2C38A

Rnase ph core of the archaeal exosome in complex with a5 rna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
271
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 80
structure length 271
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c38A01
2C37B 3M85D 2PO2A 2PO2B 2C38B 5JEAC 3M7NG 2PO1B 3GMEA 3L7ZA 3L7ZB 4OO1E 3CDJA 4AM3A 2WP8A 2WP8B 5K36E 5K36F 1UDQA 4OO1D 1R6LA 3M7ND 4NBQA 3CDIA 4IFDD 2PNZA 2PNZB 4IFDB 2NN6A 5C0XE 2NN6B 2C37A 5JEAE 5JEAF 5C0XD 2C38A 3GCMA 2PO1A 1OYPA 1E3PA 1UDNA 4AIMA 5K36D 4OO1A 4OO1B 2JE6A 2JE6B 4IFDA 2JEAA 2JEAB 2BA1G 1UDSA 2BA0G 4BA2A 4BA2B 2C39A 2C39B 1R6MA 2JEBB 2JEBA 5C0XA 5C0XB 4OO1C 5JEAD 2NN6F 2WNRB 4IFDC 2BA1D 2NN6C 3M85G 3DD6A 1UDOA 2BR2A 2BR2B 2BA0D 3HKMA 4AIDA 1E3HA 1OYRA 5C0XC 5K36A 5K36B 2PO0A 2PO0B 3U1KA 4OO1F 3H1CA 3B4TA 4IFDE 2NN6E 4IFDF 2WNRA 1OYSA 5K36C 5JEAA 5JEAB 2NN6D 4BA1A 4BA1B 3KRNA 3GLLA 5C0XF
chains in the Genus database with same CATH superfamily
4DR7I 5GMDA 4FW6A 5JEAC 1Z0BA 5IWAE 2V8PA 3L7ZA 2ZBKB 4AM3A 2WP8B 5LL6R 2HK2A 1VISA 1NHHA 3F0NA 1PKPA 4DR2I 2A2CA 4YY3E 4AQYE 4DR3E 1I94E 4IFDB 2NN6A 5C0XE 4GKJE 1N33E 4IZJA 4JI7E 4DR1E 4DV2I 2V2VA 1MU5A 5GMEA 4DPUA 1ZXMA 4DV4I 4PU9A 5JEAF 2WW4A 1IBLI 4FW7A 1XMQE 4P7AA 3P06A 2CGEA 3LTOA 3P3EA 1S16A 3QT7A 4JYAI 1RHYA 4JI6I 4GKKI 4KHPE 1Y4UA 1XNQI 2UXDE 3LPSA 2JE6B 4IFDA 1N36I 2JEAB 3K1JA 4EMDA 2IERA 3ZZUA 4WUDA 4JI2E 4BA2A 2C39B 4X64I 1Z0VA 2JEBB 1ELOA 3CWVA 5C0XA 2NN6F 4MQYA 3Q6MA 4IFDC 3K85A 1ZM9A 4WUBA 1E3HA 4B3RI 1NHIA 4U3DA 1KKHA 2X7IA 5C0XC 2CG9A 3ZZ0A 4HYMA 5K36A 5FLXC 1RR9A 2PO0B 4LFBI 2ZM6E 4RPFA 3D4JA 2Z5BB 1ZM3A 1XXEA 2V2QA 3B4TA 2UXBI 1N34I 4IFDF 4XTJA 4FN5A 2XEXA 5DRRA 4Z7CA 4YY3I 1FI4A 5K36C 5JEAB 5DROA 4LF6I 4GKJI 2J65A 3J80C 5C0XF 1XMQI 3J80Q 4JI8E 2C37B 4USKA 2PO2A 3B8HA 4Z7YA 4DR4E 1HNWE 1S4EA 1RREA 4MU3A 3B82A 3GMEA 3L7ZB 4OO1E 3CDJA 4R1FA 4KHPI 1KVKA 3ZM7A 2O1VA 1YHCA 5K36F 4LF8E 1XNRI 1Y6ZA 4B3ME 4B3SE 2Q2EB 3CDIA 3HULA 4M1KA 5BR8I 1Z59A 4FW9A 3T1HE 2PNZA 4MU4A 2NN6B 3WU3A 4IZJB 1EI1A 4NXME 4UT4A 1YH8A 2C37A 5ELWA 3T1YE 4IZKA 4LPFA 3GCMA 1Z5AA 4DV6E 4LF9I 3HJCA 1OYPA 4DV1I 4X65E 3B78A 1E3PA 2IOPA 4MDTA 2VQEI 