4DV5E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5E02
3C4TA 1XMQI 1HNWI 2HKEA 1Z5BA 1ZM4A 4DV2I 4JI1E 1S16A 1RC7A 3QT5A 1HNZE 1FWKA 1QZRA 2VQEI 3T1HE 2OI2A 3ZZUA 4FWHA 2BV3A 4LF9E 4DU8A 3J7AM 3QT8A 5IT9C 4X66E 4JI6E 2UXDI 1EI1A 4JI7E 5LMUI 4LF8I 1N32I 5LMNE 2DEJA 3LLHA 1N34I 4K0KI 2UUBE 1XHKA 2AJ4A 3J80Q 1XNQE 1MU5A 5A2QC 1FJGE 2ZM6I 4FWDA 4USKA 2B7VA 2KHXA 4DV1I 2BM1A 4LF5E 4DUZE 2R42A 4YHHE 3ADLA 2NUEA 5IT9Q 1T4OA 3CWVA 2V2VA 4DV3E 4GKKI 3PYDA 2J7KA 1FWLA 2VQFE 2UUCI 4DV6E 3V5RA 4Z7CA 1MG7A 1UHZA 2NUGA 2YT4A 4PRVA 1VISA 4DPXA 4WFTA 1ZM2A 1NHIA 4JV5E 2L33A 1HNXE 3WU4A 4DR4E 2N3HA 4JYAE 1Z0BA 3LTOA 5LL6R 2HHHE 1ZBTA 4X64E 3ZKBA 4DV4I 4LF6I 3T1YE 3GONA 3ADGA 1I94E 2NA2A 3VYYA 1WHQA 4WYQB 1XNRI 1ZXNA 2F4VE 3QT7A 4MYUA 2EFGA 2UXCI 1PIEA 4B3SE 2DEIA 1HR0E 3WU6A 4Z7YA 1FKAE 4LFAI 1U2RA 4NXNE 2L2NA 5IWAI 1N36I 1O0WA 1XMQE 1ZXMA 1HNWE 1RQ0A 4DV2E 3B82A 4LFCI 2BM0A 3PYGA 2R3VA 4JI2I 4LFBI 4JI4E 1B63A 2A2DA 4UT4A 3D4JA 4LF4I 4MYTA 4WUBA 1FNMA 1QU6A 2LUPB 4HACB 3J80C 3ADJA 4URLA 1NHJA 2Q2EB 2RSMA 2UU9E 1H7UA 5GMEA 1RR9A 2UXDE 4ZVIA 5LMUE 4LF8E 4WUCA 1J5EI 4KQVA 1IBLI 1N32E 1XMOI 3P1XA 4K0KE 1Z5AA 1T4NA 4JG4A 1KKHA 2V8PA 1IBKI 2ZM6E 4DV1E 4B3RI 4YY3I 1N33E 4FW9A 1YYOA 1HNZI 5CFFE 4GKJE 2DIXA 4GKKE 4DR5E 1H7SA 1A6FA 4DPTA 2WW4A 4DXLA 2L3JA 2VF3A 4DR3I 1NHHA 3J81C 4OX9I 4DR6I 3ADIA 4I3HA 3PYFA 2XEXA 1KTVA 4HXZA 2JY9A 4DV5I 2LTRA 2HK2A 4EMDA 1IBME 4HACA 1X49A 4B3ME 2L2KB 1X47A 3C4BA 1KVKA 4DV4E 4JI8I 1WUUA 2HFUA 2UXBE 4DU7A 1Z0VA 4YHHI 3J81Q 4DUYI 2UXCE 3B8HA 4KHPE 2E1RA 3J7Yp 4LFAE 2ZBKB 4FWGA 5BR8I 1EA6A 3OTOE 5IWAE 4DV7E 1T4LB 1N36E 1Z5CA 1Z0GA 1DI2A 4LFCE 4DPWA 4DV0I 2UUAE 1HNXI 2E5LI 4X62E 4NXMI 4DR4I 4JYAI 4JI3E 2LRSA 4JI2E 1N0VC 4PRXA 1GQEA 4X64I 5FLXC 1YZ9A 3HULA 4LF4E 1I94I 1WHNA 4JI5I 4DR2I 4JI0I 4P7AA 3ZKDA 2L3CA 2HK3A 5L3JA 4UTGA 2VQEE 1HR0I 4B3TI 3ZZ0A 1PVGA 4AQYI 1J5EE 4P52A 1IBLE 1H72C 1RREA 1XMOE 4NXNI 4DR1I 1Z0CA 1ELOA 2B7TA 4LF7I 2RTXA 5FLXQ 2V34A 1MX0A 3VYXA 4X65I 1N34E 1IBKE 4DR7I 4FN5A 4DPYA 4JI4I 4B3RE 4YY3E 4WUDA 2LJHA 1BKNA 4JI1I 2V2QA 1ZM3A 1STUA 3HTXA 4HY1A 3M6AA 4DR3E 4DKKA 2CZ9A 4ED4A 4PU9A 1H74A 2X36A 4OX9E 4DR6E 2GS8A 2HFSA 3T1HI 2UU9I 3H4LA 2NUFA 1S4EA 5GMDA 4DV5E 2UUCE 4LF9I 2LBSB 2L2MA 1Z59A 3K17A 3K1JA 4X66I 2EZ6A 4JI6I 1KIJA 2B3TB 2ZITA 3WU5A 4JI7I 5LMNI 1ZM9A 1N0UA 4DPUA 3V2UC 4USMA 1YYKA 2UUBI 1B62A 4JI8E 1XNQI 2JVAA 1PKPA 4X8WA 3Q1QA 1N33I 4LF6E 1FJGI 4DUYE 4GKJI 1NZ0A 3PYEA 4LF5I 4DUZI 4DR5I 2LTSA 2LUQA 2MDRA 1XNRE 4HYMA 3JAMC 5BR8E 1K47A 2RS6A 4DV3I 1YYWA 1Z0WA 2VQFI 5A2QQ 4DV6I 3J7AG 1IBMI 4M2ZA 4DV0E 2E5LE 1EKZA 3F0NA 4NXME 4M30A 2A2CA 2NPFA 4B3MI 4OOGC 1D6TA 1UILA 1OJ4A 2X7IA 1Z0TA 2DMYA 2RS7A 3B78A 4JV5I 1UEKA 1H73A 4LFBE 2IHR1 4JI5E 2UXBI 3JAMQ 2HHHI 4DR2E 4JI0E 1FI4A 3ZM7A 1J26A 3T1YI 2V2ZA 4R1FA 4KHPI 4B3TE 4AQYE 2HKJA 3QT6A 2F4VI 4RPFA 3LNUA 1X48A 4DR1E 3OTOI 4LF7E 4DV7I 4M1KA 4B3SI 2CPNA 3ZZTA 4XTJA 2LJPA 3WU3A 1Z0EA 4X65E 2N3GA 4DR7E 2UUAI 2DB2A 4X62I 4JI3I 1DARA 3LPSA
chains in the Genus database with same CATH superfamily
2PO2B 3C4TA 1YUJA 1XMQI 1ZAAC 1USUA 1HNWI 4TUIA 1Z5BA 1ZM4A 2HKEA 4DV2I 3L00A 4F9BB 2JEBA 5EKWA 1UBDC 2CT1A 4ZYDA 1BBGA 1A1GA 4JI1E 1S16A 3EPLA 2EOIA 3HXLA 1TF3A 3LMLA 2EMBA 1EH8A 1YFHA 4OO1D 1RC7A 4IFDB 2EMGA 3DD6A 3QT5A 2HC5A 1HNZE 3M99B 1FWKA 1KYQA 1QZRA 4MU0A 3T1HE 1PJQA 2VQEI 1G2FC 2JEAA 4R8OA 2OI2A 2JT2A 1NEIA 2EPOA 3ZZUA 4GQUA 4FWHA 2BV3A 4LF9E 4DU8A 3J7AM 2WNRA 4ZYEA 5JEAD 3CDIA 3QT8A 2LVHA 2Z5BB 2L6MA 5IT9C 4X66E 5ELWA 4JI6E 4L8NA 2I9IA 5DNLA 2UXDI 1EI1A 1IQSA 2PO0A 4JI7E 1Y5YA 5LMUI 4LF8I 2V88A 4TUGA 2J7JA 1DQ3A 1N32I 5LMNE 5DRQA 3VHTB 2EOYA 2EOQA 2DEJA 3LLHA 4WX9A 4FW6A 2EN1A 1N34I 2NN6D 4OZEA 4K0KI 5K36D 2G7HA 4BHCA 2UUBE 1XHKA 2PNMA 2AJ4A 1KJKA 2EOEA 3J80Q 1XNQE 5KL7A 4AIMA 1MU5A 4IFDF 4AM3A 2EN6A 2EMCA 4RH8A 2O1VA 1GTKA 2YRHA 5A2QC 3FIGA 1FJGE 2ZM6I 5AE2A 4FWDA 2EMZA 4USKA 2B7VA 2RPCA 2KHXA 4DV1I 2BM1A 1SFEA 1VI7A 4LF5E 4DUZE 3M85D 1HK7A 5F3WA 2R42A 4YHHE 3ADLA 4FW3A 3IWBA 3HPSA 2NUEA 5A6BA 2EPMX 5IT9Q 1T4OA 3CWVA 4RHBB 2EN7A 2R76A 3IWCA 2V2VA 4DV3E 2EPCA 1B69A 4GKKI 3PYDA 2J7KA 3PRYA 1FWLA 2WBTA 3EPKA 2VQFE 2UUCI 4DV6E 3ECRA 3AV0A 3V5RA 4R2CA 1MG7A 4Z7CA 1UHZA 4OO1B 2NUGA 3EPJA 2YT4A 4PRVA 4WPYA 2NN6C 5K36C 