2C38A

Rnase ph core of the archaeal exosome in complex with a5 rna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
271
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 80
structure length 271
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c38A01
5C0XF 2JE6A 3GCMA 2PO0B 2PO2A 4OO1F 4BA2B 2PNZB 3M7ND 5JEAC 1UDNA 3B4TA 4OO1B 5JEAB 2NN6A 5C0XD 3GMEA 2PO1B 2NN6E 4OO1D 2C38A 1UDQA 4AIDA 2C37A 5JEAF 2JEBA 2BR2A 2WNRB 3M85G 4BA1A 3DD6A 5C0XE 4IFDC 2NN6C 5K36C 4NBQA 2BA0G 2C39A 3L7ZA 4IFDB 5K36B 4AM3A 3CDIA 1OYPA 2JEAB 1R6MA 2WP8A 2PO0A 2JE6B 5JEAD 4BA2A 3CDJA 2PO2B 5C0XA 4AIMA 2JEBB 2BR2B 3M7NG 2NN6F 4IFDF 1UDOA 3U1KA 5K36F 2BA1G 1E3PA 4OO1A 1OYRA 4OO1E 1R6LA 2NN6B 5JEAE 1E3HA 3H1CA 2PO1A 2WP8B 3GLLA 1UDSA 2C38B 5C0XC 4IFDD 2NN6D 5K36D 2C37B 3HKMA 4OO1C 2WNRA 5C0XB 2PNZA 3M85D 3KRNA 2BA1D 4BA1B 5JEAA 2BA0D 4IFDA 5K36A 2C39B 3L7ZB 1OYSA 4IFDE 2JEAA 5K36E
chains in the Genus database with same CATH superfamily
2JE6A 1XMOI 1KTVA 4B3ME 3J7AG 3ZKBA 1FWLA 4DU8A 5ELWA 4DUZE 2DEJA 4X62I 1EI1A 5GMDA 3QT5A 3T1YI 5BR8I 1Z0BA 4DV1E 3OTOE 3B4TA 4GQUA 3PRYA 3HULA 4FN5A 2NN6A 3H4LA 2A2DA 3P3CA 1N33E 1VISA 4R1FA 5C0XD 1HNWE 4OO1D 4AIDA 2VQEI 4USKA 4X65E 4DUYE 4UT4A 2O1TA 3ZZ0A 4OKGA 1IBMI 5FLXC 2AE8A 5JEAF 2HHHI 4DPYA 1HNZE 1UEKA 3DD6A 4IZJD 4JV5E 2NN6C 4LF6I 3J81C 2V8PA 1H7SA 2C39A 3L7ZA 4XTJA 1S16A 4B3MI 1Y4SA 4JI0I 4DXLA 4MDTA 3J80C 4AM3A 5A2QQ 1NZ0A 4IZJA 5DROA 1R6MA 4FWHA 1ZXMA 3P06A 4PU9A 5DRPA 3JAMQ 2JE6B 1IBLE 1MX0A 4DR1E 4DV1I 3OTOI 1XHKA 3CDJA 2GQ0A 4DPXA 1KKHA 4FWGA 2JEBB 4OX9I 2BR2B 1YH8A 2E5LE 1N33I 1P42A 2BA1G 1HNWI 4LF8E 4LPFA 1PIEA 4QNJA 2NN6B 4FW6A 4X65I 4DUYI 4JI4E 5GMEA 4B3TE 5IT9Q 1HNZI 1Z5CA 1IBKE 1FNMA 4JV5I 4FW3A 4IFDD 4DR7E 5K36D 4KQVA 1USUA 5C0XB 2V2QA 1XMQI 4JI7E 4LOMA 4FWDA 1ZM2A 4JYAE 4IFDA 5K36A 4JG4A 2C39B 2R3VA 3L7ZB 3UHMA 1Y60A 3T1HI 3T1YE 5BR8E 3V2UC 1IBLI 4DR1I 3PYGA 2JEAA 4IZJB 4MQYA 4WUCA 1NHJA 1N0VC 3B78A 4P52A 3QT6A 4USMA 5DNLA 1UDNA 2VQEE 4B3SI 1XNRE 1FKAE 4B3TI 1HNXE 4I3HA 4MU0A 3PYEA 4DV7I 1IBKI 2ZBKB 2NN6E 4LF6E 4NXNI 4OZEA 2C38A 1UDQA 1ZM3A 3U1YA 5DRRA 4JI2E 4JI0E 4JI7I 4JI1I 3HJCA 3J81Q 4JYAI 4FW9A 4DR2I 