1Y5YA

Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (fae) from methylobacterium extorquens am1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
159
structure length
159
Chain Sequence
AKITKVQVGEALVGDGNEVAHIDLIIGPRGSPAETAFCNGLVNNKHGFTSLLAVIAPNLPCKPNTLMFNKVTINDARQAVQMFGPAQHGVAMAVQDAVAEGIIPADEADDLYVLVGVFIHWEAADDAKIQKYNYEATKLSIQRAVNGEPKASVVTEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How an enzyme binds the C1-carrier tetrahydromethanopterin: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Lyase
molecule keywords Formaldehyde-activating enzyme fae
total genus 55
structure length 159
sequence length 159
chains with identical sequence B, C, D, E
ec nomenclature ec 4.2.1.147: 5,6,7,8-tetrahydromethanopterin hydro-lyase.
pdb deposition date 2004-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08714 Fae Formaldehyde-activating enzyme (Fae)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Formaldehyde-activating enzyme 1y5yA00
1Y60A 1Y5YA
chains in the Genus database with same CATH superfamily
2C39B 4X66I 4LFAI 4NBQA 4HY1A 4DV7I 4B3RE 1HNXE 1R6MA 2IESA 3WU4A 1USUA 2VESA 4DR4E 4GKJE 2VF3A 4LPFA 1USVA 1ZM4A 4JI1I 4DV1I 4IS9A 2GO3A 3P3CA 1FJGE 1OYPA 4X65I 1H72C 2F1DA 1N34I 1RREA 2CZ9A 1PKPA 4JI3E 4LF4I 3QT6A 2ZBKB 3P3GA 1XMQE 3K17A 1Y4UA 4JI7E 4MU3A 1H7UA 1R6LA 4GQUA 4IFDB 2DEIA 4LF9E 3WU5A 1KTVA 2PNLA 2V2VA 4I3HA 5GMDA 4IZKB 4DUYE 4DUYI 3OTOE 3V5RA 1IBLE 3ZZ0A 2BR2B 4IZJA 3WU6A 2E5LE 5FLXQ 1QZRA 4AIMA 4DR4I 4ED4A 3GLLA 5C0XE 4OX9I 1HNXI 3J7AM 1S16A 4JI7I 4LFAE 3L7ZB 4DV2E 2IERA 3D4JA 3PYDA 1XMQI 3T1HE 4USMA 1MX0A 3P06A 2WNRA 5IT9C 3H4LA 2J7KA 4JI4E 1N34E 3HJCA 4MYTA 2Z5BB 5K36A 4WUCA 1U2RA 2F4VE 5JEAD 4JI2I 2JEAA 1E3PA 3GCMA 4FW7A 4DV6E 4GKJI 3CDJA 4KQVA 1YHCA 1Z0EA 1A6FA 5LMNI 3PYFA 3NZKA 3M85D 3PS1A 4GKKI 4DV7E 5IWAI 4Z7CA 4LOMA 4OO1A 1N32I 4B3ME 4LFBI 2C37A 4X66E 1HK7A 3T1YE 1Z0GA 4OO1B 1Z5CA 2X36A 1D6TA 4FW6A 5C0XD 2HK3A 2UXCI 1RR9A 4IFDE 2V8PA 2HKJA 4B3SE 2AJ4A 3KRNA 1ZM9A 2WNRB 1N36E 1WUUA 5ELWA 4LCGA 2CG9A 1Z0BA 2VQFI 4LCFA 3F0NA 1BKNA 4DUZE 5DRPA 2HHHE 2UXBI 1XNRI 