4MU4A 4IFDA 2A25A 3F6HA 2EL4A 1VISA 4DPXA 4WFTA 1ZM2A 3BBGA 1MEYC 4FW4A 1AH5A 1NHIA 3P3EA 5DNYA 4JV5E 2L33A 1HNXE 5DROA 3KWRA 3WU4A 4BHBA 5JEAB 4DR4E 2N3HA 4JYAE 1Z0BA 3LTOA 2C37B 2BA0D 5LL6R 4WSGA 1ZBTA 5ADZA 4X64E 2GLIA 2HHHE 3ZKBA 4DV4I 4LF6I 3T1YE 5IXMB 2WCC3 3GONA 4BC7A 3ADGA 5T6JA 1I94E 2NA2A 2NN6B 5K36B 3VYYA 3M7ND 4LU9A 5IV8B 2B9DA 1WHQA 4WYQB 2EPKX 2JYAA 2MDGA 1XNRI 2F4VE 1ZXNA 2EMXA 4OO1F 2IERA 2EN3A 3QT7A 1WRJA 4BA2B 2DLQA 2ELYA 3B4TA 2EFGA 3H09A 1A1FA 4MYUA 5C0XE 2UXCI 2EL5A 1A1LA 1PIEA 4B3SE 2DEIA 4R2PA 2WBSA 1HR0E 3HPZA 1Y60A 4Z7YA 3WU6A 1YHCA 2V8QB 1FKAE 4LFAI 2JOXA 1U2RA 2JE6B 2DGCA 4NXNE 2EMFA 2L2NA 5JEAF 5IWAI 4R2AA 1N36I 5LLQA 3H1CA 2EOSA 1BB8A 1O0WA 1XMQE 1ZXMA 1HNWE 4R2SA 3TQMA 3Q6MA 1RQ0A 4IFDC 2MC5A 4DV2E 3B82A 4IS1C 2M4IA 4LFCI 2BM0A 3C6KA 3UK3C 2LJUA 3PS3A 2NN6F 1EH7A 5K36F 3PYGA 3BF2A 5A6JA 2R3VA 4JI2I 4LFBI 4OO1A 4JI4E 1TF6A 1B63A 2A2DA 2EWLA 3P76A 2D9HA 2KOUA 1Y4UA 4UT4A 4BS9A 3D4JA 5KL6A 4LF4I 2ENAA 2JR1A 4IZJD 4MYTA 1X6FA 4WUBA 1FNMA 4BMJA 4BA1B 2BA1G 2CGEA 3BGHA 3F6GA 1QU6A 1X6HA 3QG5C 3J80C 2LUPB 4HACB 5KL5A 5JEAA 3ADJA 5A6KA 2O3ZA 2O1WA 2C37A 5DRRA 4URLA 2EN8A 1NHJA 2Q2EB 2E1MA 2YU5A 3MHSC 1X3CA 3IWDA 1X6EA 2EPRA 3JU0A 2RSMA 2Z5CA 2UU9E 1H7UA 4NHRA 2GO4A 4P78A 5GMEA 1RR9A 2ELZA 2UXDE 4ZVIA 5LMUE 4LF8E 4WUCA 1J5EI 4KQVA 1IBLI 1N32E 2NN6A 1A1JA 2C39B 1XMOI 5K36A 3P1XA 1PDAA 2BBGA 3PS1A 2EORA 4K0KE 1A1KA 1NCSA 2EPNA 1G2DC 4O4KA 4MU1A 4JI3I 4BA2A 1Z5AA 4J3DA 1DGCA 1T4NA 3Q6NA 4JG4A 2EM0A 1RHYA 2EPZA 1KKHA 2V8PA 2YZTA 1IBKI 2ZM6E 2JE6A 4DV1E 4BC9A 4B3RI 4YY3I 3K6QA 1N33E 4FW9A 1YYOA 2O1TA 4OO1C 1HNZI 4LCGA 4LCHA 3KRNA 2YSOA 2YWQA 2YTNA 4MQYA 5CFFE 3BIDA 2DIXA 4GKJE 3VK6A 4GKKE 3DJWA 4MDTA 4DR5E 1H7SA 5AE1A 1A6FA 4R03A 4DPTA 2WW4A 4DXLA 2EQ1A 2L3JA 1AAYA 2V83A 1XXEA 2VF3A 2EM7A 1NHHA 4DR3I 3J81C 2F1DA 5JEAC 4OX9I 1JK2A 4DR6I 3ADIA 4I3HA 3PYFA 1N3GA 3MSWA 2M7QA 2XEXA 4IZJB 2EMKA 1KTVA 4HXZA 2JY9A 4BCAA 4DV5I 2BA1D 2LTRA 2WZOA 2HK2A 1T38A 4BA1A 4EMDA 1IBME 3PS2A 3JTZA 2EOJA 4R2EA 4HACA 1P47A 2EN4A 2IOPA 2JXPA 1SR9A 4Q28A 1X49A 2LE2A 4B3ME 5C0XA 2L2KB 1X47A 3C4BA 2YTQA 1KVKA 4DV4E 2LCEA 4JI8I 2ENHA 3KZYA 1WUUA 2C39A 3HQ1A 3RMPA 2C38B 2HFUA 2UXBE 3GLLA 4DU7A 1Z0VA 4YHHI 2O1UA 4DMIA 3J81Q 4QNJA 2Z5CB 2LV2A 2R1FA 5AC5A 5C0XD 4P7DA 2HGHA 4DUYI 2UXCE 2V89A 2E72A 3B8HA 1R6LA 4KHPE 2E1RA 4F9AB 3J7Yp 2YU8A 2WP8A 2GPIA 4LFAE 2ZBKB 1ZBQA 5TSEA 4FWGA 5BR8I 1UDNA 2DSYA 1EA6A 1A1HA 3OTOE 2EPLX 5IWAE 2YPNA 4DV7E 1T4LB 1N36E 2J65A 1Z5CA 1Z0GA 3THNA 4IZKB 1DI2A 4LFCE 4DPWA 4DV0I 2F8BA 3AUZA 2LMZA 4GZNC 2GQ0A 2UUAE 1E3PA 1HNXI 2E5LI 4X62E 4NXMI 4DR4I 4JYAI 4JI3E 2LRSA 2EOFA 2YTIA 3OMLA 4JI2E 1N0VC 4PRXA 2EOZA 1GQEA 4X64I 2EM4A 4LTYA 4IFDE 5DRPA 5FLXC 4I8OA 1YZ9A 4IZJA 2FV4B 4MLQA 3HULA 5C0XC 1WJPA 2EMYA 4LF4E 1I94I 5A69A 1WHNA 2EJ4A 2YSPA 2PNLA 2EM9A 4JI5I 2GHFA 4DR2I 2RSIA 3K85A 4JI0I 1Y4SA 1T39A 4P7AA 3ZKDA 2EL6A 2L3CA 2HK3A 5L3JA 2EOHA 5EL9A 2PNZB 2V86A 4WXDA 2PO1A 1E3HA 2VQEE 1OYPA 4UTGA 1HR0I 4B3TI 2EMHA 3ZZ0A 1PVGA 4AQYI 4R2QA 4FK5C 1J5EE 1IBLE 4P52A 2ADRA 3THOB 1XMOE 1H72C 1RREA 2C38A 4NXNI 4DR1I 2V87A 4AIDA 4NZVA 2ENCA 1ELOA 2B7TA 1UDQA 1Z0CA 5C0XB 4LF7I 2L8TA 2YTJA 2RTXA 4ZYHA 3U1YA 2Z5EA 5FLXQ 1EH6A 1UN6B 2V34A 4ISAA 1MX0A 3VYXA 3U1KA 4X65I 1N34E 1IBKE 1R6MA 3P3GA 4FN5A 4DR7I 1WXRA 4DPYA 1MGTA 2BB8A 2BR2B 2EPAA 2FTXB 2GO3A 4B3RE 4IJDA 2RQLA 4YY3E 3NZKA 4JI4I 3DF6A 2YRMA 2JPAA 4OKGA 2EMIA 2EOMA 2VF1A 4WUDA 2LJHA 1BKNA 2WP8B 1LLMC 2V85A 4JI1I 2V2QA 4IZKA 2DRPA 2YTOA 3GCMA 1ZM3A 1UDSA 1JK1A 2JP9A 2H36X 1STUA 2CTDA 3HTXA 4HY1A 2YTFA 3M6AA 3EQ1A 1PJSA 2DLKA 1L4SA 4F6NA 4DR3E 4DKKA 1Z1BA 2CZ9A 3HKMA 4PU9A 4QNKA 1H74A 2X36A 4ED4A 5C0XF 4OO1E 2MKNA 4OX9E 4DR6E 2BA0G 2GS8A 2HFSA 3T1HI 2YRKA 3H4LA 2UU9I 2YTEA 4N3OA 2NUFA 1S4EA 4BBYA 2YTPA 4U3BA 5GMDA 4DV5E 2UUCE 4LF9I 3UHMA 2AE8A 4KZSA 2LBSB 4J8ZA 4LOMA 2L2MA 3GMEA 3M7NG 1Z59A 2M1SA 3C6MA 4HEIA 3CDJA 5JEAE 3K17A 3K1JA 3L7ZB 4X66I 2EZ6A 4M0VA 4JI6I 1KIJA 2B3TB 2ZITA 3WU5A 2PNZA 3P3CA 4KWYA 4JI7I 2KONA 2NABA 5LMNI 1OYRA 1ZM9A 1N0UA 4DPUA 3V2UC 4MLVA 4USMA 2CSHA 4F54A 4R2RA 1YYKA 2UUBI 5FWKA 1PJTA 1B62A 4JI8E 2EP3A 2NN6E 5K36E 2CVEA 1XNQI 2JVAA 1PKPA 2HJJA 4X8WA 3Q1QA 1N33I 2PO1B 4O24A 4LF6E 2PO2A 2EN2A 1FJGI 4DUYE 2EM8A 2I13A 