4LF9I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf9I00
4JI7E 1NHJA 2J7KA 3ZM7A 4DUYE 1NHIA 4DPWA 4URLA 2DEIA 3HULA 4LF8I 4WUDA 2A2DA 3WU6A 4FWHA 4B3ME 3WU4A 4K0KI 3JAMQ 2VQEE 4B3SI 4XTJA 3GONA 4MYUA 1EA6A 1KKHA 4DV4E 3T1YI 4JI4I 2XEXA 1J5EI 2UUBI 1ZXNA 4R1FA 4OX9E 4LF7I 2BV3A 4DV0I 1FJGE 1XHKA 4B3TE 4X65E 3J7AM 1Z0WA 4UTGA 4B3RI 3OTOI 3D4JA 1OJ4A 5IWAE 4DR3I 1N33E 4MYTA 4NXMI 2UU9E 4JI1E 1FI4A 4X65I 1MG7A 4LF6I 2V34A 4DV6E 1D6TA 3QT6A 4OX9I 4DPUA 4HYMA 2UUBE 4NXNI 2ZM6E 1HNZI 4GKKE 2A2CA 4X62I 4DUZE 4I3HA 4JI4E 1RR9A 1Z0EA 4LF5E 3ZKDA 4JI6E 1RREA 4B3SE 4DXLA 1HNWE 4JI2E 4GKJI 4FN5A 2AJ4A 2V8PA 4JI6I 1N0VC 3QT5A 4DUZI 1A6FA 4JI8I 4DUYI 4UT4A 4AQYE 4LFAE 2R3VA 4DV6I 1XNRE 3V5RA 2DEJA 2UUAI 4WUBA 1ZM2A 4DV1E 1MU5A 4YY3I 2BM0A 5A2QC 4NXNE 3PYGA 4JG4A 5GMDA 5LMUI 4PRXA 1I94E 1HNXI 4DR7E 2UXDI 1FWLA 4KHPE 2VF3A 1BKNA 4HY1A 4JI0E 4DR6E 3M6AA 4DR2E 1N34E 3J80C 1XMOI 2UUCI 2V2QA 4X66E 1N32E 3H4LA 3B82A 4DV4I 4USKA 5FLXC 4HACA 3J80Q 2UXCE 1IBME 2HHHI 1XNQI 4K0KE 2NPFA 3ZZ0A 4B3MI 2HHHE 1PKPA 2HFUA 4DR4E 1Z5CA 3F0NA 2UXCI 1H73A 1KTVA 1J5EE 4DPXA 1IBKE 4LF4I 2WW4A 5IT9Q 4DR2I 1DARA 2UUCE 1IBLI 2VQEI 2UXDE 3J81Q 4DR1E 4YY3E 4LFBE 2HK2A 3PYDA 2V2VA 3ZZUA 2ZITA 2UUAE 1UEKA 2ZBKB 4JI5E 4YHHE 5GMEA 1EI1A 2HK3A 1ELOA 4FWDA 1ZXMA 4HACB 1HR0E 4X64I 4P52A 1HNWI 1H72C 4JV5I 2X7IA 2EFGA 3JAMC 4ZVIA 4DR5I 3K1JA 1NZ0A 2F4VE 1WUUA 4Z7YA 2UXBI 4JI1I 4ED4A 3LTOA 3PYEA 4WUCA 1N33I 3B78A 4B3RE 1Z0GA 1Z0VA 1FJGI 4DV5I 1Z0BA 4LF9E 4LF7E 3WU3A 3T1YE 4JYAE 4JV5E 1H7SA 1B62A 2V2ZA 1XMOE 3WU5A 4HXZA 1H74A 4DV2I 3LNUA 5BR8I 4DV7I 4JI3I 1IBMI 1FKAE 4EMDA 4LF8E 2BM1A 4DU7A 1Z59A 4X66I 1N32I 1K47A 4LFCE 4P7AA 4M1KA 3ZKBA 3B8HA 5LMNE 3QT7A 4RPFA 4DR7I 2HKEA 1HNXE 3ZZTA 2GS8A 5LMUE 1I94I 3LPSA 1KVKA 1S4EA 4JI3E 1XMQI 2E5LI 5BR8E 2X36A 4DV2E 1IBLE 5LL6R 1XNRI 3J7AG 4LF5I 4AQYI 3T1HE 2ZM6I 1HNZE 4JYAI 1QZRA 1Z0TA 4YHHI 4JI5I 5L3JA 4DPTA 4GKJE 4DV7E 2E1RA 1XNQE 1FNMA 5A2QQ 4JI2I 1Z0CA 1N36I 1PIEA 5IWAI 4DR3E 1PVGA 1S16A 4X62E 2VQFI 1Z5AA 4B3TI 1VISA 1N34I 4DV3I 4DR1I 4LFBI 2UXBE 4FW9A 4JI0I 4DR6I 1ZM4A 2HKJA 2OI2A 4DV0E 4KHPI 2F4VI 4LF6E 4LF9I 5FLXQ 2Q2EB 4DV3E 4DV5E 1N0UA 2VQFE 4NXME 1IBKI 4LF4E 4DPYA 3J81C 3OTOE 3QT8A 1KIJA 4DR4I 1N36E 5IT9C 4LFAI 1Z5BA 4USMA 4FWGA 3PYFA 1MX0A 4PRVA 4JI8E 4DR5E 4JI7I 3T1HI 3V2UC 1B63A 1NHHA 4Z7CA 1XMQE 2E5LE 3Q1QA 4X64E 1HR0I 1H7UA 4DU8A 3CWVA 4GKKI 2R42A 4PU9A 4DV1I 1ZM3A 3K17A 2CZ9A 4KQVA 1FWKA 4LFCI 5LMNI 1ZM9A 2LJPA 1U2RA 2HFSA 2UU9I
chains in the Genus database with same CATH superfamily