2F4VI 5LMUI 4DV4I 1NHIA 2NN6E 1B63A 4IFDD 4DV3E 2O1UA 4FW9A 5EL9A 4KHPI 2IOPA 4DR3I 2WW4A 4XTJA 2BM0A 3PS3A 4DR5I 5K36D 2PO0B 1PIEA 4PRVA 2UUBE 4X62I 2WP8A 2GO4A 2V34A 4P52A 3GONA 3PS2A 1E3HA 3U1YA 1ELOA 5EKWA 4WUBA 2HFSA 1Z5BA 5DNXA 1N33E 4DV0I 1NZ0A 1H7SA 2JT2A 2CVEA 5BR8I 4LF9I 1XXEA 4DU8A 4U3DA 2BV3A 4X64E 1MU5A 4DR7E 3ZM7A 3Q1QA 1N0VC 4R1FA 3M7NG 4DPXA 1Z0TA 4LF7E 4AM3A 1Z0WA 3CWVA 4X65E 4AQYI 1ZXMA 2UU9I 5FWKA 4DPWA 2BR2A 4IZJB 2BA0G 1FJGI 3B8HA 4NXME 4JI5I 3M7ND 3JAMQ 2Z5EA 4B3RI 5C0XA 2PO2B 1J5EE 1Z0CA 3B82A 2UUCE 4JYAE 4DR6E 1XNQE 5DROA 2EFGA 1I94E 4OZEA 1IBKE 4DR2I 2VQEE 4YHHI 5JEAC 2WP8B 5A2QC 4JV5I 4FWGA 5DNLA 5JEAE 4K0KE 1HNWI 4DR1I 1N0UA 4HXZA 4DPUA 1HR0I 3K85A 3LTOA 3J80Q 4LF7I 1B62A 4MU4A 3QT5A 3ZKDA 2C38A 3Q6NA 4NXNI 1OYRA 4MQYA 4BA1A 4JI6I 1EI1A 1RHYA 4WUDA 2PO2A 4LF8E 2AE8A 5DRRA 2ZM6E 2PO1B 2CGEA 2NN6D 4RPFA 1Y60A 4B3TE 2O1VA 4YY3I 3LPSA 2O1WA 4MDTA 1MG7A 1N33I 5GMEA 2NN6F 1XMOE 4USKA 3LNUA 1S4EA 4LF5I 4MU1A 1VI7A 4PRXA 1ZM3A 4DV5E 1PVGA 4JG4A 3DD6A 3GMEA 1HNZI 4DR5E 4JI0I 5C0XB 2A2DA 2UXDI 1K47A 2BA1D 4IFDF 4FWDA 4LF5E 2BA0D 2R3VA 2OI2A 5C0XC 4DV3I 2PNZB 3PYEA 2PO0A 4DPYA 4JI8E 4HYMA 2C38B 4DV4E 3QT8A 2J65A 1ZM2A 1NHJA 3M85G 3QT7A 2ZM6I 2UXDE 2UXBE 4P7AA 3WU3A 2ZITA 2HHHI 1XHKA 4LFCE 4OO1F 1DARA 4DUZI 1UDSA 4UTGA 4OO1D 1IBME 4NXNE 3J7AG 1XMOI 1NHHA 2GQ0A 1FI4A 4YY3E 1KKHA 4B3TI 5DRQA 5FLXC 4QNKA 2PNMA 1P42A 3V2UC 2VQEI 4FW3A 4PU9A 3J81Q 3B78A 3PYGA 2A2CA 2JE6A 2UUAI 2C39A 5K36E 3HKMA 4JI6E 1YH8A 4B3MI 4LFBE 1J5EI 2BM1A 2JEBB 5LMNE 4JI5E 4OO1C 4DV6I 1FNMA 2PNZA 4U3BA 1VISA 2V2ZA 2Z5BA 5K36B 4J3DA 4JI4I 4DR2E 2GS8A 1I94I 1UDQA 3P3EA 4IFDA 4DR6I 2NN6B 4FWHA 2LJPA 4DV2I 2BA1G 2UUCI 3P76A 4HACB 4JYAI 1FKAE 2UUAE 2NN6A 2NN6C 1KVKA 4HACA 4DXLA 4OX9E 2V2QA 1Y6ZA 4NXMI 4MU0A 4IZJD 4AQYE 2E5LI 2UU9E 1IBLI 5K36C 2HFUA 2PO1A 3OTOI 4UT4A 1Y4SA 4DU7A 4OKGA 3JAMC 5JEAB 2HKEA 4LCHA 1Z0VA 1IBMI 2O3ZA 3M6AA 2JEBA 4DR7I 4LFCI 4IZKA 4X64I 2O1TA 2JE6B 4BA1B 2R42A 3ZZUA 5BR8E 2HK2A 2JEAB 4BA2A 1EA6A 4MYUA 4DV0E 4JI3I 4LF4E 3PRYA 4JI8I 1ZXNA 3CDIA 1H73A 1KIJA 4ZVIA 4DV1E 4JI1E 1XNRE 5IT9Q 4FW5A 