4GKJI 2EQ0A 1NZ0A 1Y6ZA 3PYEA 5AC4A 5KL4A 3KZZA 4DUZI 4DR5I 2LTSA 2LUQA 4LF5I 1OYSA 3MHHC 2MDRA 1XNRE 4HYMA 4F6MA 3JAMC 2EM2A 2BR2A 5BR8E 2MKDA 4U3DA 2EPXA 3ZOQB 5A6BD 5AE3A 1K47A 2RS6A 1YUIA 4M9VC 1GZ6A 4IS9A 4DV3I 2JEBB 1YYWA 4LCFA 2ODRD 1YH8A 2VESA 4WXCA 4F2JC 1Z0WA 3HJCA 2VQFI 2K4VA 4ZYGA 5A2QQ 4DV6I 2WBUA 3J7AG 2M9AA 3EPHA 4M2ZA 4DV0E 2VRDA 1IBMI 2JWOA 4L5NC 2E5LE 2N8XA 1EKZA 3F0NA 2PRTA 4NXME 5KL2A 2YTDA 4X9JA 4M30A 2A2CA 4MU3A 2NPFA 4IFDD 4B3MI 4OOGC 2LO3A 2Z5BA 1P42A 1D6TA 1UILA 5AASA 1OJ4A 2IESA 1BBOA 1Z0TA 2DMYA 1YPNA 2RS7A 2EM5A 2X7IA 3B78A 2FGGA 2JEAB 2MC6A 4JV5I 1UEKA 2Q8UA 4O43A 4FW5A 1H73A 2CG9A 4Q35B 1TN9A 2VE7C 4R2DA 2IHR1 4JI5E 4LFBE 1USVA 2WNRB 3JAMQ 2UXBI 2HHHI 4DR2E 4WSPA 1ZR9A 4JI0E 1FI4A 2JOBA 2EPUA 5A6AA 3ZM7A 1J26A 3L7ZA 2L92A 3T1YI 2EE8A 2K7IA 2PO0B 2EOXA 2EMAA 4HTGA 1IQOA 2V2ZA 4R1FA 4KHPI 4FW7A 4B3TE 1F2IG 2ODRC 4AQYE 2HKJA 4F9CB 2YTGA 2EOOA 2LT7A 3QT6A 4RPFA 2F4VI 1X5WA 3LNUA 1RMDA 1X48A 4DR1E 1UDOA 3OTOI 1QNTA 2IOQA 1A1IA 4LPFA 1ZU1A 4LF7E 4DV7I 2EM3A 5KL3A 4M1KA 4B3SI 2DMIA 2CPNA 4NBQA 4N4RB 4GEQB 1YSAC 3P06A 3ZZTA 2EMWA 4XTJA 1IMUA 2LJPA 3WU3A 1Z0EA 5DNXA 4X65E 2N3GA 4DR7E 3M85G 2UUAI 2DB2A 2EM6A 2EQ3A 4X62I 4O5GA 2EPPA 2EMLA 1DARA 3LPSA
chains in the Genus database with same CATH topology
3C4TA 1XMQI 1USUA 1HNWI 4TUIA 1Z5BA 1ZM4A 2HKEA 4DV2I 4F9BB 4JI1E 1S16A 3HXLA 3LMLA 1RC7A 3QT5A 1HNZE 1FWKA 1QZRA 2VQEI 3T1HE 4R8OA 2OI2A 3ZZUA 4FWHA 2BV3A 4LF9E 4DU8A 3J7AM 3QT8A 2Z5BB 2L6MA 5IT9C 4X66E 4JI6E 4L8NA 2UXDI 1EI1A 4JI7E 5LMUI 4LF8I 2V88A 4TUGA 1DQ3A 1N32I 5LMNE 2DEJA 3LLHA 1N34I 4K0KI 2G7HA 2UUBE 1XHKA 2PNMA 2AJ4A 3J80Q 1XNQE 1MU5A 2O1VA 5A2QC 3FIGA 1FJGE 2ZM6I 5AE2A 4FWDA 4USKA 2B7VA 2KHXA 4DV1I 2BM1A 4LF5E 4DUZE 1HK7A 5F3WA 2R42A 4YHHE 3ADLA 3IWBA 3HPSA 2NUEA 5IT9Q 1T4OA 3CWVA 3IWCA 2V2VA 4DV3E 4GKKI 3PYDA 2J7KA 3PRYA 1FWLA 2VQFE 2UUCI 4DV6E 3V5RA 3AV0A 4Z7CA 1MG7A 1UHZA 2NUGA 2YT4A 4PRVA 4WPYA 3F6HA 1VISA 4DPXA 4WFTA 1ZM2A 1NHIA 5DNYA 4JV5E 2L33A 1HNXE 3KWRA 3WU4A 4DR4E 2N3HA 4JYAE 1Z0BA 3LTOA 5LL6R 2HHHE 1ZBTA 5ADZA 4X64E 3ZKBA 4DV4I 4LF6I 3T1YE 3GONA 4BC7A 3ADGA 5T6JA 1I94E 2NA2A 3VYYA 4LU9A 2B9DA 1WHQA 4WYQB 1XNRI 2F4VE 1ZXNA 3QT7A 4MYUA 2EFGA 3H09A 2UXCI 1PIEA 4B3SE 2DEIA 1HR0E 3WU6A 3HPZA 4Z7YA 2V8QB 1FKAE 4LFAI 2JOXA 1U2RA 4NXNE 2L2NA 5IWAI 1N36I 1O0WA 1XMQE 1ZXMA 1HNWE 3Q6MA 1RQ0A 2MC5A 4DV2E 3B82A 4LFCI 2M4IA 2BM0A 3PYGA 2R3VA 4JI2I 4LFBI 4JI4E 1B63A 2A2DA 2EWLA 2KOUA 1Y4UA 4UT4A 4BS9A 3D4JA 4LF4I 2JR1A 4IZJD 4MYTA 4WUBA 1FNMA 4BMJA 2CGEA 3F6GA 1QU6A 2LUPB 3J80C 4HACB 3ADJA 2O1WA 4URLA 1NHJA 2Q2EB 2E1MA 3IWDA 3JU0A 2RSMA 2Z5CA 2UU9E 1H7UA 5GMEA 4P78A 1RR9A 2UXDE 4ZVIA 5LMUE 4LF8E 4WUCA 1J5EI 4KQVA 1IBLI 1N32E 1XMOI 3P1XA 4K0KE 1Z5AA 1T4NA 3Q6NA 4JG4A 1KKHA 2V8PA 2YZTA 1IBKI 2ZM6E 4DV1E 4BC9A 4B3RI 4YY3I 3K6QA 1N33E 4FW9A 1YYOA 2O1TA 1HNZI 5CFFE 4GKJE 2DIXA 3VK6A 4GKKE 3DJWA 4DR5E 1H7SA 5AE1A 1A6FA 4R03A 4DPTA 2WW4A 4DXLA 2L3JA 2VF3A 2V83A 4DR3I 1NHHA 3J81C 4OX9I 4DR6I 3ADIA 4I3HA 3PYFA 3MSWA 2M7QA 2XEXA 4IZJB 1KTVA 4HXZA 2JY9A 4BCAA 4DV5I 2LTRA 2WZOA 2HK2A 4EMDA 1IBME 3JTZA 4HACA 2IOPA 1SR9A 4Q28A 1X49A 2LE2A 4B3ME 2L2KB 1X47A 3C4BA 1KVKA 4DV4E 4JI8I 1WUUA 2HFUA 3HQ1A 3RMPA 2UXBE 4DU7A 1Z0VA 4YHHI 2O1UA 4DMIA 3J81Q 2Z5CB 4P7DA 4DUYI 2UXCE 2V89A 3B8HA 4KHPE 2E1RA 4F9AB 3J7Yp 4LFAE 2ZBKB 1ZBQA 4FWGA 5BR8I 2DSYA 1EA6A 3OTOE 5IWAE 4DV7E 1T4LB 1N36E 1Z5CA 1Z0GA 4IZKB 1DI2A 4LFCE 4DPWA 4DV0I 2F8BA 3AUZA 2LMZA 2GQ0A 2UUAE 1HNXI 2E5LI 4X62E 4NXMI 4DR4I 4JYAI 4JI3E 2LRSA 4JI2E 1N0VC 3OMLA 4PRXA 1GQEA 4X64I 4LTYA 5FLXC 4I8OA 1YZ9A 4IZJA 2FV4B 3HULA 4LF4E 1I94I 1WHNA 2PNLA 4JI5I 4DR2I 4JI0I 3K85A 1Y4SA 4P7AA 3ZKDA 2L3CA 2HK3A 5L3JA 2V86A 4UTGA 2VQEE 1HR0I 4B3TI 3ZZ0A 1PVGA 4AQYI 1J5EE 4P52A 1IBLE 1H72C 1RREA 1XMOE 4NXNI 4DR1I 2V87A 1Z0CA 1ELOA 2B7TA 4LF7I 2L8TA 2RTXA 5FLXQ 2Z5EA 2V34A 1MX0A 3VYXA 4X65I 1N34E 1IBKE 4DR7I 4FN5A 1WXRA 4DPYA 2FTXB 4JI4I 4B3RE 4YY3E 3DF6A 2VF1A 4WUDA 2LJHA 1BKNA 2V85A 4JI1I 2V2QA 4IZKA 1ZM3A 2H36X 1STUA 3HTXA 4HY1A 3M6AA 4DR3E 4DKKA 2CZ9A 4ED4A 4PU9A 1H74A 2X36A 4OX9E 4DR6E 2GS8A 2HFSA 3T1HI 2UU9I 3H4LA 4N3OA 2NUFA 1S4EA 4BBYA 5GMDA 4DV5E 2UUCE 4LF9I 4KZSA 2LBSB 4J8ZA 2L2MA 1Z59A 2M1SA 3K17A 3K1JA 4X66I 2EZ6A 4M0VA 4JI6I 1KIJA 