1UDNA 4GQUA 4JI1E 3QT5A 2Z5EA 4OO1A 2VQFE 1HNZI 2ZM6I 1IBME 2ZITA 4DV7E 1HNXI 4OZEA 2E5LI 4BA2B 4UTGA 1P42A 2NPFA 1PIEA 1USUA 2IOQA 4OO1C 5C0XB 5JEAD 1Y4SA 2WNRB 3UHMA 2HFSA 2NN6C 4HY1A 4N3OA 5FWKA 3DD6A 3M85G 4ISAA 4IS9A 2GO3A 4MYTA 2BR2A 2BA0D 2HKEA 3HKMA 4DR5I 4X66I 4YHHE 3J81C 2UXCI 3PS2A 2UUAE 3P3GA 3J81Q 3GONA 3PYDA 2VESA 4DUYI 4OX9I 5K36B 4LF5I 2EFGA 3PS3A 3U1KA 4J3DA 3OTOE 4JI3I 1K47A 4LF8I 3H1CA 4OO1F 1FWLA 1XHKA 4DV5I 4DPXA 2WNRA 2HK3A 2OI2A 1KTVA 3T1HI 2V34A 4JI5I 2NN6D 3J7AG 4USMA 4IZJD 3ZKDA 1XMOE 3Q1QA 3GLLA 1N0VC 4LFCE 4X62E 3T1YI 2JT2A 1Y60A 4JI0E 4K0KE 1FKAE 4DV6I 3M85D 2HFUA 2PO2B 5IWAI 4B3TE 5EL9A 4FW3A 2PO1B 1KIJA 2F1DA 3M6AA 5FLXQ 3Q6NA 4JI4E 4LFAE 2BV3A 3U1YA 4AQYI 4KQVA 4DR3I 4NBQA 1I94I 1USVA 4FW4A 2VQFI 3M7ND 4IFDD 2AE8A 1N33I 4JI7I 2UUCE 4DR1I 2O1UA 4LF4E 2PNZB 4DR2E 3PS1A 5JEAE 4IZKB 5C0XD 4FW5A 5DRQA 3PYFA 2PO1A 4DV3E 4DV0E 4DPWA 4HACA 4HXZA 3ZKBA 5A2QC 1VI7A 1MX0A 2UUAI 5A2QQ 2UXDI 4FWGA 4DU7A 1WUUA 3V5RA 2E1RA 1DARA 4AIMA 2HHHE 1N32E 4DR6E 2Z5CA 5K36D 4OO1B 4GKKE 4MU1A 4JI2I 4QNKA 1J5EE 1N36E 2F4VE 1Z0GA 1UDSA 2BM0A 2BA0G 5LMNE 4P52A 1Z0TA 2R42A 1R6MA 1ZXNA 1NZ0A 4DXLA 4DU8A 2R3VA 3P3CA 5DRPA 4X64E 2BA1D 1B62A 1XMOI 5DNLA 4LF7E 1FJGE 1UDOA 4JV5E 4JI0I 2BR2B 2UUBE 1HK7A 2CZ9A 4DUZE 2O1WA 4B3TI 4B3RE 1QZRA 1Z0CA 4JG4A 4DPTA 1NHJA 3PYEA 1H72C 4NXNE 5IT9C 2DEJA 4QNJA 4JI4I 4LFAI 4LCGA 5IT9Q 4LFBE 4IFDE 1OYSA 2UU9E 2V2ZA 1FWKA 2UUCI 4LF4I 1N34E 2UXBE 1D6TA 4BA1A 2GS8A 3KRNA 4U3BA 4JI8I 1Z5CA 4DR4I 2LJPA 3V2UC 1HNWI 4LF6E 3J7AM 5LMUE 1UEKA 4DV3I 2C38B 4DV0I 3H4LA 2PNLA 3M7NG 1IBKE 2O1TA 2BM1A 1Z5BA 4B3MI 4B3SI 2WP8A 2HHHI 1N32I 5K36E 4ED4A 4DR6I 3WU5A 1UDQA 5DNXA 1HR0E 1R6LA 4OO1D 1FNMA 2A2DA 4ZVIA 4MU0A 1XNRE 4NXMI 5BR8E 1J5EI 2AJ4A 2F4VI 5LMNI 4MYUA 1U2RA 2CVEA 2C38A 3PYGA 1PVGA 1Y5YA 4X65I 4DR7E 4LF7I 1FJGI 1H7UA 4JV5I 3ZZTA 4HACB 4I3HA 2UUBI 1H7SA 4PRVA 4DUZI 3JAMC 2X36A 1A6FA 2J7KA 3P76A 4LF9E 1ZM2A 4JI1I 3JAMQ 2HKJA 3QT6A 4DV1E 2VQEE 2Z5CB 1IBMI 2DEIA 2JE6A 2JEAA 2O3ZA 4NXNI 4FWHA 4DV7I 2BA1G 1OJ4A 5L3JA 1HNZE 2C39A 4DV2E 2JEBA 2UU9I 1H73A 1B63A 4DV4E 1HNXE 2PNMA 1IBLE 2E5LE 4FWDA 1BKNA 4YHHI 4LCHA 5EKWA 3WU4A 4AIDA 1Z0EA 1OYRA 5LMUI 4LOMA 4JYAE 4JI6E 4DR5E 4X66E 2VF3A 2UXCE 4OKGA 1XNQE 2GO4A 1IBKI 3K17A 3LNUA 1EA6A 1MG7A 2IESA 3OTOI 2PO0A 1ZM4A 1N0UA 4DUYE 4OX9E 4LF5E 2Z5BA 1HR0I 3NZKA 4PRXA 4DPYA 2NN6E 4JI3E 1H74A 5JEAA 2GQ0A 4LFCI 4DV5E 4X62I 1Z0WA 4BA1B 3QT8A 4K0KI 4LCFA 3PRYA 4WUCA 4URLA 4JI5E 3WU6A
