1Y5YA

Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (fae) from methylobacterium extorquens am1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
159
structure length
159
Chain Sequence
AKITKVQVGEALVGDGNEVAHIDLIIGPRGSPAETAFCNGLVNNKHGFTSLLAVIAPNLPCKPNTLMFNKVTINDARQAVQMFGPAQHGVAMAVQDAVAEGIIPADEADDLYVLVGVFIHWEAADDAKIQKYNYEATKLSIQRAVNGEPKASVVTEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Formaldehyde-activating enzyme fae
publication title How an enzyme binds the C1-carrier tetrahydromethanopterin: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1
pubmed doi rcsb
source organism Methylobacterium extorquens
total genus 55
structure length 159
sequence length 159
chains with identical sequence B, C, D, E
ec nomenclature ec 4.2.1.147: 5,6,7,8-tetrahydromethanopterin hydro-lyase.
pdb deposition date 2004-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08714 Fae Formaldehyde-activating enzyme (Fae)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Formaldehyde-activating enzyme 1y5yA00
1Y60A 1Y5YA
chains in the Genus database with same CATH superfamily
4X64E 1XNQI 3QT6A 5C0XC 4JI5E 4OO1B 3P76A 5LMUI 5K36E 4LFBI 4RPFA 3JAMC 4Z7YA 3U1YA 1OYRA 1P42A 4B3TI 3F0NA 4FW9A 3T1YI 3J80C 4X66I 1HNZE 2JEAA 4OO1F 3U1KA 2X36A 4MU4A 1XNRI 4XTJA 4DV4E 1U2RA 4MU1A 2HKJA 1EI1A 1HNWE 3T1HE 4IFDB 4LF8I 4DV0E 4FW5A 4JG4A 5ELWA 4JI2E 2F4VI 1B63A 2PO0B 4IZKA 4N3OA 1ZM2A 2HK2A 2HK3A 5C0XD 5JEAB 1Y60A 1FI4A 3B82A 5BR8E 2CVEA 4DR6I 1N0UA 2BV3A 3Q6MA 5C0XA 3WU4A 2Z5EA 1XNQE 1OJ4A 4LFAI 5LMNI 5LMUE 2BA0D 1I94I 2CG9A 1OYSA 4P52A 1HR0E 5JEAF 2HKEA 1Y5YA 4LFBE 4OZEA 4X62I 2VQEE 2VESA 4LFCI 1Y4SA 2V34A 2BA1G 3T1YE 1ZXMA 5IT9Q 4X66E 1J5EE 1XNRE 3M85G 1IBKI 2WW4A 1NHJA 1H7SA 1H7UA 2UUBI 2V2VA 1MU5A 3LNUA 4FWDA 2NN6A 1UDQA 1UDNA 3JAMQ 2V2ZA 4AQYE 4J3DA 2AE8A 4OO1E 1N34E 5DRRA 4DR6E 4QNJA 2AJ4A 4NXMI 4X65I 4GKKI 4DR2E 1H74A 2HFSA 4K0KI 3CDIA 4LFAE 3GLLA 2IOQA 4PU9A 5LMNE 4MU3A 1UDOA 1I94E 4URLA 5K36C 1B62A 1FJGI 5C0XB 2GO4A 2PO0A 2A2CA 1FWLA 1YH8A 4IZJA 1Z0TA 3J7AG 2XEXA 4JI2I 2O1VA 5IT9C 3V5RA 4UT4A 2UUBE 2ZITA 4HY1A 2UUAI 