4LF9I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf9I00
4LF8I 1Z5CA 4JV5E 1IBKI 2X7IA 3ZM7A 1WUUA 3D4JA 1I94I 4AQYI 4RPFA 4LFCE 1XMOE 1H74A 4DXLA 4XTJA 2ZITA 4HACA 1FI4A 3QT7A 1XNRI 2UUBI 2V2QA 4NXNI 5IWAI 1PKPA 3T1YI 2ZBKB 2E5LI 1HNWE 4LF9I 4DR6E 1ZM2A 4MYUA 4FW9A 4PRVA 1J5EE 1N34E 4R1FA 4DR1I 2UXDE 4B3RE 3B8HA 4USMA 4JI7I 4DV0I 2HHHE 1PVGA 4WUCA 1KIJA 4EMDA 4JI3E 4M1KA 1DARA 1NZ0A 1RREA 4X66E 3T1HE 2BM0A 4ED4A 4GKJI 4MYTA 2F4VE 4K0KE 2UUAI 4JI1E 4DR3E 3J7AG 4LF8E 3JAMQ 3ZZ0A 4LF5I 4B3TE 2UXDI 2NPFA 1K47A 3H4LA 1I94E 2VQFI 2UXBI 4X65I 4DUYI 5LMUI 1N36I 4PRXA 3JAMC 4LFBI 1Z0BA 4JI4I 4X62I 1FWKA 4X64I 1N0UA 4LFCI 4YHHE 3K1JA 4DR2I 2VQEI 2AJ4A 4USKA 1NHJA 2VF3A 4B3SI 4DR7E 4NXNE 1UEKA 2X36A 2F4VI 2E1RA 4WUBA 3K17A 4GKKI 1HR0E 2OI2A 4DPUA 2UUCE 4LFAI 3OTOE 2CZ9A 3WU6A 4X65E 4ZVIA 1H72C 4X64E 2XEXA 4OX9I 4DV0E 4UTGA 4YHHI 3QT8A 2V8PA 3V2UC 4YY3E 4JI2I 1KTVA 4FN5A 4B3SE 3T1HI 4DR7I 2BV3A 4LF6E 4FWHA 1IBKE 4JI5I 2LJPA 4I3HA 4DPWA 1RR9A 4LF5E 4B3TI 2UU9I 4AQYE 2HHHI 1HNXI 4JI3I 3ZKDA 2R3VA 1XNQE 2UXBE 1XMOI 5LMUE 4HACB 1XNRE 4DPYA 2DEIA 1ZXMA 4JI2E 2UUBE 4DR4I 4WUDA 4JI8E 1Z5AA 1VISA 1U2RA 4DU7A 4DU8A 2BM1A 1FKAE 2WW4A 4LF9E 4LF6I 3PYDA 3J81C 1Z0WA 4JG4A 4DR6I 1S16A 5BR8I 1H73A 3J7AM 1J5EI 1HR0I 4DR1E 3M6AA 3J81Q 1QZRA 4DV3I 4NXMI 1ZXNA 4JI4E 4DPXA 1ZM3A 4URLA 4DUZI 5LL6R 1B63A 4JI6I 1FWLA 4Z7YA 1XHKA 1HNZI 4DV1E 1ZM9A 1NHHA 3HULA 1XMQE 2HFSA 4FWGA 3WU4A 2Q2EB 5GMDA 4DR5I 4GKJE 2HKEA 1KKHA 3V5RA 4GKKE 4JV5I 1IBMI 1KVKA 1N32E 3Q1QA 4P52A 2V34A 4DV6I 4JI0I 4P7AA 2VQFE 4DUYE 3LNUA 1HNXE 4X62E 4FWDA 5LMNE 1XNQI 4LF7I 3PYEA 2ZM6I 1H7SA 1IBLI 2VQEE 4KHPE 3ZZUA 1Z59A 2HFUA 4JI8I 2HK3A 5IT9C 4DV4I 1D6TA 1N0VC 1Z0CA 1A6FA 1H7UA 1MG7A 4DV5E 4DV7I 3CWVA 2UUCI 4B3MI 4DV6E 3OTOI 1EA6A 4JI0E 3J80Q 3LTOA 4NXME 4DV3E 1FNMA 1FJGE 3F0NA 1NHIA 5L3JA 4OX9E 3WU3A 1N33I 4JYAI 2UXCE 1IBLE 4JI6E 4DR4E 4DV2I 4KHPI 4YY3I 3QT5A 2R42A 1HNZE 4DV1I 4DPTA 4UT4A 1XMQI 4K0KI 5IWAE 2UUAE 1Z0TA 1Z0EA 2J7KA 1MX0A 4LF4I 4PU9A 4DV5I 4KQVA 1IBME 4JI5E 3PYGA 1N34I 1Z0GA 2UU9E 4Z7CA 1Z5BA 2A2DA 4B3RI 4LFBE 1FJGI 5FLXQ 4JI7E 4HYMA 1N33E 2UXCI 4DR2E 3ZZTA 5LMNI 3WU5A 2GS8A 3LPSA 4DR5E 3T1YE 4X66I 5FLXC 3B78A 4HY1A 2V2ZA 3PYFA 1N32I 1Z0VA 4LF4E 5BR8E 5IT9Q 4DR3I 4LFAE 1OJ4A 1MU5A 4DV7E 2HKJA 5A2QQ 4B3ME 1BKNA 2V2VA 2DEJA 3QT6A 4HXZA 1S4EA 3B82A 4DUZE 2A2CA 4LF7E 2ZM6E 1N36E 3J80C 3ZKBA 1ZM4A 2EFGA 5A2QC 1EI1A 1PIEA 4JYAE 2HK2A 4DV2E 5GMEA 4DV4E 4JI1I 2E5LE 1HNWI 1ELOA 1B62A 3GONA
chains in the Genus database with same CATH superfamily
