1Y5YA

Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (fae) from methylobacterium extorquens am1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
159
structure length
159
Chain Sequence
b'AKITKVQVGEALVGDGNEVAHIDLIIGPRGSPAETAFCNGLVNNKHGFTSLLAVIAPNLPCKPNTLMFNKVTINDARQAVQMFGPAQHGVAMAVQDAVAEGIIPADEADDLYVLVGVFIHWEAADDAKIQKYNYEATKLSIQRAVNGEPKASVVTEQRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formaldehyde-activating enzyme fae
publication title How an enzyme binds the C1-carrier tetrahydromethanopterin: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Lyase
total genus 55
structure length 159
sequence length 159
chains with identical sequence B, C, D, E
ec nomenclature ec 4.2.1.147: 5,6,7,8-tetrahydromethanopterin hydro-lyase.
pdb deposition date 2004-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08714 Fae Formaldehyde-activating enzyme (Fae)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Formaldehyde-activating enzyme 1y5yA00
1Y60A 1Y5YA
chains in the Genus database with same CATH superfamily
2WP8A 4OO1C 4GQUA 3HJCA 1H7SA 2WNRA 4I3HA 5C0XA 3DD6A 1OYSA 4MQYA 4DV2I 4JI2I 1Y4SA 2A2DA 5K36B 2WP8B 4OO1D 1E3PA 1FWKA 2BV3A 4DV5I 5DNLA 1E3HA 3PYGA 1UDQA 2GS8A 4LPFA 1IBLE 2WNRB 5DRPA 5C0XB 4HY1A 2UUCE 3QT7A 1HNZI 3PYFA 4NXME 2V34A 5DROA 2VESA 2PNLA 2X7IA 2PNMA 1N0VC 3ZZUA 4JV5E 3M85D 1N32I 4LF4E 5LMUI 2IESA 2BA1D 4LF5I 5IWAI 3P3EA 4PU9A 4LCGA 1RR9A 1B62A 2J7KA 4YHHE 2O1WA 3PYEA 2OI2A 4LFAI 2ZM6E 4HYMA 4ZVIA 3T1YI 1OYRA 4LF6E 2VQFE 4DUZI 4FWDA 4FW7A 5A2QQ 4DR6I 4JI3I 4K0KE 2UXCI 4X62E 4LF8I 4OKGA 5EL9A 2CVEA 3H4LA 1R6MA 3K1JA 4U3BA 2HHHI 5JEAF 1XMOE 4JI8I 4HXZA 1FJGI 3M85G 4GKJE 2E5LI 4X66I 4B3RE 2AE8A 1Z5BA 1D6TA 4DR1E 1KKHA 4PRVA 1HR0I 1FNMA 1KTVA 1OYPA 4FN5A 4BA2A 1S4EA 3PS3A 2NN6E 2V2QA 2HKJA 1IBLI 1Y60A 4JI5E 4MU3A 4FW9A 4YY3I 4AM3A 2R42A 1XNRI 1NHJA 1ZM9A 1N0UA 4JV5I 3P76A 4DXLA 4LF4I 4DV3E 4DV6E 2Q2EB 5K36D 4X64I 3J80Q 4WUCA 3JAMQ 1YH8A 1ZM4A 1J5EI 2ZM6I 4GKKI 4KHPE 3CWVA 1VISA 1EI1A 4FW6A 5JEAA 4X65E 2R3VA 4DV1I 3OTOE 1XMQE 2F4VE 4DV7E 1H72C 1XNQI 2UXBI 2UU9I 5C0XE 4DUYI 