCH A;  5DRO A;  1BB8 A;  5AE2 A;  4USK A;  4LF6 I;  5LMN E;  1SFE A;  3ADL A;  4ISA A;  4O43 A;  2YRM A;  4YHH I;  1PVG A;  1IBL E;  1X49 A;  5A6J A;  1I94 E;  4R2P A;  1HNZ I;  4DV0 E;  2EOS A;  4LU9 A;  4KZS A;  4R2A A;  1XMO E;  5A69 A;  2L8T A;  4LFC E;  3P3C A;  1Z5B A;  4IZK B;  2JEA A;  3HJC A;  2ZM6 E;  2RTX A;  4WSG A;  2GPI A;  4O5G A;  1JK2 A;  3HTX A;  4DV1 I;  3DJW A;  1FNM A;  1NEI A;  4EMD A;  1GQE A;  1Y60 A;  2HKJ A;  4DUZ E;  2Z5B B;  4IFD F;  5F3W A;  3QT7 A;  4OO1 B;  1YYW A; 
#chains in the Genus database with same CATH homology
 4LTY A;  2A2D A;  4JI5 E;  2NUG A;  4NXM E;  1UEK A;  4X62 I;  2HFS A;  2IHR 1;  4DV4 E;  4DV7 E;  2ODR C;  2N3G A;  2B7T A;  4X64 E;  1H72 C;  1T4O A;  3WU4 A;  2L2N A;  4DR5 E;  2JWO A;  2LE2 A;  2YT4 A;  2KHX A;  5A2Q Q;  1I94 I;  4JI0 I;  3T1Y E;  4KHP E;  1ZM2 A;  2L2K B;  1FWL A;  1N36 E;  2L3J A;  2LBS B;  2KON A;  1Z0T A;  1U2R A;  2B7V A;  2EWL A;  2V85 A;  4JI8 E;  1FJG I;  2UUA I;  2RS7 A;  4K0K I;  4BBY A;  1DAR A;  2R3V A;  3ZKB A;  3F6H A;  1HK7 A;  2YZT A;  3QT6 A;  1XMQ I;  3VK6 A;  4LF7 E;  2ZBK B;  1RQ0 A;  1UIL A;  4JI1 E;  4PRV A;  4DUZ I;  4B3R E;  4DPX A;  4LF5 I;  4DV2 I;  2VQE E;  2NUE A;  1UHZ A;  2L2M A;  2EFG A;  2VQE I;  2WZO A;  4UTG A;  2UUB E;  4B3M I;  3MSW A;  4URL A;  1XMO I;  5IWA E;  2LMZ A;  3J80 Q;  4YY3 E;  2G7H A;  1IBK I;  2B3T B;  4YHH E;  1O0W A;  2UU9 E;  3ZZU A;  2DIX A;  5T6J A;  2E1R A;  3B82 A;  3K85 A;  4DR1 E;  4LF4 E;  3KWR A;  3J80 C;  4P52 A;  2UUC I;  4LFA I;  4GKJ E;  4DR7 E;  1B62 A;  3JTZ A;  4N3O A;  4GKK I;  4P78 A;  2FTX B;  2UU9 I;  2UXC I;  4BCA A;  3B8H A;  4LFB I;  5FLX C;  1HR0 E;  2Q2E B;  2VF1 A;  2MDR A;  1KIJ A;  4M30 A;  1N0U A;  2GS8 A;  3K1J A;  3IWB A;  2IOQ A;  4M2Z A;  3PYD A;  2LTS A;  2UUB I;  1MX0 A;  2V2Z A;  4IZJ D;  1BKN A;  5BR8 E;  4JYA I;  4DUY I;  2F4V E;  3J81 C;  4HAC B;  1Z0B A;  4NXM I;  4JI5 I;  3V2U C;  1FWK A;  1EA6 A;  4WSP A;  4MYU A;  4LF8 E;  3HUL A;  4DV3 I;  1Z0V A;  3F6G A;  3AUZ A;  2DB2 A;  5FLX Q;  4DV1 E;  4IZJ B;  2VE7 C;  2CGE A;  2WW4 A;  2X7I