4DV5E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5E02
1XMOI 4LF6I 4HY1A 1FNMA 1GQEA 3LLHA 1N0VC 4WUBA 2R3VA 4DR1I 4B3ME 4LF8E 5IWAI 4YY3E 1EI1A 4FW9A 1MU5A 4DV0I 2HHHE 3OTOE 1X48A 1J5EI 4LF7E 1FI4A 3F0NA 1H7UA 2XEXA 5LMUI 4JI6E 2UUCE 4RPFA 3JAMQ 1ZXNA 2E1RA 4DV2I 2CPNA 4DV1I 4DV4E 2A2CA 3B8HA 1ZXMA 4DR3I 4HACB 5IT9C 3QT6A 2BM0A 3LNUA 4LF7I 4WUCA 3WU4A 2VQFE 5LMNE 1Z0BA 4JI0I 2ZBKB 1RC7A 4B3MI 1FKAE 1Z0VA 4URLA 4FWHA 4LF5E 2RS6A 2X36A 2GS8A 1FJGE 3GONA 4JI3E 4UT4A 1XMOE 4AQYE 4LF6E 1IBME 1I94I 4NXNI 1XNQE 4B3RE 1KIJA 3QT7A 1PKPA 3VYXA 1RREA 3J7AG 4KHPI 1EA6A 2CZ9A 4K0KE 1UEKA 4JI7E 2V34A 2N3HA 2ZM6E 1D6TA 2DB2A 4X64I 1NHIA 4GKJI 4X62I 4JI5I 4DV6I 4M30A 1HNXI 4WYQB 3T1YI 1IBLE 2VQFI 5LMNI 1UILA 2B7TA 1DI2A 4DPWA 4YHHI 5FLXQ 4LF4E 1N33E 1U2RA 4DR4I 4JI0E 2ZITA 2DMYA 4Z7YA 1KTVA 3V2UC 4B3SI 2UUAI 4DR2E 2UXCI 1NHHA 1H7SA 4OX9E 1ZBTA 1HR0I 4DV2E 4DR7I 4DUYI 2HKJA 1N34I 4B3SE 3HTXA 2V8PA 3OTOI 1XNRE 4JI6I 2UXBE 3WU3A 4P52A 2NUFA 4DV7I 3LTOA 4NXMI 2UU9E 4P7AA 1N36I 1PIEA 1XNRI 2L2NA 3D4JA 4MYTA 2L2KB 4PRXA 2NUEA 4JV5I 1ELOA 1HR0E 1NZ0A 4I3HA 4DR1E 3PYEA 4DUZE 3ADLA 1HNWE 2OI2A 4Z7CA 2BV3A 1KVKA 4HYMA 4DV3E 3B82A 2V2ZA 2E5LI 2HFSA 3ZM7A 4LFCE 4X65E 2LRSA 4YHHE 5CFFE 3QT8A 5BR8I 4GKKE 3J80C 1ZM3A 1HNZE 1ZM2A 3J7AM 4PRVA 4JI4I 4JI1E 2HK2A 2L2MA 3ADGA 4X62E 4M1KA 2LJHA 2A2DA 2F4VI 2YT4A 4DXLA 4HXZA 4JI2E 1S4EA 4LFAI 3VYYA 1FWLA 4DPUA 2JY9A 2J7KA 1WHQA 4DR6E 3ZKDA 3ADJA 3HULA 1T4NA 3WU5A 4UTGA 4DV5I 1STUA 4EMDA 1BKNA 3B78A 4FN5A 4LFCI 4X65I 4WFTA 1YYWA 5GMEA 5GMDA 2LBSB 1N32E 3WU6A 1FJGI 1Z5AA 2LUPB 4JYAI 1RQ0A 1H74A 1RR9A 1HNWI 2NA2A 4B3TE 2EFGA 3PYGA 5LMUE 2B7VA 4JV5E 2KHXA 1EKZA 4NXME 2L3CA 2NPFA 1X49A 2HHHI 3LPSA 1UHZA 2UU9I 2R42A 2RTXA 1MG7A 4JYAE 4DV4I 4DPXA 1N32I 2V2VA 2LTRA 5IT9Q 1YZ9A 1FWKA 2HK3A 4USMA 3J81Q 3ZZUA 4PU9A 2X7IA 1DARA 4DPYA 2AJ4A 2UUBE 4MYUA 4DV5E 3J80Q 3JAMC 2V2QA 1A6FA 2DEIA 5IWAE 4LF8I 3ZZTA 3T1HI 2IHR1 1XHKA 1QZRA 4KQVA 1KKHA 4X64E 2ZM6I 4JI1I 1J26A 1HNXE 4DV6E 2LUQA 3ZZ0A 4DU8A 4JI7I 1Z0TA 3C4BA 4K0KI 3T1HE 4X66E 5A2QC 2UUBI 1NHJA 2E5LE 4LFBE 2LTSA 3J7Yp 1H72C 4NXNE 2DIXA 4R1FA 4X8WA 1YYKA 1MX0A 2UXDI 4DU7A 1Z5BA 4HACA 1ZM4A 3P1XA 1Z0EA 1Z0WA 3Q1QA 1I94E 3K17A 3ADIA 4AQYI 1H73A 5L3JA 2VF3A 3V5RA 2BM1A 1O0WA 4LF9I 1T4LB 4DV7E 1B63A 1N0UA 1B62A 4XTJA 1Z0GA 1N36E 1XMQE 1OJ4A 4DUYE 2VQEI 2L33A 4DR3E 5FLXC 2UXBI 1QU6A 1WUUA 1Z59A 4DV1E 4FWGA 4B3TI 1N34E 1IBKE 2Q2EB 1IBKI 4DR7E 1T4OA 4OX9I 2WW4A 3PYFA 1K47A 2VQEE 4DPTA 2UXCE 2HKEA 4DR2I 3PYDA 2UUAE 2LJPA 5A2QQ 2NUGA 4ZVIA 4M2ZA 4FWDA 1XMQI 4WUDA 1YYOA 1VISA 1Z5CA 4LF4I 2EZ6A 1Z0CA 4DV0E 4DKKA 2UUCI 4USKA 4LFBI 3ZKBA 4LF9E 4DR6I 1J5EE 4YY3I 4DR4E 1IBLI 1N33I 2DEJA 4JI5E 2RSMA 4JG4A 1ZM9A 4JI2I 2HFUA 3QT5A 4JI4E 3T1YE 2JVAA 4LFAE 3CWVA 2RS7A 4GKJE 1WHNA 3K1JA 4GKKI 2F4VE 4DR5I 2MDRA 2UXDE 4ED4A 3M6AA 4OOGC 1HNZI 4KHPE 2N3GA 3C4TA 5BR8E 1XNQI 4B3RI 3J81C 5LL6R 4JI8E 4JI8I 4X66I 1X47A 2B3TB 4JI3I 4DR5E 1PVGA 4DV3I 1S16A 4DUZI 3H4LA 1IBMI 4LF5I 2L3JA
chains in the Genus database with same CATH superfamily
5KL5A 1XMOI 4LF6I 2EPOA 4HY1A 1FNMA 4OO1D 5K36A 3ZOQB 4FW3A 1GQEA 2V88A 3LLHA 2JYAA 1UDSA 4F2JC 1N0VC 2ENCA 4WUBA 1RHYA 3THNA 2E72A 4NHRA 2R3VA 3P06A 4DR1I 4B3ME 1USUA 2Z5CA 2EM9A 2EN6A 5JEAF 4LF8E 4OO1A 5IWAI 3M85D 2EPPA 5AASA 4YY3E 2RPCA 3F6GA 2EOFA 2EOSA 2H36X 4RHBB 4R2AA 4F6NA 1EI1A 4FW9A 1MU5A 2PO1A 2EL4A 3HKMA 4DV0I 1MGTA 2LE2A 2HHHE 1Y4UA 2M9AA 3OTOE 1X48A 1TF6A 4DMIA 1UBDC 1J5EI 1X6FA 4LF7E 2PNMA 1FI4A 4P7DA 1YHCA 4P78A 3F0NA 4QNKA 4GZNC 1H7UA 2XEXA 5LMUI 4JI6E 2UUCE 4HEIA 2D9HA 1ZXNA 4IZJA 4RPFA 3JAMQ 2HJJA 5A6BA 4MU0A 2E1RA 2YPNA 2EOMA 2VRDA 4N4RB 3BIDA 3K85A 4F9CB 4DV2I 3K6QA 2CPNA 4BHBA 4DV1I 1KYQA 4DV4E 3IWCA 2V83A 2I13A 2A2CA 1OYRA 1DQ3A 1ZXMA 3B8HA 4DR3I 2JEBA 4HACB 3QG5C 2YRKA 4BHCA 2O3ZA 5IT9C 3QT6A 5IV8B 4BA2B 1BB8A 1E3HA 2BM0A 2NN6A 2JWOA 2EM5A 4R2CA 5K36D 3LNUA 4LF7I 1RMDA 3P3GA 2ADRA 4WUCA 2ZBKB 2VQFE 5LMNE 1Z0BA 4JI0I 3WU4A 1RC7A 4B3MI 2GPIA 4BA1A 5A6BD 2CGEA 2EPMX 2GQ0A 1FKAE 4TUGA 1Z0VA 4URLA 2ENHA 1L4SA 4FWHA 5K36E 2K7IA 2EPLX 2EP3A 4LF5E 1R6MA 5C0XD 2RS6A 2X36A 2GS8A 1USVA 1FJGE 1WJPA 2YTDA 4R8OA 3GONA 2DSYA 2O1TA 4JI3E 1G2FC 2VESA 4KWYA 4BMJA 1T38A 3L7ZA 4UT4A 4OO1E 2JP9A 1XMOE 4AQYE 2GLIA 4LF6E 