5LL6R 2JEBA 2BR2A 3M85G 5C0XE 3PS3A 2UXDE 2DEIA 2WW4A 4JI3I 4IFDB 4OX9E 2AJ4A 2CGEA 3NZKA 5K36B 4MU3A 1ZM4A 4LFAI 3LNUA 4LF5E 2JEAB 4DV3E 3CWVA 4K0KE 2IERA 5JEAD 1XNRI 2ZM6I 1YHCA 3QT8A 1KVKA 1HNXI 5C0XA 2UXBI 4HYMA 2O3ZA 5LMUI 3M7NG 2NN6F 1UDOA 4OO1A 1E3PA 4LF9E 1Z0VA 2A2CA 4HACA 4URLA 4MYTA 4DPWA 1XMQE 4JI2I 1E3HA 2PO1A 1Z0WA 4LFCI 3D4JA 1DARA 1B63A 2WP8B 2C38B 2E1RA 5C0XC 3T1HE 4WUDA 2UXDI 4B3RE 4OO1C 5DNXA 1U2RA 2WNRA 3PS1A 4MU1A 2EFGA 4HXZA 3M85D 4FW4A 4LF5I 4DV3I 4K0KI 4X64E 4B3SE 4IZKA 1OJ4A 4IFDE 4IS9A 5K36E 4N3OA 2IESA 2UUAE 1N32I 4DV7E 2CG9A 4LF9I 1I94I 4NXNE 1Y4UA 2PNZB 1Z0TA 3J7AM 3M7ND 3GONA 3PS2A 4X66I 2UUBI 2OI2A 4OO1B 4JI1E 4NXME 2GO3A 2IOPA 2GO4A 5JEAB 2UUCE 4HACB 4DR2E 1VI7A 2F1DA 3ZZUA 4DR5E 4LF4E 2HK3A 2V2ZA 4Z7YA 2BV3A 3GMEA 2PO1B 1FJGI 4B3RI 4LF7E 1Z0GA 2VF3A 4JI3E 2CVEA 5A2QC 1A6FA 5LMNI 5L3JA 4LFAE 2NPFA 1HK7A 3JAMC 1Y5YA 2WNRB 4X64I 1N36I 4UTGA 4BA1A 2V34A 1N34E 3M6AA 4IFDC 3WU3A 5K36C 4NBQA 4U3BA 2ZM6E 4MYUA 2BA0G 5DRQA 2UXBE 2UUAI 3ZM7A 4DV6I 1HR0E 5LMUE 4U3DA 4DR4E 5IWAE 3CDIA 1OYPA 4IZKB 4JI6E 2WP8A 5FLXQ 1RREA 2PO0A 4JI5I 4YHHI 4BA2A 3V5RA 4EMDA 5IT9C 2F4VE 1J5EI 4LFCE 4NXMI 2HFSA 2UUCI 1ZXNA 4DR5I 3LTOA 3PYFA 4LF4I 3Q1QA 2Q2EB 3J80Q 3WU6A 1QZRA 4LCGA 4LF7I 1Z5BA 4OO1E 1H73A 1R6LA 1WUUA 2ZITA 3K1JA 5JEAE 3H1CA 2Z5BA 1FI4A 3Q6MA 2HKJA 3Q6NA 4LCFA 4DV4E 4DV2E 3K17A 1N34I 2NN6D 3HKMA 2PNZA 1PVGA 1HR0I 1FWKA 1N32E 4ZVIA 1K47A 4DR4I 2IOQA 3WU4A 4BA1B 2UXCE 1BKNA 5IWAI 4MU4A 3F0NA 4M1KA 5JEAA 2BA0D 1I94E 4JI6I 2V2VA 4DPTA 5FWKA 4GKJI 2Z5EA 2HFUA 2J7KA 1ZM9A 2VQFE 3P3EA 1H74A 2F4VI 4X66E 4AQYE 2UUBE 1Y6ZA 4KHPE 5C0XF 1KIJA 1XXEA 3GCMA 4DV5I 2R42A 2PO0B 4GKKE 1N0UA 2PO2A 4OO1F 4BA2B 4DR3I 1FJGE 4FW7A 1H72C 2O1UA 5JEAC 4RPFA 5LMNE 1XNQE 4YY3E 3QT7A 2UU9I 1D6TA 4DV4I 2Z5CA 4DV2I 1RR9A 4DUZI 1N36E 1NHHA 2XEXA 5EKWA 2Z5BB 2PNMA 4DV6E 4DR6E 2C37A 2UXCI 1MG7A 4DV0E 4DPUA 4J3DA 4JI5E 4YHHE 2J65A 2VQFI 2LJPA 4Z7CA 3P3GA 4AQYI 1J5EE 1Z59A 4KHPI 2BM0A 4JI8E 4ED4A 2O1WA 2X7IA 4GKKI 1USVA 4LFBE 4PRXA 3ZKDA 2O1VA 1ELOA 4P7AA 1XNQI 2PO2B 4ISAA 4YY3I 1XMOE 4AIMA 4HY1A 1PKPA 4IFDF 3U1KA 5K36F 1NHIA 1Z5AA 4QNKA 3ZZTA 1OYRA 4X62E 1EA6A 2BM1A 4FW5A 2Z5CB 4DR6I 2HK2A 3LPSA 4WUBA 2E5LI 3GLLA 1UDSA 2VESA 3WU5A 4DV0I 3K85A 1RHYA 4GKJE 2JT2A 5EL9A 1B62A 1Z0CA 2HKEA 2C37B 4LF8I 1H7UA 1MU5A 3PYDA 2GS8A 2PNLA 4JI8I 3KRNA 2BA1D 4DV5E 4DU7A 3P76A 4JI4I 1IBME 4LFBI 2CZ9A 1S4EA 4LCHA 2HHHE 4DR3E 3B82A 3B8HA 2X36A 1OYSA 4DR7I 1Z0EA 4PRVA 2UU9E
