4DV5E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5E02
2RS6A 3ZZUA 4P52A 4DKKA 4JI4I 4GKJE 1H7SA 1GQEA 2OI2A 2NUGA 1ZM9A 4OX9I 4LF9E 3J81Q 3CWVA 1IBMI 3J7AM 2BV3A 1Z5AA 4DV5I 2RS7A 4LF5E 2VF3A 5GMDA 4LFAI 2V2QA 1Z0GA 4FWHA 1OJ4A 1N34E 4KHPE 1N0UA 4WUCA 3WU4A 1J5EE 5IWAI 4B3ME 2R3VA 4YY3I 2DMYA 1NHIA 3M6AA 1ZXNA 1YYWA 4JI6I 4DUYE 4PRXA 1Z0WA 2MDRA 1Z0EA 2EFGA 1XNRI 3B78A 4K0KE 4USKA 1IBKI 4USMA 4X62I 4Z7CA 2UXDE 4R1FA 1FWKA 4HXZA 4JI0I 2UXBI 1PKPA 2HK3A 1RREA 4DPUA 2UUBI 4DR5E 1U2RA 2LJPA 4JI2I 4MYTA 2VQEE 4HACA 4B3SI 3ZZ0A 2VQFI 3ZKBA 4GKKI 4DR2I 3ADLA 3Q1QA 3JAMC 4JI6E 3LPSA 2HFUA 2V34A 3PYFA 2UUAE 1I94E 4Z7YA 4B3RE 1Z5CA 1QZRA 3PYGA 3T1HI 4M2ZA 1H74A 5A2QC 4DR3I 4DR4I 4JI3I 3J80Q 4DR7E 1XHKA 3QT6A 1WUUA 4M1KA 4GKJI 4DV7E 1FI4A 4LF9I 2NUFA 3QT5A 2X7IA 4YHHE 1FKAE 1RC7A 2LTSA 4DUZE 4DV0E 3F0NA 4LF5I 1NZ0A 2NUEA 4DPWA 5BR8E 2UUCE 1Z0BA 2LBSB 4PRVA 1N34I 4KHPI 1J5EI 4B3MI 2N3GA 3C4BA 2WW4A 1HR0E 3K1JA 2IHR1 3D4JA 2DIXA 4DUYI 4DV1E 4K0KI 4FWDA 2V2VA 2UXDI 1A6FA 3GONA 1YYOA 2L2MA 2J7KA 3QT7A 1N0VC 2XEXA 1B62A 2B7TA 2KHXA 2BM1A 2F4VE 3QT8A 4DR5I 1EA6A 2VQEI 4PU9A 1ELOA 2CPNA 4JI8E 4NXME 4LFCE 1S4EA 2E5LE 2A2CA 1KVKA 1ZBTA 2RTXA 2UUAI 1I94I 4DPXA 4B3RI 3ZKDA 4DV6E 3WU5A 2HHHE 3JAMQ 1HNWE 4JG4A 4M30A 2UXCE 1J26A 1XMQE 1MG7A 1PIEA 4FWGA 4X64E 4DR7I 5LMUE 4DXLA 4RPFA 1IBLE 5A2QQ 1RR9A 4DV7I 3PYEA 4LF6E 4UT4A 4HYMA 1ZM2A 4YHHI 2V8PA 4DUZI 4DV0I 1FJGE 5CFFE 1N36E 4DV3E 5BR8I 1MU5A 2UUCI 4AQYE 1ZM4A 1UHZA 2LRSA 4HY1A 2A2DA 1HR0I 1HNZE 4JI1I 1EKZA 5LL6R 4LFBE 4NXNI 1ZXMA 4DV1I 3V2UC 3H4LA 3WU3A 4FW9A 1FNMA 2DEJA 3B8HA 1ZM3A 1N32E 2L2KB 5L3JA 4X65E 1VISA 3LLHA 2NA2A 4UTGA 2L3JA 3OTOE 4DR6E 1QU6A 4DPTA 2E1RA 5IT9C 2F4VI 2YT4A 4WUDA 2B3TB 2L33A 4P7AA 4JI8I 4NXMI 4LFCI 1H7UA 2E5LI 1X49A 4JI1E 1STUA 4ED4A 3P1XA 4X8WA 1N33E 4JI5E 4DV2E 5LMNE 4JYAE 4NXNE 2BM0A 2LJHA 4DV6I 3ZM7A 3V5RA 2HHHI 1B63A 1HNWI 2V2ZA 4LF8E 3J7Yp 1O0WA 2UXCI 3T1YE 1XMQI 3LTOA 1WHNA 4LF4E 4X64I 4WUBA 4LF7E 2B7VA 5LMUI 1XNQE 2CZ9A 1IBLI 2HKEA 2GS8A 4ZVIA 4LF6I 2LUPB 4DU8A 1EI1A 1FWLA 1UEKA 3ZZTA 1K47A 1T4LB 1XMOE 2DB2A 4JI7E 2L2NA 4WYQB 5FLXC 1FJGI 4KQVA 4DV4E 2ZM6E 2L3CA 4B3TE 1N36I 4DV3I 2N3HA 4JV5E 4AQYI 1X48A 1DI2A 2ZBKB 3ADGA 1HNXE 4DR1E 2JY9A 2ZITA 2RSMA 1HNZI 2UU9E 4X66E 3J81C 1MX0A 4HACB 4JI4E 4LFBI 1UILA 4OX9E 1KIJA 3VYXA 1IBME 1Z0CA 1N32I 1KTVA 4DV5E 3VYYA 1Z0TA 3K17A 4X65I 2EZ6A 4URLA 2AJ4A 1Z59A 4LFAE 3OTOI 4DR6I 1YYKA 2JVAA 2R42A 2DEIA 5IWAE 3B82A 1RQ0A 2NPFA 1KKHA 4YY3E 5GMEA 1NHHA 4DU7A 3J7AG 5IT9Q 1N33I 1BKNA 4DPYA 4JI5I 4DV2I 5LMNI 4JYAI 3HULA 4FN5A 4MYUA 1XNRE 1WHQA 1NHJA 1IBKE 4X62E 1D6TA 4OOGC 1Z0VA 4LF8I 3ADIA 4EMDA 4I3HA 3ADJA 4JI0E 2UXBE 3C4TA 3T1YI 4LF4I 1DARA 2Q2EB 4LF7I 2HFSA 2UUBE 3PYDA 1XNQI 1X47A 4JI2E 4B3SE 2VQFE 1YZ9A 3LNUA 4WFTA 1S16A 4GKKE 4DR2E 1H73A 3HTXA 2X36A 1XMOI 4JI7I 2HKJA 1H72C 4XTJA 4DV4I 2ZM6I 4B3TI 3T1HE 2HK2A 1T4NA 4JV5I 1PVGA 3J80C 2LUQA 1T4OA 3WU6A 2LTRA 5FLXQ 1HNXI 4DR3E 4DR1I 4DR4E 1Z5BA 2UU9I 4JI3E 4X66I
chains in the Genus database with same CATH superfamily
2RS6A 3ZZUA 4P52A 4DKKA 4JI4I 3FIGA 5AE2A 4GKJE 1H7SA 3P76A 1GQEA 1ZM9A 2NUGA 2OI2A 4OX9I 2K7IA 4LF9E 5K36F 2YTDA 2PRTA 4U3BA 2E72A 2WP8B 2YU8A 3CWVA 3J81Q 1IBMI 3J7AM 2J65A 2EL5A 2C37B 2ENAA 2HC5A 1Z5AA 2BV3A 4MU3A 4DV5I 2RS7A 5AE1A 4O4KA 4DMIA 1R6LA 4LF5E 3IWBA 2VF3A 1X6EA 4LPFA 4TUIA 5LLQA 5GMDA 2EMBA 2VF1A 4LFAI 2EL6A 2V2QA 2EOIA 4BA2A 2M9AA 1Z0GA 4FWHA 4F2JC 1OJ4A 1A1KA 1N34E 4KHPE 1N0UA 4WUCA 4F9AB 3P3CA 1J5EE 3WU4A 5IWAI 4B3ME 4LU9A 3AV0A 2GLIA 2WNRB 2R3VA 4YY3I 3ECRA 2JWOA 1HK7A 2DMYA 1NHIA 1PJSA 5IT9Q 2YRHA 3M6AA 2ELZA 1ZXNA 1YYWA 4JI6I 1T39A 4R2EA 4DUYE 2A25A 2YPNA 1YSAC 2MDRA 1Z0WA 4PRXA 4OO1A 1Z0EA 2EFGA 4R03A 2MC5A 1XNRI 2MDGA 2EORA 4L8NA 4K0KE 3B78A 4NBQA 4USKA 4MLVA 4USMA 4X62I 1IBKI 3F6HA 5F3WA 2WBSA 4LCGA 2MC6A 2E1MA 4Z7CA 2UXDE 4P78A 1FWKA 1A1GA 4HXZA 3DF6A 1YH8A 4FW6A 4R1FA 2JXPA 3VK6A 5DNXA 4JI0I 2UXBI 5KL4A 2FV4B 1PKPA 5DRRA 1PDAA 1KJKA 1AH5A 2V85A 2HK3A 2O1UA 2YTOA 1RREA 3K85A 2LO3A 2GQ0A 2EM4A 4N3OA 3DJWA 2VE7C 4OO1C 4DPUA 3Q6NA 2UUBI 2EPOA 2YWQA 4DR5E 1U2RA 2IOQA 4X9JA 1TF3A 2LJPA 1Y60A 4MYTA 5JEAB 3EPLA 2VQEE 2YTNA 1USVA 4HACA 4B3SI 3ZZ0A 2YTEA 2VQFI 4IFDB 5C0XE 5K36D 3ZKBA 4ZYHA 5C0XB 3L00A 4IS9A 