4DV5E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv5E02
1Z0GA 2KHXA 2JVAA 1Z0WA 4JYAE 1NHJA 4R1FA 4LFCE 3WU3A 2LUQA 1Z0VA 2LTSA 4B3RE 1T4NA 1IBLI 4X66E 2UXDI 2V34A 4JI2I 2R3VA 1N34I 3JAMQ 4X65I 3C4BA 2X7IA 4DV2I 4LFBE 4YY3I 2EZ6A 2E5LE 2UUAI 3J81Q 4X65E 1J5EI 1N0UA 4DR1E 3ADIA 2UUCI 1WUUA 1QU6A 3F0NA 5LMUE 1HNWI 1I94E 4X62E 4AQYE 4GKKI 1D6TA 4MYTA 4LF5E 4FW9A 4P52A 4JI6E 4K0KE 2UU9I 3T1HE 4YHHI 2DMYA 3J7AM 3WU6A 3VYXA 2LTRA 4JI8I 2DB2A 3V2UC 2Q2EB 3JAMC 1PKPA 1Z0EA 2DEJA 3ZZTA 4WYQB 4X64E 3HULA 1XHKA 1XNQI 4B3TI 3T1HI 3H4LA 4HYMA 5IWAI 3LTOA 1MX0A 2AJ4A 1FJGE 4DR7E 4DV6E 4MYUA 2V2QA 1NHHA 4URLA 4DR2I 3PYDA 3J7AG 4KHPE 3V5RA 2UXCE 1OJ4A 4JV5I 3LLHA 2OI2A 2EFGA 2BV3A 1FJGI 1YYOA 4DU8A 1ELOA 4OX9I 1FNMA 3B8HA 4UTGA 3GONA 1HNXI 1IBLE 2MDRA 1X48A 4DPXA 2N3HA 1Z5BA 1MG7A 4X62I 3ADLA 4DV0I 2R42A 4B3TE 1S4EA 3K1JA 2JY9A 5BR8I 4WUBA 4XTJA 1H72C 2CPNA 4Z7CA 2F4VE 3J7Yp 5A2QC 4DV1I 2E1RA 4LF8I 4WUCA 2LJPA 4I3HA 3ZKBA 4USMA 1FWLA 1H73A 3PYGA 4JI1E 2ZBKB 2RSMA 1H7SA 4WFTA 2B7TA 2NUFA 4USKA 5CFFE 5LMUI 4B3SI 2GS8A 2WW4A 1T4LB 4DV5E 4DV1E 1DARA 4LF6I 1ZXMA 2ZITA 1N33I 2ZM6I 4B3RI 4M2ZA 2B3TB 4PRVA 2L2NA 1ZM3A 4JI0E 2LRSA 2L3CA 4WUDA 4M1KA 4JI4E 2BM0A 4LF4I 4DR2E 4DR6E 5FLXQ 2VQFI 1I94I 2L2MA 1EA6A 5LL6R 4DV7I 1EKZA 2NUEA 3ZKDA 2ZM6E 3D4JA 1EI1A 4DR5E 2HFSA 1IBKE 3PYEA 2B7VA 1X47A 4DR4I 4HY1A 4JV5E 5LMNE 1N32I 1IBKI 1HNZE 4LF9I 4KQVA 4OOGC 1B63A 4B3MI 1U2RA 1UHZA 4Z7YA 3WU5A 1XMOE 4NXMI 1IBMI 3VYYA 4HACA 2HKJA 4JI5E 1O0WA 3QT6A 1N33E 1ZBTA 1QZRA 2V2VA 1A6FA 1Z0CA 3PYFA 2YT4A 1DI2A 2UXBI 4DV7E 5BR8E 1YYKA 2VQEI 3ZZUA 3WU4A 1Z0TA 2UXBE 2HK2A 1YZ9A 1N36E 1Z59A 4KHPI 4DPYA 2UXDE 1KTVA 1NZ0A 2V8PA 1T4OA 1KVKA 1PIEA 5L3JA 1B62A 2VQEE 2XEXA 4LF7I 1VISA 1Z5CA 1H74A 1HNXE 1XNRE 3QT5A 4B3ME 4DV5I 1H7UA 1FKAE 4FWHA 1N32E 1IBME 3OTOI 1KIJA 1ZXNA 4JYAI 1X49A 3ADJA 3QT8A 4JI0I 4LF9E 2UU9E 4DR3E 4LF8E 1BKNA 4NXNE 4ZVIA 1XMQE 4JI5I 2RS7A 4JI3I 4OX9E 1PVGA 5A2QQ 2LUPB 4DXLA 2NUGA 1FWKA 2HK3A 4FWDA 2DEIA 5IT9Q 2HHHE 1XMQI 4DV2E 3LPSA 1XNQE 4DV4E 2L2KB 1NHIA 2UUAE 4X8WA 4DUYI 4DV0E 3P1XA 4LF5I 2V2ZA 4UT4A 4DV6I 4FN5A 5FLXC 2RS6A 2L33A 4PRXA 4JI4I 3CWVA 4DR6I 1GQEA 1MU5A 3ZM7A 1UILA 2UXCI 2X36A 2F4VI 4LF7E 4DPUA 3OTOE 4DU7A 3B78A 3C4TA 4YY3E 2A2DA 3T1YI 4JI8E 3K17A 1XNRI 4JI2E 1J5EE 4LF4E 4DKKA 3J80Q 5IT9C 3J81C 1Z5AA 4LFAI 1RREA 4DPTA 1KKHA 2VF3A 1WHNA 3B82A 4PU9A 4GKJE 1N36I 1WHQA 1RC7A 2NA2A 2IHR1 4DPWA 3ADGA 4YHHE 2LBSB 4JI7I 1ZM9A 1YYWA 2RTXA 1ZM4A 4HACB 3ZZ0A 4NXME 1ZM2A 1J26A 3LNUA 4JI7E 4LFAE 4DV3I 2N3GA 1RQ0A 3Q1QA 4GKJI 4K0KI 1HR0E 4DUZI 5IWAE 2UUBE 4ED4A 1S16A 1HR0I 4P7AA 4DR5I 2UUCE 2DIXA 1N34E 4DV3E 4EMDA 4X64I 2HHHI 2CZ9A 5LMNI 1Z0BA 2E5LI 1K47A 4HXZA 4NXNI 2UUBI 4DUZE 4DR1I 2A2CA 4X66I 2HFUA 4GKKE 4AQYI 4RPFA 5GMEA 1RR9A 4LFBI 4JG4A 4LFCI 4DUYE 4JI1I 2J7KA 1XMOI 4LF6E 3M6AA 2BM1A 2L3JA 3T1YE 1N0VC 4B3SE 1FI4A 4JI3E 1STUA 4DR4E 5GMDA 4DR3I 2VQFE 2NPFA 1HNZI 2HKEA 4FWGA 4DV4I 2LJHA 4JI6I 4DR7I 3HTXA 4M30A 3QT7A 1HNWE 3J80C 1UEKA
chains in the Genus database with same CATH superfamily
1Z0GA 2KHXA 2GO3A 4RH8A 2JVAA 1Z0WA 4JYAE 3IWDA 1BB8A 2CT1A 1NHJA 4LFCE 3P06A 4R1FA 3WU3A 2LUQA 2GO4A 2YU8A 1Z0VA 2NN6B 2LTSA 3GLLA 4B3RE 3Q6NA 1T4NA 2E1MA 3C6MA 2J65A 2EPMX 4OZEA 4BA1A 2DGCA 1IBLI 5AE2A 2V83A 2A25A 3UK3C 4X66E 2JEAA 2V8QB 2UXDI 5IV8B 1Y4UA 2V34A 4JI2I 3HPZA 3BF2A 3CDJA 4Q28A 2GLIA 2R3VA 1N34I 3JAMQ 4X65I 3C4BA 2X7IA 4DV2I 4LFBE 2EMKA 1F2IG 1AAYA 4YY3I 5A6BD 3OMLA 2EMHA 4BA2B 2EZ6A 2E5LE 2UUAI 1Y5YA 3J81Q 4X65E 1P42A 2YTIA 2KOUA 2K4VA 1J5EI 2YTPA 1N0UA 4TUGA 3QG5C 4DR1E 3L00A 4HTGA 3ADIA 4BHBA 3TQMA 2UUCI 1WUUA 1QU6A 1TN9A 5LMUE 3F0NA 1PDAA 3P76A 1HNWI 1I94E 3HXLA 4X62E 4AQYE 2O3ZA 3FIGA 2CGEA 4GKKI 1D6TA 4MYTA 5K36C 4LF5E 2C38A 4FW9A 4OO1B 4P52A 2O1WA 1A1IA 4JI6E 3BBGA 4R2PA 3C6KA 4K0KE 4ZYHA 1Y4SA 3T1HE 4IS1C 2UU9I 2EMCA 2ENAA 1XXEA 2EE8A 1KJKA 4YHHI 3M85D 2Z5EA 2DMYA 3J7AM 1QNTA 3IWCA 3EPKA 3VYXA 3WU6A 4R2RA 2LTRA 2JWOA 4JI8I 2YTDA 1OYSA 5JEAF 2DB2A 3V2UC 2Q2EB 3JAMC 1PKPA 1Z0EA 4IZJA 2DEJA 3ZZTA 4WYQB 4X64E 2KONA 5C0XB 3HULA 4IS9A 2N8XA 1XHKA 1XNQI 2VF1A 2V85A 2IESA 2EOYA 4R2EA 4B3TI 2LT7A 3T1HI 2EN6A 4U3DA 4BC9A 3EPHA 4L8NA 4NZVA 5TSEA 2O1TA 3H4LA 4HYMA 5IWAI 3LTOA 1MX0A 2AJ4A 1FJGE 1AH5A 4DR7E 4DV6E 