5C0XD

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 70
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xD00
2WP8B 2BA0G 5K36E 4OO1B 4IFDE 5JEAE 2JEBB 2NN6D 2JEAB 2C38B 4AM3A 3GLLA 2PO1A 4AIMA 5K36F 2NN6C 4IFDF 3B4TA 2PO2A 2PNZA 5JEAF 3CDJA 2PO0A 2WNRA 3L7ZB 5K36B 3M7ND 4OO1D 5C0XA 2C37A 4IFDC 4IFDB 4BA2A 4BA1B 5JEAB 1UDNA 2C39B 4OO1C 2BA1D 1OYRA 3M7NG 1R6LA 2BR2B 5C0XE 1UDQA 1UDSA 5K36D 1E3HA 2BA1G 2JE6B 3CDIA 4NBQA 4IFDD 2JEAA 5JEAD 1R6MA 5K36C 5C0XF 2NN6A 2PO2B 5JEAC 2PO0B 2WNRB 1OYSA 2BA0D 4AIDA 3L7ZA 1OYPA 2WP8A 5C0XB 4IFDA 3DD6A 1E3PA 3M85D 3KRNA 4OO1A 2NN6E 3H1CA 3U1KA 3GCMA 2JEBA 2C38A 3GMEA 2PO1B 2BR2A 3HKMA 3M85G 2NN6F 2PNZB 5C0XD 2JE6A 4OO1E 1UDOA 5C0XC 5K36A 2C37B 2NN6B 4BA2B 4BA1A 5JEAA 2C39A 4OO1F
chains in the Genus database with same CATH superfamily
1ZXMA 4I3HA 2IERA 4IZJB 4B3MI 4DV4I 1XNRI 4LF9E 3Q6MA 2Q2EB 4JI0I 4DV7E 1HR0E 3U1YA 5K36E 2V2ZA 4USMA 1Z59A 4IFDE 4DV0I 4K0KI 1XMQE 2JEBB 3OTOE 2CZ9A 2JEAB 2C38B 4DR3E 3PS2A 1ZM2A 1J5EE 4DPWA 1N36I 1HNXE 4DR6E 1KIJA 2VF3A 1HNZE 2NN6C 3B4TA 2PO2A 2PO0A 4JI4I 2UXCE 3HULA 4UTGA 4YHHE 2A2CA 5C0XA 2C37A 3Q1QA 2HHHE 4B3TI 4BA1B 2C39B 4B3SI 4JV5I 1RREA 4DU8A 4OO1C 3PYFA 2DEIA 4J3DA 4DV6I 1IBLI 1H7UA 1OYRA 1IBKE 4GKJE 1R6LA 1Z0VA 4X62I 2Z5CA 2UU9I 4MU1A 1XMOI 1UDSA 4USKA 4LFCE 1E3HA 3J81Q 4NBQA 1BKNA 1MX0A 5IT9C 1Z0EA 5JEAD 4LPFA 4QNJA 5K36C 3P3CA 4JI3I 1XNQI 3LTOA 2GS8A 4HACA 5IWAE 2HFSA 3WU5A 2NPFA 2R42A 3ZM7A 2UXBI 4OX9I 4XTJA 4IS9A 4IZKA 2JT2A 4Z7CA 4IFDA 4NXNI 1E3PA 2GQ0A 3P76A 3ZZ0A 1IBMI 1UEKA 2CGEA 3T1YE 3J7AM 2XEXA 2JEBA 1B63A 3GONA 1RHYA 2C38A 3JAMC 1N32E 3HKMA 2O1TA 1N33I 3PYEA 4HXZA 5DRRA 5C0XD 5LMNI 1I94I 3F0NA 4URLA 2HFUA 1HNWE 4GQUA 4X66I 1N0VC 2F1DA 4X64E 4LFAI 4LCHA 2C37B 1MG7A 2NN6B 2V34A 4JI5E 4BA1A 4DR1E 2C39A 4LF7I 3H4LA 2VQEE 2E1RA 4JYAE 4FW9A 1YH8A 1N34E 1FWKA 1PVGA 2Z5CB 2X36A 4GKKE 4OO1B 2BV3A 3Q6NA 2IESA 2J65A 