4GKKI 1YUIA 4R2AA 4DR2I 3ADLA 4AIMA 3Q1QA 3JAMC 4JI6E 2PNMA 3LPSA 3M85D 4BHCA 1BB8A 2HFUA 2V34A 4FW5A 3PYFA 3AUZA 1G2FC 2HGHA 1I94E 2UUAE 4Z7YA 3M85G 4B3RE 1Z5CA 2WBUA 1YUJA 5A6BA 1QZRA 3PYGA 3T1HI 4BC9A 4M2ZA 1H74A 3BBGA 2B9DA 5A2QC 2Z5CB 4LOMA 4MLQA 4ZYDA 4DR3I 4KZSA 4DR4I 5ADZA 2EPMX 4JI3I 5TSEA 1QNTA 3J80Q 4IZJB 4DR7E 1XHKA 2L8TA 2LE2A 4MU4A 3QT6A 1USUA 1WUUA 4M1KA 4GKJI 4DV7E 1FI4A 2KOUA 1P47A 3KZYA 2NUFA 4LF9I 1WXRA 2EOMA 4J8ZA 1TN9A 2EMXA 3QT5A 2EN3A 2X7IA 4YHHE 1FKAE 2PNZB 1RC7A 2EMFA 2D9HA 2LTSA 2NN6A 4DUZE 4DV0E 2IERA 1A1JA 1MGTA 3F0NA 2EMIA 3M7ND 2NN6F 4LF5I 4U3DA 4Q28A 1NZ0A 2NUEA 4DPWA 3P06A 2R1FA 3HXLA 2GO3A 5BR8E 2UUCE 2EOEA 4WPYA 3RMPA 1Z0BA 2YTJA 2DMIA 2LBSB 4PRVA 5IV8B 1N34I 4KHPI 2CVEA 4BC7A 1J5EI 4B3MI 2N3GA 3EPKA 3C4BA 2EQ1A 5IXMB 1HR0E 2O3ZA 2WW4A 3HKMA 5A6KA 3K1JA 1G2DC 4F9CB 2IHR1 3D4JA 2O1VA 1EH6A 2PO0A 2DIXA 4DUYI 4QNJA 5K36A 4P7DA 4DV1E 2RSIA 3JU0A 5KL6A 5A6AA 4K0KI 4FWDA 3BIDA 4O5GA 2V2VA 5A6BD 5EL9A 3THOB 2YZTA 2UXDI 3KRNA 2EJ4A 1A6FA 3GONA 2EOJA 1YYOA 2BR2A 3CDJA 4ISAA 2EM6A 2L2MA 2J7KA 3QT7A 1LLMC 1N0VC 2XEXA 1B62A 4IS1C 2PO2B 4HTGA 5T6JA 4IZKA 2EMLA 3U1YA 5K36C 2B7TA 2KHXA 1Y4UA 2BM1A 2EM2A 4M9VC 2F4VE 3QT8A 4QNKA 4DR5I 2M7QA 3HPSA 2H36X 3LMLA 1EA6A 4MU1A 2VQEI 3MSWA 2EMAA 4PU9A 1ELOA 2R76A 2EN7A 2YRMA 1JK2A 2CPNA 4JI8E 4NXME 4LFCE 4R2RA 1S4EA 2E5LE 2JEBB 2DGCA 2WP8A 2LCEA 4OO1B 3UK3C 2I13A 2ELYA 3F6GA 2A2CA 2C37A 1KVKA 2NN6D 1ZBTA 2RTXA 4MU0A 2UUAI 1I94I 3EPHA 2EPUA 2LJUA 4DPXA 3OMLA 3ZKDA 4B3RI 4GEQB 4N4RB 4HEIA 4DV6E 3WU5A 2KONA 2HHHE 3PS2A 3JAMQ 3MHSC 4WXDA 1HNWE 4JG4A 2M1SA 4M30A 2I9IA 2UXCE 5KL5A 2JE6B 2EMYA 2PO1B 1J26A 1SR9A 2EE8A 1XMQE 4BHBA 1MG7A 1PIEA 5DRPA 4FWGA 2EPAA 4X64E 2EPXA 2CG9A 2EM9A 2EMHA 4DR7I 2L92A 3EQ1A 5LMUE 5JEAE 4DXLA 2F1DA 4RPFA 3UHMA 4FW4A 4BA1B 2EN1A 1IBLE 2IOPA 2O1WA 1RR9A 2EN6A 2N8XA 5A2QQ 4DV7I 1MEYC 2YTFA 2MKDA 3PYEA 2JEAA 4IFDE 2GHFA 4LF6E 4UT4A 4J3DA 5DROA 5AASA 4HYMA 1OYRA 5AC4A 2V88A 4I8OA 4O24A 1ZM2A 4YHHI 1OYPA 3KZZA 1Y5YA 2V8PA 4Q35B 4DUZI 4DV0I 5EKWA 2CT1A 2EM7A 1A1HA 2EPKX 4GQUA 1FJGE 3QG5C 2PNLA 5CFFE 1N36E 4FW3A 4DV3E 2C38A 4BCAA 2FGGA 1MU5A 4AQYE 1UDOA 1UHZA 1ZM4A 5BR8I 2UUCI 2LRSA 4HY1A 2A2DA 2EWLA 2EOFA 1IQSA 4R2DA 1AAYA 4KWYA 1HR0I 1N3GA 4BBYA 1IMUA 1HNZE 5JEAF 3Q6MA 2EN2A 5C0XA 1GTKA 4JI1I 4FK5C 4F6NA 4BS9A 3HQ1A 5LL6R 3TQMA 1EKZA 1R6MA 4LFBE 2RQLA 5C0XF 2EM0A 2FTXB 4F54A 4NXNI 2DLKA 1ZXMA 4DV1I 2C39B 3V2UC 3H4LA 2EPRA 2Z5BA 1L4SA 3CDIA 1UDQA 3WU3A 2CGEA 4FW9A 3THNA 2EOOA 1FNMA 1KYQA 2DEJA 3B8HA 1ZM3A 5DNLA 4ZYEA 2L2KB 1N32E 2EOXA 5L3JA 3BF2A 4X65E 3L7ZB 1VISA 3LLHA 2RPCA 3C6MA 2EM3A 2EMGA 1YHCA 2NA2A 2EOQA 4UTGA 1ZBQA 4WX9A 2L3JA 3OTOE 2YTIA 4DR6E 1QU6A 4DPTA 2YTPA 5AC5A 5KL7A 1OYSA 5IT9C 2E1RA 2F4VI 2YT4A 4LCHA 4WUDA 2VESA 3GCMA 2B3TB 2L33A 2EOYA 2NN6C 4P7AA 4JI8I 4NXMI 4LFCI 1H7UA 2E5LI 1X49A 4JI1E 5K36B 1STUA 2O1TA 3P1XA 4X8WA 1N33E 1GZ6A 4ED4A 4JI5E 4DV2E 1Y4SA 5LMNE 4JYAE 2PNZA 4NXNE 2GO4A 1X5WA 2BM0A 2LJHA 2EOZA 3M99B 2Z5EA 5DRQA 4DV6I 4AM3A 3ZM7A 1PJTA 2MKNA 3V5RA 2HHHI 2V83A 1B63A 2EPZA 4IJDA 4R2SA 4LF8E 2V2ZA 1HNWI 3J7Yp 1NEIA 1O0WA 3B4TA 2UXCI 3HJCA 3U1KA 2YRKA 5AE3A 2LT7A 2Q8UA 2NABA 3T1YE 5DNYA 2AE8A 3P3GA 4IZKB 3LTOA 1IQOA 1WHNA 1XMQI 3ZOQB 2ENHA 4LF4E 4BA2B 5JEAD 4TUGA 4X64I 1F2IG 4OKGA 2CSHA 4WUBA 4IFDD 4LF7E 2B7VA 5LMUI 5C0XD 1XNQE 1B69A 2CZ9A 4AIDA 2HJJA 3JTZA 1JK1A 1IBLI 2VRDA 2HKEA 1YPNA 2GS8A 4ZVIA 4LF6I 2LUPB 2J7JA 3H09A 2YTQA 4DU8A 1EI1A 1FWLA 1UEKA 4OO1E 4WXCA 1A1LA 2WBTA 3ZZTA 1T38A 1K47A 1T4LB 5A6JA 1XMOE 2DB2A 4JI7E 2WZOA 2L2NA 2ODRD 2EP3A 4F9BB 1TF6A 4WYQB 5FLXC 3DD6A 5ELWA 1FJGI 5KL3A 4DV4E 4KQVA 2ZM6E 2L3CA 2JP9A 4B3TE 1N36I 4DV3I 2PO2A 4RHBB 2JR1A 1ZU1A 2JOXA 2N3HA 2EMKA 4WSPA 4JV5E 4AQYI 1X48A 2CTDA 2G7HA 2BB8A 1DI2A 4R2PA 3PS3A 3M7NG 1RMDA 1X6HA 2V86A 2ZBKB 3PRYA 4IZJD 3ADGA 1HNXE 4DR1E 2JY9A 2ZITA 3GMEA 2EM8A 1PJQA 2RSMA 1HNZI 2UU9E 3MHHC 1E3HA 4X66E 1WJPA 3J81C 4RH8A 2WNRA 1UDNA 1MX0A 1UDSA 4HACB 3IWDA 4JI4E 4LFBI 2JEAB 2EOSA 2JEBA 3IWCA 1UILA 1NCSA 4OX9E 1KIJA 2EL4A 2JYAA 4OO1F 2JPAA 3VYXA 1Y6ZA 4M0VA 2YSPA 1IBME 2BA0D 1Z0CA 1E3PA 1N32I 2DSYA 2BA1D 3PS1A 1KTVA 4DV5E 3VYYA 1Z0TA 2BA0G 3K17A 4X65I 2EZ6A 2BA1G 4URLA 2JE6A 2EPLX 4F6MA 2AJ4A 2C38B 2PO1A 1Z59A 4LFAE 3OTOI 1ZAAC 