4LF9I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf9I00
2UUBE 4PRXA 4MYUA 4OX9I 4B3TI 3T1YI 1ZXNA 2UXDE 2ZM6I 1DARA 4LFAI 1KTVA 1FJGI 1IBKI 4JG4A 4YHHI 3QT8A 3J81Q 2F4VE 4LFBE 5IT9C 4DV0I 5LMUE 2UUAE 4DR6E 3CWVA 1ELOA 2UU9E 1XNRI 1KVKA 2V2VA 5IWAE 4USMA 1PKPA 1B63A 5FLXC 1H73A 1ZM9A 4X66E 2R3VA 1ZM2A 1XMOE 4LF4E 4LF8E 5LL6R 5IT9Q 4DV1E 1I94I 4JI0I 4FN5A 2A2CA 4WUDA 5A2QC 1H7SA 4DV6E 4B3SI 4JI7E 5LMUI 2UUAI 5GMEA 1Z5CA 5FLXQ 1N0VC 4LF5E 2VQEI 1S4EA 1FNMA 3OTOE 4FW9A 1FWLA 3WU6A 1HR0E 1S16A 1Z0WA 3PYDA 5A2QQ 1NZ0A 4UTGA 2CZ9A 4LF8I 4WUCA 3LTOA 1VISA 5LMNI 4LF9E 1OJ4A 4DV1I 3WU4A 4FWHA 4DR1I 2VQFI 1HNXE 4Z7YA 3QT5A 4K0KI 3PYEA 1PIEA 2HKJA 2AJ4A 4HACA 3QT6A 2V2QA 4JYAI 1UEKA 5GMDA 4X65E 3T1HE 4ED4A 1HNWE 2E1RA 4KHPI 4LF6I 2HHHE 3B8HA 4FWGA 1HR0I 4DR3E 4JI1I 1H74A 1XNQE 4LF7I 1IBMI 1N34I 4DV7E 1XMQE 1EA6A 4AQYE 1Z59A 4DR4E 4JV5I 3LNUA 2OI2A 4DR2E 4HXZA 1RREA 4DV2I 1U2RA 1Z0TA 1J5EE 4DV3E 4DUZI 2UUCE 2BM1A 3WU5A 4P52A 2A2DA 2V34A 3T1HI 2XEXA 2UXBI 2X7IA 1NHJA 2DEJA 1D6TA 1NHIA 1HNZE 1N36E 2UXCI 2HKEA 4B3RE 4DV5I 3B78A 2E5LI 2UUBI 4HACB 1MG7A 4PRVA 1N33E 1J5EI 2UXDI 4X64E 1FI4A 4DPUA 1ZM4A 1Z5BA 4KQVA 4EMDA 1MX0A 2F4VI 4LFBI 4DR6I 1EI1A 4JI8E 1HNZI 1IBLE 1N36I 4JI4E 3ZZTA 2UU9I 4B3RI 1FKAE 1KKHA 1A6FA 5IWAI 4GKJE 1K47A 2V2ZA 1WUUA 4X66I 1Z0GA 4NXME 1FWKA 2BM0A 4DPYA 4DPWA 1XMOI 1H7UA 1Z0BA 4LF4I 4WUBA 4NXNE 4R1FA 1QZRA 4P7AA 2LJPA 4DV6I 4JI7I 3ZM7A 4DPXA 2BV3A 3ZZUA 4B3ME 4PU9A 3Q1QA 3B82A 2R42A 1ZXMA 4JI4I 4JI5E 4LF5I 4LFCE 3ZKDA 4JI6E 4DPTA 4JI3E 3OTOI 3M6AA 4UT4A 4B3TE 3QT7A 3T1YE 2HK3A 2ZM6E 4X62E 4LF9I 4DU7A 1HNXI 1FJGE 3V2UC 1IBKE 3H4LA 4YHHE 4M1KA 4DV0E 4DR7E 4HY1A 4JI5I 4USKA 2WW4A 4X65I 1HNWI 2HHHI 3K17A 4GKKE 4DR3I 4URLA 1XNQI 4DV7I 1XMQI 4X62I 4AQYI 2ZITA 1I94E 4DR4I 3ZZ0A 4JI0E 1Z0VA 4DR2I 1NHHA 3K1JA 3J7AG 5BR8E 4B3SE 4I3HA 4DV3I 2UUCI 4DR7I 4DXLA 2DEIA 1H72C 1N32E 1PVGA 4YY3E 2VQEE 4Z7CA 3J7AM 4GKKI 3V5RA 2VF3A 4MYTA 5LMNE 4DV4E 4DR1E 2VQFE 2HFSA 2X36A 4K0KE 1Z0CA 2NPFA 5BR8I 1Z0EA 1N33I 3JAMC 3ZKBA 4X64I 4JYAE 4ZVIA 3LPSA 3HULA 4RPFA 1N32I 4YY3I 2EFGA 4KHPE 2V8PA 4LF6E 4HYMA 1N0UA 1B62A 3PYFA 4JI1E 4JI8I 3J80C 1IBLI 4LF7E 1IBME 1N34E 2HFUA 4DUYE 4JI2E 3JAMQ 4DV4I 2ZBKB 4GKJI 4JV5E 4DR5E 3WU3A 1XHKA 1RR9A 4DV2E 4OX9E 4NXMI 4DUZE 4LFAE 4XTJA 3F0NA 1MU5A 4NXNI 2Q2EB 1KIJA 3J80Q 2GS8A 3GONA 1ZM3A 2UXBE 1BKNA 4DU8A 4B3MI 5L3JA 4FWDA 2UXCE 3PYGA 1XNRE 4LFCI 3J81C 4DUYI 4DV5E 4JI6I 4JI2I 2HK2A 1Z5AA 3D4JA 4JI3I 2E5LE 2J7KA 4DR5I
chains in the Genus database with same CATH superfamily
