4LF9I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf9I00
1KVKA 1MX0A 4JI8E 3LPSA 3M6AA 4B3SI 1ZXNA 4OX9E 1N32I 3JAMC 4KHPE 2DEIA 2UXCE 4FWHA 4USKA 1KIJA 2HKEA 4DXLA 4LF9I 4LFAI 4B3TE 3J7AM 4JI3I 4URLA 4DUYI 4JI6E 1ELOA 2DEJA 4ED4A 1QZRA 2UXDI 4P52A 3ZZTA 2UUCI 4Z7YA 2UXBI 4X64E 4DV3I 4LF4E 4UT4A 4WUCA 4DR6E 1KKHA 4DV4E 4UTGA 4JI8I 3J81C 1HNXE 4JI1E 2A2DA 3QT6A 4MYTA 2X7IA 3B8HA 1H74A 5IWAE 4OX9I 2UUAE 2CZ9A 4FN5A 2BM1A 3B82A 1XNQE 3GONA 1FKAE 4HY1A 3ZKBA 4JV5E 2F4VE 4KHPI 1DARA 4DR3E 2UXCI 1N34E 1PVGA 1HNWE 2V2QA 3Q1QA 4FW9A 4PU9A 4DU7A 4B3TI 2GS8A 1K47A 4DPTA 4JI6I 4Z7CA 3J80C 1FWKA 1J5EE 4GKKE 4X64I 4PRVA 4I3HA 4LF4I 4DR6I 3PYDA 4DV7E 1D6TA 4DV4I 4M1KA 1HNXI 4JI1I 4HYMA 4JG4A 4XTJA 5IWAI 4HACA 2UUAI 4DPUA 1XNQI 2HHHE 4LF8E 4JV5I 1Z0TA 1B62A 4WUDA 2F4VI 4KQVA 1WUUA 1Z0BA 3WU3A 4DV1E 1FNMA 4DR3I 1N34I 1S4EA 1HNWI 3F0NA 3WU6A 2ZM6E 5GMDA 3J81Q 1A6FA 4JI2E 4NXME 3ZM7A 3HULA 1N0VC 3PYGA 1J5EI 4GKKI 2LJPA 3LTOA 3K1JA 3T1HE 4GKJE 4DV7I 1ZXMA 3QT5A 4K0KE 3LNUA 5IT9C 4LFCE 1NHIA 1XNRE 4FWGA 4B3ME 4JI5E 3J80Q 1H7SA 2HHHI 4LF8I 1H72C 4DPWA 1NHHA 1ZM4A 4DV1I 2E1RA 1ZM2A 3QT7A 1Z0VA 4WUBA 2BM0A 2ZM6I 4NXNE 4USMA 5LMNE 2J7KA 4JI2I 4JI0E 2ZITA 1MG7A 4DR1E 4NXMI 1H73A 5GMEA 1Z5CA 1Z0WA 4JYAE 4DU8A 3ZKDA 3ZZ0A 1IBKE 4DV5E 3T1YE 4R1FA 1FI4A 3T1HI 1IBLE 4GKJI 3D4JA 2BV3A 2UU9E 4K0KI 2V34A 1Z5BA 4LFCI 1XNRI 2E5LE 4B3MI 4JI5I 3WU4A 4DV6E 2ZBKB 3J7AG 2R42A 4DPYA 1Z0EA 5FLXQ 1EI1A 2HFSA 2UUBE 1NHJA 4DR5E 4LF6E 4HACB 4DR4E 4NXNI 5LMNI 2HFUA 1H7UA 4JI0I 5IT9Q 4DV2E 4DR1I 1N33E 2XEXA 4YY3E 1VISA 4JYAI 1IBKI 4DV5I 3T1YI 1FWLA 5A2QQ 1Z0CA 1BKNA 5LL6R 1IBLI 4X65E 2UU9I 4PRXA 1Z59A 1Z5AA 2E5LI 3PYEA 2EFGA 4DV6I 3V2UC 2R3VA 1PKPA 2HKJA 4LF7E 1KTVA 3WU5A 3PYFA 1OJ4A 1EA6A 2UUBI 4AQYI 4LF6I 4DR5I 1PIEA 5FLXC 4DR4I 4LFBE 4HXZA 2VQFE 2VF3A 1I94E 4B3RE 4DV2I 4MYUA 3V5RA 1N33I 4YY3I 1B63A 4RPFA 1S16A 2WW4A 4JI4E 4DUZE 5A2QC 3H4LA 4X65I 4JI7E 1N0UA 1XMQE 4DR2E 5LMUE 4LF7I 3K17A 4DPXA 1N36E 2V2VA 4X66E 1HNZE 1XMOE 2A2CA 1HR0E 4LFBI 2VQFI 1I94I 4B3RI 4LF5E 1IBME 2OI2A 4DR7E 3OTOE 2HK3A 3B78A 4YHHE 4JI4I 2VQEE 2V8PA 5L3JA 4DUZI 4P7AA 1MU5A 4JI7I 1XMQI 2NPFA 1FJGE 1UEKA 4DR2I 4AQYE 4DV0E 4X62E 5BR8E 2Q2EB 5LMUI 2X36A 1ZM3A 4FWDA 1N36I 3JAMQ 4B3SE 1XHKA 4X66I 1HNZI 1XMOI 2V2ZA 4ZVIA 1N32E 1HR0I 2AJ4A 4LF5I 1RR9A 1U2RA 1IBMI 2HK2A 4DR7I 1Z0GA 3OTOI 4EMDA 4YHHI 2VQEI 3QT8A 4LF9E 4LFAE 1RREA 4JI3E 3ZZUA 1NZ0A 4DUYE 3CWVA 2UXDE 1ZM9A 2UUCE 1FJGI 2UXBE 4DV3E 4DV0I 4X62I 5BR8I
chains in the Genus database with same CATH superfamily