1IBME 1I94I 2JE6B 4NXNI 4IZKA 3M99B 1XNQE 2EMXA 4B3RE 3PRYA 4OO1B 1KIJA 2J65A 2I9IA 3QT7A 1PKPA 3VYXA 1EH6A 3J7AG 1RREA 4BCAA 3L00A 4KHPI 2PNLA 1EA6A 2CZ9A 2M7QA 2VF1A 2YSPA 3H1CA 1GTKA 5DNYA 4K0KE 2LVHA 5DRRA 1UEKA 2WP8A 4Q28A 4JI7E 2EN1A 4AM3A 5LLQA 4WX9A 2JR1A 1N3GA 5TSEA 2V34A 2N3HA 2ZM6E 3CDIA 1D6TA 2DB2A 4X64I 5FWKA 2EMGA 1SR9A 1NHIA 3PS1A 1PJTA 4GKJI 4X62I 4JI5I 5K36B 4DV6I 4M30A 1HNXI 4R03A 2JOXA 3Q6NA 4WYQB 3T1YI 1IBLE 2BA0G 2VQFI 5LMNI 1UILA 2B7TA 1DI2A 2Q8UA 4DPWA 1DGCA 3CDJA 4KZSA 2EPAA 4YHHI 5FLXQ 4LF4E 4R2DA 4WXCA 1N33E 5A6AA 1U2RA 4DR4I 2DLQA 4JI0E 2ZITA 2PNZB 3JTZA 2EM2A 2M1SA 2DMYA 1Z1BA 2R1FA 2C38B 2EN2A 4Z7YA 1KTVA 3V2UC 1KJKA 2FTXB 2EMFA 5A6KA 2UUAI 4B3SI 1UDOA 4DR2E 2UXCI 1NHHA 4ISAA 1H7SA 2PRTA 1EH7A 3DD6A 2L8TA 3FIGA 4OX9E 4BC7A 1ZBTA 1TF3A 2E1MA 1HR0I 4DV2E 4DR7I 5AE3A 4DUYI 1UDNA 2HKJA 1N34I 4B3SE 3HTXA 2EPNA 1YFHA 2V8PA 3OTOI 4LTYA 4Q35B 2VE7C 1XNRE 2V85A 4JI6I 2UXBE 5JEAD 1OYPA 3WU3A 4P52A 2EJ4A 2CSHA 4BC9A 2NUFA 3U1KA 4DV7I 1F2IG 3LTOA 2JEAA 4NXMI 3P3CA 2UU9E 4P7AA 1A1GA 1N36I 2MKDA 3HQ1A 1PIEA 1XNRI 1X6HA 2M4IA 2YTQA 2L2NA 2L6MA 5AE1A 3D4JA 4MYTA 2L92A 2L2KB 2EPZA 4PRXA 2NUEA 3EPKA 4OKGA 1ELOA 4JV5I 1HR0E 2WZOA 1NZ0A 4O24A 3JU0A 1X6EA 3RMPA 3EPHA 5C0XC 2EMKA 4I3HA 4DR1E 3PYEA 4NZVA 2LO3A 3EQ1A 4DUZE 3ADLA 2DLKA 2EMCA 2EMWA 1HNWE 1UDQA 1YUJA 2OI2A 4Z7CA 2EOYA 2BV3A 4J8ZA 1TN9A 4R2SA 1MEYC 1KVKA 2C39B 4HYMA 5KL3A 4DV3E 2IESA 1ZAAC 4O4KA 3B82A 2EN7A 1LLMC 4M9VC 4MU3A 2V2ZA 5K36C 4U3DA 2E5LI 2HFSA 2C37A 2YTOA 1A1IA 3ZM7A 4X65E 4FK5C 4LFCE 2LRSA 2EWLA 5CFFE 4YHHE 1ZU1A 2J7JA 3LMLA 3QT8A 5BR8I 4GKKE 3HJCA 4R2RA 3J80C 2YZTA 2LJUA 1ZM3A 4GQUA 4RH8A 5JEAC 2WBSA 1HNZE 4ZYDA 1ZM2A 3UHMA 4PRVA 5C0XF 4JI1E 2YWQA 4JI4I 2HK2A 3J7AM 2L2MA 3ADGA 2EOEA 4X62E 4M1KA 4BA1B 2LJHA 2A2DA 1WRJA 2F4VI 4IZKB 1IMUA 1QNTA 2YT4A 4DXLA 4HXZA 4JI2E 1S4EA 4M0VA 2PO2B 2ELZA 2EM6A 4ZYEA 4BBYA 4LFAI 3VYYA 3PS2A 3F6HA 1FWLA 2YTJA 4DPUA 1AAYA 2JY9A 4X9JA 1WHQA 4DR6E 2GO4A 1PDAA 3ADJA 2J7KA 3ZKDA 4GEQB 3HULA 1T4NA 3WU5A 4IFDE 4UTGA 1BBGA 4DV5I 3P3EA 1STUA 4FW5A 2ELYA 1IQOA 4LCFA 4EMDA 2G7HA 4BA2A 3EPLA 3KZZA 1BKNA 2O1VA 5ELWA 5C0XE 3L7ZB 3B78A 4FN5A 1OYSA 4LFCI 4X65I 3DF6A 2B9DA 4HTGA 4WFTA 4IS1C 1YYWA 2NN6B 5GMEA 5GMDA 2PO1B 2LBSB 1ZBQA 1JK2A 2EN3A 1N32E 3WU6A 4IZJB 1FJGI 3PS3A 1Z5AA 2LUPB 4OO1C 4BS9A 4F6MA 5KL4A 2IOPA 4MU1A 4U3BA 4F54A 2AE8A 4JYAI 3GLLA 1RQ0A 2V8QB 4WSPA 5KL7A 2RSIA 1H74A 1RR9A 3M7ND 1HNWI 1BBOA 4N3OA 1HK7A 2NA2A 3AUZA 2JE6A 4B3TE 2EOJA 2GHFA 5DRPA 2V86A 2LCEA 3DJWA 2EFGA 3PYGA 2YU5A 3VHTB 5LMUE 2WNRB 2B7VA 5AC5A 4MU4A 4IFDD 4JV5E 2BR2B 3VK6A 2KHXA 2RQLA 2ODRD 1EKZA 2MKNA 4NXME 4LCHA 2L3CA 2NPFA 2EN4A 4O5GA 1X49A 5C0XB 4MLVA 2Z5BA 2HHHI 4FW4A 4J3DA 3LPSA 5JEAA 1UHZA 1Y4SA 2UU9I 3KZYA 1P47A 2R42A 2O1UA 2EOOA 2RTXA 1MG7A 2MC6A 3H09A 5AC4A 1Y5YA 5DROA 2WBUA 4JYAE 4F9BB 3M7NG 4DV4I 4DPXA 5KL6A 2BA1D 2O1WA 2EPRA 1N32I 2V2VA 2LTRA 1B69A 5IT9Q 1YZ9A 2F1DA 3EPJA 1FWKA 2CVEA 2HK3A 2CG9A 4USMA 1T39A 3TQMA 1A1LA 4R2EA 1X3CA 3J81Q 3M85G 3ZZUA 2K4VA 4PU9A 3ECRA 2EPKX 2X7IA 1GZ6A 4IFDA 2KOUA 1DARA 4LPFA 2YTEA 2JOBA 4DPYA 1UN6B 2AJ4A 2EMZA 5JEAB 2UUBE 4MYUA 2BA0D 4DV5E 4WXDA 3IWDA 2YSOA 3J80Q 3IWBA 3JAMC 2EMAA 4L8NA 2R76A 3MHSC 2YTNA 2JEBB 2ENAA 2EOIA 2V2QA 4WPYA 1A6FA 2DEIA 2EORA 5IWAE 2EOXA 2YU8A 3NZKA 4LF8I 3ZZTA 2BBGA 3T1HI 2IHR1 1XHKA 2EPCA 1QZRA 4KQVA 1A1JA 2C38A 5DNXA 1KKHA 3Q6MA 4X64E 2WNRA 4OO1F 1Y6ZA 2ZM6I 1A1HA 3P76A 4JI1I 2EPXA 3HXLA 1J26A 1HNXE 1IQSA 4DV6E 2LUQA 3ZZ0A 3AV0A 4DU8A 1YSAC 2EM4A 4JI7I 1Z0TA 2JT2A 2YTPA 5IXMB 3C4BA 3MHHC 2PO0A 2PO2A 4K0KI 2EM3A 3T1HE 4X66E 5A2QC 2UUBI 2C39A 4ZYGA 1NHJA 2E5LE 1VI7A 4R2PA 4LFBE 2LTSA 2YRMA 3HPZA 2YTGA 3J7Yp 2BR2A 2EOQA 1H72C 1YUIA 2EQ0A 4NXNE 2DIXA 4WSGA 2A25A 4R1FA 1A1KA 4X8WA 1YYKA 1MX0A 2EPUA 3KRNA 2UXDI 4DU7A 1Z5BA 4HACA 1ZM4A 3P1XA 1Z0EA 5DRQA 2EQ1A 3BBGA 2EOHA 4MQYA 1Z0WA 2NN6E 3Q1QA 1I94E 3K17A 3ADIA 5C0XA 4AQYI 2EL6A 2YRHA 4QNJA 2EMHA 4MDTA 2JXPA 2V87A 2LMZA 1H73A 3HPSA 5L3JA 2EM8A 2EMIA 2HGHA 2VF3A 5T6JA 3V5RA 2EMLA 4TUIA 2LV2A 2V89A 2BM1A 5K36F 1O0WA 4LF9I 1A1FA 2IERA 3C6KA 1T4LB 4DV7E 1B63A 2PO0B 1N0UA 1R6LA 3GMEA 1B62A 5A6JA 2DGCA 4XTJA 1Z0GA 3THOB 3UK3C 1XMQE 1N36E 1E3PA 5ADZA 2HC5A 4LCGA 2FV4B 2MDGA 1OJ4A 2LT7A 4DUYE 