1A1FA 4MYUA 2V2QA 2BA1D 5DNLA 1NHHA 2MDGA 1Y60A 4BC7A 4URLA 4DR2I 2PNZB 3PYDA 3J7AG 4KHPE 2NN6D 3V5RA 4MLVA 1EH7A 2UXCE 1OJ4A 3PS3A 4AM3A 4JV5I 3LLHA 2L8TA 2EMYA 2OI2A 2WBTA 5JEAB 2EFGA 2GHFA 5F3WA 2CG9A 1P47A 2BV3A 4MDTA 5FWKA 1FJGI 1YYOA 4DU8A 1ELOA 4OX9I 3M7NG 4NHRA 1FNMA 2PNLA 4RHBB 2YSPA 3B8HA 1L4SA 4UTGA 3GONA 3U1KA 1HNXI 2BR2B 3EPLA 1UN6B 2EPRA 2PRTA 1IBLE 2MDRA 1X48A 4N3OA 4OO1E 2EMWA 4F54A 2JR1A 1UBDC 4DPXA 2N3HA 2BBGA 1Z5BA 3EPJA 2NN6A 1MG7A 4X62I 2YPNA 1VI7A 3GMEA 2BA0G 3ADLA 4QNJA 4DV0I 2R42A 4WSPA 4J8ZA 1MEYC 4B3TE 2O1VA 1S4EA 3K1JA 3KRNA 1YH8A 2M9AA 2WNRA 1A1HA 1YPNA 2WZOA 2JY9A 5BR8I 4WUBA 4XTJA 2EM5A 3BIDA 1H72C 1PJSA 4O4KA 4IFDB 3H09A 2PO0A 2CPNA 4Z7CA 2F4VE 2FGGA 2EOEA 2WNRB 3J7Yp 5A2QC 4DV1I 2E1RA 4WXDA 4LF8I 2GQ0A 2LJPA 4WUCA 4I3HA 3ZKBA 4WPYA 4USMA 2ENCA 1DQ3A 1FWLA 1H73A 3PYGA 4JI1E 2ZBKB 1NCSA 2RSMA 2ADRA 1H7SA 5DRQA 2LO3A 4WFTA 2B7TA 1JK2A 3ZOQB 4IZKA 2NUFA 2EOIA 5K36D 4USKA 5CFFE 5LMUI 3KZYA 4B3SI 5JEAE 5AC5A 2GS8A 2WW4A 1A1GA 4OO1D 4WXCA 1T4LB 4DV5E 5DRRA 4DV1E 1DARA 5KL5A 4LF6I 4IZKB 2IERA 1ZXMA 2FTXB 2ZITA 1N33I 3EQ1A 2CTDA 2JOBA 5JEAA 2ZM6I 1GZ6A 4B3RI 2C37B 4M2ZA 2B3TB 4PRVA 2L2NA 2WCC3 2VRDA 1ZM3A 2YTGA 5ADZA 4JI0E 2LRSA 3HQ1A 2L3CA 4WUDA 2JEBB 4M1KA 5KL3A 5KL4A 2I13A 4JI4E 2BM0A 4DR2E 4DR6E 2NN6E 2EM8A 3LMLA 1SR9A 4F6NA 2JEBA 2H36X 2YTEA 5FLXQ 2VQFI 1I94I 5A69A 2L2MA 5KL7A 1HK7A 2EOZA 2F8BA 5LL6R 4R2AA 1EA6A 2C39B 2CVEA 2DLQA 3DJWA 4DV7I 1EKZA 2NUEA 3ZKDA 2ZM6E 1YSAC 4MQYA 5K36B 3D4JA 2EQ0A 4BBYA 3VHTB 2EM6A 1EI1A 4KWYA 4NBQA 2EORA 2LMZA 2PO2A 1OYRA 4MU4A 4DR5E 2HFSA 2JEAB 4BMJA 1IBKE 5DRPA 1X6EA 3PYEA 2B7VA 4R2DA 1X47A 3MSWA 4DR4I 4IZJB 4HY1A 4JV5E 2V86A 4O24A 5LMNE 2EOJA 2EPPA 1N32I 1IBKI 1HNZE 4LF9I 2HC5A 2L92A 2R1FA 4DXLA 2DMIA 2PNMA 4OOGC 1B63A 4FW7A 4KQVA 2M4IA 4B3MI 1U2RA 5JEAD 4LOMA 1UHZA 1LLMC 2EPCA 1NEIA 5AE3A 4Z7YA 3WU5A 3M85G 1XMOE 4NXMI 4OO1C 3HJCA 1IBMI 4DMIA 3K6QA 3THOB 3VYYA 4J3DA 4HACA 1BBGA 2HKJA 4JI5E 1IQSA 1O0WA 2YTOA 2Z5CA 5A6JA 3QT6A 1N33E 1ZBTA 1QZRA 2EL5A 2G7HA 4WX9A 2V2VA 1A6FA 1Z0CA 2F1DA 3PYFA 5KL2A 5DNXA 2YT4A 4AIMA 1DI2A 1GTKA 2UXBI 4DV7E 5BR8E 1YYKA 4FW6A 4LU9A 2VQEI 3B4TA 1USUA 3ZZUA 2I9IA 3U1YA 3AUZA 3GCMA 4ZYEA 3MHSC 2BR2A 3WU4A 1Z0TA 4P78A 2UXBE 2HK2A 1YZ9A 4ZYGA 1N36E 1Z59A 5ELWA 4KHPI 4DPYA 2WP8A 2EOXA 2UXDE 2BA1G 5EL9A 1KTVA 1NZ0A 1R6LA 4BS9A 2V8PA 1T4OA 4P7DA 1KVKA 3HPSA 4M9VC 1PIEA 2EOQA 5L3JA 1UDOA 4OO1A 1B62A 2PO1A 2JXPA 2VQEE 2XEXA 4LF7I 4FW4A 2FV4B 4FW3A 2EOFA 1VISA 1Z5CA 1H74A 1HNXE 3ECRA 1XNRE 2EPKX 3QT5A 4B3ME 2C38B 4DV5I 1TF3A 2GPIA 1FKAE 1H7UA 2J7JA 2L6MA 4FWHA 3LNUA 3F6HA 2YSOA 2ENHA 2EOMA 3VK6A 4GZNC 1IBME 2EOSA 2Q8UA 5T6JA 5AC4A 1N32E 3OTOI 3F6GA 2EQ1A 2MC6A 4WSGA 1KIJA 1ZXNA 3PS2A 4IJDA 4F9BB 4JYAI 2EPOA 1X49A 1OYPA 1X5WA 3ADJA 3QT8A 4JI0I 4LF9E 2EP3A 2YTQA 2UU9E 4DR3E 4OKGA 2EL6A 4LF8E 3P3EA 1X6HA 1BKNA 2YRHA 2EPLX 4NXNE 4ZVIA 2RSIA 2EM9A 1XMQE 4JI5I 2RS7A 4JI3I 1EH6A 1G2DC 4OX9E 1PVGA 4BA1B 5A2QQ 4LF4I 2LUPB 3HKMA 2NUGA 2MC5A 3THNA 1BBOA 1FWKA 2HK3A 4FWDA 2EPXA 2DEIA 1USVA 2EMIA 5IT9Q 2HHHE 2NN6C 4DV2E 2JT2A 1XMQI 3LPSA 1XNQE 4R2SA 4DV4E 1KYQA 2L2KB 1NHIA 4IFDE 2EOOA 1ZU1A 2UUAE 2EPZA 2BB8A 4N4RB 4R03A 4X8WA 4DV0E 4AIDA 4DUYI 3P1XA 4KZSA 4LF5I 2V2ZA 2EM7A 4LCHA 1RMDA 4O5GA 4UT4A 4L5NC 1DGCA 4DV6I 4FN5A 5FLXC 2V87A 2NABA 2RS6A 1PJTA 2L33A 4PRXA 2DSYA 3CWVA 4ISAA 2MKDA 4JI4I 1GQEA 4DR6I 1MU5A 2YTJA 1R6MA 3ZM7A 1UILA 2UXCI 2ODRC 2X36A 4QNKA 5KL6A 2F4VI 4LF7E 2YTFA 5A6BA 2DLKA 3OTOE 2AE8A 4DPUA 2Z5BB 4DU7A 3B78A 3C4TA 4YY3E 4MU3A 1WRJA 4R8OA 2A2DA 4R2QA 3T1YI 2EM2A 4JI8E 3K17A 1G2FC 1XNRI 4JI2E 1J5EE 1X3CA 4LF4E 4DKKA 5IT9C 3J80Q 3J81C 1YFHA 1MGTA 5DNYA 1A1LA 4LCFA 2JP9A 3M99B 2K7IA 1YHCA 1Z5AA 3DD6A 2RQLA 4LFAI 3DF6A 2EPAA 1IMUA 2EMXA 5AE1A 1RREA 2V88A 3PS1A 2JPAA 5IXMB 1KKHA 4DPTA 5C0XD 5C0XC 2VF3A 1WHNA 3B82A 4PU9A 2EMBA 4MLQA 4GKJE 3UHMA 1N36I 5AASA 1WHQA 1RC7A 2YU5A 2YWQA 2NA2A 2IHR1 4X9JA 2O1UA 3ADGA 4ZYDA 4YHHE 4DPWA 2LBSB 4JI7I 1ZM9A 1EH8A 4F6MA 5C0XE 2EM4A 1YYWA 2RTXA 1T39A 1ZM4A 2HJJA 3MHHC 5LLQA 2VESA 4OO1F 5JEAC 5K36F 2PNZA 4HACB 3ZZ0A 1Y6ZA 4NXME 1ZM2A 1J26A 1A1KA 4Q35B 4JI7E 4BHCA 2LJUA 1B69A 2DRPA 4LFAE 1E3PA 3IWBA 4LCGA 4DV3I 3L7ZA 2N3GA 2R76A 2PO1B 1RQ0A 3Q1QA 4GKJI 1PJQA 4K0KI 2C37A 