4DR6I 4R8OA 1YYKA 2JVAA 1BBOA 1DQ3A 2R42A 4GZNC 2DEIA 3NZKA 2YSOA 1N33I 5IWAE 3B82A 2YU5A 4BA1A 1RQ0A 5JEAA 2NPFA 1KKHA 2ENCA 4YY3E 1A1FA 5GMEA 4IFDA 1NHHA 4DU7A 3EPJA 3J7AG 2JT2A 4OZEA 5A69A 1BKNA 4IFDF 1A1IA 4DPYA 4DV2I 2Z5BB 5LMNI 4JI5I 4JYAI 3K6QA 2F8BA 2LVHA 2GPIA 3HULA 4FN5A 4MYUA 1XNRE 4MDTA 1WHQA 2LV2A 1X3CA 1NHJA 1IBKE 4X62E 1D6TA 2YTGA 2NN6E 2V8QB 2NN6B 2BBGA 4OOGC 1Z0VA 3VHTB 5JEAC 3ADIA 1XXEA 4EMDA 4LF8I 4I3HA 3ADJA 3H1CA 4JI0E 4NHRA 4R2CA 2UXBE 3C4TA 4IFDC 1YFHA 2EPCA 3T1YI 1VI7A 4LCFA 5C0XC 2EN8A 4LF4I 2EN4A 3C6KA 2JOBA 4O43A 1DARA 2Z5CA 2Q2EB 4R2QA 1EH7A 4L5NC 4LF7I 3P3EA 4LTYA 2UUBE 2HFSA 3PYDA 1XNQI 1X47A 4JI2E 4IZJA 4B3SE 1RHYA 1DGCA 2WCC3 4JI2I 2VQFE 1YZ9A 5FWKA 3LNUA 2IESA 4OO1D 2K4VA 4WFTA 2EMZA 1S16A 4GKKE 2ADRA 2C39A 2PO0B 2ODRC 2EQ3A 4DR2E 1H73A 4FW7A 2DRPA 1SFEA 5K36E 1P42A 4WSGA 3HTXA 2X36A 1XMOI 2L6MA 2EPNA 4JI7I 5KL2A 2EQ0A 3KWRA 2M4IA 1H72C 2HKJA 4XTJA 1ZR9A 3L7ZA 4DV4I 2ZM6I 2EMCA 4B3TI 2V89A 3T1HE 2HK2A 4BMJA 1X6FA 1T4NA 1Z1BA 2BR2B 1PVGA 4JV5I 3J80C 2EMWA 2EM5A 1WRJA 1T4OA 2LUQA 3WU6A 4NZVA 2V87A 1BBGA 2EOHA 2LMZA 1UN6B 2LTRA 4MQYA 3BGHA 5FLXQ 1EH8A 1HNXI 3GLLA 4DR3E 2DLQA 3HPZA 1UBDC 2EPPA 4ZYGA 4DR4E 1Z5BA 4DR1I 2UU9I 4JI3E 4X66I
chains in the Genus database with same CATH topology
2RS6A 3ZZUA 4P52A 4DKKA 4JI4I 3FIGA 5AE2A 4GKJE 1H7SA 1GQEA 1ZM9A 2NUGA 2OI2A 4OX9I 4LF9E 3J81Q 3CWVA 1IBMI 3J7AM 2BV3A 1Z5AA 4DV5I 2RS7A 5AE1A 4DMIA 4LF5E 3IWBA 2VF3A 4TUIA 5GMDA 2VF1A 4LFAI 2V2QA 1Z0GA 4FWHA 1OJ4A 1N34E 4KHPE 1N0UA 4WUCA 4F9AB 3WU4A 1J5EE 5IWAI 4B3ME 4LU9A 3AV0A 2R3VA 4YY3I 2JWOA 1HK7A 2DMYA 1NHIA 3M6AA 1ZXNA 1YYWA 4JI6I 4DUYE 4PRXA 1Z0WA 2MDRA 1Z0EA 2EFGA 4R03A 2MC5A 1XNRI 4L8NA 3B78A 4K0KE 4USKA 1IBKI 4USMA 4X62I 3F6HA 5F3WA 2MC6A 2E1MA 4Z7CA 2UXDE 4P78A 1FWKA 4HXZA 4R1FA 3DF6A 4JI0I 3VK6A 2UXBI 2FV4B 1PKPA 2V85A 2HK3A 2O1UA 3K85A 1RREA 2GQ0A 4N3OA 3DJWA 2VE7C 4DPUA 3Q6NA 2UUBI 4DR5E 1U2RA 2IOQA 2LJPA 4JI2I 4MYTA 2VQEE 1USVA 4HACA 4B3SI 3ZZ0A 2VQFI 3ZKBA 4GKKI 4DR2I 3ADLA 3Q1QA 3JAMC 4JI6E 2PNMA 3LPSA 2HFUA 2V34A 3PYFA 3AUZA 2UUAE 1I94E 4Z7YA 4B3RE 1Z5CA 1QZRA 3PYGA 3T1HI 4BC9A 4M2ZA 1H74A 2B9DA 5A2QC 2Z5CB 4DR3I 4KZSA 4DR4I 5ADZA 4JI3I 3J80Q 4IZJB 4DR7E 1XHKA 2L8TA 2LE2A 3QT6A 1USUA 1WUUA 4M1KA 4GKJI 4DV7E 1FI4A 2KOUA 4LF9I 2NUFA 1WXRA 4J8ZA 3QT5A 2X7IA 4YHHE 1FKAE 1RC7A 2LTSA 4DUZE 4DV0E 3F0NA 4LF5I 4Q28A 1NZ0A 2NUEA 4DPWA 3P06A 3HXLA 5BR8E 2UUCE 4WPYA 3RMPA 1Z0BA 2LBSB 4PRVA 1N34I 4KHPI 4BC7A 1J5EI 4B3MI 2N3GA 3C4BA 2WW4A 1HR0E 3K1JA 4F9CB 2IHR1 3D4JA 2O1VA 2DIXA 4DUYI 4P7DA 4DV1E 3JU0A 4K0KI 4FWDA 2V2VA 2YZTA 2UXDI 1A6FA 3GONA 1YYOA 2L2MA 2J7KA 3QT7A 1N0VC 2XEXA 1B62A 5T6JA 4IZKA 2B7TA 2KHXA 1Y4UA 2BM1A 2F4VE 3QT8A 4DR5I 2M7QA 1EA6A 3HPSA 2H36X 3LMLA 2VQEI 3MSWA 4PU9A 1ELOA 2CPNA 4JI8E 4NXME 4LFCE 1S4EA 2E5LE 3F6GA 2A2CA 1KVKA 1ZBTA 2RTXA 2UUAI 1I94I 4DPXA 3OMLA 3ZKDA 4B3RI 4GEQB 4DV6E 3WU5A 2KONA 2HHHE 3JAMQ 1HNWE 4JG4A 2M1SA 4M30A 2UXCE 1J26A 1SR9A 1XMQE 1MG7A 1PIEA 4FWGA 4X64E 2CG9A 4DR7I 2L92A 5LMUE 4DXLA 4RPFA 2IOPA 1IBLE 2O1WA 5A2QQ 1RR9A 4DV7I 3PYEA 4LF6E 4UT4A 5AASA 4HYMA 2V88A 4I8OA 1ZM2A 4YHHI 2V8PA 4DUZI 4DV0I 1FJGE 5CFFE 1N36E 4DV3E 5BR8I 4BCAA 2FGGA 1MU5A 4AQYE 1ZM4A 1UHZA 2UUCI 2LRSA 4HY1A 2A2DA 2EWLA 1HR0I 4BBYA 1HNZE 3Q6MA 4JI1I 4BS9A 3HQ1A 5LL6R 1EKZA 4LFBE 4NXNI 2FTXB 4F54A 1ZXMA 4DV1I 3V2UC 3H4LA 2Z5BA 3WU3A 2CGEA 4FW9A 1FNMA 2DEJA 3B8HA 1ZM3A 1N32E 2L2KB 5L3JA 4X65E 1VISA 3LLHA 2NA2A 4UTGA 1ZBQA 2L3JA 3OTOE 4DR6E 1QU6A 4DPTA 2E1RA 5IT9C 2F4VI 2YT4A 4WUDA 2B3TB 2L33A 4P7AA 4JI8I 4NXMI 4LFCI 1H7UA 2E5LI 1X49A 4JI1E 1STUA 2O1TA 1N33E 3P1XA 4X8WA 1GZ6A 4ED4A 4JI5E 4DV2E 1Y4SA 5LMNE 4JYAE 4NXNE 2BM0A 2LJHA 2Z5EA 4DV6I 3ZM7A 3V5RA 2HHHI 2V83A 1B63A 1HNWI 2V2ZA 4LF8E 3J7Yp 1O0WA 2UXCI 3HJCA 5AE3A 3T1YE 5DNYA 4IZKB 1XMQI 3LTOA 1WHNA 3ZOQB 4LF4E 4TUGA 4X64I 4WUBA 4LF7E 2B7VA 5LMUI 1XNQE 2CZ9A 1IBLI 3JTZA 2HKEA 2GS8A 4ZVIA 4LF6I 2LUPB 3H09A 4DU8A 1EI1A 1FWLA 1UEKA 3ZZTA 1K47A 1T4LB 1XMOE 2DB2A 4JI7E 2L2NA 2WZOA 2ODRD 4F9BB 4WYQB 5FLXC 1FJGI 4KQVA 4DV4E 2ZM6E 2L3CA 4B3TE 1N36I 4DV3I 2JR1A 2N3HA 4JV5E 4WSPA 2JOXA 4AQYI 1X48A 2G7HA 1DI2A 2V86A 2ZBKB 3PRYA 4IZJD 3ADGA 1HNXE 4DR1E 2JY9A 2ZITA 2RSMA 1HNZI 2UU9E 4X66E 3J81C 1MX0A 4HACB 3IWDA 4JI4E 