2B3TB 2ZITA 3WU5A 4JI7I 2KONA 5LMNI 1ZM9A 1N0UA 4DPUA 3V2UC 4USMA 4F54A 1YYKA 2UUBI 5FWKA 1B62A 4JI8E 1XNQI 2JVAA 1PKPA 4X8WA 3Q1QA 1N33I 4LF6E 1FJGI 4DUYE 4GKJI 1NZ0A 1Y6ZA 3PYEA 4LF5I 4DUZI 4DR5I 2LTSA 2LUQA 2MDRA 1XNRE 4HYMA 3JAMC 5BR8E 3ZOQB 1K47A 5AE3A 2RS6A 1GZ6A 4DV3I 1YYWA 2ODRD 1Z0WA 3HJCA 2VQFI 2K4VA 5A2QQ 4DV6I 3J7AG 1IBMI 4M2ZA 4DV0E 2JWOA 4L5NC 2E5LE 1EKZA 3F0NA 4NXME 4M30A 2A2CA 2NPFA 4B3MI 4OOGC 2Z5BA 1D6TA 1UILA 5AASA 1OJ4A 2X7IA 1Z0TA 2DMYA 2RS7A 3B78A 2FGGA 4JV5I 2MC6A 1UEKA 1H73A 2CG9A 2VE7C 4LFBE 2IHR1 4JI5E 2UXBI 1USVA 3JAMQ 2HHHI 4DR2E 4WSPA 4JI0E 1FI4A 3ZM7A 2JOBA 1J26A 2L92A 3T1YI 2V2ZA 4R1FA 4KHPI 4B3TE 2ODRC 4AQYE 2HKJA 4F9CB 3QT6A 2F4VI 4RPFA 3LNUA 1X48A 4DR1E 3OTOI 2IOQA 4LF7E 4DV7I 4M1KA 4B3SI 2CPNA 4GEQB 3P06A 3ZZTA 4XTJA 2LJPA 3WU3A 1Z0EA 4X65E 2N3GA 4DR7E 2UUAI 2DB2A 4X62I 4JI3I 1DARA 3LPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4T A;  1XMQ I;  1HNW I;  2HKE A;  1Z5B A;  1ZM4 A;  4DV2 I;  4JI1 E;  1S16 A;  1RC7 A;  3QT5 A;  1HNZ E;  1FWK A;  1QZR A;  2VQE I;  3T1H E;  2OI2 A;  3ZZU A;  4FWH A;  2BV3 A;  4LF9 E;  4DU8 A;  3J7A M;  3QT8 A;  5IT9 C;  4X66 E;  4JI6 E;  2UXD I;  1EI1 A;  4JI7 E;  5LMU I;  4LF8 I;  1N32 I;  5LMN E;  2DEJ A;  3LLH A;  1N34 I;  4K0K I;  2UUB E;  1XHK A;  2AJ4 A;  3J80 Q;  1XNQ E;  1MU5 A;  5A2Q C;  1FJG E;  2ZM6 I;  4FWD A;  4USK A;  2B7V A;  2KHX A;  4DV1 I;  2BM1 A;  4LF5 E;  4DUZ E;  2R42 A;  4YHH E;  3ADL A;  2NUE A;  5IT9 Q;  1T4O A;  3CWV A;  2V2V A;  4DV3 E;  4GKK I;  3PYD A;  2J7K A;  1FWL A;  2VQF E;  2UUC I;  4DV6 E;  3V5R A;  4Z7C A;  1MG7 A;  1UHZ A;  2NUG A;  2YT4 A;  4PRV A;  1VIS A;  4DPX A;  4WFT A;  1ZM2 A;  1NHI A;  4JV5 E;  2L33 A;  1HNX E;  3WU4 A;  4DR4 E;  2N3H A;  4JYA E;  1Z0B A;  3LTO A;  5LL6 R;  2HHH E;  1ZBT A;  4X64 E;  3ZKB A;  4DV4 I;  4LF6 I;  3T1Y E;  3GON A;  3ADG A;  1I94 E;  2NA2 A;  3VYY A;  1WHQ A;  4WYQ B;  1XNR I;  1ZXN A;  2F4V E;  3QT7 A;  4MYU A;  2EFG A;  2UXC I;  1PIE A;  4B3S E;  2DEI A;  1HR0 E;  3WU6 A;  4Z7Y A;  1FKA E;  4LFA I;  1U2R A;  4NXN E;  2L2N A;  5IWA I;  1N36 I;  1O0W A;  1XMQ E;  1ZXM A;  1HNW E;  1RQ0 A;  4DV2 E;  3B82 A;  4LFC I;  2BM0 A;  3PYG A;  2R3V A;  4JI2 I;  4LFB I;  4JI4 E;  1B63 A;  2A2D A;  4UT4 A;  3D4J A;  4LF4 I;  4MYT A;  4WUB A;  1FNM A;  1QU6 A;  2LUP B;  4HAC B;  3J80 C;  3ADJ A;  4URL A;  1NHJ A;  2Q2E B;  2RSM A;  2UU9 E;  1H7U A;  5GME A;  1RR9 A;  2UXD E;  4ZVI A;  5LMU E;  4LF8 E;  4WUC A;  1J5E I;  4KQV A;  1IBL I;  1N32 E;  1XMO I;  3P1X A;  4K0K E;  1Z5A A;  1T4N A;  4JG4 A;  1KKH A;  2V8P A;  1IBK I;  2ZM6 E;  4DV1 E;  4B3R I;  4YY3 I;  1N33 E;  4FW9 A;  1YYO A;  1HNZ I;  5CFF E;  4GKJ E;  2DIX A;  4GKK E;  4DR5 E;  1H7S A;  1A6F A;  4DPT A;  2WW4 A;  4DXL A;  2L3J A;  2VF3 A;  4DR3 I;  1NHH A;  3J81 C;  4OX9 I;  4DR6 I;  3ADI A;  4I3H A;  3PYF A;  2XEX A;  1KTV A;  4HXZ A;  2JY9 A;  4DV5 I;  2LTR A;  2HK2 A;  4EMD A;  1IBM E;  4HAC A;  1X49 A;  4B3M E;  2L2K B;  1X47 A;  3C4B A;  1KVK A;  4DV4 E;  4JI8 I;  1WUU A;  2HFU A;  2UXB E;  4DU7 A;  1Z0V A;  4YHH I;  3J81 Q;  4DUY I;  2UXC E;  3B8H A;  4KHP E;  2E1R A;  3J7Y p;  4LFA E;  2ZBK B;  4FWG A;  5BR8 I;  1EA6 A;  3OTO E;  5IWA E;  4DV7 E;  1T4L B;  1N36 E;  1Z5C A;  1Z0G A;  1DI2 A;  4LFC E;  4DPW A;  4DV0 I;  2UUA E;  1HNX I;  2E5L I;  4X62 E;  4NXM I;  4DR4 I;  4JYA I;  4JI3 E;  2LRS A;  4JI2 E;  1N0V C;  4PRX A;  1GQE A;  4X64 I;  5FLX C;  1YZ9 A;  3HUL A;  4LF4 E;  1I94 I;  1WHN A;  4JI5 I;  4DR2 I;  4JI0 I;  4P7A A;  3ZKD A;  2L3C A;  2HK3 A;  5L3J A;  4UTG A;  2VQE E;  1HR0 I;  4B3T I;  3ZZ0 A;  1PVG A;  4AQY I;  1J5E E;  4P52 A;  1IBL E;  1H72 C;  1RRE A;  1XMO E;  4NXN I;  4DR1 I;  1Z0C A;  1ELO A;  2B7T A;  4LF7 I;  2RTX A;  5FLX Q;  2V34 A;  1MX0 A;  3VYX A;  4X65 I;  1N34 E;  1IBK E;  4DR7 I;  4FN5 A;  4DPY A;  4JI4 I;  4B3R E;  4YY3 E;  4WUD A;  2LJH A;  1BKN A;  4JI1 I;  2V2Q A;  1ZM3 A;  1STU A;  3HTX A;  4HY1 A;  3M6A A;  4DR3 E;  4DKK A;  2CZ9 A;  4ED4 A;  4PU9 A;  1H74 A;  2X36 A;  4OX9 E;  4DR6 E;  2GS8 A;  2HFS A;  3T1H I;  2UU9 I;  3H4L A;  2NUF A;  1S4E A;  5GMD A;  4DV5 E;  2UUC E;  4LF9 I;  2LBS B;  2L2M A;  1Z59 A;  3K17 A;  3K1J A;  4X66 I;  2EZ6 A;  4JI6 