2O1WA 4LCHA 3PRYA 1KVKA 1MX0A 4JI8E 2JEBA 5K36D 4IFDF 3LPSA 5DRQA 3M6AA 4B3SI 2Z5EA 1ZXNA 4OX9E 1N32I 2PNZB 4BA1A 3JAMC 3P76A 5ELWA 4KHPE 1OYRA 2BA1D 4IFDC 4IFDB 2DEIA 2UXCE 4FWHA 4USKA 2NN6E 1KIJA 2HKEA 4ISAA 4DXLA 4LF9I 4LFAI 1USVA 5JEAF 4B3TE 3J7AM 4JI3I 4URLA 5JEAE 4DUYI 4JI6E 1ELOA 2DEJA 4ED4A 1QZRA 4AM3A 2UXDI 4P52A 1E3PA 3ZZTA 2UUCI 4Z7YA 2UXBI 4X64E 4DV3I 4LF4E 4QNJA 4OO1A 4UT4A 4LOMA 3GMEA 5JEAB 4WUCA 4DR6E 2WP8A 1KKHA 5C0XE 2Z5BA 4DV4E 4UTGA 4JI8I 3J81C 4U3BA 1HNXE 4JI1E 2A2DA 2CG9A 3QT6A 4MYTA 2X7IA 2WNRA 4FW5A 3B8HA 1H74A 5IWAE 4OX9I 2UUAE 2CZ9A 4FN5A 2BM1A 3B82A 5C0XB 1XNQE 3GONA 1FKAE 4HY1A 4IZJA 3ZKBA 4JV5E 3M85G 2F4VE 4KHPI 1DARA 4DR3E 2UXCI 1N34E 1PVGA 4FW4A 1HNWE 2V2QA 3Q1QA 4FW9A 2C39A 4FW3A 3UHMA 4PU9A 4DU7A 4IFDD 4B3TI 2GS8A 1K47A 1Y5YA 4DPTA 4JI6I 4Z7CA 3J80C 1FWKA 1J5EE 4GKKE 4X64I 4PRVA 4I3HA 4LF4I 1Y6ZA 4DR6I 3PYDA 4DV7E 1D6TA 4DV4I 4M1KA 2JT2A 2GO4A 1USUA 1HNXI 4JI1I 5JEAD 4HYMA 4JG4A 3P06A 4XTJA 5IWAI 4HACA 2UUAI 4DPUA 1XXEA 1XNQI 2JEAA 2O1TA 4IZKA 2HHHE 4LF8E 1OYSA 1Z0TA 1B62A 4WUDA 5EL9A 4KQVA 2IOPA 2JEBB 2F4VI 3Q6MA 1WUUA 5C0XD 4FW6A 1Z0BA 3WU3A 4DV1E 1FNMA 4DR3I 1N34I 1S4EA 1HNWI 3F0NA 4AIDA 3WU6A 2ZM6E 5GMDA 3J81Q 1A6FA 4JI2E 4JV5I 2PO0A 4NXME 3ZM7A 2BR2B 2C37A 3HULA 1N0VC 4IFDE 3PYGA 1J5EI 4GKKI 2LJPA 3LTOA 2CVEA 3K1JA 3P3EA 4MDTA 3T1HE 4DV7I 4GKJE 1ZXMA 3QT5A 2BA0G 4K0KE 2GO3A 3PS3A 3LNUA 5IT9C 4LFCE 1NHIA 4MU0A 1XNRE 4FWGA 4OO1C 4B3ME 4MQYA 4JI5E 3J80Q 1YHCA 1H7SA 1OYPA 2HHHI 4LF8I 2Z5BB 1H72C 4OZEA 2C38A 4DPWA 1NHHA 1ZM4A 5DRPA 4DV1I 2E1RA 3H1CA 1ZM2A 5DRRA 3QT7A 2WNRB 1Z0VA 4WUBA 2BM0A 2ZM6I 5FWKA 4NXNE 4USMA 5LMNE 2J7KA 2F1DA 4JI2I 4JI0E 4IZJB 2ZITA 1MG7A 4DR1E 4NXMI 4LPFA 1H73A 1UDNA 5GMEA 4BA2A 1Z5CA 1UDQA 1Z0WA 4JYAE 2Z5CA 4DU8A 2GQ0A 3ZKDA 3ZZ0A 2C39B 1IBKE 4DV5E 3GLLA 3T1YE 4R1FA 1FI4A 3T1HI 1IBLE 4GKJI 3D4JA 1HK7A 2BV3A 2UU9E 4K0KI 2NN6A 1UDOA 2V34A 1Z5BA 4LFCI 2PNLA 1XNRI 2E5LE 4B3MI 4JI5I 3WU4A 4DV6E 2BA0D 3L7ZB 3U1YA 2ZBKB 3J7AG 2R42A 4DPYA 1Z0EA 3KRNA 5FLXQ 1EI1A 2HFSA 4N3OA 2UUBE 1NHJA 4DR5E 4LF6E 4HACB 4DR4E 5K36C 2JE6B 4NXNI 5C0XA 5LMNI 2HFUA 2JEAB 1H7UA 4IZKB 4MU3A 4JI0I 5IT9Q 4DV2E 4DR1I 3K85A 1N33E 2XEXA 4J3DA 4YY3E 1VISA 4JYAI 4IZJD 5K36A 1IBKI 4DV5I 3T1YI 1FWLA 5A2QQ 1Z0CA 1BKNA 3DD6A 5LL6R 1IBLI 4X65E 2UU9I 4PRXA 1Z59A 1Z5AA 2PO0B 2IERA 3PS2A 2C37B 3Q6NA 3P3CA 2PO1A 2E5LI 3CDIA 3PYEA 4BA1B 2EFGA 4DV6I 3V2UC 2R3VA 1PKPA 3M85D 2HKJA 4LF7E 1KTVA 3WU5A 3PYFA 2PO2A 1OJ4A 1EA6A 2IOQA 3HJCA 4OO1F 2UUBI 4GQUA 4AQYI 4LF6I 4DR5I 3HKMA 1PIEA 5FLXC 4DR4I 2AE8A 4LFBE 4OO1E 4AIMA 4HXZA 2VQFE 2VF3A 1I94E 4B3RE 4DV2I 3B4TA 4MYUA 3V5RA 1N33I 2C38B 2O1VA 4YY3I 1B63A 4RPFA 1S16A 2WW4A 4JI4E 4OO1B 4QNKA 4MU4A 2WP8B 4DUZE 4FW7A 5A2QC 3H4LA 4X65I 4JI7E 1N0UA 1XMQE 2BR2A 2NN6F 4BA2B 4DR2E 2Z5CB 2PNZA 3NZKA 1VI7A 5LMUE 4LF7I 4IFDA 4LCGA 3K17A 4DPXA 2O1UA 2NN6C 2NN6B 1N36E 1R6MA 3U1KA 2V2VA 1RHYA 4X66E 1HNZE 1XMOE 2A2CA 3M7NG 5JEAC 1HR0E 4LFBI 5C0XF 2VQFI 1I94I 4B3RI 1P42A 4LCFA 4LF5E 1IBME 2OI2A 4DR7E 