4LFBI 3IWCA 1UILA 4OX9E 1KIJA 3VYXA 1Y6ZA 4M0VA 1IBME 1Z0CA 1N32I 2DSYA 1KTVA 4DV5E 3VYYA 1Z0TA 3K17A 4X65I 2EZ6A 4URLA 2AJ4A 1Z59A 4LFAE 3OTOI 4DR6I 4R8OA 1YYKA 2JVAA 1DQ3A 2R42A 2DEIA 5IWAE 3B82A 1RQ0A 2NPFA 1KKHA 4YY3E 5GMEA 1NHHA 4DU7A 3J7AG 5IT9Q 1N33I 1BKNA 4DPYA 4JI5I 4DV2I 2Z5BB 5LMNI 4JYAI 3K6QA 2F8BA 3HULA 4FN5A 4MYUA 1XNRE 1WHQA 1NHJA 1IBKE 4X62E 1D6TA 2V8QB 4OOGC 1Z0VA 4LF8I 3ADIA 4EMDA 4I3HA 3ADJA 4JI0E 2UXBE 3C4TA 3T1YI 4LF4I 2JOBA 1DARA 2Z5CA 2Q2EB 4L5NC 4LF7I 4LTYA 2UUBE 2HFSA 3PYDA 1XNQI 1X47A 4JI2E 4IZJA 4B3SE 2VQFE 1YZ9A 5FWKA 3LNUA 2K4VA 4WFTA 1S16A 4GKKE 2ODRC 4DR2E 1H73A 3HTXA 2X36A 1XMOI 2L6MA 4JI7I 2HKJA 3KWRA 1H72C 2M4IA 4XTJA 4DV4I 2ZM6I 4B3TI 2V89A 3T1HE 2HK2A 4BMJA 1T4NA 4JV5I 1PVGA 3J80C 2LUQA 1T4OA 3WU6A 2V87A 2LMZA 2LTRA 5FLXQ 1HNXI 4DR3E 3HPZA 4DR1I 4DR4E 1Z5BA 2PNLA 2UU9I 4JI3E 4X66I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS6 A;  3ZZU A;  4P52 A;  4DKK A;  4JI4 I;  4GKJ E;  1H7S A;  1GQE A;  2OI2 A;  2NUG A;  1ZM9 A;  4OX9 I;  4LF9 E;  3J81 Q;  3CWV A;  1IBM I;  3J7A M;  2BV3 A;  1Z5A A;  4DV5 I;  2RS7 A;  4LF5 E;  2VF3 A;  5GMD A;  4LFA I;  2V2Q A;  1Z0G A;  4FWH A;  1OJ4 A;  1N34 E;  4KHP E;  1N0U A;  4WUC A;  3WU4 A;  1J5E E;  5IWA I;  4B3M E;  2R3V A;  4YY3 I;  2DMY A;  1NHI A;  3M6A A;  1ZXN A;  1YYW A;  4JI6 I;  4DUY E;  4PRX A;  1Z0W A;  2MDR A;  1Z0E A;  2EFG A;  1XNR I;  3B78 A;  4K0K E;  4USK A;  1IBK I;  4USM A;  4X62 I;  4Z7C A;  2UXD E;  4R1F A;  1FWK A;  4HXZ A;  4JI0 I;  2UXB I;  1PKP A;  2HK3 A;  1RRE A;  4DPU A;  2UUB I;  4DR5 E;  1U2R A;  2LJP A;  4JI2 I;  4MYT A;  2VQE E;  4HAC A;  4B3S I;  3ZZ0 A;  2VQF I;  3ZKB A;  4GKK I;  4DR2 I;  3ADL A;  3Q1Q A;  3JAM C;  4JI6 E;  3LPS A;  2HFU A;  2V34 A;  3PYF A;  2UUA E;  1I94 E;  4Z7Y A;  4B3R E;  1Z5C A;  1QZR A;  3PYG A;  3T1H I;  4M2Z A;  1H74 A;  5A2Q C;  4DR3 I;  4DR4 I;  4JI3 I;  3J80 Q;  4DR7 E;  1XHK A;  3QT6 A;  1WUU A;  4M1K A;  4GKJ I;  4DV7 E;  1FI4 A;  4LF9 I;  2NUF A;  3QT5 A;  2X7I A;  4YHH E;  1FKA E;  1RC7 A;  2LTS A;  4DUZ E;  4DV0 E;  3F0N A;  4LF5 I;  1NZ0 A;  2NUE A;  4DPW A;  5BR8 E;  2UUC E;  1Z0B A;  2LBS B;  4PRV A;  1N34 I;  4KHP I;  1J5E I;  4B3M I;  2N3G A;  3C4B A;  2WW4 A;  1HR0 E;  3K1J A;  2IHR 1;  3D4J A;  2DIX A;  4DUY I;  4DV1 E;  4K0K I;  4FWD A;  2V2V A;  2UXD I;  1A6F A;  3GON A;  1YYO A;  2L2M A;  2J7K A;  3QT7 A;  1N0V C;  2XEX A;  1B62 A;  2B7T A;  2KHX A;  2BM1 A;  2F4V E;  3QT8 A;  4DR5 I;  1EA6 A;  2VQE I;  4PU9 A;  1ELO A;  2CPN A;  4JI8 E;  4NXM E;  4LFC E;  1S4E A;  2E5L E;  2A2C A;  1KVK A;  1ZBT A;  2RTX A;  2UUA I;  1I94 I;  4DPX A;  4B3R I;  3ZKD A;  4DV6 E;  3WU5 A;  2HHH E;  3JAM Q;  1HNW E;  4JG4 A;  4M30 A;  2UXC E;  1J26 A;  1XMQ E;  1MG7 A;  1PIE A;  4FWG A;  4X64 E;  4DR7 I;  5LMU E;  4DXL A;  4RPF A;  1IBL E;  5A2Q Q;  1RR9 A;  4DV7 I;  3PYE A;  4LF6 E;  4UT4 A;  4HYM A;  1ZM2 A;  4YHH I;  2V8P A;  4DUZ I;  4DV0 I;  1FJG E;  5CFF E;  1N36 E;  4DV3 E;  5BR8 I;  1MU5 A;  2UUC I;  4AQY E;  1ZM4 A;  1UHZ A;  2LRS A;  4HY1 A;  2A2D A;  1HR0 I;  1HNZ E;  4JI1 I;  1EKZ A;  5LL6 R;  4LFB E;  4NXN I;  1ZXM A;  4DV1 I;  3V2U C;  3H4L A;  3WU3 A;  4FW9 A;  1FNM A;  2DEJ A;  3B8H A;  1ZM3 A;  1N32 E;  2L2K B;  5L3J A;  4X65 E;  1VIS A;  3LLH A;  2NA2 A;  4UTG A;  2L3J A;  3OTO E;  4DR6 E;  1QU6 A;  4DPT A;  2E1R A;  5IT9 C;  2F4V I;  2YT4 A;  4WUD A;  2B3T B;  2L33 A;  4P7A A;  4JI8 I;  4NXM I;  4LFC I;  1H7U A;  2E5L I;  1X49 A;  4JI1 E;  1STU A;  4ED4 A;  3P1X A;  4X8W A;  1N33 E;  4JI5 E;  4DV2 E;  5LMN E;  4JYA E;  4NXN E;  2BM0 A;  2LJH A;  4DV6 I;  3ZM7 A;  3V5R A;  2HHH I;  1B63 A;  1HNW I;  2V2Z A;  4LF8 E;  3J7Y p;  1O0W A;  2UXC I;  3T1Y E;  1XMQ I;  3LTO A;  1WHN A;  4LF4 E;  4X64 I;  4WUB A;  4LF7 E;  2B7V A;  5LMU I;  1XNQ E;  2CZ9 A;  1IBL I;  2HKE A;  2GS8 A;  4ZVI A;  4LF6 I;  2LUP B;  4DU8 A;  1EI1 A;  1FWL A;  1UEK A;  3ZZT A;  1K47 A;  1T4L B;  1XMO E;  2DB2 A;  4JI7 E;  2L2N A;  4WYQ B;  5FLX C;  1FJG I;  4KQV A;  4DV4 E;  2ZM6 E;  2L3C A;  4B3T E;  1N36 I;  4DV3 I;  2N3H A;  4JV5 E;  4AQY I;  1X48 A;  1DI2 A;  2ZBK B;  3ADG A;  1HNX E;  4DR1 E;  2JY9 A;  2ZIT A;  2RSM A;  1HNZ I;  2UU9 E;  4X66 E;  3J81 C;  1MX0 