I;  1KIJ A;  2B3T B;  2ZIT A;  3WU5 A;  4JI7 I;  5LMN I;  1ZM9 A;  1N0U A;  4DPU A;  3V2U C;  4USM A;  1YYK A;  2UUB I;  1B62 A;  4JI8 E;  1XNQ I;  2JVA A;  1PKP A;  4X8W A;  3Q1Q A;  1N33 I;  4LF6 E;  1FJG I;  4DUY E;  4GKJ I;  1NZ0 A;  3PYE A;  4LF5 I;  4DUZ I;  4DR5 I;  2LTS A;  2LUQ A;  2MDR A;  1XNR E;  4HYM A;  3JAM C;  5BR8 E;  1K47 A;  2RS6 A;  4DV3 I;  1YYW A;  1Z0W A;  2VQF I;  5A2Q Q;  4DV6 I;  3J7A G;  1IBM I;  4M2Z A;  4DV0 E;  2E5L E;  1EKZ A;  3F0N A;  4NXM E;  4M30 A;  2A2C A;  2NPF A;  4B3M I;  4OOG C;  1D6T A;  1UIL A;  1OJ4 A;  2X7I A;  1Z0T A;  2DMY A;  2RS7 A;  3B78 A;  4JV5 I;  1UEK A;  1H73 A;  4LFB E;  2IHR 1;  4JI5 E;  2UXB I;  3JAM Q;  2HHH I;  4DR2 E;  4JI0 E;  1FI4 A;  3ZM7 A;  1J26 A;  3T1Y I;  2V2Z A;  4R1F A;  4KHP I;  4B3T E;  4AQY E;  2HKJ A;  3QT6 A;  2F4V I;  4RPF A;  3LNU A;  1X48 A;  4DR1 E;  3OTO I;  4LF7 E;  4DV7 I;  4M1K A;  4B3S I;  2CPN A;  3ZZT A;  4XTJ A;  2LJP A;  3WU3 A;  1Z0E A;  4X65 E;  2N3G A;  4DR7 E;  2UUA I;  2DB2 A;  4X62 I;  4JI3 I;  1DAR A;  3LPS A; 
#chains in the Genus database with same CATH topology
 2PO2 B;  3C4T A;  1YUJ A;  1XMQ I;  1ZAA C;  1USU A;  1HNW I;  4TUI A;  1Z5B A;  1ZM4 A;  2HKE A;  4DV2 I;  3L00 A;  4F9B B;  2JEB A;  5EKW A;  1UBD C;  2CT1 A;  4ZYD A;  1BBG A;  1A1G A;  4JI1 E;  1S16 A;  3EPL A;  2EOI A;  3HXL A;  1TF3 A;  3LML A;  2EMB A;  1EH8 A;  1YFH A;  4OO1 D;  1RC7 A;  4IFD B;  2EMG A;  3DD6 A;  3QT5 A;  2HC5 A;  1HNZ E;  3M99 B;  1FWK A;  1KYQ A;  1QZR A;  4MU0 A;  3T1H E;  1PJQ A;  2VQE I;  1G2F C;  2JEA A;  4R8O A;  2OI2 A;  2JT2 A;  1NEI A;  2EPO A;  3ZZU A;  4GQU A;  4FWH A;  2BV3 A;  4LF9 E;  4DU8 A;  3J7A M;  2WNR A;  4ZYE A;  5JEA D;  3CDI A;  3QT8 A;  2LVH A;  2Z5B B;  2L6M A;  5IT9 C;  4X66 E;  5ELW A;  4JI6 E;  4L8N A;  2I9I A;  5DNL A;  2UXD I;  1EI1 A;  1IQS A;  2PO0 A;  4JI7 E;  1Y5Y A;  5LMU I;  4LF8 I;  2V88 A;  4TUG A;  2J7J A;  1DQ3 A;  1N32 I;  5LMN E;  5DRQ A;  3VHT B;  2EOY A;  2EOQ A;  2DEJ A;  3LLH A;  4WX9 A;  4FW6 A;  2EN1 A;  1N34 I;  2NN6 D;  4OZE A;  4K0K I;  5K36 D;  2G7H A;  4BHC A;  2UUB E;  1XHK A;  2PNM A;  2AJ4 A;  1KJK A;  2EOE A;  3J80 Q;  1XNQ E;  5KL7 A;  4AIM A;  1MU5 A;  4IFD F;  4AM3 A;  2EN6 A;  2EMC A;  4RH8 A;  2O1V A;  1GTK A;  2YRH A;  5A2Q C;  3FIG A;  1FJG E;  2ZM6 I;  5AE2 A;  4FWD A;  2EMZ A;  4USK A;  2B7V A;  2RPC A;  2KHX A;  4DV1 I;  2BM1 A;  1SFE A;  1VI7 A;  4LF5 E;  4DUZ E;  3M85 D;  1HK7 A;  5F3W A;  2R42 A;  4YHH E;  3ADL A;  4FW3 A;  3IWB A;  3HPS A;  2NUE A;  5A6B A;  2EPM X;  5IT9 Q;  1T4O A;  3CWV A;  4RHB B;  2EN7 A;  2R76 A;  3IWC A;  2V2V A;  4DV3 E;  2EPC A;  1B69 A;  4GKK I;  3PYD A;  2J7K A;  3PRY A;  1FWL A;  2WBT A;  3EPK A;  2VQF E;  2UUC I;  4DV6 E;  3ECR A;  3AV0 A;  3V5R A;  4R2C A;  1MG7 A;  4Z7C A;  1UHZ A;  4OO1 B;  2NUG A;  3EPJ A;  2YT4 A;  4PRV A;  4WPY A;  2NN6 C;  5K36 C;  4MU4 A;  4IFD A;  2A25 A;  3F6H A;  2EL4 A;  1VIS A;  4DPX A;  4WFT A;  1ZM2 A;  3BBG A;  1MEY C;  4FW4 A;  1AH5 A;  1NHI A;  3P3E A;  5DNY A;  4JV5 E;  2L33 A;  1HNX E;  5DRO A;  3KWR A;  3WU4 A;  4BHB A;  5JEA B;  4DR4 E;  2N3H A;  4JYA E;  1Z0B A;  3LTO A;  2C37 B;  2BA0 D;  5LL6 R;  4WSG A;  1ZBT A;  5ADZ A;  4X64 E;  2GLI A;  2HHH E;  3ZKB A;  4DV4 I;  4LF6 I;  3T1Y E;  5IXM B;  2WCC 3;  3GON A;  4BC7 A;  3ADG A;  5T6J A;  1I94 E;  2NA2 A;  2NN6 B;  5K36 B;  3VYY A;  3M7N D;  4LU9 A;  5IV8 B;  2B9D A;  1WHQ A;  4WYQ B;  2EPK X;  2JYA A;  2MDG A;  1XNR I;  2F4V E;  1ZXN A;  2EMX A;  4OO1 F;  2IER A;  2EN3 A;  3QT7 A;  1WRJ A;  4BA2 B;  2DLQ A;  2ELY A;  3B4T A;  2EFG A;  3H09 A;  1A1F A;  4MYU A;  5C0X E;  2UXC I;  2EL5 A;  1A1L A;  1PIE A;  4B3S E;  2DEI A;  4R2P A;  2WBS A;  1HR0 E;  3HPZ A;  1Y60 A;  4Z7Y A;  3WU6 A;  1YHC A;  2V8Q B;  1FKA E;  4LFA I;  2JOX A;  1U2R A;  2JE6 B;  2DGC A;  4NXN E;  2EMF A;  2L2N A;  5JEA F;  5IWA I;  4R2A A;  1N36 I;  5LLQ A;  3H1C A;  2EOS A;  1BB8 A;  1O0W A;  1XMQ E;  1ZXM A;  1HNW E;  4R2S A;  3TQM A;  3Q6M A;  1RQ0 A;  4IFD C;  2MC5 A;  4DV2 E;  3B82 A;  4IS1 C;  2M4I A;  4LFC I;  2BM0 A;  3C6K A;  3UK3 C;  2LJU A;  3PS3 A;  2NN6 F;  1EH7 A;  5K36 F;  3PYG A;  3BF2 A;  5A6J A;  2R3V A;  4JI2 I;  4LFB I;  4OO1 