4LF8I 1Z5CA 4JV5E 1IBKI 1YHCA 2X7IA 3ZM7A 1WUUA 3D4JA 1I94I 2Z5CB 4AQYI 2NN6D 2WP8B 2NN6B 4RPFA 2PNZB 4LFCE 3KRNA 1YH8A 1XMOE 1H74A 4DXLA 4XTJA 2ZITA 4HACA 1FI4A 2J65A 3QT7A 3U1YA 1XNRI 5DROA 4MQYA 4IS9A 4OO1E 2UUBI 2V2QA 4NXNI 5JEAF 5IWAI 1USVA 1PKPA 2VESA 3T1YI 2ZBKB 2E5LI 1HNWE 4LF9I 4DR6E 2O1UA 1ZM2A 4MYUA 5DRQA 1Y6ZA 4FW9A 4PRVA 1J5EE 4IFDA 1N34E 4R1FA 2Z5EA 4DR1I 2CG9A 2PO1B 2UXDE 4B3RE 2WP8A 3B8HA 2IERA 2PO2B 4USMA 5JEAA 4JI7I 4DV0I 3GMEA 2HHHE 1PVGA 4WUCA 1KIJA 4EMDA 4JI3E 4M1KA 1DARA 1NZ0A 3PS1A 1RREA 4X66E 3T1HE 5DRPA 4IZJA 2BM0A 4ED4A 5C0XB 2Z5BA 3UHMA 4GKJI 2PNLA 4MYTA 2F4VE 2PO2A 4K0KE 2UUAI 4U3DA 4QNJA 1UDQA 4JI1E 4DR3E 5C0XD 3J7AG 4IFDB 4LF8E 3JAMQ 2C39A 4OO1F 3ZZ0A 5K36B 4LF5I 4B3TE 5DNLA 3L7ZA 2UXDI 2NPFA 1K47A 3H4LA 3L7ZB 1I94E 2VQFI 2UXBI 4X65I 4DUYI 5LMUI 2GO3A 1N36I 4IZJD 4PRXA 3JAMC 4LFBI 1Z0BA 4JI4I 4X62I 1FWKA 3PS2A 2JE6A 4X64I 1N0UA 4LFCI 4YHHE 1VI7A 3K1JA 4DR2I 3DD6A 3K85A 2VQEI 2AJ4A 4USKA 5DRRA 2BA0G 3P3GA 4OO1C 1NHJA 4U3BA 2VF3A 4B3SI 4DR7E 4NXNE 2PNZA 4OO1B 1UEKA 2X36A 2F4VI 2E1RA 3HJCA 4WUBA 3CDJA 3K17A 1UDNA 4GKKI 4OKGA 1R6MA 5C0XC 1HR0E 4LCGA 4LCFA 2OI2A 5ELWA 3P06A 4DPUA 2UUCE 5EL9A 4LFAI 2JEBA 4FW7A 3OTOE 2CZ9A 2BR2B 2Z5CA 4ISAA 4IZJB 3WU6A 4X65E 1Y5YA 4FW6A 2F1DA 4IFDF 4ZVIA 1H72C 4X64E 4OO1A 2XEXA 4OX9I 4DV0E 4UTGA 4YHHI 3QT8A 2V8PA 3GCMA 3V2UC 4YY3E 1E3PA 3HKMA 2O1VA 4JI2I 2O1WA 1KTVA 4FN5A 4B3SE 3T1HI 4DR7I 5DNXA 2BV3A 5EKWA 1USUA 4LF6E 1OYSA 2JEAB 5FWKA 3M85G 4NBQA 4FWHA 1HK7A 1IBKE 4JI5I 2LJPA 2O3ZA 4I3HA 4DPWA 1RR9A 4LF5E 4B3TI 2UU9I 4AQYE 2HHHI 1HNXI 4OO1D 4JI3I 3ZKDA 2R3VA 1XNQE 2JT2A 2UXBE 3CDIA 3Q6MA 4MDTA 5LMUE 1XMOI 1OYRA 1R6LA 2C39B 4HACB 1UDSA 1XNRE 5JEAC 5K36F 1Y60A 4DPYA 4FW4A 2DEIA 1ZXMA 2IOQA 3P3EA 4JI2E 2UUBE 4DR4I 4WUDA 4JI8E 1Z5AA 1VISA 5JEAE 1U2RA 4DU7A 4DU8A 2BM1A 1FKAE 2WW4A 4LF9E 2O1TA 2C37A 4LF6I 3PYDA 3P76A 3J81C 1Z0WA 4JG4A 4DR6I 2WNRA 1S16A 2WNRB 5BR8I 1H73A 3J7AM 1J5EI 3M7NG 5K36A 4QNKA 4FW3A 1HR0I 4DR1E 3M6AA 5JEAB 3P3CA 3J81Q 1QZRA 4DV3I 4NXMI 4IFDC 1ZXNA 2BR2A 4JI4E 4DPXA 1ZM3A 4URLA 1OYPA 4DUZI 3B4TA 5LL6R 1B63A 4J3DA 4JI6I 2BA0D 1FWLA 4Z7YA 1XHKA 2PNMA 1HNZI 4DV1E 1ZM9A 3NZKA 1NHHA 4MU0A 2PO1A 3HULA 1XMQE 2HFSA 4FWGA 3WU4A 2Q2EB 2PO0A 5GMDA 4DR5I 5K36D 4GKJE 2HKEA 1P42A 1KKHA 3V5RA 4GKKE 4JV5I 1IBMI 3PRYA 2JEAA 1KVKA 1N32E 3Q1QA 1XXEA 4MU3A 4P52A 2V34A 4DV6I 4AIMA 4JI0I 4P7AA 2VQFE 5C0XA 4DUYE 4IFDE 3LNUA 1HNXE 2CVEA 4BA2B 4X62E 4FWDA 5LMNE 1XNQI 4N3OA 4LF7I 3PYEA 2BA1D 1H7SA 2ZM6I 1IBLI 2VQEE 4KHPE 1RHYA 3ZZUA 1Z59A 2HFUA 4JI8I 2HK3A 3Q6NA 5IT9C 2NN6E 2JE6B 4DV4I 1D6TA 2CGEA 1Y4SA 1N0VC 1Z0CA 2C37B 4IZKA 2NN6C 1A6FA 4OZEA 1H7UA 1MG7A 4DV5E 4DV7I 3CWVA 2UUCI 4B3MI 4DV6E 3OTOI 2JEBB 4BA1B 1EA6A 4JI0E 3J80Q 2GQ0A 2PO0B 3LTOA 4DV3E 1FNMA 5JEAD 4NXME 1FJGE 3F0NA 1NHIA 5L3JA 4OX9E 3WU3A 1UDOA 1N33I 4LOMA 4JYAI 2UXCE 1Y4UA 1IBLE 4JI6E 4DR4E 4DV2I 4KHPI 4YY3I 3QT5A 2R42A 2AE8A 1HNZE 4DV1I 4DPTA 4AM3A 4UT4A 1XMQI 2NN6A 4K0KI 5IWAE 2UUAE 1Z0TA 1Z0EA 4BA2A 4IZKB 3M7ND 2J7KA 