4DR7I 2UXDE 4MYTA 3QT6A 4JI4I 4JI1E 1HNWI 5JEAB 3WU6A 1XHKA 2BM0A 2JE6B 4AIDA 2CG9A 4BA1A 1NHHA 3B78A 2CZ9A 4JI7E 5DRQA 1H73A 4IFDC 2GO3A 1Z0EA 5EKWA 3Q6MA 1N36E 3QT8A 4B3SI 4LFBE 3Q1QA 4JG4A 1I94E 3HULA 4DR5E 1IBKI 4DR4E 2X36A 4BA1B 4FW4A 1N33I 4NXNI 4DR2E 1Z0WA 4FWGA 3P3GA 4DR3E 4IFDD 2BA0D 1P42A 2EFGA 5LMNE 3P06A 3J81C 4HACA 4OX9E 2UUBE 2UUAE 1IBME 4UT4A 1PIEA 1N34E 2PO1A 1HNXE 5IT9Q 2Z5BA 3M6AA 3T1HE 4JI0E 4DV4I 3J7AG 2JEAA 3PRYA 5LL6R 5BR8E 4DPUA 2A2CA 4DV0I 4OO1F 1BKNA 2V2ZA 3WU5A 2PO2A 1Y5YA 3PS2A 4HACB 1UDSA 1H74A 4LF7E 4P52A 2Z5EA 2PO1B 4JYAI 3WU3A 4DU7A 4MU1A 4B3TE 2Z5BB 5ELWA 4JI6I 2JEAB 2BA0G 2NN6C 2PO2B 4FWHA 3CDIA 2AJ4A 1FKAE 2HK3A 3GONA 4LF9E 2O1TA 2NN6D 1MG7A 3GLLA 4USKA 1MU5A 1A6FA 4P7AA 3L7ZA 3D4JA 2IOPA 2PO0A 1KVKA 2C39A 1YHCA 1H7UA 2NPFA 1NHIA 4FW3A 4OO1A 4LCFA 2VF3A 5K36C 1NZ0A 5FLXQ 5JEAE 2BR2A 3CDJA 1USVA 2UUCI 2GQ0A 2HKEA 1PVGA 2O1UA 2O1VA 4J3DA 4NXMI 2C38A 4B3ME 3L7ZB 5C0XC 4RPFA 2PO0B 4LFCE 4BA2B 2C39B 4OO1B 4LF7I 2CGEA 2BR2B 1Z0VA 5DNXA 2HHHE 2VQEE 4YHHI 2JT2A 2C38B 2J65A 5C0XD 4LF6I 4EMDA 3GMEA 2VQFI 5A2QC 1Z5AA 4DV2E 4JI2E 3Q6NA 4X62I 3PS1A 4K0KI 3B4TA 1XMOI 1DARA 4DV5E 4GKJI 4URLA 4B3RI 2HFUA 4PRXA 4DR1I 2O3ZA 1HNZE 2WW4A 4JI5I 4NBQA 3KRNA 1N32E 1Z59A 3U1KA 5LMUE 1MX0A 4FW5A 3M7ND 3U1YA 1WUUA 4LCHA 4USMA 3K85A 4LF5E 3V5RA 3NZKA 1ELOA 5IWAE 4AIMA 4MYUA 4DV3I 4DV6I 2GO4A 1USUA 3V2UC 1UEKA 4DPTA 4LFAE 4Z7CA 3J80C 3T1YE 3HKMA 3JAMC 2V2VA 4DUZE 4R1FA 4MU4A 4QNJA 2VQEI 1EA6A 4DR6E 4JI3E 4KHPI 2UXCE 4LF8E 2IOQA 4X65I 3OTOI 1UDOA 1XMQI 2F4VI 3H1CA 4JI8E 4DV7I 4AQYE 3J7AM 4IFDF 1Z0TA 3LNUA 1FJGE 2E5LE 3ZKDA 3M7NG 4X66E 2UXDI 1HK7A 1HR0E 5FWKA 4IZJA 4JI1I 4DPXA 4M1KA 2V8PA 4WUDA 3F0NA 3UHMA 4IFDE 4YY3E 5L3JA 4OO1E 1XNRE 2IERA 4JI7I 5JEAC 2XEXA 3LTOA 5GMDA 3B82A 1PKPA 5GMEA 1N36I 4LFBI 1RHYA 4IZJB 3ZKBA 1I94I 2LJPA 4IZKA 4KQVA 4DR5I 4X64E 4DR4I 3GCMA 4OZEA 4DPYA 4WUBA 1K47A 2C37A 4DR2I 4MDTA 1J5EE 4DR3I 1ZM3A 5JEAD 4IS9A 4GKKE 1ZXMA 4UTGA 1Z0BA 5LMNI 4IFDA 4DV1E 4IZKB 4OX9I 1OJ4A 2UUBI 2UUAI 2JEBA 1IBMI 4Z7YA 1XNQE 2UXBE 3P3CA 2UU9E 1N34I 2NN6F 4DUYE 5IT9C 4DR7E 1HNXI 2C37B 