1HR0E 3PRYA 2V89A 4LTYA 1WXRA 2JE6B 1JK1A 1WJPA 4DUZI 5IWAE 1E3HA 2UUBE 2LVHA 2PO2B 5C0XA 4ED4A 1S16A 2EJ4A 1HR0I 3H1CA 4P7AA 4DR5I 2UUCE 2DIXA 3KWRA 1N34E 2D9HA 3RMPA 4DV3E 3CDIA 4EMDA 4BCAA 1N3GA 2EN8A 4X64I 4FK5C 2HHHI 4IFDC 1IQOA 2CZ9A 5LMNI 4M0VA 2B9DA 2C39A 2JOXA 2LV2A 5EKWA 2EQ3A 1Z0BA 2E5LI 2LCEA 4F9AB 1YUJA 1K47A 4GQUA 4HXZA 3KZZA 5K36A 3JU0A 1TF6A 2EN3A 4NXNI 3K85A 2ODRD 2UUBI 2ELYA 4DUZE 4DR1I 2A2CA 2Z5CB 2MKNA 3L7ZB 1T38A 4X66I 2EM0A 2E72A 2HFUA 2YRMA 4IFDA 2YRKA 4GKKE 4AQYI 1UDNA 4RPFA 5GMEA 4FW5A 2EMAA 2EWLA 1RR9A 3P3GA 4JG4A 4LFBI 2EL4A 4I8OA 2EMGA 2EPUA 4LFCI 2WBSA 3Q6MA 2BA0D 4DUYE 4JI1I 4MU1A 2J7KA 4LPFA 2EN4A 1Z1BA 1XMOI 4BA2A 4R2CA 4LF6E 4IFDF 3M6AA 2BM1A 2L3JA 2M1SA 2YZTA 1YUIA 2EMZA 1A1JA 3T1YE 2EOHA 1ZBQA 2NN6F 4IFDD 3BGHA 1N0VC 3AV0A 5K36E 4F9CB 4B3SE 2HGHA 2WP8B 1FI4A 5C0XF 2YTNA 4F2JC 3M7ND 4JI3E 1STUA 2IOQA 2EM3A 4DR4E 2IOPA 5DROA 2EPNA 2JE6A 1X6FA 2Z5BA 5GMDA 4HEIA 2EN1A 2VQFE 4DR3I 2NPFA 4TUIA 1HNZI 1ZR9A 4GEQB 1UDSA 2HKEA 4FWGA 4DV4I 2ELZA 2LJHA 1UDQA 4JI6I 4DR7I 3HTXA 2WBUA 2EMLA 1RHYA 4M30A 5A6KA 5A6AA 3QT7A 2CSHA 2LE2A 1ZAAC 2EMFA 1HNWE 4MU0A 2PO0B 4U3BA 2M7QA 3J80C 3JTZA 3P3CA 2VE7C 1SFEA 1UEKA 2EN7A 2JYAA 4O43A 3NZKA 4IZJD 2RPCA 2EN2A
chains in the Genus database with same CATH topology
1Z0GA 2KHXA 2JVAA 1Z0WA 4JYAE 3IWDA 1NHJA 4R1FA 4LFCE 3P06A 3WU3A 2LUQA 1Z0VA 2LTSA 4B3RE 3Q6NA 1T4NA 2E1MA 1IBLI 5AE2A 2V83A 4X66E 2UXDI 2V8QB 1Y4UA 2V34A 4JI2I 3HPZA 4Q28A 2R3VA 1N34I 3JAMQ 4X65I 3C4BA 2X7IA 4DV2I 4LFBE 4YY3I 3OMLA 2EZ6A 2E5LE 2UUAI 3J81Q 4X65E 2KOUA 2K4VA 1J5EI 1N0UA 4TUGA 4DR1E 3ADIA 2UUCI 1WUUA 1QU6A 3F0NA 5LMUE 1HNWI 1I94E 3HXLA 4X62E 4AQYE 4GKKI 3FIGA 2CGEA 1D6TA 4MYTA 4LF5E 4FW9A 4P52A 2O1WA 4JI6E 4K0KE 1Y4SA 2UU9I 3T1HE 4YHHI 2Z5EA 2DMYA 3J7AM 3IWCA 3WU6A 3VYXA 2LTRA 2JWOA 4JI8I 2DB2A 3V2UC 2Q2EB 3JAMC 1PKPA 1Z0EA 4IZJA 2DEJA 3ZZTA 4WYQB 4X64E 2KONA 3HULA 1XHKA 1XNQI 2VF1A 2V85A 4B3TI 3T1HI 4BC9A 4L8NA 2O1TA 3H4LA 4HYMA 5IWAI 3LTOA 1MX0A 2AJ4A 1FJGE 4DR7E 4DV6E 4MYUA 2V2QA 1NHHA 4URLA 4BC7A 4DR2I 3PYDA 3J7AG 4KHPE 3V5RA 2UXCE 1OJ4A 4JV5I 3LLHA 2L8TA 2OI2A 2EFGA 5F3WA 2CG9A 2BV3A 5FWKA 1FJGI 1YYOA 4DU8A 1ELOA 4OX9I 1FNMA 2PNLA 3B8HA 4UTGA 3GONA 1HNXI 1IBLE 2MDRA 1X48A 4N3OA 4F54A 2JR1A 4DPXA 2N3HA 1Z5BA 1MG7A 4X62I 3ADLA 4DV0I 2R42A 4WSPA 4J8ZA 4B3TE 2O1VA 1S4EA 3K1JA 2WZOA 2JY9A 5BR8I 4WUBA 4XTJA 1H72C 3H09A 2CPNA 4Z7CA 2F4VE 2FGGA 3J7Yp 5A2QC 4DV1I 2E1RA 4LF8I 2GQ0A 2LJPA 4WUCA 4I3HA 3ZKBA 4WPYA 4USMA 1DQ3A 1FWLA 1H73A 3PYGA 4JI1E 2ZBKB 2RSMA 1H7SA 4WFTA 2B7TA 3ZOQB 4IZKA 2NUFA 4USKA 5CFFE 5LMUI 4B3SI 2GS8A 2WW4A 1T4LB 4DV5E 4DV1E 1DARA 4LF6I 4IZKB 1ZXMA 2FTXB 2ZITA 1N33I 2JOBA 2ZM6I 1GZ6A 4B3RI 4M2ZA 2B3TB 4PRVA 2L2NA 1ZM3A 5ADZA 4JI0E 2LRSA 3HQ1A 2L3CA 4WUDA 4M1KA 4JI4E 2BM0A 4LF4I 4DR2E 4DR6E 5FLXQ 3LMLA 1SR9A 2H36X 2VQFI 1I94I 2L2MA 1HK7A 2F8BA 5LL6R 1EA6A 3DJWA 4DV7I 1EKZA 2NUEA 3ZKDA 2ZM6E 3D4JA 4BBYA 1EI1A 2LMZA 4DR5E 2HFSA 4BMJA 1IBKE 3PYEA 2B7VA 1X47A 3MSWA 4DR4I 4IZJB 4HY1A 4JV5E 2V86A 5LMNE 1N32I 1IBKI 1HNZE 4LF9I 2L92A 2PNMA 4OOGC 1B63A 4KQVA 2M4IA 4B3MI 1U2RA 1UHZA 4Z7YA 5AE3A 3WU5A 1XMOE 4NXMI 3HJCA 1IBMI 4DMIA 3K6QA 3VYYA 4HACA 2HKJA 4JI5E 1O0WA 2Z5CA 3QT6A 1N33E 1ZBTA 1QZRA 2G7HA 2V2VA 1A6FA 1Z0CA 3PYFA 2YT4A 1DI2A 2UXBI 4DV7E 5BR8E 1YYKA 2VQEI 4LU9A 1USUA 3ZZUA 3AUZA 3WU4A 1Z0TA 4P78A 2UXBE 2HK2A 1YZ9A 1N36E 1Z59A 4KHPI 4DPYA 2UXDE 1KTVA 1NZ0A 4BS9A 2V8PA 1T4OA 4P7DA 1KVKA 3HPSA 1PIEA 5L3JA 1B62A 2VQEE 2XEXA 4LF7I 2FV4B 1VISA 1Z5CA 1H74A 1HNXE 1XNRE 3QT5A 4B3ME 4DV5I 1H7UA 1FKAE 2L6MA 4FWHA 3F6HA 3VK6A 1N32E 1IBME 5T6JA 3OTOI 3F6GA 2MC6A 1KIJA 1ZXNA 4F9BB 4JYAI 1X49A 3ADJA 3QT8A 4JI0I 4LF9E 2UU9E 4DR3E 4LF8E 1BKNA 4NXNE 4ZVIA 1XMQE 4JI5I 2RS7A 4JI3I 4OX9E 1PVGA 5A2QQ 2LUPB 4DXLA 2NUGA 2MC5A 1FWKA 2HK3A 4FWDA 2DEIA 1USVA 5IT9Q 2HHHE 1XMQI 4DV2E 3LPSA 1XNQE 4DV4E 2L2KB 1NHIA 2UUAE 4X8WA 4R03A 4DUYI 4DV0E 3P1XA 4KZSA 4LF5I 2V2ZA 4UT4A 4DV6I 4L5NC 4FN5A 5FLXC 2V87A 2RS6A 2L33A 4PRXA 4JI4I 2DSYA 3CWVA 4DR6I 1GQEA 1MU5A 3ZM7A 1UILA 2UXCI 2ODRC 2X36A 2F4VI 4LF7E 4DPUA 3OTOE 2Z5BB 4DU7A 3B78A 3C4TA 4YY3E 4R8OA 2A2DA 3T1YI 4JI8E 3K17A 1XNRI 4JI2E 1J5EE 4LF4E 4DKKA 5IT9C 3J80Q 3J81C 5DNYA 1Z5AA 4LFAI 3DF6A 1RREA 4DPTA 5AE1A 2V88A 1KKHA 