4DV1E 1WUUA 3GLLA 4KHPE 2UUAE 4LF9I 3V5RA 2PO1A 4DV7I 1HR0I 3LPSA 2AJ4A 3B82A 4LCGA 3T1HE 5JEAF 2X7IA 3CDJA 3LNUA 1XMQI 4PRXA 3PS3A 4DR3I 1Z5AA 2UXDE 1J5EI 1HNXI 5K36B 4IZKB 4DR6I 5LMUE 4IFDB 1HNZI 2IOQA 2LJPA 4FW6A 3WU4A 2BA1D 5DNXA 2UXCI 3QT5A 1H73A 5DROA 4DPUA 4DUZE 2F4VE 4YHHI 3M7NG 2HHHI 2V2QA 4PRVA 5LL6R 1P42A 1UDQA 5IT9Q 4LF5E 1H74A 2IOPA 1IBKI 4GKJI 1B62A 2VQFE 1USVA 4DR2E 4LOMA 5C0XF 4LF8E 2NN6A 4LCFA 3J80C 4ED4A 2BM0A 4JI8I 2PNMA 4LFCI 4QNKA 4AIDA 5ELWA 1H72C 3L7ZA 4MU3A 4LF6E 5IWAI 4NXME 1FJGI 4OO1A 2E5LE 3JAMQ 3U1KA 2HKJA 2PO1B 2HK3A 3M85G 4DV3E 4ISAA 3T1YI 2ZM6E 2JE6A 3P3GA 4DV5E 1N32I 5EL9A 4Z7YA 5K36A 4JI7E 4DPYA 1Y4UA 1N0UA 4N3OA 4DR5E 1Y60A 4DR7E 2CG9A 2WP8B 4LFBE 2R3VA 1K47A 4YY3E 1HNWI 2O1WA 4X64I 4JI5I 4DR1I 5BR8E 1Z0CA 1XXEA 2OI2A 2ZBKB 5L3JA 4JI6E 5JEAE 3QT7A 5A2QC 2VQEI 2NN6D 1PIEA 4AM3A 4JYAI 4WUBA 1XNQE 4X65I 1N34I 4RPFA 1FNMA 4GKKI 1ZXNA 3UHMA 2UUBE 1D6TA 4JI1E 4WUCA 4FWHA 4P52A 3L7ZB 4DV1I 4KHPI 4DPXA 2UUAI 4OO1D 1H7SA 4BA2A 3T1HI 4OZEA 1NHJA 1QZRA 4FW5A 4MYUA 2UXDI 2HKEA 4AQYE 3B8HA 5LMUI 1Z5CA 4KQVA 3HJCA 1NHIA 5C0XE 4B3RE 4DR4E 2V8PA 3K85A 4DXLA 5K36D 4DUYE 4FW3A 2JE6B 4IFDD 1S16A 3OTOI 4DUZI 2F4VI 3D4JA 4LFAE 3J80Q 2O1UA 5JEAC 2EFGA 1MU5A 2WNRB 3CWVA 2UUCE 1OYSA 3WU3A 4LF5I 3B78A 4JG4A 1OYPA 2WP8A 4MYTA 4PU9A 3PYDA 4LF4E 4DR2I 2Z5BA 3DD6A 4LF8I 3J7AG 2PNLA 3KRNA 4MQYA 1EI1A 2DEJA 4MU4A 5GMEA 3K1JA 3PYGA 1PKPA 3P06A 1Z5BA 1ZM3A 5DRPA 2BR2A 4UT4A 4LF6I 4JI2E 1KTVA 4DV2E 4NXMI 2NN6F 1Y6ZA 5FWKA 2E5LI 1VISA 2WW4A 4WUDA 1UDOA 1A6FA 3V2UC 4B3ME 4DV4E 5C0XC 4M1KA 1XNRE 4JI0E 2O1VA 4BA2B 4MDTA 4DV3I 4K0KE 5DNLA 4DV0E 1XHKA 4OO1F 1OJ4A 2ZM6I 2Z5EA 4ZVIA 1USUA 3ZZUA 3ZKBA 5FLXC 2BA0G 3PRYA 1FKAE 2HK2A 4FN5A 4DV5I 1N36E 4JI7I 4DU7A 3QT6A 1FWLA 5A2QQ 4DR5I 4FWGA 3NZKA 4DR7I 2GO4A 1Z0BA 4JI4E 4LFBI 2ZITA 1Z0TA 1HK7A 4YY3I 4HYMA 4B3TE 4AIMA 5K36F 3P3EA 4IFDF 4B3SE 2PNZA 5BR8I 4JI8E 4JV5E 