2UUBE 2JEBB 4PRXA 4MYUA 4NBQA 4OX9I 4B3TI 3T1YI 1ZXNA 2UXDE 2ZM6I 1DARA 4LFAI 1KTVA 5K36F 1FJGI 2PO1B 5EL9A 4BA2B 3GLLA 1IBKI 4JG4A 4YHHI 1OYSA 3QT8A 3J81Q 5DRRA 2F4VE 3M85D 4LFBE 5IT9C 1UDQA 4DV0I 5LMUE 2UUAE 4DR6E 3CWVA 3P06A 1ELOA 4GQUA 5C0XC 2UU9E 1XNRI 1KVKA 2V2VA 2IOQA 5IWAE 2BA0D 5JEAA 4USMA 1PKPA 5C0XE 1B63A 5FLXC 1H73A 1ZM9A 4X66E 2R3VA 1E3PA 1UDOA 2WNRA 1ZM2A 1XMOE 4LF4E 4LF8E 5LL6R 5IT9Q 2JEAA 5K36C 4DV1E 1I94I 3CDIA 2GO3A 4JI0I 4FN5A 2A2CA 4WUDA 2Z5CA 5A2QC 1H7SA 4MU0A 4AIMA 5K36E 3PRYA 4DV6E 2C37B 4B3SI 4JI7E 3U1KA 5LMUI 2UUAI 5GMEA 3M7NG 1OYPA 1Z5CA 4IFDA 5FLXQ 2IOPA 1N0VC 2BR2A 4LF5E 2VQEI 1S4EA 2PO0A 4AIDA 1FNMA 3OTOE 4FW9A 1FWLA 3UHMA 3WU6A 1HR0E 1E3HA 2NN6A 4FW7A 1S16A 1Z0WA 3PYDA 5A2QQ 5ELWA 1NZ0A 4UTGA 2CZ9A 4LF8I 4WUCA 3LTOA 1VISA 5LMNI 4LF9E 1OJ4A 4DV1I 3WU4A 4FWHA 4DR1I 2VQFI 1HNXE 1Y60A 4Z7YA 3QT5A 4K0KI 4LCHA 3PYEA 1PIEA 2HKJA 2AJ4A 4HACA 3QT6A 2V2QA 4JYAI 1UEKA 5GMDA 4X65E 5JEAB 3T1HE 3B4TA 4ED4A 1HNWE 2E1RA 2JT2A 4KHPI 4LF6I 2HHHE 3B8HA 2C38A 4FWGA 1HR0I 2WNRB 1P42A 4DR3E 4U3BA 4JI1I 2C37A 1H74A 1XNQE 2JEAB 4LF7I 1IBMI 1N34I 4DV7E 1XMQE 1EA6A 4AQYE 1OYRA 2Z5CB 1Z59A 4DR4E 3P3GA 4OKGA 4JV5I 3LNUA 2OI2A 4DR2E 4HXZA 1RREA 2AE8A 4DV2I 1U2RA 4IFDD 1Z0TA 4IFDB 1J5EE 4MU1A 4DV3E 4DUZI 2UUCE 2BR2B 2BM1A 3WU5A 4P52A 4LCGA 3Q6NA 2PO0B 2A2DA 3M7ND 2V34A 4FW6A 3GMEA 3T1HI 4IS9A 2XEXA 4LCFA 2NN6D 1R6LA 2NN6B 2UXBI 2F1DA 2X7IA 1NHJA 2DEJA 1D6TA 1NHIA 3P3EA 1HNZE 1N36E 4FW4A 2UXCI 2HKEA 4B3RE 3H1CA 4DV5I 4OZEA 3B78A 4BA1A 3CDJA 2E5LI 1UDNA 2UUBI 4HACB 1MG7A 4PRVA 2E5LE 1N33E 4OO1A 1J5EI 2UXDI 4X64E 1FI4A 2Z5EA 3HKMA 4IZKA 3PS2A 4DPUA 2C38B 1ZM4A 1Z5BA 4KQVA 4EMDA 1MX0A 2F4VI 4LFBI 2C39A 3K85A 3HJCA 4DR6I 1EI1A 3U1YA 4JI8E 1HNZI 1IBLE 1N36I 4JI4E 3ZZTA 1USVA 2UU9I 4B3RI 1FKAE 1KKHA 1A6FA 5IWAI 4GKJE 1K47A 5DNXA 2V2ZA 4ISAA 1WUUA 4X66I 1Z0GA 4NXME 1FWKA 2BM0A 4DPYA 4DPWA 1XMOI 1H7UA 1Z0BA 4LF4I 1R6MA 2CVEA 2IERA 4MQYA 4WUBA 4NXNE 4R1FA 1QZRA 1RHYA 2CGEA 2PO2A 4P7AA 2LJPA 4DV6I 4IFDF 4JI7I 3P76A 3ZM7A 4DPXA 2BV3A 3ZZUA 4B3ME 2CG9A 4PU9A 3Q1QA 3B82A 2R42A 4LOMA 1ZXMA 4JI4I 4BA1B 5JEAC 5JEAD 4JI5E 4LF5I 4LFCE 3ZKDA 4JI6E 4DPTA 2BA1G 3PS3A 4JI3E 2NN6F 5C0XA 3OTOI 3M6AA 4OO1D 4OO1B 4UT4A 4B3TE 3QT7A 3T1YE 2PNZA 2HK3A 2ZM6E 4IZKB 2Z5BA 4X62E 4LF9I 4DU7A 1HNXI 1FJGE 2O1UA 3V2UC 1Y5YA 2C39B 1IBKE 3H4LA 1YHCA 2IESA 4YHHE 4IFDC 5K36A 4M1KA 4DV0E 3L7ZA 4MDTA 4DR7E 4IFDE 2GQ0A 4JI5I 4USKA 2WW4A 4X65I 1YH8A 1HNWI 2NN6C 2HHHI 3K17A 2J65A 4GKKE 4DR3I 4URLA 2NN6E 1XNQI 2PNMA 4DV7I 1XMQI 4X62I 4AQYI 2ZITA 4QNJA 1I94E 4DR4I 2PO2B 4MU3A 3ZZ0A 1Y4UA 4QNKA 4JI0E 1Z0VA 1VI7A 4DR2I 4U3DA 1NHHA 2O1VA 3K1JA 3J7AG 5BR8E 4B3SE 4I3HA 4DV3I 2UUCI 4DR7I 4DXLA 2DEIA 1HK7A 1H72C 5C0XD 1N32E 1PVGA 4IZJA 4YY3E 5C0XB 2VQEE 4Z7CA 2WP8A 3J7AM 4GKKI 2BA1D 2O1TA 2PNZB 5EKWA 2Z5BB 2VF3A 3V5RA 3P3CA 5JEAF 4MYTA 5LMNE 4DV4E 5K36D 4DR1E 2VQFE 3GCMA 2HFSA 2PNLA 5K36B 2X36A 5DRPA 4K0KE 4OO1F 4AM3A 1Z0CA 2JE6B 3L7ZB 2NPFA 5BR8I 1Z0EA 1N33I 5DRQA 3JAMC 3ZKBA 2JEBA 4X64I 