3QT5A 3T1HI 4JI0I 4AQYI 2ZITA 5BR8I 4JI4E 1HNWE 1Y4UA 1S16A 4IFDB 4ISAA 1VI7A 2PNZA 4XTJA 2DEIA 4U3DA 2BA1G 2JEBB 2ZBKB 4B3TI 4QNKA 3PYDA 4B3SE 5DRRA 1Z0CA 1XXEA 5K36F 3ZM7A 2PNZB 1IBKE 2HFSA 1Y6ZA 1N33E 4NXNE 1R6LA 4LF9I 3K17A 2Z5CA 5C0XF 4DU8A 4ED4A 3J81Q 1ZXNA 2NN6A 2E1RA 3B8HA 1RREA 1ZM2A 5K36E 1U2RA 1Z5CA 1FI4A 2F1DA 3ZZ0A 1FWLA 5FLXC 4LOMA 4DV4E 2JE6A 4DV0E 1Z0GA 2Z5CB 4N3OA 1QZRA 2HK2A 4MU0A 4IZJD 2NN6B 4B3MI 2DEJA 4LFCI 3ZZTA 3LPSA 4JYAE 4JI6E 1B63A 2BM1A 1KIJA 4DPWA 1UDNA 5K36A 3WU4A
chains in the Genus database with same CATH topology
1Y60A 1Y5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y60 A;  1Y5Y A; 
#chains in the Genus database with same CATH topology
 2WP8 A;  4OO1 C;  4GQU A;  3HJC A;  1H7S A;  2WNR A;  4I3H A;  5C0X A;  3DD6 A;  1OYS A;  4MQY A;  4DV2 I;  4JI2 I;  1Y4S A;  2A2D A;  5K36 B;  2WP8 B;  4OO1 D;  1E3P A;  1FWK A;  2BV3 A;  4DV5 I;  5DNL A;  1E3H A;  3PYG A;  1UDQ A;  2GS8 A;  4LPF A;  1IBL E;  2WNR B;  5DRP A;  5C0X B;  4HY1 A;  2UUC E;  3QT7 A;  1HNZ I;  3PYF A;  4NXM E;  2V34 A;  5DRO A;  2VES A;  2PNL A;  2X7I A;  2PNM A;  1N0V C;  3ZZU A;  4JV5 E;  3M85 D;  1N32 I;  4LF4 E;  5LMU I;  2IES A;  2BA1 D;  4LF5 I;  5IWA I;  3P3E A;  4PU9 A;  4LCG A;  1RR9 A;  1B62 A;  2J7K A;  4YHH E;  2O1W A;  3PYE A;  2OI2 A;  4LFA I;  2ZM6 E;  4HYM A;  4ZVI A;  3T1Y I;  1OYR A;  4LF6 E;  2VQF E;  4DUZ I;  4FWD A;  4FW7 A;  5A2Q Q;  4DR6 I;  4JI3 I;  4K0K E;  2UXC I;  4X62 E;  4LF8 I;  4OKG A;  5EL9 A;  2CVE A;  3H4L A;  1R6M A;  3K1J A;  4U3B A;  2HHH I;  5JEA F;  1XMO E;  4JI8 I;  4HXZ A;  1FJG I;  3M85 G;  4GKJ E;  2E5L I;  4X66 I;  4B3R E;  2AE8 A;  1Z5B A;  1D6T A;  4DR1 E;  1KKH A;  4PRV A;  1HR0 I;  1FNM A;  1KTV A;  1OYP A;  4FN5 A;  4BA2 A;  1S4E A;  3PS3 A;  2NN6 E;  2V2Q A;  2HKJ A;  1IBL I;  1Y60 A;  4JI5 E;  4MU3 A;  4FW9 A;  4YY3 I;  4AM3 A;  2R42 A;  1XNR I;  1NHJ A;  1ZM9 A;  1N0U A;  4JV5 I;  3P76 A;  4DXL A;  4LF4 I;  4DV3 E;  4DV6 E;  2Q2E B;  5K36 D;  4X64 I;  3J80 Q;  4WUC A;  3JAM Q;  1YH8 A;  1ZM4 A;  1J5E I;  2ZM6 I;  4GKK I;  4KHP E;  3CWV A;  1VIS