3C6MA 5AE2A 5F3WA 2VQEI 2L33A 2JPAA 4DR3E 5FLXC 2Z5CB 4NBQA 3U1YA 2UXBI 1QU6A 3BGHA 1WUUA 1Z59A 4DV1E 4I8OA 4FWGA 4FW7A 2NABA 4B3TI 1N34E 1JK1A 1IBKE 2Q2EB 2Z5EA 1IBKI 4DR7E 2EOZA 1T4OA 4R2QA 1YH8A 2KONA 3MSWA 4LOMA 2WW4A 1ZR9A 5EL9A 4OX9I 5EKWA 2YTIA 1NCSA 3PYFA 1K47A 5DNLA 2VQEE 4DPTA 2UXCE 2HKEA 4DR2I 2WP8B 3PYDA 2FGGA 2UUAE 2LJPA 2DRPA 5A2QQ 2YTFA 2NUGA 4IJDA 1YPNA 4M2ZA 4FWDA 4ZVIA 4WUDA 1XMQI 2CTDA 2NN6C 1YYOA 1VISA 1Z5CA 4LF4I 2EZ6A 1Z0CA 2EE8A 4DKKA 4DV0E 2IOQA 2UUCI 4IFDF 4MLQA 4USKA 2DMIA 2EM0A 1Y60A 4LFBI 3ZKBA 4LF9E 1PJSA 4DR6I 1J5EE 1XXEA 1NEIA 3KWRA 2N8XA 4AIDA 4DR4E 3GCMA 4YY3I 1IBLI 1N33I 2NN6D 2DEJA 4JI5E 4FW6A 2RSMA 1PJQA 2WBTA 2EMYA 1ZM9A 4JG4A 4JI2I 2EN8A 2JEAB 1G2DC 2HFUA 4LU9A 3QT5A 4JI4E 5A69A 5JEAE 2BA1G 3T1YE 2JVAA 2C37B 4LFAE 3B4TA 4AIMA 3CWVA 2RS7A 4F9AB 4GKJE 1WHNA 2PNZA 3K1JA 4GKKI 2F4VE 4DR5I 1X5WA 2MDRA 2UXDE 2EM7A 4ED4A 1WXRA 5KL2A 3M6AA 3OMLA 4OZEA 4OOGC 1HNZI 2EQ3A 2EMBA 4KHPE 2N3GA 4ZYHA 3BF2A 3C4TA 2EL5A 4IZJD 1AH5A 1P42A 2GO3A 2F8BA 2ODRC 5BR8E 1XNQI 4B3RI 3J81C 5LL6R 4IFDC 1EH8A 4O43A 4JI8E 4JI8I 4L5NC 4X66I 1X47A 1SFEA 2B3TB 4JI3I 2WCC3 2CT1A 2Z5BB 4DR5E 1PVGA 2MC5A 4DV3I 2NN6F 1S16A 4DUZI 3H4LA 2BB8A 4IFDB 1IBMI 4IS9A 4LF5I 2L3JA
chains in the Genus database with same CATH topology
1XMOI 4LF6I 4HY1A 1FNMA 3ZOQB 1GQEA 2V88A 3LLHA 1N0VC 4WUBA 2R3VA 3P06A 4DR1I 4B3ME 1USUA 2Z5CA 4LF8E 5IWAI 5AASA 4YY3E 3F6GA 2H36X 1EI1A 4FW9A 1MU5A 4DV0I 2LE2A 2HHHE 1Y4UA 3OTOE 1X48A 4DMIA 1J5EI 4LF7E 2PNMA 1FI4A 4P7DA 4P78A 3F0NA 1H7UA 2XEXA 5LMUI 4JI6E 2UUCE 4IZJA 4RPFA 1ZXNA 3JAMQ 2E1RA 3K85A 4F9CB 4DV2I 3K6QA 2CPNA 4DV1I 4DV4E 3IWCA 2V83A 2A2CA 1DQ3A 1ZXMA 3B8HA 4DR3I 4HACB 5IT9C 3QT6A 2BM0A 2JWOA 3LNUA 4LF7I 4WUCA 2ZBKB 2VQFE 5LMNE 1Z0BA 4JI0I 3WU4A 1RC7A 4B3MI 2CGEA 2GQ0A 1FKAE 4TUGA 1Z0VA 4URLA 4FWHA 4LF5E 2RS6A 2X36A 2GS8A 1USVA 1FJGE 4R8OA 3GONA 2DSYA 2O1TA 4JI3E 4BMJA 4UT4A 1XMOE 4AQYE 4LF6E 1IBME 1I94I 4NXNI 4IZKA 1XNQE 4B3RE 3PRYA 1KIJA 3QT7A 1PKPA 3VYXA 3J7AG 1RREA 4BCAA 4KHPI 2PNLA 1EA6A 2CZ9A 2VF1A 2M7QA 5DNYA 4K0KE 1UEKA 4Q28A 4JI7E 2JR1A 2V34A 2N3HA 2ZM6E 1D6TA 2DB2A 4X64I 5FWKA 1SR9A 1NHIA 4GKJI 4X62I 4JI5I 4DV6I 4M30A 1HNXI 4R03A 2JOXA 3Q6NA 4WYQB 3T1YI 1IBLE 2VQFI 5LMNI 1UILA 2B7TA 1DI2A 4DPWA 4KZSA 4YHHI 5FLXQ 4LF4E 1N33E 1U2RA 4DR4I 4JI0E 2ZITA 3JTZA 2M1SA 2DMYA 4Z7YA 1KTVA 3V2UC 2FTXB 4B3SI 2UUAI 4DR2E 2UXCI 1NHHA 1H7SA 2L8TA 3FIGA 4OX9E 4BC7A 1ZBTA 2E1MA 1HR0I 4DV2E 4DR7I 5AE3A 4DUYI 2HKJA 1N34I 4B3SE 3HTXA 2V8PA 3OTOI 4LTYA 2VE7C 1XNRE 2V85A 4JI6I 2UXBE 3WU3A 4P52A 4BC9A 2NUFA 4DV7I 3LTOA 4NXMI 2UU9E 4P7AA 1N36I 3HQ1A 1PIEA 1XNRI 2M4IA 2L2NA 2L6MA 5AE1A 3D4JA 4MYTA 2L92A 2L2KB 4PRXA 2NUEA 4JV5I 1ELOA 1HR0E 2WZOA 1NZ0A 3JU0A 3RMPA 4I3HA 4DR1E 3PYEA 4DUZE 3ADLA 1HNWE 2OI2A 4Z7CA 2BV3A 4J8ZA 1KVKA 4HYMA 4DV3E 3B82A 2V2ZA 2E5LI 2HFSA 3ZM7A 4LFCE 4X65E 2LRSA 2EWLA 5CFFE 4YHHE 3LMLA 3QT8A 5BR8I 4GKKE 3HJCA 3J80C 2YZTA 1ZM3A 1HNZE 1ZM2A 3J7AM 4PRVA 4JI4I 4JI1E 2HK2A 2L2MA 3ADGA 4X62E 4M1KA 2LJHA 2A2DA 2F4VI 4IZKB 2YT4A 4DXLA 4HXZA 4JI2E 1S4EA 4M0VA 4BBYA 4LFAI 3VYYA 3F6HA 1FWLA 4DPUA 2JY9A 2J7KA 1WHQA 4DR6E 3ZKDA 3ADJA 4GEQB 3HULA 1T4NA 3WU5A 4UTGA 4DV5I 1STUA 4EMDA 2G7HA 1BKNA 2O1VA 3B78A 4FN5A 4LFCI 4X65I 3DF6A 2B9DA 4WFTA 1YYWA 5GMEA 5GMDA 2LBSB 1ZBQA 1N32E 3WU6A 1FJGI 4IZJB 1Z5AA 2LUPB 4BS9A 2IOPA 4F54A 4JYAI 1RQ0A 2V8QB 4WSPA 1H74A 1RR9A 1HNWI 4N3OA 1HK7A 2NA2A 3AUZA 4B3TE 2V86A 2EFGA 3DJWA 3PYGA 5LMUE 2B7VA 4JV5E 3VK6A 2KHXA 2ODRD 1EKZA 4NXME 2L3CA 2NPFA 1X49A 2Z5BA 2HHHI 3LPSA 1UHZA 1Y4SA 2UU9I 2R42A 2O1UA 2RTXA 1MG7A 2MC6A 3H09A 4JYAE 4F9BB 4DV4I 4DPXA 2O1WA 1N32I 2V2VA 2LTRA 5IT9Q 1YZ9A 1FWKA 2HK3A 2CG9A 4USMA 3J81Q 3ZZUA 2K4VA 4PU9A 2X7IA 1GZ6A 2KOUA 1DARA 4DPYA 2JOBA 2AJ4A 2UUBE 4MYUA 4DV5E 3IWDA 3J80Q 3IWBA 3JAMC 4L8NA 2V2QA 4WPYA 1A6FA 2DEIA 5IWAE 4LF8I 3ZZTA 3T1HI 2IHR1 1XHKA 1QZRA 4KQVA 1KKHA 3Q6MA 4X64E 1Y6ZA 2ZM6I 4JI1I 3HXLA 1J26A 1HNXE 4DV6E 2LUQA 3ZZ0A 3AV0A 4DU8A 4JI7I 1Z0TA 3C4BA 4K0KI 3T1HE 4X66E 5A2QC 2UUBI 1NHJA 2E5LE 4LFBE 2LTSA 3HPZA 3J7Yp 1H72C 4NXNE 2DIXA 4R1FA 4X8WA 1YYKA 1MX0A 2UXDI 4DU7A 1Z5BA 4HACA 1ZM4A 3P1XA 1Z0EA 1Z0WA 3Q1QA 1I94E 3K17A 3ADIA 4AQYI 2V87A 1H73A 2LMZA 3HPSA 5L3JA 2VF3A 5T6JA 3V5RA 4TUIA 2V89A 2BM1A 