4JYAE 4ZVIA 3LPSA 3HULA 4RPFA 1XXEA 3M85G 1N32I 4YY3I 2GO4A 4N3OA 1Y6ZA 2EFGA 4KHPE 2V8PA 4LF6E 2PO1A 4HYMA 4BA2A 1N0UA 2VESA 1B62A 3PYFA 5FWKA 4JI1E 4JI8I 2BA0G 3J80C 1IBLI 4LF7E 1IBME 1N34E 2HFUA 4FW3A 4DUYE 4JI2E 3JAMQ 4DV4I 2ZBKB 4GKJI 4JV5E 5DNLA 5JEAE 4DR5E 4OO1C 3WU3A 1USUA 1XHKA 1RR9A 4DV2E 3DD6A 4MU4A 3Q6MA 4OX9E 4NXMI 3NZKA 4OO1E 4IZJD 5DROA 4DUZE 4LFAE 4IZJB 4XTJA 3F0NA 1MU5A 2WP8B 4NXNI 4J3DA 2Q2EB 1KIJA 4FW5A 3J80Q 1Y4SA 2GS8A 3GONA 2O1WA 1ZM3A 2O3ZA 2UXBE 1BKNA 2JE6A 4DU8A 1UDSA 4B3MI 5L3JA 4FWDA 2UXCE 3KRNA 3PYGA 1XNRE 4LFCI 5C0XF 3J81C 4DUYI 4DV5E 4JI6I 4JI2I 2HK2A 1Z5AA 3PS1A 3D4JA 4JI3I 4HY1A 4LPFA 2J7KA 4DR5I
chains in the Genus database with same CATH topology
2UUBE 4PRXA 4MYUA 4OX9I 4B3TI 3T1YI 1ZXNA 2UXDE 2ZM6I 1DARA 4LFAI 1KTVA 1FJGI 1IBKI 4JG4A 4YHHI 3QT8A 3J81Q 2F4VE 4LFBE 5IT9C 4DV0I 5LMUE 2UUAE 4DR6E 3CWVA 3P06A 1ELOA 2UU9E 1XNRI 1KVKA 2V2VA 2IOQA 5IWAE 4USMA 1PKPA 1B63A 5FLXC 1H73A 1ZM9A 4X66E 2R3VA 1ZM2A 1XMOE 4LF4E 4LF8E 5LL6R 5IT9Q 4DV1E 1I94I 4JI0I 4FN5A 2A2CA 4WUDA 2Z5CA 5A2QC 1H7SA 3PRYA 4DV6E 4B3SI 4JI7E 5LMUI 2UUAI 5GMEA 1Z5CA 5FLXQ 2IOPA 1N0VC 4LF5E 2VQEI 1S4EA 1FNMA 3OTOE 4FW9A 1FWLA 3WU6A 1HR0E 1S16A 1Z0WA 3PYDA 5A2QQ 1NZ0A 4UTGA 2CZ9A 4LF8I 4WUCA 3LTOA 1VISA 5LMNI 4LF9E 1OJ4A 4DV1I 3WU4A 4FWHA 4DR1I 2VQFI 1HNXE 4Z7YA 3QT5A 4K0KI 3PYEA 1PIEA 2HKJA 2AJ4A 4HACA 3QT6A 2V2QA 4JYAI 1UEKA 5GMDA 4X65E 3T1HE 4ED4A 1HNWE 2E1RA 4KHPI 4LF6I 2HHHE 3B8HA 4FWGA 1HR0I 4DR3E 4JI1I 1H74A 1XNQE 4LF7I 1IBMI 1N34I 4DV7E 1XMQE 1EA6A 4AQYE 2Z5CB 1Z59A 4DR4E 4JV5I 3LNUA 2OI2A 4DR2E 4HXZA 1RREA 4DV2I 1U2RA 1Z0TA 1J5EE 4DV3E 4DUZI 2UUCE 2BM1A 3WU5A 4P52A 3Q6NA 2A2DA 2V34A 3T1HI 2XEXA 2UXBI 2X7IA 1NHJA 2DEJA 1D6TA 1NHIA 1HNZE 1N36E 2UXCI 2HKEA 4B3RE 4DV5I 3B78A 2E5LI 2UUBI 4HACB 1MG7A 4PRVA 2E5LE 1N33E 1J5EI 2UXDI 4X64E 1FI4A 2Z5EA 4IZKA 4DPUA 1ZM4A 1Z5BA 4KQVA 4EMDA 1MX0A 2F4VI 4LFBI 3K85A 3HJCA 4DR6I 1EI1A 4JI8E 1HNZI 1IBLE 1N36I 4JI4E 3ZZTA 1USVA 2UU9I 4B3RI 1FKAE 1KKHA 1A6FA 5IWAI 4GKJE 1K47A 2V2ZA 1WUUA 4X66I 1Z0GA 4NXME 1FWKA 2BM0A 4DPYA 4DPWA 1XMOI 1H7UA 1Z0BA 4LF4I 4WUBA 4NXNE 4R1FA 1QZRA 2CGEA 4P7AA 2LJPA 4DV6I 4JI7I 3ZM7A 4DPXA 2BV3A 3ZZUA 4B3ME 2CG9A 4PU9A 3Q1QA 3B82A 2R42A 1ZXMA 4JI4I 4JI5E 4LF5I 4LFCE 3ZKDA 4JI6E 4DPTA 4JI3E 3OTOI 3M6AA 4UT4A 4B3TE 3QT7A 3T1YE 2HK3A 2ZM6E 4IZKB 2Z5BA 4X62E 4LF9I 4DU7A 1HNXI 1FJGE 2O1UA 3V2UC 1IBKE 3H4LA 4YHHE 4M1KA 4DV0E 4DR7E 2GQ0A 4JI5I 4USKA 2WW4A 4X65I 1HNWI 2HHHI 3K17A 4GKKE 4DR3I 4URLA 1XNQI 2PNMA 4DV7I 1XMQI 4X62I 4AQYI 2ZITA 1I94E 4DR4I 3ZZ0A 1Y4UA 4JI0E 1Z0VA 4DR2I 1NHHA 2O1VA 3K1JA 3J7AG 5BR8E 4B3SE 4I3HA 4DV3I 2UUCI 4DR7I 4DXLA 2DEIA 1HK7A 1H72C 1N32E 1PVGA 4IZJA 4YY3E 2VQEE 4Z7CA 3J7AM 4GKKI 2O1TA 2Z5BB 2VF3A 3V5RA 4MYTA 5LMNE 4DV4E 4DR1E 2VQFE 