5JEAE 3ZKBA 1E3PA 2IERA 3V2UC 4FWHA 3WU6A 4BA2B 4DPYA 4JV5I 3HJCA 5K36D 2NN6B 1HR0I 1UEKA 3ZZ0A 3PYDA 4X65E 4NXME 2LJPA 4GKKE 4DV1E 2VQEI 4K0KE 5K36A 2C38B 1ELOA 4JI1I 1J5EI 4LF6I 1FJGE 3H4LA 2NN6F 4JI6I 1N33I 2BM1A 4DV7I 4B3MI 4LCGA 4DR7I 1D6TA 1EA6A 5DROA 3M6AA 4DV6I 4P7AA 3K17A 2EFGA 4JI7E 4R1FA 2GQ0A 2DEIA 2BA0G 4IZJB 2F1DA 3HULA 3D4JA 4MYUA 5LL6R 1MX0A 4AQYI 4IFDF 2UUAE 1N34I 4MQYA 4U3BA 1IBME 1Z0CA 4DR2I 2JEBB 1H73A 2BR2A 1USVA 1QZRA 4JV5E 4OO1C 1XXEA 2ZM6E 2E5LI 2PO2B 2Z5CA 4DPUA 4MU0A 4I3HA 4KHPE 5L3JA 4LF5E 1N36I 1UDSA 3GONA 3PS3A 4BA1A 4JI1E 2IESA 4DV2I 2GO3A 4LF6E 2UXDI 4JI6E 1Z0EA 1N33E 4DV7E 5K36B 4B3ME 2PNZA 4BA2A 4DXLA 4DR7E 4IFDC 2CGEA 2WNRA 5IWAE 1FWKA 2ZBKB 4DV6E 1Z5AA 4OX9E 1Z59A 4FW6A 4YHHI 4DR1I 3ZZUA 3J81C 2VQFI 4DR3E 4NXNE 3ZKDA 3M7NG 4DR4E 1Z5BA 4OO1D 1PIEA 4KQVA 2C38A 5JEAC 1XMQE 2UXBI 2NN6E 4DPXA 1K47A 4DV1I 1S16A 4GQUA 4FN5A 3CDJA 2BA1D 2A2DA 1WUUA 1N0VC 2E5LE 5EKWA 5DRQA 3M85D 2BR2B 4IFDD 2CZ9A 4OKGA 1N36E 4IFDE 1OYPA 4M1KA 1RR9A 3WU3A 4DUYI 4DV2E 2Z5CB 2UXDE 4LF7I 2R42A 4JI7I 2WP8B 1XMOI 3B8HA 1Z0VA 2JEBA 4FW3A 4FWGA 4B3SI 5C0XF 4HACA 4FW4A 2O1WA 4BA1B 5JEAD 4EMDA 1N32I 3J7AM 4JI3I 3QT7A 3PRYA 2PO2A 1IBMI 4YHHE 4DR1E 2PNZB 4DPWA 2VQFE 4IS9A 3PYEA 2HFUA 3H1CA 3GMEA 2WNRB 3P06A 5DNXA 2ZM6I 2UXBE 2Z5BB 2UUCI 3LTOA 4WUBA 4KHPI 4DU8A 2X7IA 4DUZI 4LF5I 1YHCA 4USKA 1XHKA 3ZM7A 2JE6A 4DR5E 4LCHA 3PYFA 2UU9I 1PKPA 4NBQA 1Y6ZA 1NZ0A 3L7ZA 3Q6NA 4LOMA 1VI7A 1IBLI 3GCMA 1Z0WA 1MG7A 1RREA 2O1UA 2HHHI 5A2QC 2O1TA 3J81Q 2C39B 2VF3A 4DUYE 5FLXC 2PO1B 5IWAI 4LF7E 2J65A 4U3DA 4JI0I 4OX9I 4GKJE 4HYMA 1XMOE 1ZM3A 4NXNI 4DR3I 4B3SE 2BM0A 4DV3I 4DR4I 1N32E 1HNXE 4LF4I 4LCFA 1Y4UA 4AIMA 1XMQI 4JI3E 2Q2EB 4DPTA 3KRNA 1KKHA 1PVGA 2UXCE 4HACB 1KVKA 3OTOE 4LPFA 4B3RI 4PRXA 1R6LA 1HK7A 4WUCA 4AM3A 3ZZTA 2NN6C 2R3VA 3WU5A 4YY3I 1FKAE 2O3ZA 2UUCE 4Z7CA 3P3CA 1Z0BA 5C0XE 2WP8A 4DUZE 3LPSA 4LF9E 1S4EA 4DV5I 4JI4E 1H72C 2UU9E 2C37B 1KTVA 1IBLE 1FNMA 3PS1A 2HHHE 2DEJA 4JI8I 2JE6B 4PRVA 4JYAI 2NPFA 3P3GA 3P3EA 3PS2A 4JI0E 1USUA 2PNLA 2Z5BA 3L7ZB 4B3TE 1DARA 4DU7A 4DV3E 1E3HA 5GMEA 1A6FA 5K36F 3UHMA 4LF4E 3PYGA 