1MX0A 4LF4I 4PU9A 4DV5I 4KQVA 1IBME 4LCHA 3PYGA 4JI5E 1N34I 1Z0GA 4MU1A 2UU9E 3GLLA 4Z7CA 2A2DA 1Z5BA 4B3RI 4LFBE 4LPFA 1FJGI 2NN6F 5K36C 5FLXQ 4JI7E 2BA1G 4HYMA 1N33E 2UXCI 4DR2E 3ZZTA 5K36E 2C38A 5LMNI 4GQUA 5C0XF 3WU5A 4IFDD 2GS8A 3LPSA 4DR5E 1E3HA 3T1YE 4X66I 5FLXC 3B78A 4HY1A 3PS3A 2V2ZA 3PYFA 1N32I 1Z0VA 4MU4A 2IOPA 4AIDA 3U1KA 4LF4E 5BR8E 5IT9Q 3M85D 4DR3I 4LFAE 4FW5A 1OJ4A 1MU5A 5C0XE 2IESA 3H1CA 2C38B 4DV7E 2HKJA 2GO4A 5A2QQ 4B3ME 1BKNA 2V2VA 2DEJA 4BA1A 3QT6A 4HXZA 1S4EA 3B82A 4DUZE 2A2CA 4LF7E 2ZM6E 1N36E 3J80C 3ZKBA 1ZM4A 2EFGA 5A2QC 1EI1A 1PIEA 4JYAE 2HK2A 4DV2E 5GMEA 2Z5BB 4DV4E 4JI1I 2E5LE 1HNWI 1ELOA 1B62A 3GONA
chains in the Genus database with same CATH topology
4LF8I 1Z5CA 4JV5E 1IBKI 2X7IA 3ZM7A 1WUUA 3D4JA 1I94I 2Z5CB 4AQYI 4RPFA 4LFCE 1XMOE 1H74A 4DXLA 4XTJA 2ZITA 4HACA 1FI4A 3QT7A 1XNRI 2UUBI 2V2QA 4NXNI 5IWAI 1USVA 1PKPA 3T1YI 2ZBKB 2E5LI 1HNWE 4LF9I 4DR6E 2O1UA 1ZM2A 4MYUA 1Y6ZA 4FW9A 4PRVA 1J5EE 1N34E 4R1FA 2Z5EA 4DR1I 2CG9A 2UXDE 4B3RE 3B8HA 4USMA 4JI7I 4DV0I 2HHHE 1PVGA 4WUCA 1KIJA 4EMDA 4JI3E 4M1KA 1DARA 1NZ0A 1RREA 4X66E 3T1HE 4IZJA 2BM0A 4ED4A 2Z5BA 4GKJI 2PNLA 4MYTA 2F4VE 4K0KE 2UUAI 4JI1E 4DR3E 3J7AG 4LF8E 3JAMQ 3ZZ0A 4LF5I 4B3TE 2UXDI 2NPFA 1K47A 3H4LA 1I94E 2VQFI 2UXBI 4X65I 4DUYI 5LMUI 1N36I 4IZJD 4PRXA 3JAMC 4LFBI 1Z0BA 4JI4I 4X62I 1FWKA 4X64I 1N0UA 4LFCI 4YHHE 3K1JA 4DR2I 3K85A 2VQEI 2AJ4A 4USKA 1NHJA 2VF3A 4B3SI 4DR7E 4NXNE 1UEKA 2X36A 2F4VI 2E1RA 3HJCA 4WUBA 3K17A 4GKKI 1HR0E 2OI2A 3P06A 4DPUA 2UUCE 4LFAI 3OTOE 2CZ9A 2Z5CA 4IZJB 3WU6A 4X65E 4ZVIA 1H72C 4X64E 2XEXA 4OX9I 4DV0E 4UTGA 4YHHI 3QT8A 2V8PA 3V2UC 4YY3E 2O1VA 4JI2I 2O1WA 1KTVA 4FN5A 4B3SE 3T1HI 4DR7I 2BV3A 1USUA 4LF6E 5FWKA 4FWHA 1HK7A 1IBKE 4JI5I 2LJPA 4I3HA 4DPWA 1RR9A 4LF5E 4B3TI 2UU9I 4AQYE 2HHHI 1HNXI 4JI3I 3ZKDA 2R3VA 1XNQE 2UXBE 3Q6MA 1XMOI 5LMUE 4HACB 1XNRE 4DPYA 2DEIA 1ZXMA 2IOQA 4JI2E 2UUBE 4DR4I 4WUDA 4JI8E 1Z5AA 1VISA 1U2RA 4DU7A 4DU8A 2BM1A 1FKAE 2WW4A 4LF9E 2O1TA 4LF6I 3PYDA 3J81C 1Z0WA 4JG4A 4DR6I 1S16A 5BR8I 1H73A 3J7AM 1J5EI 1HR0I 4DR1E 3M6AA 3J81Q 1QZRA 4DV3I 4NXMI 1ZXNA 4JI4E 4DPXA 1ZM3A 4URLA 4DUZI 5LL6R 1B63A 4JI6I 1FWLA 4Z7YA 1XHKA 2PNMA 1HNZI 4DV1E 1ZM9A 1NHHA 3HULA 1XMQE 2HFSA 4FWGA 3WU4A 2Q2EB 5GMDA 4DR5I 4GKJE 2HKEA 1KKHA 3V5RA 4GKKE 4JV5I 1IBMI 3PRYA 1KVKA 1N32E 3Q1QA 4P52A 2V34A 4DV6I 4JI0I 4P7AA 2VQFE 4DUYE 3LNUA 1HNXE 4X62E 4FWDA 5LMNE 1XNQI 4N3OA 4LF7I 3PYEA 2ZM6I 1H7SA 1IBLI 2VQEE 4KHPE 3ZZUA 1Z59A 2HFUA 4JI8I 2HK3A 3Q6NA 5IT9C 4DV4I 1D6TA 2CGEA 1Y4SA 1N0VC 1Z0CA 4IZKA 1A6FA 1H7UA 1MG7A 4DV5E 4DV7I 3CWVA 2UUCI 4B3MI 4DV6E 3OTOI 1EA6A 4JI0E 3J80Q 2GQ0A 3LTOA 4DV3E 1FNMA 4NXME 1FJGE 3F0NA 1NHIA 5L3JA 4OX9E 3WU3A 1N33I 4JYAI 2UXCE 1Y4UA 1IBLE 4JI6E 4DR4E 4DV2I 4KHPI 4YY3I 3QT5A 2R42A 1HNZE 