2HFSA 2PNLA 2X36A 4K0KE 1Z0CA 2NPFA 5BR8I 1Z0EA 1N33I 3JAMC 3ZKBA 4X64I 4JYAE 4ZVIA 3LPSA 3HULA 4RPFA 1N32I 4YY3I 4N3OA 1Y6ZA 2EFGA 4KHPE 2V8PA 4LF6E 4HYMA 1N0UA 1B62A 3PYFA 5FWKA 4JI1E 4JI8I 3J80C 1IBLI 4LF7E 1IBME 1N34E 2HFUA 4DUYE 4JI2E 3JAMQ 4DV4I 2ZBKB 4GKJI 4JV5E 4DR5E 3WU3A 1USUA 1XHKA 1RR9A 4DV2E 3Q6MA 4OX9E 4NXMI 4IZJD 4DUZE 4LFAE 4IZJB 4XTJA 3F0NA 1MU5A 4NXNI 2Q2EB 1KIJA 3J80Q 1Y4SA 2GS8A 3GONA 2O1WA 1ZM3A 2UXBE 1BKNA 4DU8A 4B3MI 5L3JA 4FWDA 2UXCE 3PYGA 1XNRE 4LFCI 3J81C 4DUYI 4DV5E 4JI6I 4JI2I 2HK2A 1Z5AA 3D4JA 4JI3I 4HY1A 2J7KA 4DR5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB E;  4PRX A;  4MYU A;  4OX9 I;  4B3T I;  3T1Y I;  1ZXN A;  2UXD E;  2ZM6 I;  1DAR A;  4LFA I;  1KTV A;  1FJG I;  1IBK I;  4JG4 A;  4YHH I;  3QT8 A;  3J81 Q;  2F4V E;  4LFB E;  5IT9 C;  4DV0 I;  5LMU E;  2UUA E;  4DR6 E;  3CWV A;  1ELO A;  2UU9 E;  1XNR I;  1KVK A;  2V2V A;  5IWA E;  4USM A;  1PKP A;  1B63 A;  5FLX C;  1H73 A;  1ZM9 A;  4X66 E;  2R3V A;  1ZM2 A;  1XMO E;  4LF4 E;  4LF8 E;  5LL6 R;  5IT9 Q;  4DV1 E;  1I94 I;  4JI0 I;  4FN5 A;  2A2C A;  4WUD A;  5A2Q C;  1H7S A;  4DV6 E;  4B3S I;  4JI7 E;  5LMU I;  2UUA I;  5GME A;  1Z5C A;  5FLX Q;  1N0V C;  4LF5 E;  2VQE I;  1S4E A;  1FNM A;  3OTO E;  4FW9 A;  1FWL A;  3WU6 A;  1HR0 E;  1S16 A;  1Z0W A;  3PYD A;  5A2Q Q;  1NZ0 A;  4UTG A;  2CZ9 A;  4LF8 I;  4WUC A;  3LTO A;  1VIS A;  5LMN I;  4LF9 E;  1OJ4 A;  4DV1 I;  3WU4 A;  4FWH A;  4DR1 I;  2VQF I;  1HNX E;  4Z7Y A;  3QT5 A;  4K0K I;  3PYE A;  1PIE A;  2HKJ A;  2AJ4 A;  4HAC A;  3QT6 A;  2V2Q A;  4JYA I;  1UEK A;  5GMD A;  4X65 E;  3T1H E;  4ED4 A;  1HNW E;  2E1R A;  4KHP I;  4LF6 I;  2HHH E;  3B8H A;  4FWG A;  1HR0 I;  4DR3 E;  4JI1 I;  1H74 A;  1XNQ E;  4LF7 I;  1IBM I;  1N34 I;  4DV7 E;  1XMQ E;  1EA6 A;  4AQY E;  1Z59 A;  4DR4 E;  4JV5 I;  3LNU A;  2OI2 A;  4DR2 E;  4HXZ A;  1RRE A;  4DV2 I;  1U2R A;  1Z0T A;  1J5E E;  4DV3 E;  4DUZ I;  2UUC E;  2BM1 A;  3WU5 A;  4P52 A;  2A2D A;  2V34 A;  3T1H I;  2XEX A;  2UXB I;  2X7I A;  1NHJ A;  2DEJ A;  1D6T A;  1NHI A;  1HNZ E;  1N36 E;  2UXC I;  2HKE A;  4B3R E;  4DV5 I;  3B78 A;  2E5L I;  2UUB I;  4HAC B;  1MG7 A;  4PRV A;  1N33 E;  1J5E I;  2UXD I;  4X64 E;  1FI4 A;  4DPU A;  1ZM4 A;  1Z5B A;  4KQV A;  4EMD A;  1MX0 A;  2F4V I;  4LFB I;  4DR6 I;  1EI1 A;  4JI8 E;  1HNZ I;  1IBL E;  1N36 I;  4JI4 E;  3ZZT A;  2UU9 I;  4B3R I;  1FKA E;  1KKH A;  1A6F A;  5IWA I;  4GKJ E;  1K47 A;  2V2Z A;  1WUU A;  4X66 I;  1Z0G A;  4NXM E;  1FWK A;  2BM0 A;  4DPY A;  4DPW A;  1XMO I;  1H7U A;  1Z0B A;  4LF4 I;  4WUB A;  4NXN E;  4R1F A;  1QZR A;  4P7A A;  2LJP A;  4DV6 I;  4JI7 I;  3ZM7 A;  4DPX A;  2BV3 A;  3ZZU A;  4B3M E;  4PU9 A;  3Q1Q A;  3B82 A;  2R42 A;  1ZXM A;  4JI4 I;  4JI5 E;  