chains in the Genus database with same CATH topology
5C0XF 2JE6A 3GCMA 2PO0B 2PO2A 4OO1F 4BA2B 2PNZB 3M7ND 5JEAC 1UDNA 3B4TA 4OO1B 5JEAB 2NN6A 5C0XD 3GMEA 2PO1B 2NN6E 4OO1D 2C38A 1UDQA 4AIDA 2C37A 5JEAF 2JEBA 2BR2A 2WNRB 3M85G 4BA1A 3DD6A 5C0XE 4IFDC 2NN6C 5K36C 4NBQA 2BA0G 2C39A 3L7ZA 4IFDB 5K36B 4AM3A 3CDIA 1OYPA 2JEAB 1R6MA 2WP8A 2PO0A 2JE6B 5JEAD 4BA2A 3CDJA 2PO2B 5C0XA 4AIMA 2JEBB 2BR2B 3M7NG 2NN6F 4IFDF 1UDOA 3U1KA 5K36F 2BA1G 1E3PA 4OO1A 1OYRA 4OO1E 1R6LA 2NN6B 5JEAE 1E3HA 3H1CA 2PO1A 2WP8B 3GLLA 1UDSA 2C38B 5C0XC 4IFDD 2NN6D 5K36D 2C37B 3HKMA 4OO1C 2WNRA 5C0XB 2PNZA 3M85D 3KRNA 2BA1D 4BA1B 5JEAA 2BA0D 4IFDA 5K36A 2C39B 3L7ZB 1OYSA 4IFDE 2JEAA 5K36E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X F;  2JE6 A;  3GCM A;  2PO0 B;  2PO2 A;  4OO1 F;  4BA2 B;  2PNZ B;  3M7N D;  5JEA C;  1UDN A;  3B4T A;  4OO1 B;  5JEA B;  2NN6 A;  5C0X D;  3GME A;  2PO1 B;  2NN6 E;  4OO1 D;  2C38 A;  1UDQ A;  4AID A;  2C37 A;  5JEA F;  2JEB A;  2BR2 A;  2WNR B;  3M85 G;  4BA1 A;  3DD6 A;  5C0X E;  4IFD C;  2NN6 C;  5K36 C;  4NBQ A;  2BA0 G;  2C39 A;  3L7Z A;  4IFD B;  5K36 B;  4AM3 A;  3CDI A;  1OYP A;  2JEA B;  1R6M A;  2WP8 A;  2PO0 A;  2JE6 B;  5JEA D;  4BA2 A;  3CDJ A;  2PO2 B;  5C0X A;  4AIM A;  2JEB B;  2BR2 B;  3M7N G;  2NN6 F;  4IFD F;  1UDO A;  3U1K A;  5K36 F;  2BA1 G;  1E3P A;  4OO1 A;  1OYR A;  4OO1 E;  1R6L A;  2NN6 B;  5JEA E;  1E3H A;  3H1C A;  2PO1 A;  2WP8 B;  3GLL A;  1UDS A;  2C38 B;  5C0X C;  4IFD D;  2NN6 D;  5K36 D;  2C37 B;  3HKM A;  4OO1 C;  2WNR A;  5C0X B;  2PNZ A;  3M85 D;  3KRN A;  2BA1 D;  4BA1 B;  5JEA A;  2BA0 D;  4IFD A;  5K36 A;  2C39 B;  3L7Z B;  1OYS A;  4IFD E;  2JEA A;  5K36 E; 
#chains in the Genus database with same CATH topology