4DV1I 4DPTA 4UT4A 1XMQI 4K0KI 5IWAE 2UUAE 1Z0TA 1Z0EA 4IZKB 2J7KA 1MX0A 4LF4I 4PU9A 4DV5I 4KQVA 1IBME 4JI5E 3PYGA 1N34I 1Z0GA 2UU9E 4Z7CA 1Z5BA 2A2DA 4B3RI 4LFBE 1FJGI 5FLXQ 4JI7E 4HYMA 1N33E 2UXCI 4DR2E 3ZZTA 5LMNI 3WU5A 2GS8A 3LPSA 4DR5E 3T1YE 4X66I 5FLXC 3B78A 4HY1A 2V2ZA 3PYFA 1N32I 1Z0VA 2IOPA 4LF4E 5BR8E 5IT9Q 4DR3I 4LFAE 1OJ4A 1MU5A 4DV7E 2HKJA 5A2QQ 4B3ME 1BKNA 2V2VA 2DEJA 3QT6A 4HXZA 1S4EA 3B82A 4DUZE 2A2CA 4LF7E 2ZM6E 1N36E 3J80C 3ZKBA 1ZM4A 2EFGA 5A2QC 1EI1A 1PIEA 4JYAE 2HK2A 4DV2E 5GMEA 2Z5BB 4DV4E 4JI1I 2E5LE 1HNWI 1ELOA 1B62A 3GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 I;  1Z5C A;  4JV5 E;  1IBK I;  2X7I A;  3ZM7 A;  1WUU A;  3D4J A;  1I94 I;  4AQY I;  4RPF A;  4LFC E;  1XMO E;  1H74 A;  4DXL A;  4XTJ A;  2ZIT A;  4HAC A;  1FI4 A;  3QT7 A;  1XNR I;  2UUB I;  2V2Q A;  4NXN I;  5IWA I;  1PKP A;  3T1Y I;  2ZBK B;  2E5L I;  1HNW E;  4LF9 I;  4DR6 E;  1ZM2 A;  4MYU A;  4FW9 A;  4PRV A;  1J5E E;  1N34 E;  4R1F A;  4DR1 I;  2UXD E;  4B3R E;  3B8H A;  4USM A;  4JI7 I;  4DV0 I;  2HHH E;  1PVG A;  4WUC A;  1KIJ A;  4EMD A;  4JI3 E;  4M1K A;  1DAR A;  1NZ0 A;  1RRE A;  4X66 E;  3T1H E;  2BM0 A;  4ED4 A;  4GKJ I;  4MYT A;  2F4V E;  4K0K E;  2UUA I;  4JI1 E;  4DR3 E;  3J7A G;  4LF8 E;  3JAM Q;  3ZZ0 A;  4LF5 I;  4B3T E;  2UXD I;  2NPF A;  1K47 A;  3H4L A;  1I94 E;  2VQF I;  2UXB I;  4X65 I;  4DUY I;  5LMU I;  1N36 I;  4PRX A;  3JAM C;  4LFB I;  1Z0B A;  4JI4 I;  4X62 I;  1FWK A;  4X64 I;  1N0U A;  4LFC I;  4YHH E;  3K1J A;  4DR2 I;  2VQE I;  2AJ4 A;  4USK A;  1NHJ A;  2VF3 A;  4B3S I;  4DR7 E;  4NXN E;  1UEK A;  2X36 A;  2F4V I;  2E1R A;  4WUB A;  3K17 A;  4GKK I;  1HR0 E;  2OI2 A;  4DPU A;  2UUC E;  4LFA I;  3OTO E;  2CZ9 A;  3WU6 A;  4X65 E;  4ZVI A;  1H72 C;  4X64 E;  2XEX A;  4OX9 I;  4DV0 E;  4UTG A;  4YHH I;  3QT8 A;  2V8P A;  3V2U C;  4YY3 E;  4JI2 I;  1KTV A;  4FN5 A;  4B3S E;  3T1H I;  4DR7 I;  2BV3 A;  4LF6 E;  4FWH A;  1IBK E;  4JI5 I;  2LJP A;  4I3H A;  4DPW A;  1RR9 A;  4LF5 E;  4B3T I;  2UU9 I;  4AQY E;  2HHH I;  1HNX I;  4JI3 I;  3ZKD A;  2R3V A;  1XNQ E;  2UXB E;  1XMO I;  5LMU E;  4HAC B;  1XNR E;  4DPY A;  2DEI A;  1ZXM A;  4JI2 E;  2UUB E;  4DR4 I;  4WUD A;  4JI8 E;  1Z5A A;  1VIS A;  1U2R A;  4DU7 A;  4DU8 A;  2BM1 A;  1FKA E;  2WW4 A;  4LF9 E;  4LF6 I;  3PYD A;  3J81 C;  1Z0W A;  4JG4 A;  4DR6 I;  1S16 A;  5BR8 I;  1H73 A;  3J7A M;  1J5E I;  1HR0 I;  4DR1 E;  3M6A A;  3J81 Q;  1QZR A;  4DV3 I;  4NXM I;  1ZXN A;  4JI4 E;  4DPX A;  1ZM3 A;  4URL A;  4DUZ I;  5LL6 R;  1B63 A;  4JI6 I;  1FWL A;  4Z7Y A;  1XHK A;  1HNZ I;  4DV1 E;  1ZM9 A;  1NHH A;  3HUL A;  1XMQ E;  2HFS A;  4FWG A;  3WU4 A;  2Q2E B;  5GMD A;  4DR5 I;  4GKJ E;  2HKE A;  1KKH A;  3V5R A;  4GKK E;  4JV5 I;  1IBM I;  