4JI7E 5JEAB 1NHJA 2BA0D 2J7KA 3ZM7A 4DUYE 1NHIA 4DPWA 4URLA 2DEIA 3HULA 4LF8I 4WUDA 2A2DA 3WU6A 4MU0A 4FWHA 4B3ME 3CDJA 2PO2B 3WU4A 4K0KI 3JAMQ 2VQEE 4B3SI 2O1VA 4XTJA 1OYRA 3GONA 4LCHA 4N3OA 4MYUA 1EA6A 1KKHA 4DV4E 4IS9A 3T1YI 4JI4I 2XEXA 3UHMA 1Y6ZA 1J5EI 2UUBI 1ZXNA 4R1FA 4OX9E 4LF7I 2BV3A 1E3PA 4IZJB 4DV0I 2UU9I 1FJGE 1XHKA 5EL9A 3L7ZA 4B3TE 4X65E 3J7AM 5FWKA 1Z0WA 4UTGA 4B3RI 4IZKA 3OTOI 1USVA 3D4JA 1OJ4A 2Z5BA 5IWAE 4DR3I 1N33E 4MYTA 4NXMI 2UU9E 4JI1E 1FI4A 3M7NG 3PRYA 4X65I 1MG7A 3Q6NA 2C39A 4LF6I 2BA1D 2GO3A 5JEAF 2V34A 1P42A 4DV6E 1D6TA 4QNJA 3QT6A 4OX9I 4OO1A 4DPUA 1OYSA 4HYMA 2UUBE 4IFDE 4NXNI 2ZM6E 1HNZI 1OYPA 3U1YA 4GKKE 2A2CA 4X62I 4DUZE 4I3HA 4JI4E 2CVEA 1RR9A 1Z0EA 4LF5E 4LCFA 3ZKDA 4JI6E 5DNXA 1RREA 3U1KA 4QNKA 4B3SE 4DXLA 1HNWE 4JI2E 1UDQA 4GKJI 4FN5A 2AJ4A 2V8PA 4JI6I 1HK7A 2PNZB 1N0VC 3QT5A 4DUZI 5DRPA 1A6FA 4JI8I 4DUYI 4UT4A 4U3DA 4AQYE 4U3BA 4LFAE 2R3VA 4DV6I 4AM3A 2IERA 1XNRE 3V5RA 2JT2A 2DEJA 4OZEA 3K85A 5K36F 5C0XA 2UUAI 4WUBA 1ZM2A 5DRQA 1Y60A 2CGEA 4DV1E 1MU5A 2O1UA 2CG9A 4FW5A 5DROA 4YY3I 5JEAE 2BM0A 5A2QC 4NXNE 3PYGA 4JG4A 5GMDA 5LMUI 4PRXA 1I94E 1HNXI 4DR7E 2UXDI 1FWLA 4KHPE 2VF3A 1BKNA 4HY1A 4JI0E 4DR6E 3M6AA 4DR2E 5C0XF 1N34E 3J80C 1XMOI 2UUCI 2V2QA 2PNMA 4X66E 1N32E 3H4LA 3B82A 2WP8B 4DV4I 1USUA 2AE8A 4USKA 5FLXC 4HACA 3J80Q 2VESA 2UXCE 1IBME 2HHHI 1XNQI 4K0KE 2PNZA 2NPFA 3ZZ0A 4B3MI 2HHHE 1PKPA 3P3GA 3GCMA 2HFUA 1UDSA 4DR4E 1Z5CA 3F0NA 3PS1A 2BR2A 2UXCI 1H73A 3GMEA 1KTVA 3H1CA 2PNLA 4IZJA 1J5EE 4DPXA 3P06A 1IBKE 4LF4I 2WW4A 5IT9Q 4DR2I 2C38B 2BR2B 1DARA 2UUCE 1IBLI 2VQEI 2UXDE 3J81Q 3P3CA 4DR1E 4YY3E 2J65A 4LFBE 2HK2A 3PYDA 2C39B 2V2VA 3ZZUA 2ZITA 2UUAE 2IOPA 2F1DA 4J3DA 4IFDC 1UEKA 4OO1E 2ZBKB 4NBQA 4JI5E 4BA2A 4YHHE 1VI7A 5GMEA 4FW4A 1EI1A 2HK3A 2PO0A 1ELOA 3HKMA 1YH8A 4AIDA 4FWDA 1ZXMA 4HACB 1HR0E 4X64I 4MU4A 4P52A 2O1WA 1HNWI 2NN6A 2GO4A 1H72C 4JV5I 4FW7A 4ISAA 2X7IA 2EFGA 3JAMC 4IFDA 4ZVIA 2Z5CB 4DR5I 3K1JA 1NZ0A 3M85D 1RHYA 2PO1B 1WUUA 2F4VE 4Z7YA 2PO1A 4LPFA 2UXBI 4JI1I 2Z5CA 4ED4A 3LTOA 3PYEA 3HJCA 4WUCA 1R6LA 1N33I 4IFDF 3B78A 4IZJD 4B3RE 1R6MA 1Z0GA 1Z0VA 3NZKA 1FJGI 4DV5I 1UDNA 5DNLA 1Z0BA 2JE6B 4LF9E 2WP8A 3M7ND 4LF7E 2JE6A 2PO0B 2O1TA 3WU3A 3T1YE 3CDIA 4JYAE 4JV5E 2IESA 1H7SA 2NN6F 1B62A 2V2ZA 2C38A 2Z5BB 1XMOE 1YHCA 3WU5A 3DD6A 4HXZA 2O3ZA 5JEAA 1H74A 4DV2I 3LNUA 5BR8I 4DV7I 4JI3I 1IBMI 1FKAE 5ELWA 4EMDA 4LF8E 4FW6A 2BM1A 1Y5YA 1Z59A 4DU7A 4X66I 1N32I 4MQYA 1K47A 2GQ0A 2NN6C 4LFCE 4M1KA 3ZKBA 5JEAD 3B8HA 5LMNE 1UDOA 1XXEA 3QT7A 4RPFA 4AIMA 4DR7I 2PO2A 3P3EA 4MU1A 1E3HA 2HKEA 1HNXE 3ZZTA 2GS8A 5LMUE 1I94I 3LPSA 2BA0G 1KVKA 2NN6D 1S4EA 4OO1D 4JI3E 3M85G 4MU3A 5EKWA 4OO1C 1XMQI 2E5LI 4LCGA 5BR8E 2X36A 4DV2E 1IBLE 5LL6R 1XNRI 3J7AG 3P76A 2BA1G 4LF5I 2NN6B 5K36A 4LOMA 2JEAB 4AQYI 3PS2A 3T1HE 2ZM6I 1HNZE 4JYAI 1QZRA 1Z0TA 2C37A 4YHHI 4JI5I 5L3JA 4DPTA 4GKJE 3PS3A 4DV7E 2E1RA 1XNQE 1FNMA 3B4TA 5A2QQ 4JI2I 1Z0CA 1N36I 2WNRA 4OO1F 1PIEA 5IWAI 4DR3E 3L7ZB 1PVGA 1S16A 4BA1B 4X62E 2VQFI 1Z5AA 1Y4SA 