4DV5E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5E02
1MG7A 2VQFE 5LMUI 2A2DA 4DUZI 4DV7E 2J7KA 3B82A 4FWGA 4WFTA 4UTGA 1IBKE 3ADLA 2L3JA 5BR8E 2RTXA 4B3TI 3C4TA 1XNRE 1MX0A 2BM0A 4HACA 4KHPE 4MYUA 1J5EE 4JG4A 3B78A 2HK2A 1ZM9A 3T1HI 4X64E 4PRVA 4WUCA 4OX9E 4PU9A 1HR0I 1N33I 2N3GA 1RQ0A 4DV0E 4DR6I 2LUPB 1N32I 4URLA 2B7TA 4FN5A 3PYFA 3HULA 1HNZI 4NXME 3J80C 3PYDA 2NUGA 1J26A 3H4LA 2AJ4A 1XMQE 1N34E 2LBSB 4AQYI 1HNWE 1FJGI 2EZ6A 1MU5A 4LF6I 4LFAI 1XNQE 1X47A 4LF9I 2LTRA 2N3HA 2UUCE 4DKKA 4EMDA 4DV5I 1X49A 2MDRA 4DR2I 1N36I 4LF7I 2E5LI 4LFBE 1OJ4A 2UUAI 4UT4A 2V2ZA 4DV2I 4P7AA 4X65E 5FLXQ 4LF4E 2ZBKB 2UXBE 3F0NA 4JI3I 3ADIA 1Z5BA 4DUYE 4DPUA 1DI2A 1UHZA 4X62E 2A2CA 4DV1E 3LLHA 4DR3E 5LMNI 4DR1I 2DB2A 2RS6A 4LF8E 4YY3I 1T4NA 2RSMA 4B3MI 1T4LB 3D4JA 5LMUE 2Q2EB 2LRSA 1RR9A 2IHR1 2HHHI 2NA2A 1K47A 4B3RE 2VF3A 1I94E 2HKJA 2OI2A 1NZ0A 2DEIA 1GQEA 4DR5I 2L2MA 3GONA 2X7IA 4NXNE 4JI4E 4DPTA 2UU9E 2YT4A 3J80Q 3CWVA 4M30A 3T1HE 5IWAI 1WHQA 1X48A 4X8WA 1NHIA 2F4VE 1YYWA 1ELOA 2NPFA 3PYGA 3VYXA 1S4EA 1NHHA 1XHKA 2GS8A 3J81Q 3ZZ0A 3QT5A 4DU7A 2VQEE 1Z0WA 4DR4E 5LL6R 1IBLI 4MYTA 4JYAE 3QT7A 4HACB 3ZKDA 3OTOI 4JI5E 2DIXA 4DV6I 4AQYE 2HK3A 3LNUA 4LF9E 4JI1E 1NHJA 2L3CA 1H7UA 4FW9A 4JV5I 1EA6A 3LPSA 2EFGA 4DV5E 1IBME 4LF5E 4DR2E 2VQFI 4LF7E 4DV7I 5IT9C 3JAMC 1QZRA 1ZXNA 1IBKI 2UXDE 2B3TB 5L3JA 5BR8I 3HTXA 4DR7E 1XNRI 1Z0EA 3J81C 4ZVIA 2DEJA 4X66I 1ZM4A 1QU6A 1PIEA 4DR1E 3WU3A 4USMA 4X64I 3T1YI 4FWDA 1EI1A 2NUFA 2L2KB 4Z7YA 2WW4A 4OX9I 4B3SI 3J7AG 4USKA 4M1KA 4DV0I 2HHHE 1B62A 3P1XA 1FI4A 1ZM3A 2HFSA 1XMOI 4JI8I 5GMDA 4NXMI 1ZM2A 1B63A 4YHHI 4LFCE 3QT8A 4XTJA 4M2ZA 1Z5AA 4K0KE 2RS7A 4DU8A 2UXCE 4HYMA 2E1RA 1XMQI 2L2NA 2ZM6E 1KKHA 1N34I 4JI6E 3J7AM 1PKPA 4I3HA 1VISA 5IWAE 3J7Yp 1XNQI 4DUZE 3PYEA 2HKEA 1Z0BA 2UUCI 4DV3I 2BV3A 3V5RA 4FWHA 4B3TE 3C4BA 4ED4A 2B7VA 2DMYA 3ADGA 4DV4I 4LFBI 1Z0GA 3ZZUA 1Z0TA 4GKKI 1H73A 4X65I 4KQVA 3B8HA 4LF4I 1H7SA 1Z59A 2UXBI 3V2UC 5IT9Q 3JAMQ 4DV6E 3WU4A 2V2QA 1RC7A 1N0UA 4DUYI 1HR0E 1N33E 4DXLA 1PVGA 4HY1A 4X62I 1ZBTA 3ZKBA 2BM1A 4DV1I 5GMEA 4DR6E 4DR3I 1EKZA 1N32E 1RREA 1D6TA 1HNXI 1HNZE 2X36A 4JI0I 4JI2I 3K17A 3K1JA 1UEKA 1Z0CA 3ZZTA 4JI7I 4R1FA 1STUA 4GKJI 1T4OA 4B3RI 4DPYA 1FJGE 1I94I 4RPFA 4LF6E 4LFAE 2V2VA 3ZM7A 1H74A 2JY9A 4NXNI 4JI4I 1H72C 2KHXA 4X66E 2UU9I 2UUBI 1UILA 1Z5CA 1FWLA 1N36E 2E5LE 5A2QQ 3T1YE 2UUAE 2LTSA 2L33A 3Q1QA 1ZXMA 1FKAE 4B3SE 2F4VI 4DV2E 4PRXA 2ZITA 4Z7CA 4JI3E 2LJHA 1XMOE 1YZ9A 4JI8E 4KHPI 2VQEI 2CZ9A 4DR4I 4YHHE 1U2RA 5LMNE 2R3VA 1J5EI 4JYAI 4OOGC 4WYQB 4P52A 2XEXA 4JI5I 4YY3E 3VYYA 3WU5A 4B3ME 3LTOA 2JVAA 4JI1I 1YYKA 4DV3E 4DPXA 1DARA 2CPNA 3ADJA 2R42A 2NUEA 3M6AA 4DR5E 1IBMI 1FNMA 1KVKA 4LF5I 1A6FA 4DV4E 1O0WA 1BKNA 5A2QC 4GKKE 2UXDI 1HNWI 1Z0VA 2LUQA 4DR7I 1WHNA 1KIJA 2LJPA 4HXZA 2V8PA 5CFFE 3WU6A 1HNXE 4JI0E 1S16A 4JI2E 1IBLE 2V34A 4JI7E 1YYOA 1FWKA 3OTOE 2HFUA 4GKJE 4LFCI 1WUUA 4K0KI 4JV5E 2UXCI 2ZM6I 4JI6I 2UUBE 4LF8I 4WUBA 1KTVA 1N0VC 4WUDA 5FLXC 3QT6A 4DPWA
chains in the Genus database with same CATH superfamily
2EM5A 1MG7A 2VQFE 5LMUI 2A2DA 4DUZI 2JOBA 4DV7E 5KL4A 2CSHA 2J7KA 3B82A 3H1CA 2JYAA 4BCAA 4FWGA 4GQUA 2YTGA 5IT9Q 2KONA 4WFTA 4UTGA 1IBKE 4LCHA 5EKWA 3ADLA 1DQ3A 5A6BD 2L3JA 5BR8E 3JTZA 5F3WA 2RTXA 5FWKA 4B3TI 3C4TA 4MLVA 5A6KA 2ELZA 2PNZB 4BC9A 1XNRE 3AUZA 1MX0A 2MKDA 5JEAE 4MDTA 1AAYA 2BM0A 4HACA 4HTGA 2C38A 5DRRA 4KHPE 2AE8A 4L8NA 2EN3A 1SFEA 4FW5A 4MYUA 5C0XB 1J5EE 4JG4A 2DMIA 2HK2A 1ZM9A 2MC5A 4R2AA 3B78A 3T1HI 2EM2A 2Z5BA 2EPOA 1X3CA 4X64E 4PRVA 4WUCA 4I8OA 1EH8A 2EM7A 4OX9E 4PU9A 1HR0I 1G2DC 1N33I 2FGGA 2N3GA 1RQ0A 1UDOA 3Q6NA 4X9JA 1IQOA 1PJQA 5K36C 4DV0E 4TUIA 4DR6I 2HC5A 3EPJA 2LUPB 5T6JA 2O3ZA 2O1VA 5C0XE 1N32I 4URLA 5AE1A 2B7TA 4FN5A 4KWYA 2BR2A 2YTEA 3PYFA 2GO4A 1Y60A 3HULA 4MLQA 1HNZI 4NXME 3BBGA 3J80C 3HXLA 3PYDA 2NUGA 4MU1A 1J26A 2YSPA 1A1IA 1YHCA 3H4LA 4M0VA 5AC5A 3J80Q 2E1MA 2LV2A 2AJ4A 1X6EA 1XMQE 1Y5YA 3PS2A 1KYQA 2WNRB 1N34E 2EOOA 2LBSB 4AQYI 5K36A 1HNWE 1FJGI 4GZNC 2EZ6A 1MU5A 4LCFA 4LF6I 1XNQE 4LFAI 1X47A 2EMAA 4LF9I 2JXPA 2LTRA 2N3HA 1RHYA 4FK5C 4P78A 2UUCE 4DKKA 3QG5C 2Q8UA 4MQYA 3CDJA 5EL9A 4EMDA 2EMGA 1Z1BA 3GCMA 2RQLA 4F6MA 4IZKA 4DV5I 1X49A 2MDRA 4F9AB 4U3DA 4DR2I 2PO1A 1N36I 4R2PA 4LF7I 2E5LI 