1KVK A;  1N32 E;  3Q1Q A;  4P52 A;  2V34 A;  4DV6 I;  4JI0 I;  4P7A A;  2VQF E;  4DUY E;  3LNU A;  1HNX E;  4X62 E;  4FWD A;  5LMN E;  1XNQ I;  4LF7 I;  3PYE A;  2ZM6 I;  1H7S A;  1IBL I;  2VQE E;  4KHP E;  3ZZU A;  1Z59 A;  2HFU A;  4JI8 I;  2HK3 A;  5IT9 C;  4DV4 I;  1D6T A;  1N0V C;  1Z0C A;  1A6F A;  1H7U A;  1MG7 A;  4DV5 E;  4DV7 I;  3CWV A;  2UUC I;  4B3M I;  4DV6 E;  3OTO I;  1EA6 A;  4JI0 E;  3J80 Q;  3LTO A;  4NXM E;  4DV3 E;  1FNM A;  1FJG E;  3F0N A;  1NHI A;  5L3J A;  4OX9 E;  3WU3 A;  1N33 I;  4JYA I;  2UXC E;  1IBL E;  4JI6 E;  4DR4 E;  4DV2 I;  4KHP I;  4YY3 I;  3QT5 A;  2R42 A;  1HNZ E;  4DV1 I;  4DPT A;  4UT4 A;  1XMQ I;  4K0K I;  5IWA E;  2UUA E;  1Z0T A;  1Z0E A;  2J7K A;  1MX0 A;  4LF4 I;  4PU9 A;  4DV5 I;  4KQV A;  1IBM E;  4JI5 E;  3PYG A;  1N34 I;  1Z0G A;  2UU9 E;  4Z7C A;  1Z5B A;  2A2D A;  4B3R I;  4LFB E;  1FJG I;  5FLX Q;  4JI7 E;  4HYM A;  1N33 E;  2UXC I;  4DR2 E;  3ZZT A;  5LMN I;  3WU5 A;  2GS8 A;  3LPS A;  4DR5 E;  3T1Y E;  4X66 I;  5FLX C;  3B78 A;  4HY1 A;  2V2Z A;  3PYF A;  1N32 I;  1Z0V A;  4LF4 E;  5BR8 E;  5IT9 Q;  4DR3 I;  4LFA E;  1OJ4 A;  1MU5 A;  4DV7 E;  2HKJ A;  5A2Q Q;  4B3M E;  1BKN A;  2V2V A;  2DEJ A;  3QT6 A;  4HXZ A;  1S4E A;  3B82 A;  4DUZ E;  2A2C A;  4LF7 E;  2ZM6 E;  1N36 E;  3J80 C;  3ZKB A;  1ZM4 A;  2EFG A;  5A2Q C;  1EI1 A;  1PIE A;  4JYA E;  2HK2 A;  4DV2 E;  5GME A;  4DV4 E;  4JI1 I;  2E5L E;  1HNW I;  1ELO A;  1B62 A;  3GON A; 
#chains in the Genus database with same CATH topology
 4LF8 I;  1Z5C A;  4JV5 E;  1IBK I;  1YHC A;  2X7I A;  3ZM7 A;  1WUU A;  3D4J A;  1I94 I;  2Z5C B;  4AQY I;  2NN6 D;  2WP8 B;  2NN6 B;  4RPF A;  2PNZ B;  4LFC E;  3KRN A;  1YH8 A;  1XMO E;  1H74 A;  4DXL A;  4XTJ A;  2ZIT A;  4HAC A;  1FI4 A;  2J65 A;  3QT7 A;  3U1Y A;  1XNR I;  5DRO A;  4MQY A;  4IS9 A;  4OO1 E;  2UUB I;  2V2Q A;  4NXN I;  5JEA F;  5IWA I;  1USV A;  1PKP A;  2VES A;  3T1Y I;  2ZBK B;  2E5L I;  1HNW E;  4LF9 I;  4DR6 E;  2O1U A;  1ZM2 A;  4MYU A;  5DRQ A;  1Y6Z A;  4FW9 A;  4PRV A;  1J5E E;  4IFD A;  1N34 E;  4R1F A;  2Z5E A;  4DR1 I;  2CG9 A;  2PO1 B;  2UXD E;  4B3R E;  2WP8 A;  3B8H A;  2IER A;  2PO2 B;  4USM A;  5JEA A;  4JI7 I;  4DV0 I;  3GME A;  2HHH E;  1PVG A;  4WUC A;  1KIJ A;  4EMD A;  4JI3 E;  4M1K A;  1DAR A;  1NZ0 A;  3PS1 A;  1RRE A;  4X66 E;  3T1H E;  5DRP A;  4IZJ A;  2BM0 A;  4ED4 A;  5C0X B;  2Z5B A;  3UHM A;  4GKJ I;  2PNL A;  4MYT A;  2F4V E;  2PO2 A;  4K0K E;  2UUA I;  4U3D A;  4QNJ A;  1UDQ A;  4JI1 E;  4DR3 E;  5C0X D;  3J7A G;  4IFD B;  4LF8 E;  3JAM Q;  2C39 A;  4OO1 F;  3ZZ0 A;  5K36 B;  4LF5 I;  4B3T E;  5DNL A;  3L7Z A;  2UXD I;  2NPF A;  1K47 A;  3H4L A;  3L7Z B;  1I94 E;  2VQF I;  2UXB I;  4X65 I;  4DUY I;  5LMU I;  2GO3 A;  1N36 I;  4IZJ D;  4PRX A;  3JAM C;  4LFB I;  1Z0B A;  4JI4 I;  4X62 I;  1FWK A;  3PS2 A;  2JE6 A;  4X64 I;  1N0U A;  4LFC I;  4YHH E;  1VI7 A;  3K1J A;  4DR2 I;  3DD6 A;  3K85 A;  2VQE I;  2AJ4 A;  4USK A;  5DRR A;  2BA0 G;  3P3G A;  4OO1 C;  1NHJ A;  4U3B A;  2VF3 A;  4B3S I;  4DR7 E;  4NXN E;  2PNZ A;  4OO1 B;  1UEK A;  2X36 A;  2F4V I;  2E1R A;  3HJC A;  4WUB A;  3CDJ A;  3K17 A;  1UDN A;  4GKK I;  4OKG A;  1R6M A;  5C0X C;  1HR0 E;  4LCG A;  4LCF A;  2OI2 A;  5ELW A;  3P06 A;  4DPU A;  2UUC E;  5EL9 A;  4LFA I;  2JEB A;  4FW7 A;  3OTO E;  2CZ9 A;  2BR2 B;  2Z5C A;  4ISA A;  4IZJ B;  3WU6 A;  4X65 E;  1Y5Y A;  4FW6 A;  2F1D A;  4IFD F;  4ZVI A;  1H72 C;  4X64 E;  4OO1 A;  2XEX A;  4OX9 I;  4DV0 E;  4UTG A;  4YHH I;  3QT8 A;  2V8P A;  3GCM A;  3V2U C;  4YY3 E;  1E3P A;  3HKM A;  2O1V A;  4JI2 I;  2O1W A;  1KTV A;  4FN5 A;  4B3S E;  3T1H I;  4DR7 I;  5DNX A;  2BV3 A;  5EKW A;  1USU A;  4LF6 E;  1OYS A;  2JEA B;  5FWK A;  3M85 G;  4NBQ A;  4FWH A;  1HK7 A;  1IBK E;  4JI5 I;  2LJP A;  2O3Z A;  4I3H A;  4DPW A;  1RR9 A;  4LF5 E;  4B3T I;  2UU9 I;  4AQY E;  2HHH I;  1HNX I;  4OO1 D;  4JI3 I;  3ZKD A;  2R3V A;  1XNQ E;  2JT2 A;  2UXB E;  3CDI A;  3Q6M A;  4MDT A;  5LMU E;  1XMO I;  1OYR A;  1R6L A;  2C39 B;  4HAC B;  1UDS A;  1XNR E;  5JEA C;  5K36 F;  1Y60 A;  4DPY A;  4FW4 A;  2DEI A;  1ZXM A;  2IOQ A;  3P3E A;  4JI2 E;  2UUB E;  4DR4 I;  4WUD A;  4JI8 E;  1Z5A A;  1VIS A;  5JEA E;  1U2R A;  4DU7 A;  4DU8 A;  2BM1 A;  1FKA E;  2WW4 A;  4LF9 E;  2O1T A;  2C37 A;  4LF6 I;  3PYD A;  3P76 A;  3J81 C;  1Z0W A;  4JG4 A;  4DR6 I;  2WNR A;  1S16 A;  2WNR B;  5BR8 I;  1H73 A;  3J7A M;  1J5E I;  3M7N G;  5K36 A;  4QNK A;  4FW3 A;  1HR0 I;  4DR1 E;  3M6A A;  5JEA B;  3P3C A;  3J81 Q;  1QZR A;  4DV3 I;  4NXM I;  4IFD C;  1ZXN A;  2BR2 A;  4JI4 E;  4DPX A;  1ZM3 A;  4URL A;  1OYP A;  4DUZ I;  3B4T A;  5LL6 R;  1B63 A;  4J3D A;  4JI6 I;  2BA0 D;  1FWL A;  4Z7Y A;  1XHK A;  2PNM A;  1HNZ I;  4DV1 E;  1ZM9 A;  3NZK A;  1NHH A;  4MU0 A;  2PO1 A;  3HUL A;  1XMQ E;  2HFS A;  4FWG A;  3WU4 A;  2Q2E B;  2PO0 A;  5GMD A;  4DR5 I;  5K36 D;  4GKJ E;  2HKE A;  1P42 A;  1KKH A;  3V5R A;  4GKK E;  4JV5 I;  1IBM I;  3PRY A;  2JEA A;  1KVK A;  1N32 E;  3Q1Q A;  1XXE A;  4MU3 A;  4P52 A;  2V34 A;  4DV6 I;  4AIM A;  4JI0 I;  4P7A A;  2VQF E;  5C0X A;  4DUY E;  4IFD E;  3LNU A;  1HNX E;  2CVE A;  4BA2 B;  4X62 E;  4FWD A;  5LMN E;  1XNQ I;  4N3O A;  4LF7 I;  3PYE A;  2BA1 D;  1H7S A;  2ZM6 I;  1IBL I;  2VQE E;  4KHP E;  1RHY A;  3ZZU A;  1Z59 A;  2HFU A;  4JI8 I;  2HK3 A;  3Q6N A;  5IT9 C;  2NN6 E;  2JE6 B;  4DV4 I;  1D6T A;  2CGE A;  1Y4S A;  1N0V C;  1Z0C A;  2C37 B;  4IZK A;  2NN6 C;  1A6F A;  4OZE A;  1H7U A;  1MG7 A;  4DV5 E;  4DV7 I;  3CWV A;  