4JI6I 4MU0A 1VI7A 4DV6E 1ZM9A 1Y4SA 2WNRA 1IBLE 3M7ND 1KKHA 4IFDC 2Z5BB 4X62E 5JEAB 2VESA 1FJGE 2UU9E 1UDNA 1XMOE 2UUBI 4JI1I 4HY1A 4FW4A 4IZJA 4P7AA 1RR9A 3PS1A 1S4EA 4JI3E 2BR2B 3ZKDA 2O3ZA 1DARA 2BA1G 3CDIA 2JEAA 2UXBE 2A2DA 4OX9E 1R6MA 3J81C 4AQYI 4OKGA 1FI4A 2J7KA 3QT8A 4NXNE 2PO2B 4B3RI 4DR4I 1ZM4A 1IBME 2PO0B 4DUYI 4R1FA 1NZ0A 2BA0D 5C0XB 1ELOA 1NHHA 5DRQA 3M85D 1EA6A 1N33E 3K17A 3WU6A 1Z0GA 2NN6E 3H1CA 5EKWA 2UUCI 5LMNE 1I94E 3GCMA 5GMDA 4EMDA 2GO3A 4LF4I 3ZZTA 3M6AA 3GMEA 4X65E 4X66E 1U2RA 2PNZB 2BM1A 4U3DA 4U3BA 4LF7E 1Z0WA 4FWDA 4OO1E 4FW7A 2AE8A 1Y5YA 2VQFI 4HACB 4DPTA 4JI2I 2V2VA 5JEAA 4DV2I 4IZJD 1KVKA 5FLXQ 2CVEA 1YHCA
chains in the Genus database with same CATH topology
2WP8B 2BA0G 5K36E 4OO1B 4IFDE 5JEAE 2JEBB 2NN6D 2JEAB 2C38B 4AM3A 3GLLA 2PO1A 4AIMA 5K36F 2NN6C 4IFDF 3B4TA 2PO2A 2PNZA 5JEAF 3CDJA 2PO0A 2WNRA 3L7ZB 5K36B 3M7ND 4OO1D 5C0XA 2C37A 4IFDC 4IFDB 4BA2A 4BA1B 5JEAB 1UDNA 2C39B 4OO1C 2BA1D 1OYRA 3M7NG 1R6LA 2BR2B 5C0XE 1UDQA 1UDSA 5K36D 1E3HA 2BA1G 2JE6B 3CDIA 4NBQA 4IFDD 2JEAA 5JEAD 1R6MA 5K36C 5C0XF 2NN6A 2PO2B 5JEAC 2PO0B 2WNRB 1OYSA 2BA0D 4AIDA 3L7ZA 1OYPA 2WP8A 5C0XB 4IFDA 3DD6A 1E3PA 3M85D 3KRNA 4OO1A 2NN6E 3H1CA 3U1KA 3GCMA 2JEBA 2C38A 3GMEA 2PO1B 2BR2A 3HKMA 3M85G 2NN6F 2PNZB 5C0XD 2JE6A 4OO1E 1UDOA 5C0XC 5K36A 2C37B 2NN6B 4BA2B 4BA1A 5JEAA 2C39A 4OO1F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP8 B;  2BA0 G;  5K36 E;  4OO1 B;  4IFD E;  5JEA E;  2JEB B;  2NN6 D;  2JEA B;  2C38 B;  4AM3 A;  3GLL A;  2PO1 A;  4AIM A;  5K36 F;  2NN6 C;  4IFD F;  3B4T A;  2PO2 A;  2PNZ A;  5JEA F;  3CDJ A;  2PO0 A;  2WNR A;  3L7Z B;  5K36 B;  3M7N D;  4OO1 D;  5C0X A;  2C37 A;  4IFD C;  4IFD B;  4BA2 A;  4BA1 B;  5JEA B;  1UDN A;  2C39 B;  4OO1 C;  2BA1 D;  1OYR A;  3M7N G;  1R6L A;  2BR2 B;  5C0X E;  1UDQ A;  1UDS A;  5K36 D;  1E3H A;  2BA1 G;  2JE6 B;  3CDI A;  4NBQ A;  4IFD D;  