1O0WA 4LF9I 1T4LB 4DV7E 1B63A 1N0UA 1B62A 4XTJA 1Z0GA 1N36E 1XMQE 5ADZA 2FV4B 1OJ4A 4DUYE 5AE2A 5F3WA 2VQEI 2L33A 4DR3E 5FLXC 2Z5CB 2UXBI 1QU6A 1WUUA 1Z59A 4DV1E 4I8OA 4FWGA 4B3TI 1N34E 1IBKE 2Q2EB 2Z5EA 1IBKI 4DR7E 1T4OA 2KONA 3MSWA 4OX9I 2WW4A 3PYFA 1K47A 2VQEE 4DPTA 2UXCE 2HKEA 4DR2I 3PYDA 2FGGA 2UUAE 2LJPA 5A2QQ 2NUGA 4M2ZA 4FWDA 4ZVIA 1XMQI 4WUDA 1YYOA 1VISA 1Z5CA 4LF4I 2EZ6A 1Z0CA 4DV0E 4DKKA 2IOQA 2UUCI 4USKA 4LFBI 3ZKBA 4LF9E 4DR6I 1J5EE 3KWRA 4YY3I 4DR4E 1IBLI 1N33I 2DEJA 4JI5E 2RSMA 4JG4A 1ZM9A 4JI2I 2HFUA 4LU9A 3QT5A 4JI4E 3T1YE 2JVAA 4LFAE 3CWVA 2RS7A 4F9AB 4GKJE 1WHNA 3K1JA 4GKKI 2F4VE 4DR5I 2MDRA 2UXDE 4ED4A 1WXRA 3M6AA 3OMLA 4OOGC 1HNZI 4KHPE 2N3GA 3C4TA 4IZJD 2F8BA 2ODRC 5BR8E 1XNQI 4B3RI 3J81C 5LL6R 4JI8E 4JI8I 4L5NC 4X66I 1X47A 2B3TB 4JI3I 2Z5BB 4DR5E 1PVGA 2MC5A 4DV3I 1S16A 4DUZI 3H4LA 1IBMI 4LF5I 2L3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO I;  4LF6 I;  4HY1 A;  1FNM A;  1GQE A;  3LLH A;  1N0V C;  4WUB A;  2R3V A;  4DR1 I;  4B3M E;  4LF8 E;  5IWA I;  4YY3 E;  1EI1 A;  4FW9 A;  1MU5 A;  4DV0 I;  2HHH E;  3OTO E;  1X48 A;  1J5E I;  4LF7 E;  1FI4 A;  3F0N A;  1H7U A;  2XEX A;  5LMU I;  4JI6 E;  2UUC E;  4RPF A;  3JAM Q;  1ZXN A;  2E1R A;  4DV2 I;  2CPN A;  4DV1 I;  4DV4 E;  2A2C A;  3B8H A;  1ZXM A;  4DR3 I;  4HAC B;  5IT9 C;  3QT6 A;  2BM0 A;  3LNU A;  4LF7 I;  4WUC A;  3WU4 A;  2VQF E;  5LMN E;  1Z0B A;  4JI0 I;  2ZBK B;  1RC7 A;  4B3M I;  1FKA E;  1Z0V A;  4URL A;  4FWH A;  4LF5 E;  2RS6 A;  2X36 A;  2GS8 A;  1FJG E;  3GON A;  4JI3 E;  4UT4 A;  1XMO E;  4AQY E;  4LF6 E;  1IBM E;  1I94 I;  4NXN I;  1XNQ E;  4B3R E;  1KIJ A;  3QT7 A;  1PKP A;  3VYX A;  1RRE A;  3J7A G;  4KHP I;  1EA6 A;  2CZ9 A;  4K0K E;  1UEK A;  4JI7 E;  2V34 A;  2N3H A;  2ZM6 E;  1D6T A;  2DB2 A;  4X64 I;  1NHI A;  4GKJ I;  4X62 I;  4JI5 I;  4DV6 I;  4M30 A;  1HNX I;  4WYQ B;  3T1Y I;  1IBL E;  2VQF I;  5LMN I;  1UIL A;  2B7T A;  1DI2 A;  4DPW A;  4YHH I;  5FLX Q;  4LF4 E;  1N33 E;  1U2R A;  4DR4 I;  4JI0 E;  2ZIT A;  2DMY A;  4Z7Y A;  1KTV A;  3V2U C;  4B3S I;  2UUA I;  4DR2 E;  2UXC I;  1NHH A;  1H7S A;  4OX9 E;  1ZBT A;  1HR0 I;  4DV2 E;  4DR7 I;  4DUY I;  2HKJ A;  1N34 I;  4B3S E;  3HTX A;  2V8P A;  3OTO I;  1XNR E;  4JI6 I;  2UXB E;  3WU3 A;  4P52 A;  2NUF A;  4DV7 I;  3LTO A;  4NXM I;  2UU9 E;  4P7A A;  1N36 I;  1PIE A;  1XNR I;  2L2N A;  3D4J A;  4MYT A;  2L2K B;  4PRX A;  2NUE A;  4JV5 I;  1ELO A;  1HR0 E;  1NZ0 A;  4I3H A;  4DR1 E;  3PYE A;  4DUZ E;  3ADL A;  1HNW E;  2OI2 A;  4Z7C A;  2BV3 A;  1KVK A;  4HYM A;  4DV3 E;  3B82 A;  2V2Z A;  2E5L I;  2HFS A;  3ZM7 A;  4LFC E;  4X65 E;  2LRS A;  4YHH E;  5CFF E;  3QT8 A;  5BR8 I;  4GKK E;  3J80 C;  1ZM3 A;  1HNZ E;  1ZM2 A;  3J7A M;  4PRV A;  4JI4 I;  4JI1 E;  2HK2 A;  2L2M A;  3ADG A;  4X62 E;  4M1K A;  2LJH A;  2A2D A;  2F4V I;  2YT4 A;  4DXL A;  4HXZ A;  4JI2 E;  1S4E A;  4LFA I;  3VYY A;  1FWL A;  4DPU A;  2JY9 A;  2J7K A;  1WHQ A;  4DR6 E;  3ZKD A;  3ADJ A;  3HUL A;  1T4N A;  3WU5 A;  4UTG A;  4DV5 I;  1STU A;  4EMD A;  1BKN A;  3B78 A;  4FN5 A;  4LFC I;  4X65 I;  4WFT A;  1YYW A;  5GME A;  5GMD A;  2LBS B;  1N32 E;  3WU6 A;  1FJG I;  1Z5A A;  2LUP B;  4JYA I;  1RQ0 A;  1H74 A;  1RR9 A;  1HNW I;  2NA2 A;  4B3T E;  2EFG A;  3PYG A;  5LMU E;  2B7V A;  4JV5 E;  2KHX A;  1EKZ A;  4NXM E;  2L3C A;  2NPF A;  1X49 A;  2HHH I;  3LPS A;  1UHZ A;  2UU9 I;  2R42 A;  2RTX A;  1MG7 A;  4JYA E;  4DV4 I;  4DPX A;  1N32 I;  2V2V A;  2LTR A;  5IT9 Q;  1YZ9 A;  1FWK A;  2HK3 A;  4USM A;  3J81 Q;  3ZZU A;  4PU9 A;  2X7I A;  1DAR A;  4DPY A;  2AJ4 A;  2UUB E;  4MYU A;  4DV5 E;  3J80 Q;  3JAM C;  2V2Q A;  1A6F A;  2DEI A;  5IWA E;  4LF8 I;  3ZZT A;  3T1H I;  2IHR 1;  1XHK A;  1QZR A;  4KQV A;  1KKH A;  4X64 E;  2ZM6 I;  4JI1 I;  1J26 A;  1HNX E;  4DV6 E;  2LUQ A;  3ZZ0 A;  4DU8 A;  4JI7 I;  1Z0T A;  3C4B A;  4K0K I;  3T1H E;  4X66 E;  5A2Q C;  2UUB I;  1NHJ A;  2E5L E;  4LFB E;  2LTS A;  3J7Y p;  1H72 C;  4NXN E;  2DIX A;  4R1F A;  4X8W A;  1YYK A;  1MX0 A;  2UXD I;  4DU7 A;  1Z5B A;  4HAC A;  1ZM4 A;  3P1X A;  1Z0E A;  1Z0W A;  3Q1Q A;  1I94 E;  3K17 A;  3ADI A;  4AQY I;  1H73 A;  5L3J A;  2VF3 A;  3V5R A;  2BM1 A;  1O0W A;  4LF9 I;  1T4L B;  4DV7 