2JEAA 4LFBE 2EQ1A 4OO1A 3F6GA 2WP8B 4NHRA 1OJ4A 2UUAI 4F6NA 2L8TA 2V2ZA 4UT4A 2PO0A 2V8QB 2EL5A 2LVHA 2WCC3 1NCSA 4DV2I 4P7AA 4F9BB 4X65E 1T38A 2C37A 4LF4E 5FLXQ 2EPZA 4OO1B 1PDAA 2J65A 2ZBKB 2UXBE 4FW4A 3F0NA 4JI3I 3ADIA 2F1DA 5K36D 1Z5BA 4DUYE 1YUIA 4DPUA 1YSAC 1DI2A 4R03A 4LOMA 1UHZA 4X62E 2A2CA 4DV1E 3LLHA 5A6AA 4DR3E 1MEYC 5LMNI 2EM3A 4DR1I 2DB2A 4Q35B 1USVA 5AE2A 4O43A 3FIGA 4OO1E 2RS6A 4LF8E 4YY3I 4AM3A 1T4NA 1UDQA 2M9AA 2RSMA 1ZU1A 3IWBA 4B3MI 2YPNA 1T4LB 3D4JA 5LMUE 2Q2EB 1BBGA 3L7ZB 2VESA 2YZTA 2LRSA 5LLQA 2YWQA 2IHR1 1RR9A 4ZYEA 2HHHI 2EMZA 4IFDC 2PRTA 2O1TA 5KL5A 2NA2A 1K47A 4B3RE 2EOJA 1Y6ZA 1I94E 2HKJA 2VF3A 4AIMA 2M1SA 2OI2A 1NZ0A 2DEIA 1GQEA 4DR5I 4RHBB 5A69A 2L2MA 3GONA 1JK2A 2EN6A 1GTKA 2LO3A 2I13A 1EH7A 2X7IA 3KWRA 5DRQA 3EPLA 3F6HA 3M99B 4JI4E 4NXNE 4LU9A 4R2QA 2UU9E 4DPTA 3ZOQB 2F8BA 1USUA 2YT4A 1E3PA 3C6KA 3UHMA 1R6MA 3CWVA 1X6FA 5JEAB 2BB8A 2B9DA 2EPRA 4M30A 3T1HE 1A1FA 4HEIA 4IFDA 2BA0G 5IWAI 1WHQA 2EOXA 1X48A 1IQSA 2IOPA 3MHSC 4X8WA 5DNXA 2EPMX 1NHIA 2EM9A 2YRKA 2CGEA 2F4VE 4MU3A 1TF6A 4FW7A 1YYWA 1ELOA 3TQMA 2NPFA 3PYGA 3VYXA 1S4EA 1NHHA 2IESA 1XHKA 2GS8A 2C39A 2YTDA 3J81Q 5KL2A 5TSEA 3ZZ0A 4KZSA 2GHFA 4ZYDA 3QT5A 2EM4A 1UN6B 2MKNA 4FW3A 2VQEE 1Z0WA 4DU7A 4DR4E 1WXRA 5LL6R 1P42A 2DSYA 1IBLI 4MYTA 3ECRA 1X6HA 2YTOA 1XXEA 3BGHA 4JYAE 3QT7A 4HACB 3PRYA 3M85D 3ZKDA 2EN7A 1ZBQA 2C38B 3HKMA 2EN8A 2V83A 2L6MA 3MSWA 4JI5E 3OTOI 2DIXA 2DLQA 4DV6I 3CDIA 4AQYE 3THOB 2V85A 2EPLX 2N8XA 4IFDD 2ELYA 1X5WA 2HK3A 2Z5BB 3LNUA 4LF9E 4JI1E 3HJCA 1NHJA 2HJJA 2L3CA 4IS9A 1H7UA 4FW9A 4JV5I 2EM0A 2EOSA 2LMZA 2EPCA 3P3EA 1EA6A 2YTPA 2EMXA 4ZYHA 3LPSA 4WUDA 5IV8B 2EFGA 2EOZA 3L00A 4DV5E 1IBME 2NN6C 3DD6A 4LF5E 4DR2E 1YFHA 5AASA 2VQFI 2EE8A 4LF7E 1A1HA 4DV7I 5IT9C 2K7IA 3JAMC 2EMLA 2JWOA 2BR2B 2GO3A 3P3GA 2EOEA 4DMIA 5JEAF 2GLIA 1QZRA 4P7DA 2CVEA 1ZXNA 2EMKA 1IBKI 2UXDE 1VI7A 1OYSA 2B3TB 2A25A 2R1FA 5L3JA 5BR8I 3HTXA 2YRHA 4DR7E 2PNMA 4WSPA 4R2RA 1XNRI 1Z0EA 2PO2A 3J81C 4ZVIA 5K36B 2DEJA 4MU0A 2NN6A 1F2IG 3K6QA 1BB8A 2BA1D 4X66I 1ZM4A 1QU6A 1PIEA 2JT2A 2EMCA 2EMIA 2EMWA 2EOMA 2J7JA 4DR1E 2IERA 4IZJA 3WU3A 2BA0D 4USMA 4X64I 3T1YI 4FWDA 1EI1A 5C0XF 2NUFA 2L2KB 2YTFA 1TN9A 4Z7YA 2CG9A 2WW4A 4OX9I 4B3SI 3J7AG 4IZKB 5K36E 2EWLA 2YU5A 3M85G 4USKA 2PO1B 2YTQA 1A1GA 4M1KA 4DV0I 2JEAB 2HHHE 2IOQA 2EPNA 4WPYA 3HPSA 2LJUA 3P1XA 1B62A 1FI4A 2PO0B 1ZM3A 2HFSA 2VRDA 1XMOI 4JI8I 2NN6E 5AC4A 5GMDA 4NXMI 1ZM2A 2C37B 1B63A 2Z5CA 4YHHI 4LFCE 3QT8A 4XTJA 4M2ZA 1Z5AA 2Z5EA 4K0KE 2EOYA 2RS7A 4LPFA 4DU8A 1UDNA 2UXCE 2EPPA 2CT1A 2E1RA 4HYMA 2NN6D 1XMQI 2EN4A 2L2NA 2ZM6E 1KKHA 1N34I 4JI6E 2Z5CB 3J7AM 1PKPA 2ENAA 2ODRC 4I3HA 1VISA 2EOFA 3JU0A 2YRMA 5IWAE 4IZJD 3J7Yp 1XNQI 4DUZE 3PYEA 2HKEA 1Z0BA 5A6JA 4TUGA 1WJPA 2UUCI 1G2FC 3U1KA 4DV3I 2ADRA 1A1LA 2BV3A 1P47A 2JE6A 2V86A 1E3HA 3P06A 3V5RA 2YTIA 4FWHA 4B3TE 3C4BA 4ED4A 2EM8A 1YH8A 5K36F 1OYRA 2B7VA 2EM6A 2DMYA 2KOUA 3ADGA 4R8OA 4RH8A 4BA1A 3BIDA 4DV4I 5JEAC 4LFBI 2BA1G 1Z0GA 4O4KA 2WBSA 3ZZUA 2LCEA 1Z0TA 4R2DA 4WSGA 3LMLA 1SR9A 4GKKI 1H73A 4IFDB 4BA1B 4X65I 4KQVA 3B8HA 4LF4I 4R2CA 3OMLA 1H7SA 1Z59A 3BF2A 2UXBI 2O1UA 2O1WA 3V2UC 2VF1A 3KZZA 3JAMQ 2JOXA 4DV6E 4OZEA 2EQ3A 1UDSA 2V2QA 3WU4A 1RC7A 2EOHA 1N0UA 4DUYI 1HR0E 1N33E 2I9IA 1PJSA 4DXLA 4OO1F 3KZYA 1PVGA 4HY1A 4X62I 1ZBTA 2MC6A 2BM1A 3ZKBA 4DV1I 1ZAAC 4R2SA 3NZKA 4DR6E 2EPAA 5GMEA 4DR3I 5ADZA 1EKZA 1N32E 5C0XC 4BC7A 4BBYA 5KL7A 1RREA 1HNXI 1D6TA 1HNZE 3H09A 2X36A 2DLKA 3VHTB 4JI0I 2E72A 2EOQA 4JI2I 3K17A 3K1JA 1UEKA 2MDGA 1Z0CA 4R2EA 2C39B 3ZZTA 4JI7I 3MHHC 2JEBA 2ODRD 4IFDE 2PNZA 3M7ND 2HGHA 4R1FA 2EMBA 2WBTA 1STUA 4GKJI 4O5GA 1T4OA 4B3RI 2M7QA 5AE3A 1TF3A 1FJGE 4J3DA 4DPYA 1I94I 4BS9A 4RPFA 4LF6E 4LFAE 2JEBB 2L92A 2ENCA 4BHCA 5C0XA 3VK6A 3EPKA 2V2VA 3ZM7A 1H74A 2JY9A 1QNTA 2M4IA 4NXNI 4JI4I 1H72C 2KHXA 4X66E 2UU9I 1DGCA 3C6MA 3GLLA 2UUBI 5JEAD 2V88A 2YU8A 2GPIA 2D9HA 1UILA 1Z5CA 5DRPA 1N36E 1FWLA 2EOIA 2E5LE 5A2QQ 3T1YE 1IMUA 5DNYA 5DNLA 4GEQB 1YUJA 2UUAE 2LTSA 2L33A 3Q1QA 1ZXMA 1FKAE 4B3SE 2F4VI 1MGTA 1OYPA 4DV2E 4PRXA 2WZOA 1LLMC 4ISAA 2ZITA 4Z7CA 2G7HA 5KL3A 1A1JA 4JI3E 5ELWA 2LJHA 4IFDF 4F54A 1XMOE 1YZ9A 4JI8E 4KHPI 4BHBA 2VQEI 2CZ9A 1GZ6A 2EORA 2WNRA 4DR4I 4YHHE 1U2RA 4ZYGA 5C0XD 2VE7C 5LMNE 4N4RB 