5DNXA 4MU1A 3OTOE 2HK3A 3B78A 4YHHE 4JI4I 2VQEE 5EKWA 5JEAA 4U3DA 2V8PA 5K36F 5L3JA 5C0XC 4DUZI 1YH8A 4P7AA 5K36E 1MU5A 4OO1D 4JI7I 1UDSA 1XMQI 2NPFA 1FJGE 2O3ZA 1UEKA 4DR2I 4AQYE 1R6LA 4DV0E 4X62E 5BR8E 5K36B 3PS1A 5DROA 2VESA 2PNMA 1Y4SA 2Q2EB 1Y4UA 5LMUI 3GCMA 2BA1G 2X36A 4NBQA 1ZM3A 1Y60A 4FWDA 1N36I 2J65A 3JAMQ 4B3SE 1XHKA 2PO1B 4X66I 1HNZI 1XMOI 2V2ZA 4ZVIA 1N32E 1HR0I 2NN6D 1E3HA 2AJ4A 5DNLA 2CGEA 3L7ZA 4IS9A 4LF5I 1RR9A 1U2RA 1IBMI 2HK2A 4DR7I 2PO2B 1Z0GA 3OTOI 4EMDA 4YHHI 2VQEI 3QT8A 4LF9E 4LFAE 3M7ND 1RREA 2JE6A 4JI3E 2IESA 3ZZUA 1NZ0A 3CDJA 4DUYE 3P3GA 3CWVA 2UXDE 1ZM9A 2UUCE 1FJGI 2UXBE 4DV3E 4DV0I 4X62I 4OKGA 5BR8I
chains in the Genus database with same CATH topology
2O1WA 3PRYA 1KVKA 1MX0A 4JI8E 3LPSA 3M6AA 4B3SI 2Z5EA 1ZXNA 4OX9E 1N32I 3JAMC 4KHPE 2DEIA 2UXCE 4FWHA 4USKA 1KIJA 2HKEA 4DXLA 4LF9I 4LFAI 1USVA 4B3TE 3J7AM 4JI3I 4URLA 4DUYI 4JI6E 1ELOA 2DEJA 4ED4A 1QZRA 2UXDI 4P52A 3ZZTA 2UUCI 4Z7YA 2UXBI 4X64E 4DV3I 4LF4E 4UT4A 4WUCA 4DR6E 1KKHA 2Z5BA 4DV4E 4UTGA 4JI8I 3J81C 1HNXE 4JI1E 2A2DA 2CG9A 3QT6A 4MYTA 2X7IA 3B8HA 1H74A 5IWAE 4OX9I 2UUAE 2CZ9A 4FN5A 2BM1A 3B82A 1XNQE 3GONA 1FKAE 4HY1A 4IZJA 3ZKBA 4JV5E 2F4VE 4KHPI 1DARA 4DR3E 2UXCI 1N34E 1PVGA 1HNWE 2V2QA 3Q1QA 4FW9A 4PU9A 4DU7A 4B3TI 2GS8A 1K47A 4DPTA 4JI6I 4Z7CA 3J80C 1FWKA 1J5EE 4GKKE 4X64I 4PRVA 4I3HA 4LF4I 1Y6ZA 4DR6I 3PYDA 4DV7E 1D6TA 4DV4I 4M1KA 1USUA 1HNXI 4JI1I 4HYMA 4JG4A 3P06A 4XTJA 5IWAI 4HACA 2UUAI 4DPUA 1XNQI 2O1TA 4IZKA 2HHHE 4LF8E 4JV5I 1Z0TA 1B62A 4WUDA 2F4VI 4KQVA 2IOPA 3Q6MA 1WUUA 1Z0BA 3WU3A 4DV1E 1FNMA 4DR3I 1N34I 1S4EA 1HNWI 3F0NA 3WU6A 2ZM6E 5GMDA 3J81Q 1A6FA 4JI2E 4NXME 3ZM7A 3HULA 1N0VC 3PYGA 1J5EI 4GKKI 2LJPA 3LTOA 3K1JA 3T1HE 4GKJE 4DV7I 1ZXMA 3QT5A 4K0KE 3LNUA 5IT9C 4LFCE 1NHIA 1XNRE 4FWGA 4B3ME 4JI5E 3J80Q 1H7SA 2HHHI 4LF8I 2Z5BB 1H72C 4DPWA 1NHHA 1ZM4A 4DV1I 2E1RA 1ZM2A 3QT7A 1Z0VA 4WUBA 2BM0A 2ZM6I 5FWKA 4NXNE 4USMA 5LMNE 2J7KA 4JI2I 4JI0E 4IZJB 2ZITA 1MG7A 4DR1E 4NXMI 1H73A 5GMEA 1Z5CA 1Z0WA 4JYAE 2Z5CA 4DU8A 2GQ0A 3ZKDA 3ZZ0A 1IBKE 4DV5E 3T1YE 4R1FA 1FI4A 3T1HI 1IBLE 4GKJI 3D4JA 1HK7A 2BV3A 2UU9E 4K0KI 2V34A 1Z5BA 4LFCI 2PNLA 1XNRI 2E5LE 4B3MI 4JI5I 3WU4A 4DV6E 2ZBKB 3J7AG 2R42A 4DPYA 1Z0EA 5FLXQ 1EI1A 2HFSA 4N3OA 2UUBE 1NHJA 4DR5E 4LF6E 4HACB 4DR4E 4NXNI 5LMNI 2HFUA 1H7UA 4IZKB 4JI0I 5IT9Q 4DV2E 4DR1I 3K85A 1N33E 2XEXA 4YY3E 1VISA 4JYAI 4IZJD 1IBKI 4DV5I 3T1YI 1FWLA 5A2QQ 1Z0CA 1BKNA 5LL6R 1IBLI 4X65E 2UU9I 4PRXA 1Z59A 1Z5AA 3Q6NA 2E5LI 3PYEA 2EFGA 4DV6I 3V2UC 2R3VA 1PKPA 2HKJA 4LF7E 1KTVA 3WU5A 3PYFA 1OJ4A 1EA6A 2IOQA 3HJCA 2UUBI 4AQYI 4LF6I 4DR5I 1PIEA 5FLXC 4DR4I 4LFBE 4HXZA 2VQFE 2VF3A 1I94E 4B3RE 4DV2I 4MYUA 3V5RA 1N33I 2O1VA 4YY3I 1B63A 4RPFA 1S16A 2WW4A 4JI4E 4DUZE 5A2QC 3H4LA 4X65I 4JI7E 1N0UA 1XMQE 4DR2E 