2C38A

Rnase ph core of the archaeal exosome in complex with a5 rna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
271
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 80
structure length 271
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c38A01
1E3PA 1R6MA 3L7ZB 4OO1D 2WNRB 5JEAD 2PO0B 5JEAF 5C0XE 4IFDE 2BA1G 2WP8B 2C39A 4BA1A 5C0XD 4IFDD 2JEAA 2NN6A 1E3HA 1OYSA 2JE6B 2JEBB 4OO1E 5JEAA 2PO2B 2JEBA 5JEAB 1OYRA 4BA2B 1UDQA 2C38B 3GCMA 2NN6F 2WP8A 3HKMA 2BR2B 5K36F 2NN6B 2BA1D 3U1KA 3H1CA 2JE6A 5K36A 1UDSA 4OO1B 3L7ZA 2C37A 3M85D 5C0XF 5JEAE 4IFDF 2C37B 2BA0D 2PO1A 2JEAB 3B4TA 5C0XC 4IFDC 5JEAC 3M7NG 3GLLA 5K36C 2PO2A 4AM3A 3M85G 2PNZB 4OO1C 3CDIA 4NBQA 5K36E 1OYPA 4BA2A 2C38A 1UDOA 5C0XA 4IFDA 2PO1B 1R6LA 2NN6C 2BR2A 5C0XB 4IFDB 2BA0G 1UDNA 3M7ND 4AIMA 4OO1F 2NN6E 3GMEA 2PO0A 4OO1A 2PNZA 4AIDA 2C39B 3CDJA 4BA1B 2NN6D 5K36B 2WNRA 3KRNA 3DD6A 5K36D
chains in the Genus database with same CATH superfamily
4B3ME 3ZZ0A 1E3PA 1R6MA 4DR1E 4JI5E 1YH8A 5IT9Q 4IFDE 2JT2A 5BR8I 2O3ZA 4FWHA 4DR7E 4DR5E 4DV7I 2PNMA 5C0XD 3B8HA 2NN6A 1E3HA 2NPFA 1OYSA 4JI2I 4WUCA 4LCGA 4FWGA 2JEBB 3GONA 1KTVA 3WU3A 4K0KE 4ZVIA 5JEAA 1N36E 1WUUA 1OYRA 2F1DA 4BA2B 3P3CA 1FJGE 1UDQA 2ZITA 1I94I 1K47A 4I3HA 4HXZA 1HNWE 4DR7I 2Z5BA 4JV5E 4DR5I 2J7KA 1OJ4A 2WW4A 4WUDA 2UXBI 3V5RA 2PNLA 5FLXC 4LF7E 5K36F 3ZKDA 1D6TA 3HULA 4OX9E 1XMQE 4LFAI 1XNQI 1ZM4A 4JI1E 2HHHE 4OO1B 3L7ZA 2C37A 1ZXNA 4GKJE 3K17A 4UTGA 1MU5A 4DV7E 1RREA 1IBLE 1Z0EA 1XMQI 4DV4I 2V2ZA 4JI8I 2PO1A 4JI5I 4KHPE 4USKA 2JEAB 3PS2A 4YY3E 4GKKI 3J7AM 5JEAC 4U3BA 4B3RE 1Z0VA 3M7NG 3WU6A 4LFAE 1Z0TA 4U3DA 3M85G 4OO1C 2GO4A 4FN5A 1XNRE 3ZZUA 4LF5E 4PRXA 4IFDA 4LF7I 1R6LA 1N33E 4EMDA 4B3RI 2DEJA 5C0XB 5FLXQ 4DV0E 3NZKA 2BA0G 3M7ND 2CZ9A 2HFSA 4N3OA 4HACB 1XNRI 3LNUA 5BR8E 4JV5I 1B63A 1RHYA 1N33I 2AE8A 1A6FA 4DPTA 5LMNI 2UUAE 4MYTA 4RPFA 4DV0I 4DUZE 1UEKA 5K36B 4GKKE 4M1KA 4OX9I 1MX0A 3Q6NA 4X62E 1N0UA 4LCHA 1Z5BA 2WNRB 5DRQA 4MYUA 4JI1I 2IESA 5JEAD 2PO0B 1I94E 4LF8I 5DNXA 2UUBI 4ISAA 5LMUE 1PVGA 3J81Q 1NHJA 2J65A 2JE6B 1VISA 4DUYE 4AQYE 2HHHI 4LF9E 4LF8E 3PYFA 4GKJI 2PO2B 1Z0WA 5EKWA 4MDTA 2BM0A 1P42A 