chains in the Genus database with same CATH topology
2C37B 3M85D 2PO2A 2PO2B 2C38B 5JEAC 3M7NG 2PO1B 3GMEA 3L7ZA 3L7ZB 4OO1E 3CDJA 4AM3A 2WP8A 2WP8B 5K36E 5K36F 1UDQA 4OO1D 1R6LA 3M7ND 4NBQA 3CDIA 4IFDD 2PNZA 2PNZB 4IFDB 2NN6A 5C0XE 2NN6B 2C37A 5JEAE 5JEAF 5C0XD 2C38A 3GCMA 2PO1A 1OYPA 1E3PA 1UDNA 4AIMA 5K36D 4OO1A 4OO1B 2JE6A 2JE6B 4IFDA 2JEAA 2JEAB 2BA1G 1UDSA 2BA0G 4BA2A 4BA2B 2C39A 2C39B 1R6MA 2JEBB 2JEBA 5C0XA 5C0XB 4OO1C 5JEAD 2NN6F 2WNRB 4IFDC 2BA1D 2NN6C 3M85G 3DD6A 1UDOA 2BR2A 2BR2B 2BA0D 3HKMA 4AIDA 1E3HA 1OYRA 5C0XC 5K36A 5K36B 2PO0A 2PO0B 3U1KA 4OO1F 3H1CA 3B4TA 4IFDE 2NN6E 4IFDF 2WNRA 1OYSA 5K36C 5JEAA 5JEAB 2NN6D 4BA1A 4BA1B 3KRNA 3GLLA 5C0XF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C37 B;  3M85 D;  2PO2 A;  2PO2 B;  2C38 B;  5JEA C;  3M7N G;  2PO1 B;  3GME A;  3L7Z A;  3L7Z B;  4OO1 E;  3CDJ A;  4AM3 A;  2WP8 A;  2WP8 B;  5K36 E;  5K36 F;  1UDQ A;  4OO1 D;  1R6L A;  3M7N D;  4NBQ A;  3CDI A;  4IFD D;  2PNZ A;  2PNZ B;  4IFD B;  2NN6 A;  5C0X E;  2NN6 B;  2C37 A;  5JEA E;  5JEA F;  5C0X D;  2C38 A;  3GCM A;  2PO1 A;  1OYP A;  1E3P A;  1UDN A;  4AIM A;  5K36 D;  4OO1 A;  4OO1 B;  2JE6 A;  2JE6 B;  4IFD A;  2JEA A;  2JEA B;  2BA1 G;  1UDS A;  2BA0 G;  4BA2 A;  4BA2 B;  2C39 A;  2C39 B;  1R6M A;  2JEB B;  2JEB A;  5C0X A;  5C0X B;  4OO1 C;  5JEA D;  2NN6 F;  2WNR B;  4IFD C;  2BA1 D;  2NN6 C;  3M85 G;  3DD6 A;  1UDO A;  2BR2 A;  2BR2 B;  2BA0 D;  3HKM A;  4AID A;  1E3H A;  1OYR A;  5C0X C;  5K36 A;  5K36 B;  2PO0 A;  2PO0 B;  3U1K A;  4OO1 F;  3H1C A;  3B4T A;  4IFD E;  2NN6 E;  4IFD F;  2WNR A;  1OYS A;  5K36 C;  5JEA A;  5JEA B;  2NN6 D;  4BA1 A;  4BA1 B;  3KRN A;  3GLL A;  5C0X F; 
#chains in the Genus database with same CATH topology