2WNRB 4B3TI 1VISA 1N34I 4DV3I 4DR1I 4LFBI 2UXBE 4FW9A 4JI0I 4DR6I 1ZM4A 2HKJA 2OI2A 4DV0E 5DRRA 4KHPI 5K36E 4OKGA 2F4VI 4LF6E 4LF9I 3GLLA 5FLXQ 2Q2EB 4DV3E 4MDTA 4DV5E 1N0UA 2VQFE 4NXME 1IBKI 4LF4E 2JEBA 4DPYA 3J81C 1Y4UA 3OTOE 3QT8A 1KIJA 5K36B 4DR4I 1N36E 4FW3A 5C0XE 4BA2B 5IT9C 4LFAI 1Z5BA 4USMA 4FWGA 3PYFA 1MX0A 4PRVA 4JI8E 4DR5E 5C0XD 4JI7I 3T1HI 3V2UC 1B63A 1NHHA 4IFDB 4Z7CA 3KRNA 5C0XB 5K36C 1XMQE 2E5LE 4OO1B 3Q1QA 4X64E 1HR0I 2JEBB 2C37B 4GQUA 1H7UA 4DU8A 2JEAA 4IFDD 3CWVA 4GKKI 2NN6E 5K36D 2R42A 3Q6MA 4PU9A 4DV1I 1ZM3A 3K17A 2CZ9A 2Z5EA 5JEAC 4IZKB 4KQVA 5C0XC 1FWKA 4LFCI 5LMNI 1ZM9A 2LJPA 4BA1A 1U2RA 2HFSA 2IOQA 4P7AA
chains in the Genus database with same CATH topology
4JI7E 1NHJA 2J7KA 3ZM7A 4DUYE 1NHIA 4DPWA 4URLA 2DEIA 3HULA 4LF8I 4WUDA 2A2DA 3WU6A 4FWHA 4B3ME 3WU4A 4K0KI 3JAMQ 2VQEE 4B3SI 2O1VA 4XTJA 3GONA 4N3OA 4MYUA 1EA6A 1KKHA 4DV4E 3T1YI 4JI4I 2XEXA 1Y6ZA 1J5EI 2UUBI 1ZXNA 4R1FA 4OX9E 4LF7I 2BV3A 4IZJB 4DV0I 1FJGE 1XHKA 4B3TE 4X65E 3J7AM 5FWKA 1Z0WA 4UTGA 4B3RI 4IZKA 3OTOI 1USVA 3D4JA 1OJ4A 2Z5BA 5IWAE 4DR3I 1N33E 4MYTA 4NXMI 2UU9E 4JI1E 1FI4A 3PRYA 4X65I 1MG7A 3Q6NA 4LF6I 2V34A 4DV6E 1D6TA 3QT6A 4OX9I 4DPUA 4HYMA 2UUBE 4NXNI 2ZM6E 1HNZI 4GKKE 2A2CA 4X62I 4DUZE 4I3HA 4JI4E 1RR9A 1Z0EA 4LF5E 3ZKDA 4JI6E 1RREA 4B3SE 4DXLA 1HNWE 4JI2E 4GKJI 4FN5A 2AJ4A 2V8PA 4JI6I 1HK7A 1N0VC 3QT5A 4DUZI 1A6FA 4JI8I 4DUYI 4UT4A 4AQYE 4LFAE 2R3VA 4DV6I 1XNRE 3V5RA 2DEJA 3K85A 2UUAI 4WUBA 1ZM2A 2CGEA 4DV1E 1MU5A 2O1UA 2CG9A 4YY3I 2BM0A 5A2QC 4NXNE 3PYGA 4JG4A 5GMDA 5LMUI 4PRXA 1I94E 1HNXI 4DR7E 2UXDI 1FWLA 4KHPE 2VF3A 1BKNA 4HY1A 4JI0E 4DR6E 3M6AA 4DR2E 1N34E 3J80C 1XMOI 2UUCI 2V2QA 2PNMA 4X66E 1N32E 3H4LA 3B82A 4DV4I 1USUA 4USKA 5FLXC 4HACA 3J80Q 2UXCE 1IBME 2HHHI 1XNQI 4K0KE 2NPFA 3ZZ0A 4B3MI 2HHHE 1PKPA 2HFUA 4DR4E 1Z5CA 3F0NA 2UXCI 1H73A 1KTVA 1J5EE 2PNLA 4IZJA 4DPXA 3P06A 1IBKE 4LF4I 2WW4A 5IT9Q 4DR2I 1DARA 2UUCE 1IBLI 2VQEI 2UXDE 3J81Q 4DR1E 4YY3E 4LFBE 2HK2A 3PYDA 2V2VA 3ZZUA 2ZITA 2UUAE 2IOPA 1UEKA 2ZBKB 4JI5E 4YHHE 5GMEA 1EI1A 2HK3A 1ELOA 4FWDA 1ZXMA 4HACB 1HR0E 4X64I 4P52A 2O1WA 1HNWI 1H72C 4JV5I 2X7IA 2EFGA 3JAMC 4ZVIA 2Z5CB 4DR5I 3K1JA 1NZ0A 2F4VE 1WUUA 4Z7YA 2UXBI 4JI1I 2Z5CA 4ED4A 3LTOA 3PYEA 3HJCA 4WUCA 1N33I 3B78A 4IZJD 4B3RE 1Z0GA 1Z0VA 1FJGI 4DV5I 1Z0BA 4LF9E 4LF7E 2O1TA 3WU3A 3T1YE 4JYAE 4JV5E 1H7SA 1B62A 2V2ZA 2Z5BB 1XMOE 3WU5A 4HXZA 1H74A 4DV2I 3LNUA 5BR8I 4DV7I 4JI3I 1IBMI 1FKAE 4EMDA 4LF8E 2BM1A 4DU7A 1Z59A 4X66I 1N32I 1K47A 2GQ0A 4P7AA 4LFCE 4M1KA 3ZKBA 3B8HA 5LMNE 3QT7A 4RPFA 4DR7I 2HKEA 1HNXE 3ZZTA 2GS8A 5LMUE 1I94I 3LPSA 1KVKA 1S4EA 4JI3E 1XMQI 2E5LI 5BR8E 2X36A 4DV2E 1IBLE 5LL6R 1XNRI 3J7AG 4LF5I 4AQYI 3T1HE 2ZM6I 1HNZE 4JYAI 1QZRA 1Z0TA 4YHHI 4JI5I 5L3JA 4DPTA 4GKJE 4DV7E 2E1RA 1XNQE 1FNMA 