A;  4HAC B;  4JI4 E;  4LFB I;  1UIL A;  4OX9 E;  1KIJ A;  3VYX A;  1IBM E;  1Z0C A;  1N32 I;  1KTV A;  4DV5 E;  3VYY A;  1Z0T A;  3K17 A;  4X65 I;  2EZ6 A;  4URL A;  2AJ4 A;  1Z59 A;  4LFA E;  3OTO I;  4DR6 I;  1YYK A;  2JVA A;  2R42 A;  2DEI A;  5IWA E;  3B82 A;  1RQ0 A;  2NPF A;  1KKH A;  4YY3 E;  5GME A;  1NHH A;  4DU7 A;  3J7A G;  5IT9 Q;  1N33 I;  1BKN A;  4DPY A;  4JI5 I;  4DV2 I;  5LMN I;  4JYA I;  3HUL A;  4FN5 A;  4MYU A;  1XNR E;  1WHQ A;  1NHJ A;  1IBK E;  4X62 E;  1D6T A;  4OOG C;  1Z0V A;  4LF8 I;  3ADI A;  4EMD A;  4I3H A;  3ADJ A;  4JI0 E;  2UXB E;  3C4T A;  3T1Y I;  4LF4 I;  1DAR A;  2Q2E B;  4LF7 I;  2HFS A;  2UUB E;  3PYD A;  1XNQ I;  1X47 A;  4JI2 E;  4B3S E;  2VQF E;  1YZ9 A;  3LNU A;  4WFT A;  1S16 A;  4GKK E;  4DR2 E;  1H73 A;  3HTX A;  2X36 A;  1XMO I;  4JI7 I;  2HKJ A;  1H72 C;  4XTJ A;  4DV4 I;  2ZM6 I;  4B3T I;  3T1H E;  2HK2 A;  1T4N A;  4JV5 I;  1PVG A;  3J80 C;  2LUQ A;  1T4O A;  3WU6 A;  2LTR A;  5FLX Q;  1HNX I;  4DR3 E;  4DR1 I;  4DR4 E;  1Z5B A;  2UU9 I;  4JI3 E;  4X66 I; 
#chains in the Genus database with same CATH topology
 2RS6 A;  3ZZU A;  4P52 A;  4DKK A;  4JI4 I;  3FIG A;  5AE2 A;  4GKJ E;  1H7S A;  3P76 A;  1GQE A;  1ZM9 A;  2NUG A;  2OI2 A;  4OX9 I;  2K7I A;  4LF9 E;  5K36 F;  2YTD A;  2PRT A;  4U3B A;  2E72 A;  2WP8 B;  2YU8 A;  3CWV A;  3J81 Q;  1IBM I;  3J7A M;  2J65 A;  2EL5 A;  2C37 B;  2ENA A;  2HC5 A;  1Z5A A;  2BV3 A;  4MU3 A;  4DV5 I;  2RS7 A;  5AE1 A;  4O4K A;  4DMI A;  1R6L A;  4LF5 E;  3IWB A;  2VF3 A;  1X6E A;  4LPF A;  4TUI A;  5LLQ A;  5GMD A;  2EMB A;  2VF1 A;  4LFA I;  2EL6 A;  2V2Q A;  2EOI A;  4BA2 A;  2M9A A;  1Z0G A;  4FWH A;  4F2J C;  1OJ4 A;  1A1K A;  1N34 E;  4KHP E;  1N0U A;  4WUC A;  4F9A B;  3P3C A;  1J5E E;  3WU4 A;  5IWA I;  4B3M E;  4LU9 A;  3AV0 A;  2GLI A;  2WNR B;  2R3V A;  4YY3 I;  3ECR A;  2JWO A;  1HK7 A;  2DMY A;  1NHI A;  1PJS A;  5IT9 Q;  2YRH A;  3M6A A;  2ELZ A;  1ZXN A;  1YYW A;  4JI6 I;  1T39 A;  4R2E A;  4DUY E;  2A25 A;  2YPN A;  1YSA C;  2MDR A;  1Z0W A;  4PRX A;  4OO1 A;  1Z0E A;  2EFG A;  4R03 A;  2MC5 A;  1XNR I;  2MDG A;  2EOR A;  4L8N A;  4K0K E;  3B78 A;  4NBQ A;  4USK A;  4MLV A;  4USM A;  4X62 I;  1IBK I;  3F6H A;  5F3W A;  2WBS A;  4LCG A;  2MC6 A;  2E1M A;  4Z7C A;  2UXD E;  4P78 A;  1FWK A;  1A1G A;  4HXZ A;  3DF6 A;  1YH8 A;  4FW6 A;  4R1F A;  2JXP A;  3VK6 A;  5DNX A;  4JI0 I;  2UXB I;  5KL4 A;  2FV4 B;  1PKP A;  5DRR A;  1PDA A;  1KJK A;  1AH5 A;  2V85 A;  2HK3 A;  2O1U A;  2YTO A;  1RRE A;  3K85 A;  2LO3 A;  2GQ0 A;  2EM4 A;  4N3O A;  3DJW A;  2VE7 C;  4OO1 C;  4DPU A;  3Q6N A;  2UUB I;  2EPO A;  2YWQ A;  4DR5 E;  1U2R A;  2IOQ A;  4X9J A;  1TF3 A;  2LJP A;  1Y60 A;  4MYT A;  5JEA B;  3EPL A;  2VQE E;  2YTN A;  1USV A;  4HAC A;  4B3S I;  3ZZ0 A;  2YTE A;  2VQF I;  4IFD B;  5C0X E;  5K36 D;  3ZKB A;  4ZYH A;  5C0X B;  3L00 A;  4IS9 A;  4GKK I;  1YUI A;  4R2A A;  4DR2 I;  3ADL A;  4AIM A;  3Q1Q A;  3JAM C;  4JI6 E;  2PNM A;  3LPS A;  3M85 D;  4BHC A;  1BB8 A;  2HFU A;  2V34 A;  4FW5 A;  3PYF A;  3AUZ A;  1G2F C;  2HGH A;  1I94 E;  2UUA E;  4Z7Y A;  3M85 G;  4B3R E;  1Z5C A;  2WBU A;  1YUJ A;  5A6B A;  1QZR A;  3PYG A;  3T1H I;  4BC9 A;  4M2Z A;  1H74 A;  3BBG A;  2B9D A;  5A2Q C;  2Z5C B;  4LOM A;  4MLQ A;  4ZYD A;  4DR3 I;  4KZS A;  4DR4 I;  5ADZ A;  2EPM X;  4JI3 I;  5TSE A;  1QNT A;  3J80 Q;  4IZJ B;  4DR7 E;  1XHK A;  2L8T A;  2LE2 A;  4MU4 A;  3QT6 A;  1USU A;  1WUU A;  4M1K A;  4GKJ I;  4DV7 E;  1FI4 A;  2KOU A;  1P47 A;  3KZY A;  2NUF A;  4LF9 I;  1WXR A;  2EOM A;  4J8Z A;  1TN9 A;  2EMX A;  3QT5 A;  2EN3 A;  2X7I A;  4YHH E;  1FKA E;  2PNZ B;  1RC7 A;  2EMF A;  2D9H A;  2LTS A;  2NN6 A;  4DUZ E;  4DV0 E;  2IER A;  1A1J A;  1MGT A;  3F0N A;  2EMI A;  3M7N D;  2NN6 F;  4LF5 I;  4U3D A;  4Q28 A;  1NZ0 A;  2NUE A;  4DPW A;  3P06 A;  2R1F A;  3HXL A;  2GO3 A;  5BR8 E;  2UUC E;  2EOE A;  4WPY A;  3RMP A;  1Z0B A;  2YTJ A;  2DMI A;  2LBS B;  4PRV A;  5IV8 B;  1N34 I;  4KHP I;  2CVE A;  4BC7 A;  1J5E I;  4B3M I;  2N3G A;  3EPK A;  3C4B A;  2EQ1 A;  5IXM B;  1HR0 E;  2O3Z A;  2WW4 A;  3HKM A;  5A6K A;  3K1J A;  1G2D C;  4F9C B;  2IHR 1;  3D4J A;  2O1V A;  1EH6 A;  2PO0 A;  2DIX A;  4DUY