1ZM3A 3V2UC 3B78A 1Y60A 3WU4A 4IS9A 1NHHA 2O1WA 2C38B 2O1TA 3GCMA 4P7AA 4DV4E 5FWKA 4B3SI 2HK3A 3J80C 4X64I 3HKMA 4FW7A 2GS8A 4DUZI 4Z7CA 2NN6B 2OI2A 1HR0I 1HNXE 2E5LI 4YHHE 1UDSA 5LMNE 2UUAI 4DR4E 3CWVA 2UXBE 2R3VA 5C0XF 5JEAE 3M85D 3J7AG 1ELOA 2XEXA 2X7IA 2IERA 2BA0D 2X36A 1H74A 4WUBA 3B4TA 5C0XC 4QNKA 4IZJA 4JI7I 4JG4A 4X62I 4DV1E 2Z5CB 1HNXI 3PYDA 4YHHI 4DV5I 5K36C 4DR4I 5IWAI 2UXCI 4GQUA 4LCFA 4BA2A 5A2QQ 4JI3E 5GMDA 4YY3I 1UDOA 3LTOA 5LMUI 5GMEA 4LFBE 4DR6I 3PYGA 4DPWA 4DU7A 1Z5AA 4JI6E 1J5EE 4IZJB 1ZXMA 1FWLA 1N32E 1Y4SA 5DRPA 4AIMA 1XMOE 3H4LA 4UT4A 3P76A 4DR3E 2HK2A 2PO0A 2LJPA 3OTOI 2DEIA 3PS1A 2C39B 4DPUA 3CDJA 2UU9E 4X65E 2Z5EA 4R1FA 4JI6I 5LL6R 4DU8A 1Z5CA 4DPYA 2WNRA 3KRNA 1XMOI 3P3EA 4JI4I 4DR3I 4ED4A 1EI1A 4P52A 4DV5E 3Q1QA 4JI8E 5JEAF 4X65I 3P06A 5C0XE 1S4EA 1IBKE 4DPXA 1KVKA 1S16A 2BA1G 4DV6E 4JI3I 2V34A 4KQVA 4MU3A 4IFDD 4IZKB 3JAMC 4JI4E 2UXDE 3QT7A 3UHMA 1HNZI 4LFCE 1J5EI 1N32I 2F4VI 4JI7E 4OO1E 3T1HE 2IOQA 4LF5I 2JEBA 4NXMI 1FWKA 2O1VA 2UUBE 1USUA 2A2CA 2ZBKB 4OKGA 1Y6ZA 4FW9A 4LF6I 2NN6F 4DXLA 1NHIA 4DV6I 4AQYI 2BR2B 3K1JA 2BA1D 4JYAI 4NXME 4DV1I 1PKPA 4FW6A 1XHKA 1N34E 4LFCI 3P3GA 1KIJA 1Z0BA 1Z0CA 4DV2E 2UXCE 4MQYA 4X64E 5ELWA 1H7UA 4LFBI 4MU0A 2UU9I 1Y4UA 4X66E 3D4JA 4LOMA 4JI0E 1Z59A 4Z7YA 3LPSA 4LF4E 5DRRA 3HJCA 1NZ0A 2PO2A 4HACA 1ZM2A 4NXNI 1DARA 4QNJA 2PNZB 3CDIA 4NBQA 1XXEA 4DUYI 3JAMQ 1OYPA 1N36I 2F4VE 2VF3A 5IT9C 3ZZTA 5C0XA 1Y5YA 3J80Q 1FJGI 4DR2E 3QT5A 1VI7A 4IFDB 1N34I 4FWDA 4LF6E 1HK7A 1QZRA 1PIEA 1ZM9A 1USVA 2HKEA 4B3MI 4OO1A 2UUCE 4AIDA 4DR1I 4MU1A 1HR0E 4BA1B 2E5LE 4USMA 1HNZE 4X66I 2V8PA 2JE6A 3T1HI 3DD6A 3PYEA 3M6AA 4HYMA 3L7ZB 4OO1D 3OTOE 4J3DA 3J81C 2O1UA 5DROA 3T1YE 2GQ0A 4HY1A 2HKJA 4LF4I 2WP8B 2C39A 4BA1A 2IOPA 2JEAA 4DV3E 2CG9A 1IBME 1FNMA 4MU4A 5IWAE 1FKAE 3PRYA 5DNLA 4DV2I 2GO3A 1H7SA 5EL9A 5JEAB 2VQFE 1BKNA 2CGEA 3ZM7A 2UUCI 4DR6E 1XNQE 4DV3I 1EA6A 2WP8A 3Q6MA 4IZKA 4FW5A 4FW4A 3U1KA 3H1CA 3ZKBA 2AJ4A 3F0NA 4LPFA 5K36A 1KKHA 4KHPI 2VQEE 1YHCA 4K0KI 1H72C 1B62A 3PS3A 2VQFI 4IFDF 5A2QC 2BM1A 2C37B 4JYAE 2Z5BB 2CVEA 4DR2I 1MG7A 1U2RA 3QT6A 2V2VA 4IFDC 2Q2EB 1IBKI 3WU5A 1N0VC 3U1YA 2VESA 3QT8A 4XTJA 5L3JA 4URLA 2R42A 3GLLA 4PU9A 4JI2E 1FI4A 4AM3A 2UXDI 3T1YI 5K36E 2BV3A 1IBMI 3B82A 4JI0I 4LF9I 1Z0GA 2C38A 2E1RA 2PO1B 2V2QA 2NN6C 2BR2A 4B3TI 2EFGA 2HFUA 4B3SE 1UDNA 2Z5CA 4NXNE 4OO1F 3K85A 2ZM6E 1H73A 2NN6E 3GMEA 2PNZA 2A2DA 4FW3A 4PRVA 4B3TE 1HNWI 2NN6D 2VQEI 1RR9A 4OZEA 2ZM6I 1IBLI 4IZJD 5K36D