 4DR7 I;  5GMD A;  4FW6 A;  5JEA C;  1Z0B A;  5IWA E;  2V8P A;  3L7Z A;  2ZBK B;  4AM3 A;  2WP8 B;  5LL6 R;  2HK2 A;  1VIS A;  1NHH A;  3F0N A;  1PKP A;  4DR2 I;  2A2C A;  4YY3 E;  4AQY E;  4DR3 E;  1I94 E;  4IFD B;  2NN6 A;  5C0X E;  4GKJ E;  1N33 E;  4IZJ A;  4JI7 E;  4DR1 E;  4DV2 I;  2V2V A;  1MU5 A;  5GME A;  4DPU A;  1ZXM A;  4DV4 I;  4PU9 A;  5JEA F;  2WW4 A;  1IBL I;  4FW7 A;  1XMQ E;  4P7A A;  3P06 A;  2CGE A;  3LTO A;  3P3E A;  1S16 A;  3QT7 A;  4JYA I;  1RHY A;  4JI6 I;  4GKK I;  4KHP E;  1Y4U A;  1XNQ I;  2UXD E;  3LPS A;  2JE6 B;  4IFD A;  1N36 I;  2JEA B;  3K1J A;  4EMD A;  2IER A;  3ZZU A;  4WUD A;  4JI2 E;  4BA2 A;  2C39 B;  4X64 I;  1Z0V A;  2JEB B;  1ELO A;  3CWV A;  5C0X A;  2NN6 F;  4MQY A;  3Q6M A;  4IFD C;  3K85 A;  1ZM9 A;  4WUB A;  1E3H A;  4B3R I;  1NHI A;  4U3D A;  1KKH A;  2X7I A;  5C0X C;  2CG9 A;  3ZZ0 A;  4HYM A;  5K36 A;  5FLX C;  1RR9 A;  2PO0 B;  4LFB I;  2ZM6 E;  4RPF A;  3D4J A;  2Z5B B;  1ZM3 A;  1XXE A;  2V2Q A;  3B4T A;  2UXB I;  1N34 I;  4IFD F;  4XTJ A;  4FN5 A;  2XEX A;  5DRR A;  4Z7C A;  4YY3 I;  1FI4 A;  5K36 C;  5JEA B;  5DRO A;  4LF6 I;  4GKJ I;  2J65 A;  3J80 C;  5C0X F;  1XMQ I;  3J80 Q;  4JI8 E;  2C37 B;  4USK A;  2PO2 A;  3B8H A;  4Z7Y A;  4DR4 E;  1HNW E;  1S4E A;  1RRE A;  4MU3 A;  3B82 A;  3GME A;  3L7Z B;  4OO1 E;  3CDJ A;  4R1F A;  4KHP I;  1KVK A;  3ZM7 A;  2O1V A;  1YHC A;  5K36 F;  4LF8 E;  1XNR I;  1Y6Z A;  4B3M E;  4B3S E;  2Q2E B;  3CDI A;  3HUL A;  4M1K A;  5BR8 I;  1Z59 A;  4FW9 A;  3T1H E;  2PNZ A;  4MU4 A;  2NN6 B;  3WU3 A;  4IZJ B;  1EI1 A;  4NXM E;  4UT4 A;  1YH8 A;  2C37 A;  5ELW A;  3T1Y E;  4IZK A;  4LPF A;  3GCM A;  1Z5A A;  4DV6 E;  4LF9 I;  3HJC A;  1OYP A;  4DV1 I;  4X65 E;  3B78 A;  1E3P A;  2IOP A;  4MDT A;  2VQE I;  1UDN A;  4GQU A;  4JI1 E;  3QT5 A;  2Z5E A;  4OO1 A;  2VQF E;  1HNZ I;  2ZM6 I;  1IBM E;  2ZIT A;  4DV7 E;  1HNX I;  4OZE A;  2E5L I;  4BA2 B;  4UTG A;  1P42 A;  2NPF A;  1PIE A;  1USU A;  2IOQ A;  4OO1 C;  5C0X B;  5JEA D;  1Y4S A;  2WNR B;  3UHM A;  2HFS A;  2NN6 C;  4HY1 A;  4N3O A;  5FWK A;  3DD6 A;  3M85 G;  4ISA A;  4IS9 A;  2GO3 A;  4MYT A;  2BR2 A;  2BA0 D;  2HKE A;  3HKM A;  4DR5 I;  4X66 I;  4YHH E;  3J81 C;  2UXC I;  3PS2 A;  