2NN6D 1NHIA 1VISA 1Z5CA 4LF8E 4OO1A 2JEAB 4B3RE 1KIJA 1NHHA 3DD6A 2F4VE 2C39A 4UTGA 4MYTA 2PO1A 4YY3E 4DR5I 5A2QQ 4X64I 2J7KA 5FLXQ 3NZKA 4ISAA 4JI5I 5FWKA 3CWVA 3Q1QA 4DV5E 4USMA 4ZVIA 5EL9A 4IZKB 2IOPA 2JT2A 4MDTA 2GS8A 2E1RA 3J80Q 1Z0GA 4GKJI 4AIDA 1R6MA 2V2QA 4IFDA 3M7ND 4IZJD 1HNZI 5DNLA 4JI8E 3QT5A 1HNXI 4JYAE 4DV4I 4X62E 5DRPA 3K1JA 1ZM4A 4LFCE 4QNKA 1HNWI 3T1HI 3B78A 2UXCI 4DV0I 5GMDA 3HKMA 4WUDA 5JEAA 4ED4A 3OTOI 2V8PA 4FW7A 4HXZA 3QT8A 2OI2A 2PNMA 1IBKE 2C37A 4LF9I 3B4TA 1RHYA 1ZM9A 5BR8I 4JI4I 3K85A 1ZXNA 1BKNA
chains in the Genus database with same CATH topology
1Y60A 1Y5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y60 A;  1Y5Y A; 
#chains in the Genus database with same CATH topology
 4X64 E;  1XNQ I;  3QT6 A;  5C0X C;  4JI5 E;  4OO1 B;  3P76 A;  5LMU I;  5K36 E;  4LFB I;  4RPF A;  3JAM C;  4Z7Y A;  3U1Y A;  1OYR A;  1P42 A;  4B3T I;  3F0N A;  4FW9 A;  3T1Y I;  3J80 C;  4X66 I;  1HNZ E;  2JEA A;  4OO1 F;  3U1K A;  2X36 A;  4MU4 A;  1XNR I;  4XTJ A;  4DV4 E;  1U2R A;  4MU1 A;  2HKJ A;  1EI1 A;  1HNW E;  3T1H E;  4IFD B;  4LF8 I;  4DV0 E;  4FW5 A;  4JG4 A;  5ELW A;  4JI2 E;  2F4V I;  1B63 A;  2PO0 B;  4IZK A;  4N3O A;  1ZM2 A;  2HK2 A;  2HK3 A;  5C0X D;  5JEA B;  1Y60 A;  1FI4 A;  3B82 A;  5BR8 E;  2CVE A;  4DR6 I;  1N0U A;  2BV3 A;  3Q6M A;  5C0X A;  3WU4 A;  2Z5E A;  1XNQ E;  1OJ4 A;  4LFA I;  5LMN I;  5LMU E;  2BA0 D;  1I94 I;  2CG9 A;  1OYS A;  4P52 A;  1HR0 E;  5JEA F;  2HKE A;  1Y5Y A;  4LFB E;  4OZE A;  4X62 I;  2VQE E;  2VES A;  4LFC I;  1Y4S A;  2V34 A;  2BA1 G;  3T1Y E;  1ZXM A;  5IT9 Q;  4X66 E;  1J5E E;  1XNR E;  3M85 G;  1IBK I;  2WW4 A;  1NHJ A;  1H7S A;  1H7U A;  2UUB I;  2V2V A;  1MU5 A;  3LNU A;  4FWD A;  2NN6 A;  1UDQ A;  1UDN A;  3JAM Q;  2V2Z A;  4AQY E;  4J3D A;  2AE8 A;  4OO1 E;  1N34 E;  5DRR A;  4DR6 E;  4QNJ A;  2AJ4 A;  4NXM I;  4X65 I;  4GKK I;  4DR2 E;  1H74 A;  2HFS A;  4K0K I;  3CDI A;  4LFA E;  3GLL A;  2IOQ A;  4PU9 A;  5LMN E;  4MU3 A;  1UDO A;  1I94 E;  4URL A;  5K36 C;  1B62 A;  1FJG I;  5C0X B;  2GO4 A;  2PO0 A;  2A2C A;  1FWL A;  1YH8 A;  4IZJ A;  