chains in the Genus database with same CATH topology
1E3PA 1R6MA 3L7ZB 4OO1D 2WNRB 5JEAD 2PO0B 5JEAF 5C0XE 4IFDE 2BA1G 2WP8B 2C39A 4BA1A 5C0XD 4IFDD 2JEAA 2NN6A 1E3HA 1OYSA 2JE6B 2JEBB 4OO1E 5JEAA 2PO2B 2JEBA 5JEAB 1OYRA 4BA2B 1UDQA 2C38B 3GCMA 2NN6F 2WP8A 3HKMA 2BR2B 5K36F 2NN6B 2BA1D 3U1KA 3H1CA 2JE6A 5K36A 1UDSA 4OO1B 3L7ZA 2C37A 3M85D 5C0XF 5JEAE 4IFDF 2C37B 2BA0D 2PO1A 2JEAB 3B4TA 5C0XC 4IFDC 5JEAC 3M7NG 3GLLA 5K36C 2PO2A 4AM3A 3M85G 2PNZB 4OO1C 3CDIA 4NBQA 5K36E 1OYPA 4BA2A 2C38A 1UDOA 5C0XA 4IFDA 2PO1B 1R6LA 2NN6C 2BR2A 5C0XB 4IFDB 2BA0G 1UDNA 3M7ND 4AIMA 4OO1F 2NN6E 3GMEA 2PO0A 4OO1A 2PNZA 4AIDA 2C39B 3CDJA 4BA1B 2NN6D 5K36B 2WNRA 3KRNA 3DD6A 5K36D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  1R6M A;  3L7Z B;  4OO1 D;  2WNR B;  5JEA D;  2PO0 B;  5JEA F;  5C0X E;  4IFD E;  2BA1 G;  2WP8 B;  2C39 A;  4BA1 A;  5C0X D;  4IFD D;  2JEA A;  2NN6 A;  1E3H A;  1OYS A;  2JE6 B;  2JEB B;  4OO1 E;  5JEA A;  2PO2 B;  2JEB A;  5JEA B;  1OYR A;  4BA2 B;  1UDQ A;  2C38 B;  3GCM A;  2NN6 F;  2WP8 A;  3HKM A;  2BR2 B;  5K36 F;  2NN6 B;  2BA1 D;  3U1K A;  3H1C A;  2JE6 A;  5K36 A;  1UDS A;  4OO1 B;  3L7Z A;  2C37 A;  3M85 D;  5C0X F;  5JEA E;  4IFD F;  2C37 B;  2BA0 D;  2PO1 A;  2JEA B;  3B4T A;  5C0X C;  4IFD C;  5JEA C;  3M7N G;  3GLL A;  5K36 C;  2PO2 A;  4AM3 A;  3M85 G;  2PNZ B;  4OO1 C;  3CDI A;  4NBQ A;  5K36 E;  1OYP A;  4BA2 A;  2C38 A;  1UDO A;  5C0X A;  4IFD A;  2PO1 B;  1R6L A;  2NN6 C;  2BR2 A;  5C0X B;  4IFD B;  2BA0 G;  1UDN A;  3M7N D;  4AIM A;  4OO1 F;  2NN6 E;  3GME A;  2PO0 A;  4OO1 A;  2PNZ A;  4AID A;  2C39 B;  3CDJ A;  4BA1 B;  2NN6 D;  5K36 B;  2WNR A;  3KRN A;  3DD6 A;  5K36 D; 
#chains in the Genus database with same CATH topology