4LF5 I;  4LFC E;  3ZKD A;  4JI6 E;  4DPT A;  4JI3 E;  3OTO I;  3M6A A;  4UT4 A;  4B3T E;  3QT7 A;  3T1Y E;  2HK3 A;  2ZM6 E;  4X62 E;  4LF9 I;  4DU7 A;  1HNX I;  1FJG E;  3V2U C;  1IBK E;  3H4L A;  4YHH E;  4M1K A;  4DV0 E;  4DR7 E;  4HY1 A;  4JI5 I;  4USK A;  2WW4 A;  4X65 I;  1HNW I;  2HHH I;  3K17 A;  4GKK E;  4DR3 I;  4URL A;  1XNQ I;  4DV7 I;  1XMQ I;  4X62 I;  4AQY I;  2ZIT A;  1I94 E;  4DR4 I;  3ZZ0 A;  4JI0 E;  1Z0V A;  4DR2 I;  1NHH A;  3K1J A;  3J7A G;  5BR8 E;  4B3S E;  4I3H A;  4DV3 I;  2UUC I;  4DR7 I;  4DXL A;  2DEI A;  1H72 C;  1N32 E;  1PVG A;  4YY3 E;  2VQE E;  4Z7C A;  3J7A M;  4GKK I;  3V5R A;  2VF3 A;  4MYT A;  5LMN E;  4DV4 E;  4DR1 E;  2VQF E;  2HFS A;  2X36 A;  4K0K E;  1Z0C A;  2NPF A;  5BR8 I;  1Z0E A;  1N33 I;  3JAM C;  3ZKB A;  4X64 I;  4JYA E;  4ZVI A;  3LPS A;  3HUL A;  4RPF A;  1N32 I;  4YY3 I;  2EFG A;  4KHP E;  2V8P A;  4LF6 E;  4HYM A;  1N0U A;  1B62 A;  3PYF A;  4JI1 E;  4JI8 I;  3J80 C;  1IBL I;  4LF7 E;  1IBM E;  1N34 E;  2HFU A;  4DUY E;  4JI2 E;  3JAM Q;  4DV4 I;  2ZBK B;  4GKJ I;  4JV5 E;  4DR5 E;  3WU3 A;  1XHK A;  1RR9 A;  4DV2 E;  4OX9 E;  4NXM I;  4DUZ E;  4LFA E;  4XTJ A;  3F0N A;  1MU5 A;  4NXN I;  2Q2E B;  1KIJ A;  3J80 Q;  2GS8 A;  3GON A;  1ZM3 A;  2UXB E;  1BKN A;  4DU8 A;  4B3M I;  5L3J A;  4FWD A;  2UXC E;  3PYG A;  1XNR E;  4LFC I;  3J81 C;  4DUY I;  4DV5 E;  4JI6 I;  4JI2 I;  2HK2 A;  1Z5A A;  3D4J A;  4JI3 I;  2E5L E;  2J7K A;  4DR5 I; 
#chains in the Genus database with same CATH topology
 2UUB E;  2JEB B;  4PRX A;  4MYU A;  4NBQ A;  4OX9 I;  4B3T I;  3T1Y I;  1ZXN A;  2UXD E;  2ZM6 I;  1DAR A;  4LFA I;  1KTV A;  5K36 F;  1FJG I;  2PO1 B;  5EL9 A;  4BA2 B;  3GLL A;  1IBK I;  4JG4 A;  4YHH I;  1OYS A;  3QT8 A;  3J81 Q;  5DRR A;  2F4V E;  3M85 D;  4LFB E;  5IT9 C;  1UDQ A;  4DV0 I;  5LMU E;  2UUA E;  4DR6 E;  3CWV A;  3P06 A;  1ELO A;  4GQU A;  5C0X C;  2UU9 E;  1XNR I;  1KVK A;  2V2V A;  2IOQ A;  5IWA E;  2BA0 D;  5JEA A;  4USM A;  1PKP A;  5C0X E;  1B63 A;  5FLX C;  1H73 A;  1ZM9 A;  4X66 E;  2R3V A;  1E3P A;  1UDO A;  2WNR A;  1ZM2 A;  1XMO E;  4LF4 E;  4LF8 E;  5LL6 R;  5IT9 Q;  2JEA A;  5K36 C;  4DV1 E;  1I94 I;  3CDI A;  2GO3 A;  4JI0 I;  4FN5 A;  2A2C A;  4WUD A;  2Z5C A;  5A2Q C;  1H7S A;  4MU0 A;  4AIM A;  5K36 E;  3PRY A;  4DV6 E;  2C37 B;  4B3S I;  4JI7 E;  3U1K A;  5LMU I;  2UUA I;  5GME A;  3M7N G;  1OYP A;  1Z5C A;  4IFD A;  5FLX Q;  2IOP A;  1N0V C;  2BR2 A;  4LF5 E;  2VQE I;  1S4E A;  2PO0 A;  4AID A;  1FNM A;  3OTO E;  4FW9 A;  1FWL A;  3UHM A;  3WU6 A;  1HR0 E;  1E3H A;  2NN6 A;  4FW7 A;  1S16 A;  1Z0W A;  3PYD A;  5A2Q Q;  5ELW A;  1NZ0 A;  4UTG A;  2CZ9 A;  4LF8 I;  4WUC A;  3LTO A;  1VIS A;  5LMN I;  4LF9 E;  1OJ4 A;  4DV1 I;  3WU4 A;  4FWH