5A2QQ 4JI2I 1Z0CA 1N36I 1PIEA 5IWAI 4DR3E 1PVGA 1S16A 4X62E 2VQFI 1Z5AA 1Y4SA 4B3TI 1VISA 1N34I 4DV3I 4DR1I 4LFBI 2UXBE 4FW9A 4JI0I 4DR6I 1ZM4A 2HKJA 2OI2A 4DV0E 4KHPI 2F4VI 4LF6E 4LF9I 5FLXQ 2Q2EB 4DV3E 4DV5E 1N0UA 2VQFE 4NXME 1IBKI 4LF4E 4DPYA 3J81C 1Y4UA 3OTOE 3QT8A 1KIJA 4DR4I 1N36E 5IT9C 4LFAI 1Z5BA 4USMA 4FWGA 3PYFA 1MX0A 4PRVA 4JI8E 4DR5E 4JI7I 3T1HI 3V2UC 1B63A 1NHHA 4Z7CA 1XMQE 2E5LE 3Q1QA 4X64E 1HR0I 1H7UA 4DU8A 3CWVA 4GKKI 2R42A 3Q6MA 4PU9A 4DV1I 1ZM3A 3K17A 2CZ9A 2Z5EA 4IZKB 4KQVA 1FWKA 4LFCI 5LMNI 1ZM9A 2LJPA 1U2RA 2HFSA 2IOQA 2UU9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 E;  1NHJ A;  2J7K A;  3ZM7 A;  4DUY E;  1NHI A;  4DPW A;  4URL A;  2DEI A;  3HUL A;  4LF8 I;  4WUD A;  2A2D A;  3WU6 A;  4FWH A;  4B3M E;  3WU4 A;  4K0K I;  3JAM Q;  2VQE E;  4B3S I;  4XTJ A;  3GON A;  4MYU A;  1EA6 A;  1KKH A;  4DV4 E;  3T1Y I;  4JI4 I;  2XEX A;  1J5E I;  2UUB I;  1ZXN A;  4R1F A;  4OX9 E;  4LF7 I;  2BV3 A;  4DV0 I;  1FJG E;  1XHK A;  4B3T E;  4X65 E;  3J7A M;  1Z0W A;  4UTG A;  4B3R I;  3OTO I;  3D4J A;  1OJ4 A;  5IWA E;  4DR3 I;  1N33 E;  4MYT A;  4NXM I;  2UU9 E;  4JI1 E;  1FI4 A;  4X65 I;  1MG7 A;  4LF6 I;  2V34 A;  4DV6 E;  1D6T A;  3QT6 A;  4OX9 I;  4DPU A;  4HYM A;  2UUB E;  4NXN I;  2ZM6 E;  1HNZ I;  4GKK E;  2A2C A;  4X62 I;  4DUZ E;  4I3H A;  4JI4 E;  1RR9 A;  1Z0E A;  4LF5 E;  3ZKD A;  4JI6 E;  1RRE A;  4B3S E;  4DXL A;  1HNW E;  4JI2 E;  4GKJ I;  4FN5 A;  2AJ4 A;  2V8P A;  4JI6 I;  1N0V C;  3QT5 A;  4DUZ I;  1A6F A;  4JI8 I;  4DUY I;  4UT4 A;  4AQY E;  4LFA E;  2R3V A;  4DV6 I;  1XNR E;  3V5R A;  2DEJ A;  2UUA I;  4WUB A;  1ZM2 A;  4DV1 E;  1MU5 A;  4YY3 I;  2BM0 A;  5A2Q C;  4NXN E;  3PYG A;  4JG4 A;  5GMD A;  5LMU I;  4PRX A;  1I94 E;  1HNX I;  4DR7 E;  2UXD I;  1FWL A;  4KHP E;  2VF3 A;  1BKN A;  4HY1 A;  4JI0 E;  4DR6 E;  3M6A A;  4DR2 E;  1N34 E;  3J80 C;  1XMO I;  2UUC I;  2V2Q A;  4X66 E;  1N32 E;  3H4L A;  3B82 A;  4DV4 I;  4USK A;  5FLX C;  4HAC A;  3J80 Q;  2UXC E;  1IBM E;  2HHH I;  1XNQ I;  4K0K E;  2NPF A;  3ZZ0 A;  4B3M I;  2HHH E;  1PKP A;  2HFU A;  4DR4 E;  1Z5C A;  3F0N A;  2UXC I;  1H73 A;  1KTV A;  1J5E E;  4DPX A;  1IBK E;  4LF4 I;  2WW4 A;  5IT9 Q;  4DR2 I;  1DAR A;  2UUC E;  1IBL I;  2VQE I;  2UXD E;  3J81 Q;  4DR1 E;  4YY3 E;  4LFB E;  2HK2 A;  3PYD A;  2V2V A;  3ZZU A;  2ZIT A;  2UUA E;  1UEK A;  2ZBK B;  4JI5 E;  4YHH E;  5GME A;  1EI1 A;  2HK3 A;  1ELO A;  4FWD A;  1ZXM A;  4HAC B;  1HR0 E;  4X64 I;  4P52 A;  1HNW I;  1H72 C;  4JV5 I;  2X7I A;  2EFG A;  3JAM C;  4ZVI A;  4DR5 I;  3K1J A;  1NZ0 A;  2F4V E;  1WUU A;  4Z7Y A;  2UXB I;  4JI1 I;  4ED4 A;  3LTO A;  3PYE A;  4WUC A;  1N33 I;  3B78 A;  4B3R E;  1Z0G A;  1Z0V A;  1FJG I;  4DV5 I;  1Z0B A;  4LF9 E;  4LF7 E;  