2UUC I;  4B3M I;  4DV6 E;  3OTO I;  2JEB B;  4BA1 B;  1EA6 A;  4JI0 E;  3J80 Q;  2GQ0 A;  2PO0 B;  3LTO A;  4DV3 E;  1FNM A;  5JEA D;  4NXM E;  1FJG E;  3F0N A;  1NHI A;  5L3J A;  4OX9 E;  3WU3 A;  1UDO A;  1N33 I;  4LOM A;  4JYA I;  2UXC E;  1Y4U A;  1IBL E;  4JI6 E;  4DR4 E;  4DV2 I;  4KHP I;  4YY3 I;  3QT5 A;  2R42 A;  2AE8 A;  1HNZ E;  4DV1 I;  4DPT A;  4AM3 A;  4UT4 A;  1XMQ I;  2NN6 A;  4K0K I;  5IWA E;  2UUA E;  1Z0T A;  1Z0E A;  4BA2 A;  4IZK B;  3M7N D;  2J7K A;  1MX0 A;  4LF4 I;  4PU9 A;  4DV5 I;  4KQV A;  1IBM E;  4LCH A;  3PYG A;  4JI5 E;  1N34 I;  1Z0G A;  4MU1 A;  2UU9 E;  3GLL A;  4Z7C A;  2A2D A;  1Z5B A;  4B3R I;  4LFB E;  4LPF A;  1FJG I;  2NN6 F;  5K36 C;  5FLX Q;  4JI7 E;  2BA1 G;  4HYM A;  1N33 E;  2UXC I;  4DR2 E;  3ZZT A;  5K36 E;  2C38 A;  5LMN I;  4GQU A;  5C0X F;  3WU5 A;  4IFD D;  2GS8 A;  3LPS A;  4DR5 E;  1E3H A;  3T1Y E;  4X66 I;  5FLX C;  3B78 A;  4HY1 A;  3PS3 A;  2V2Z A;  3PYF A;  1N32 I;  1Z0V A;  4MU4 A;  2IOP A;  4AID A;  3U1K A;  4LF4 E;  5BR8 E;  5IT9 Q;  3M85 D;  4DR3 I;  4LFA E;  4FW5 A;  1OJ4 A;  1MU5 A;  5C0X E;  2IES A;  3H1C A;  2C38 B;  4DV7 E;  2HKJ A;  2GO4 A;  5A2Q Q;  4B3M E;  1BKN A;  2V2V A;  2DEJ A;  4BA1 A;  3QT6 A;  4HXZ A;  1S4E A;  3B82 A;  4DUZ E;  2A2C A;  4LF7 E;  2ZM6 E;  1N36 E;  3J80 C;  3ZKB A;  1ZM4 A;  2EFG A;  5A2Q C;  1EI1 A;  1PIE A;  4JYA E;  2HK2 A;  4DV2 E;  5GME A;  2Z5B B;  4DV4 E;  4JI1 I;  2E5L E;  1HNW I;  1ELO A;  1B62 A;  3GON A; 
#chains in the Genus database with same CATH homology
 4LF8 I;  1Z5C A;  4JV5 E;  1IBK I;  2X7I A;  3ZM7 A;  1WUU A;  3D4J A;  1I94 I;  2Z5C B;  4AQY I;  4RPF A;  4LFC E;  1XMO E;  1H74 A;  4DXL A;  4XTJ A;  2ZIT A;  4HAC A;  1FI4 A;  3QT7 A;  1XNR I;  2UUB I;  2V2Q A;  4NXN I;  5IWA I;  1USV A;  1PKP A;  3T1Y I;  2ZBK B;  2E5L I;  1HNW E;  4LF9 I;  4DR6 E;  2O1U A;  1ZM2 A;  4MYU A;  1Y6Z A;  4FW9 A;  4PRV A;  1J5E E;  1N34 E;  4R1F A;  2Z5E A;  4DR1 I;  2CG9 A;  2UXD E;  4B3R E;  3B8H A;  4USM A;  4JI7 I;  4DV0 I;  2HHH E;  1PVG A;  4WUC A;  1KIJ A;  4EMD A;  4JI3 E;  4M1K A;  1DAR A;  1NZ0 A;  1RRE A;  4X66 E;  3T1H E;  4IZJ A;  2BM0 A;  4ED4 A;  2Z5B A;  4GKJ I;  2PNL A;  4MYT A;  2F4V E;  4K0K E;  2UUA I;  4JI1 E;  4DR3 E;  3J7A G;  4LF8 E;  3JAM Q;  3ZZ0 A;  4LF5 I;  4B3T E;  2UXD I;  2NPF A;  1K47 A;  3H4L A;  1I94 E;  2VQF I;  2UXB I;  4X65 I;  4DUY I;  5LMU I;  1N36 I;  4IZJ D;  4PRX A;  3JAM C;  4LFB I;  1Z0B A;  4JI4 I;  4X62 I;  1FWK A;  4X64 I;  1N0U A;  4LFC I;  4YHH E;  3K1J A;  4DR2 I;  3K85 A;  2VQE I;  2AJ4 A;  4USK A;  1NHJ A;  2VF3 A;  4B3S I;  4DR7 E;  4NXN E;  1UEK A;  2X36 A;  2F4V I;  2E1R A;  3HJC A;  4WUB A;  3K17 A;  4GKK I;  1HR0 E;  2OI2 A;  3P06 A;  4DPU A;  2UUC E;  4LFA I;  3OTO E;  