2VF3A 1WHNA 3B82A 4PU9A 4GKJE 1N36I 5AASA 1WHQA 1RC7A 2NA2A 2IHR1 2O1UA 3ADGA 4YHHE 4DPWA 2LBSB 4JI7I 1ZM9A 1YYWA 2RTXA 1ZM4A 4HACB 3ZZ0A 1Y6ZA 4NXME 1ZM2A 1J26A 3LNUA 4JI7E 4LFAE 3IWBA 4DV3I 2N3GA 1RQ0A 3Q1QA 4GKJI 4K0KI 1HR0E 3PRYA 2V89A 4LTYA 1WXRA 4DUZI 5IWAE 2UUBE 4ED4A 1S16A 1HR0I 4P7AA 4DR5I 2UUCE 2DIXA 3KWRA 1N34E 3RMPA 4DV3E 4EMDA 4BCAA 4X64I 2HHHI 2CZ9A 5LMNI 4M0VA 2B9DA 2JOXA 1Z0BA 2E5LI 4F9AB 1K47A 4HXZA 3JU0A 4NXNI 3K85A 2ODRD 2UUBI 4DUZE 4DR1I 2A2CA 2Z5CB 4X66I 2HFUA 4GKKE 4AQYI 4RPFA 5GMEA 1RR9A 2EWLA 4LFBI 4JG4A 4I8OA 4LFCI 3Q6MA 4DUYE 4JI1I 2J7KA 1XMOI 4LF6E 3M6AA 2BM1A 2L3JA 2M1SA 2YZTA 3T1YE 1ZBQA 1N0VC 3AV0A 4F9CB 4B3SE 1FI4A 4JI3E 1STUA 2IOQA 4DR4E 2IOPA 2Z5BA 5GMDA 4DR3I 2VQFE 2NPFA 4TUIA 1HNZI 4GEQB 2HKEA 4FWGA 4DV4I 2LJHA 4JI6I 4DR7I 3HTXA 4M30A 3QT7A 2LE2A 1HNWE 2M7QA 3J80C 3JTZA 2VE7C 1UEKA 4IZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0G A;  2KHX A;  2JVA A;  1Z0W A;  4JYA E;  1NHJ A;  4R1F A;  4LFC E;  3WU3 A;  2LUQ A;  1Z0V A;  2LTS A;  4B3R E;  1T4N A;  1IBL I;  4X66 E;  2UXD I;  2V34 A;  4JI2 I;  2R3V A;  1N34 I;  3JAM Q;  4X65 I;  3C4B A;  2X7I A;  4DV2 I;  4LFB E;  4YY3 I;  2EZ6 A;  2E5L E;  2UUA I;  3J81 Q;  4X65 E;  1J5E I;  1N0U A;  4DR1 E;  3ADI A;  2UUC I;  1WUU A;  1QU6 A;  3F0N A;  5LMU E;  1HNW I;  1I94 E;  4X62 E;  4AQY E;  4GKK I;  1D6T A;  4MYT A;  4LF5 E;  4FW9 A;  4P52 A;  4JI6 E;  4K0K E;  2UU9 I;  3T1H E;  4YHH I;  2DMY A;  3J7A M;  3WU6 A;  3VYX A;  2LTR A;  4JI8 I;  2DB2 A;  3V2U C;  2Q2E B;  3JAM C;  1PKP A;  1Z0E A;  2DEJ A;  3ZZT A;  4WYQ B;  4X64 E;  3HUL A;  1XHK A;  1XNQ I;  4B3T I;  3T1H I;  3H4L A;  4HYM A;  5IWA I;  3LTO A;  1MX0 A;  2AJ4 A;  1FJG E;  4DR7 E;  4DV6 E;  4MYU A;  2V2Q A;  1NHH A;  4URL A;  4DR2 I;  3PYD A;  3J7A G;  4KHP E;  3V5R A;  2UXC E;  1OJ4 A;  4JV5 I;  3LLH A;  2OI2 A;  2EFG A;  2BV3 A;  1FJG I;  1YYO A;  4DU8 A;  1ELO A;  4OX9 I;  1FNM A;  3B8H A;  4UTG A;  3GON A;  1HNX I;  1IBL E;  2MDR A;  1X48 A;  4DPX A;  2N3H A;  1Z5B A;  1MG7 A;  4X62 I;  3ADL A;  4DV0 I;  2R42 A;  4B3T E;  1S4E A;  3K1J A;  2JY9 A;  5BR8 I;  4WUB A;  4XTJ A;  1H72 C;  2CPN A;  4Z7C A;  2F4V E;  3J7Y p;  5A2Q C;  4DV1 I;  2E1R A;  4LF8 I;  4WUC A;  2LJP A;  4I3H A;  3ZKB A;  4USM A;  1FWL A;  1H73 A;  3PYG A;  4JI1 E;  2ZBK B;  2RSM A;  1H7S A;  4WFT A;  2B7T A;  2NUF A;  4USK A;  5CFF E;  5LMU I;  4B3S I;  2GS8 A;  2WW4 A;  1T4L B;  4DV5 E;  4DV1 E;  1DAR A;  4LF6 I;  1ZXM A;  2ZIT A;  1N33 I;  2ZM6 I;  4B3R I;  4M2Z A;  2B3T B;  4PRV A;  2L2N A;  1ZM3 A;  4JI0 E;  2LRS A;  2L3C A;  4WUD A;  4M1K A;  4JI4 E;  2BM0 A;  4LF4 I;  4DR2 E;  4DR6 E;  5FLX Q;  2VQF I;  1I94 I;  2L2M A;  1EA6 A;  5LL6 R;  4DV7 I;  1EKZ A;  2NUE A;  3ZKD A;  2ZM6 E;  3D4J A;  1EI1 A;  4DR5 E;  2HFS A;  1IBK E;  3PYE A;  2B7V A;  1X47 A;  4DR4 I;  4HY1 A;  4JV5 E;  5LMN E;  1N32 I;  1IBK I;  1HNZ E;  4LF9 I;  4KQV A;  4OOG C;  1B63 A;  4B3M I;  1U2R A;  1UHZ A;  4Z7Y A;  3WU5 A;  1XMO E;  4NXM I;  1IBM I;  3VYY A;  4HAC A;  2HKJ A;  4JI5 E;  1O0W A;  3QT6 A;  1N33 E;  1ZBT A;  1QZR A;  2V2V A;  1A6F A;  1Z0C A;  3PYF A;  2YT4 A;  1DI2 A;  2UXB I;  4DV7 E;  5BR8 E;  1YYK A;  2VQE I;  3ZZU A;  3WU4 A;  1Z0T A;  2UXB E;  2HK2 A;  1YZ9 A;  1N36 E;  1Z59 A;  4KHP I;  4DPY A;  2UXD E;  1KTV A;  1NZ0 A;  2V8P A;  1T4O A;  1KVK A;  1PIE A;  5L3J A;  1B62 A;  2VQE E;  2XEX A;  4LF7 I;  1VIS A;  1Z5C A;  1H74 A;  1HNX E;  1XNR E;  3QT5 A;  4B3M E;  4DV5 I;  1H7U A;  1FKA E;  4FWH A;  1N32 E;  1IBM E;  3OTO I;  1KIJ A;  1ZXN A;  4JYA I;  1X49 A;  3ADJ A;  3QT8 A;  4JI0 I;  4LF9 E;  2UU9 E;  4DR3 E;  4LF8 E;  1BKN A;  4NXN E;  4ZVI A;  1XMQ E;  4JI5 I;  2RS7 A;  4JI3 I;  4OX9 E;  1PVG A;  5A2Q Q;  2LUP B;  4DXL A;  2NUG A;  1FWK A;  2HK3 A;  4FWD A;  2DEI A;  5IT9 Q;  2HHH E;  1XMQ I;  4DV2 E;  3LPS A;  1XNQ E;  4DV4 E;  2L2K B;  1NHI A;  2UUA E;  4X8W A;  4DUY I;  4DV0 E;  3P1X A;  4LF5 I;  2V2Z A;  4UT4 A;  4DV6 I;  4FN5 A;  5FLX C;  2RS6 A;  2L33 A;  4PRX A;  4JI4 I;  3CWV A;  4DR6 I;  1GQE A;  1MU5 A;  3ZM7 A;  1UIL A;  2UXC I;  2X36 A;  2F4V I;  4LF7 E;  4DPU A;  3OTO E;  4DU7 A;  3B78 A;  3C4T A;  4YY3 E;  2A2D A;  3T1Y I;  4JI8 E;  3K17 A;  1XNR I;  