2C38A

Rnase ph core of the archaeal exosome in complex with a5 rna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
271
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 80
structure length 271
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c38A01
5C0XC 2WP8A 3M7ND 5JEAA 2C37A 2WP8B 3KRNA 2PO1B 5K36C 2JE6A 1OYRA 1UDQA 2JEBA 5C0XA 2BR2A 1E3HA 3M7NG 4IFDF 4OO1C 5JEAD 4BA2B 2BA1G 1R6MA 1E3PA 4IFDC 5K36B 2BA0G 2BR2B 3M85G 4OO1A 3CDJA 4OO1B 2BA1D 5JEAE 3HKMA 5K36F 2NN6B 4BA2A 2JEBB 2PNZA 5C0XF 5JEAF 4NBQA 5C0XD 5C0XE 1OYSA 3L7ZB 3CDIA 2NN6E 1UDSA 2NN6D 3GLLA 3GMEA 2C39B 2NN6F 5C0XB 4BA1B 2C38A 2JEAB 5K36D 4IFDA 3B4TA 4IFDB 2JEAA 3U1KA 4OO1D 3DD6A 3GCMA 2PO2B 5JEAC 2PO0A 4BA1A 4AIMA 5K36A 2C39A 4IFDD 4AIDA 1UDOA 3M85D 2BA0D 3L7ZA 5K36E 2JE6B 2WNRB 1R6LA 3H1CA 2C38B 4IFDE 2WNRA 1OYPA 2C37B 2NN6A 5JEAB 4OO1F 4OO1E 2PO0B 1UDNA 4AM3A 2PO1A 2NN6C 2PO2A 2PNZB
chains in the Genus database with same CATH superfamily
2A2CA 5C0XC 4NXME 2CG9A 1YH8A 2VQEE 3T1HI 1IBLE 3M7ND 1HNZE 1ZM4A 4DUZE 3LTOA 1NHJA 3KRNA 1WUUA 4JI0I 2IOQA 4P7AA 4DV0I 4MYUA 2JE6A 5EKWA 1UDQA 4JI7I 4LCGA 1N36E 4B3MI 1J5EI 3PRYA 2NPFA 1Z0GA 4X64I 5EL9A 4LFCI 1YHCA 1Z0TA 1N32I 4B3RE 4IZKB 4MDTA 4DPUA 2IERA 4HACA 4LF8I 4DPXA 4IFDF 2UXCE 4FW4A 1R6MA 4AQYI 1VISA 4DV6E 4DV7I 5BR8I 4DV2E 4LF7I 3ZKBA 3M85G 3T1YI 3B8HA 4OO1A 2Z5CA 5DRQA 5FLXQ 4DR7E 4B3SI 1OJ4A 1UEKA 1ZM2A 4LF4E 5DRPA 5IT9Q 2EFGA 1USUA 3PYEA 1N0VC 1OYSA 3L7ZB 2NN6E 3GLLA 1ZM3A 2AE8A 2C39B 2GO4A 4OKGA 3J81C 4LF9E 1Z0VA 4BA1B 1KTVA 1H73A 3M6AA 4DPTA 2XEXA 4LF4I 3B4TA 5LMNI 1NHHA 4JV5E 1QZRA 2X7IA 4DUYE 3ZZTA 1XMOE 1P42A 3PYGA 4OO1D 4X65E 4DR7I 3P06A 4JI4E 2PO0A 5DROA 3J80C 2UUCI 5IT9C 4IFDD 3K17A 2UUCE 2O1WA 2V2ZA 1D6TA 2BA0D 1HK7A 1I94E 4FWDA 4DR5I 2UXCI 4LF8E 1FWKA 2C38B 4ISAA 4K0KI 1OYPA 2C37B 1H7SA 4JI6E 1Y5YA 4HY1A 1Z0EA 3Q6NA 4DR1E 4FW6A 2O1VA 3V2UC 2UXDE 5LMUE 4JI7E 4DPYA 1N34E 4OZEA 5A2QC 4JI0E 2PNZB 3QT8A 2AJ4A 5IWAI 2PNMA 5JEAA 2LJPA 4X62E 1XMQI 3J80Q 4HYMA 3JAMQ 4MYTA 5DNXA 2CGEA 5C0XA 2UUAE 2BR2A 4FW3A 2UXBE 1K47A 4FWGA 3PYFA 4DR4I 4DR4E 3M7NG 4JV5I 1B62A 5LMNE 4JI2I 4Z7YA 1MU5A 4LF5E 3P3CA 4X66E 4AQYE 