A;  1EI1 A;  4FW6 A;  5JEA A;  4X65 E;  2R3V A;  4DV1 I;  3OTO E;  1XMQ E;  2F4V E;  4DV7 E;  1H72 C;  1XNQ I;  2UXB I;  2UU9 I;  5C0X E;  4DUY I;  4DR7 I;  2UXD E;  4MYT A;  3QT6 A;  4JI4 I;  4JI1 E;  1HNW I;  5JEA B;  3WU6 A;  1XHK A;  2BM0 A;  2JE6 B;  4AID A;  2CG9 A;  4BA1 A;  1NHH A;  3B78 A;  2CZ9 A;  4JI7 E;  5DRQ A;  1H73 A;  4IFD C;  2GO3 A;  1Z0E A;  5EKW A;  3Q6M A;  1N36 E;  3QT8 A;  4B3S I;  4LFB E;  3Q1Q A;  4JG4 A;  1I94 E;  3HUL A;  4DR5 E;  1IBK I;  4DR4 E;  2X36 A;  4BA1 B;  4FW4 A;  1N33 I;  4NXN I;  4DR2 E;  1Z0W A;  4FWG A;  3P3G A;  4DR3 E;  4IFD D;  2BA0 D;  1P42 A;  2EFG A;  5LMN E;  3P06 A;  3J81 C;  4HAC A;  4OX9 E;  2UUB E;  2UUA E;  1IBM E;  4UT4 A;  1PIE A;  1N34 E;  2PO1 A;  1HNX E;  5IT9 Q;  2Z5B A;  3M6A A;  3T1H E;  4JI0 E;  4DV4 I;  3J7A G;  2JEA A;  3PRY A;  5LL6 R;  5BR8 E;  4DPU A;  2A2C A;  4DV0 I;  4OO1 F;  1BKN A;  2V2Z A;  3WU5 A;  2PO2 A;  1Y5Y A;  3PS2 A;  4HAC B;  1UDS A;  1H74 A;  4LF7 E;  4P52 A;  2Z5E A;  2PO1 B;  4JYA I;  3WU3 A;  4DU7 A;  4MU1 A;  4B3T E;  2Z5B B;  5ELW A;  4JI6 I;  2JEA B;  2BA0 G;  2NN6 C;  2PO2 B;  4FWH A;  3CDI A;  2AJ4 A;  1FKA E;  2HK3 A;  3GON A;  4LF9 E;  2O1T A;  2NN6 D;  1MG7 A;  3GLL A;  4USK A;  1MU5 A;  1A6F A;  4P7A A;  3L7Z A;  3D4J A;  2IOP A;  2PO0 A;  1KVK A;  2C39 A;  1YHC A;  1H7U A;  2NPF A;  1NHI A;  4FW3 A;  4OO1 A;  4LCF A;  2VF3 A;  5K36 C;  1NZ0 A;  5FLX Q;  5JEA E;  2BR2 A;  3CDJ A;  1USV A;  2UUC I;  2GQ0 A;  2HKE A;  1PVG A;  2O1U A;  2O1V A;  4J3D A;  4NXM I;  2C38 A;  4B3M E;  3L7Z B;  5C0X C;  4RPF A;  2PO0 B;  4LFC E;  4BA2 B;  2C39 B;  4OO1 B;  4LF7 I;  2CGE A;  2BR2 B;  1Z0V A;  5DNX A;  2HHH E;  2VQE E;  4YHH I;  2JT2 A;  2C38 B;  2J65 A;  5C0X D;  4LF6 I;  4EMD A;  3GME A;  2VQF I;  5A2Q C;  1Z5A A;  4DV2 E;  4JI2 E;  3Q6N A;  4X62 I;  3PS1 A;  4K0K I;  3B4T A;  1XMO I;  1DAR A;  4DV5 E;  4GKJ I;  4URL A;  4B3R I;  2HFU A;  4PRX A;  4DR1 I;  2O3Z A;  1HNZ E;  2WW4 A;  4JI5 I;  4NBQ A;  3KRN A;  1N32 E;  1Z59 A;  3U1K A;  5LMU E;  1MX0 A;  4FW5 A;  3M7N D;  3U1Y A;  1WUU A;  4LCH A;  4USM A;  