1Z0T A;  3J7A G;  2XEX A;  4JI2 I;  2O1V A;  5IT9 C;  3V5R A;  4UT4 A;  2UUB E;  2ZIT A;  4HY1 A;  2UUA I;  5JEA E;  3ZKB A;  1E3P A;  2IER A;  3V2U C;  4FWH A;  3WU6 A;  4BA2 B;  4DPY A;  4JV5 I;  3HJC A;  5K36 D;  2NN6 B;  1HR0 I;  1UEK A;  3ZZ0 A;  3PYD A;  4X65 E;  4NXM E;  2LJP A;  4GKK E;  4DV1 E;  2VQE I;  4K0K E;  5K36 A;  2C38 B;  1ELO A;  4JI1 I;  1J5E I;  4LF6 I;  1FJG E;  3H4L A;  2NN6 F;  4JI6 I;  1N33 I;  2BM1 A;  4DV7 I;  4B3M I;  4LCG A;  4DR7 I;  1D6T A;  1EA6 A;  5DRO A;  3M6A A;  4DV6 I;  4P7A A;  3K17 A;  2EFG A;  4JI7 E;  4R1F A;  2GQ0 A;  2DEI A;  2BA0 G;  4IZJ B;  2F1D A;  3HUL A;  3D4J A;  4MYU A;  5LL6 R;  1MX0 A;  4AQY I;  4IFD F;  2UUA E;  1N34 I;  4MQY A;  4U3B A;  1IBM E;  1Z0C A;  4DR2 I;  2JEB B;  1H73 A;  2BR2 A;  1USV A;  1QZR A;  4JV5 E;  4OO1 C;  1XXE A;  2ZM6 E;  2E5L I;  2PO2 B;  2Z5C A;  4DPU A;  4MU0 A;  4I3H A;  4KHP E;  5L3J A;  4LF5 E;  1N36 I;  1UDS A;  3GON A;  3PS3 A;  4BA1 A;  4JI1 E;  2IES A;  4DV2 I;  2GO3 A;  4LF6 E;  2UXD I;  4JI6 E;  1Z0E A;  1N33 E;  4DV7 E;  5K36 B;  4B3M E;  2PNZ A;  4BA2 A;  4DXL A;  4DR7 E;  4IFD C;  2CGE A;  2WNR A;  5IWA E;  1FWK A;  2ZBK B;  4DV6 E;  1Z5A A;  4OX9 E;  1Z59 A;  4FW6 A;  4YHH I;  4DR1 I;  3ZZU A;  3J81 C;  2VQF I;  4DR3 E;  4NXN E;  3ZKD A;  3M7N G;  4DR4 E;  1Z5B A;  4OO1 D;  1PIE A;  4KQV A;  2C38 A;  5JEA C;  1XMQ E;  2UXB I;  2NN6 E;  4DPX A;  1K47 A;  4DV1 I;  1S16 A;  4GQU A;  4FN5 A;  3CDJ A;  2BA1 D;  2A2D A;  1WUU A;  1N0V C;  2E5L E;  5EKW A;  5DRQ A;  3M85 D;  2BR2 B;  4IFD D;  2CZ9 A;  4OKG A;  1N36 E;  4IFD E;  1OYP A;  4M1K A;  1RR9 A;  3WU3 A;  4DUY I;  4DV2 E;  2Z5C B;  2UXD E;  4LF7 I;  2R42 A;  4JI7 I;  2WP8 B;  1XMO I;  3B8H A;  1Z0V A;  2JEB A;  4FW3 A;  4FWG A;  4B3S I;  5C0X F;  4HAC A;  4FW4 A;  2O1W A;  4BA1 B;  5JEA D;  4EMD A;  1N32 I;  3J7A M;  4JI3 I;  3QT7 A;  3PRY A;  2PO2 A;  1IBM I;  4YHH E;  4DR1 E;  2PNZ B;  4DPW A;  2VQF E;  4IS9 A;  3PYE A;  2HFU A;  3H1C A;  3GME A;  2WNR B;  3P06 A;  5DNX A;  2ZM6 I;  2UXB E;  2Z5B B;  2UUC I;  3LTO A;  4WUB A;  4KHP I;  4DU8 A;  2X7I A;  4DUZ I;  