3V5RA 2BA1G 2O3ZA 3PS3A 5IWAE 4LF9I 5FWKA 3P3GA 4IFDC 5K36B 2VF3A 2BA0G 1N32E 2BR2B 3Q6MA 3P76A 4JYAI 1KIJA 3WU6A 5LMUI 1FJGE 4DU8A 5JEAE 4DV1I 2UU9I 4YY3E 1N36I 1MX0A 4B3TI 2NN6B 4DV5I 4ED4A 4JI3I 2PNZA 4NBQA 2HHHI 5C0XE 1NHIA 1I94I 3T1HE 1IBLI 4J3DA 3J7AM 3B78A 3CDIA 3GMEA 4DV2I 1EA6A 1IBMI 4DV6I 4MU1A 2V2VA 2O1UA 3ZZ0A 5C0XB 4JI4I 1XXEA 2C38A 1PIEA 4DR2E 1XMOI 1DARA 1H72C 2IESA 3WU3A 1Z0BA 3JAMC 3UHMA 4X64E 1FWLA 4DV1E 3J7AG 1Y4UA 1Y4SA 2V8PA 4B3ME 3WU4A 1N33I 3PYDA 4LF6E 5K36A 2C39A 4IZJA 4WUDA 4U3BA 3L7ZA 1N33E 1KVKA 5L3JA 3QT7A 1R6LA 4NXMI 4X66I 3H1CA 3ZZUA 4LF5I 2ZM6E 3HULA 4WUCA 2NN6A 2VQFI 2J7KA 1B63A 1H74A 4MU4A 4R1FA 2UUAI 2PO0B 4DR6I 4ZVIA 4OX9I 1XNQI 4AM3A 2O1TA 4LF7E 2NN6C 2PO2A 4FN5A 2HKEA 2BM1A 1PKPA 1S16A 2HHHE 1Z0WA 3ZKDA 2IOPA 4B3RI 4DV5E 1BKNA 1OYRA 4FW9A 4B3TE 2CVEA 1E3HA 2UXDI 4DR1I 2UU9E 4IS9A 3NZKA 4IZJD 4LFAI 1FKAE 4M1KA 4DR5E 2HFUA 2VQEI 1ZXNA 2GQ0A 1FI4A 1H7UA 2OI2A 4JI2E 4DR6E 2Z5CB 4LOMA 3CDJA 4OO1B 2F1DA 1HNWE 3CWVA 3P3EA 2HKJA 1ZXMA 3ZM7A 3HKMA 4PRVA 2HFSA 4JG4A 3HJCA 4P52A 2ZM6I 4JI8I 2JEBB 5C0XF 4YY3I 1Y6ZA 4DV3I 2UUBE 4IZKA 4LPFA 2Z5BB 5GMEA 4DXLA 1Z0CA 4GKKE 2WW4A 1N0UA 3PS2A 2NN6D 1Z59A 1IBKI 4DPWA 4LF6I 4GKKI 1XHKA 3QT5A 3QT6A 1Z5CA 2GO3A 2ZBKB 4DV3E 2UUBI 4PRXA 4DU7A 1HR0I 3U1KA 4UTGA 4HACB 1Y60A 5JEAC 4KHPE 4GKJE 1MG7A 2UXBI 4BA1A 2F4VI 4AIMA 4YHHE 4JI1E 3T1YE 5GMDA 4LFBE 5LL6R 4AIDA 1HNXE 4X62I 1XMQE 2F4VE 2JE6B 4X65I 3F0NA 4USMA 4FW5A 5DNLA 2E1RA 4MU3A 4DUYI 1HR0E 2X36A 4LFAE 1U2RA 4QNKA 1RHYA 4XTJA 5JEAB 4Z7CA 3B82A 4OO1F 5DRRA 1Z5AA 5ELWA 4JYAE 1FNMA 4K0KE 2V34A 2A2DA 4U3DA 4KQVA 2WP8A 5FLXC 4FWHA 4FW7A 2HK2A 1HNZI 3K1JA 2C37A 2WP8B 1ZM9A 2R42A 1HNXI 4NXNI 2PO1B 4WUBA 3U1YA 1XNQE 5K36C 4YHHI 2E5LI 1XNRE 4PU9A 4DV4E 4GKJI 4B3SE 4KHPI 4DV4I 4LCFA 1XNRI 1KKHA 4LCHA 2E5LE 2DEIA 4MQYA 4OO1C 5JEAD 2DEJA 4BA2B 3PS1A 1S4EA 1E3PA 4USKA 2JT2A 2PNLA 3LNUA 4GQUA 4UT4A 2BM0A 4IZJB 3H4LA 1N34I 3GONA 4LFCE 4DR3I 2BA1D 4EMDA 1J5EE 4JI8E 4JI6I 4JI5I 5K36F 4DV0E 1USVA 4MU0A 2Q2EB 4BA2A 1VI7A 4DR2I 5JEAF 5C0XD 1HNWI 1IBME 4LFBI 4N3OA 1UDSA 5BR8E 2VESA 2NN6F 4JI1I 1EI1A 2V2QA 4HXZA 4RPFA 4JI3E 2JEAB 4URLA 5K36D 4IFDA 2ZITA 4JI5E 5A2QQ 3K85A 4IFDB 2JEAA 1Z5BA 2CZ9A 1PVGA 3DD6A 3GCMA 2PO2B 2HK3A 1FJGI 4DR3E 3OTOE 1ELOA 2Z5EA 3Q1QA 2R3VA 1IBKE 2BV3A 1RREA 1UDOA 3D4JA 3M85D 1A6FA 3OTOI 5K36E 4DUZI 4I3HA 2WNRB 1RR9A 2Z5BA 2GS8A 2J65A 4IFDE 2WNRA 4OX9E 3LPSA 3WU5A 4OO1E 2VQFE 4QNJA 1NZ0A 1UDNA 3J81Q 2PO1A 4NXNE 4DV7E 2JEBA