I;  4QNJ A;  5K36 A;  4P7D A;  4DV1 E;  2RSI A;  3JU0 A;  5KL6 A;  5A6A A;  4K0K I;  4FWD A;  3BID A;  4O5G A;  2V2V A;  5A6B D;  5EL9 A;  3THO B;  2YZT A;  2UXD I;  3KRN A;  2EJ4 A;  1A6F A;  3GON A;  2EOJ A;  1YYO A;  2BR2 A;  3CDJ A;  4ISA A;  2EM6 A;  2L2M A;  2J7K A;  3QT7 A;  1LLM C;  1N0V C;  2XEX A;  1B62 A;  4IS1 C;  2PO2 B;  4HTG A;  5T6J A;  4IZK A;  2EML A;  3U1Y A;  5K36 C;  2B7T A;  2KHX A;  1Y4U A;  2BM1 A;  2EM2 A;  4M9V C;  2F4V E;  3QT8 A;  4QNK A;  4DR5 I;  2M7Q A;  3HPS A;  2H36 X;  3LML A;  1EA6 A;  4MU1 A;  2VQE I;  3MSW A;  2EMA A;  4PU9 A;  1ELO A;  2R76 A;  2EN7 A;  2YRM A;  1JK2 A;  2CPN A;  4JI8 E;  4NXM E;  4LFC E;  4R2R A;  1S4E A;  2E5L E;  2JEB B;  2DGC A;  2WP8 A;  2LCE A;  4OO1 B;  3UK3 C;  2I13 A;  2ELY A;  3F6G A;  2A2C A;  2C37 A;  1KVK A;  2NN6 D;  1ZBT A;  2RTX A;  4MU0 A;  2UUA I;  1I94 I;  3EPH A;  2EPU A;  2LJU A;  4DPX A;  3OML A;  3ZKD A;  4B3R I;  4GEQ B;  4N4R B;  4HEI A;  4DV6 E;  3WU5 A;  2KON A;  2HHH E;  3PS2 A;  3JAM Q;  3MHS C;  4WXD A;  1HNW E;  4JG4 A;  2M1S A;  4M30 A;  2I9I A;  2UXC E;  5KL5 A;  2JE6 B;  2EMY A;  2PO1 B;  1J26 A;  1SR9 A;  2EE8 A;  1XMQ E;  4BHB A;  1MG7 A;  1PIE A;  5DRP A;  4FWG A;  2EPA A;  4X64 E;  2EPX A;  2CG9 A;  2EM9 A;  2EMH A;  4DR7 I;  2L92 A;  3EQ1 A;  5LMU E;  5JEA E;  4DXL A;  2F1D A;  4RPF A;  3UHM A;  4FW4 A;  4BA1 B;  2EN1 A;  1IBL E;  2IOP A;  2O1W A;  1RR9 A;  2EN6 A;  2N8X A;  5A2Q Q;  4DV7 I;  1MEY C;  2YTF A;  2MKD A;  3PYE A;  2JEA A;  4IFD E;  2GHF A;  4LF6 E;  4UT4 A;  4J3D A;  5DRO A;  5AAS A;  4HYM A;  1OYR A;  5AC4 A;  2V88 A;  4I8O A;  4O24 A;  1ZM2 A;  4YHH I;  1OYP A;  3KZZ A;  1Y5Y A;  2V8P A;  4Q35 B;  4DUZ I;  4DV0 I;  5EKW A;  2CT1 A;  2EM7 A;  1A1H A;  2EPK X;  4GQU A;  1FJG E;  3QG5 C;  2PNL A;  5CFF E;  1N36 E;  4FW3 A;  4DV3 E;  2C38 A;  4BCA A;  2FGG A;  1MU5 A;  4AQY E;  1UDO A;  1UHZ A;  1ZM4 A;  5BR8 I;  2UUC I;  2LRS A;  4HY1 A;  2A2D A;  2EWL A;  2EOF A;  1IQS A;  4R2D A;  1AAY A;  4KWY A;  1HR0 I;  1N3G A;  4BBY A;  1IMU A;  1HNZ E;  5JEA F;  3Q6M A;  2EN2 A;  5C0X A;  1GTK A;  4JI1 I;  4FK5 C;  4F6N A;  4BS9 A;  3HQ1 A;  5LL6 R;  3TQM A;  1EKZ A;  1R6M A;  4LFB E;  2RQL A;  5C0X F;  2EM0 A;  2FTX B;  4F54 A;  4NXN I;  2DLK A;  1ZXM A;  4DV1 I;  2C39 B;  3V2U C;  3H4L A;  2EPR A;  2Z5B A;  1L4S A;  3CDI A;  1UDQ A;  3WU3 A;  2CGE A;  4FW9 A;  3THN A;  2EOO A;  1FNM A;  1KYQ A;  2DEJ A;  3B8H A;  1ZM3 A;  5DNL A;  4ZYE A;  2L2K B;  1N32 E;  2EOX A;  5L3J A;  3BF2 A;  4X65 E;  3L7Z B;  1VIS A;  3LLH A;  2RPC A;  3C6M A;  2EM3 A;  2EMG A;  1YHC A;  2NA2 A;  2EOQ A;  4UTG A;  1ZBQ A;  4WX9 A;  2L3J A;  3OTO E;  2YTI A;  4DR6 E;  1QU6 A;  4DPT A;  2YTP A;  5AC5 A;  5KL7 A;  1OYS A;  5IT9 C;  2E1R A;  2F4V I;  2YT4 A;  4LCH A;  4WUD A;  2VES A;  3GCM A;  2B3T B;  2L33 A;  2EOY A;  2NN6 C;  4P7A A;  4JI8 I;  4NXM I;  4LFC I;  1H7U A;  2E5L I;  1X49 A;  4JI1 E;  5K36 B;  1STU A;  2O1T A;  3P1X A;  4X8W A;  1N33 E;  1GZ6 A;  4ED4 A;  4JI5 E;  4DV2 E;  1Y4S A;  5LMN E;  4JYA E;  2PNZ A;  4NXN E;  2GO4 A;  1X5W A;  2BM0 A;  2LJH A;  2EOZ A;  3M99 B;  2Z5E A;  5DRQ A;  4DV6 I;  4AM3 A;  3ZM7 A;  1PJT A;  2MKN A;  3V5R A;  2HHH I;  2V83 A;  1B63 A;  2EPZ A;  4IJD A;  4R2S A;  4LF8 E;  2V2Z A;  1HNW I;  3J7Y p;  1NEI A;  1O0W A;  3B4T A;  2UXC I;  3HJC A;  3U1K A;  2YRK A;  5AE3 A;  2LT7 A;  2Q8U A;  2NAB A;  3T1Y E;  5DNY A;  2AE8 A;  3P3G A;  4IZK B;  3LTO A;  1IQO A;  1WHN A;  1XMQ I;  3ZOQ B;  2ENH A;  4LF4 E;  4BA2 B;  5JEA D;  4TUG A;  4X64 I;  1F2I G;  4OKG A;  2CSH A;  4WUB A;  4IFD D;  4LF7 E;  2B7V A;  5LMU I;  5C0X D;  1XNQ E;  1B69 A;  2CZ9 A;  4AID A;  2HJJ A;  3JTZ A;  1JK1 A;  1IBL I;  2VRD A;  2HKE A;  1YPN A;  2GS8 A;  4ZVI A;  4LF6 I;  2LUP B;  2J7J A;  3H09 A;  2YTQ A;  4DU8 A;  1EI1 A;  1FWL A;  1UEK A;  4OO1 E;  4WXC A;  1A1L A;  2WBT A;  3ZZT A;  1T38 A;  1K47 A;  1T4L B;  5A6J A;  1XMO E;  2DB2 A;  4JI7 E;  2WZO A;  2L2N A;  2ODR D;  2EP3 A;  4F9B B;  1TF6 A;  4WYQ B;  5FLX C;  3DD6 A;  5ELW A;  1FJG I;  5KL3 A;  4DV4 E;  4KQV A;  2ZM6 E;  2L3C A;  2JP9 A;  4B3T E;  1N36 I;  4DV3 I;  2PO2 A;  4RHB B;  2JR1 A;  1ZU1 A;  2JOX A;  2N3H A;  2EMK A;  4WSP A;  4JV5 