4N3OA 3K1JA 5C0XF 4OO1E 3ZZTA 4X62E 2UUBI 1FWKA 4M1KA 4JI0E 5LL6R 1HNZE 5JEAF 2XEXA 4DR3E 3UHMA 1FWLA 4DV5I 5L3JA 3J81C 4KHPE 2IOQA 3J80C 1Y5YA 3H1CA 2C37B 3U1KA 5A2QQ 4B3SI 5LMUE 4LF6E 1H74A 2UXCE 1Z5AA 3ZKBA 4AIDA 4LF8I 1OJ4A 2Z5CB 1UDNA 5JEAA 3T1YI 4FN5A 2Z5CA 2NPFA 4BA2B 4QNJA 2VQFE 1N32E 1UEKA 5K36F 5IWAE 4Z7YA 4GKKE 4URLA 3L7ZA 4ISAA 3Q6MA 1N36I 1HR0E 4JI2E 4DPTA 4DR1E 2X7IA 3HULA 4LF6I 4K0KI 1HNWE 2E1RA 4JV5E 2DEJA 4YHHE 1OYSA 4FW4A 3B4TA 1IBKI 4EMDA 1Z59A 2Q2EB 1UDOA 4IFDC 1XNQI 3T1HI
chains in the Genus database with same CATH topology
1Y60A 1Y5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y60 A;  1Y5Y A; 
#chains in the Genus database with same CATH topology
 2C39 B;  4X66 I;  4LFA I;  4NBQ A;  4HY1 A;  4DV7 I;  4B3R E;  1HNX E;  1R6M A;  2IES A;  3WU4 A;  1USU A;  2VES A;  4DR4 E;  4GKJ E;  2VF3 A;  4LPF A;  1USV A;  1ZM4 A;  4JI1 I;  4DV1 I;  4IS9 A;  2GO3 A;  3P3C A;  1FJG E;  1OYP A;  4X65 I;  1H72 C;  2F1D A;  1N34 I;  1RRE A;  2CZ9 A;  1PKP A;  4JI3 E;  4LF4 I;  3QT6 A;  2ZBK B;  3P3G A;  1XMQ E;  3K17 A;  1Y4U A;  4JI7 E;  4MU3 A;  1H7U A;  1R6L A;  4GQU A;  4IFD B;  2DEI A;  4LF9 E;  3WU5 A;  1KTV A;  2PNL A;  2V2V A;  4I3H A;  5GMD A;  4IZK B;  4DUY E;  4DUY I;  3OTO E;  3V5R A;  1IBL E;  3ZZ0 A;  2BR2 B;  4IZJ A;  3WU6 A;  2E5L E;  5FLX Q;  1QZR A;  4AIM A;  4DR4 I;  4ED4 A;  3GLL A;  5C0X E;  4OX9 I;  1HNX I;  3J7A M;  1S16 A;  4JI7 I;  4LFA E;  3L7Z B;  4DV2 E;  2IER A;  3D4J A;  3PYD A;  1XMQ I;  3T1H E;  4USM A;  1MX0 A;  3P06 A;  2WNR A;  5IT9 C;  3H4L A;  2J7K A;  4JI4 E;  1N34 E;  3HJC A;  4MYT A;  2Z5B B;  5K36 A;  4WUC A;  1U2R A;  2F4V E;  5JEA D;  4JI2 I;  2JEA A;  1E3P A;  3GCM A;  4FW7 A;  4DV6 E;  4GKJ I;  3CDJ A;  4KQV A;  1YHC A;  1Z0E A;  1A6F A;  5LMN I;  3PYF A;  3NZK A;  3M85 D;  3PS1 A;  4GKK I;  4DV7 E;  5IWA I;  4Z7C A;  4LOM A;  4OO1 A;  1N32 I;  4B3M E;  4LFB I;  2C37 A;  4X66 E;  1HK7 A;  3T1Y E;  1Z0G A;  4OO1 B;  1Z5C A;  2X36 A;  1D6T A;  4FW6 A;  5C0X D;  2HK3 A;  2UXC I;  1RR9 A;  4IFD E;  2V8P A;  2HKJ A;  4B3S E;  2AJ4 A;  3KRN A;  1ZM9 