A;  4DR1 I;  2VQF I;  1HNX E;  1Y60 A;  4Z7Y A;  3QT5 A;  4K0K I;  4LCH A;  3PYE A;  1PIE A;  2HKJ A;  2AJ4 A;  4HAC A;  3QT6 A;  2V2Q A;  4JYA I;  1UEK A;  5GMD A;  4X65 E;  5JEA B;  3T1H E;  3B4T A;  4ED4 A;  1HNW E;  2E1R A;  2JT2 A;  4KHP I;  4LF6 I;  2HHH E;  3B8H A;  2C38 A;  4FWG A;  1HR0 I;  2WNR B;  1P42 A;  4DR3 E;  4U3B A;  4JI1 I;  2C37 A;  1H74 A;  1XNQ E;  2JEA B;  4LF7 I;  1IBM I;  1N34 I;  4DV7 E;  1XMQ E;  1EA6 A;  4AQY E;  1OYR A;  2Z5C B;  1Z59 A;  4DR4 E;  3P3G A;  4OKG A;  4JV5 I;  3LNU A;  2OI2 A;  4DR2 E;  4HXZ A;  1RRE A;  2AE8 A;  4DV2 I;  1U2R A;  4IFD D;  1Z0T A;  4IFD B;  1J5E E;  4MU1 A;  4DV3 E;  4DUZ I;  2UUC E;  2BR2 B;  2BM1 A;  3WU5 A;  4P52 A;  4LCG A;  3Q6N A;  2PO0 B;  2A2D A;  3M7N D;  2V34 A;  4FW6 A;  3GME A;  3T1H I;  4IS9 A;  2XEX A;  4LCF A;  2NN6 D;  1R6L A;  2NN6 B;  2UXB I;  2F1D A;  2X7I A;  1NHJ A;  2DEJ A;  1D6T A;  1NHI A;  3P3E A;  1HNZ E;  1N36 E;  4FW4 A;  2UXC I;  2HKE A;  4B3R E;  3H1C A;  4DV5 I;  4OZE A;  3B78 A;  4BA1 A;  3CDJ A;  2E5L I;  1UDN A;  2UUB I;  4HAC B;  1MG7 A;  4PRV A;  2E5L E;  1N33 E;  4OO1 A;  1J5E I;  2UXD I;  4X64 E;  1FI4 A;  2Z5E A;  3HKM A;  4IZK A;  3PS2 A;  4DPU A;  2C38 B;  1ZM4 A;  1Z5B A;  4KQV A;  4EMD A;  1MX0 A;  2F4V I;  4LFB I;  2C39 A;  3K85 A;  3HJC A;  4DR6 I;  1EI1 A;  3U1Y A;  4JI8 E;  1HNZ I;  1IBL E;  1N36 I;  4JI4 E;  3ZZT A;  1USV A;  2UU9 I;  4B3R I;  1FKA E;  1KKH A;  1A6F A;  5IWA I;  4GKJ E;  1K47 A;  5DNX A;  2V2Z A;  4ISA A;  1WUU A;  4X66 I;  1Z0G A;  4NXM E;  1FWK A;  2BM0 A;  4DPY A;  4DPW A;  1XMO I;  1H7U A;  1Z0B A;  4LF4 I;  1R6M A;  2CVE A;  2IER A;  4MQY A;  4WUB A;  4NXN E;  4R1F A;  1QZR A;  1RHY A;  2CGE A;  2PO2 A;  4P7A A;  2LJP A;  4DV6 I;  4IFD F;  4JI7 I;  3P76 A;  3ZM7 A;  4DPX A;  2BV3 A;  3ZZU A;  4B3M E;  2CG9 A;  4PU9 A;  3Q1Q A;  3B82 A;  2R42 A;  4LOM A;  1ZXM A;  4JI4 I;  4BA1 B;  5JEA C;  5JEA D;  4JI5 E;  4LF5 I;  4LFC E;  3ZKD A;  4JI6 E;  4DPT A;  2BA1 G;  3PS3 A;  4JI3 E;  2NN6 F;  5C0X A;  3OTO I;  3M6A A;  4OO1 D;  4OO1 B;  4UT4 A;  4B3T E;  3QT7 A;  3T1Y E;  2PNZ A;  2HK3 A;  2ZM6 E;  4IZK B;  2Z5B A;  4X62 E;  4LF9 I;  4DU7 A;  1HNX I;  1FJG E;  2O1U A;  3V2U C;  1Y5Y A;  2C39 B;  1IBK E;  3H4L A;  1YHC A;  2IES A;  4YHH E;  4IFD C;  5K36 A;  4M1K A;  4DV0 E;  3L7Z A;  4MDT A;  4DR7 E;  4IFD E;  2GQ0 A;  4JI5 I;  4USK A;  2WW4 A;  4X65 I;  1YH8 A;  1HNW I;  2NN6 C;  2HHH I;  3K17 A;  2J65 A;  4GKK E;  4DR3 I;  4URL A;  2NN6 E;  1XNQ I;  2PNM A;  4DV7 I;  1XMQ I;  4X62 I;  4AQY I;  2ZIT A;  4QNJ A;  1I94 E;  4DR4 I;  2PO2 B;  4MU3 A;  3ZZ0 A;  1Y4U A;  4QNK A;  4JI0 E;  1Z0V A;  1VI7 A;  4DR2 I;  4U3D A;  1NHH A;  2O1V A;  3K1J A;  3J7A G;  5BR8 E;  4B3S E;  4I3H A;  4DV3 I;  2UUC