2UUA E;  3P3G A;  3J81 Q;  3GON A;  3PYD A;  2VES A;  4DUY I;  4OX9 I;  5K36 B;  4LF5 I;  2EFG A;  3PS3 A;  3U1K A;  4J3D A;  3OTO E;  4JI3 I;  1K47 A;  4LF8 I;  3H1C A;  4OO1 F;  1FWL A;  1XHK A;  4DV5 I;  4DPX A;  2WNR A;  2HK3 A;  2OI2 A;  1KTV A;  3T1H I;  2V34 A;  4JI5 I;  2NN6 D;  3J7A G;  4USM A;  4IZJ D;  3ZKD A;  1XMO E;  3Q1Q A;  3GLL A;  1N0V C;  4LFC E;  4X62 E;  3T1Y I;  2JT2 A;  1Y60 A;  4JI0 E;  4K0K E;  1FKA E;  4DV6 I;  3M85 D;  2HFU A;  2PO2 B;  5IWA I;  4B3T E;  5EL9 A;  4FW3 A;  2PO1 B;  1KIJ A;  2F1D A;  3M6A A;  5FLX Q;  3Q6N A;  4JI4 E;  4LFA E;  2BV3 A;  3U1Y A;  4AQY I;  4KQV A;  4DR3 I;  4NBQ A;  1I94 I;  1USV A;  4FW4 A;  2VQF I;  3M7N D;  4IFD D;  2AE8 A;  1N33 I;  4JI7 I;  2UUC E;  4DR1 I;  2O1U A;  4LF4 E;  2PNZ B;  4DR2 E;  3PS1 A;  5JEA E;  4IZK B;  5C0X D;  4FW5 A;  5DRQ A;  3PYF A;  2PO1 A;  4DV3 E;  4DV0 E;  4DPW A;  4HAC A;  4HXZ A;  3ZKB A;  5A2Q C;  1VI7 A;  1MX0 A;  2UUA I;  5A2Q Q;  2UXD I;  4FWG A;  4DU7 A;  1WUU A;  3V5R A;  2E1R A;  1DAR A;  4AIM A;  2HHH E;  1N32 E;  4DR6 E;  2Z5C A;  5K36 D;  4OO1 B;  4GKK E;  4MU1 A;  4JI2 I;  4QNK A;  1J5E E;  1N36 E;  2F4V E;  1Z0G A;  1UDS A;  2BM0 A;  2BA0 G;  5LMN E;  4P52 A;  1Z0T A;  2R42 A;  1R6M A;  1ZXN A;  1NZ0 A;  4DXL A;  4DU8 A;  2R3V A;  3P3C A;  5DRP A;  4X64 E;  2BA1 D;  1B62 A;  1XMO I;  5DNL A;  4LF7 E;  1FJG E;  1UDO A;  4JV5 E;  4JI0 I;  2BR2 B;  2UUB E;  1HK7 A;  2CZ9 A;  4DUZ E;  2O1W A;  4B3T I;  4B3R E;  1QZR A;  1Z0C A;  4JG4 A;  4DPT A;  1NHJ A;  3PYE A;  1H72 C;  4NXN E;  5IT9 C;  2DEJ A;  4QNJ A;  4JI4 I;  4LFA I;  4LCG A;  5IT9 Q;  4LFB E;  4IFD E;  1OYS A;  2UU9 E;  2V2Z A;  1FWK A;  2UUC I;  4LF4 I;  1N34 E;  2UXB E;  1D6T A;  4BA1 A;  2GS8 A;  3KRN A;  4U3B A;  4JI8 I;  1Z5C A;  4DR4 I;  2LJP A;  3V2U C;  1HNW I;  4LF6 E;  3J7A M;  5LMU E;  1UEK A;  4DV3 I;  2C38 B;  4DV0 I;  3H4L A;  2PNL A;  3M7N G;  1IBK E;  2O1T A;  2BM1 A;  1Z5B A;  4B3M I;  4B3S I;  2WP8 A;  2HHH I;  1N32 I;  5K36 E;  4ED4 A;  4DR6 I;  3WU5 A;  1UDQ A;  5DNX A;  1HR0 E;  1R6L A;  4OO1 D;  1FNM A;  2A2D A;  4ZVI A;  4MU0 A;  1XNR E;  4NXM I;  5BR8 E;  1J5E