2R3VA 3K85A 1J5EI 4JYAI 2PO2B 2LT7A 4OOGC 4WYQB 5KL6A 3P76A 4P52A 2XEXA 3PS1A 2NN6B 2V87A 4JI5I 4YY3E 2CTDA 4QNKA 2EMYA 2EP3A 4OO1C 3THNA 1UBDC 1AH5A 3VYYA 4B3ME 3LTOA 3WU5A 4QNJA 2EMHA 1HK7A 4IZJB 2JVAA 4JI1I 2GQ0A 3M7NG 1YYKA 3AV0A 1A1KA 4F9CB 4DV3E 4FW6A 4DPXA 1DARA 3EQ1A 2CPNA 3ADJA 2EPUA 2NUEA 2R42A 2WP8A 2EQ0A 3M6AA 3Q6MA 2ENHA 4U3BA 1YPNA 3HQ1A 4DR5E 2JPAA 1PJTA 1FNMA 1KVKA 1IBMI 4LF5I 2EPKX 1A6FA 4DV4E 1O0WA 4NBQA 1BKNA 1EH6A 5A2QC 2EJ4A 3RMPA 4IS1C 3B4TA 2R76A 2YSOA 4GKKE 2UXDI 2EPXA 4BA2A 1HNWI 2LE2A 4J8ZA 1Z0VA 2PNLA 2LUQA 4DR7I 3HPZA 1WHNA 1KIJA 2LJPA 2YTNA 1ZR9A 4BA2B 3P3CA 3U1YA 3DJWA 4O24A 4IJDA 1RMDA 4HXZA 4N3OA 1N3GA 2DGCA 3GMEA 2FTXB 2EL4A 4NZVA 3EPHA 2V8PA 5CFFE 4Q28A 3L7ZA 4F2JC 2JP9A 4MU4A 3WU6A 1HNXE 4M9VC 1Y4UA 2JE6B 2WBUA 2EN1A 3KRNA 1R6LA 4JI0E 2RPCA 4JI2E 1S16A 1IBLE 3DF6A 4WX9A 5DROA 1B69A 3IWDA 4AIDA 2V34A 5A6BA 2NN6F 2BBGA 4JI7E 1T39A 1YYOA 2EN2A 1L4SA 4OO1D 1FWKA 4BMJA 5IXMB 3OTOE 2HFUA 4L5NC 2RSIA 4GKJE 2K4VA 1KJKA 1NEIA 1WRJA 1Y4SA 2FV4B 3PS3A 4LFCI 1WUUA 5JEAA 4K0KI 2EMFA 4LCGA 1JK1A 2V89A 4JV5E 4WXDA 2JR1A 2UXCI 3IWCA 2DRPA 2NABA 2H36X 3UK3C 2ZM6I 4JI6I 2UUBE 4LF8I 4LTYA 4WXCA 4OKGA 4WUBA 2EL6A 2YTJA 1KTVA 1N0VC 1BBOA 5FLXC 3QT6A 4DPWA
chains in the Genus database with same CATH topology
1MG7A 2VQFE 5LMUI 2A2DA 4DUZI 2JOBA 4DV7E 2J7KA 3B82A 4BCAA 4FWGA 2KONA 4WFTA 4UTGA 1IBKE 3ADLA 1DQ3A 2L3JA 5BR8E 3JTZA 5F3WA 2RTXA 5FWKA 4B3TI 3C4TA 4BC9A 1XNRE 3AUZA 1MX0A 2BM0A 4HACA 4KHPE 4L8NA 4MYUA 1J5EE 4JG4A 3B78A 2HK2A 1ZM9A 2MC5A 3T1HI 2Z5BA 4X64E 4PRVA 4WUCA 4I8OA 4OX9E 4PU9A 1HR0I 1N33I 2FGGA 2N3GA 1RQ0A 3Q6NA 4DV0E 4TUIA 4DR6I 2LUPB 5T6JA 2O1VA 1N32I 4URLA 5AE1A 2B7TA 4FN5A 3PYFA 3HULA 1HNZI 4NXME 3J80C 3HXLA 3PYDA 2NUGA 1J26A 3H4LA 4M0VA 2E1MA 2AJ4A 1XMQE 1N34E 2LBSB 4AQYI 1HNWE 1FJGI 2EZ6A 1MU5A 4LF6I 4LFAI 1XNQE 1X47A 4LF9I 2LTRA 2N3HA 4P78A 2UUCE 4DKKA 4EMDA 4IZKA 4DV5I 1X49A 2MDRA 4F9AB 4DR2I 1N36I 4LF7I 2E5LI 4LFBE 3F6GA 1OJ4A 2UUAI 4UT4A 2L8TA 2V2ZA 2V8QB 4DV2I 4P7AA 4F9BB 4X65E 5FLXQ 4LF4E 2ZBKB 2UXBE 3F0NA 4JI3I 3ADIA 1Z5BA 4DUYE 4DPUA 1DI2A 4R03A 1UHZA 4X62E 2A2CA 4DV1E 3LLHA 4DR3E 5LMNI 4DR1I 2DB2A 1USVA 5AE2A 3FIGA 2RS6A 4LF8E 4YY3I 1T4NA 2RSMA 3IWBA 4B3MI 1T4LB 3D4JA 5LMUE 2Q2EB 2YZTA 2LRSA 1RR9A 2IHR1 2HHHI 2O1TA 2NA2A 1K47A 4B3RE 1Y6ZA 2VF3A 1I94E 2HKJA 2M1SA 2OI2A 1NZ0A 2DEIA 1GQEA 4DR5I 2L2MA 3GONA 2X7IA 3KWRA 3F6HA 4NXNE 4JI4E 4LU9A 2UU9E 4DPTA 3ZOQB 2F8BA 1USUA 2YT4A 3J80Q 3CWVA 4M30A 2B9DA 3T1HE 5IWAI 1WHQA 1X48A 2IOPA 4X8WA 1NHIA 2CGEA 2F4VE 1YYWA 1ELOA 2NPFA 3PYGA 3VYXA 1S4EA 1NHHA 1XHKA 2GS8A 3J81Q 3ZZ0A 4KZSA 3QT5A 4DU7A 2VQEE 1Z0WA 4DR4E 1WXRA 5LL6R 2DSYA 1IBLI 4MYTA 4JYAE 3QT7A 4HACB 3PRYA 3ZKDA 1ZBQA 2V83A 3MSWA 2L6MA 3OTOI 4JI5E 2DIXA 4DV6I 4AQYE 2V85A 2Z5BB 2HK3A 3LNUA 4LF9E 4JI1E 3HJCA 1NHJA 2L3CA 1H7UA 4FW9A 4JV5I 2LMZA 1EA6A 3LPSA 2EFGA 4DV5E 1IBME 4LF5E 4DR2E 5AASA 2VQFI 4LF7E 4DV7I 5IT9C 3JAMC 2JWOA 4DMIA 1QZRA 4P7DA 1ZXNA 1IBKI 2UXDE 2B3TB 5L3JA 5BR8I 3HTXA 4DR7E 2PNMA 4WSPA 1XNRI 1Z0EA 3J81C 4ZVIA 2DEJA 3K6QA 4X66I 1ZM4A 1QU6A 1PIEA 4IZJA 4DR1E 3WU3A 4USMA 4X64I 3T1YI 4FWDA 1EI1A 2NUFA 2L2KB 4Z7YA 2CG9A 2WW4A 4OX9I 4B3SI 3J7AG 4IZKB 2EWLA 4USKA 4M1KA 4DV0I 2HHHE 2IOQA 4WPYA 3HPSA 3P1XA 1B62A 1FI4A 1ZM3A 2HFSA 1XMOI 4JI8I 5GMDA 4NXMI 1ZM2A 1B63A 2Z5CA 4YHHI 4LFCE 3QT8A 4XTJA 4M2ZA 1Z5AA 2Z5EA 4K0KE 2RS7A 4DU8A 2UXCE 4HYMA 2E1RA 1XMQI 2L2NA 2ZM6E 1KKHA 1N34I 4JI6E 2Z5CB 3J7AM 1PKPA 2ODRC 4I3HA 1VISA 3JU0A 5IWAE 4IZJD 3J7Yp 1XNQI 4DUZE 3PYEA 2HKEA 1Z0BA 4TUGA 2UUCI 4DV3I 2BV3A 2V86A 3P06A 3V5RA 4FWHA 4B3TE 3C4BA 4ED4A 2B7VA 2DMYA 2KOUA 3ADGA 4R8OA 4DV4I 4LFBI 1Z0GA 3ZZUA 1Z0TA 3LMLA 1SR9A 4GKKI 1H73A 4X65I 4KQVA 3B8HA 4LF4I 3OMLA 1H7SA 1Z59A 2UXBI 2O1UA 2O1WA 3V2UC 2VF1A 3JAMQ 5IT9Q 2JOXA 4DV6E 3WU4A 2V2QA 1RC7A 1N0UA 4DUYI 1HR0E 1N33E 4DXLA 1PVGA 4HY1A 4X62I 1ZBTA 2MC6A 2BM1A 3ZKBA 4DV1I 5GMEA 4DR6E 4DR3I 5ADZA 1EKZA 1N32E 4BC7A 4BBYA 1RREA 1HNXI 1D6TA 1HNZE 3H09A 2X36A 4JI0I 4JI2I 3K17A 3K1JA 1UEKA 1Z0CA 3ZZTA 4JI7I 2ODRD 4R1FA 1STUA 4GKJI 1T4OA 4B3RI 2M7QA 5AE3A 1FJGE 4DPYA 1I94I 4BS9A 4RPFA 4LF6E 4LFAE 2L92A 3VK6A 2V2VA 3ZM7A 1H74A 2JY9A 2M4IA 4NXNI 4JI4I 1H72C 2KHXA 4X66E 2UU9I 2UUBI 2V88A 1UILA 1Z5CA 1FWLA 1N36E 2E5LE 