I;  4DR7 I;  4DXL A;  2DEI A;  1HK7 A;  1H72 C;  5C0X D;  1N32 E;  1PVG A;  4IZJ A;  4YY3 E;  5C0X B;  2VQE E;  4Z7C A;  2WP8 A;  3J7A M;  4GKK I;  2BA1 D;  2O1T A;  2PNZ B;  5EKW A;  2Z5B B;  2VF3 A;  3V5R A;  3P3C A;  5JEA F;  4MYT A;  5LMN E;  4DV4 E;  5K36 D;  4DR1 E;  2VQF E;  3GCM A;  2HFS A;  2PNL A;  5K36 B;  2X36 A;  5DRP A;  4K0K E;  4OO1 F;  4AM3 A;  1Z0C A;  2JE6 B;  3L7Z B;  2NPF A;  5BR8 I;  1Z0E A;  1N33 I;  5DRQ A;  3JAM C;  3ZKB A;  2JEB A;  4X64 I;  4JYA E;  4ZVI A;  3LPS A;  3HUL A;  4RPF A;  1XXE A;  3M85 G;  1N32 I;  4YY3 I;  2GO4 A;  4N3O A;  1Y6Z A;  2EFG A;  4KHP E;  2V8P A;  4LF6 E;  2PO1 A;  4HYM A;  4BA2 A;  1N0U A;  2VES A;  1B62 A;  3PYF A;  5FWK A;  4JI1 E;  4JI8 I;  2BA0 G;  3J80 C;  1IBL I;  4LF7 E;  1IBM E;  1N34 E;  2HFU A;  4FW3 A;  4DUY E;  4JI2 E;  3JAM Q;  4DV4 I;  2ZBK B;  4GKJ I;  4JV5 E;  5DNL A;  5JEA E;  4DR5 E;  4OO1 C;  3WU3 A;  1USU A;  1XHK A;  1RR9 A;  4DV2 E;  3DD6 A;  4MU4 A;  3Q6M A;  4OX9 E;  4NXM I;  3NZK A;  4OO1 E;  4IZJ D;  5DRO A;  4DUZ E;  4LFA E;  4IZJ B;  4XTJ A;  3F0N A;  1MU5 A;  2WP8 B;  4NXN I;  4J3D A;  2Q2E B;  1KIJ A;  4FW5 A;  3J80 Q;  1Y4S A;  2GS8 A;  3GON A;  2O1W A;  1ZM3 A;  2O3Z A;  2UXB E;  1BKN A;  2JE6 A;  4DU8 A;  1UDS A;  4B3M I;  5L3J A;  4FWD A;  2UXC E;  3KRN A;  3PYG A;  1XNR E;  4LFC I;  5C0X F;  3J81 C;  4DUY I;  4DV5 E;  4JI6 I;  4JI2 I;  2HK2 A;  1Z5A A;  3PS1 A;  3D4J A;  4JI3 I;  4HY1 A;  4LPF A;  2J7K A;  4DR5 I; 
#chains in the Genus database with same CATH homology
 2UUB E;  4PRX A;  4MYU A;  4OX9 I;  4B3T I;  3T1Y I;  1ZXN A;  2UXD E;  2ZM6 I;  1DAR A;  4LFA I;  1KTV A;  1FJG I;  1IBK I;  4JG4 A;  4YHH I;  3QT8 A;  3J81 Q;  2F4V E;  4LFB E;  5IT9 C;  4DV0 I;  5LMU E;  2UUA E;  4DR6 E;  3CWV A;  3P06 A;  1ELO A;  2UU9 E;  1XNR I;  1KVK A;  2V2V A;  2IOQ A;  5IWA E;  4USM A;  1PKP A;  1B63 A;  5FLX C;  1H73 A;  1ZM9 A;  4X66 E;  2R3V A;  1ZM2 A;  1XMO E;  4LF4 E;  4LF8 E;  5LL6 R;  5IT9 Q;  4DV1 E;  1I94 I;  4JI0 I;  4FN5 A;  2A2C A;  4WUD A;  2Z5C A;  5A2Q C;  1H7S A;  3PRY A;  4DV6 E;  4B3S I;  4JI7 E;  5LMU I;  2UUA I;  5GME A;  1Z5C A;  5FLX Q;  2IOP A;  1N0V C;  4LF5 E;  2VQE I;  1S4E A;  1FNM A;  3OTO E;  4FW9 A;  1FWL A;  3WU6 A;  1HR0 E;  1S16 A;  1Z0W A;  3PYD A;  5A2Q Q;  1NZ0 A;  4UTG A;  2CZ9 A;  4LF8 I;  4WUC A;  3LTO A;  1VIS A;  5LMN I;  4LF9 E;  1OJ4 A;  4DV1 I;  3WU4 A;  4FWH A;  4DR1 I;  2VQF I;  1HNX E;  4Z7Y A;  3QT5 A;  4K0K I;  3PYE A;  1PIE A;  2HKJ A;  2AJ4 A;  4HAC A;  3QT6 A;  2V2Q A;  4JYA I;  1UEK A;  5GMD A;  4X65 E;  3T1H E;  4ED4 A;  1HNW E;  2E1R A;  4KHP I;  4LF6 I;  2HHH E;  3B8H A;  4FWG A;  1HR0 I;  4DR3 E;  4JI1 I;  1H74 A;  1XNQ E;  4LF7 I;  1IBM I;  1N34 I;  4DV7 E;  1XMQ E;  1EA6 A;  