2CZ9 A;  2Z5C A;  4IZJ B;  3WU6 A;  4X65 E;  4ZVI A;  1H72 C;  4X64 E;  2XEX A;  4OX9 I;  4DV0 E;  4UTG A;  4YHH I;  3QT8 A;  2V8P A;  3V2U C;  4YY3 E;  2O1V A;  4JI2 I;  2O1W A;  1KTV A;  4FN5 A;  4B3S E;  3T1H I;  4DR7 I;  2BV3 A;  1USU A;  4LF6 E;  5FWK A;  4FWH A;  1HK7 A;  1IBK E;  4JI5 I;  2LJP A;  4I3H A;  4DPW A;  1RR9 A;  4LF5 E;  4B3T I;  2UU9 I;  4AQY E;  2HHH I;  1HNX I;  4JI3 I;  3ZKD A;  2R3V A;  1XNQ E;  2UXB E;  3Q6M A;  1XMO I;  5LMU E;  4HAC B;  1XNR E;  4DPY A;  2DEI A;  1ZXM A;  2IOQ A;  4JI2 E;  2UUB E;  4DR4 I;  4WUD A;  4JI8 E;  1Z5A A;  1VIS A;  1U2R A;  4DU7 A;  4DU8 A;  2BM1 A;  1FKA E;  2WW4 A;  4LF9 E;  2O1T A;  4LF6 I;  3PYD A;  3J81 C;  1Z0W A;  4JG4 A;  4DR6 I;  1S16 A;  5BR8 I;  1H73 A;  3J7A M;  1J5E I;  1HR0 I;  4DR1 E;  3M6A A;  3J81 Q;  1QZR A;  4DV3 I;  4NXM I;  1ZXN A;  4JI4 E;  4DPX A;  1ZM3 A;  4URL A;  4DUZ I;  5LL6 R;  1B63 A;  4JI6 I;  1FWL A;  4Z7Y A;  1XHK A;  2PNM A;  1HNZ I;  4DV1 E;  1ZM9 A;  1NHH A;  3HUL A;  1XMQ E;  2HFS A;  4FWG A;  3WU4 A;  2Q2E B;  5GMD A;  4DR5 I;  4GKJ E;  2HKE A;  1KKH A;  3V5R A;  4GKK E;  4JV5 I;  1IBM I;  3PRY A;  1KVK A;  1N32 E;  3Q1Q A;  4P52 A;  2V34 A;  4DV6 I;  4JI0 I;  4P7A A;  2VQF E;  4DUY E;  3LNU A;  1HNX E;  4X62 E;  4FWD A;  5LMN E;  1XNQ I;  4N3O A;  4LF7 I;  3PYE A;  2ZM6 I;  1H7S A;  1IBL I;  2VQE E;  4KHP E;  3ZZU A;  1Z59 A;  2HFU A;  4JI8 I;  2HK3 A;  3Q6N A;  5IT9 C;  4DV4 I;  1D6T A;  2CGE A;  1Y4S A;  1N0V C;  1Z0C A;  4IZK A;  1A6F A;  1H7U A;  1MG7 A;  4DV5 E;  4DV7 I;  3CWV A;  2UUC I;  4B3M I;  4DV6 E;  3OTO I;  1EA6 A;  4JI0 E;  3J80 Q;  2GQ0 A;  3LTO A;  4DV3 E;  1FNM A;  4NXM E;  1FJG E;  3F0N A;  1NHI A;  5L3J A;  4OX9 E;  3WU3 A;  1N33 I;  4JYA I;  2UXC E;  1Y4U A;  1IBL E;  4JI6 E;  4DR4 E;  4DV2 I;  4KHP I;  4YY3 I;  3QT5 A;  2R42 A;  1HNZ E;  4DV1 I;  4DPT A;  4UT4 A;  1XMQ I;  4K0K I;  5IWA E;  2UUA E;  1Z0T A;  1Z0E A;  4IZK B;  2J7K A;  1MX0 A;  4LF4 I;  4PU9 A;  4DV5 I;  4KQV A;  1IBM E;  4JI5 E;  3PYG A;  1N34 I;  1Z0G A;  2UU9 E;  4Z7C A;  1Z5B A;  2A2D A;  4B3R I;  4LFB E;  1FJG I;  5FLX Q;  4JI7 E;  4HYM A;  1N33 E;  2UXC I;  4DR2 E;  3ZZT A;  5LMN I;  3WU5 A;  2GS8 A;  3LPS A;  4DR5 E;  3T1Y E;  4X66 I;  5FLX C;  3B78 A;  4HY1 A;  2V2Z A;  3PYF A;  1N32 I;  1Z0V A;  2IOP A;  4LF4 E;  5BR8 E;  5IT9 Q;  4DR3 I;  4LFA E;  1OJ4 A;  1MU5 A;  4DV7 E;  2HKJ A;  5A2Q Q;  4B3M E;  1BKN A;  2V2V A;  2DEJ A;  3QT6 A;  4HXZ A;  1S4E A;  3B82 A;  4DUZ E;  2A2C A;  4LF7 E;  2ZM6 E;  1N36 E;  3J80 C;  3ZKB A;  1ZM4 A;  2EFG A;  5A2Q C;  1EI1 A;  1PIE A;  4JYA E;  2HK2 A;  4DV2 E;  5GME A;  2Z5B B;  4DV4 E;  4JI1 I;  2E5L E;  1HNW I;  1ELO A;  1B62 A;  3GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...