E;  1B63 A;  1N0U A;  1B62 A;  4XTJ A;  1Z0G A;  1N36 E;  1XMQ E;  1OJ4 A;  4DUY E;  2VQE I;  2L33 A;  4DR3 E;  5FLX C;  2UXB I;  1QU6 A;  1WUU A;  1Z59 A;  4DV1 E;  4FWG A;  4B3T I;  1N34 E;  1IBK E;  2Q2E B;  1IBK I;  4DR7 E;  1T4O A;  4OX9 I;  2WW4 A;  3PYF A;  1K47 A;  2VQE E;  4DPT A;  2UXC E;  2HKE A;  4DR2 I;  3PYD A;  2UUA E;  2LJP A;  5A2Q Q;  2NUG A;  4ZVI A;  4M2Z A;  4FWD A;  1XMQ I;  4WUD A;  1YYO A;  1VIS A;  1Z5C A;  4LF4 I;  2EZ6 A;  1Z0C A;  4DV0 E;  4DKK A;  2UUC I;  4USK A;  4LFB I;  3ZKB A;  4LF9 E;  4DR6 I;  1J5E E;  4YY3 I;  4DR4 E;  1IBL I;  1N33 I;  2DEJ A;  4JI5 E;  2RSM A;  4JG4 A;  1ZM9 A;  4JI2 I;  2HFU A;  3QT5 A;  4JI4 E;  3T1Y E;  2JVA A;  4LFA E;  3CWV A;  2RS7 A;  4GKJ E;  1WHN A;  3K1J A;  4GKK I;  2F4V E;  4DR5 I;  2MDR A;  2UXD E;  4ED4 A;  3M6A A;  4OOG C;  1HNZ I;  4KHP E;  2N3G A;  3C4T A;  5BR8 E;  1XNQ I;  4B3R I;  3J81 C;  5LL6 R;  4JI8 E;  4JI8 I;  4X66 I;  1X47 A;  2B3T B;  4JI3 I;  4DR5 E;  1PVG A;  4DV3 I;  1S16 A;  4DUZ I;  3H4L A;  1IBM I;  4LF5 I;  2L3J A; 
#chains in the Genus database with same CATH topology
 5KL5 A;  1XMO I;  4LF6 I;  2EPO A;  4HY1 A;  1FNM A;  4OO1 D;  5K36 A;  3ZOQ B;  4FW3 A;  1GQE A;  2V88 A;  3LLH A;  2JYA A;  1UDS A;  4F2J C;  1N0V C;  2ENC A;  4WUB A;  1RHY A;  3THN A;  2E72 A;  4NHR A;  2R3V A;  3P06 A;  4DR1 I;  4B3M E;  1USU A;  2Z5C A;  2EM9 A;  2EN6 A;  5JEA F;  4LF8 E;  4OO1 A;  5IWA I;  3M85 D;  2EPP A;  5AAS A;  4YY3 E;  2RPC A;  3F6G A;  2EOF A;  2EOS A;  2H36 X;  4RHB B;  4R2A A;  4F6N A;  1EI1 A;  4FW9 A;  1MU5 A;  2PO1 A;  2EL4 A;  3HKM A;  4DV0 I;  1MGT A;  2LE2 A;  2HHH E;  1Y4U A;  2M9A A;  3OTO E;  1X48 A;  1TF6 A;  4DMI A;  1UBD C;  1J5E I;  1X6F A;  4LF7 E;  2PNM A;  1FI4 A;  4P7D A;  1YHC A;  4P78 A;  3F0N A;  4QNK A;  4GZN C;  1H7U A;  2XEX A;  5LMU I;  4JI6 E;  2UUC E;  4HEI A;  2D9H A;  1ZXN A;  4IZJ A;  4RPF A;  3JAM Q;  2HJJ A;  5A6B A;  4MU0 A;  2E1R A;  2YPN A;  2EOM A;  2VRD A;  4N4R B;  3BID A;  3K85 A;  4F9C B;  4DV2 I;  3K6Q A;  2CPN A;  4BHB A;  4DV1 I;  1KYQ A;  4DV4 E;  3IWC A;  2V83 A;  2I13 A;  2A2C A;  1OYR A;  1DQ3 A;  1ZXM A;  3B8H A;  4DR3 I;  2JEB A;  4HAC B;  3QG5 C;  2YRK A;  4BHC A;  2O3Z A;  5IT9 C;  3QT6 A;  5IV8 B;  4BA2 B;  1BB8 A;  1E3H A;  2BM0 A;  2NN6 A;  2JWO A;  2EM5 A;  4R2C A;  5K36 D;  3LNU A;  4LF7 I;  1RMD A;  3P3G A;  2ADR A;  4WUC A;  2ZBK B;  2VQF E;  5LMN E;  1Z0B A;  4JI0 I;  3WU4 A;  1RC7 A;  4B3M I;  2GPI A;  4BA1 A;  5A6B D;  2CGE A;  2EPM X;  2GQ0 A;  1FKA E;  4TUG A;  1Z0V A;  4URL A;  2ENH A;  1L4S A;  4FWH A;  5K36 E;  2K7I A;  2EPL X;  2EP3 A;  4LF5 E;  1R6M A;  5C0X D;  2RS6 A;  2X36 A;  2GS8 A;  1USV A;  1FJG E;  1WJP A;  2YTD A;  4R8O A;  3GON A;  2DSY A;  2O1T A;  4JI3 E;  1G2F C;  2VES A;  4KWY A;  4BMJ A;  1T38 A;  3L7Z A;  4UT4 A;  4OO1 E;  2JP9 A;  1XMO E;  4AQY E;  2GLI A;  4LF6 E;  1IBM E;  1I94 I;  2JE6 B;  4NXN I;  4IZK A;  3M99 B;  1XNQ E;  2EMX A;  4B3R E;  3PRY A;  4OO1 B;  1KIJ A;  2J65 A;  2I9I A;  3QT7 A;  1PKP A;  3VYX A;  1EH6 A;  3J7A G;  1RRE A;  4BCA A;  3L00 A;  4KHP I;  2PNL A;  1EA6 A;  2CZ9 A;  2M7Q A;  2VF1 A;  2YSP A;  3H1C A;  1GTK A;  5DNY A;  4K0K E;  2LVH A;  5DRR A;  1UEK A;  2WP8 A;  4Q28 A;  4JI7 E;  2EN1 A;  4AM3 A;  5LLQ A;  4WX9 A;  2JR1 A;  1N3G A;  5TSE A;  2V34 A;  2N3H A;  2ZM6 E;  3CDI A;  1D6T A;  2DB2 A;  4X64 I;  5FWK A;  2EMG A;  1SR9 A;  1NHI A;  3PS1 A;  1PJT A;  4GKJ I;  4X62 I;  4JI5 I;  5K36 B;  4DV6 I;  4M30 A;  1HNX I;  4R03 A;  2JOX A;  3Q6N A;  4WYQ B;  3T1Y I;  1IBL E;  2BA0 G;  2VQF I;  5LMN I;  1UIL A;  2B7T A;  1DI2 A;  2Q8U A;  4DPW A;  1DGC A;  3CDJ A;  4KZS A;  2EPA A;  4YHH I;  5FLX Q;  4LF4 E;  4R2D A;  4WXC A;  1N33 E;  5A6A A;  1U2R A;  4DR4 I;  2DLQ A;  4JI0 E;  2ZIT A;  2PNZ B;  3JTZ A;  2EM2 A;  2M1S A;  2DMY A;  1Z1B A;  2R1F A;  2C38 B;  2EN2 A;  4Z7Y A;  1KTV A;  3V2U C;  1KJK A;  2FTX B;  2EMF A;  5A6K A;  2UUA I;  4B3S I;  1UDO A;  4DR2 E;  2UXC I;  1NHH A;  4ISA A;  1H7S A;  2PRT A;  1EH7 A;  3DD6 A;  2L8T A;  3FIG A;  4OX9 E;  4BC7 A;  1ZBT A;  1TF3 A;  2E1M A;  1HR0 I;  4DV2 E;  4DR7 I;  5AE3 A;  4DUY I;  1UDN A;  2HKJ A;  1N34 I;  4B3S E;  3HTX A;  2EPN A;  1YFH