3WU3 A;  3T1Y E;  4JYA E;  4JV5 E;  1H7S A;  1B62 A;  2V2Z A;  1XMO E;  3WU5 A;  4HXZ A;  1H74 A;  4DV2 I;  3LNU A;  5BR8 I;  4DV7 I;  4JI3 I;  1IBM I;  1FKA E;  4EMD A;  4LF8 E;  2BM1 A;  4DU7 A;  1Z59 A;  4X66 I;  1N32 I;  1K47 A;  4LFC E;  4P7A A;  4M1K A;  3ZKB A;  3B8H A;  5LMN E;  3QT7 A;  4RPF A;  4DR7 I;  2HKE A;  1HNX E;  3ZZT A;  2GS8 A;  5LMU E;  1I94 I;  3LPS A;  1KVK A;  1S4E A;  4JI3 E;  1XMQ I;  2E5L I;  5BR8 E;  2X36 A;  4DV2 E;  1IBL E;  5LL6 R;  1XNR I;  3J7A G;  4LF5 I;  4AQY I;  3T1H E;  2ZM6 I;  1HNZ E;  4JYA I;  1QZR A;  1Z0T A;  4YHH I;  4JI5 I;  5L3J A;  4DPT A;  4GKJ E;  4DV7 E;  2E1R A;  1XNQ E;  1FNM A;  5A2Q Q;  4JI2 I;  1Z0C A;  1N36 I;  1PIE A;  5IWA I;  4DR3 E;  1PVG A;  1S16 A;  4X62 E;  2VQF I;  1Z5A A;  4B3T I;  1VIS A;  1N34 I;  4DV3 I;  4DR1 I;  4LFB I;  2UXB E;  4FW9 A;  4JI0 I;  4DR6 I;  1ZM4 A;  2HKJ A;  2OI2 A;  4DV0 E;  4KHP I;  2F4V I;  4LF6 E;  4LF9 I;  5FLX Q;  2Q2E B;  4DV3 E;  4DV5 E;  1N0U A;  2VQF E;  4NXM E;  1IBK I;  4LF4 E;  4DPY A;  3J81 C;  3OTO E;  3QT8 A;  1KIJ A;  4DR4 I;  1N36 E;  5IT9 C;  4LFA I;  1Z5B A;  4USM A;  4FWG A;  3PYF A;  1MX0 A;  4PRV A;  4JI8 E;  4DR5 E;  4JI7 I;  3T1H I;  3V2U C;  1B63 A;  1NHH A;  4Z7C A;  1XMQ E;  2E5L E;  3Q1Q A;  4X64 E;  1HR0 I;  1H7U A;  4DU8 A;  3CWV A;  4GKK I;  2R42 A;  4PU9 A;  4DV1 I;  1ZM3 A;  3K17 A;  2CZ9 A;  4KQV A;  1FWK A;  4LFC I;  5LMN I;  1ZM9 A;  2LJP A;  1U2R A;  2HFS A;  2UU9 I; 
#chains in the Genus database with same CATH topology
 4JI7 E;  5JEA B;  1NHJ A;  2BA0 D;  2J7K A;  3ZM7 A;  4DUY E;  1NHI A;  4DPW A;  4URL A;  2DEI A;  3HUL A;  4LF8 I;  4WUD A;  2A2D A;  3WU6 A;  4MU0 A;  4FWH A;  4B3M E;  3CDJ A;  2PO2 B;  3WU4 A;  4K0K I;  3JAM Q;  2VQE E;  4B3S I;  2O1V A;  4XTJ A;  1OYR A;  3GON A;  4LCH A;  4N3O A;  4MYU A;  1EA6 A;  1KKH A;  4DV4 E;  4IS9 A;  3T1Y I;  4JI4 I;  2XEX A;  3UHM A;  1Y6Z A;  1J5E I;  2UUB I;  1ZXN A;  4R1F A;  4OX9 E;  4LF7 I;  2BV3 A;  1E3P A;  4IZJ B;  4DV0 I;  2UU9 I;  1FJG E;  1XHK A;  5EL9 A;  3L7Z A;  4B3T E;  4X65 E;  3J7A M;  5FWK A;  1Z0W A;  4UTG A;  4B3R I;  4IZK A;  3OTO I;  1USV A;  3D4J A;  1OJ4 A;  2Z5B A;  5IWA E;  4DR3 I;  1N33 E;  4MYT A;  4NXM I;  2UU9 E;  4JI1 E;  1FI4 A;  3M7N G;  3PRY A;  4X65 I;  1MG7 A;  3Q6N A;  2C39 A;  4LF6 I;  2BA1 D;  2GO3 A;  5JEA F;  2V34 A;  1P42 A;  4DV6 E;  1D6T A;  4QNJ A;  3QT6 A;  4OX9 I;  4OO1 A;  4DPU A;  1OYS A;  4HYM A;  2UUB E;  4IFD E;  4NXN I;  2ZM6 E;  1HNZ I;  1OYP A;  3U1Y A;  4GKK E;  2A2C A;  4X62 I;  4DUZ E;  4I3H A;  4JI4 E;  2CVE A;  1RR9 A;  1Z0E A;  4LF5 E;  4LCF A;  3ZKD A;  4JI6 E;  5DNX A;  1RRE A;  3U1K A;  4QNK A;  4B3S E;  4DXL A;  1HNW E;  4JI2 E;  1UDQ A;  4GKJ I;  4FN5 A;  2AJ4 A;  2V8P A;  4JI6 