2Z5CB 5LMUE 4LF7I 3K17A 4DPXA 2O1UA 1N36E 2V2VA 4X66E 1HNZE 1XMOE 2A2CA 1HR0E 4LFBI 2VQFI 1I94I 4B3RI 4LF5E 1IBME 2OI2A 4DR7E 3OTOE 2HK3A 3B78A 4YHHE 4JI4I 2VQEE 2V8PA 5L3JA 4DUZI 4P7AA 1MU5A 4JI7I 1XMQI 2NPFA 1FJGE 1UEKA 4DR2I 4AQYE 4DV0E 4X62E 5BR8E 2PNMA 1Y4SA 2Q2EB 1Y4UA 5LMUI 2X36A 1ZM3A 4FWDA 1N36I 3JAMQ 4B3SE 1XHKA 4X66I 1HNZI 1XMOI 2V2ZA 4ZVIA 1N32E 1HR0I 2AJ4A 2CGEA 4LF5I 1RR9A 1U2RA 1IBMI 2HK2A 4DR7I 1Z0GA 3OTOI 4EMDA 4YHHI 2VQEI 3QT8A 4LF9E 4LFAE 1RREA 4JI3E 3ZZUA 1NZ0A 4DUYE 3CWVA 2UXDE 1ZM9A 2UUCE 1FJGI 2UXBE 4DV3E 4DV0I 4X62I 5BR8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVK A;  1MX0 A;  4JI8 E;  3LPS A;  3M6A A;  4B3S I;  1ZXN A;  4OX9 E;  1N32 I;  3JAM C;  4KHP E;  2DEI A;  2UXC E;  4FWH A;  4USK A;  1KIJ A;  2HKE A;  4DXL A;  4LF9 I;  4LFA I;  4B3T E;  3J7A M;  4JI3 I;  4URL A;  4DUY I;  4JI6 E;  1ELO A;  2DEJ A;  4ED4 A;  1QZR A;  2UXD I;  4P52 A;  3ZZT A;  2UUC I;  4Z7Y A;  2UXB I;  4X64 E;  4DV3 I;  4LF4 E;  4UT4 A;  4WUC A;  4DR6 E;  1KKH A;  4DV4 E;  4UTG A;  4JI8 I;  3J81 C;  1HNX E;  4JI1 E;  2A2D A;  3QT6 A;  4MYT A;  2X7I A;  3B8H A;  1H74 A;  5IWA E;  4OX9 I;  2UUA E;  2CZ9 A;  4FN5 A;  2BM1 A;  3B82 A;  1XNQ E;  3GON A;  1FKA E;  4HY1 A;  3ZKB A;  4JV5 E;  2F4V E;  4KHP I;  1DAR A;  4DR3 E;  2UXC I;  1N34 E;  1PVG A;  1HNW E;  2V2Q A;  3Q1Q A;  4FW9 A;  4PU9 A;  4DU7 A;  4B3T I;  2GS8 A;  1K47 A;  4DPT A;  4JI6 I;  4Z7C A;  3J80 C;  1FWK A;  1J5E E;  4GKK E;  4X64 I;  4PRV A;  4I3H A;  4LF4 I;  4DR6 I;  3PYD A;  4DV7 E;  1D6T A;  4DV4 I;  4M1K A;  1HNX I;  4JI1 I;  4HYM A;  4JG4 A;  4XTJ A;  5IWA I;  4HAC A;  2UUA I;  4DPU A;  1XNQ I;  2HHH E;  4LF8 E;  4JV5 I;  1Z0T A;  1B62 A;  4WUD A;  2F4V I;  4KQV A;  1WUU A;  1Z0B A;  3WU3 A;  4DV1 E;  1FNM A;  4DR3 I;  1N34 I;  1S4E A;  1HNW I;  3F0N A;  3WU6 A;  2ZM6 E;  5GMD A;  3J81 Q;  1A6F A;  4JI2 E;  4NXM E;  3ZM7 A;  3HUL A;  1N0V C;  3PYG A;  1J5E I;  4GKK I;  2LJP A;  3LTO A;  3K1J A;  3T1H E;  4GKJ E;  4DV7 I;  1ZXM A;  3QT5 A;  4K0K E;  3LNU A;  5IT9 C;  4LFC E;  1NHI A;  1XNR E;  4FWG A;  4B3M E;  4JI5 E;  3J80 Q;  1H7S A;  2HHH I;  4LF8 I;  1H72 C;  4DPW A;  1NHH A;  1ZM4 A;  4DV1 I;  2E1R A;  1ZM2 A;  3QT7 A;  1Z0V A;  4WUB A;  2BM0 A;  2ZM6 I;  4NXN E;  4USM A;  5LMN E;  2J7K A;  4JI2 I;  4JI0 E;  2ZIT A;  1MG7 A;  4DR1 E;  4NXM I;  1H73 A;  5GME A;  1Z5C A;  1Z0W A;  4JYA E;  4DU8 A;  3ZKD A;  3ZZ0 A;  1IBK E;  4DV5 E;  3T1Y E;  4R1F A;  1FI4 A;  3T1H I;  1IBL E;  4GKJ I;  3D4J A;  2BV3 A;  2UU9 E;  4K0K I;  2V34 A;  1Z5B A;  4LFC I;  1XNR I;  2E5L E;  4B3M I;  4JI5 I;  3WU4 A;  4DV6 E;  2ZBK B;  3J7A G;  2R42 A;  4DPY A;  1Z0E A;  5FLX Q;  1EI1 A;  2HFS A;  2UUB E;  1NHJ A;  4DR5 E;  4LF6 E;  4HAC B;  4DR4 E;  4NXN I;  