 2JE6 A;  1XMO I;  1KTV A;  4B3M E;  3J7A G;  3ZKB A;  1FWL A;  4DU8 A;  5ELW A;  4DUZ E;  2DEJ A;  4X62 I;  1EI1 A;  5GMD A;  3QT5 A;  3T1Y I;  5BR8 I;  1Z0B A;  4DV1 E;  3OTO E;  3B4T A;  4GQU A;  3PRY A;  3HUL A;  4FN5 A;  2NN6 A;  3H4L A;  2A2D A;  3P3C A;  1N33 E;  1VIS A;  4R1F A;  5C0X D;  1HNW E;  4OO1 D;  4AID A;  2VQE I;  4USK A;  4X65 E;  4DUY E;  4UT4 A;  2O1T A;  3ZZ0 A;  4OKG A;  1IBM I;  5FLX C;  2AE8 A;  5JEA F;  2HHH I;  4DPY A;  1HNZ E;  1UEK A;  3DD6 A;  4IZJ D;  4JV5 E;  2NN6 C;  4LF6 I;  3J81 C;  2V8P A;  1H7S A;  2C39 A;  3L7Z A;  4XTJ A;  1S16 A;  4B3M I;  1Y4S A;  4JI0 I;  4DXL A;  4MDT A;  3J80 C;  4AM3 A;  5A2Q Q;  1NZ0 A;  4IZJ A;  5DRO A;  1R6M A;  4FWH A;  1ZXM A;  3P06 A;  4PU9 A;  5DRP A;  3JAM Q;  2JE6 B;  1IBL E;  1MX0 A;  4DR1 E;  4DV1 I;  3OTO I;  1XHK A;  3CDJ A;  2GQ0 A;  4DPX A;  1KKH A;  4FWG A;  2JEB B;  4OX9 I;  2BR2 B;  1YH8 A;  2E5L E;  1N33 I;  1P42 A;  2BA1 G;  1HNW I;  4LF8 E;  4LPF A;  1PIE A;  4QNJ A;  2NN6 B;  4FW6 A;  4X65 I;  4DUY I;  4JI4 E;  5GME A;  4B3T E;  5IT9 Q;  1HNZ I;  1Z5C A;  1IBK E;  1FNM A;  4JV5 I;  4FW3 A;  4IFD D;  4DR7 E;  5K36 D;  4KQV A;  1USU A;  5C0X B;  2V2Q A;  1XMQ I;  4JI7 E;  4LOM A;  4FWD A;  1ZM2 A;  4JYA E;  4IFD A;  5K36 A;  4JG4 A;  2C39 B;  2R3V A;  3L7Z B;  3UHM A;  1Y60 A;  3T1H I;  3T1Y E;  5BR8 E;  3V2U C;  1IBL I;  4DR1 I;  3PYG A;  2JEA A;  4IZJ B;  4MQY A;  4WUC A;  1NHJ A;  1N0V C;  3B78 A;  4P52 A;  3QT6 A;  4USM A;  5DNL A;  1UDN A;  2VQE E;  4B3S I;  1XNR E;  1FKA E;  4B3T I;  1HNX E;  4I3H A;  4MU0 A;  3PYE A;  4DV7 I;  1IBK I;  2ZBK B;  2NN6 E;  4LF6 E;  4NXN I;  4OZE A;  2C38 A;  1UDQ A;  1ZM3 A;  3U1Y A;  5DRR A;  4JI2 E;  4JI0 E;  4JI7 I;  4JI1 I;  3HJC A;  3J81 Q;  4JYA I;  4FW9 A;  4DR2 I;  5LL6 R;  2JEB A;  2BR2 A;  3M85 G;  5C0X E;  3PS3 A;  2UXD E;  2DEI A;  2WW4 A;  4JI3 I;  4IFD B;  4OX9 E;  2AJ4 A;  2CGE A;  3NZK A;  5K36 B;  4MU3 A;  1ZM4 A;  4LFA I;  3LNU A;  4LF5 E;  2JEA B;  4DV3 E;  3CWV A;  4K0K E;  2IER A;  5JEA D;  1XNR I;  2ZM6 I;  1YHC A;  3QT8 A;  1KVK A;  1HNX I;  5C0X A;  2UXB I;  4HYM A;  2O3Z A;  5LMU I;  3M7N G;  2NN6 F;  1UDO A;  4OO1 A;  1E3P A;  4LF9 E;  1Z0V A;  2A2C A;  4HAC A;  4URL A;  4MYT A;  