2JEA A;  5JEA D;  1R6M A;  5K36 C;  5C0X F;  2NN6 A;  2PO2 B;  5JEA C;  2PO0 B;  2WNR B;  1OYS A;  2BA0 D;  4AID A;  3L7Z A;  1OYP A;  2WP8 A;  5C0X B;  4IFD A;  3DD6 A;  1E3P A;  3M85 D;  3KRN A;  4OO1 A;  2NN6 E;  3H1C A;  3U1K A;  3GCM A;  2JEB A;  2C38 A;  3GME A;  2PO1 B;  2BR2 A;  3HKM A;  3M85 G;  2NN6 F;  2PNZ B;  5C0X D;  2JE6 A;  4OO1 E;  1UDO A;  5C0X C;  5K36 A;  2C37 B;  2NN6 B;  4BA2 B;  4BA1 A;  5JEA A;  2C39 A;  4OO1 F; 
#chains in the Genus database with same CATH topology
 1ZXM A;  4I3H A;  2IER A;  4IZJ B;  4B3M I;  4DV4 I;  1XNR I;  4LF9 E;  3Q6M A;  2Q2E B;  4JI0 I;  4DV7 E;  1HR0 E;  3U1Y A;  5K36 E;  2V2Z A;  4USM A;  1Z59 A;  4IFD E;  4DV0 I;  4K0K I;  1XMQ E;  2JEB B;  3OTO E;  2CZ9 A;  2JEA B;  2C38 B;  4DR3 E;  3PS2 A;  1ZM2 A;  1J5E E;  4DPW A;  1N36 I;  1HNX E;  4DR6 E;  1KIJ A;  2VF3 A;  1HNZ E;  2NN6 C;  3B4T A;  2PO2 A;  2PO0 A;  4JI4 I;  2UXC E;  3HUL A;  4UTG A;  4YHH E;  2A2C A;  5C0X A;  2C37 A;  3Q1Q A;  2HHH E;  4B3T I;  4BA1 B;  2C39 B;  4B3S I;  4JV5 I;  1RRE A;  4DU8 A;  4OO1 C;  3PYF A;  2DEI A;  4J3D A;  4DV6 I;  1IBL I;  1H7U A;  1OYR A;  1IBK E;  4GKJ E;  1R6L A;  1Z0V A;  4X62 I;  2Z5C A;  2UU9 I;  4MU1 A;  1XMO I;  1UDS A;  4USK A;  4LFC E;  1E3H A;  3J81 Q;  4NBQ A;  1BKN A;  1MX0 A;  5IT9 C;  1Z0E A;  5JEA D;  4LPF A;  4QNJ A;  5K36 C;  3P3C A;  4JI3 I;  1XNQ I;  3LTO A;  2GS8 A;  4HAC A;  5IWA E;  2HFS A;  3WU5 A;  2NPF A;  2R42 A;  3ZM7 A;  2UXB I;  4OX9 I;  4XTJ A;  4IS9 A;  4IZK A;  2JT2 A;  4Z7C A;  4IFD A;  4NXN I;  1E3P A;  2GQ0 A;  3P76 A;  3ZZ0 A;  1IBM I;  1UEK A;  2CGE A;  3T1Y E;  3J7A M;  2XEX A;  2JEB A;  1B63 A;  3GON A;  1RHY A;  2C38 A;  3JAM C;  1N32 E;  3HKM A;  2O1T A;  1N33 I;  3PYE A;  4HXZ A;  5DRR A;  5C0X D;  5LMN I;  1I94 I;  3F0N A;  4URL A;  2HFU A;  1HNW E;  4GQU A;  4X66 I;  1N0V C;  2F1D A;  4X64 E;  4LFA I;  4LCH A;  2C37 B;  