5A2QQ 3T1YE 5DNYA 4GEQB 2UUAE 2LTSA 2L33A 3Q1QA 1ZXMA 1FKAE 4B3SE 2F4VI 4DV2E 4PRXA 2WZOA 2ZITA 4Z7CA 2G7HA 4JI3E 2LJHA 4F54A 1XMOE 1YZ9A 4JI8E 4KHPI 2VQEI 2CZ9A 1GZ6A 4DR4I 4YHHE 1U2RA 2VE7C 5LMNE 2R3VA 1J5EI 3K85A 4JYAI 4OOGC 4WYQB 4P52A 2XEXA 2V87A 4JI5I 4YY3E 3VYYA 3WU5A 4B3ME 3LTOA 1HK7A 4IZJB 2JVAA 4JI1I 2GQ0A 1YYKA 3AV0A 4F9CB 4DV3E 4DPXA 1DARA 2CPNA 3ADJA 2R42A 2NUEA 3M6AA 3Q6MA 3HQ1A 4DR5E 1IBMI 1FNMA 1KVKA 4LF5I 1A6FA 4DV4E 1O0WA 1BKNA 5A2QC 3RMPA 4GKKE 2UXDI 1HNWI 2LE2A 4J8ZA 1Z0VA 2PNLA 2LUQA 4DR7I 3HPZA 1WHNA 1KIJA 2LJPA 3DJWA 4HXZA 4N3OA 2FTXB 2V8PA 5CFFE 4Q28A 3WU6A 1HNXE 1Y4UA 4JI0E 1S16A 4JI2E 1IBLE 3DF6A 3IWDA 2V34A 4JI7E 1YYOA 1FWKA 4BMJA 3OTOE 2HFUA 4L5NC 4GKJE 2K4VA 1Y4SA 2FV4B 4LFCI 1WUUA 4K0KI 4JV5E 2V89A 2UXCI 2JR1A 3IWCA 2H36X 2ZM6I 4JI6I 2UUBE 4LF8I 4LTYA 4WUBA 1KTVA 1N0VC 4WUDA 5FLXC 3QT6A 4DPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG7 A;  2VQF E;  5LMU I;  2A2D A;  4DUZ I;  4DV7 E;  2J7K A;  3B82 A;  4FWG A;  4WFT A;  4UTG A;  1IBK E;  3ADL A;  2L3J A;  5BR8 E;  2RTX A;  4B3T I;  3C4T A;  1XNR E;  1MX0 A;  2BM0 A;  4HAC A;  4KHP E;  4MYU A;  1J5E E;  4JG4 A;  3B78 A;  2HK2 A;  1ZM9 A;  3T1H I;  4X64 E;  4PRV A;  4WUC A;  4OX9 E;  4PU9 A;  1HR0 I;  1N33 I;  2N3G A;  1RQ0 A;  4DV0 E;  4DR6 I;  2LUP B;  1N32 I;  4URL A;  2B7T A;  4FN5 A;  3PYF A;  3HUL A;  1HNZ I;  4NXM E;  3J80 C;  3PYD A;  2NUG A;  1J26 A;  3H4L A;  2AJ4 A;  1XMQ E;  1N34 E;  2LBS B;  4AQY I;  1HNW E;  1FJG I;  2EZ6 A;  1MU5 A;  4LF6 I;  4LFA I;  1XNQ E;  1X47 A;  4LF9 I;  2LTR A;  2N3H A;  2UUC E;  4DKK A;  4EMD A;  4DV5 I;  1X49 A;  2MDR A;  4DR2 I;  1N36 I;  4LF7 I;  2E5L I;  4LFB E;  1OJ4 A;  2UUA I;  4UT4 A;  2V2Z A;  4DV2 I;  4P7A A;  4X65 E;  5FLX Q;  4LF4 E;  2ZBK B;  2UXB E;  3F0N A;  4JI3 I;  3ADI A;  1Z5B A;  4DUY E;  4DPU A;  1DI2 A;  1UHZ A;  4X62 E;  2A2C A;  4DV1 E;  3LLH A;  4DR3 E;  5LMN I;  4DR1 I;  2DB2 A;  2RS6 A;  4LF8 E;  4YY3 I;  1T4N A;  2RSM A;  4B3M I;  1T4L B;  3D4J A;  5LMU E;  2Q2E B;  2LRS A;  1RR9 A;  2IHR 1;  2HHH I;  2NA2 A;  1K47 A;  4B3R E;  2VF3 A;  1I94 E;  2HKJ A;  2OI2 A;  1NZ0 A;  2DEI A;  1GQE A;  4DR5 I;  2L2M A;  3GON A;  2X7I A;  4NXN E;  4JI4 E;  4DPT A;  2UU9 E;  2YT4 A;  3J80 Q;  3CWV A;  4M30 A;  3T1H E;  5IWA I;  1WHQ A;  1X48 A;  4X8W A;  1NHI A;  2F4V E;  1YYW A;  1ELO A;  2NPF A;  3PYG A;  3VYX A;  1S4E A;  1NHH A;  1XHK A;  2GS8 A;  3J81 Q;  3ZZ0 A;  3QT5 A;  4DU7 A;  2VQE E;  1Z0W A;  4DR4 E;  5LL6 R;  1IBL I;  4MYT A;  4JYA E;  3QT7 A;  4HAC B;  3ZKD A;  3OTO I;  4JI5 E;  2DIX A;  4DV6 I;  4AQY E;  2HK3 A;  3LNU A;  4LF9 E;  4JI1 E;  1NHJ A;  2L3C A;  1H7U A;  4FW9 A;  4JV5 I;  1EA6 A;  3LPS A;  2EFG A;  4DV5 E;  1IBM E;  4LF5 E;  4DR2 E;  2VQF I;  4LF7 E;  4DV7 I;  5IT9 C;  3JAM C;  1QZR A;  1ZXN A;  1IBK I;  2UXD E;  2B3T B;  5L3J A;  5BR8 I;  3HTX A;  4DR7 E;  1XNR I;  1Z0E A;  3J81 C;  4ZVI A;  2DEJ A;  4X66 I;  1ZM4 A;  1QU6 A;  1PIE A;  4DR1 E;  3WU3 A;  4USM A;  4X64 I;  3T1Y I;  4FWD A;  1EI1 A;  2NUF A;  2L2K B;  4Z7Y A;  2WW4 A;  4OX9 I;  4B3S I;  3J7A G;  4USK A;  4M1K A;  4DV0 I;  2HHH E;  1B62 A;  3P1X A;  1FI4 A;  1ZM3 A;  2HFS A;  1XMO I;  4JI8 I;  5GMD A;  4NXM I;  1ZM2 A;  1B63 A;  4YHH I;  4LFC E;  3QT8 A;  4XTJ A;  4M2Z A;  1Z5A A;  4K0K E;  2RS7 A;  4DU8 A;  2UXC E;  4HYM A;  2E1R A;  1XMQ I;  2L2N A;  2ZM6 E;  1KKH A;  1N34 I;  4JI6 E;  3J7A M;  1PKP A;  4I3H A;  1VIS A;  5IWA E;  3J7Y p;  1XNQ I;  4DUZ E;  3PYE A;  2HKE A;  1Z0B A;  2UUC I;  4DV3 I;  2BV3 A;  3V5R A;  4FWH A;  4B3T E;  3C4B A;  4ED4 A;  2B7V A;  2DMY A;  3ADG A;  4DV4 I;  4LFB I;  1Z0G A;  3ZZU A;  1Z0T A;  4GKK I;  1H73 A;  4X65 I;  4KQV A;  3B8H A;  4LF4 I;  1H7S A;  1Z59 A;  2UXB I;  3V2U C;  5IT9 Q;  3JAM Q;  4DV6 E;  3WU4 A;  2V2Q A;  1RC7 A;  1N0U A;  4DUY I;  1HR0 E;  1N33 E;  4DXL A;  1PVG A;  4HY1 A;  4X62 I;  1ZBT A;  3ZKB A;  2BM1 A;  4DV1 I;  5GME A;  4DR6 E;  4DR3 I;  1EKZ A;  1N32 E;  1RRE A;  1D6T A;  1HNX I;  1HNZ E;  2X36 A;  4JI0 I;  4JI2 I;  3K17 A;  3K1J A;  1UEK A;  1Z0C A;  3ZZT A;  4JI7 I;  4R1F A;  1STU A;  4GKJ I;  1T4O A;  4B3R I;  4DPY A;  1FJG E;  1I94 I;  4RPF A;  4LF6 E;  4LFA E;  2V2V A;  3ZM7 A;  1H74 A;  2JY9 