I;  2AJ4 A;  2F4V I;  5LMN I;  4MYU A;  1U2R A;  2CVE A;  2C38 A;  3PYG A;  1PVG A;  1Y5Y A;  4X65 I;  4DR7 E;  4LF7 I;  1FJG I;  1H7U A;  4JV5 I;  3ZZT A;  4HAC B;  4I3H A;  2UUB I;  1H7S A;  4PRV A;  4DUZ I;  3JAM C;  2X36 A;  1A6F A;  2J7K A;  3P76 A;  4LF9 E;  1ZM2 A;  4JI1 I;  3JAM Q;  2HKJ A;  3QT6 A;  4DV1 E;  2VQE E;  2Z5C B;  1IBM I;  2DEI A;  2JE6 A;  2JEA A;  2O3Z A;  4NXN I;  4FWH A;  4DV7 I;  2BA1 G;  1OJ4 A;  5L3J A;  1HNZ E;  2C39 A;  4DV2 E;  2JEB A;  2UU9 I;  1H73 A;  1B63 A;  4DV4 E;  1HNX E;  2PNM A;  1IBL E;  2E5L E;  4FWD A;  1BKN A;  4YHH I;  4LCH A;  5EKW A;  3WU4 A;  4AID A;  1Z0E A;  1OYR A;  5LMU I;  4LOM A;  4JYA E;  4JI6 E;  4DR5 E;  4X66 E;  2VF3 A;  2UXC E;  4OKG A;  1XNQ E;  2GO4 A;  1IBK I;  3K17 A;  3LNU A;  1EA6 A;  1MG7 A;  2IES A;  3OTO I;  2PO0 A;  1ZM4 A;  1N0U A;  4DUY E;  4OX9 E;  4LF5 E;  2Z5B A;  1HR0 I;  3NZK A;  4PRX A;  4DPY A;  2NN6 E;  4JI3 E;  1H74 A;  5JEA A;  2GQ0 A;  4LFC I;  4DV5 E;  4X62 I;  1Z0W A;  4BA1 B;  3QT8 A;  4K0K I;  4LCF A;  3PRY A;  4WUC A;  4URL A;  4JI5 E;  3WU6 A; 
#chains in the Genus database with same CATH homology
 2C37 B;  3M85 D;  2PO2 A;  2PO2 B;  2C38 B;  5JEA C;  3M7N G;  2PO1 B;  3GME A;  3L7Z A;  3L7Z B;  4OO1 E;  3CDJ A;  4AM3 A;  2WP8 A;  2WP8 B;  5K36 E;  5K36 F;  1UDQ A;  4OO1 D;  1R6L A;  3M7N D;  4NBQ A;  3CDI A;  4IFD D;  2PNZ A;  2PNZ B;  4IFD B;  2NN6 A;  5C0X E;  2NN6 B;  2C37 A;  5JEA E;  5JEA F;  5C0X D;  2C38 A;  3GCM A;  2PO1 A;  1OYP A;  1E3P A;  1UDN A;  4AIM A;  5K36 D;  4OO1 A;  4OO1 B;  2JE6 A;  2JE6 B;  4IFD A;  2JEA A;  2JEA B;  2BA1 G;  1UDS A;  2BA0 G;  4BA2 A;  4BA2 B;  2C39 A;  2C39 B;  1R6M A;  2JEB B;  2JEB A;  5C0X A;  5C0X B;  4OO1 C;  5JEA D;  2NN6 F;  2WNR B;  4IFD C;  2BA1 D;  2NN6 C;  3M85 G;  3DD6 A;  1UDO A;  2BR2 A;  2BR2 B;  2BA0 D;  3HKM A;  4AID A;  1E3H A;  1OYR A;  5C0X C;  5K36 A;  5K36 B;  2PO0 A;  2PO0 B;  3U1K A;  4OO1 F;  3H1C A;  3B4T A;  4IFD E;  2NN6 E;  4IFD F;  2WNR A;  1OYS A;  5K36 C;  5JEA A;  5JEA B;  2NN6 D;  4BA1 A;  4BA1 B;  3KRN A;  3GLL A;  5C0X F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...