1MG7 A;  2NN6 B;  2V34 A;  4JI5 E;  4BA1 A;  4DR1 E;  2C39 A;  4LF7 I;  3H4L A;  2VQE E;  2E1R A;  4JYA E;  4FW9 A;  1YH8 A;  1N34 E;  1FWK A;  1PVG A;  2Z5C B;  2X36 A;  4GKK E;  4OO1 B;  2BV3 A;  3Q6N A;  2IES A;  2J65 A;  4DV1 E;  1WUU A;  3GLL A;  4KHP E;  2UUA E;  4LF9 I;  3V5R A;  2PO1 A;  4DV7 I;  1HR0 I;  3LPS A;  2AJ4 A;  3B82 A;  4LCG A;  3T1H E;  5JEA F;  2X7I A;  3CDJ A;  3LNU A;  1XMQ I;  4PRX A;  3PS3 A;  4DR3 I;  1Z5A A;  2UXD E;  1J5E I;  1HNX I;  5K36 B;  4IZK B;  4DR6 I;  5LMU E;  4IFD B;  1HNZ I;  2IOQ A;  2LJP A;  4FW6 A;  3WU4 A;  2BA1 D;  5DNX A;  2UXC I;  3QT5 A;  1H73 A;  5DRO A;  4DPU A;  4DUZ E;  2F4V E;  4YHH I;  3M7N G;  2HHH I;  2V2Q A;  4PRV A;  5LL6 R;  1P42 A;  1UDQ A;  5IT9 Q;  4LF5 E;  1H74 A;  2IOP A;  1IBK I;  4GKJ I;  1B62 A;  2VQF E;  1USV A;  4DR2 E;  4LOM A;  5C0X F;  4LF8 E;  2NN6 A;  4LCF A;  3J80 C;  4ED4 A;  2BM0 A;  4JI8 I;  2PNM A;  4LFC I;  4QNK A;  4AID A;  5ELW A;  1H72 C;  3L7Z A;  4MU3 A;  4LF6 E;  5IWA I;  4NXM E;  1FJG I;  4OO1 A;  2E5L E;  3JAM Q;  3U1K A;  2HKJ A;  2PO1 B;  2HK3 A;  3M85 G;  4DV3 E;  4ISA A;  3T1Y I;  2ZM6 E;  2JE6 A;  3P3G A;  4DV5 E;  1N32 I;  5EL9 A;  4Z7Y A;  5K36 A;  4JI7 E;  4DPY A;  1Y4U A;  1N0U A;  4N3O A;  4DR5 E;  1Y60 A;  4DR7 E;  2CG9 A;  2WP8 B;  4LFB E;  2R3V A;  1K47 A;  4YY3 E;  1HNW I;  2O1W A;  4X64 I;  4JI5 I;  4DR1 I;  5BR8 E;  1Z0C A;  1XXE A;  2OI2 A;  2ZBK B;  5L3J A;  4JI6 E;  5JEA E;  3QT7 A;  5A2Q C;  2VQE I;  2NN6 D;  1PIE A;  4AM3 A;  4JYA I;  4WUB A;  1XNQ E;  4X65 I;  1N34 I;  4RPF A;  1FNM A;  4GKK I;  1ZXN A;  3UHM A;  2UUB E;  1D6T A;  4JI1 E;  4WUC A;  4FWH A;  4P52 A;  3L7Z B;  4DV1 I;  4KHP I;  4DPX A;  2UUA I;  4OO1 D;  1H7S A;  4BA2 A;  3T1H I;  4OZE A;  1NHJ A;  1QZR A;  4FW5 A;  4MYU A;  2UXD I;  2HKE A;  4AQY E;  3B8H A;  5LMU I;  1Z5C A;  4KQV A;  3HJC A;  1NHI A;  5C0X E;  4B3R E;  4DR4 