A;  4NXN I;  4JI4 I;  1H72 C;  2KHX A;  4X66 E;  2UU9 I;  2UUB I;  1UIL A;  1Z5C A;  1FWL A;  1N36 E;  2E5L E;  5A2Q Q;  3T1Y E;  2UUA E;  2LTS A;  2L33 A;  3Q1Q A;  1ZXM A;  1FKA E;  4B3S E;  2F4V I;  4DV2 E;  4PRX A;  2ZIT A;  4Z7C A;  4JI3 E;  2LJH A;  1XMO E;  1YZ9 A;  4JI8 E;  4KHP I;  2VQE I;  2CZ9 A;  4DR4 I;  4YHH E;  1U2R A;  5LMN E;  2R3V A;  1J5E I;  4JYA I;  4OOG C;  4WYQ B;  4P52 A;  2XEX A;  4JI5 I;  4YY3 E;  3VYY A;  3WU5 A;  4B3M E;  3LTO A;  2JVA A;  4JI1 I;  1YYK A;  4DV3 E;  4DPX A;  1DAR A;  2CPN A;  3ADJ A;  2R42 A;  2NUE A;  3M6A A;  4DR5 E;  1IBM I;  1FNM A;  1KVK A;  4LF5 I;  1A6F A;  4DV4 E;  1O0W A;  1BKN A;  5A2Q C;  4GKK E;  2UXD I;  1HNW I;  1Z0V A;  2LUQ A;  4DR7 I;  1WHN A;  1KIJ A;  2LJP A;  4HXZ A;  2V8P A;  5CFF E;  3WU6 A;  1HNX E;  4JI0 E;  1S16 A;  4JI2 E;  1IBL E;  2V34 A;  4JI7 E;  1YYO A;  1FWK A;  3OTO E;  2HFU A;  4GKJ E;  4LFC I;  1WUU A;  4K0K I;  4JV5 E;  2UXC I;  2ZM6 I;  4JI6 I;  2UUB E;  4LF8 I;  4WUB A;  1KTV A;  1N0V C;  4WUD A;  5FLX C;  3QT6 A;  4DPW A; 
#chains in the Genus database with same CATH topology
 2EM5 A;  1MG7 A;  2VQF E;  5LMU I;  2A2D A;  4DUZ I;  2JOB A;  4DV7 E;  5KL4 A;  2CSH A;  2J7K A;  3B82 A;  3H1C A;  2JYA A;  4BCA A;  4FWG A;  4GQU A;  2YTG A;  5IT9 Q;  2KON A;  4WFT A;  4UTG A;  1IBK E;  4LCH A;  5EKW A;  3ADL A;  1DQ3 A;  5A6B D;  2L3J A;  5BR8 E;  3JTZ A;  5F3W A;  2RTX A;  5FWK A;  4B3T I;  3C4T A;  4MLV A;  5A6K A;  2ELZ A;  2PNZ B;  4BC9 A;  1XNR E;  3AUZ A;  1MX0 A;  2MKD A;  5JEA E;  4MDT A;  1AAY A;  2BM0 A;  4HAC A;  4HTG A;  2C38 A;  5DRR A;  4KHP E;  2AE8 A;  4L8N A;  2EN3 A;  1SFE A;  4FW5 A;  4MYU A;  5C0X B;  1J5E E;  4JG4 A;  2DMI A;  2HK2 A;  1ZM9 A;  2MC5 A;  4R2A A;  3B78 A;  3T1H I;  2EM2 A;  2Z5B A;  2EPO A;  1X3C A;  4X64 E;  4PRV A;  4WUC A;  4I8O A;  1EH8 A;  2EM7 A;  4OX9 E;  4PU9 A;  1HR0 I;  1G2D C;  1N33 I;  2FGG A;  2N3G A;  1RQ0 A;  1UDO A;  3Q6N A;  4X9J A;  1IQO A;  1PJQ A;  5K36 C;  4DV0 E;  4TUI A;  4DR6 I;  2HC5 A;  3EPJ A;  2LUP B;  5T6J A;  2O3Z A;  2O1V A;  5C0X E;  1N32 I;  4URL A;  5AE1 A;  2B7T A;  4FN5 A;  4KWY A;  2BR2 A;  2YTE A;  3PYF A;  2GO4 A;  1Y60 A;  3HUL A;  4MLQ A;  1HNZ I;  4NXM E;  3BBG A;  3J80 C;  3HXL A;  3PYD A;  2NUG A;  4MU1 A;  1J26 A;  2YSP A;  1A1I A;  1YHC A;  3H4L A;  4M0V A;  5AC5 A;  3J80 Q;  2E1M A;  2LV2 A;  2AJ4 A;  1X6E A;  1XMQ E;  1Y5Y A;  3PS2 A;  1KYQ A;  2WNR B;  1N34 E;  2EOO A;  2LBS B;  4AQY I;  5K36 A;  1HNW E;  1FJG I;  4GZN C;  2EZ6 A;  1MU5 A;  4LCF A;  4LF6 I;  1XNQ E;  4LFA I;  1X47 A;  2EMA A;  4LF9 I;  2JXP A;  2LTR A;  2N3H A;  1RHY A;  4FK5 C;  4P78 A;  2UUC E;  4DKK A;  3QG5 C;  2Q8U A;  4MQY A;  3CDJ A;  5EL9 A;  4EMD A;  2EMG A;  1Z1B A;  3GCM A;  2RQL A;  4F6M A;  4IZK A;  4DV5 I;  1X49 A;  2MDR A;  4F9A B;  4U3D A;  4DR2 I;  2PO1 A;  1N36 I;  4R2P A;  4LF7 I;  2E5L I;  2JEA A;  4LFB E;  2EQ1 A;  4OO1 A;  3F6G A;  2WP8 B;  4NHR A;  1OJ4 A;  2UUA I;  4F6N A;  2L8T A;  2V2Z A;  4UT4 A;  2PO0 A;  2V8Q B;  2EL5 A;  2LVH A;  2WCC 3;  1NCS A;  4DV2 I;  4P7A A;  4F9B B;  4X65 E;  1T38 A;  2C37 A;  4LF4 E;  5FLX Q;  2EPZ A;  4OO1 B;  1PDA A;  2J65 A;  2ZBK B;  2UXB E;  4FW4 A;  3F0N A;  4JI3 I;  3ADI A;  2F1D A;  5K36 D;  1Z5B A;  4DUY E;  1YUI A;  4DPU A;  1YSA C;  1DI2 A;  4R03 A;  4LOM A;  1UHZ A;  4X62 E;  2A2C A;  4DV1 E;  3LLH A;  5A6A A;  4DR3 E;  1MEY C;  5LMN I;  2EM3 A;  4DR1 I;  2DB2 A;  4Q35 B;  1USV A;  5AE2 A;  4O43 A;  3FIG A;  4OO1 E;  2RS6 A;  4LF8 E;  4YY3 I;  4AM3 A;  1T4N A;  1UDQ A;  2M9A A;  2RSM A;  1ZU1 A;  3IWB A;  4B3M I;  2YPN A;  1T4L B;  3D4J A;  5LMU E;  2Q2E B;  1BBG A;  3L7Z B;  2VES A;  2YZT A;  2LRS A;  5LLQ A;  2YWQ A;  2IHR 1;  1RR9 A;  4ZYE A;  2HHH I;  2EMZ A;  4IFD C;  2PRT A;  2O1T A;  5KL5 A;  2NA2 A;  1K47 A;  4B3R E;  2EOJ A;  1Y6Z A;  1I94 E;  2HKJ A;  2VF3 A;  4AIM A;  2M1S A;  2OI2 A;  1NZ0 A;  2DEI A;  1GQE A;  4DR5 I;  4RHB B;  5A69 A;  2L2M A;  3GON A;  1JK2 A;  2EN6 A;  1GTK A;  2LO3 A;  2I13 A;  1EH7 A;  2X7I A;  3KWR A;  5DRQ A;  3EPL A;  3F6H A;  3M99 B;  4JI4 E;  4NXN E;  4LU9 A;  4R2Q A;  2UU9 E;  4DPT A;  3ZOQ B;  2F8B A;  1USU A;  2YT4 A;  1E3P A;  3C6K A;  3UHM A;  1R6M