A;  4JI4 E;  1TF6 A;  1B63 A;  2A2D A;  2EWL A;  3P76 A;  2D9H A;  2KOU A;  1Y4U A;  4UT4 A;  4BS9 A;  3D4J A;  5KL6 A;  4LF4 I;  2ENA A;  2JR1 A;  4IZJ D;  4MYT A;  1X6F A;  4WUB A;  1FNM A;  4BMJ A;  4BA1 B;  2BA1 G;  2CGE A;  3BGH A;  3F6G A;  1QU6 A;  1X6H A;  3QG5 C;  3J80 C;  2LUP B;  4HAC B;  5KL5 A;  5JEA A;  3ADJ A;  5A6K A;  2O3Z A;  2O1W A;  2C37 A;  5DRR A;  4URL A;  2EN8 A;  1NHJ A;  2Q2E B;  2E1M A;  2YU5 A;  3MHS C;  1X3C A;  3IWD A;  1X6E A;  2EPR A;  3JU0 A;  2RSM A;  2Z5C A;  2UU9 E;  1H7U A;  4NHR A;  2GO4 A;  4P78 A;  5GME A;  1RR9 A;  2ELZ A;  2UXD E;  4ZVI A;  5LMU E;  4LF8 E;  4WUC A;  1J5E I;  4KQV A;  1IBL I;  1N32 E;  2NN6 A;  1A1J A;  2C39 B;  1XMO I;  5K36 A;  3P1X A;  1PDA A;  2BBG A;  3PS1 A;  2EOR A;  4K0K E;  1A1K A;  1NCS A;  2EPN A;  1G2D C;  4O4K A;  4MU1 A;  4JI3 I;  4BA2 A;  1Z5A A;  4J3D A;  1DGC A;  1T4N A;  3Q6N A;  4JG4 A;  2EM0 A;  1RHY A;  2EPZ A;  1KKH A;  2V8P A;  2YZT A;  1IBK I;  2ZM6 E;  2JE6 A;  4DV1 E;  4BC9 A;  4B3R I;  4YY3 I;  3K6Q A;  1N33 E;  4FW9 A;  1YYO A;  2O1T A;  4OO1 C;  1HNZ I;  4LCG A;  4LCH A;  3KRN A;  2YSO A;  2YWQ A;  2YTN A;  4MQY A;  5CFF E;  3BID A;  2DIX A;  4GKJ E;  3VK6 A;  4GKK E;  3DJW A;  4MDT A;  4DR5 E;  1H7S A;  5AE1 A;  1A6F A;  4R03 A;  4DPT A;  2WW4 A;  4DXL A;  2EQ1 A;  2L3J A;  1AAY A;  2V83 A;  1XXE A;  2VF3 A;  2EM7 A;  1NHH A;  4DR3 I;  3J81 C;  2F1D A;  5JEA C;  4OX9 I;  1JK2 A;  4DR6 I;  3ADI A;  4I3H A;  3PYF A;  1N3G A;  3MSW A;  2M7Q A;  2XEX A;  4IZJ B;  2EMK A;  1KTV A;  4HXZ A;  2JY9 A;  4BCA A;  4DV5 I;  2BA1 D;  2LTR A;  2WZO A;  2HK2 A;  1T38 A;  4BA1 A;  4EMD A;  1IBM E;  3PS2 A;  3JTZ A;  2EOJ A;  4R2E A;  4HAC A;  1P47 A;  2EN4 A;  2IOP A;  2JXP A;  1SR9 A;  4Q28 A;  1X49 A;  2LE2 A;  4B3M E;  5C0X A;  2L2K B;  1X47 A;  3C4B A;  2YTQ A;  1KVK A;  4DV4 E;  2LCE A;  4JI8 I;  2ENH A;  3KZY A;  1WUU A;  2C39 A;  3HQ1 A;  3RMP A;  2C38 B;  2HFU A;  2UXB E;  3GLL A;  4DU7 A;  1Z0V A;  4YHH I;  2O1U A;  4DMI A;  3J81 Q;  4QNJ A;  2Z5C B;  2LV2 A;  2R1F A;  5AC5 A;  5C0X D;  4P7D A;  2HGH A;  4DUY I;  2UXC E;  2V89 A;  2E72 A;  3B8H A;  1R6L A;  4KHP E;  2E1R A;  4F9A B;  3J7Y p;  2YU8 A;  2WP8 A;  2GPI A;  4LFA E;  2ZBK B;  1ZBQ A;  5TSE A;  4FWG A;  5BR8 I;  1UDN A;  2DSY A;  1EA6 A;  1A1H A;  3OTO E;  2EPL X;  5IWA E;  2YPN A;  4DV7 E;  1T4L B;  1N36 E;  2J65 A;  1Z5C A;  1Z0G A;  3THN A;  4IZK B;  1DI2 A;  4LFC E;  4DPW A;  4DV0 I;  2F8B A;  3AUZ A;  2LMZ A;  4GZN C;  2GQ0 A;  2UUA E;  1E3P A;  1HNX I;  2E5L I;  4X62 E;  4NXM I;  4DR4 I;  4JYA I;  4JI3 E;  2LRS A;  2EOF A;  2YTI A;  3OML A;  4JI2 E;  1N0V C;  4PRX A;  2EOZ A;  1GQE A;  4X64 I;  2EM4 A;  4LTY A;  4IFD E;  5DRP A;  5FLX C;  4I8O A;  1YZ9 A;  4IZJ A;  2FV4 B;  4MLQ A;  3HUL A;  5C0X C;  1WJP A;  2EMY A;  4LF4 E;  1I94 I;  5A69 A;  1WHN A;  2EJ4 A;  2YSP A;  2PNL A;  2EM9 A;  4JI5 I;  2GHF A;  4DR2 I;  2RSI A;  3K85 A;  4JI0 I;  1Y4S A;  1T39 A;  4P7A A;  3ZKD A;  2EL6 A;  2L3C A;  2HK3 A;  5L3J A;  2EOH A;  5EL9 A;  2PNZ B;  2V86 A;  4WXD A;  2PO1 A;  1E3H A;  2VQE E;  1OYP A;  4UTG A;  1HR0 I;  4B3T I;  2EMH A;  3ZZ0 A;  1PVG A;  4AQY I;  4R2Q A;  4FK5 C;  1J5E E;  1IBL E;  4P52 A;  2ADR A;  3THO B;  1XMO E;  1H72 C;  1RRE A;  2C38 A;  4NXN I;  4DR1 I;  2V87 A;  4AID A;  4NZV A;  2ENC A;  1ELO A;  2B7T A;  1UDQ A;  1Z0C A;  5C0X B;  4LF7 I;  2L8T A;  2YTJ A;  2RTX A;  4ZYH A;  3U1Y A;  2Z5E A;  5FLX Q;  1EH6 A;  1UN6 B;  2V34 A;  4ISA A;  1MX0 A;  3VYX A;  3U1K A;  4X65 I;  1N34 E;  1IBK E;  1R6M A;  3P3G A;  4FN5 A;  4DR7 I;  1WXR A;  4DPY A;  1MGT A;  2BB8 A;  2BR2 B;  2EPA A;  2FTX B;  2GO3 A;  4B3R E;  4IJD A;  2RQL A;  4YY3 E;  3NZK A;  4JI4 I;  3DF6 A;  2YRM A;  2JPA A;  4OKG A;  2EMI A;  2EOM A;  2VF1 A;  4WUD A;  2LJH A;  1BKN A;  2WP8 B;  1LLM C;  2V85 A;  4JI1 I;  2V2Q A;  4IZK A;  2DRP A;  2YTO A;  3GCM A;  1ZM3 A;  1UDS A;  1JK1 A;  2JP9 A;  2H36 X;  1STU A;  2CTD A;  3HTX A;  4HY1 A;  2YTF A;  3M6A A;  3EQ1 A;  1PJS A;  2DLK A;  1L4S A;  4F6N A;  4DR3 E;  4DKK A;  1Z1B A;  2CZ9 A;  3HKM A;  4PU9 A;  4QNK A;  1H74 A;  2X36 A;  4ED4 A;  5C0X F;  4OO1 E;  2MKN A;  4OX9 E;  4DR6 E;  2BA0 G;  2GS8 A;  2HFS A;  3T1H