I;  1HK7 A;  2PNZ B;  1N0V C;  3QT5 A;  4DUZ I;  5DRP A;  1A6F A;  4JI8 I;  4DUY I;  4UT4 A;  4U3D A;  4AQY E;  4U3B A;  4LFA E;  2R3V A;  4DV6 I;  4AM3 A;  2IER A;  1XNR E;  3V5R A;  2JT2 A;  2DEJ A;  4OZE A;  3K85 A;  5K36 F;  5C0X A;  2UUA I;  4WUB A;  1ZM2 A;  5DRQ A;  1Y60 A;  2CGE A;  4DV1 E;  1MU5 A;  2O1U A;  2CG9 A;  4FW5 A;  5DRO A;  4YY3 I;  5JEA E;  2BM0 A;  5A2Q C;  4NXN E;  3PYG A;  4JG4 A;  5GMD A;  5LMU I;  4PRX A;  1I94 E;  1HNX I;  4DR7 E;  2UXD I;  1FWL A;  4KHP E;  2VF3 A;  1BKN A;  4HY1 A;  4JI0 E;  4DR6 E;  3M6A A;  4DR2 E;  5C0X F;  1N34 E;  3J80 C;  1XMO I;  2UUC I;  2V2Q A;  2PNM A;  4X66 E;  1N32 E;  3H4L A;  3B82 A;  2WP8 B;  4DV4 I;  1USU A;  2AE8 A;  4USK A;  5FLX C;  4HAC A;  3J80 Q;  2VES A;  2UXC E;  1IBM E;  2HHH I;  1XNQ I;  4K0K E;  2PNZ A;  2NPF A;  3ZZ0 A;  4B3M I;  2HHH E;  1PKP A;  3P3G A;  3GCM A;  2HFU A;  1UDS A;  4DR4 E;  1Z5C A;  3F0N A;  3PS1 A;  2BR2 A;  2UXC I;  1H73 A;  3GME A;  1KTV A;  3H1C A;  2PNL A;  4IZJ A;  1J5E E;  4DPX A;  3P06 A;  1IBK E;  4LF4 I;  2WW4 A;  5IT9 Q;  4DR2 I;  2C38 B;  2BR2 B;  1DAR A;  2UUC E;  1IBL I;  2VQE I;  2UXD E;  3J81 Q;  3P3C A;  4DR1 E;  4YY3 E;  2J65 A;  4LFB E;  2HK2 A;  3PYD A;  2C39 B;  2V2V A;  3ZZU A;  2ZIT A;  2UUA E;  2IOP A;  2F1D A;  4J3D A;  4IFD C;  1UEK A;  4OO1 E;  2ZBK B;  4NBQ A;  4JI5 E;  4BA2 A;  4YHH E;  1VI7 A;  5GME A;  4FW4 A;  1EI1 A;  2HK3 A;  2PO0 A;  1ELO A;  3HKM A;  1YH8 A;  4AID A;  4FWD A;  1ZXM A;  4HAC B;  1HR0 E;  4X64 I;  4MU4 A;  4P52 A;  2O1W A;  1HNW I;  2NN6 A;  2GO4 A;  1H72 C;  4JV5 I;  4FW7 A;  4ISA A;  2X7I A;  2EFG A;  3JAM C;  4IFD A;  4ZVI A;  2Z5C B;  4DR5 I;  3K1J A;  1NZ0 A;  3M85 D;  1RHY A;  2PO1 B;  1WUU A;  2F4V E;  4Z7Y A;  2PO1 A;  4LPF A;  2UXB I;  4JI1 I;  2Z5C A;  4ED4 A;  3LTO A;  3PYE A;  3HJC A;  4WUC A;  1R6L A;  1N33 I;  4IFD F;  3B78 A;  4IZJ D;  4B3R E;  1R6M A;  1Z0G A;  1Z0V A;  3NZK A;  1FJG I;  4DV5 I;  1UDN A;  5DNL A;  1Z0B A;  2JE6 B;  4LF9 E;  2WP8 A;  3M7N D;  4LF7 E;  2JE6 A;  2PO0 B;  2O1T A;  3WU3 A;  3T1Y E;  3CDI A;  4JYA E;  4JV5 E;  2IES A;  1H7S A;  2NN6 F;  1B62 A;  2V2Z A;  2C38 A;  2Z5B B;  1XMO E;  1YHC A;  3WU5 A;  3DD6 A;  4HXZ A;  2O3Z A;  5JEA A;  1H74 A;  4DV2 I;  3LNU A;  5BR8 I;  4DV7 I;  4JI3 I;  1IBM I;  1FKA E;  5ELW A;  4EMD A;  4LF8 E;  4FW6 A;  2BM1 A;  1Y5Y A;  1Z59 A;  4DU7 A;  4X66 I;  1N32 I;  4MQY A;  1K47 A;  2GQ0 A;  2NN6 C;  4LFC E;  4M1K A;  3ZKB A;  5JEA D;  3B8H A;  5LMN E;  1UDO A;  1XXE A;  3QT7 A;  4RPF A;  4AIM A;  4DR7 I;  2PO2 A;  3P3E A;  4MU1 A;  1E3H A;  2HKE A;  1HNX E;  3ZZT A;  2GS8 A;  5LMU E;  1I94 I;  3LPS A;  2BA0 G;  1KVK A;  2NN6 D;  1S4E A;  4OO1 D;  4JI3 E;  3M85 G;  4MU3 A;  5EKW A;  4OO1 C;  1XMQ I;  2E5L