A;  3CWV A;  1X6F A;  5JEA B;  2BB8 A;  2B9D A;  2EPR A;  4M30 A;  3T1H E;  1A1F A;  4HEI A;  4IFD A;  2BA0 G;  5IWA I;  1WHQ A;  2EOX A;  1X48 A;  1IQS A;  2IOP A;  3MHS C;  4X8W A;  5DNX A;  2EPM X;  1NHI A;  2EM9 A;  2YRK A;  2CGE A;  2F4V E;  4MU3 A;  1TF6 A;  4FW7 A;  1YYW A;  1ELO A;  3TQM A;  2NPF A;  3PYG A;  3VYX A;  1S4E A;  1NHH A;  2IES A;  1XHK A;  2GS8 A;  2C39 A;  2YTD A;  3J81 Q;  5KL2 A;  5TSE A;  3ZZ0 A;  4KZS A;  2GHF A;  4ZYD A;  3QT5 A;  2EM4 A;  1UN6 B;  2MKN A;  4FW3 A;  2VQE E;  1Z0W A;  4DU7 A;  4DR4 E;  1WXR A;  5LL6 R;  1P42 A;  2DSY A;  1IBL I;  4MYT A;  3ECR A;  1X6H A;  2YTO A;  1XXE A;  3BGH A;  4JYA E;  3QT7 A;  4HAC B;  3PRY A;  3M85 D;  3ZKD A;  2EN7 A;  1ZBQ A;  2C38 B;  3HKM A;  2EN8 A;  2V83 A;  2L6M A;  3MSW A;  4JI5 E;  3OTO I;  2DIX A;  2DLQ A;  4DV6 I;  3CDI A;  4AQY E;  3THO B;  2V85 A;  2EPL X;  2N8X A;  4IFD D;  2ELY A;  1X5W A;  2HK3 A;  2Z5B B;  3LNU A;  4LF9 E;  4JI1 E;  3HJC A;  1NHJ A;  2HJJ A;  2L3C A;  4IS9 A;  1H7U A;  4FW9 A;  4JV5 I;  2EM0 A;  2EOS A;  2LMZ A;  2EPC A;  3P3E A;  1EA6 A;  2YTP A;  2EMX A;  4ZYH A;  3LPS A;  4WUD A;  5IV8 B;  2EFG A;  2EOZ A;  3L00 A;  4DV5 E;  1IBM E;  2NN6 C;  3DD6 A;  4LF5 E;  4DR2 E;  1YFH A;  5AAS A;  2VQF I;  2EE8 A;  4LF7 E;  1A1H A;  4DV7 I;  5IT9 C;  2K7I A;  3JAM C;  2EML A;  2JWO A;  2BR2 B;  2GO3 A;  3P3G A;  2EOE A;  4DMI A;  5JEA F;  2GLI A;  1QZR A;  4P7D A;  2CVE A;  1ZXN A;  2EMK A;  1IBK I;  2UXD E;  1VI7 A;  1OYS A;  2B3T B;  2A25 A;  2R1F A;  5L3J A;  5BR8 I;  3HTX A;  2YRH A;  4DR7 E;  2PNM A;  4WSP A;  4R2R A;  1XNR I;  1Z0E A;  2PO2 A;  3J81 C;  4ZVI A;  5K36 B;  2DEJ A;  4MU0 A;  2NN6 A;  1F2I G;  3K6Q A;  1BB8 A;  2BA1 D;  4X66 I;  1ZM4 A;  1QU6 A;  1PIE A;  2JT2 A;  2EMC A;  2EMI A;  2EMW A;  2EOM A;  2J7J A;  4DR1 E;  2IER A;  4IZJ A;  3WU3 A;  2BA0 D;  4USM A;  4X64 I;  3T1Y I;  4FWD A;  1EI1 A;  5C0X F;  2NUF A;  2L2K B;  2YTF A;  1TN9 A;  4Z7Y A;  2CG9 A;  2WW4 A;  4OX9 I;  4B3S I;  3J7A G;  4IZK B;  5K36 E;  2EWL A;  2YU5 A;  3M85 G;  4USK A;  2PO1 B;  2YTQ A;  1A1G A;  4M1K A;  4DV0 I;  2JEA B;  2HHH E;  2IOQ A;  2EPN A;  4WPY A;  3HPS A;  2LJU A;  3P1X A;  1B62 A;  1FI4 A;  2PO0 B;  1ZM3 A;  2HFS A;  2VRD A;  1XMO I;  4JI8 I;  2NN6 E;  5AC4 A;  5GMD A;  4NXM I;  1ZM2 A;  2C37 B;  1B63 A;  2Z5C A;  4YHH I;  4LFC E;  3QT8 A;  4XTJ A;  4M2Z A;  1Z5A A;  2Z5E A;  4K0K E;  2EOY A;  2RS7 A;  4LPF A;  4DU8 A;  1UDN A;  2UXC E;  2EPP A;  2CT1 A;  2E1R A;  4HYM A;  2NN6 D;  1XMQ I;  2EN4 A;  2L2N A;  2ZM6 E;  1KKH A;  1N34 I;  4JI6 E;  2Z5C B;  3J7A M;  1PKP A;  2ENA A;  2ODR C;  4I3H A;  1VIS A;  2EOF A;  3JU0 A;  2YRM A;  5IWA E;  4IZJ D;  3J7Y p;  1XNQ I;  4DUZ E;  3PYE A;  2HKE A;  1Z0B A;  5A6J A;  4TUG A;  1WJP A;  2UUC I;  1G2F C;  3U1K A;  4DV3 I;  2ADR A;  1A1L A;  2BV3 A;  1P47 A;  2JE6 A;  2V86 A;  1E3H A;  3P06 A;  3V5R A;  2YTI A;  4FWH A;  4B3T E;  3C4B A;  4ED4 A;  2EM8 A;  1YH8 A;  5K36 F;  1OYR A;  2B7V A;  2EM6 A;  2DMY A;  2KOU A;  3ADG A;  4R8O A;  4RH8 A;  4BA1 A;  3BID A;  4DV4 I;  5JEA C;  4LFB I;  2BA1 G;  1Z0G A;  4O4K A;  2WBS A;  3ZZU A;  2LCE A;  1Z0T A;  4R2D A;  4WSG A;  3LML A;  1SR9 A;  4GKK I;  1H73 A;  4IFD B;  4BA1 B;  4X65 I;  4KQV A;  3B8H A;  4LF4 I;  4R2C A;  3OML A;  1H7S A;  1Z59 A;  3BF2 A;  2UXB I;  2O1U A;  2O1W A;  3V2U C;  2VF1 A;  3KZZ A;  3JAM Q;  2JOX A;  4DV6 E;  4OZE A;  2EQ3 A;  1UDS A;  2V2Q A;  3WU4 A;  1RC7 A;  2EOH A;  1N0U A;  4DUY I;  1HR0 E;  1N33 E;  2I9I A;  1PJS A;  4DXL A;  4OO1 F;  3KZY A;  1PVG A;  4HY1 A;  4X62 I;  1ZBT A;  2MC6 A;  2BM1 A;  3ZKB A;  4DV1 I;  1ZAA C;  4R2S A;  3NZK A;  4DR6 E;  2EPA A;  5GME A;  4DR3 I;  5ADZ A;  1EKZ A;  1N32 E;  5C0X C;  4BC7 A;  4BBY A;  5KL7 A;  1RRE A;  1HNX I;  1D6T A;  1HNZ E;  3H09 A;  2X36 A;  2DLK A;  3VHT B;  4JI0 I;  2E72 A;  2EOQ A;  4JI2 I;  3K17 A;  3K1J A;  1UEK A;  2MDG A;  1Z0C A;  4R2E A;  2C39 B;  3ZZT A;  4JI7 I;  3MHH C;  2JEB A;  2ODR D;  4IFD E;  2PNZ A;  3M7N D;  2HGH A;  4R1F A;  2EMB A;  2WBT A;  1STU A;  4GKJ I;  4O5G A;  1T4O A;  4B3R I;  2M7Q A;  5AE3 A;  1TF3 A;  1FJG E;  4J3D A;  4DPY A;  1I94 I;  4BS9 A;  4RPF A;  4LF6 E;  4LFA E;  2JEB B;  2L92 