I;  2YRK A;  3H4L A;  2UU9 I;  2YTE A;  4N3O A;  2NUF A;  1S4E A;  4BBY A;  2YTP A;  4U3B A;  5GMD A;  4DV5 E;  2UUC E;  4LF9 I;  3UHM A;  2AE8 A;  4KZS A;  2LBS B;  4J8Z A;  4LOM A;  2L2M A;  3GME A;  3M7N G;  1Z59 A;  2M1S A;  3C6M A;  4HEI A;  3CDJ A;  5JEA E;  3K17 A;  3K1J A;  3L7Z B;  4X66 I;  2EZ6 A;  4M0V A;  4JI6 I;  1KIJ A;  2B3T B;  2ZIT A;  3WU5 A;  2PNZ A;  3P3C A;  4KWY A;  4JI7 I;  2KON A;  2NAB A;  5LMN I;  1OYR A;  1ZM9 A;  1N0U A;  4DPU A;  3V2U C;  4MLV A;  4USM A;  2CSH A;  4F54 A;  4R2R A;  1YYK A;  2UUB I;  5FWK A;  1PJT A;  1B62 A;  4JI8 E;  2EP3 A;  2NN6 E;  5K36 E;  2CVE A;  1XNQ I;  2JVA A;  1PKP A;  2HJJ A;  4X8W A;  3Q1Q A;  1N33 I;  2PO1 B;  4O24 A;  4LF6 E;  2PO2 A;  2EN2 A;  1FJG I;  4DUY E;  2EM8 A;  2I13 A;  4GKJ I;  2EQ0 A;  1NZ0 A;  1Y6Z A;  3PYE A;  5AC4 A;  5KL4 A;  3KZZ A;  4DUZ I;  4DR5 I;  2LTS A;  2LUQ A;  4LF5 I;  1OYS A;  3MHH C;  2MDR A;  1XNR E;  4HYM A;  4F6M A;  3JAM C;  2EM2 A;  2BR2 A;  5BR8 E;  2MKD A;  4U3D A;  2EPX A;  3ZOQ B;  5A6B D;  5AE3 A;  1K47 A;  2RS6 A;  1YUI A;  4M9V C;  1GZ6 A;  4IS9 A;  4DV3 I;  2JEB B;  1YYW A;  4LCF A;  2ODR D;  1YH8 A;  2VES A;  4WXC A;  4F2J C;  1Z0W A;  3HJC A;  2VQF I;  2K4V A;  4ZYG A;  5A2Q Q;  4DV6 I;  2WBU A;  3J7A G;  2M9A A;  3EPH A;  4M2Z A;  4DV0 E;  2VRD A;  1IBM I;  2JWO A;  4L5N C;  2E5L E;  2N8X A;  1EKZ A;  3F0N A;  2PRT A;  4NXM E;  5KL2 A;  2YTD A;  4X9J A;  4M30 A;  2A2C A;  4MU3 A;  2NPF A;  4IFD D;  4B3M I;  4OOG C;  2LO3 A;  2Z5B A;  1P42 A;  1D6T A;  1UIL A;  5AAS A;  1OJ4 A;  2IES A;  1BBO A;  1Z0T A;  2DMY A;  1YPN A;  2RS7 A;  2EM5 A;  2X7I A;  3B78 A;  2FGG A;  2JEA B;  2MC6 A;  4JV5 I;  1UEK A;  2Q8U A;  4O43 A;  4FW5 A;  1H73 A;  2CG9 A;  4Q35 B;  1TN9 A;  2VE7 C;  4R2D A;  2IHR 1;  4JI5 E;  4LFB E;  1USV A;  2WNR B;  3JAM Q;  2UXB I;  2HHH I;  4DR2 E;  4WSP A;  1ZR9 A;  4JI0 E;  1FI4 A;  2JOB A;  2EPU A;  5A6A A;  3ZM7 A;  1J26 A;  3L7Z A;  2L92 A;  3T1Y I;  2EE8 A;  2K7I A;  2PO0 B;  2EOX A;  2EMA A;  4HTG A;  1IQO A;  2V2Z A;  4R1F A;  4KHP I;  4FW7 A;  4B3T E;  1F2I G;  2ODR C;  4AQY E;  2HKJ A;  4F9C B;  2YTG A;  2EOO A;  2LT7 A;  3QT6 A;  4RPF A;  2F4V I;  1X5W A;  3LNU A;  1RMD A;  1X48 A;  4DR1 E;  1UDO A;  3OTO I;  1QNT A;  2IOQ A;  1A1I A;  4LPF A;  1ZU1 A;  4LF7 E;  4DV7 I;  2EM3 A;  5KL3 A;  4M1K A;  4B3S I;  2DMI A;  2CPN A;  4NBQ A;  4N4R B;  4GEQ B;  1YSA C;  3P06 A;  3ZZT A;  2EMW A;  4XTJ A;  1IMU A;  2LJP A;  3WU3 A;  1Z0E A;  5DNX A;  4X65 E;  2N3G A;  4DR7 E;  3M85 G;  2UUA I;  2DB2 A;  2EM6 A;  2EQ3 A;  4X62 I;  4O5G A;  2EPP A;  2EML A;  1DAR A;  3LPS A; 
#chains in the Genus database with same CATH homology
 3C4T A;  1XMQ I;  1USU A;  1HNW I;  4TUI A;  1Z5B A;  1ZM4 A;  2HKE A;  4DV2 I;  4F9B B;  4JI1 E;  1S16 A;  3HXL A;  3LML A;  1RC7 A;  3QT5 A;  1HNZ E;  1FWK A;  1QZR A;  2VQE I;  3T1H E;  4R8O A;  2OI2 A;  3ZZU A;  4FWH A;  2BV3 A;  4LF9 E;  4DU8 A;  3J7A M;  3QT8 A;  2Z5B B;  2L6M A;  5IT9 C;  4X66 E;  4JI6 E;  4L8N A;  2UXD I;  1EI1 A;  4JI7 E;  5LMU I;  4LF8 I;  2V88 A;  4TUG A;  1DQ3 A;  1N32 I;  5LMN E;  2DEJ A;  3LLH A;  1N34 I;  4K0K I;  2G7H A;  2UUB E;  1XHK A;  2PNM A;  2AJ4 A;  3J80 Q;  1XNQ E;  1MU5 A;  2O1V A;  5A2Q C;  3FIG A;  1FJG E;  2ZM6 I;  5AE2 A;  4FWD A;  4USK A;  2B7V A;  2KHX A;  4DV1 I;  2BM1 A;  4LF5 E;  4DUZ E;  1HK7 A;  5F3W A;  2R42 A;  4YHH E;  3ADL A;  3IWB A;  3HPS A;  2NUE A;  5IT9 Q;  1T4O A;  3CWV A;  3IWC A;  2V2V A;  4DV3 E;  4GKK I;  3PYD A;  2J7K A;  3PRY A;  1FWL A;  2VQF E;  2UUC I;  4DV6 E;  3V5R A;  3AV0 A;  4Z7C A;  1MG7 A;  1UHZ A;  2NUG A;  2YT4 A;  4PRV A;  4WPY A;  3F6H A;  1VIS A;  4DPX A;  4WFT A;  1ZM2 A;  1NHI A;  5DNY A;  4JV5 E;  2L33 A;  1HNX E;  3KWR A;  3WU4 A;  4DR4 E;  2N3H A;  4JYA E;  1Z0B A;  3LTO A;  5LL6 R;  2HHH E;  1ZBT A;  5ADZ A;  4X64 E;  3ZKB A;  4DV4 I;  4LF6 I;  3T1Y E;  3GON A;  4BC7 A;  3ADG A;  5T6J A;  1I94 E;  2NA2 A;  3VYY A;  4LU9 A;  2B9D A;  1WHQ A;  4WYQ B;  1XNR I;  2F4V E;  1ZXN A;  3QT7 A;  4MYU A;  2EFG A;  3H09 A;  2UXC I;  1PIE A;  4B3S E;  2DEI A;  1HR0 E;  3WU6 A;  3HPZ A;  4Z7Y A;  2V8Q B;  1FKA E;  4LFA I;  2JOX A;  1U2R A;  4NXN E;  2L2N A;  5IWA I;  1N36 