E;  4AQY I;  1X48 A;  2CTD A;  2G7H A;  2BB8 A;  1DI2 A;  4R2P A;  3PS3 A;  3M7N G;  1RMD A;  1X6H A;  2V86 A;  2ZBK B;  3PRY A;  4IZJ D;  3ADG A;  1HNX E;  4DR1 E;  2JY9 A;  2ZIT A;  3GME A;  2EM8 A;  1PJQ A;  2RSM A;  1HNZ I;  2UU9 E;  3MHH C;  1E3H A;  4X66 E;  1WJP A;  3J81 C;  4RH8 A;  2WNR A;  1UDN A;  1MX0 A;  1UDS A;  4HAC B;  3IWD A;  4JI4 E;  4LFB I;  2JEA B;  2EOS A;  2JEB A;  3IWC A;  1UIL A;  1NCS A;  4OX9 E;  1KIJ A;  2EL4 A;  2JYA A;  4OO1 F;  2JPA A;  3VYX A;  1Y6Z A;  4M0V A;  2YSP A;  1IBM E;  2BA0 D;  1Z0C A;  1E3P A;  1N32 I;  2DSY A;  2BA1 D;  3PS1 A;  1KTV A;  4DV5 E;  3VYY A;  1Z0T A;  2BA0 G;  3K17 A;  4X65 I;  2EZ6 A;  2BA1 G;  4URL A;  2JE6 A;  2EPL X;  4F6M A;  2AJ4 A;  2C38 B;  2PO1 A;  1Z59 A;  4LFA E;  3OTO I;  1ZAA C;  4DR6 I;  4R8O A;  1YYK A;  2JVA A;  1BBO A;  1DQ3 A;  2R42 A;  4GZN C;  2DEI A;  3NZK A;  2YSO A;  1N33 I;  5IWA E;  3B82 A;  2YU5 A;  4BA1 A;  1RQ0 A;  5JEA A;  2NPF A;  1KKH A;  2ENC A;  4YY3 E;  1A1F A;  5GME A;  4IFD A;  1NHH A;  4DU7 A;  3EPJ A;  3J7A G;  2JT2 A;  4OZE A;  5A69 A;  1BKN A;  4IFD F;  1A1I A;  4DPY A;  4DV2 I;  2Z5B B;  5LMN I;  4JI5 I;  4JYA I;  3K6Q A;  2F8B A;  2LVH A;  2GPI A;  3HUL A;  4FN5 A;  4MYU A;  1XNR E;  4MDT A;  1WHQ A;  2LV2 A;  1X3C A;  1NHJ A;  1IBK E;  4X62 E;  1D6T A;  2YTG A;  2NN6 E;  2V8Q B;  2NN6 B;  2BBG A;  4OOG C;  1Z0V A;  3VHT B;  5JEA C;  3ADI A;  1XXE A;  4EMD A;  4LF8 I;  4I3H A;  3ADJ A;  3H1C A;  4JI0 E;  4NHR A;  4R2C A;  2UXB E;  3C4T A;  4IFD C;  1YFH A;  2EPC A;  3T1Y I;  1VI7 A;  4LCF A;  5C0X C;  2EN8 A;  4LF4 I;  2EN4 A;  3C6K A;  2JOB A;  4O43 A;  1DAR A;  2Z5C A;  2Q2E B;  4R2Q A;  1EH7 A;  4L5N C;  4LF7 I;  3P3E A;  4LTY A;  2UUB E;  2HFS A;  3PYD A;  1XNQ I;  1X47 A;  4JI2 E;  4IZJ A;  4B3S E;  1RHY A;  1DGC A;  2WCC 3;  4JI2 I;  2VQF E;  1YZ9 A;  5FWK A;  3LNU A;  2IES A;  4OO1 D;  2K4V A;  4WFT A;  2EMZ A;  1S16 A;  4GKK E;  2ADR A;  2C39 A;  2PO0 B;  2ODR C;  2EQ3 A;  4DR2 E;  1H73 A;  4FW7 A;  2DRP A;  1SFE A;  5K36 E;  1P42 A;  4WSG A;  3HTX A;  2X36 A;  1XMO I;  2L6M A;  2EPN A;  4JI7 I;  5KL2 A;  2EQ0 A;  3KWR A;  2M4I A;  1H72 C;  2HKJ A;  4XTJ A;  1ZR9 A;  3L7Z A;  4DV4 I;  2ZM6 I;  2EMC A;  4B3T I;  2V89 A;  3T1H E;  2HK2 A;  4BMJ A;  1X6F A;  1T4N A;  1Z1B A;  2BR2 B;  1PVG A;  4JV5 I;  3J80 C;  2EMW A;  2EM5 A;  1WRJ A;  1T4O A;  2LUQ A;  3WU6 A;  4NZV A;  2V87 A;  1BBG A;  2EOH A;  2LMZ A;  1UN6 B;  2LTR A;  4MQY A;  3BGH A;  5FLX Q;  1EH8 A;  1HNX I;  3GLL A;  4DR3 E;  2DLQ A;  3HPZ A;  1UBD C;  2EPP A;  4ZYG A;  4DR4 E;  1Z5B A;  4DR1 I;  2UU9 I;  4JI3 E;  4X66 I; 
#chains in the Genus database with same CATH homology
 2RS6 A;  3ZZU A;  4P52 A;  4DKK A;  4JI4 I;  3FIG A;  5AE2 A;  4GKJ E;  1H7S A;  1GQE A;  1ZM9 A;  2NUG A;  2OI2 A;  4OX9 I;  4LF9 E;  3J81 Q;  3CWV A;  1IBM I;  3J7A M;  2BV3 A;  1Z5A A;  4DV5 I;  2RS7 A;  5AE1 A;  4DMI A;  4LF5 E;  3IWB A;  2VF3 A;  4TUI A;  5GMD A;  2VF1 A;  4LFA I;  2V2Q A;  1Z0G A;  4FWH A;  1OJ4 A;  1N34 E;  4KHP E;  1N0U A;  4WUC A;  4F9A B;  3WU4 A;  1J5E E;  5IWA I;  4B3M E;  4LU9 A;  3AV0 A;  2R3V A;  4YY3 I;  2JWO A;  1HK7 A;  2DMY A;  1NHI A;  3M6A A;  1ZXN A;  1YYW A;  4JI6 I;  4DUY E;  4PRX A;  1Z0W A;  2MDR A;  1Z0E A;  2EFG A;  4R03 A;  2MC5 A;  1XNR I;  4L8N A;  3B78 A;  4K0K E;  4USK A;  1IBK I;  4USM A;  4X62 I;  3F6H A;  5F3W A;  2MC6 A;  2E1M A;  4Z7C A;  2UXD E;  4P78 A;  1FWK A;  4HXZ A;  4R1F A;  3DF6 A;  4JI0 I;  3VK6 A;  2UXB I;  2FV4 B;  1PKP A;  2V85 A;  2HK3 A;  2O1U A;  3K85 A;  1RRE A;  2GQ0 A;  4N3O A;  3DJW A;  2VE7 C;  4DPU A;  3Q6N A;  2UUB I;  4DR5 E;  1U2R A;  2IOQ A;  2LJP A;  4JI2 I;  4MYT A;  2VQE E;  1USV A;  4HAC A;  4B3S I;  3ZZ0 A;  2VQF I;  3ZKB A;  4GKK I;  4DR2 I;  3ADL A;  3Q1Q A;  3JAM C;  4JI6 E;  2PNM A;  3LPS A;  2HFU A;  2V34 A;  3PYF A;  3AUZ A;  2UUA E;  1I94 E;  4Z7Y A;  4B3R E;  1Z5C A;  1QZR A;  3PYG A;  3T1H I;  4BC9 A;  4M2Z A;  1H74 A;  2B9D A;  5A2Q C;  2Z5C B;  4DR3 I;  4KZS A;  4DR4 I;  5ADZ A;  4JI3 I;  3J80 Q;  4IZJ B;  4DR7 E;  1XHK A;  2L8T A;  2LE2 A;  3QT6 A;  1USU A;  1WUU A;  4M1K A;  4GKJ I;  4DV7 E;  1FI4 A;  2KOU A;  4LF9 I;  2NUF A;  1WXR A;  4J8Z A;  3QT5 