4AQY E;  2Z5C B;  1Z59 A;  4DR4 E;  4JV5 I;  3LNU A;  2OI2 A;  4DR2 E;  4HXZ A;  1RRE A;  4DV2 I;  1U2R A;  1Z0T A;  1J5E E;  4DV3 E;  4DUZ I;  2UUC E;  2BM1 A;  3WU5 A;  4P52 A;  3Q6N A;  2A2D A;  2V34 A;  3T1H I;  2XEX A;  2UXB I;  2X7I A;  1NHJ A;  2DEJ A;  1D6T A;  1NHI A;  1HNZ E;  1N36 E;  2UXC I;  2HKE A;  4B3R E;  4DV5 I;  3B78 A;  2E5L I;  2UUB I;  4HAC B;  1MG7 A;  4PRV A;  2E5L E;  1N33 E;  1J5E I;  2UXD I;  4X64 E;  1FI4 A;  2Z5E A;  4IZK A;  4DPU A;  1ZM4 A;  1Z5B A;  4KQV A;  4EMD A;  1MX0 A;  2F4V I;  4LFB I;  3K85 A;  3HJC A;  4DR6 I;  1EI1 A;  4JI8 E;  1HNZ I;  1IBL E;  1N36 I;  4JI4 E;  3ZZT A;  1USV A;  2UU9 I;  4B3R I;  1FKA E;  1KKH A;  1A6F A;  5IWA I;  4GKJ E;  1K47 A;  2V2Z A;  1WUU A;  4X66 I;  1Z0G A;  4NXM E;  1FWK A;  2BM0 A;  4DPY A;  4DPW A;  1XMO I;  1H7U A;  1Z0B A;  4LF4 I;  4WUB A;  4NXN E;  4R1F A;  1QZR A;  2CGE A;  4P7A A;  2LJP A;  4DV6 I;  4JI7 I;  3ZM7 A;  4DPX A;  2BV3 A;  3ZZU A;  4B3M E;  2CG9 A;  4PU9 A;  3Q1Q A;  3B82 A;  2R42 A;  1ZXM A;  4JI4 I;  4JI5 E;  4LF5 I;  4LFC E;  3ZKD A;  4JI6 E;  4DPT A;  4JI3 E;  3OTO I;  3M6A A;  4UT4 A;  4B3T E;  3QT7 A;  3T1Y E;  2HK3 A;  2ZM6 E;  4IZK B;  2Z5B A;  4X62 E;  4LF9 I;  4DU7 A;  1HNX I;  1FJG E;  2O1U A;  3V2U C;  1IBK E;  3H4L A;  4YHH E;  4M1K A;  4DV0 E;  4DR7 E;  2GQ0 A;  4JI5 I;  4USK A;  2WW4 A;  4X65 I;  1HNW I;  2HHH I;  3K17 A;  4GKK E;  4DR3 I;  4URL A;  1XNQ I;  2PNM A;  4DV7 I;  1XMQ I;  4X62 I;  4AQY I;  2ZIT A;  1I94 E;  4DR4 I;  3ZZ0 A;  1Y4U A;  4JI0 E;  1Z0V A;  4DR2 I;  1NHH A;  2O1V A;  3K1J A;  3J7A G;  5BR8 E;  4B3S E;  4I3H A;  4DV3 I;  2UUC I;  4DR7 I;  4DXL A;  2DEI A;  1HK7 A;  1H72 C;  1N32 E;  1PVG A;  4IZJ A;  4YY3 E;  2VQE E;  4Z7C A;  3J7A M;  4GKK I;  2O1T A;  2Z5B B;  2VF3 A;  3V5R A;  4MYT A;  5LMN E;  4DV4 E;  4DR1 E;  2VQF E;  2HFS A;  2PNL A;  2X36 A;  4K0K E;  1Z0C A;  2NPF A;  5BR8 I;  1Z0E A;  1N33 I;  3JAM C;  3ZKB A;  4X64 I;  4JYA E;  4ZVI A;  3LPS A;  3HUL A;  4RPF A;  1N32 I;  4YY3 I;  4N3O A;  1Y6Z A;  2EFG A;  4KHP E;  2V8P A;  4LF6 E;  4HYM A;  1N0U A;  1B62 A;  3PYF A;  5FWK A;  4JI1 E;  4JI8 I;  3J80 C;  1IBL I;  4LF7 E;  1IBM E;  1N34 E;  2HFU A;  4DUY E;  4JI2 E;  3JAM Q;  4DV4 I;  2ZBK B;  4GKJ I;  4JV5 E;  4DR5 E;  3WU3 A;  1USU A;  1XHK A;  1RR9 A;  4DV2 E;  3Q6M A;  4OX9 E;  4NXM I;  4IZJ D;  4DUZ E;  4LFA E;  4IZJ B;  4XTJ A;  3F0N A;  1MU5 A;  4NXN I;  2Q2E B;  1KIJ A;  3J80 Q;  1Y4S A;  2GS8 A;  3GON A;  2O1W A;  1ZM3 A;  2UXB E;  1BKN A;  4DU8 A;  4B3M I;  5L3J A;  4FWD A;  2UXC E;  3PYG A;  1XNR E;  4LFC I;  3J81 C;  4DUY I;  4DV5 E;  4JI6 I;  4JI2 I;  2HK2 A;  1Z5A A;  3D4J A;  4JI3 I;  4HY1 A;  2J7K A;  4DR5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...