chains in the Genus database with same CATH topology
5C0XC 2WP8A 3M7ND 5JEAA 2C37A 2WP8B 3KRNA 2PO1B 5K36C 2JE6A 1OYRA 1UDQA 2JEBA 5C0XA 2BR2A 1E3HA 3M7NG 4IFDF 4OO1C 5JEAD 4BA2B 2BA1G 1R6MA 1E3PA 4IFDC 5K36B 2BA0G 2BR2B 3M85G 4OO1A 3CDJA 4OO1B 2BA1D 5JEAE 3HKMA 5K36F 2NN6B 4BA2A 2JEBB 2PNZA 5C0XF 5JEAF 4NBQA 5C0XD 5C0XE 1OYSA 3L7ZB 3CDIA 2NN6E 1UDSA 2NN6D 3GLLA 3GMEA 2C39B 2NN6F 5C0XB 4BA1B 2C38A 2JEAB 5K36D 4IFDA 3B4TA 4IFDB 2JEAA 3U1KA 4OO1D 3DD6A 3GCMA 2PO2B 5JEAC 2PO0A 4BA1A 4AIMA 5K36A 2C39A 4IFDD 4AIDA 1UDOA 3M85D 2BA0D 3L7ZA 5K36E 2JE6B 2WNRB 1R6LA 3H1CA 2C38B 4IFDE 2WNRA 1OYPA 2C37B 2NN6A 5JEAB 4OO1F 4OO1E 2PO0B 1UDNA 4AM3A 2PO1A 2NN6C 2PO2A 2PNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X C;  2WP8 A;  3M7N D;  5JEA A;  2C37 A;  2WP8 B;  3KRN A;  2PO1 B;  5K36 C;  2JE6 A;  1OYR A;  1UDQ A;  2JEB A;  5C0X A;  2BR2 A;  1E3H A;  3M7N G;  4IFD F;  4OO1 C;  5JEA D;  4BA2 B;  2BA1 G;  1R6M A;  1E3P A;  4IFD C;  5K36 B;  2BA0 G;  2BR2 B;  3M85 G;  4OO1 A;  3CDJ A;  4OO1 B;  2BA1 D;  5JEA E;  3HKM A;  5K36 F;  2NN6 B;  4BA2 A;  2JEB B;  2PNZ A;  5C0X F;  5JEA F;  4NBQ A;  5C0X D;  5C0X E;  1OYS A;  3L7Z B;  3CDI A;  2NN6 E;  1UDS A;  2NN6 D;  3GLL A;  3GME A;  2C39 B;  2NN6 F;  5C0X B;  4BA1 B;  2C38 A;  2JEA B;  5K36 D;  4IFD A;  3B4T A;  4IFD B;  2JEA A;  3U1K A;  4OO1 D;  3DD6 A;  3GCM A;  2PO2 B;  5JEA C;  2PO0 A;  4BA1 A;  4AIM A;  5K36 A;  2C39 A;  4IFD D;  4AID A;  1UDO A;  3M85 D;  2BA0 D;  3L7Z A;  5K36 E;  2JE6 B;  2WNR B;  1R6L A;  3H1C A;  2C38 B;  4IFD E;  2WNR A;  1OYP A;  2C37 B;  2NN6 A;  5JEA B;  4OO1 F;  4OO1 E;  2PO0 B;  1UDN A;  4AM3 A;  2PO1 A;  2NN6 C;  2PO2 A;  2PNZ B; 
#chains in the Genus database with same CATH topology