 4B3M E;  3ZZ0 A;  1E3P A;  1R6M A;  4DR1 E;  4JI5 E;  1YH8 A;  5IT9 Q;  4IFD E;  2JT2 A;  5BR8 I;  2O3Z A;  4FWH A;  4DR7 E;  4DR5 E;  4DV7 I;  2PNM A;  5C0X D;  3B8H A;  2NN6 A;  1E3H A;  2NPF A;  1OYS A;  4JI2 I;  4WUC A;  4LCG A;  4FWG A;  2JEB B;  3GON A;  1KTV A;  3WU3 A;  4K0K E;  4ZVI A;  5JEA A;  1N36 E;  1WUU A;  1OYR A;  2F1D A;  4BA2 B;  3P3C A;  1FJG E;  1UDQ A;  2ZIT A;  1I94 I;  1K47 A;  4I3H A;  4HXZ A;  1HNW E;  4DR7 I;  2Z5B A;  4JV5 E;  4DR5 I;  2J7K A;  1OJ4 A;  2WW4 A;  4WUD A;  2UXB I;  3V5R A;  2PNL A;  5FLX C;  4LF7 E;  5K36 F;  3ZKD A;  1D6T A;  3HUL A;  4OX9 E;  1XMQ E;  4LFA I;  1XNQ I;  1ZM4 A;  4JI1 E;  2HHH E;  4OO1 B;  3L7Z A;  2C37 A;  1ZXN A;  4GKJ E;  3K17 A;  4UTG A;  1MU5 A;  4DV7 E;  1RRE A;  1IBL E;  1Z0E A;  1XMQ I;  4DV4 I;  2V2Z A;  4JI8 I;  2PO1 A;  4JI5 I;  4KHP E;  4USK A;  2JEA B;  3PS2 A;  4YY3 E;  4GKK I;  3J7A M;  5JEA C;  4U3B A;  4B3R E;  1Z0V A;  3M7N G;  3WU6 A;  4LFA E;  1Z0T A;  4U3D A;  3M85 G;  4OO1 C;  2GO4 A;  4FN5 A;  1XNR E;  3ZZU A;  4LF5 E;  4PRX A;  4IFD A;  4LF7 I;  1R6L A;  1N33 E;  4EMD A;  4B3R I;  2DEJ A;  5C0X B;  5FLX Q;  4DV0 E;  3NZK A;  2BA0 G;  3M7N D;  2CZ9 A;  2HFS A;  4N3O A;  4HAC B;  1XNR I;  3LNU A;  5BR8 E;  4JV5 I;  1B63 A;  1RHY A;  1N33 I;  2AE8 A;  1A6F A;  4DPT A;  5LMN I;  2UUA E;  4MYT A;  4RPF A;  4DV0 I;  4DUZ E;  1UEK A;  5K36 B;  4GKK E;  4M1K A;  4OX9 I;  1MX0 A;  3Q6N A;  4X62 E;  1N0U A;  4LCH A;  1Z5B A;  2WNR B;  5DRQ A;  4MYU A;  4JI1 I;  2IES A;  5JEA D;  2PO0 B;  1I94 E;  4LF8 I;  5DNX A;  2UUB I;  4ISA A;  5LMU E;  1PVG A;  3J81 Q;  1NHJ A;  2J65 A;  2JE6 B;  1VIS A;  4DUY E;  4AQY E;  2HHH I;  4LF9 E;  4LF8 E;  3PYF A;  4GKJ I;  2PO2 B;  1Z0W A;  5EKW A;  4MDT A;  2BM0 A;  1P42 A;  1ZM3 A;  3V2U C;  3B78 A;  1Y60 A;  3WU4 A;  4IS9 A;  1NHH A;  2O1W A;  2C38 B;  2O1T A;  3GCM A;  4P7A A;  4DV4 E;  5FWK A;  4B3S I;  2HK3 A;  3J80 C;  4X64 I;  3HKM A;  4FW7 A;  2GS8 A;  4DUZ I;  4Z7C A;  2NN6 B;  2OI2 A;  1HR0 I;  1HNX E;  2E5L I;  4YHH E;  1UDS A;  5LMN E;  2UUA I;  4DR4 E;  3CWV A;  2UXB E;  2R3V A;  5C0X F;  5JEA E;  3M85 D;  3J7A G;  1ELO A;  2XEX A;  2X7I A;  2IER A;  2BA0 D;  2X36 A;  1H74 A;  4WUB A;  3B4T A;  5C0X C;  