4JI2 E;  1J5E E;  4LF4 E;  4DKK A;  3J80 Q;  5IT9 C;  3J81 C;  1Z5A A;  4LFA I;  1RRE A;  4DPT A;  1KKH A;  2VF3 A;  1WHN A;  3B82 A;  4PU9 A;  4GKJ E;  1N36 I;  1WHQ A;  1RC7 A;  2NA2 A;  2IHR 1;  4DPW A;  3ADG A;  4YHH E;  2LBS B;  4JI7 I;  1ZM9 A;  1YYW A;  2RTX A;  1ZM4 A;  4HAC B;  3ZZ0 A;  4NXM E;  1ZM2 A;  1J26 A;  3LNU A;  4JI7 E;  4LFA E;  4DV3 I;  2N3G A;  1RQ0 A;  3Q1Q A;  4GKJ I;  4K0K I;  1HR0 E;  4DUZ I;  5IWA E;  2UUB E;  4ED4 A;  1S16 A;  1HR0 I;  4P7A A;  4DR5 I;  2UUC E;  2DIX A;  1N34 E;  4DV3 E;  4EMD A;  4X64 I;  2HHH I;  2CZ9 A;  5LMN I;  1Z0B A;  2E5L I;  1K47 A;  4HXZ A;  4NXN I;  2UUB I;  4DUZ E;  4DR1 I;  2A2C A;  4X66 I;  2HFU A;  4GKK E;  4AQY I;  4RPF A;  5GME A;  1RR9 A;  4LFB I;  4JG4 A;  4LFC I;  4DUY E;  4JI1 I;  2J7K A;  1XMO I;  4LF6 E;  3M6A A;  2BM1 A;  2L3J A;  3T1Y E;  1N0V C;  4B3S E;  1FI4 A;  4JI3 E;  1STU A;  4DR4 E;  5GMD A;  4DR3 I;  2VQF E;  2NPF A;  1HNZ I;  2HKE A;  4FWG A;  4DV4 I;  2LJH A;  4JI6 I;  4DR7 I;  3HTX A;  4M30 A;  3QT7 A;  1HNW E;  3J80 C;  1UEK A; 
#chains in the Genus database with same CATH topology
 1Z0G A;  2KHX A;  2GO3 A;  4RH8 A;  2JVA A;  1Z0W A;  4JYA E;  3IWD A;  1BB8 A;  2CT1 A;  1NHJ A;  4LFC E;  3P06 A;  4R1F A;  3WU3 A;  2LUQ A;  2GO4 A;  2YU8 A;  1Z0V A;  2NN6 B;  2LTS A;  3GLL A;  4B3R E;  3Q6N A;  1T4N A;  2E1M A;  3C6M A;  2J65 A;  2EPM X;  4OZE A;  4BA1 A;  2DGC A;  1IBL I;  5AE2 A;  2V83 A;  2A25 A;  3UK3 C;  4X66 E;  2JEA A;  2V8Q B;  2UXD I;  5IV8 B;  1Y4U A;  2V34 A;  4JI2 I;  3HPZ A;  3BF2 A;  3CDJ A;  4Q28 A;  2GLI A;  2R3V A;  1N34 I;  3JAM Q;  4X65 I;  3C4B A;  2X7I A;  4DV2 I;  4LFB E;  2EMK A;  1F2I G;  1AAY A;  4YY3 I;  5A6B D;  3OML A;  2EMH A;  4BA2 B;  2EZ6 A;  2E5L E;  2UUA I;  1Y5Y A;  3J81 Q;  4X65 E;  1P42 A;  2YTI A;  2KOU A;  2K4V A;  1J5E I;  2YTP A;  1N0U A;  4TUG A;  3QG5 C;  4DR1 E;  3L00 A;  4HTG A;  3ADI A;  4BHB A;  3TQM A;  2UUC I;  1WUU A;  1QU6 A;  1TN9 A;  5LMU E;  3F0N A;  1PDA A;  3P76 A;  1HNW I;  1I94 E;  3HXL A;  4X62 E;  4AQY E;  2O3Z A;  3FIG A;  2CGE A;  4GKK I;  1D6T A;  4MYT A;  5K36 C;  4LF5 E;  2C38 A;  4FW9 A;  4OO1 B;  4P52 A;  2O1W A;  1A1I A;  4JI6 E;  3BBG A;  4R2P A;  3C6K A;  4K0K E;  4ZYH A;  1Y4S A;  3T1H E;  4IS1 C;  2UU9 I;  2EMC A;  2ENA A;  1XXE A;  2EE8 A;  1KJK A;  4YHH I;  3M85 D;  2Z5E A;  2DMY A;  3J7A M;  1QNT A;  3IWC A;  3EPK A;  3VYX A;  3WU6 A;  4R2R A;  2LTR A;  2JWO A;  4JI8 I;  2YTD A;  1OYS A;  5JEA F;  2DB2 A;  3V2U C;  2Q2E B;  3JAM C;  1PKP A;  1Z0E A;  4IZJ A;  2DEJ A;  3ZZT A;  4WYQ B;  4X64 E;  2KON A;  5C0X B;  3HUL A;  4IS9 A;  2N8X A;  1XHK A;  1XNQ I;  2VF1 A;  2V85 A;  2IES A;  2EOY A;  4R2E A;  4B3T I;  2LT7 A;  3T1H I;  2EN6 A;  4U3D A;  4BC9 A;  3EPH A;  4L8N A;  4NZV A;  5TSE A;  2O1T A;  3H4L A;  4HYM A;  5IWA I;  3LTO A;  1MX0 A;  2AJ4 A;  1FJG E;  1AH5 A;  4DR7 E;  4DV6 E;  1A1F A;  4MYU A;  2V2Q A;  2BA1 D;  5DNL A;  1NHH A;  2MDG A;  1Y60 A;  4BC7 A;  4URL A;  4DR2 I;  2PNZ B;  3PYD A;  3J7A G;  4KHP E;  2NN6 D;  3V5R A;  4MLV A;  1EH7 A;  2UXC E;  1OJ4 A;  3PS3 A;  4AM3 A;  4JV5 I;  3LLH A;  2L8T A;  2EMY A;  2OI2 A;  2WBT A;  5JEA B;  2EFG A;  2GHF A;  5F3W A;  2CG9 A;  1P47 A;  2BV3 A;  4MDT A;  5FWK A;  1FJG I;  1YYO A;  4DU8 A;  1ELO A;  4OX9 I;  3M7N G;  4NHR A;  1FNM A;  2PNL A;  4RHB B;  2YSP A;  3B8H A;  1L4S A;  4UTG A;  3GON A;  3U1K A;  1HNX I;  2BR2 B;  3EPL A;  1UN6 B;  2EPR A;  2PRT A;  1IBL E;  2MDR A;  1X48 A;  4N3O A;  4OO1 E;  2EMW A;  4F54 A;  2JR1 A;  1UBD C;  4DPX A;  2N3H A;  2BBG A;  1Z5B A;  3EPJ A;  2NN6 A;  1MG7 A;  4X62 I;  2YPN A;  1VI7 A;  3GME A;  2BA0 G;  3ADL A;  4QNJ A;  4DV0 I;  2R42 A;  4WSP A;  4J8Z A;  1MEY C;  4B3T E;  2O1V A;  1S4E A;  3K1J A;  3KRN A;  1YH8 A;  2M9A A;  2WNR A;  1A1H A;  1YPN A;  2WZO A;  2JY9 A;  5BR8 I;  4WUB A;  4XTJ A;  2EM5 A;  3BID A;  1H72 C;  1PJS A;  4O4K A;  4IFD B;  3H09 A;  2PO0 A;  2CPN A;  4Z7C A;  2F4V E;  2FGG A;  2EOE A;  2WNR B;  3J7Y p;  5A2Q C;  4DV1 I;  2E1R A;  4WXD A;  4LF8 I;  2GQ0 A;  2LJP A;  4WUC A;  4I3H A;  3ZKB A;  4WPY A;  4USM A;  2ENC A;  1DQ3 A;  1FWL A;  1H73 A;  3PYG A;  4JI1 E;  2ZBK B;  1NCS A;  2RSM A;  2ADR A;  1H7S A;  5DRQ A;  2LO3 A;  4WFT A;  2B7T A;  1JK2 A;  3ZOQ B;  4IZK A;  2NUF A;  2EOI A;  5K36 D;  4USK A;  5CFF E;  5LMU I;  3KZY A;  4B3S I;  5JEA E;  5AC5 A;  2GS8 A;  2WW4 A;  1A1G A;  4OO1 D;  4WXC A;  1T4L B;  4DV5 E;  5DRR A;  4DV1 E;  1DAR A;  5KL5 A;  4LF6 I;  4IZK B;  2IER A;  1ZXM A;  2FTX B;  2ZIT A;  1N33 I;  3EQ1 A;  2CTD A;  2JOB A;  5JEA A;  2ZM6 I;  1GZ6 A;  4B3R I;  2C37 B;  4M2Z A;  2B3T B;  4PRV A;  2L2N A;  2WCC 3;  2VRD A;  1ZM3 A;  2YTG A;  5ADZ A;  4JI0 E;  2LRS A;  3HQ1 A;  2L3C A;  4WUD A;  2JEB B;  4M1K A;  5KL3 A;  5KL4 A;  2I13 A;  4JI4 E;  2BM0 A;  4DR2 E;  4DR6 E;  2NN6 E;  2EM8 A;  3LML A;  1SR9 A;  4F6N A;  2JEB A;  2H36 X;  2YTE A;  5FLX Q;  2VQF I;  1I94 I;  5A69 A;  2L2M A;  5KL7 A;  1HK7 A;  2EOZ A;  2F8B A;  5LL6 R;  4R2A A;  1EA6 A;  2C39 B;  2CVE A;  2DLQ A;  3DJW A;  4DV7 I;  1EKZ A;  2NUE A;  3ZKD A;  2ZM6 E;  1YSA C;  4MQY A;  5K36 B;  3D4J A;  2EQ0 A;  4BBY A;  3VHT B;  2EM6 A;  1EI1 A;  4KWY A;  4NBQ A;  2EOR A;  2LMZ A;  2PO2 A;  1OYR A;  4MU4 A;  4DR5 E;  2HFS A;  2JEA B;  4BMJ A;  1IBK E;  5DRP A;  1X6E A;  3PYE A;  2B7V A;  4R2D A;  1X47 A;  3MSW A;  4DR4 I;  4IZJ B;  4HY1 A;  4JV5 E;  2V86 A;  4O24 A;  5LMN E;  2EOJ A;  2EPP A;  1N32 I;  1IBK I;  1HNZ E;  4LF9 I;  2HC5 A;  2L92 A;  2R1F A;  4DXL A;  2DMI A;  2PNM A;  4OOG C;  1B63 A;  4FW7 A;  4KQV A;  2M4I A;  4B3M I;  1U2R A;  5JEA D;  4LOM A;  1UHZ A;  1LLM C;  2EPC A;  1NEI A;  5AE3 A;  4Z7Y A;  3WU5 A;  3M85 G;  1XMO E;  4NXM I;  4OO1 C;  3HJC A;  1IBM I;  4DMI A;  3K6Q A;  3THO B;  3VYY A;  4J3D A;  4HAC A;  1BBG A;  2HKJ A;  4JI5 E;  1IQS A;  1O0W A;  2YTO A;  2Z5C A;  5A6J A;  3QT6 A;  1N33 E;  1ZBT A;  1QZR A;  2EL5 A;  2G7H A;  4WX9 A;  2V2V A;  1A6F A;  1Z0C A;  2F1D A;  3PYF A;  5KL2 A;  5DNX A;  2YT4 A;  4AIM A;  1DI2 A;  1GTK A;  2UXB I;  4DV7 E;  5BR8 E;  1YYK A;  4FW6 A;  4LU9 A;  2VQE I;  3B4T A;  1USU A;  3ZZU A;  2I9I A;  3U1Y A;  3AUZ A;  3GCM A;  4ZYE A;  3MHS C;  2BR2 A;  3WU4 A;  1Z0T A;  4P78 A;  2UXB E;  2HK2 A;  1YZ9 A;  4ZYG A;  1N36 E;  1Z59 A;  5ELW A;  4KHP I;  4DPY A;  2WP8 A;  2EOX A;  2UXD E;  2BA1 G;  5EL9 A;  1KTV A;  1NZ0 A;  1R6L A;  4BS9 A;  2V8P A;  1T4O A;  4P7D A;  1KVK A;  3HPS A;  4M9V C;  1PIE A;  2EOQ A;  5L3J A;  1UDO A;  4OO1 A;  1B62 A;  2PO1 A;  2JXP A;  2VQE E;  2XEX A;  4LF7 I;  4FW4 A;  2FV4 B;  4FW3 A;  2EOF A;  1VIS A;  1Z5C A;  1H74 A;  1HNX E;  3ECR A;  1XNR E;  2EPK X;  3QT5 A;  4B3M E;  2C38 B;  4DV5 I;  1TF3 A;  2GPI A;  1FKA E;  1H7U A;  2J7J A;  2L6M A;  4FWH A;  3LNU A;  3F6H A;  2YSO A;  2ENH A;  2EOM A;  3VK6 A;  4GZN C;  1IBM E;  2EOS A;  2Q8U A;  5T6J A;  5AC4 A;  1N32 E;  3OTO I;  3F6G A;  2EQ1 A;  2MC6 A;  4WSG A;  1KIJ A;  1ZXN A;  3PS2 A;  4IJD A;  4F9B B;  4JYA I;  2EPO A;  1X49 A;  1OYP A;  1X5W A;  3ADJ A;  3QT8 A;  4JI0 I;  4LF9 E;  2EP3 A;  2YTQ A;  2UU9 E;  4DR3 E;  4OKG A;  2EL6 A;  4LF8 E;  3P3E A;  1X6H A;  1BKN A;  2YRH A;  2EPL X;  4NXN E;  4ZVI A;  2RSI A;  2EM9 A;  1XMQ E;  4JI5 I;  2RS7 A;  4JI3 I;  1EH6 A;  1G2D C;  4OX9 E;  1PVG A;  4BA1 B;  5A2Q Q;  4LF4 I;  2LUP B;  3HKM A;  2NUG A;  2MC5 A;  3THN A;  1BBO A;  1FWK A;  2HK3 A;  4FWD A;  2EPX A;  2DEI A;  1USV A;  2EMI A;  5IT9 Q;  2HHH E;  2NN6 C;  4DV2 E;  2JT2 A;  1XMQ I;  3LPS A;  1XNQ E;  4R2S A;  4DV4 E;  1KYQ A;  2L2K B;  1NHI A;  4IFD E;  2EOO A;  1ZU1 A;  2UUA E;  2EPZ A;  2BB8 A;  4N4R B;  4R03 A;  4X8W A;  4DV0 E;  4AID A;  4DUY I;  3P1X A;  4KZS A;  4LF5 I;  2V2Z A;  2EM7 A;  4LCH A;  1RMD A;  4O5G A;  4UT4 A;  4L5N C;  1DGC A;  4DV6 I;  4FN5 A;  5FLX C;  2V87 A;  2NAB A;  2RS6 A;  1PJT A;  2L33 A;  4PRX A;  2DSY A;  3CWV A;  4ISA A;  2MKD A;  4JI4 I;  1GQE A;  4DR6 I;  1MU5 A;  2YTJ A;  1R6M A;  3ZM7 A;  1UIL A;  2UXC I;  2ODR C;  2X36 A;  4QNK A;  5KL6 A;  2F4V I;  4LF7 E;  2YTF A;  5A6B A;  2DLK A;  3OTO E;  2AE8 A;  4DPU A;  2Z5B B;  4DU7 A;  3B78 A;  3C4T A;  4YY3 E;  4MU3 A;  1WRJ A;  4R8O A;  2A2D A;  4R2Q A;  3T1Y I;  2EM2 A;  4JI8 E;  3K17 A;  1G2F C;  1XNR I;  4JI2 E;  1J5E E;  1X3C A;  4LF4 E;  4DKK A;  5IT9 C;  3J80 Q;  3J81 C;  1YFH A;  1MGT A;  5DNY A;  1A1L A;  4LCF A;  2JP9 A;  3M99 B;  2K7I A;  1YHC A;  1Z5A A;  3DD6 A;  2RQL A;  4LFA