 2A2C A;  5C0X C;  4NXM E;  2CG9 A;  1YH8 A;  2VQE E;  3T1H I;  1IBL E;  3M7N D;  1HNZ E;  1ZM4 A;  4DUZ E;  3LTO A;  1NHJ A;  3KRN A;  1WUU A;  4JI0 I;  2IOQ A;  4P7A A;  4DV0 I;  4MYU A;  2JE6 A;  5EKW A;  1UDQ A;  4JI7 I;  4LCG A;  1N36 E;  4B3M I;  1J5E I;  3PRY A;  2NPF A;  1Z0G A;  4X64 I;  5EL9 A;  4LFC I;  1YHC A;  1Z0T A;  1N32 I;  4B3R E;  4IZK B;  4MDT A;  4DPU A;  2IER A;  4HAC A;  4LF8 I;  4DPX A;  4IFD F;  2UXC E;  4FW4 A;  1R6M A;  4AQY I;  1VIS A;  4DV6 E;  4DV7 I;  5BR8 I;  4DV2 E;  4LF7 I;  3ZKB A;  3M85 G;  3T1Y I;  3B8H A;  4OO1 A;  2Z5C A;  5DRQ A;  5FLX Q;  4DR7 E;  4B3S I;  1OJ4 A;  1UEK A;  1ZM2 A;  4LF4 E;  5DRP A;  5IT9 Q;  2EFG A;  1USU A;  3PYE A;  1N0V C;  1OYS A;  3L7Z B;  2NN6 E;  3GLL A;  1ZM3 A;  2AE8 A;  2C39 B;  2GO4 A;  4OKG A;  3J81 C;  4LF9 E;  1Z0V A;  4BA1 B;  1KTV A;  1H73 A;  3M6A A;  4DPT A;  2XEX A;  4LF4 I;  3B4T A;  5LMN I;  1NHH A;  4JV5 E;  1QZR A;  2X7I A;  4DUY E;  3ZZT A;  1XMO E;  1P42 A;  3PYG A;  4OO1 D;  4X65 E;  4DR7 I;  3P06 A;  4JI4 E;  2PO0 A;  5DRO A;  3J80 C;  2UUC I;  5IT9 C;  4IFD D;  3K17 A;  2UUC E;  2O1W A;  2V2Z A;  1D6T A;  2BA0 D;  1HK7 A;  1I94 E;  4FWD A;  4DR5 I;  2UXC I;  4LF8 E;  1FWK A;  2C38 B;  4ISA A;  4K0K I;  1OYP A;  2C37 B;  1H7S A;  4JI6 E;  1Y5Y A;  4HY1 A;  1Z0E A;  3Q6N A;  4DR1 E;  4FW6 A;  2O1V A;  3V2U C;  2UXD E;  5LMU E;  4JI7 E;  4DPY A;  1N34 E;  4OZE A;  5A2Q C;  4JI0 E;  2PNZ B;  3QT8 A;  2AJ4 A;  5IWA I;  2PNM A;  5JEA A;  2LJP A;  4X62 E;  1XMQ I;  3J80 Q;  4HYM A;  3JAM Q;  4MYT A;  5DNX A;  2CGE A;  5C0X A;  2UUA E;  2BR2 A;  4FW3 A;  2UXB E;  1K47 A;  4FWG A;  3PYF A;  4DR4 I;  4DR4 E;  3M7N G;  4JV5 I;  1B62 A;  5LMN E;  4JI2 I;  4Z7Y A;  1MU5 A;  4LF5 E;  3P3C A;  4X66 E;  4AQY E;  3V5R A;  2BA1 G;  2O3Z A;  3PS3 A;  5IWA E;  4LF9 I;  5FWK A;  3P3G A;  4IFD C;  5K36 B;  2VF3 A;  2BA0 G;  1N32 E;  2BR2 B;  3Q6M A;  3P76 A;  4JYA I;  1KIJ A;  3WU6 A;  5LMU I;  1FJG E;  4DU8 A;  5JEA E;  4DV1 I;  2UU9 I;  4YY3 E;  1N36 I;  1MX0 A;  4B3T I;  2NN6 B;  4DV5 I;  4ED4 A;  4JI3 I;  2PNZ A;  4NBQ A;  2HHH I;  5C0X E;  1NHI A;  1I94 I;  3T1H E;  1IBL I;  4J3D A;  3J7A M;  3B78 A;  3CDI A;  3GME A;  4DV2 I;  1EA6 A;  1IBM I;  4DV6 