A;  2ENC A;  4BHC A;  5C0X A;  3VK6 A;  3EPK A;  2V2V A;  3ZM7 A;  1H74 A;  2JY9 A;  1QNT A;  2M4I A;  4NXN I;  4JI4 I;  1H72 C;  2KHX A;  4X66 E;  2UU9 I;  1DGC A;  3C6M A;  3GLL A;  2UUB I;  5JEA D;  2V88 A;  2YU8 A;  2GPI A;  2D9H A;  1UIL A;  1Z5C A;  5DRP A;  1N36 E;  1FWL A;  2EOI A;  2E5L E;  5A2Q Q;  3T1Y E;  1IMU A;  5DNY A;  5DNL A;  4GEQ B;  1YUJ A;  2UUA E;  2LTS A;  2L33 A;  3Q1Q A;  1ZXM A;  1FKA E;  4B3S E;  2F4V I;  1MGT A;  1OYP A;  4DV2 E;  4PRX A;  2WZO A;  1LLM C;  4ISA A;  2ZIT A;  4Z7C A;  2G7H A;  5KL3 A;  1A1J A;  4JI3 E;  5ELW A;  2LJH A;  4IFD F;  4F54 A;  1XMO E;  1YZ9 A;  4JI8 E;  4KHP I;  4BHB A;  2VQE I;  2CZ9 A;  1GZ6 A;  2EOR A;  2WNR A;  4DR4 I;  4YHH E;  1U2R A;  4ZYG A;  5C0X D;  2VE7 C;  5LMN E;  4N4R B;  2R3V A;  3K85 A;  1J5E I;  4JYA I;  2PO2 B;  2LT7 A;  4OOG C;  4WYQ B;  5KL6 A;  3P76 A;  4P52 A;  2XEX A;  3PS1 A;  2NN6 B;  2V87 A;  4JI5 I;  4YY3 E;  2CTD A;  4QNK A;  2EMY A;  2EP3 A;  4OO1 C;  3THN A;  1UBD C;  1AH5 A;  3VYY A;  4B3M E;  3LTO A;  3WU5 A;  4QNJ A;  2EMH A;  1HK7 A;  4IZJ B;  2JVA A;  4JI1 I;  2GQ0 A;  3M7N G;  1YYK A;  3AV0 A;  1A1K A;  4F9C B;  4DV3 E;  4FW6 A;  4DPX A;  1DAR A;  3EQ1 A;  2CPN A;  3ADJ A;  2EPU A;  2NUE A;  2R42 A;  2WP8 A;  2EQ0 A;  3M6A A;  3Q6M A;  2ENH A;  4U3B A;  1YPN A;  3HQ1 A;  4DR5 E;  2JPA A;  1PJT A;  1FNM A;  1KVK A;  1IBM I;  4LF5 I;  2EPK X;  1A6F A;  4DV4 E;  1O0W A;  4NBQ A;  1BKN A;  1EH6 A;  5A2Q C;  2EJ4 A;  3RMP A;  4IS1 C;  3B4T A;  2R76 A;  2YSO A;  4GKK E;  2UXD I;  2EPX A;  4BA2 A;  1HNW I;  2LE2 A;  4J8Z A;  1Z0V A;  2PNL A;  2LUQ A;  4DR7 I;  3HPZ A;  1WHN A;  1KIJ A;  2LJP A;  2YTN A;  1ZR9 A;  4BA2 B;  3P3C A;  3U1Y A;  3DJW A;  4O24 A;  4IJD A;  1RMD A;  4HXZ A;  4N3O A;  1N3G A;  2DGC A;  3GME A;  2FTX B;  2EL4 A;  4NZV A;  3EPH A;  2V8P A;  5CFF E;  4Q28 A;  3L7Z A;  4F2J C;  2JP9 A;  4MU4 A;  3WU6 A;  1HNX E;  4M9V C;  1Y4U A;  2JE6 B;  2WBU A;  2EN1 A;  3KRN A;  1R6L A;  4JI0 E;  2RPC A;  4JI2 E;  1S16 A;  1IBL E;  3DF6 A;  4WX9 A;  5DRO A;  1B69 A;  3IWD A;  4AID A;  2V34 A;  5A6B A;  2NN6 F;  2BBG A;  4JI7 E;  1T39 A;  1YYO A;  2EN2 A;  1L4S A;  4OO1 D;  1FWK A;  4BMJ A;  5IXM B;  3OTO E;  2HFU A;  4L5N C;  2RSI A;  4GKJ E;  2K4V A;  1KJK A;  1NEI A;  1WRJ A;  1Y4S A;  2FV4 B;  3PS3 A;  4LFC I;  1WUU A;  5JEA A;  4K0K I;  2EMF A;  4LCG A;  1JK1 A;  2V89 A;  4JV5 E;  4WXD A;  2JR1 A;  2UXC I;  3IWC A;  2DRP A;  2NAB A;  2H36 X;  3UK3 C;  2ZM6 I;  4JI6 I;  2UUB E;  4LF8 I;  4LTY A;  4WXC A;  4OKG A;  4WUB A;  2EL6 A;  2YTJ A;  1KTV A;  1N0V C;  1BBO A;  5FLX C;  3QT6 A;  4DPW A; 
#chains in the Genus database with same CATH homology
 1MG7 A;  2VQF E;  5LMU I;  2A2D A;  4DUZ I;  2JOB A;  4DV7 E;  2J7K A;  3B82 A;  4BCA A;  4FWG A;  2KON A;  4WFT A;  4UTG A;  1IBK E;  3ADL A;  1DQ3 A;  2L3J A;  5BR8 E;  3JTZ A;  5F3W A;  2RTX A;  5FWK A;  4B3T I;  3C4T A;  4BC9 A;  1XNR E;  3AUZ A;  1MX0 A;  2BM0 A;  4HAC A;  4KHP E;  4L8N A;  4MYU A;  1J5E E;  4JG4 A;  3B78 A;  2HK2 A;  1ZM9 A;  2MC5 A;  3T1H I;  2Z5B A;  4X64 E;  4PRV A;  4WUC A;  4I8O A;  4OX9 E;  4PU9 A;  1HR0 I;  1N33 I;  2FGG A;  2N3G A;  1RQ0 A;  3Q6N A;  4DV0 E;  4TUI A;  4DR6 I;  2LUP B;  5T6J A;  2O1V A;  1N32 I;  4URL A;  5AE1 A;  2B7T A;  4FN5 A;  3PYF A;  3HUL A;  1HNZ I;  4NXM E;  3J80 C;  3HXL A;  3PYD A;  2NUG A;  1J26 A;  3H4L A;  4M0V A;  2E1M A;  2AJ4 A;  1XMQ E;  1N34 E;  2LBS B;  4AQY I;  1HNW E;  1FJG I;  2EZ6 A;  1MU5 A;  4LF6 I;  4LFA I;  1XNQ E;  1X47 A;  4LF9 I;  2LTR A;  2N3H A;  4P78 A;  2UUC E;  4DKK A;  4EMD A;  4IZK A;  4DV5 I;  1X49 A;  2MDR A;  4F9A B;  4DR2 I;  1N36 I;  4LF7 I;  2E5L I;  4LFB E;  3F6G A;  1OJ4 A;  2UUA I;  4UT4 A;  2L8T A;  2V2Z A;  2V8Q B;  4DV2 I;  4P7A A;  4F9B B;  4X65 E;  5FLX Q;  4LF4 E;  2ZBK B;  2UXB E;  3F0N A;  4JI3 I;  3ADI A;  1Z5B A;  4DUY E;  4DPU A;  1DI2 A;  4R03 A;  1UHZ A;  4X62 E;  2A2C A;  4DV1 E;  3LLH A;  4DR3 E;  5LMN I;  4DR1 I;  2DB2 A;  1USV A;  5AE2 A;  3FIG A;  2RS6 A;  4LF8 E;  4YY3 I;  1T4N A;  2RSM A;  3IWB A;  4B3M I;  1T4L B;  3D4J A;  5LMU E;  2Q2E B;  2YZT A;  2LRS A;  1RR9 A;  2IHR 1;  2HHH I;  2O1T A;  2NA2 A;  1K47 A;  4B3R E;  1Y6Z A;  2VF3 