A;  2X7I A;  4YHH E;  1FKA E;  1RC7 A;  2LTS A;  4DUZ E;  4DV0 E;  3F0N A;  4LF5 I;  4Q28 A;  1NZ0 A;  2NUE A;  4DPW A;  3P06 A;  3HXL A;  5BR8 E;  2UUC E;  4WPY A;  3RMP A;  1Z0B A;  2LBS B;  4PRV A;  1N34 I;  4KHP I;  4BC7 A;  1J5E I;  4B3M I;  2N3G A;  3C4B A;  2WW4 A;  1HR0 E;  3K1J A;  4F9C B;  2IHR 1;  3D4J A;  2O1V A;  2DIX A;  4DUY I;  4P7D A;  4DV1 E;  3JU0 A;  4K0K I;  4FWD A;  2V2V A;  2YZT A;  2UXD I;  1A6F A;  3GON A;  1YYO A;  2L2M A;  2J7K A;  3QT7 A;  1N0V C;  2XEX A;  1B62 A;  5T6J A;  4IZK A;  2B7T A;  2KHX A;  1Y4U A;  2BM1 A;  2F4V E;  3QT8 A;  4DR5 I;  2M7Q A;  1EA6 A;  3HPS A;  2H36 X;  3LML A;  2VQE I;  3MSW A;  4PU9 A;  1ELO A;  2CPN A;  4JI8 E;  4NXM E;  4LFC E;  1S4E A;  2E5L E;  3F6G A;  2A2C A;  1KVK A;  1ZBT A;  2RTX A;  2UUA I;  1I94 I;  4DPX A;  3OML A;  3ZKD A;  4B3R I;  4GEQ B;  4DV6 E;  3WU5 A;  2KON A;  2HHH E;  3JAM Q;  1HNW E;  4JG4 A;  2M1S A;  4M30 A;  2UXC E;  1J26 A;  1SR9 A;  1XMQ E;  1MG7 A;  1PIE A;  4FWG A;  4X64 E;  2CG9 A;  4DR7 I;  2L92 A;  5LMU E;  4DXL A;  4RPF A;  2IOP A;  1IBL E;  2O1W A;  5A2Q Q;  1RR9 A;  4DV7 I;  3PYE A;  4LF6 E;  4UT4 A;  5AAS A;  4HYM A;  2V88 A;  4I8O A;  1ZM2 A;  4YHH I;  2V8P A;  4DUZ I;  4DV0 I;  1FJG E;  5CFF E;  1N36 E;  4DV3 E;  5BR8 I;  4BCA A;  2FGG A;  1MU5 A;  4AQY E;  1ZM4 A;  1UHZ A;  2UUC I;  2LRS A;  4HY1 A;  2A2D A;  2EWL A;  1HR0 I;  4BBY A;  1HNZ E;  3Q6M A;  4JI1 I;  4BS9 A;  3HQ1 A;  5LL6 R;  1EKZ A;  4LFB E;  4NXN I;  2FTX B;  4F54 A;  1ZXM A;  4DV1 I;  3V2U C;  3H4L A;  2Z5B A;  3WU3 A;  2CGE A;  4FW9 A;  1FNM A;  2DEJ A;  3B8H A;  1ZM3 A;  1N32 E;  2L2K B;  5L3J A;  4X65 E;  1VIS A;  3LLH A;  2NA2 A;  4UTG A;  1ZBQ A;  2L3J A;  3OTO E;  4DR6 E;  1QU6 A;  4DPT A;  2E1R A;  5IT9 C;  2F4V I;  2YT4 A;  4WUD A;  2B3T B;  2L33 A;  4P7A A;  4JI8 I;  4NXM I;  4LFC I;  1H7U A;  2E5L I;  1X49 A;  4JI1 E;  1STU A;  2O1T A;  1N33 E;  3P1X A;  4X8W A;  1GZ6 A;  4ED4 A;  4JI5 E;  4DV2 E;  1Y4S A;  5LMN E;  4JYA E;  4NXN E;  2BM0 A;  2LJH A;  2Z5E A;  4DV6 I;  3ZM7 A;  3V5R A;  2HHH I;  2V83 A;  1B63 A;  1HNW I;  2V2Z A;  4LF8 E;  3J7Y p;  1O0W A;  2UXC I;  3HJC A;  5AE3 A;  3T1Y E;  5DNY A;  4IZK B;  1XMQ I;  3LTO A;  1WHN A;  3ZOQ B;  4LF4 E;  4TUG A;  4X64 I;  4WUB A;  4LF7 E;  2B7V A;  5LMU I;  1XNQ E;  2CZ9 A;  1IBL I;  3JTZ A;  2HKE A;  2GS8 A;  4ZVI A;  4LF6 I;  2LUP B;  3H09 A;  4DU8 A;  1EI1 A;  1FWL A;  1UEK A;  3ZZT A;  1K47 A;  1T4L B;  1XMO E;  2DB2 A;  4JI7 E;  2L2N A;  2WZO A;  2ODR D;  4F9B B;  4WYQ B;  5FLX C;  1FJG I;  4KQV A;  4DV4 E;  2ZM6 E;  2L3C A;  4B3T E;  1N36 I;  4DV3 I;  2JR1 A;  2N3H A;  4JV5 E;  4WSP A;  2JOX A;  4AQY I;  1X48 A;  2G7H A;  1DI2 A;  2V86 A;  2ZBK B;  3PRY A;  4IZJ D;  3ADG A;  1HNX E;  4DR1 E;  2JY9 A;  2ZIT A;  2RSM A;  1HNZ I;  2UU9 E;  4X66 E;  3J81 C;  1MX0 A;  4HAC B;  3IWD A;  4JI4 E;  4LFB I;  3IWC A;  1UIL A;  4OX9 E;  1KIJ A;  3VYX A;  1Y6Z A;  4M0V A;  1IBM E;  1Z0C A;  1N32 I;  2DSY A;  1KTV A;  4DV5 E;  3VYY A;  1Z0T A;  3K17 A;  4X65 I;  2EZ6 A;  4URL A;  2AJ4 A;  1Z59 A;  4LFA E;  3OTO I;  4DR6 I;  4R8O A;  1YYK A;  2JVA A;  1DQ3 A;  2R42 A;  2DEI A;  5IWA E;  3B82 A;  1RQ0 A;  2NPF A;  1KKH A;  4YY3 E;  5GME A;  1NHH A;  4DU7 A;  3J7A G;  5IT9 Q;  1N33 I;  1BKN A;  4DPY A;  4JI5 I;  4DV2 I;  2Z5B B;  5LMN I;  4JYA I;  3K6Q A;  2F8B A;  3HUL A;  4FN5 A;  4MYU A;  1XNR E;  1WHQ A;  1NHJ A;  1IBK E;  4X62 E;  1D6T A;  2V8Q B;  4OOG C;  1Z0V A;  4LF8 I;  3ADI A;  4EMD A;  4I3H A;  3ADJ A;  4JI0 E;  2UXB E;  3C4T A;  3T1Y I;  4LF4 I;  2JOB A;  1DAR A;  2Z5C A;  2Q2E B;  4L5N C;  4LF7 I;  4LTY A;  2UUB E;  2HFS A;  3PYD A;  1XNQ I;  1X47 A;  4JI2 E;  4IZJ A;  4B3S E;  2VQF E;  1YZ9 A;  5FWK A;  3LNU A;  2K4V A;  4WFT A;  1S16 A;  4GKK E;  2ODR C;  4DR2 E;  1H73 A;  3HTX A;  2X36 A;  1XMO I;  2L6M A;  4JI7 I;  2HKJ A;  3KWR A;  1H72 C;  2M4I A;  4XTJ A;  4DV4 I;  2ZM6 I;  4B3T I;  2V89 A;  3T1H E;  2HK2 A;  4BMJ A;  1T4N A;  4JV5 I;  1PVG A;  3J80 C;  2LUQ A;  1T4O A;  3WU6 A;  2V87 A;  2LMZ A;  2LTR A;  5FLX Q;  1HNX I;  4DR3 E;  3HPZ A;  4DR1 I;  4DR4 E;  1Z5B A;  2PNL A;  2UU9 I;  4JI3 E;  4X66 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...