I;  3DF6 A;  2EPA A;  1IMU A;  2EMX A;  5AE1 A;  1RRE A;  2V88 A;  3PS1 A;  2JPA A;  5IXM B;  1KKH A;  4DPT A;  5C0X D;  5C0X C;  2VF3 A;  1WHN A;  3B82 A;  4PU9 A;  2EMB A;  4MLQ A;  4GKJ E;  3UHM A;  1N36 I;  5AAS A;  1WHQ A;  1RC7 A;  2YU5 A;  2YWQ A;  2NA2 A;  2IHR 1;  4X9J A;  2O1U A;  3ADG A;  4ZYD A;  4YHH E;  4DPW A;  2LBS B;  4JI7 I;  1ZM9 A;  1EH8 A;  4F6M A;  5C0X E;  2EM4 A;  1YYW A;  2RTX A;  1T39 A;  1ZM4 A;  2HJJ A;  3MHH C;  5LLQ A;  2VES A;  4OO1 F;  5JEA C;  5K36 F;  2PNZ A;  4HAC B;  3ZZ0 A;  1Y6Z A;  4NXM E;  1ZM2 A;  1J26 A;  1A1K A;  4Q35 B;  4JI7 E;  4BHC A;  2LJU A;  1B69 A;  2DRP A;  4LFA E;  1E3P A;  3IWB A;  4LCG A;  4DV3 I;  3L7Z A;  2N3G A;  2R76 A;  2PO1 B;  1RQ0 A;  3Q1Q A;  4GKJ I;  1PJQ A;  4K0K I;  2C37 A;  1HR0 E;  3PRY A;  2V89 A;  4LTY A;  1WXR A;  2JE6 B;  1JK1 A;  1WJP A;  4DUZ I;  5IWA E;  1E3H A;  2UUB E;  2LVH A;  2PO2 B;  5C0X A;  4ED4 A;  1S16 A;  2EJ4 A;  1HR0 I;  3H1C A;  4P7A A;  4DR5 I;  2UUC E;  2DIX A;  3KWR A;  1N34 E;  2D9H A;  3RMP A;  4DV3 E;  3CDI A;  4EMD A;  4BCA A;  1N3G A;  2EN8 A;  4X64 I;  4FK5 C;  2HHH I;  4IFD C;  1IQO A;  2CZ9 A;  5LMN I;  4M0V A;  2B9D A;  2C39 A;  2JOX A;  2LV2 A;  5EKW A;  2EQ3 A;  1Z0B A;  2E5L I;  2LCE A;  4F9A B;  1YUJ A;  1K47 A;  4GQU A;  4HXZ A;  3KZZ A;  5K36 A;  3JU0 A;  1TF6 A;  2EN3 A;  4NXN I;  3K85 A;  2ODR D;  2UUB I;  2ELY A;  4DUZ E;  4DR1 I;  2A2C A;  2Z5C B;  2MKN A;  3L7Z B;  1T38 A;  4X66 I;  2EM0 A;  2E72 A;  2HFU A;  2YRM A;  4IFD A;  2YRK A;  4GKK E;  4AQY I;  1UDN A;  4RPF A;  5GME A;  4FW5 A;  2EMA A;  2EWL A;  1RR9 A;  3P3G A;  4JG4 A;  4LFB I;  2EL4 A;  4I8O A;  2EMG A;  2EPU A;  4LFC I;  2WBS A;  3Q6M A;  2BA0 D;  4DUY E;  4JI1 I;  4MU1 A;  2J7K A;  4LPF A;  2EN4 A;  1Z1B A;  1XMO I;  4BA2 A;  4R2C A;  4LF6 E;  4IFD F;  3M6A A;  2BM1 A;  2L3J A;  2M1S A;  2YZT A;  1YUI A;  2EMZ A;  1A1J A;  3T1Y E;  2EOH A;  1ZBQ A;  2NN6 F;  4IFD D;  3BGH A;  1N0V C;  3AV0 A;  5K36 E;  4F9C B;  4B3S E;  2HGH A;  2WP8 B;  1FI4 A;  5C0X F;  2YTN A;  4F2J C;  3M7N D;  4JI3 E;  1STU A;  2IOQ A;  2EM3 A;  4DR4 E;  2IOP A;  5DRO A;  2EPN A;  2JE6 A;  1X6F A;  2Z5B A;  5GMD A;  4HEI A;  2EN1 A;  2VQF E;  4DR3 I;  2NPF A;  4TUI A;  1HNZ I;  1ZR9 A;  4GEQ B;  1UDS A;  2HKE A;  4FWG A;  4DV4 I;  2ELZ A;  2LJH A;  1UDQ A;  4JI6 I;  4DR7 I;  3HTX A;  2WBU A;  2EML A;  1RHY A;  4M30 A;  5A6K A;  5A6A A;  3QT7 A;  2CSH A;  2LE2 A;  1ZAA C;  2EMF A;  1HNW E;  4MU0 A;  2PO0 B;  4U3B A;  2M7Q A;  3J80 C;  3JTZ A;  3P3C A;  2VE7 C;  1SFE A;  1UEK A;  2EN7 A;  2JYA A;  4O43 A;  3NZK A;  4IZJ D;  2RPC A;  2EN2 A; 
#chains in the Genus database with same CATH homology
 1Z0G A;  2KHX A;  2JVA A;  1Z0W A;  4JYA E;  3IWD A;  1NHJ A;  4R1F A;  4LFC E;  3P06 A;  3WU3 A;  2LUQ A;  1Z0V A;  2LTS A;  4B3R E;  3Q6N A;  1T4N A;  2E1M A;  1IBL I;  5AE2 A;  2V83 A;  4X66 E;  2UXD I;  2V8Q B;  1Y4U A;  2V34 A;  4JI2 I;  3HPZ A;  4Q28 A;  2R3V A;  1N34 I;  3JAM Q;  4X65 I;  3C4B A;  2X7I A;  4DV2 I;  4LFB E;  4YY3 I;  3OML A;  2EZ6 A;  2E5L E;  2UUA I;  3J81 Q;  4X65 E;  2KOU A;  2K4V A;  1J5E I;  1N0U A;  4TUG A;  4DR1 E;  3ADI A;  2UUC I;  1WUU A;  1QU6 A;  3F0N A;  5LMU E;  1HNW I;  1I94 E;  3HXL A;  4X62 E;  4AQY E;  4GKK I;  3FIG A;  2CGE A;  1D6T A;  4MYT A;  4LF5 E;  4FW9 A;  4P52 A;  2O1W A;  4JI6 E;  4K0K E;  1Y4S A;  2UU9 I;  3T1H E;  4YHH I;  2Z5E A;  2DMY A;  3J7A M;  3IWC A;  3WU6 A;  3VYX A;  2LTR A;  2JWO A;  4JI8 I;  2DB2 A;  3V2U C;  2Q2E B;  3JAM C;  1PKP A;  1Z0E A;  4IZJ A;  2DEJ A;  3ZZT A;  4WYQ B;  4X64 E;  2KON A;  3HUL A;  1XHK A;  1XNQ I;  2VF1 A;  2V85 A;  4B3T I;  3T1H I;  4BC9 A;  4L8N A;  2O1T A;  3H4L A;  4HYM A;  5IWA I;  3LTO A;  1MX0 A;  2AJ4 A;  1FJG E;  4DR7 E;  4DV6 E;  4MYU A;  2V2Q A;  1NHH A;  4URL A;  4BC7 A;  4DR2 I;  3PYD A;  3J7A G;  4KHP E;  3V5R A;  2UXC E;  1OJ4 A;  4JV5 I;  3LLH A;  2L8T A;  2OI2 A;  2EFG A;  5F3W A;  2CG9 A;  2BV3 A;  5FWK A;  1FJG I;  1YYO A;  4DU8 A;  1ELO A;  4OX9 I;  1FNM A;  2PNL A;  3B8H A;  4UTG A;  3GON A;  1HNX I;  1IBL E;  2MDR A;  1X48 A;  4N3O A;  4F54 A;  2JR1 A;  4DPX A;  2N3H A;  1Z5B A;  1MG7 A;  4X62 I;  3ADL A;  4DV0 I;  2R42 A;  4WSP A;  4J8Z