A;  2V8P A;  3OTO I;  4LTY A;  4Q35 B;  2VE7 C;  1XNR E;  2V85 A;  4JI6 I;  2UXB E;  5JEA D;  1OYP A;  3WU3 A;  4P52 A;  2EJ4 A;  2CSH A;  4BC9 A;  2NUF A;  3U1K A;  4DV7 I;  1F2I G;  3LTO A;  2JEA A;  4NXM I;  3P3C A;  2UU9 E;  4P7A A;  1A1G A;  1N36 I;  2MKD A;  3HQ1 A;  1PIE A;  1XNR I;  1X6H A;  2M4I A;  2YTQ A;  2L2N A;  2L6M A;  5AE1 A;  3D4J A;  4MYT A;  2L92 A;  2L2K B;  2EPZ A;  4PRX A;  2NUE A;  3EPK A;  4OKG A;  1ELO A;  4JV5 I;  1HR0 E;  2WZO A;  1NZ0 A;  4O24 A;  3JU0 A;  1X6E A;  3RMP A;  3EPH A;  5C0X C;  2EMK A;  4I3H A;  4DR1 E;  3PYE A;  4NZV A;  2LO3 A;  3EQ1 A;  4DUZ E;  3ADL A;  2DLK A;  2EMC A;  2EMW A;  1HNW E;  1UDQ A;  1YUJ A;  2OI2 A;  4Z7C A;  2EOY A;  2BV3 A;  4J8Z A;  1TN9 A;  4R2S A;  1MEY C;  1KVK A;  2C39 B;  4HYM A;  5KL3 A;  4DV3 E;  2IES A;  1ZAA C;  4O4K A;  3B82 A;  2EN7 A;  1LLM C;  4M9V C;  4MU3 A;  2V2Z A;  5K36 C;  4U3D A;  2E5L I;  2HFS A;  2C37 A;  2YTO A;  1A1I A;  3ZM7 A;  4X65 E;  4FK5 C;  4LFC E;  2LRS A;  2EWL A;  5CFF E;  4YHH E;  1ZU1 A;  2J7J A;  3LML A;  3QT8 A;  5BR8 I;  4GKK E;  3HJC A;  4R2R A;  3J80 C;  2YZT A;  2LJU A;  1ZM3 A;  4GQU A;  4RH8 A;  5JEA C;  2WBS A;  1HNZ E;  4ZYD A;  1ZM2 A;  3UHM A;  4PRV A;  5C0X F;  4JI1 E;  2YWQ A;  4JI4 I;  2HK2 A;  3J7A M;  2L2M A;  3ADG A;  2EOE A;  4X62 E;  4M1K A;  4BA1 B;  2LJH A;  2A2D A;  1WRJ A;  2F4V I;  4IZK B;  1IMU A;  1QNT A;  2YT4 A;  4DXL A;  4HXZ A;  4JI2 E;  1S4E A;  4M0V A;  2PO2 B;  2ELZ A;  2EM6 A;  4ZYE A;  4BBY A;  4LFA I;  3VYY A;  3PS2 A;  3F6H A;  1FWL A;  2YTJ A;  4DPU A;  1AAY A;  2JY9 A;  4X9J A;  1WHQ A;  4DR6 E;  2GO4 A;  1PDA A;  3ADJ A;  2J7K A;  3ZKD A;  4GEQ B;  3HUL A;  1T4N A;  3WU5 A;  4IFD E;  4UTG A;  1BBG A;  4DV5 I;  3P3E A;  1STU A;  4FW5 A;  2ELY A;  1IQO A;  4LCF A;  4EMD A;  2G7H A;  4BA2 A;  3EPL A;  3KZZ A;  1BKN A;  2O1V A;  5ELW A;  5C0X E;  3L7Z B;  3B78 A;  4FN5 A;  1OYS A;  4LFC I;  4X65 I;  3DF6 A;  2B9D A;  4HTG A;  4WFT A;  4IS1 C;  1YYW A;  2NN6 B;  5GME A;  5GMD A;  2PO1 B;  2LBS B;  1ZBQ A;  1JK2 A;  2EN3 A;  1N32 E;  3WU6 A;  4IZJ B;  1FJG I;  3PS3 A;  1Z5A A;  2LUP B;  4OO1 C;  4BS9 A;  4F6M A;  5KL4 A;  2IOP A;  4MU1 A;  4U3B A;  4F54 A;  2AE8 A;  4JYA I;  3GLL A;  1RQ0 A;  2V8Q B;  4WSP A;  5KL7 A;  2RSI A;  1H74 A;  1RR9 A;  3M7N D;  1HNW I;  1BBO A;  4N3O A;  1HK7 A;  2NA2 A;  3AUZ A;  2JE6 A;  4B3T E;  2EOJ A;  2GHF A;  5DRP A;  2V86 A;  2LCE A;  3DJW A;  2EFG A;  3PYG A;  2YU5 A;  3VHT B;  5LMU E;  2WNR B;  2B7V A;  5AC5 A;  4MU4 A;  4IFD D;  4JV5 E;  2BR2 B;  3VK6 A;  2KHX A;  2RQL A;  2ODR D;  1EKZ A;  2MKN A;  4NXM E;  4LCH A;  2L3C A;  2NPF A;  2EN4 A;  4O5G A;  1X49 A;  5C0X B;  4MLV A;  2Z5B A;  2HHH I;  4FW4 A;  4J3D A;  3LPS A;  5JEA A;  1UHZ A;  1Y4S A;  2UU9 I;  3KZY A;  1P47 A;  2R42 A;  2O1U A;  2EOO A;  2RTX A;  1MG7 A;  2MC6 A;  3H09 A;  5AC4 A;  1Y5Y A;  5DRO A;  2WBU A;  4JYA E;  4F9B B;  3M7N G;  4DV4 I;  4DPX A;  5KL6 A;  2BA1 D;  2O1W A;  2EPR A;  1N32 I;  2V2V A;  2LTR A;  1B69 A;  5IT9 Q;  1YZ9 A;  2F1D A;  3EPJ A;  1FWK A;  2CVE A;  2HK3 A;  2CG9 A;  4USM A;  1T39 A;  3TQM A;  1A1L A;  4R2E A;  1X3C A;  3J81 Q;  3M85 G;  3ZZU A;  2K4V A;  4PU9 A;  3ECR A;  2EPK X;  2X7I A;  1GZ6 A;  4IFD A;  2KOU A;  1DAR A;  4LPF A;  2YTE A;  2JOB A;  4DPY A;  1UN6 B;  2AJ4 A;  2EMZ A;  5JEA B;  2UUB E;  4MYU A;  2BA0 D;  4DV5 E;  4WXD A;  3IWD A;  2YSO A;  3J80 Q;  3IWB A;  3JAM C;  2EMA A;  4L8N A;  2R76 A;  3MHS C;  2YTN A;  2JEB B;  2ENA A;  2EOI A;  2V2Q A;  4WPY A;  1A6F A;  2DEI A;  2EOR A;  5IWA E;  2EOX A;  2YU8 A;  3NZK A;  4LF8 I;  3ZZT A;  2BBG A;  3T1H I;  2IHR 1;  1XHK A;  2EPC A;  1QZR A;  4KQV A;  1A1J A;  2C38 A;  5DNX A;  1KKH A;  3Q6M A;  4X64 E;  2WNR A;  4OO1 F;  1Y6Z A;  2ZM6 I;  1A1H A;  3P76 A;  4JI1 I;  2EPX A;  3HXL A;  1J26 A;  1HNX E;  1IQS A;  4DV6 E;  2LUQ A;  3ZZ0 A;  3AV0 A;  4DU8 A;  1YSA C;  2EM4 A;  4JI7 I;  1Z0T A;  2JT2 A;  2YTP A;  5IXM B;  3C4B A;  3MHH C;  2PO0 A;  2PO2 A;  4K0K I;  2EM3 A;  3T1H E;  4X66 E;  5A2Q C;  2UUB I;  2C39 A;  4ZYG A;  1NHJ A;  2E5L E;  1VI7 A;  4R2P A;  4LFB E;  2LTS A;  2YRM A;  3HPZ A;  2YTG A;  3J7Y p;  2BR2 A;  2EOQ A;  1H72 C;  1YUI A;  2EQ0 A;  4NXN