5LMN I;  2HFU A;  1H7U A;  4JI0 I;  5IT9 Q;  4DV2 E;  4DR1 I;  1N33 E;  2XEX A;  4YY3 E;  1VIS A;  4JYA I;  1IBK I;  4DV5 I;  3T1Y I;  1FWL A;  5A2Q Q;  1Z0C A;  1BKN A;  5LL6 R;  1IBL I;  4X65 E;  2UU9 I;  4PRX A;  1Z59 A;  1Z5A A;  2E5L I;  3PYE A;  2EFG A;  4DV6 I;  3V2U C;  2R3V A;  1PKP A;  2HKJ A;  4LF7 E;  1KTV A;  3WU5 A;  3PYF A;  1OJ4 A;  1EA6 A;  2UUB I;  4AQY I;  4LF6 I;  4DR5 I;  1PIE A;  5FLX C;  4DR4 I;  4LFB E;  4HXZ A;  2VQF E;  2VF3 A;  1I94 E;  4B3R E;  4DV2 I;  4MYU A;  3V5R A;  1N33 I;  4YY3 I;  1B63 A;  4RPF A;  1S16 A;  2WW4 A;  4JI4 E;  4DUZ E;  5A2Q C;  3H4L A;  4X65 I;  4JI7 E;  1N0U A;  1XMQ E;  4DR2 E;  5LMU E;  4LF7 I;  3K17 A;  4DPX A;  1N36 E;  2V2V A;  4X66 E;  1HNZ E;  1XMO E;  2A2C A;  1HR0 E;  4LFB I;  2VQF I;  1I94 I;  4B3R I;  4LF5 E;  1IBM E;  2OI2 A;  4DR7 E;  3OTO E;  2HK3 A;  3B78 A;  4YHH E;  4JI4 I;  2VQE E;  2V8P A;  5L3J A;  4DUZ I;  4P7A A;  1MU5 A;  4JI7 I;  1XMQ I;  2NPF A;  1FJG E;  1UEK A;  4DR2 I;  4AQY E;  4DV0 E;  4X62 E;  5BR8 E;  2Q2E B;  5LMU I;  2X36 A;  1ZM3 A;  4FWD A;  1N36 I;  3JAM Q;  4B3S E;  1XHK A;  4X66 I;  1HNZ I;  1XMO I;  2V2Z A;  4ZVI A;  1N32 E;  1HR0 I;  2AJ4 A;  4LF5 I;  1RR9 A;  1U2R A;  1IBM I;  2HK2 A;  4DR7 I;  1Z0G A;  3OTO I;  4EMD A;  4YHH I;  2VQE I;  3QT8 A;  4LF9 E;  4LFA E;  1RRE A;  4JI3 E;  3ZZU A;  1NZ0 A;  4DUY E;  3CWV A;  2UXD E;  1ZM9 A;  2UUC E;  1FJG I;  2UXB E;  4DV3 E;  4DV0 I;  4X62 I;  5BR8 I; 
#chains in the Genus database with same CATH topology
 2O1W A;  4LCH A;  3PRY A;  1KVK A;  1MX0 A;  4JI8 E;  2JEB A;  5K36 D;  4IFD F;  3LPS A;  5DRQ A;  3M6A A;  4B3S I;  2Z5E A;  1ZXN A;  4OX9 E;  1N32 I;  2PNZ B;  4BA1 A;  3JAM C;  3P76 A;  5ELW A;  4KHP E;  1OYR A;  2BA1 D;  4IFD C;  4IFD B;  2DEI A;  2UXC E;  4FWH A;  4USK A;  2NN6 E;  1KIJ A;  2HKE A;  4ISA A;  4DXL A;  4LF9 I;  4LFA I;  1USV A;  5JEA F;  4B3T E;  3J7A M;  4JI3 I;  4URL A;  5JEA E;  4DUY I;  4JI6 E;  1ELO A;  2DEJ A;  4ED4 A;  1QZR A;  4AM3 A;  2UXD I;  4P52 A;  1E3P A;  3ZZT A;  2UUC I;  4Z7Y A;  2UXB I;  4X64 E;  4DV3 I;  4LF4 E;  4QNJ A;  4OO1 A;  4UT4 A;  4LOM A;  3GME A;  5JEA B;  4WUC A;  4DR6 E;  2WP8 A;  1KKH A;  5C0X E;  2Z5B A;  4DV4 E;  4UTG A;  4JI8 I;  3J81 C;  4U3B A;  1HNX E;  4JI1 E;  2A2D A;  2CG9 A;  3QT6 A;  4MYT A;  2X7I A;  2WNR A;  4FW5 A;  3B8H A;  1H74 A;  5IWA E;  4OX9 I;  2UUA E;  2CZ9 A;  4FN5 A;  2BM1 A;  3B82 A;  5C0X B;  1XNQ E;  3GON A;  1FKA E;  4HY1 A;  4IZJ A;  3ZKB A;  4JV5 E;  3M85 G;  2F4V E;  4KHP I;  1DAR A;  4DR3 E;  2UXC I;  1N34 E;  1PVG A;  4FW4 A;  1HNW E;  2V2Q A;  3Q1Q A;  4FW9 A;  2C39 A;  4FW3 A;  3UHM A;  4PU9 A;  4DU7 A;  4IFD D;  4B3T I;  2GS8 A;  1K47 A;  1Y5Y A;  4DPT A;  4JI6 I;  4Z7C A;  3J80 C;  1FWK