I;  4MU1 A;  2V2V A;  2O1U A;  3ZZ0 A;  5C0X B;  4JI4 I;  1XXE A;  2C38 A;  1PIE A;  4DR2 E;  1XMO I;  1DAR A;  1H72 C;  2IES A;  3WU3 A;  1Z0B A;  3JAM C;  3UHM A;  4X64 E;  1FWL A;  4DV1 E;  3J7A G;  1Y4U A;  1Y4S A;  2V8P A;  4B3M E;  3WU4 A;  1N33 I;  3PYD A;  4LF6 E;  5K36 A;  2C39 A;  4IZJ A;  4WUD A;  4U3B A;  3L7Z A;  1N33 E;  1KVK A;  5L3J A;  3QT7 A;  1R6L A;  4NXM I;  4X66 I;  3H1C A;  3ZZU A;  4LF5 I;  2ZM6 E;  3HUL A;  4WUC A;  2NN6 A;  2VQF I;  2J7K A;  1B63 A;  1H74 A;  4MU4 A;  4R1F A;  2UUA I;  2PO0 B;  4DR6 I;  4ZVI A;  4OX9 I;  1XNQ I;  4AM3 A;  2O1T A;  4LF7 E;  2NN6 C;  2PO2 A;  4FN5 A;  2HKE A;  2BM1 A;  1PKP A;  1S16 A;  2HHH E;  1Z0W A;  3ZKD A;  2IOP A;  4B3R I;  4DV5 E;  1BKN A;  1OYR A;  4FW9 A;  4B3T E;  2CVE A;  1E3H A;  2UXD I;  4DR1 I;  2UU9 E;  4IS9 A;  3NZK A;  4IZJ D;  4LFA I;  1FKA E;  4M1K A;  4DR5 E;  2HFU A;  2VQE I;  1ZXN A;  2GQ0 A;  1FI4 A;  1H7U A;  2OI2 A;  4JI2 E;  4DR6 E;  2Z5C B;  4LOM A;  3CDJ A;  4OO1 B;  2F1D A;  1HNW E;  3CWV A;  3P3E A;  2HKJ A;  1ZXM A;  3ZM7 A;  3HKM A;  4PRV A;  2HFS A;  4JG4 A;  3HJC A;  4P52 A;  2ZM6 I;  4JI8 I;  2JEB B;  5C0X F;  4YY3 I;  1Y6Z A;  4DV3 I;  2UUB E;  4IZK A;  4LPF A;  2Z5B B;  5GME A;  4DXL A;  1Z0C A;  4GKK E;  2WW4 A;  1N0U A;  3PS2 A;  2NN6 D;  1Z59 A;  1IBK I;  4DPW A;  4LF6 I;  4GKK I;  1XHK A;  3QT5 A;  3QT6 A;  1Z5C A;  2GO3 A;  2ZBK B;  4DV3 E;  2UUB I;  4PRX A;  4DU7 A;  1HR0 I;  3U1K A;  4UTG A;  4HAC B;  1Y60 A;  5JEA C;  4KHP E;  4GKJ E;  1MG7 A;  2UXB I;  4BA1 A;  2F4V I;  4AIM A;  4YHH E;  4JI1 E;  3T1Y E;  5GMD A;  4LFB E;  5LL6 R;  4AID A;  1HNX E;  4X62 I;  1XMQ E;  2F4V E;  2JE6 B;  4X65 I;  3F0N A;  4USM A;  4FW5 A;  5DNL A;  2E1R A;  4MU3 A;  4DUY I;  1HR0 E;  2X36 A;  4LFA E;  1U2R A;  4QNK A;  1RHY A;  4XTJ A;  5JEA B;  4Z7C A;  3B82 A;  4OO1 F;  5DRR A;  1Z5A A;  5ELW A;  4JYA E;  1FNM A;  4K0K E;  2V34 A;  2A2D A;  4U3D A;  4KQV A;  2WP8 A;  5FLX C;  4FWH A;  4FW7 A;  2HK2 A;  1HNZ I;  3K1J A;  2C37 A;  2WP8 B;  1ZM9 A;  2R42 A;  1HNX I;  4NXN I;  2PO1 B;  4WUB A;  3U1Y A;  1XNQ E;  5K36 C;  4YHH I;  2E5L I;  1XNR E;  4PU9 A;  