E;  2DIX A;  4WSG A;  2A25 A;  4R1F A;  1A1K A;  4X8W A;  1YYK A;  1MX0 A;  2EPU A;  3KRN A;  2UXD I;  4DU7 A;  1Z5B A;  4HAC A;  1ZM4 A;  3P1X A;  1Z0E A;  5DRQ A;  2EQ1 A;  3BBG A;  2EOH A;  4MQY A;  1Z0W A;  2NN6 E;  3Q1Q A;  1I94 E;  3K17 A;  3ADI A;  5C0X A;  4AQY I;  2EL6 A;  2YRH A;  4QNJ A;  2EMH A;  4MDT A;  2JXP A;  2V87 A;  2LMZ A;  1H73 A;  3HPS A;  5L3J A;  2EM8 A;  2EMI A;  2HGH A;  2VF3 A;  5T6J A;  3V5R A;  2EML A;  4TUI A;  2LV2 A;  2V89 A;  2BM1 A;  5K36 F;  1O0W A;  4LF9 I;  1A1F A;  2IER A;  3C6K A;  1T4L B;  4DV7 E;  1B63 A;  2PO0 B;  1N0U A;  1R6L A;  3GME A;  1B62 A;  5A6J A;  2DGC A;  4XTJ A;  1Z0G A;  3THO B;  3UK3 C;  1XMQ E;  1N36 E;  1E3P A;  5ADZ A;  2HC5 A;  4LCG A;  2FV4 B;  2MDG A;  1OJ4 A;  2LT7 A;  4DUY E;  3C6M A;  5AE2 A;  5F3W A;  2VQE I;  2L33 A;  2JPA A;  4DR3 E;  5FLX C;  2Z5C B;  4NBQ A;  3U1Y A;  2UXB I;  1QU6 A;  3BGH A;  1WUU A;  1Z59 A;  4DV1 E;  4I8O A;  4FWG A;  4FW7 A;  2NAB A;  4B3T I;  1N34 E;  1JK1 A;  1IBK E;  2Q2E B;  2Z5E A;  1IBK I;  4DR7 E;  2EOZ A;  1T4O A;  4R2Q A;  1YH8 A;  2KON A;  3MSW A;  4LOM A;  2WW4 A;  1ZR9 A;  5EL9 A;  4OX9 I;  5EKW A;  2YTI A;  1NCS A;  3PYF A;  1K47 A;  5DNL A;  2VQE E;  4DPT A;  2UXC E;  2HKE A;  4DR2 I;  2WP8 B;  3PYD A;  2FGG A;  2UUA E;  2LJP A;  2DRP A;  5A2Q Q;  2YTF A;  2NUG A;  4IJD A;  1YPN A;  4M2Z A;  4FWD A;  4ZVI A;  4WUD A;  1XMQ I;  2CTD A;  2NN6 C;  1YYO A;  1VIS A;  1Z5C A;  4LF4 I;  2EZ6 A;  1Z0C A;  2EE8 A;  4DKK A;  4DV0 E;  2IOQ A;  2UUC I;  4IFD F;  4MLQ A;  4USK A;  2DMI A;  2EM0 A;  1Y60 A;  4LFB I;  3ZKB A;  4LF9 E;  1PJS A;  4DR6 I;  1J5E E;  1XXE A;  1NEI A;  3KWR A;  2N8X A;  4AID A;  4DR4 E;  3GCM A;  4YY3 I;  1IBL I;  1N33 I;  2NN6 D;  2DEJ A;  4JI5 E;  4FW6 A;  2RSM A;  1PJQ A;  2WBT A;  2EMY A;  1ZM9 A;  4JG4 A;  4JI2 I;  2EN8 A;  2JEA B;  1G2D C;  2HFU A;  4LU9 A;  3QT5 A;  4JI4 E;  5A69 A;  5JEA E;  2BA1 G;  3T1Y E;  2JVA A;  2C37 B;  4LFA E;  3B4T A;  4AIM A;  3CWV A;  2RS7 A;  4F9A B;  4GKJ E;  1WHN A;  2PNZ A;  3K1J A;  4GKK I;  2F4V E;  4DR5 I;  1X5W A;  2MDR A;  2UXD E;  2EM7 A;  4ED4 A;  1WXR A;  5KL2 A;  3M6A A;  3OML A;  4OZE A;  4OOG C;  1HNZ I;  2EQ3 A;  2EMB A;  4KHP E;  2N3G A;  4ZYH A;  3BF2 A;  3C4T A;  2EL5 A;  4IZJ D;  1AH5 A;  1P42 A;  2GO3 A;  2F8B A;  2ODR C;  5BR8 E;  1XNQ I;  4B3R I;  3J81 C;  5LL6 R;  4IFD C;  1EH8 A;  4O43 A;  4JI8 E;  4JI8 I;  4L5N C;  4X66 I;  1X47 A;  1SFE A;  2B3T B;  4JI3 I;  2WCC 3;  2CT1 A;  2Z5B B;  4DR5 E;  1PVG A;  2MC5 A;  4DV3 I;  2NN6 F;  1S16 A;  4DUZ I;  3H4L A;  2BB8 A;  4IFD B;  1IBM I;  4IS9 A;  4LF5 I;  2L3J A; 
#chains in the Genus database with same CATH homology
 1XMO I;  4LF6 I;  4HY1 A;  1FNM A;  3ZOQ B;  1GQE A;  2V88 A;  3LLH A;  1N0V C;  4WUB A;  2R3V A;  3P06 A;  4DR1 I;  4B3M E;  1USU A;  2Z5C A;  4LF8 E;  5IWA I;  5AAS A;  4YY3 E;  3F6G A;  2H36 X;  1EI1 A;  4FW9 A;  1MU5 A;  4DV0 I;  2LE2 A;  2HHH E;  1Y4U A;  3OTO E;  1X48 A;  4DMI A;  1J5E I;  4LF7 E;  2PNM A;  1FI4 A;  4P7D A;  4P78 A;  3F0N A;  1H7U A;  2XEX A;  5LMU I;  4JI6 E;  2UUC E;  4IZJ A;  4RPF A;  1ZXN A;  3JAM Q;  2E1R A;  3K85 A;  4F9C B;  4DV2 I;  3K6Q A;  2CPN A;  4DV1 I;  4DV4 E;  3IWC A;  2V83 A;  2A2C A;  1DQ3 A;  1ZXM A;  3B8H A;  4DR3 I;  4HAC B;  5IT9 C;  3QT6 A;  2BM0 A;  2JWO A;  3LNU A;  4LF7 I;  4WUC A;  2ZBK B;  2VQF E;  5LMN E;  1Z0B A;  4JI0 I;  3WU4 A;  1RC7 A;  4B3M I;  2CGE A;  2GQ0 A;  1FKA E;  4TUG A;  1Z0V A;  4URL A;  4FWH A;  4LF5 E;  2RS6 A;  2X36 A;  2GS8 A;  1USV A;  1FJG E;  4R8O A;  3GON A;  2DSY A;  2O1T A;  4JI3 E;  4BMJ A;  4UT4 A;  1XMO E;  4AQY E;  4LF6 E;  1IBM E;  1I94 I;  4NXN I;  4IZK A;  1XNQ E;  4B3R E;  3PRY A;  1KIJ A;  3QT7 A;  1PKP A;  3VYX A;  3J7A G;  1RRE A;  4BCA A;  4KHP I;  2PNL A;  1EA6 A;  2CZ9 A;  2VF1 A;  2M7Q A;  5DNY A;  4K0K E;  1UEK A;  4Q28 A;  4JI7 E;  2JR1 A;  2V34 A;  2N3H A;  2ZM6 E;  1D6T A;  2DB2 A;  4X64 I;  5FWK A;  1SR9 A;  1NHI A;  4GKJ I;  4X62 I;  4JI5 I;  4DV6 I;  4M30 A;  1HNX I;  4R03 A;  2JOX A;  3Q6N A;  4WYQ B;  3T1Y I;  1IBL E;  2VQF I;  5LMN I;  1UIL A;  2B7T A;  1DI2 A;  4DPW A;  4KZS A;  4YHH I;  5FLX Q;  4LF4 E;  1N33 E;  1U2R A;  4DR4 I;  4JI0 E;  2ZIT