A;  2WNR B;  1N36 E;  1WUU A;  5ELW A;  4LCG A;  2CG9 A;  1Z0B A;  2VQF I;  4LCF A;  3F0N A;  1BKN A;  4DUZ E;  5DRP A;  2HHH E;  2UXB I;  1XNR I;  2F4V I;  5LMU I;  4DV4 I;  1NHI A;  2NN6 E;  1B63 A;  4IFD D;  4DV3 E;  2O1U A;  4FW9 A;  5EL9 A;  4KHP I;  2IOP A;  4DR3 I;  2WW4 A;  4XTJ A;  2BM0 A;  3PS3 A;  4DR5 I;  5K36 D;  2PO0 B;  1PIE A;  4PRV A;  2UUB E;  4X62 I;  2WP8 A;  2GO4 A;  2V34 A;  4P52 A;  3GON A;  3PS2 A;  1E3H A;  3U1Y A;  1ELO A;  5EKW A;  4WUB A;  2HFS A;  1Z5B A;  5DNX A;  1N33 E;  4DV0 I;  1NZ0 A;  1H7S A;  2JT2 A;  2CVE A;  5BR8 I;  4LF9 I;  1XXE A;  4DU8 A;  4U3D A;  2BV3 A;  4X64 E;  1MU5 A;  4DR7 E;  3ZM7 A;  3Q1Q A;  1N0V C;  4R1F A;  3M7N G;  4DPX A;  1Z0T A;  4LF7 E;  4AM3 A;  1Z0W A;  3CWV A;  4X65 E;  4AQY I;  1ZXM A;  2UU9 I;  5FWK A;  4DPW A;  2BR2 A;  4IZJ B;  2BA0 G;  1FJG I;  3B8H A;  4NXM E;  4JI5 I;  3M7N D;  3JAM Q;  2Z5E A;  4B3R I;  5C0X A;  2PO2 B;  1J5E E;  1Z0C A;  3B82 A;  2UUC E;  4JYA E;  4DR6 E;  1XNQ E;  5DRO A;  2EFG A;  1I94 E;  4OZE A;  1IBK E;  4DR2 I;  2VQE E;  4YHH I;  5JEA C;  2WP8 B;  5A2Q C;  4JV5 I;  4FWG A;  5DNL A;  5JEA E;  4K0K E;  1HNW I;  4DR1 I;  1N0U A;  4HXZ A;  4DPU A;  1HR0 I;  3K85 A;  3LTO A;  3J80 Q;  4LF7 I;  1B62 A;  4MU4 A;  3QT5 A;  3ZKD A;  2C38 A;  3Q6N A;  4NXN I;  1OYR A;  4MQY A;  4BA1 A;  4JI6 I;  1EI1 A;  1RHY A;  4WUD A;  2PO2 A;  4LF8 E;  2AE8 A;  5DRR A;  2ZM6 E;  2PO1 B;  2CGE A;  2NN6 D;  4RPF A;  1Y60 A;  4B3T E;  2O1V A;  4YY3 I;  3LPS A;  2O1W A;  4MDT A;  1MG7 A;  1N33 I;  5GME A;  2NN6 F;  1XMO E;  4USK A;  3LNU A;  1S4E A;  4LF5 I;  4MU1 A;  1VI7 A;  4PRX A;  1ZM3 A;  4DV5 E;  1PVG A;  4JG4 A;  3DD6 A;  3GME A;  1HNZ I;  4DR5 E;  4JI0 I;  5C0X B;  2A2D A;  2UXD I;  1K47 A;  2BA1 D;  4IFD F;  4FWD A;  4LF5 E;  2BA0 D;  2R3V A;  2OI2 A;  5C0X C;  4DV3 I;  2PNZ B;  3PYE A;  2PO0 A;  4DPY A;  4JI8 E;  4HYM A;  2C38 B;  4DV4 E;  3QT8 A;  2J65 A;  1ZM2 A;  1NHJ A;  3M85 G;  3QT7 A;  2ZM6 I;  2UXD E;  2UXB E;  4P7A A;  3WU3 A;  2ZIT A;  2HHH I;  1XHK A;  4LFC E;  4OO1 F;  1DAR A;  4DUZ I;  1UDS A;  4UTG A;  