4DV4 E;  4GKJ I;  4B3S E;  4KHP I;  4DV4 I;  4LCF A;  1XNR I;  1KKH A;  4LCH A;  2E5L E;  2DEI A;  4MQY A;  4OO1 C;  5JEA D;  2DEJ A;  4BA2 B;  3PS1 A;  1S4E A;  1E3P A;  4USK A;  2JT2 A;  2PNL A;  3LNU A;  4GQU A;  4UT4 A;  2BM0 A;  4IZJ B;  3H4L A;  1N34 I;  3GON A;  4LFC E;  4DR3 I;  2BA1 D;  4EMD A;  1J5E E;  4JI8 E;  4JI6 I;  4JI5 I;  5K36 F;  4DV0 E;  1USV A;  4MU0 A;  2Q2E B;  4BA2 A;  1VI7 A;  4DR2 I;  5JEA F;  5C0X D;  1HNW I;  1IBM E;  4LFB I;  4N3O A;  1UDS A;  5BR8 E;  2VES A;  2NN6 F;  4JI1 I;  1EI1 A;  2V2Q A;  4HXZ A;  4RPF A;  4JI3 E;  2JEA B;  4URL A;  5K36 D;  4IFD A;  2ZIT A;  4JI5 E;  5A2Q Q;  3K85 A;  4IFD B;  2JEA A;  1Z5B A;  2CZ9 A;  1PVG A;  3DD6 A;  3GCM A;  2PO2 B;  2HK3 A;  1FJG I;  4DR3 E;  3OTO E;  1ELO A;  2Z5E A;  3Q1Q A;  2R3V A;  1IBK E;  2BV3 A;  1RRE A;  1UDO A;  3D4J A;  3M85 D;  1A6F A;  3OTO I;  5K36 E;  4DUZ I;  4I3H A;  2WNR B;  1RR9 A;  2Z5B A;  2GS8 A;  2J65 A;  4IFD E;  2WNR A;  4OX9 E;  3LPS A;  3WU5 A;  4OO1 E;  2VQF E;  4QNJ A;  1NZ0 A;  1UDN A;  3J81 Q;  2PO1 A;  4NXN E;  4DV7 E;  2JEB A; 
#chains in the Genus database with same CATH homology
 5C0X C;  2WP8 A;  3M7N D;  5JEA A;  2C37 A;  2WP8 B;  3KRN A;  2PO1 B;  5K36 C;  2JE6 A;  1OYR A;  1UDQ A;  2JEB A;  5C0X A;  2BR2 A;  1E3H A;  3M7N G;  4IFD F;  4OO1 C;  5JEA D;  4BA2 B;  2BA1 G;  1R6M A;  1E3P A;  4IFD C;  5K36 B;  2BA0 G;  2BR2 B;  3M85 G;  4OO1 A;  3CDJ A;  4OO1 B;  2BA1 D;  5JEA E;  3HKM A;  5K36 F;  2NN6 B;  4BA2 A;  2JEB B;  2PNZ A;  5C0X F;  5JEA F;  4NBQ A;  5C0X D;  5C0X E;  1OYS A;  3L7Z B;  3CDI A;  2NN6 E;  1UDS A;  2NN6 D;  3GLL A;  3GME A;  2C39 B;  2NN6 F;  5C0X B;  4BA1 B;  2C38 A;  2JEA B;  5K36 D;  4IFD A;  3B4T A;  4IFD B;  2JEA A;  3U1K A;  4OO1 D;  3DD6 A;  3GCM A;  2PO2 B;  5JEA C;  2PO0 A;  4BA1 A;  4AIM A;  5K36 A;  2C39 A;  4IFD D;  4AID A;  1UDO A;  3M85 D;  2BA0 D;  3L7Z A;  5K36 E;  2JE6 B;  2WNR B;  1R6L A;  3H1C A;  2C38 B;  4IFD E;  2WNR A;  1OYP A;  2C37 B;  2NN6 A;  5JEA B;  4OO1 F;  4OO1 E;  2PO0 B;  1UDN A;  4AM3 A;  2PO1 A;  2NN6 C;  2PO2 A;  2PNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...