A;  3JTZ A;  2M1S A;  2DMY A;  4Z7Y A;  1KTV A;  3V2U C;  2FTX B;  4B3S I;  2UUA I;  4DR2 E;  2UXC I;  1NHH A;  1H7S A;  2L8T A;  3FIG A;  4OX9 E;  4BC7 A;  1ZBT A;  2E1M A;  1HR0 I;  4DV2 E;  4DR7 I;  5AE3 A;  4DUY I;  2HKJ A;  1N34 I;  4B3S E;  3HTX A;  2V8P A;  3OTO I;  4LTY A;  2VE7 C;  1XNR E;  2V85 A;  4JI6 I;  2UXB E;  3WU3 A;  4P52 A;  4BC9 A;  2NUF A;  4DV7 I;  3LTO A;  4NXM I;  2UU9 E;  4P7A A;  1N36 I;  3HQ1 A;  1PIE A;  1XNR I;  2M4I A;  2L2N A;  2L6M A;  5AE1 A;  3D4J A;  4MYT A;  2L92 A;  2L2K B;  4PRX A;  2NUE A;  4JV5 I;  1ELO A;  1HR0 E;  2WZO A;  1NZ0 A;  3JU0 A;  3RMP A;  4I3H A;  4DR1 E;  3PYE A;  4DUZ E;  3ADL A;  1HNW E;  2OI2 A;  4Z7C A;  2BV3 A;  4J8Z A;  1KVK A;  4HYM A;  4DV3 E;  3B82 A;  2V2Z A;  2E5L I;  2HFS A;  3ZM7 A;  4LFC E;  4X65 E;  2LRS A;  2EWL A;  5CFF E;  4YHH E;  3LML A;  3QT8 A;  5BR8 I;  4GKK E;  3HJC A;  3J80 C;  2YZT A;  1ZM3 A;  1HNZ E;  1ZM2 A;  3J7A M;  4PRV A;  4JI4 I;  4JI1 E;  2HK2 A;  2L2M A;  3ADG A;  4X62 E;  4M1K A;  2LJH A;  2A2D A;  2F4V I;  4IZK B;  2YT4 A;  4DXL A;  4HXZ A;  4JI2 E;  1S4E A;  4M0V A;  4BBY A;  4LFA I;  3VYY A;  3F6H A;  1FWL A;  4DPU A;  2JY9 A;  2J7K A;  1WHQ A;  4DR6 E;  3ZKD A;  3ADJ A;  4GEQ B;  3HUL A;  1T4N A;  3WU5 A;  4UTG A;  4DV5 I;  1STU A;  4EMD A;  2G7H A;  1BKN A;  2O1V A;  3B78 A;  4FN5 A;  4LFC I;  4X65 I;  3DF6 A;  2B9D A;  4WFT A;  1YYW A;  5GME A;  5GMD A;  2LBS B;  1ZBQ A;  1N32 E;  3WU6 A;  1FJG I;  4IZJ B;  1Z5A A;  2LUP B;  4BS9 A;  2IOP A;  4F54 A;  4JYA I;  1RQ0 A;  2V8Q B;  4WSP A;  1H74 A;  1RR9 A;  1HNW I;  4N3O A;  1HK7 A;  2NA2 A;  3AUZ A;  4B3T E;  2V86 A;  2EFG A;  3DJW A;  3PYG A;  5LMU E;  2B7V A;  4JV5 E;  3VK6 A;  2KHX A;  2ODR D;  1EKZ A;  4NXM E;  2L3C A;  2NPF A;  1X49 A;  2Z5B A;  2HHH I;  3LPS A;  1UHZ A;  1Y4S A;  2UU9 I;  2R42 A;  2O1U A;  2RTX A;  1MG7 A;  2MC6 A;  3H09 A;  4JYA E;  4F9B B;  4DV4 I;  4DPX A;  2O1W A;  1N32 I;  2V2V A;  2LTR A;  5IT9 Q;  1YZ9 A;  1FWK A;  2HK3 A;  2CG9 A;  4USM A;  3J81 Q;  3ZZU A;  2K4V A;  4PU9 A;  2X7I A;  1GZ6 A;  2KOU A;  1DAR A;  4DPY A;  2JOB A;  2AJ4 A;  2UUB E;  4MYU A;  4DV5 E;  3IWD A;  3J80 Q;  3IWB A;  3JAM C;  4L8N A;  2V2Q A;  4WPY A;  1A6F A;  2DEI A;  5IWA E;  4LF8 I;  3ZZT A;  3T1H I;  2IHR 1;  1XHK A;  1QZR A;  4KQV A;  1KKH A;  3Q6M A;  4X64 E;  1Y6Z A;  2ZM6 I;  4JI1 I;  3HXL A;  1J26 A;  1HNX E;  4DV6 E;  2LUQ A;  3ZZ0 A;  3AV0 A;  4DU8 A;  4JI7 I;  1Z0T A;  3C4B A;  4K0K I;  3T1H E;  4X66 E;  5A2Q C;  2UUB I;  1NHJ A;  2E5L E;  4LFB E;  2LTS A;  3HPZ A;  3J7Y p;  1H72 C;  4NXN E;  2DIX A;  4R1F A;  4X8W A;  1YYK A;  1MX0 A;  2UXD I;  4DU7 A;  1Z5B A;  4HAC A;  1ZM4 A;  3P1X A;  1Z0E A;  1Z0W A;  3Q1Q A;  1I94 E;  3K17 A;  3ADI A;  4AQY I;  2V87 A;  1H73 A;  2LMZ A;  3HPS A;  5L3J A;  2VF3 A;  5T6J A;  3V5R A;  4TUI A;  2V89 A;  2BM1 A;  1O0W A;  4LF9 I;  1T4L B;  4DV7 E;  1B63 A;  1N0U A;  1B62 A;  4XTJ A;  1Z0G A;  1N36 E;  1XMQ E;  5ADZ A;  2FV4 B;  1OJ4 A;  4DUY E;  5AE2 A;  5F3W A;  2VQE I;  2L33 A;  4DR3 E;  5FLX C;  2Z5C B;  2UXB I;  1QU6 A;  1WUU A;  1Z59 A;  4DV1 E;  4I8O A;  4FWG A;  4B3T I;  1N34 E;  1IBK E;  2Q2E B;  2Z5E A;  1IBK I;  4DR7 E;  1T4O A;  2KON A;  3MSW A;  4OX9 I;  2WW4 A;  3PYF A;  1K47 A;  2VQE E;  4DPT A;  2UXC E;  2HKE A;  4DR2 I;  3PYD A;  2FGG A;  2UUA E;  2LJP A;  5A2Q Q;  2NUG A;  4M2Z A;  4FWD A;  4ZVI A;  1XMQ I;  4WUD A;  1YYO A;  1VIS A;  1Z5C A;  4LF4 I;  2EZ6 A;  1Z0C A;  4DV0 E;  4DKK A;  2IOQ A;  2UUC I;  4USK A;  4LFB I;  3ZKB A;  4LF9 E;  4DR6 I;  1J5E E;  3KWR A;  4YY3 I;  4DR4 E;  1IBL I;  1N33 I;  2DEJ A;  4JI5 E;  2RSM A;  4JG4 A;  1ZM9 A;  4JI2 I;  2HFU A;  4LU9 A;  3QT5 A;  4JI4 E;  3T1Y E;  2JVA A;  4LFA E;  3CWV A;  2RS7 A;  4F9A B;  4GKJ E;  1WHN A;  3K1J A;  4GKK I;  2F4V E;  4DR5 I;  2MDR A;  2UXD E;  4ED4 A;  1WXR A;  3M6A A;  3OML A;  4OOG C;  1HNZ I;  4KHP E;  2N3G A;  3C4T A;  4IZJ D;  2F8B A;  2ODR C;  5BR8 E;  1XNQ I;  4B3R I;  3J81 C;  5LL6 R;  4JI8 E;  4JI8 I;  4L5N C;  4X66 I;  1X47 A;  2B3T B;  4JI3 I;  2Z5B B;  4DR5 E;  1PVG A;  2MC5 A;  4DV3 I;  1S16 A;  4DUZ I;  3H4L A;  1IBM I;  4LF5 I;  2L3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...