4OO1 D;  1IBM E;  4NXN E;  3J7A G;  1XMO I;  1NHH A;  2GQ0 A;  1FI4 A;  4YY3 E;  1KKH A;  4B3T I;  5DRQ A;  5FLX C;  4QNK A;  2PNM A;  1P42 A;  3V2U C;  2VQE I;  4FW3 A;  4PU9 A;  3J81 Q;  3B78 A;  3PYG A;  2A2C A;  2JE6 A;  2UUA I;  2C39 A;  5K36 E;  3HKM A;  4JI6 E;  1YH8 A;  4B3M I;  4LFB E;  1J5E I;  2BM1 A;  2JEB B;  5LMN E;  4JI5 E;  4OO1 C;  4DV6 I;  1FNM A;  2PNZ A;  4U3B A;  1VIS A;  2V2Z A;  2Z5B A;  5K36 B;  4J3D A;  4JI4 I;  4DR2 E;  2GS8 A;  1I94 I;  1UDQ A;  3P3E A;  4IFD A;  4DR6 I;  2NN6 B;  4FWH A;  2LJP A;  4DV2 I;  2BA1 G;  2UUC I;  3P76 A;  4HAC B;  4JYA I;  1FKA E;  2UUA E;  2NN6 A;  2NN6 C;  1KVK A;  4HAC A;  4DXL A;  4OX9 E;  2V2Q A;  1Y6Z A;  4NXM I;  4MU0 A;  4IZJ D;  4AQY E;  2E5L I;  2UU9 E;  1IBL I;  5K36 C;  2HFU A;  2PO1 A;  3OTO I;  4UT4 A;  1Y4S A;  4DU7 A;  4OKG A;  3JAM C;  5JEA B;  2HKE A;  4LCH A;  1Z0V A;  1IBM I;  2O3Z A;  3M6A A;  2JEB A;  4DR7 I;  4LFC I;  4IZK A;  4X64 I;  2O1T A;  2JE6 B;  4BA1 B;  2R42 A;  3ZZU A;  5BR8 E;  2HK2 A;  2JEA B;  4BA2 A;  1EA6 A;  4MYU A;  4DV0 E;  4JI3 I;  4LF4 E;  3PRY A;  4JI8 I;  1ZXN A;  3CDI A;  1H73 A;  1KIJ A;  4ZVI A;  4DV1 E;  4JI1 E;  1XNR E;  5IT9 Q;  4FW5 A;  4N3O A;  3K1J A;  5C0X F;  4OO1 E;  3ZZT A;  4X62 E;  2UUB I;  1FWK A;  4M1K A;  4JI0 E;  5LL6 R;  1HNZ E;  5JEA F;  2XEX A;  4DR3 E;  3UHM A;  1FWL A;  4DV5 I;  5L3J A;  3J81 C;  4KHP E;  2IOQ A;  3J80 C;  1Y5Y A;  3H1C A;  2C37 B;  3U1K A;  5A2Q Q;  4B3S I;  5LMU E;  4LF6 E;  1H74 A;  2UXC E;  1Z5A A;  3ZKB A;  4AID A;  4LF8 I;  1OJ4 A;  2Z5C B;  1UDN A;  5JEA A;  3T1Y I;  4FN5 A;  2Z5C A;  2NPF A;  4BA2 B;  4QNJ A;  2VQF E;  1N32 E;  1UEK A;  5K36 F;  5IWA E;  4Z7Y A;  4GKK E;  4URL A;  3L7Z A;  4ISA A;  3Q6M A;  1N36 I;  1HR0 E;  4JI2 E;  4DPT A;  4DR1 E;  2X7I A;  3HUL A;  4LF6 I;  4K0K I;  1HNW E;  2E1R A;  4JV5 E;  2DEJ A;  4YHH E;  1OYS A;  4FW4 A;  3B4T A;  1IBK I;  4EMD A;  1Z59 A;  2Q2E B;  1UDO A;  4IFD C;  1XNQ I;  3T1H I; 
#chains in the Genus database with same CATH homology
 1Y60 A;  1Y5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...