4DPW A;  1XMQ E;  4JI2 I;  1E3H A;  2PO1 A;  1Z0W A;  4LFC I;  3D4J A;  1DAR A;  1B63 A;  2WP8 B;  2C38 B;  2E1R A;  5C0X C;  3T1H E;  4WUD A;  2UXD I;  4B3R E;  4OO1 C;  5DNX A;  1U2R A;  2WNR A;  3PS1 A;  4MU1 A;  2EFG A;  4HXZ A;  3M85 D;  4FW4 A;  4LF5 I;  4DV3 I;  4K0K I;  4X64 E;  4B3S E;  4IZK A;  1OJ4 A;  4IFD E;  4IS9 A;  5K36 E;  4N3O A;  2IES A;  2UUA E;  1N32 I;  4DV7 E;  2CG9 A;  4LF9 I;  1I94 I;  4NXN E;  1Y4U A;  2PNZ B;  1Z0T A;  3J7A M;  3M7N D;  3GON A;  3PS2 A;  4X66 I;  2UUB I;  2OI2 A;  4OO1 B;  4JI1 E;  4NXM E;  2GO3 A;  2IOP A;  2GO4 A;  5JEA B;  2UUC E;  4HAC B;  4DR2 E;  1VI7 A;  2F1D A;  3ZZU A;  4DR5 E;  4LF4 E;  2HK3 A;  2V2Z A;  4Z7Y A;  2BV3 A;  3GME A;  2PO1 B;  1FJG I;  4B3R I;  4LF7 E;  1Z0G A;  2VF3 A;  4JI3 E;  2CVE A;  5A2Q C;  1A6F A;  5LMN I;  5L3J A;  4LFA E;  2NPF A;  1HK7 A;  3JAM C;  1Y5Y A;  2WNR B;  4X64 I;  1N36 I;  4UTG A;  4BA1 A;  2V34 A;  1N34 E;  3M6A A;  4IFD C;  3WU3 A;  5K36 C;  4NBQ A;  4U3B A;  2ZM6 E;  4MYU A;  2BA0 G;  5DRQ A;  2UXB E;  2UUA I;  3ZM7 A;  4DV6 I;  1HR0 E;  5LMU E;  4U3D A;  4DR4 E;  5IWA E;  3CDI A;  1OYP A;  4IZK B;  4JI6 E;  2WP8 A;  5FLX Q;  1RRE A;  2PO0 A;  4JI5 I;  4YHH I;  4BA2 A;  3V5R A;  4EMD A;  5IT9 C;  2F4V E;  1J5E I;  4LFC E;  4NXM I;  2HFS A;  2UUC I;  1ZXN A;  4DR5 I;  3LTO A;  3PYF A;  4LF4 I;  3Q1Q A;  2Q2E B;  3J80 Q;  3WU6 A;  1QZR A;  4LCG A;  4LF7 I;  1Z5B A;  4OO1 E;  1H73 A;  1R6L A;  1WUU A;  2ZIT A;  3K1J A;  5JEA E;  3H1C A;  2Z5B A;  1FI4 A;  3Q6M A;  2HKJ A;  3Q6N A;  4LCF A;  4DV4 E;  4DV2 E;  3K17 A;  1N34 I;  2NN6 D;  3HKM A;  2PNZ A;  1PVG A;  1HR0 I;  1FWK A;  1N32 E;  4ZVI A;  1K47 A;  4DR4 I;  2IOQ A;  3WU4 A;  4BA1 B;  2UXC E;  1BKN A;  5IWA I;  4MU4 A;  3F0N A;  4M1K A;  5JEA A;  2BA0 D;  1I94 E;  4JI6 I;  2V2V A;  4DPT A;  5FWK A;  4GKJ I;  2Z5E A;  2HFU A;  2J7K A;  1ZM9 A;  2VQF E;  3P3E A;  1H74 A;  2F4V I;  4X66 E;  4AQY E;  2UUB E;  1Y6Z A;  4KHP E;  5C0X F;  1KIJ A;  1XXE A;  3GCM A;  4DV5 I;  2R42 A;  2PO0 B;  4GKK E;  1N0U A;  2PO2 A;  4OO1 F;  4BA2 B;  4DR3 I;  1FJG E;  4FW7 A;  1H72 C;  2O1U A;  5JEA C;  4RPF A;  5LMN