A;  2JY9 A;  1NHH A;  3LTO A;  4B3T E;  1S4E A;  4JI2 I;  3H09 A;  4DPT A;  4RPF A;  3QT5 A;  5LMN I;  5IT9 Q;  4WYQ B;  1USV A;  5A2Q C;  2CPN A;  4AQY I;  2B9D A;  5DNY A;  4X64 I;  2DEI A;  4BMJ A;  1NHJ A;  1WUU A;  4XTJ A;  4DV7 I;  2RS6 A;  4GKK E;  2E5L E;  4DR4 I;  2HHH I;  4LF9 I;  4LFA E;  3VYX A;  4WPY A;  1HNW E;  2UXD E;  4FWH A;  1QU6 A;  2K4V A;  3LML A;  4JI4 I;  4ED4 A;  1N33 E;  1N36 I;  3V5R A;  4DPW A;  5LMU I;  4IZK A;  3OTO I;  4X8W A;  2F8B A;  4DU8 A;  4USM A;  4DR5 I;  1Z0C A;  2ZM6 I;  4P7A A;  2VF3 A;  5GMD A;  5FWK A;  2ODR D;  3T1H I;  4FWD A;  4JI3 E;  4DV2 E;  4B3R I;  1IBL I;  1Z0E A;  5L3J A;  1D6T A;  4DV6 I;  2LRS A;  2CZ9 A;  4DR6 I;  3HPZ A;  4R8O A;  4BC9 A;  1T4N A;  1Z5C A;  4PRX A;  3ZZ0 A;  4Z7C A;  4F9C B;  1RR9 A;  4OOG C;  2MC5 A;  1T4L B;  3WU3 A;  4JV5 E;  1XNQ E;  2NA2 A;  1B63 A;  3M6A A;  4OX9 E;  4NXN E;  2UUA E;  4K0K E;  4DPU A;  4HXZ A;  4DXL A;  1GZ6 A;  2BM0 A;  3K17 A;  2O1W A;  4DV0 I;  4JI0 E;  3QT8 A;  3JAM Q;  1IBM E;  3DF6 A;  4P7D A;  1A6F A;  4JI7 E;  1XHK A;  3D4J A;  2UXB E;  4R1F A;  2KOU A;  3P1X A;  3ZOQ B;  3JAM C;  1Z59 A;  2L3C A;  4X62 E;  2LUQ A;  1XNR E;  4TUG A;  3HPS A;  1Z0W A;  4JI3 I;  2DMY A;  1J5E E;  4M0V A;  1ZXN A;  1ZM4 A;  1FI4 A;  2OI2 A;  1J26 A;  4DR3 E;  1FKA E;  2A2C A;  2HK2 A;  2V2V A;  3PRY A;  1Z0G A;  2V2Q A;  3Q6N A;  4M1K A;  1DQ3 A;  2VQF E;  2O1U A;  4JI6 I;  4LFC I;  3LPS A;  3PYF A;  1SR9 A;  1Z5A A;  3FIG A;  1N34 E;  4F9A B;  1N32 E;  2LJP A;  1HNZ E;  3ZZT A;  4FN5 A;  2RSM A;  3B78 A;  4LF9 E;  2E5L I;  1H73 A;  1ZXM A;  1XNQ I;  4BS9 A;  2X36 A;  3C4T A;  1ELO A;  2O1V A;  5ADZ A;  4JI7 I;  5AAS A;  3PYE A;  4LF7 I;  3ADI A;  4DR6 E;  2M7Q A;  1WHN A;  4DU7 A;  5AE1 A;  4FW9 A;  3J81 Q;  4DR2 E;  3HXL A;  4X65 I;  2GQ0 A;  3T1H E;  5CFF E;  3K6Q A;  1ZM3 A;  3AV0 A;  4JI6 E;  4B3T I;  1K47 A;  4F9B B;  2M1S A;  1RC7 A;  1ZM9 A;  4NXN I;  3Q1Q A;  1H7U A;  3OML A;  4BC7 A;  2FGG A;  4ZVI A;  1X47 A;  2DEJ A;  4DV3 E;  4LF8 I;  1N33 I;  1HNX E;  1J5E I;  1KKH A;  2JR1 A;  1WXR A;  2O1T A;  