I;  1O0W A;  1XMQ E;  1ZXM A;  1HNW E;  3Q6M A;  1RQ0 A;  2MC5 A;  4DV2 E;  3B82 A;  4LFC I;  2M4I A;  2BM0 A;  3PYG A;  2R3V A;  4JI2 I;  4LFB I;  4JI4 E;  1B63 A;  2A2D A;  2EWL A;  2KOU A;  1Y4U A;  4UT4 A;  4BS9 A;  3D4J A;  4LF4 I;  2JR1 A;  4IZJ D;  4MYT A;  4WUB A;  1FNM A;  4BMJ A;  2CGE A;  3F6G A;  1QU6 A;  2LUP B;  3J80 C;  4HAC B;  3ADJ A;  2O1W A;  4URL A;  1NHJ A;  2Q2E B;  2E1M A;  3IWD A;  3JU0 A;  2RSM A;  2Z5C A;  2UU9 E;  1H7U A;  5GME A;  4P78 A;  1RR9 A;  2UXD E;  4ZVI A;  5LMU E;  4LF8 E;  4WUC A;  1J5E I;  4KQV A;  1IBL I;  1N32 E;  1XMO I;  3P1X A;  4K0K E;  1Z5A A;  1T4N A;  3Q6N A;  4JG4 A;  1KKH A;  2V8P A;  2YZT A;  1IBK I;  2ZM6 E;  4DV1 E;  4BC9 A;  4B3R I;  4YY3 I;  3K6Q A;  1N33 E;  4FW9 A;  1YYO A;  2O1T A;  1HNZ I;  5CFF E;  4GKJ E;  2DIX A;  3VK6 A;  4GKK E;  3DJW A;  4DR5 E;  1H7S A;  5AE1 A;  1A6F A;  4R03 A;  4DPT A;  2WW4 A;  4DXL A;  2L3J A;  2VF3 A;  2V83 A;  4DR3 I;  1NHH A;  3J81 C;  4OX9 I;  4DR6 I;  3ADI A;  4I3H A;  3PYF A;  3MSW A;  2M7Q A;  2XEX A;  4IZJ B;  1KTV A;  4HXZ A;  2JY9 A;  4BCA A;  4DV5 I;  2LTR A;  2WZO A;  2HK2 A;  4EMD A;  1IBM E;  3JTZ A;  4HAC A;  2IOP A;  1SR9 A;  4Q28 A;  1X49 A;  2LE2 A;  4B3M E;  2L2K B;  1X47 A;  3C4B A;  1KVK A;  4DV4 E;  4JI8 I;  1WUU A;  2HFU A;  3HQ1 A;  3RMP A;  2UXB E;  4DU7 A;  1Z0V A;  4YHH I;  2O1U A;  4DMI A;  3J81 Q;  2Z5C B;  4P7D A;  4DUY I;  2UXC E;  2V89 A;  3B8H A;  4KHP E;  2E1R A;  4F9A B;  3J7Y p;  4LFA E;  2ZBK B;  1ZBQ A;  4FWG A;  5BR8 I;  2DSY A;  1EA6 A;  3OTO E;  5IWA E;  4DV7 E;  1T4L B;  1N36 E;  1Z5C A;  1Z0G A;  4IZK B;  1DI2 A;  4LFC E;  4DPW A;  4DV0 I;  2F8B A;  3AUZ A;  2LMZ A;  2GQ0 A;  2UUA E;  1HNX I;  2E5L I;  4X62 E;  4NXM I;  4DR4 I;  4JYA I;  4JI3 E;  2LRS A;  4JI2 E;  1N0V C;  3OML A;  4PRX A;  1GQE A;  4X64 I;  4LTY A;  5FLX C;  4I8O A;  1YZ9 A;  4IZJ A;  2FV4 B;  3HUL A;  4LF4 E;  1I94 I;  1WHN A;  2PNL A;  4JI5 I;  4DR2 I;  4JI0 I;  3K85 A;  1Y4S A;  4P7A A;  3ZKD A;  2L3C A;  2HK3 A;  5L3J A;  2V86 A;  4UTG A;  2VQE E;  1HR0 I;  4B3T I;  3ZZ0 A;  1PVG A;  4AQY I;  1J5E E;  4P52 A;  1IBL E;  1H72 C;  1RRE A;  1XMO E;  4NXN I;  4DR1 I;  2V87 A;  1Z0C A;  1ELO A;  2B7T A;  4LF7 I;  2L8T A;  2RTX A;  5FLX Q;  2Z5E A;  2V34 A;  1MX0 A;  3VYX A;  4X65 I;  1N34 E;  1IBK E;  4DR7 I;  4FN5 A;  1WXR A;  4DPY A;  2FTX B;  4JI4 I;  4B3R E;  4YY3 E;  3DF6 A;  2VF1 A;  4WUD A;  2LJH A;  1BKN A;  2V85 A;  4JI1 I;  2V2Q A;  4IZK A;  1ZM3 A;  2H36 X;  1STU A;  3HTX A;  4HY1 A;  3M6A A;  4DR3 E;  4DKK A;  2CZ9 A;  4ED4 A;  4PU9 A;  1H74 A;  2X36 A;  4OX9 E;  4DR6 E;  2GS8 A;  2HFS A;  3T1H I;  2UU9 I;  3H4L A;  4N3O A;  2NUF A;  1S4E A;  4BBY A;  5GMD A;  4DV5 E;  2UUC E;  4LF9 I;  4KZS A;  2LBS B;  4J8Z A;  2L2M A;  1Z59 A;  2M1S A;  3K17 A;  3K1J A;  4X66 I;  2EZ6 A;  4M0V A;  4JI6 I;  1KIJ A;  2B3T B;  2ZIT A;  3WU5 A;  4JI7 I;  2KON A;  5LMN I;  1ZM9 A;  1N0U A;  4DPU A;  3V2U C;  4USM A;  4F54 A;  1YYK A;  2UUB I;  5FWK A;  1B62 A;  4JI8 E;  1XNQ I;  2JVA A;  1PKP A;  4X8W A;  3Q1Q A;  1N33 I;  4LF6 E;  1FJG I;  4DUY E;  4GKJ I;  1NZ0 A;  1Y6Z A;  3PYE A;  4LF5 I;  4DUZ I;  4DR5 I;  2LTS A;  2LUQ A;  2MDR A;  1XNR E;  4HYM A;  3JAM C;  5BR8 E;  3ZOQ B;  1K47 A;  5AE3 A;  2RS6 A;  1GZ6 A;  4DV3 I;  1YYW A;  2ODR D;  1Z0W A;  3HJC A;  2VQF I;  2K4V A;  5A2Q Q;  4DV6 I;  3J7A G;  1IBM I;  4M2Z A;  4DV0 E;  2JWO A;  4L5N C;  2E5L E;  1EKZ A;  3F0N A;  4NXM E;  4M30 A;  2A2C A;  2NPF A;  4B3M I;  4OOG C;  2Z5B A;  1D6T A;  1UIL A;  5AAS A;  1OJ4 A;  2X7I A;  1Z0T A;  2DMY A;  2RS7 A;  3B78 A;  2FGG A;  4JV5 I;  2MC6 A;  1UEK A;  1H73 A;  2CG9 A;  2VE7 C;  4LFB E;  2IHR 1;  4JI5 E;  2UXB I;  1USV A;  3JAM Q;  2HHH I;  4DR2 E;  4WSP A;  4JI0 E;  1FI4 A;  3ZM7 A;  2JOB A;  1J26 A;  2L92 A;  3T1Y I;  2V2Z A;  4R1F A;  4KHP I;  4B3T E;  2ODR C;  4AQY E;  2HKJ A;  4F9C B;  3QT6 A;  2F4V I;  4RPF A;  3LNU A;  1X48 A;  4DR1 E;  3OTO I;  2IOQ A;  4LF7 E;  4DV7 I;  4M1K A;  4B3S I;  2CPN A;  4GEQ B;  3P06 A;  3ZZT A;  4XTJ A;  2LJP A;  3WU3 A;  1Z0E A;  4X65 E;  2N3G A;  4DR7 E;  2UUA I;  2DB2 A;  4X62 I;  4JI3 I;  1DAR A;  3LPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...