4QNK A;  4IZJ A;  4JI7 I;  4JG4 A;  4X62 I;  4DV1 E;  2Z5C B;  1HNX I;  3PYD A;  4YHH I;  4DV5 I;  5K36 C;  4DR4 I;  5IWA I;  2UXC I;  4GQU A;  4LCF A;  4BA2 A;  5A2Q Q;  4JI3 E;  5GMD A;  4YY3 I;  1UDO A;  3LTO A;  5LMU I;  5GME A;  4LFB E;  4DR6 I;  3PYG A;  4DPW A;  4DU7 A;  1Z5A A;  4JI6 E;  1J5E E;  4IZJ B;  1ZXM A;  1FWL A;  1N32 E;  1Y4S A;  5DRP A;  4AIM A;  1XMO E;  3H4L A;  4UT4 A;  3P76 A;  4DR3 E;  2HK2 A;  2PO0 A;  2LJP A;  3OTO I;  2DEI A;  3PS1 A;  2C39 B;  4DPU A;  3CDJ A;  2UU9 E;  4X65 E;  2Z5E A;  4R1F A;  4JI6 I;  5LL6 R;  4DU8 A;  1Z5C A;  4DPY A;  2WNR A;  3KRN A;  1XMO I;  3P3E A;  4JI4 I;  4DR3 I;  4ED4 A;  1EI1 A;  4P52 A;  4DV5 E;  3Q1Q A;  4JI8 E;  5JEA F;  4X65 I;  3P06 A;  5C0X E;  1S4E A;  1IBK E;  4DPX A;  1KVK A;  1S16 A;  2BA1 G;  4DV6 E;  4JI3 I;  2V34 A;  4KQV A;  4MU3 A;  4IFD D;  4IZK B;  3JAM C;  4JI4 E;  2UXD E;  3QT7 A;  3UHM A;  1HNZ I;  4LFC E;  1J5E I;  1N32 I;  2F4V I;  4JI7 E;  4OO1 E;  3T1H E;  2IOQ A;  4LF5 I;  2JEB A;  4NXM I;  1FWK A;  2O1V A;  2UUB E;  1USU A;  2A2C A;  2ZBK B;  4OKG A;  1Y6Z A;  4FW9 A;  4LF6 I;  2NN6 F;  4DXL A;  1NHI A;  4DV6 I;  4AQY I;  2BR2 B;  3K1J A;  2BA1 D;  4JYA I;  4NXM E;  4DV1 I;  1PKP A;  4FW6 A;  1XHK A;  1N34 E;  4LFC I;  3P3G A;  1KIJ A;  1Z0B A;  1Z0C A;  4DV2 E;  2UXC E;  4MQY A;  4X64 E;  5ELW A;  1H7U A;  4LFB I;  4MU0 A;  2UU9 I;  1Y4U A;  4X66 E;  3D4J A;  4LOM A;  4JI0 E;  1Z59 A;  4Z7Y A;  3LPS A;  4LF4 E;  5DRR A;  3HJC A;  1NZ0 A;  2PO2 A;  4HAC A;  1ZM2 A;  4NXN I;  1DAR A;  4QNJ A;  2PNZ B;  3CDI A;  4NBQ A;  1XXE A;  4DUY I;  3JAM Q;  1OYP A;  1N36 I;  2F4V E;  2VF3 A;  5IT9 C;  3ZZT A;  5C0X A;  1Y5Y A;  3J80 Q;  1FJG I;  4DR2 E;  3QT5 A;  1VI7 A;  4IFD B;  1N34 I;  4FWD A;  4LF6 E;  1HK7 A;  1QZR A;  1PIE A;  1ZM9 A;  1USV A;  2HKE A;  4B3M I;  4OO1 A;  2UUC E;  4AID A;  4DR1 I;  4MU1 A;  1HR0 E;  4BA1 B;  2E5L E;  4USM A;  1HNZ E;  4X66 I;  2V8P A;  2JE6 A;  3T1H I;  3DD6 A;  3PYE A;  3M6A A;  4HYM A;  3L7Z B;  4OO1 D;  3OTO E;  4J3D A;  3J81 C;  2O1U A;  5DRO A;  3T1Y E;  2GQ0 A;  4HY1 A;  2HKJ A;  4LF4 I;  2WP8 B;  2C39 A;  4BA1 A;  2IOP