A;  1J5E E;  4GKK E;  4X64 I;  4PRV A;  4I3H A;  4LF4 I;  1Y6Z A;  4DR6 I;  3PYD A;  4DV7 E;  1D6T A;  4DV4 I;  4M1K A;  2JT2 A;  2GO4 A;  1USU A;  1HNX I;  4JI1 I;  5JEA D;  4HYM A;  4JG4 A;  3P06 A;  4XTJ A;  5IWA I;  4HAC A;  2UUA I;  4DPU A;  1XXE A;  1XNQ I;  2JEA A;  2O1T A;  4IZK A;  2HHH E;  4LF8 E;  1OYS A;  1Z0T A;  1B62 A;  4WUD A;  5EL9 A;  4KQV A;  2IOP A;  2JEB B;  2F4V I;  3Q6M A;  1WUU A;  5C0X D;  4FW6 A;  1Z0B A;  3WU3 A;  4DV1 E;  1FNM A;  4DR3 I;  1N34 I;  1S4E A;  1HNW I;  3F0N A;  4AID A;  3WU6 A;  2ZM6 E;  5GMD A;  3J81 Q;  1A6F A;  4JI2 E;  4JV5 I;  2PO0 A;  4NXM E;  3ZM7 A;  2BR2 B;  2C37 A;  3HUL A;  1N0V C;  4IFD E;  3PYG A;  1J5E I;  4GKK I;  2LJP A;  3LTO A;  2CVE A;  3K1J A;  3P3E A;  4MDT A;  3T1H E;  4DV7 I;  4GKJ E;  1ZXM A;  3QT5 A;  2BA0 G;  4K0K E;  2GO3 A;  3PS3 A;  3LNU A;  5IT9 C;  4LFC E;  1NHI A;  4MU0 A;  1XNR E;  4FWG A;  4OO1 C;  4B3M E;  4MQY A;  4JI5 E;  3J80 Q;  1YHC A;  1H7S A;  1OYP A;  2HHH I;  4LF8 I;  2Z5B B;  1H72 C;  4OZE A;  2C38 A;  4DPW A;  1NHH A;  1ZM4 A;  5DRP A;  4DV1 I;  2E1R A;  3H1C A;  1ZM2 A;  5DRR A;  3QT7 A;  2WNR B;  1Z0V A;  4WUB A;  2BM0 A;  2ZM6 I;  5FWK A;  4NXN E;  4USM A;  5LMN E;  2J7K A;  2F1D A;  4JI2 I;  4JI0 E;  4IZJ B;  2ZIT A;  1MG7 A;  4DR1 E;  4NXM I;  4LPF A;  1H73 A;  1UDN A;  5GME A;  4BA2 A;  1Z5C A;  1UDQ A;  1Z0W A;  4JYA E;  2Z5C A;  4DU8 A;  2GQ0 A;  3ZKD A;  3ZZ0 A;  2C39 B;  1IBK E;  4DV5 E;  3GLL A;  3T1Y E;  4R1F A;  1FI4 A;  3T1H I;  1IBL E;  4GKJ I;  3D4J A;  1HK7 A;  2BV3 A;  2UU9 E;  4K0K I;  2NN6 A;  1UDO A;  2V34 A;  1Z5B A;  4LFC I;  2PNL A;  1XNR I;  2E5L E;  4B3M I;  4JI5 I;  3WU4 A;  4DV6 E;  2BA0 D;  3L7Z B;  3U1Y A;  2ZBK B;  3J7A G;  2R42 A;  4DPY A;  1Z0E A;  3KRN A;  5FLX Q;  1EI1 A;  2HFS A;  4N3O A;  2UUB E;  1NHJ A;  4DR5 E;  4LF6 E;  4HAC B;  4DR4 E;  5K36 C;  2JE6 B;  4NXN I;  5C0X A;  5LMN I;  2HFU A;  2JEA B;  1H7U A;  4IZK B;  4MU3 A;  4JI0 I;  5IT9 Q;  4DV2 E;  4DR1 I;  3K85 A;  1N33 E;  2XEX A;  4J3D A;  4YY3 E;  1VIS A;  4JYA I;  4IZJ D;  5K36 A;  1IBK I;  4DV5 I;  3T1Y I;  1FWL A;  5A2Q Q;  1Z0C A;  1BKN A;  3DD6 A;  5LL6 R;  1IBL I;  4X65 E;  2UU9 I;  4PRX A;  1Z59 A;  1Z5A A;  2PO0 B;  2IER A;  3PS2 A;  2C37 B;  3Q6N A;  3P3C A;  2PO1 A;  2E5L I;  3CDI A;  3PYE A;  4BA1 B;  2EFG A;  4DV6 I;  3V2U C;  2R3V A;  1PKP A;  3M85 D;  2HKJ A;  4LF7 E;  1KTV A;  3WU5 A;  3PYF A;  2PO2 A;  1OJ4 A;  1EA6 A;  2IOQ A;  3HJC A;  4OO1 F;  2UUB I;  4GQU A;  4AQY I;  4LF6 I;  4DR5 I;  3HKM A;  1PIE A;  5FLX C;  4DR4 I;  2AE8 A;  4LFB E;  4OO1 E;  4AIM A;  4HXZ A;  2VQF E;  2VF3 A;  1I94 E;  4B3R E;  4DV2 I;  3B4T A;  4MYU A;  3V5R A;  1N33 I;  2C38 B;  2O1V A;  4YY3 I;  1B63 A;  4RPF A;  1S16 A;  2WW4 A;  4JI4 