A;  1I94 E;  2HKJ A;  2M1S A;  2OI2 A;  1NZ0 A;  2DEI A;  1GQE A;  4DR5 I;  2L2M A;  3GON A;  2X7I A;  3KWR A;  3F6H A;  4NXN E;  4JI4 E;  4LU9 A;  2UU9 E;  4DPT A;  3ZOQ B;  2F8B A;  1USU A;  2YT4 A;  3J80 Q;  3CWV A;  4M30 A;  2B9D A;  3T1H E;  5IWA I;  1WHQ A;  1X48 A;  2IOP A;  4X8W A;  1NHI A;  2CGE A;  2F4V E;  1YYW A;  1ELO A;  2NPF A;  3PYG A;  3VYX A;  1S4E A;  1NHH A;  1XHK A;  2GS8 A;  3J81 Q;  3ZZ0 A;  4KZS A;  3QT5 A;  4DU7 A;  2VQE E;  1Z0W A;  4DR4 E;  1WXR A;  5LL6 R;  2DSY A;  1IBL I;  4MYT A;  4JYA E;  3QT7 A;  4HAC B;  3PRY A;  3ZKD A;  1ZBQ A;  2V83 A;  3MSW A;  2L6M A;  3OTO I;  4JI5 E;  2DIX A;  4DV6 I;  4AQY E;  2V85 A;  2Z5B B;  2HK3 A;  3LNU A;  4LF9 E;  4JI1 E;  3HJC A;  1NHJ A;  2L3C A;  1H7U A;  4FW9 A;  4JV5 I;  2LMZ A;  1EA6 A;  3LPS A;  2EFG A;  4DV5 E;  1IBM E;  4LF5 E;  4DR2 E;  5AAS A;  2VQF I;  4LF7 E;  4DV7 I;  5IT9 C;  3JAM C;  2JWO A;  4DMI A;  1QZR A;  4P7D A;  1ZXN A;  1IBK I;  2UXD E;  2B3T B;  5L3J A;  5BR8 I;  3HTX A;  4DR7 E;  2PNM A;  4WSP A;  1XNR I;  1Z0E A;  3J81 C;  4ZVI A;  2DEJ A;  3K6Q A;  4X66 I;  1ZM4 A;  1QU6 A;  1PIE A;  4IZJ A;  4DR1 E;  3WU3 A;  4USM A;  4X64 I;  3T1Y I;  4FWD A;  1EI1 A;  2NUF A;  2L2K B;  4Z7Y A;  2CG9 A;  2WW4 A;  4OX9 I;  4B3S I;  3J7A G;  4IZK B;  2EWL A;  4USK A;  4M1K A;  4DV0 I;  2HHH E;  2IOQ A;  4WPY A;  3HPS A;  3P1X A;  1B62 A;  1FI4 A;  1ZM3 A;  2HFS A;  1XMO I;  4JI8 I;  5GMD A;  4NXM I;  1ZM2 A;  1B63 A;  2Z5C A;  4YHH I;  4LFC E;  3QT8 A;  4XTJ A;  4M2Z A;  1Z5A A;  2Z5E A;  4K0K E;  2RS7 A;  4DU8 A;  2UXC E;  4HYM A;  2E1R A;  1XMQ I;  2L2N A;  2ZM6 E;  1KKH A;  1N34 I;  4JI6 E;  2Z5C B;  3J7A M;  1PKP A;  2ODR C;  4I3H A;  1VIS A;  3JU0 A;  5IWA E;  4IZJ D;  3J7Y p;  1XNQ I;  4DUZ E;  3PYE A;  2HKE A;  1Z0B A;  4TUG A;  2UUC I;  4DV3 I;  2BV3 A;  2V86 A;  3P06 A;  3V5R A;  4FWH A;  4B3T E;  3C4B A;  4ED4 A;  2B7V A;  2DMY A;  2KOU A;  3ADG A;  4R8O A;  4DV4 I;  4LFB I;  1Z0G A;  3ZZU A;  1Z0T A;  3LML A;  1SR9 A;  4GKK I;  1H73 A;  4X65 I;  4KQV A;  3B8H A;  4LF4 I;  3OML A;  1H7S A;  1Z59 A;  2UXB I;  2O1U A;  2O1W A;  3V2U C;  2VF1 A;  3JAM Q;  5IT9 Q;  2JOX A;  4DV6 E;  3WU4 A;  2V2Q A;  1RC7 A;  1N0U A;  4DUY I;  1HR0 E;  1N33 E;  4DXL A;  1PVG A;  4HY1 A;  4X62 I;  1ZBT A;  2MC6 A;  2BM1 A;  3ZKB A;  4DV1 I;  5GME A;  4DR6 E;  4DR3 I;  5ADZ A;  1EKZ A;  1N32 E;  4BC7 A;  4BBY A;  1RRE A;  1HNX I;  1D6T A;  1HNZ E;  3H09 A;  2X36 A;  4JI0 I;  4JI2 I;  3K17 A;  3K1J A;  1UEK A;  1Z0C A;  3ZZT A;  4JI7 I;  2ODR D;  4R1F A;  1STU A;  4GKJ I;  1T4O A;  4B3R I;  2M7Q A;  5AE3 A;  1FJG E;  4DPY A;  1I94 I;  4BS9 A;  4RPF A;  4LF6 E;  4LFA E;  2L92 A;  3VK6 A;  2V2V A;  3ZM7 A;  1H74 A;  2JY9 A;  2M4I A;  4NXN I;  4JI4 I;  1H72 C;  2KHX A;  4X66 E;  2UU9 I;  2UUB I;  2V88 A;  1UIL A;  1Z5C A;  1FWL A;  1N36 E;  2E5L E;  5A2Q Q;  3T1Y E;  5DNY A;  4GEQ B;  2UUA E;  2LTS A;  2L33 A;  3Q1Q A;  1ZXM A;  1FKA E;  4B3S E;  2F4V I;  4DV2 E;  4PRX A;  2WZO A;  2ZIT A;  4Z7C A;  2G7H A;  4JI3 E;  2LJH A;  4F54 A;  1XMO E;  1YZ9 A;  4JI8 E;  4KHP I;  2VQE I;  2CZ9 A;  1GZ6 A;  4DR4 I;  4YHH E;  1U2R A;  2VE7 C;  5LMN E;  2R3V A;  1J5E I;  3K85 A;  4JYA I;  4OOG C;  4WYQ B;  4P52 A;  2XEX A;  2V87 A;  4JI5 I;  4YY3 E;  3VYY A;  3WU5 A;  4B3M E;  3LTO A;  1HK7 A;  4IZJ B;  2JVA A;  4JI1 I;  2GQ0 A;  1YYK A;  3AV0 A;  4F9C B;  4DV3 E;  4DPX A;  1DAR A;  2CPN A;  3ADJ A;  2R42 A;  2NUE A;  3M6A A;  3Q6M A;  3HQ1 A;  4DR5 E;  1IBM I;  1FNM A;  1KVK A;  4LF5 I;  1A6F A;  4DV4 E;  1O0W A;  1BKN A;  5A2Q C;  3RMP A;  4GKK E;  2UXD I;  1HNW I;  2LE2 A;  4J8Z A;  1Z0V A;  2PNL A;  2LUQ A;  4DR7 I;  3HPZ A;  1WHN A;  1KIJ A;  2LJP A;  3DJW A;  4HXZ A;  4N3O A;  2FTX B;  2V8P A;  5CFF E;  4Q28 A;  3WU6 A;  1HNX E;  1Y4U A;  4JI0 E;  1S16 A;  4JI2 E;  1IBL E;  3DF6 A;  3IWD A;  2V34 A;  4JI7 E;  1YYO A;  1FWK A;  4BMJ A;  3OTO E;  2HFU A;  4L5N C;  4GKJ E;  2K4V A;  1Y4S A;  2FV4 B;  4LFC I;  1WUU A;  4K0K I;  4JV5 E;  2V89 A;  2UXC I;  2JR1 A;  3IWC A;  2H36 X;  2ZM6 I;  4JI6 I;  2UUB E;  4LF8 I;  4LTY A;  4WUB A;  1KTV A;  1N0V C;  4WUD A;  5FLX C;  3QT6 A;  4DPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...