A;  4B3T E;  2O1V A;  1S4E A;  3K1J A;  2WZO A;  2JY9 A;  5BR8 I;  4WUB A;  4XTJ A;  1H72 C;  3H09 A;  2CPN A;  4Z7C A;  2F4V E;  2FGG A;  3J7Y p;  5A2Q C;  4DV1 I;  2E1R A;  4LF8 I;  2GQ0 A;  2LJP A;  4WUC A;  4I3H A;  3ZKB A;  4WPY A;  4USM A;  1DQ3 A;  1FWL A;  1H73 A;  3PYG A;  4JI1 E;  2ZBK B;  2RSM A;  1H7S A;  4WFT A;  2B7T A;  3ZOQ B;  4IZK A;  2NUF A;  4USK A;  5CFF E;  5LMU I;  4B3S I;  2GS8 A;  2WW4 A;  1T4L B;  4DV5 E;  4DV1 E;  1DAR A;  4LF6 I;  4IZK B;  1ZXM A;  2FTX B;  2ZIT A;  1N33 I;  2JOB A;  2ZM6 I;  1GZ6 A;  4B3R I;  4M2Z A;  2B3T B;  4PRV A;  2L2N A;  1ZM3 A;  5ADZ A;  4JI0 E;  2LRS A;  3HQ1 A;  2L3C A;  4WUD A;  4M1K A;  4JI4 E;  2BM0 A;  4LF4 I;  4DR2 E;  4DR6 E;  5FLX Q;  3LML A;  1SR9 A;  2H36 X;  2VQF I;  1I94 I;  2L2M A;  1HK7 A;  2F8B A;  5LL6 R;  1EA6 A;  3DJW A;  4DV7 I;  1EKZ A;  2NUE A;  3ZKD A;  2ZM6 E;  3D4J A;  4BBY A;  1EI1 A;  2LMZ A;  4DR5 E;  2HFS A;  4BMJ A;  1IBK E;  3PYE A;  2B7V A;  1X47 A;  3MSW A;  4DR4 I;  4IZJ B;  4HY1 A;  4JV5 E;  2V86 A;  5LMN E;  1N32 I;  1IBK I;  1HNZ E;  4LF9 I;  2L92 A;  2PNM A;  4OOG C;  1B63 A;  4KQV A;  2M4I A;  4B3M I;  1U2R A;  1UHZ A;  4Z7Y A;  5AE3 A;  3WU5 A;  1XMO E;  4NXM I;  3HJC A;  1IBM I;  4DMI A;  3K6Q A;  3VYY A;  4HAC A;  2HKJ A;  4JI5 E;  1O0W A;  2Z5C A;  3QT6 A;  1N33 E;  1ZBT A;  1QZR A;  2G7H A;  2V2V A;  1A6F A;  1Z0C A;  3PYF A;  2YT4 A;  1DI2 A;  2UXB I;  4DV7 E;  5BR8 E;  1YYK A;  2VQE I;  4LU9 A;  1USU A;  3ZZU A;  3AUZ A;  3WU4 A;  1Z0T A;  4P78 A;  2UXB E;  2HK2 A;  1YZ9 A;  1N36 E;  1Z59 A;  4KHP I;  4DPY A;  2UXD E;  1KTV A;  1NZ0 A;  4BS9 A;  2V8P A;  1T4O A;  4P7D A;  1KVK A;  3HPS A;  1PIE A;  5L3J A;  1B62 A;  2VQE E;  2XEX A;  4LF7 I;  2FV4 B;  1VIS A;  1Z5C A;  1H74 A;  1HNX E;  1XNR E;  3QT5 A;  4B3M E;  4DV5 I;  1H7U A;  1FKA E;  2L6M A;  4FWH A;  3F6H A;  3VK6 A;  1N32 E;  1IBM E;  5T6J A;  3OTO I;  3F6G A;  2MC6 A;  1KIJ A;  1ZXN A;  4F9B B;  4JYA I;  1X49 A;  3ADJ A;  3QT8 A;  4JI0 I;  4LF9 E;  2UU9 E;  4DR3 E;  4LF8 E;  1BKN A;  4NXN E;  4ZVI A;  1XMQ E;  4JI5 I;  2RS7 A;  4JI3 I;  4OX9 E;  1PVG A;  5A2Q Q;  2LUP B;  4DXL A;  2NUG A;  2MC5 A;  1FWK A;  2HK3 A;  4FWD A;  2DEI A;  1USV A;  5IT9 Q;  2HHH E;  1XMQ I;  4DV2 E;  3LPS A;  1XNQ E;  4DV4 E;  2L2K B;  1NHI A;  2UUA E;  4X8W A;  4R03 A;  4DUY I;  4DV0 E;  3P1X A;  4KZS A;  4LF5 I;  2V2Z A;  4UT4 A;  4DV6 I;  4L5N C;  4FN5 A;  5FLX C;  2V87 A;  2RS6 A;  2L33 A;  4PRX A;  4JI4 I;  2DSY A;  3CWV A;  4DR6 I;  1GQE A;  1MU5 A;  3ZM7 A;  1UIL A;  2UXC I;  2ODR C;  2X36 A;  2F4V I;  4LF7 E;  4DPU A;  3OTO E;  2Z5B B;  4DU7 A;  3B78 A;  3C4T A;  4YY3 E;  4R8O A;  2A2D A;  3T1Y I;  4JI8 E;  3K17 A;  1XNR I;  4JI2 E;  1J5E E;  4LF4 E;  4DKK A;  5IT9 C;  3J80 Q;  3J81 C;  5DNY A;  1Z5A A;  4LFA I;  3DF6 A;  1RRE A;  4DPT A;  5AE1 A;  2V88 A;  1KKH A;  2VF3 A;  1WHN A;  3B82 A;  4PU9 A;  4GKJ E;  1N36 I;  5AAS A;  1WHQ A;  1RC7 A;  2NA2 A;  2IHR 1;  2O1U A;  3ADG A;  4YHH E;  4DPW A;  2LBS B;  4JI7 I;  1ZM9 A;  1YYW A;  2RTX A;  1ZM4 A;  4HAC B;  3ZZ0 A;  1Y6Z A;  4NXM E;  1ZM2 A;  1J26 A;  3LNU A;  4JI7 E;  4LFA E;  3IWB A;  4DV3 I;  2N3G A;  1RQ0 A;  3Q1Q A;  4GKJ I;  4K0K I;  1HR0 E;  3PRY A;  2V89 A;  4LTY A;  1WXR A;  4DUZ I;  5IWA E;  2UUB E;  4ED4 A;  1S16 A;  1HR0 I;  4P7A A;  4DR5 I;  2UUC E;  2DIX A;  3KWR A;  1N34 E;  3RMP A;  4DV3 E;  4EMD A;  4BCA A;  4X64 I;  2HHH I;  2CZ9 A;  5LMN I;  4M0V A;  2B9D A;  2JOX A;  1Z0B A;  2E5L I;  4F9A B;  1K47 A;  4HXZ A;  3JU0 A;  4NXN I;  3K85 A;  2ODR D;  2UUB I;  4DUZ E;  4DR1 I;  2A2C A;  2Z5C B;  4X66 I;  2HFU A;  4GKK E;  4AQY I;  4RPF A;  5GME A;  1RR9 A;  2EWL A;  4LFB I;  4JG4 A;  4I8O A;  4LFC I;  3Q6M A;  4DUY E;  4JI1 I;  2J7K A;  1XMO I;  4LF6 E;  3M6A A;  2BM1 A;  2L3J A;  2M1S A;  2YZT A;  3T1Y E;  1ZBQ A;  1N0V C;  3AV0 A;  4F9C B;  4B3S E;  1FI4 A;  4JI3 E;  1STU A;  2IOQ A;  4DR4 E;  2IOP A;  2Z5B A;  5GMD A;  4DR3 I;  2VQF E;  2NPF A;  4TUI A;  1HNZ I;  4GEQ B;  2HKE A;  4FWG A;  4DV4 I;  2LJH A;  4JI6 I;  4DR7 I;  3HTX A;  4M30 A;  3QT7 A;  2LE2 A;  1HNW E;  2M7Q A;  3J80 C;  3JTZ A;  2VE7 C;  1UEK A;  4IZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...