A;  2JEA A;  4DV3 E;  2CG9 A;  1IBM E;  1FNM A;  4MU4 A;  5IWA E;  1FKA E;  3PRY A;  5DNL A;  4DV2 I;  2GO3 A;  1H7S A;  5EL9 A;  5JEA B;  2VQF E;  1BKN A;  2CGE A;  3ZM7 A;  2UUC I;  4DR6 E;  1XNQ E;  4DV3 I;  1EA6 A;  2WP8 A;  3Q6M A;  4IZK A;  4FW5 A;  4FW4 A;  3U1K A;  3H1C A;  3ZKB A;  2AJ4 A;  3F0N A;  4LPF A;  5K36 A;  1KKH A;  4KHP I;  2VQE E;  1YHC A;  4K0K I;  1H72 C;  1B62 A;  3PS3 A;  2VQF I;  4IFD F;  5A2Q C;  2BM1 A;  2C37 B;  4JYA E;  2Z5B B;  2CVE A;  4DR2 I;  1MG7 A;  1U2R A;  3QT6 A;  2V2V A;  4IFD C;  2Q2E B;  1IBK I;  3WU5 A;  1N0V C;  3U1Y A;  2VES A;  3QT8 A;  4XTJ A;  5L3J A;  4URL A;  2R42 A;  3GLL A;  4PU9 A;  4JI2 E;  1FI4 A;  4AM3 A;  2UXD I;  3T1Y I;  5K36 E;  2BV3 A;  1IBM I;  3B82 A;  4JI0 I;  4LF9 I;  1Z0G A;  2C38 A;  2E1R A;  2PO1 B;  2V2Q A;  2NN6 C;  2BR2 A;  4B3T I;  2EFG A;  2HFU A;  4B3S E;  1UDN A;  2Z5C A;  4NXN E;  4OO1 F;  3K85 A;  2ZM6 E;  1H73 A;  2NN6 E;  3GME A;  2PNZ A;  2A2D A;  4FW3 A;  4PRV A;  4B3T E;  1HNW I;  2NN6 D;  2VQE I;  1RR9 A;  4OZE A;  2ZM6 I;  1IBL I;  4IZJ D;  5K36 D; 
#chains in the Genus database with same CATH homology
 1E3P A;  1R6M A;  3L7Z B;  4OO1 D;  2WNR B;  5JEA D;  2PO0 B;  5JEA F;  5C0X E;  4IFD E;  2BA1 G;  2WP8 B;  2C39 A;  4BA1 A;  5C0X D;  4IFD D;  2JEA A;  2NN6 A;  1E3H A;  1OYS A;  2JE6 B;  2JEB B;  4OO1 E;  5JEA A;  2PO2 B;  2JEB A;  5JEA B;  1OYR A;  4BA2 B;  1UDQ A;  2C38 B;  3GCM A;  2NN6 F;  2WP8 A;  3HKM A;  2BR2 B;  5K36 F;  2NN6 B;  2BA1 D;  3U1K A;  3H1C A;  2JE6 A;  5K36 A;  1UDS A;  4OO1 B;  3L7Z A;  2C37 A;  3M85 D;  5C0X F;  5JEA E;  4IFD F;  2C37 B;  2BA0 D;  2PO1 A;  2JEA B;  3B4T A;  5C0X C;  4IFD C;  5JEA C;  3M7N G;  3GLL A;  5K36 C;  2PO2 A;  4AM3 A;  3M85 G;  2PNZ B;  4OO1 C;  3CDI A;  4NBQ A;  5K36 E;  1OYP A;  4BA2 A;  2C38 A;  1UDO A;  5C0X A;  4IFD A;  2PO1 B;  1R6L A;  2NN6 C;  2BR2 A;  5C0X B;  4IFD B;  2BA0 G;  1UDN A;  3M7N D;  4AIM A;  4OO1 F;  2NN6 E;  3GME A;  2PO0 A;  4OO1 A;  2PNZ A;  4AID A;  2C39 B;  3CDJ A;  4BA1 B;  2NN6 D;  5K36 B;  2WNR A;  3KRN A;  3DD6 A;  5K36 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...