3K85 A;  4LF5 E;  3V5R A;  3NZK A;  1ELO A;  5IWA E;  4AIM A;  4MYU A;  4DV3 I;  4DV6 I;  2GO4 A;  1USU A;  3V2U C;  1UEK A;  4DPT A;  4LFA E;  4Z7C A;  3J80 C;  3T1Y E;  3HKM A;  3JAM C;  2V2V A;  4DUZ E;  4R1F A;  4MU4 A;  4QNJ A;  2VQE I;  1EA6 A;  4DR6 E;  4JI3 E;  4KHP I;  2UXC E;  4LF8 E;  2IOQ A;  4X65 I;  3OTO I;  1UDO A;  1XMQ I;  2F4V I;  3H1C A;  4JI8 E;  4DV7 I;  4AQY E;  3J7A M;  4IFD F;  1Z0T A;  3LNU A;  1FJG E;  2E5L E;  3ZKD A;  3M7N G;  4X66 E;  2UXD I;  1HK7 A;  1HR0 E;  5FWK A;  4IZJ A;  4JI1 I;  4DPX A;  4M1K A;  2V8P A;  4WUD A;  3F0N A;  3UHM A;  4IFD E;  4YY3 E;  5L3J A;  4OO1 E;  1XNR E;  2IER A;  4JI7 I;  5JEA C;  2XEX A;  3LTO A;  5GMD A;  3B82 A;  1PKP A;  5GME A;  1N36 I;  4LFB I;  1RHY A;  4IZJ B;  3ZKB A;  1I94 I;  2LJP A;  4IZK A;  4KQV A;  4DR5 I;  4X64 E;  4DR4 I;  3GCM A;  4OZE A;  4DPY A;  4WUB A;  1K47 A;  2C37 A;  4DR2 I;  4MDT A;  1J5E E;  4DR3 I;  1ZM3 A;  5JEA D;  4IS9 A;  4GKK E;  1ZXM A;  4UTG A;  1Z0B A;  5LMN I;  4IFD A;  4DV1 E;  4IZK B;  4OX9 I;  1OJ4 A;  2UUB I;  2UUA I;  2JEB A;  1IBM I;  4Z7Y A;  1XNQ E;  2UXB E;  3P3C A;  2UU9 E;  1N34 I;  2NN6 F;  4DUY E;  5IT9 C;  4DR7 E;  1HNX I;  2C37 B;  3QT5 A;  3T1H I;  4JI0 I;  4AQY I;  2ZIT A;  5BR8 I;  4JI4 E;  1HNW E;  1Y4U A;  1S16 A;  4IFD B;  4ISA A;  1VI7 A;  2PNZ A;  4XTJ A;  2DEI A;  4U3D A;  2BA1 G;  2JEB B;  2ZBK B;  4B3T I;  4QNK A;  3PYD A;  4B3S E;  5DRR A;  1Z0C A;  1XXE A;  5K36 F;  3ZM7 A;  2PNZ B;  1IBK E;  2HFS A;  1Y6Z A;  1N33 E;  4NXN E;  1R6L A;  4LF9 I;  3K17 A;  2Z5C A;  5C0X F;  4DU8 A;  4ED4 A;  3J81 Q;  1ZXN A;  2NN6 A;  2E1R A;  3B8H A;  1RRE A;  1ZM2 A;  5K36 E;  1U2R A;  1Z5C A;  1FI4 A;  2F1D A;  3ZZ0 A;  1FWL A;  5FLX C;  4LOM A;  4DV4 E;  2JE6 A;  4DV0 E;  1Z0G A;  2Z5C B;  4N3O A;  1QZR A;  2HK2 A;  4MU0 A;  4IZJ D;  2NN6 B;  4B3M I;  2DEJ A;  4LFC I;  3ZZT A;  3LPS A;  4JYA E;  4JI6 E;  1B63 A;  2BM1 A;  1KIJ A;  4DPW A;  1UDN A;  5K36 A;  3WU4 A; 
#chains in the Genus database with same CATH homology
 1Y60 A;  1Y5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...