I;  4LCG A;  5BR8 E;  2X36 A;  4DV2 E;  1IBL E;  5LL6 R;  1XNR I;  3J7A G;  3P76 A;  2BA1 G;  4LF5 I;  2NN6 B;  5K36 A;  4LOM A;  2JEA B;  4AQY I;  3PS2 A;  3T1H E;  2ZM6 I;  1HNZ E;  4JYA I;  1QZR A;  1Z0T A;  2C37 A;  4YHH I;  4JI5 I;  5L3J A;  4DPT A;  4GKJ E;  3PS3 A;  4DV7 E;  2E1R A;  1XNQ E;  1FNM A;  3B4T A;  5A2Q Q;  4JI2 I;  1Z0C A;  1N36 I;  2WNR A;  4OO1 F;  1PIE A;  5IWA I;  4DR3 E;  3L7Z B;  1PVG A;  1S16 A;  4BA1 B;  4X62 E;  2VQF I;  1Z5A A;  1Y4S A;  2WNR B;  4B3T I;  1VIS A;  1N34 I;  4DV3 I;  4DR1 I;  4LFB I;  2UXB E;  4FW9 A;  4JI0 I;  4DR6 I;  1ZM4 A;  2HKJ A;  2OI2 A;  4DV0 E;  5DRR A;  4KHP I;  5K36 E;  4OKG A;  2F4V I;  4LF6 E;  4LF9 I;  3GLL A;  5FLX Q;  2Q2E B;  4DV3 E;  4MDT A;  4DV5 E;  1N0U A;  2VQF E;  4NXM E;  1IBK I;  4LF4 E;  2JEB A;  4DPY A;  3J81 C;  1Y4U A;  3OTO E;  3QT8 A;  1KIJ A;  5K36 B;  4DR4 I;  1N36 E;  4FW3 A;  5C0X E;  4BA2 B;  5IT9 C;  4LFA I;  1Z5B A;  4USM A;  4FWG A;  3PYF A;  1MX0 A;  4PRV A;  4JI8 E;  4DR5 E;  5C0X D;  4JI7 I;  3T1H I;  3V2U C;  1B63 A;  1NHH A;  4IFD B;  4Z7C A;  3KRN A;  5C0X B;  5K36 C;  1XMQ E;  2E5L E;  4OO1 B;  3Q1Q A;  4X64 E;  1HR0 I;  2JEB B;  2C37 B;  4GQU A;  1H7U A;  4DU8 A;  2JEA A;  4IFD D;  3CWV A;  4GKK I;  2NN6 E;  5K36 D;  2R42 A;  3Q6M A;  4PU9 A;  4DV1 I;  1ZM3 A;  3K17 A;  2CZ9 A;  2Z5E A;  5JEA C;  4IZK B;  4KQV A;  5C0X C;  1FWK A;  4LFC I;  5LMN I;  1ZM9 A;  2LJP A;  4BA1 A;  1U2R A;  2HFS A;  2IOQ A;  4P7A A; 
#chains in the Genus database with same CATH homology
 4JI7 E;  1NHJ A;  2J7K A;  3ZM7 A;  4DUY E;  1NHI A;  4DPW A;  4URL A;  2DEI A;  3HUL A;  4LF8 I;  4WUD A;  2A2D A;  3WU6 A;  4FWH A;  4B3M E;  3WU4 A;  4K0K I;  3JAM Q;  2VQE E;  4B3S I;  2O1V A;  4XTJ A;  3GON A;  4N3O A;  4MYU A;  1EA6 A;  1KKH A;  4DV4 E;  3T1Y I;  4JI4 I;  2XEX A;  1Y6Z A;  1J5E I;  2UUB I;  1ZXN A;  4R1F A;  4OX9 E;  4LF7 I;  2BV3 A;  4IZJ B;  4DV0 I;  1FJG E;  1XHK A;  4B3T E;  4X65 E;  3J7A M;  5FWK A;  1Z0W A;  4UTG A;  4B3R I;  4IZK A;  3OTO I;  1USV A;  3D4J A;  1OJ4 A;  2Z5B A;  5IWA E;  4DR3 I;  1N33 E;  4MYT A;  4NXM I;  2UU9 E;  4JI1 E;  1FI4 A;  3PRY A;  4X65 I;  1MG7 A;  3Q6N A;  4LF6 I;  2V34 A;  4DV6 E;  1D6T A;  3QT6 A;  4OX9 I;  4DPU A;  4HYM A;  2UUB E;  4NXN I;  2ZM6 E;  1HNZ I;  4GKK E;  2A2C A;  4X62 I;  4DUZ E;  4I3H A;  4JI4 E;  1RR9 A;  1Z0E A;  4LF5 E;  3ZKD A;  4JI6 E;  1RRE A;  4B3S E;  4DXL A;  1HNW E;  4JI2 E;  4GKJ I;  4FN5 A;  2AJ4 A;  2V8P A;  4JI6 I;  1HK7 A;  1N0V C;  3QT5 A;  4DUZ I;  1A6F A;  4JI8 I;  4DUY I;  4UT4 A;  4AQY E;  4LFA E;  2R3V A;  4DV6 I;  1XNR E;  3V5R A;  2DEJ A;  3K85 A;  2UUA I;  4WUB A;  1ZM2 A;  2CGE A;  4DV1 E;  1MU5 A;  2O1U A;  2CG9 A;  4YY3 I;  2BM0 A;  5A2Q C;  4NXN E;  3PYG A;  