E;  4OO1 B;  4QNK A;  4MU4 A;  2WP8 B;  4DUZ E;  4FW7 A;  5A2Q C;  3H4L A;  4X65 I;  4JI7 E;  1N0U A;  1XMQ E;  2BR2 A;  2NN6 F;  4BA2 B;  4DR2 E;  2Z5C B;  2PNZ A;  3NZK A;  1VI7 A;  5LMU E;  4LF7 I;  4IFD A;  4LCG A;  3K17 A;  4DPX A;  2O1U A;  2NN6 C;  2NN6 B;  1N36 E;  1R6M A;  3U1K A;  2V2V A;  1RHY A;  4X66 E;  1HNZ E;  1XMO E;  2A2C A;  3M7N G;  5JEA C;  1HR0 E;  4LFB I;  5C0X F;  2VQF I;  1I94 I;  4B3R I;  1P42 A;  4LCF A;  4LF5 E;  1IBM E;  2OI2 A;  4DR7 E;  5DNX A;  4MU1 A;  3OTO E;  2HK3 A;  3B78 A;  4YHH E;  4JI4 I;  2VQE E;  5EKW A;  5JEA A;  4U3D A;  2V8P A;  5K36 F;  5L3J A;  5C0X C;  4DUZ I;  1YH8 A;  4P7A A;  5K36 E;  1MU5 A;  4OO1 D;  4JI7 I;  1UDS A;  1XMQ I;  2NPF A;  1FJG E;  2O3Z A;  1UEK A;  4DR2 I;  4AQY E;  1R6L A;  4DV0 E;  4X62 E;  5BR8 E;  5K36 B;  3PS1 A;  5DRO A;  2VES A;  2PNM A;  1Y4S A;  2Q2E B;  1Y4U A;  5LMU I;  3GCM A;  2BA1 G;  2X36 A;  4NBQ A;  1ZM3 A;  1Y60 A;  4FWD A;  1N36 I;  2J65 A;  3JAM Q;  4B3S E;  1XHK A;  2PO1 B;  4X66 I;  1HNZ I;  1XMO I;  2V2Z A;  4ZVI A;  1N32 E;  1HR0 I;  2NN6 D;  1E3H A;  2AJ4 A;  5DNL A;  2CGE A;  3L7Z A;  4IS9 A;  4LF5 I;  1RR9 A;  1U2R A;  1IBM I;  2HK2 A;  4DR7 I;  2PO2 B;  1Z0G A;  3OTO I;  4EMD A;  4YHH I;  2VQE I;  3QT8 A;  4LF9 E;  4LFA E;  3M7N D;  1RRE A;  2JE6 A;  4JI3 E;  2IES A;  3ZZU A;  1NZ0 A;  3CDJ A;  4DUY E;  3P3G A;  3CWV A;  2UXD E;  1ZM9 A;  2UUC E;  1FJG I;  2UXB E;  4DV3 E;  4DV0 I;  4X62 I;  4OKG A;  5BR8 I; 
#chains in the Genus database with same CATH homology
 2O1W A;  3PRY A;  1KVK A;  1MX0 A;  4JI8 E;  3LPS A;  3M6A A;  4B3S I;  2Z5E A;  1ZXN A;  4OX9 E;  1N32 I;  3JAM C;  4KHP E;  2DEI A;  2UXC E;  4FWH A;  4USK A;  1KIJ A;  2HKE A;  4DXL A;  4LF9 I;  4LFA I;  1USV A;  4B3T E;  3J7A M;  4JI3 I;  4URL A;  4DUY I;  4JI6 E;  1ELO A;  2DEJ A;  4ED4 A;  1QZR A;  2UXD I;  4P52 A;  3ZZT A;  2UUC I;  4Z7Y A;  2UXB I;  4X64 E;  4DV3 I;  4LF4 E;  4UT4 A;  4WUC A;  4DR6 E;  1KKH A;  2Z5B A;  4DV4 E;  4UTG A;  4JI8 I;  3J81 C;  1HNX E;  4JI1 E;  2A2D A;  2CG9 A;  3QT6 A;  4MYT A;  2X7I A;  3B8H A;  1H74 A;  5IWA E;  4OX9 I;  2UUA E;  2CZ9 A;  4FN5 A;  2BM1 A;  3B82 A;  1XNQ E;  3GON A;  1FKA E;  4HY1 A;  4IZJ A;  3ZKB A;  4JV5 E;  2F4V E;  4KHP I;  1DAR A;  4DR3 E;  2UXC I;  1N34 E;  1PVG A;  1HNW E;  2V2Q A;  3Q1Q A;  4FW9 A;  4PU9 A;  4DU7 A;  4B3T I;  2GS8 A;  1K47 A;  4DPT A;  4JI6 I;  4Z7C A;  3J80 C;  1FWK A;  1J5E E;  4GKK E;  4X64 I;  4PRV A;  4I3H A;  4LF4 I;  1Y6Z A;  4DR6 I;  3PYD A;  4DV7 E;  1D6T A;  4DV4 I;  4M1K A;  1USU A;  1HNX I;  4JI1 I;  4HYM A;  4JG4 A;  3P06 A;  4XTJ A;  5IWA I;  4HAC A;  2UUA I;  4DPU A;  1XNQ I;  2O1T A;  4IZK A;  2HHH E;  4LF8 E;  4JV5 I;  1Z0T A;  1B62 A;  4WUD A;  2F4V I;  4KQV A;  