E;  1XNQ E;  4YY3 E;  3QT7 A;  2UU9 I;  1D6T A;  4DV4 I;  2Z5C A;  4DV2 I;  1RR9 A;  4DUZ I;  1N36 E;  1NHH A;  2XEX A;  5EKW A;  2Z5B B;  2PNM A;  4DV6 E;  4DR6 E;  2C37 A;  2UXC I;  1MG7 A;  4DV0 E;  4DPU A;  4J3D A;  4JI5 E;  4YHH E;  2J65 A;  2VQF I;  2LJP A;  4Z7C A;  3P3G A;  4AQY I;  1J5E E;  1Z59 A;  4KHP I;  2BM0 A;  4JI8 E;  4ED4 A;  2O1W A;  2X7I A;  4GKK I;  1USV A;  4LFB E;  4PRX A;  3ZKD A;  2O1V A;  1ELO A;  4P7A A;  1XNQ I;  2PO2 B;  4ISA A;  4YY3 I;  1XMO E;  4AIM A;  4HY1 A;  1PKP A;  4IFD F;  3U1K A;  5K36 F;  1NHI A;  1Z5A A;  4QNK A;  3ZZT A;  1OYR A;  4X62 E;  1EA6 A;  2BM1 A;  4FW5 A;  2Z5C B;  4DR6 I;  2HK2 A;  3LPS A;  4WUB A;  2E5L I;  3GLL A;  1UDS A;  2VES A;  3WU5 A;  4DV0 I;  3K85 A;  1RHY A;  4GKJ E;  2JT2 A;  5EL9 A;  1B62 A;  1Z0C A;  2HKE A;  2C37 B;  4LF8 I;  1H7U A;  1MU5 A;  3PYD A;  2GS8 A;  2PNL A;  4JI8 I;  3KRN A;  2BA1 D;  4DV5 E;  4DU7 A;  3P76 A;  4JI4 I;  1IBM E;  4LFB I;  2CZ9 A;  1S4E A;  4LCH A;  2HHH E;  4DR3 E;  3B82 A;  3B8H A;  2X36 A;  1OYS A;  4DR7 I;  1Z0E A;  4PRV A;  2UU9 E; 
#chains in the Genus database with same CATH homology
 5C0X F;  2JE6 A;  3GCM A;  2PO0 B;  2PO2 A;  4OO1 F;  4BA2 B;  2PNZ B;  3M7N D;  5JEA C;  1UDN A;  3B4T A;  4OO1 B;  5JEA B;  2NN6 A;  5C0X D;  3GME A;  2PO1 B;  2NN6 E;  4OO1 D;  2C38 A;  1UDQ A;  4AID A;  2C37 A;  5JEA F;  2JEB A;  2BR2 A;  2WNR B;  3M85 G;  4BA1 A;  3DD6 A;  5C0X E;  4IFD C;  2NN6 C;  5K36 C;  4NBQ A;  2BA0 G;  2C39 A;  3L7Z A;  4IFD B;  5K36 B;  4AM3 A;  3CDI A;  1OYP A;  2JEA B;  1R6M A;  2WP8 A;  2PO0 A;  2JE6 B;  5JEA D;  4BA2 A;  3CDJ A;  2PO2 B;  5C0X A;  4AIM A;  2JEB B;  2BR2 B;  3M7N G;  2NN6 F;  4IFD F;  1UDO A;  3U1K A;  5K36 F;  2BA1 G;  1E3P A;  4OO1 A;  1OYR A;  4OO1 E;  1R6L A;  2NN6 B;  5JEA E;  1E3H A;  3H1C A;  2PO1 A;  2WP8 B;  3GLL A;  1UDS A;  2C38 B;  5C0X C;  4IFD D;  2NN6 D;  5K36 D;  2C37 B;  3HKM A;  4OO1 C;  2WNR A;  5C0X B;  2PNZ A;  3M85 D;  3KRN A;  2BA1 D;  4BA1 B;  5JEA A;  2BA0 D;  4IFD A;  5K36 A;  2C39 B;  3L7Z B;  1OYS A;  4IFD E;  2JEA A;  5K36 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...