4LF5 I;  1YHC A;  4USK A;  1XHK A;  3ZM7 A;  2JE6 A;  4DR5 E;  4LCH A;  3PYF A;  2UU9 I;  1PKP A;  4NBQ A;  1Y6Z A;  1NZ0 A;  3L7Z A;  3Q6N A;  4LOM A;  1VI7 A;  1IBL I;  3GCM A;  1Z0W A;  1MG7 A;  1RRE A;  2O1U A;  2HHH I;  5A2Q C;  2O1T A;  3J81 Q;  2C39 B;  2VF3 A;  4DUY E;  5FLX C;  2PO1 B;  5IWA I;  4LF7 E;  2J65 A;  4U3D A;  4JI0 I;  4OX9 I;  4GKJ E;  4HYM A;  1XMO E;  1ZM3 A;  4NXN I;  4DR3 I;  4B3S E;  2BM0 A;  4DV3 I;  4DR4 I;  1N32 E;  1HNX E;  4LF4 I;  4LCF A;  1Y4U A;  4AIM A;  1XMQ I;  4JI3 E;  2Q2E B;  4DPT A;  3KRN A;  1KKH A;  1PVG A;  2UXC E;  4HAC B;  1KVK A;  3OTO E;  4LPF A;  4B3R I;  4PRX A;  1R6L A;  1HK7 A;  4WUC A;  4AM3 A;  3ZZT A;  2NN6 C;  2R3V A;  3WU5 A;  4YY3 I;  1FKA E;  2O3Z A;  2UUC E;  4Z7C A;  3P3C A;  1Z0B A;  5C0X E;  2WP8 A;  4DUZ E;  3LPS A;  4LF9 E;  1S4E A;  4DV5 I;  4JI4 E;  1H72 C;  2UU9 E;  2C37 B;  1KTV A;  1IBL E;  1FNM A;  3PS1 A;  2HHH E;  2DEJ A;  4JI8 I;  2JE6 B;  4PRV A;  4JYA I;  2NPF A;  3P3G A;  3P3E A;  3PS2 A;  4JI0 E;  1USU A;  2PNL A;  2Z5B A;  3L7Z B;  4B3T E;  1DAR A;  4DU7 A;  4DV3 E;  1E3H A;  5GME A;  1A6F A;  5K36 F;  3UHM A;  4LF4 E;  3PYG A;  2NN6 D;  1NHI A;  1VIS A;  1Z5C A;  4LF8 E;  4OO1 A;  2JEA B;  4B3R E;  1KIJ A;  1NHH A;  3DD6 A;  2F4V E;  2C39 A;  4UTG A;  4MYT A;  2PO1 A;  4YY3 E;  4DR5 I;  5A2Q Q;  4X64 I;  2J7K A;  5FLX Q;  3NZK A;  4ISA A;  4JI5 I;  5FWK A;  3CWV A;  3Q1Q A;  4DV5 E;  4USM A;  4ZVI A;  5EL9 A;  4IZK B;  2IOP A;  2JT2 A;  4MDT A;  2GS8 A;  2E1R A;  3J80 Q;  1Z0G A;  4GKJ I;  4AID A;  1R6M A;  2V2Q A;  4IFD A;  3M7N D;  4IZJ D;  1HNZ I;  5DNL A;  4JI8 E;  3QT5 A;  1HNX I;  4JYA E;  4DV4 I;  4X62 E;  5DRP A;  3K1J A;  1ZM4 A;  4LFC E;  4QNK A;  1HNW I;  3T1H I;  3B78 A;  2UXC I;  4DV0 I;  5GMD A;  3HKM A;  4WUD A;  5JEA A;  4ED4 A;  3OTO I;  2V8P A;  4FW7 A;  4HXZ A;  3QT8 A;  2OI2 A;  2PNM A;  1IBK E;  2C37 A;  4LF9 I;  3B4T A;  1RHY A;  1ZM9 A;  5BR8 I;  4JI4 I;  3K85 A;  1ZXN A;  1BKN A; 
#chains in the Genus database with same CATH homology
 1Y60 A;  1Y5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...