2H36 X;  4DV6 E;  1HNX I;  3ZKD A;  2F4V I;  2DSY A;  1WHQ A;  2L6M A;  4PU9 A;  4B3S I;  4I8O A;  2XEX A;  4DV5 I;  5BR8 I;  4HAC A;  3H4L A;  4WFT A;  1QZR A;  3C4B A;  2CG9 A;  2NUF A;  2PNM A;  3CWV A;  4WUD A;  2V86 A;  4R03 A;  4X65 E;  1ZBT A;  4LFB E;  2HKE A;  2LTR A;  5LMU E;  1RRE A;  2Z5B A;  1YZ9 A;  3VYY A;  4X66 I;  1OJ4 A;  2Z5C A;  1HNW I;  2JVA A;  1PKP A;  3IWD A;  4OX9 I;  3Q6M A;  2PNL A;  3LLH A;  4LF4 I;  2AJ4 A;  1X48 A;  2Z5C B;  4HYM A;  1PIE A;  3LNU A;  1S16 A;  4AQY E;  4I3H A;  2E1M A;  4X66 E;  3J7A M;  1N34 I;  1KVK A;  4B3M E;  1YYK A;  2JOB A;  3ZM7 A;  1Y4S A;  2HFU A;  3ADG A;  2MC6 A;  3OTO E;  3JU0 A;  1XMQ E;  1STU A;  1H7S A;  3RMP A;  1VIS A;  4JI4 E;  5AE3 A;  2BV3 A;  3GON A;  2HHH E;  4DKK A;  4DR4 E;  4Z7Y A;  2N3H A;  2LUP B;  1YYO A;  3J7Y p;  4YY3 I;  3J7A G;  4HY1 A;  1MG7 A;  1N32 I;  1NHI A;  4GEQ B;  5IWA I;  4DPY A;  2V8Q B;  1DI2 A;  2M4I A;  2R42 A;  2L33 A;  1Y6Z A;  3F0N A;  2V34 A;  3PYG A;  4Q28 A;  4JI2 E;  1NZ0 A;  1H74 A;  1N0V C;  1EKZ A;  4TUI A;  4DR7 I;  4J8Z A;  4L8N A;  4JI1 I;  4DR3 I;  3WU6 A;  4JG4 A;  2J7K A;  2NPF A;  2V83 A;  4WUC A;  4DV5 E;  4B3S E;  4IZJ A;  4FWG A;  1IBK E;  4KQV A;  5IT9 C;  3HQ1 A;  3IWC A;  1Y4U A;  3WU5 A;  2UXB I;  1FJG E;  3ADJ A;  1ZBQ A;  4DMI A;  4DUY E;  3P06 A;  2VQF I;  4F54 A;  2V88 A;  4JYA E;  2LJH A;  1KTV A;  2V87 A;  2IOP A;  1IBM I;  4KHP I;  4LF5 E;  3T1Y I;  2V8P A;  2BM1 A;  5GME A;  2ZIT A;  2L92 A;  4LF6 E;  1EI1 A;  4UT4 A;  1HR0 I;  4DR2 I;  5LL6 R;  2HK3 A;  2UXD I;  2UXC E;  2FV4 B;  4WUB A;  4MYT A;  1XNR I;  2V89 A;  4DV4 I;  1USU A;  2EZ6 A;  2Z5E A;  4GKJ I;  4JV5 I;  2UUC E;  1MU5 A;  4L5N C;  4JI8 I;  4DR1 I;  2JOX A;  5AE2 A;  4USK A;  4LF6 I;  5LMN E;  3ADL A;  4YHH I;  1PVG A;  1IBL E;  1X49 A;  1I94 E;  1HNZ I;  4DV0 E;  4LU9 A;  4KZS A;  1XMO E;  2L8T A;  4LFC E;  1Z5B A;  4IZK B;  3HJC A;  2ZM6 E;  2RTX A;  4DV1 I;  3HTX A;  3DJW A;  1FNM A;  4EMD A;  1GQE A;  2HKJ A;  4DUZ E;  2Z5B B;  5F3W A;  3QT7 A;  1YYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...