4JG4 A;  5GMD A;  5LMU I;  4PRX A;  1I94 E;  1HNX I;  4DR7 E;  2UXD I;  1FWL A;  4KHP E;  2VF3 A;  1BKN A;  4HY1 A;  4JI0 E;  4DR6 E;  3M6A A;  4DR2 E;  1N34 E;  3J80 C;  1XMO I;  2UUC I;  2V2Q A;  2PNM A;  4X66 E;  1N32 E;  3H4L A;  3B82 A;  4DV4 I;  1USU A;  4USK A;  5FLX C;  4HAC A;  3J80 Q;  2UXC E;  1IBM E;  2HHH I;  1XNQ I;  4K0K E;  2NPF A;  3ZZ0 A;  4B3M I;  2HHH E;  1PKP A;  2HFU A;  4DR4 E;  1Z5C A;  3F0N A;  2UXC I;  1H73 A;  1KTV A;  1J5E E;  2PNL A;  4IZJ A;  4DPX A;  3P06 A;  1IBK E;  4LF4 I;  2WW4 A;  5IT9 Q;  4DR2 I;  1DAR A;  2UUC E;  1IBL I;  2VQE I;  2UXD E;  3J81 Q;  4DR1 E;  4YY3 E;  4LFB E;  2HK2 A;  3PYD A;  2V2V A;  3ZZU A;  2ZIT A;  2UUA E;  2IOP A;  1UEK A;  2ZBK B;  4JI5 E;  4YHH E;  5GME A;  1EI1 A;  2HK3 A;  1ELO A;  4FWD A;  1ZXM A;  4HAC B;  1HR0 E;  4X64 I;  4P52 A;  2O1W A;  1HNW I;  1H72 C;  4JV5 I;  2X7I A;  2EFG A;  3JAM C;  4ZVI A;  2Z5C B;  4DR5 I;  3K1J A;  1NZ0 A;  2F4V E;  1WUU A;  4Z7Y A;  2UXB I;  4JI1 I;  2Z5C A;  4ED4 A;  3LTO A;  3PYE A;  3HJC A;  4WUC A;  1N33 I;  3B78 A;  4IZJ D;  4B3R E;  1Z0G A;  1Z0V A;  1FJG I;  4DV5 I;  1Z0B A;  4LF9 E;  4LF7 E;  2O1T A;  3WU3 A;  3T1Y E;  4JYA E;  4JV5 E;  1H7S A;  1B62 A;  2V2Z A;  2Z5B B;  1XMO E;  3WU5 A;  4HXZ A;  1H74 A;  4DV2 I;  3LNU A;  5BR8 I;  4DV7 I;  4JI3 I;  1IBM I;  1FKA E;  4EMD A;  4LF8 E;  2BM1 A;  4DU7 A;  1Z59 A;  4X66 I;  1N32 I;  1K47 A;  2GQ0 A;  4P7A A;  4LFC E;  4M1K A;  3ZKB A;  3B8H A;  5LMN E;  3QT7 A;  4RPF A;  4DR7 I;  2HKE A;  1HNX E;  3ZZT A;  2GS8 A;  5LMU E;  1I94 I;  3LPS A;  1KVK A;  1S4E A;  4JI3 E;  1XMQ I;  2E5L I;  5BR8 E;  2X36 A;  4DV2 E;  1IBL E;  5LL6 R;  1XNR I;  3J7A G;  4LF5 I;  4AQY I;  3T1H E;  2ZM6 I;  1HNZ E;  4JYA I;  1QZR A;  1Z0T A;  4YHH I;  4JI5 I;  5L3J A;  4DPT A;  4GKJ E;  4DV7 E;  2E1R A;  1XNQ E;  1FNM A;  5A2Q Q;  4JI2 I;  1Z0C A;  1N36 I;  1PIE A;  5IWA I;  4DR3 E;  1PVG A;  1S16 A;  4X62 E;  2VQF I;  1Z5A A;  1Y4S A;  4B3T I;  1VIS A;  1N34 I;  4DV3 I;  4DR1 I;  4LFB I;  2UXB E;  4FW9 A;  4JI0 I;  4DR6 I;  1ZM4 A;  2HKJ A;  2OI2 A;  4DV0 E;  4KHP I;  2F4V I;  4LF6 E;  4LF9 I;  5FLX Q;  2Q2E B;  4DV3 E;  4DV5 E;  1N0U A;  2VQF E;  4NXM E;  1IBK I;  4LF4 E;  4DPY A;  3J81 C;  1Y4U A;  3OTO E;  3QT8 A;  1KIJ A;  4DR4 I;  1N36 E;  5IT9 C;  4LFA I;  1Z5B A;  4USM A;  4FWG A;  3PYF A;  1MX0 A;  4PRV A;  4JI8 E;  4DR5 E;  4JI7 I;  3T1H I;  3V2U C;  1B63 A;  1NHH A;  4Z7C A;  1XMQ E;  2E5L E;  3Q1Q A;  4X64 E;  1HR0 I;  1H7U A;  4DU8 A;  3CWV A;  4GKK I;  2R42 A;  3Q6M A;  4PU9 A;  4DV1 I;  1ZM3 A;  3K17 A;  2CZ9 A;  2Z5E A;  4IZK B;  4KQV A;  1FWK A;  4LFC I;  5LMN I;  1ZM9 A;  2LJP A;  1U2R A;  2HFS A;  2IOQ A;  2UU9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...