2IOP A;  3Q6M A;  1WUU A;  1Z0B A;  3WU3 A;  4DV1 E;  1FNM A;  4DR3 I;  1N34 I;  1S4E A;  1HNW I;  3F0N A;  3WU6 A;  2ZM6 E;  5GMD A;  3J81 Q;  1A6F A;  4JI2 E;  4NXM E;  3ZM7 A;  3HUL A;  1N0V C;  3PYG A;  1J5E I;  4GKK I;  2LJP A;  3LTO A;  3K1J A;  3T1H E;  4GKJ E;  4DV7 I;  1ZXM A;  3QT5 A;  4K0K E;  3LNU A;  5IT9 C;  4LFC E;  1NHI A;  1XNR E;  4FWG A;  4B3M E;  4JI5 E;  3J80 Q;  1H7S A;  2HHH I;  4LF8 I;  2Z5B B;  1H72 C;  4DPW A;  1NHH A;  1ZM4 A;  4DV1 I;  2E1R A;  1ZM2 A;  3QT7 A;  1Z0V A;  4WUB A;  2BM0 A;  2ZM6 I;  5FWK A;  4NXN E;  4USM A;  5LMN E;  2J7K A;  4JI2 I;  4JI0 E;  4IZJ B;  2ZIT A;  1MG7 A;  4DR1 E;  4NXM I;  1H73 A;  5GME A;  1Z5C A;  1Z0W A;  4JYA E;  2Z5C A;  4DU8 A;  2GQ0 A;  3ZKD A;  3ZZ0 A;  1IBK E;  4DV5 E;  3T1Y E;  4R1F A;  1FI4 A;  3T1H I;  1IBL E;  4GKJ I;  3D4J A;  1HK7 A;  2BV3 A;  2UU9 E;  4K0K I;  2V34 A;  1Z5B A;  4LFC I;  2PNL A;  1XNR I;  2E5L E;  4B3M I;  4JI5 I;  3WU4 A;  4DV6 E;  2ZBK B;  3J7A G;  2R42 A;  4DPY A;  1Z0E A;  5FLX Q;  1EI1 A;  2HFS A;  4N3O A;  2UUB E;  1NHJ A;  4DR5 E;  4LF6 E;  4HAC B;  4DR4 E;  4NXN I;  5LMN I;  2HFU A;  1H7U A;  4IZK B;  4JI0 I;  5IT9 Q;  4DV2 E;  4DR1 I;  3K85 A;  1N33 E;  2XEX A;  4YY3 E;  1VIS A;  4JYA I;  4IZJ D;  1IBK I;  4DV5 I;  3T1Y I;  1FWL A;  5A2Q Q;  1Z0C A;  1BKN A;  5LL6 R;  1IBL I;  4X65 E;  2UU9 I;  4PRX A;  1Z59 A;  1Z5A A;  3Q6N A;  2E5L I;  3PYE A;  2EFG A;  4DV6 I;  3V2U C;  2R3V A;  1PKP A;  2HKJ A;  4LF7 E;  1KTV A;  3WU5 A;  3PYF A;  1OJ4 A;  1EA6 A;  2IOQ A;  3HJC A;  2UUB I;  4AQY I;  4LF6 I;  4DR5 I;  1PIE A;  5FLX C;  4DR4 I;  4LFB E;  4HXZ A;  2VQF E;  2VF3 A;  1I94 E;  4B3R E;  4DV2 I;  4MYU A;  3V5R A;  1N33 I;  2O1V A;  4YY3 I;  1B63 A;  4RPF A;  1S16 A;  2WW4 A;  4JI4 E;  4DUZ E;  5A2Q C;  3H4L A;  4X65 I;  4JI7 E;  1N0U A;  1XMQ E;  4DR2 E;  2Z5C B;  5LMU E;  4LF7 I;  3K17 A;  4DPX A;  2O1U A;  1N36 E;  2V2V A;  4X66 E;  1HNZ E;  1XMO E;  2A2C A;  1HR0 E;  4LFB I;  2VQF I;  1I94 I;  4B3R I;  4LF5 E;  1IBM E;  2OI2 A;  4DR7 E;  3OTO E;  2HK3 A;  3B78 A;  4YHH E;  4JI4 I;  2VQE E;  2V8P A;  5L3J A;  4DUZ I;  4P7A A;  1MU5 A;  4JI7 I;  1XMQ I;  2NPF A;  1FJG E;  1UEK A;  4DR2 I;  4AQY E;  4DV0 E;  4X62 E;  5BR8 E;  2PNM A;  1Y4S A;  2Q2E B;  1Y4U A;  5LMU I;  2X36 A;  1ZM3 A;  4FWD A;  1N36 I;  3JAM Q;  4B3S E;  1XHK A;  4X66 I;  1HNZ I;  1XMO I;  2V2Z A;  4ZVI A;  1N32 E;  1HR0 I;  2AJ4 A;  2CGE A;  4LF5 I;  1RR9 A;  1U2R A;  1IBM I;  2HK2 A;  4DR7 I;  1Z0G A;  3OTO I;  4EMD A;  4YHH I;  2VQE I;  3QT8 A;  4LF9 E;  4LFA E;  1RRE A;  4JI3 E;  3ZZU A;  1NZ0 A;  4DUY E;  3CWV A;  2UXD E;  1ZM9 A;  2UUC E;  1FJG I;  2UXB E;  4DV3 E;  4DV0 I;  4X62 I;  5BR8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...