E;  2V8P A;  3K85 A;  4DXL A;  5K36 D;  4DUY E;  4FW3 A;  2JE6 B;  4IFD D;  1S16 A;  3OTO I;  4DUZ I;  2F4V I;  3D4J A;  4LFA E;  3J80 Q;  2O1U A;  5JEA C;  2EFG A;  1MU5 A;  2WNR B;  3CWV A;  2UUC E;  1OYS A;  3WU3 A;  4LF5 I;  3B78 A;  4JG4 A;  1OYP A;  2WP8 A;  4MYT A;  4PU9 A;  3PYD A;  4LF4 E;  4DR2 I;  2Z5B A;  3DD6 A;  4LF8 I;  3J7A G;  2PNL A;  3KRN A;  4MQY A;  1EI1 A;  2DEJ A;  4MU4 A;  5GME A;  3K1J A;  3PYG A;  1PKP A;  3P06 A;  1Z5B A;  1ZM3 A;  5DRP A;  2BR2 A;  4UT4 A;  4LF6 I;  4JI2 E;  1KTV A;  4DV2 E;  4NXM I;  2NN6 F;  1Y6Z A;  5FWK A;  2E5L I;  1VIS A;  2WW4 A;  4WUD A;  1UDO A;  1A6F A;  3V2U C;  4B3M E;  4DV4 E;  5C0X C;  4M1K A;  1XNR E;  4JI0 E;  2O1V A;  4BA2 B;  4MDT A;  4DV3 I;  4K0K E;  5DNL A;  4DV0 E;  1XHK A;  4OO1 F;  1OJ4 A;  2ZM6 I;  2Z5E A;  4ZVI A;  1USU A;  3ZZU A;  3ZKB A;  5FLX C;  2BA0 G;  3PRY A;  1FKA E;  2HK2 A;  4FN5 A;  4DV5 I;  1N36 E;  4JI7 I;  4DU7 A;  3QT6 A;  1FWL A;  5A2Q Q;  4DR5 I;  4FWG A;  3NZK A;  4DR7 I;  2GO4 A;  1Z0B A;  4JI4 E;  4LFB I;  2ZIT A;  1Z0T A;  1HK7 A;  4YY3 I;  4HYM A;  4B3T E;  4AIM A;  5K36 F;  3P3E A;  4IFD F;  4B3S E;  2PNZ A;  5BR8 I;  4JI8 E;  4JV5 E;  4JI6 I;  4MU0 A;  1VI7 A;  4DV6 E;  1ZM9 A;  1Y4S A;  2WNR A;  1IBL E;  3M7N D;  1KKH A;  4IFD C;  2Z5B B;  4X62 E;  5JEA B;  2VES A;  1FJG E;  2UU9 E;  1UDN A;  1XMO E;  2UUB I;  4JI1 I;  4HY1 A;  4FW4 A;  4IZJ A;  4P7A A;  1RR9 A;  3PS1 A;  1S4E A;  4JI3 E;  2BR2 B;  3ZKD A;  2O3Z A;  1DAR A;  2BA1 G;  3CDI A;  2JEA A;  2UXB E;  2A2D A;  4OX9 E;  1R6M A;  3J81 C;  4AQY I;  4OKG A;  1FI4 A;  2J7K A;  3QT8 A;  4NXN E;  2PO2 B;  4B3R I;  4DR4 I;  1ZM4 A;  1IBM E;  2PO0 B;  4DUY I;  4R1F A;  1NZ0 A;  2BA0 D;  5C0X B;  1ELO A;  1NHH A;  5DRQ A;  3M85 D;  1EA6 A;  1N33 E;  3K17 A;  3WU6 A;  1Z0G A;  2NN6 E;  3H1C A;  5EKW A;  2UUC I;  5LMN E;  1I94 E;  3GCM A;  5GMD A;  4EMD A;  2GO3 A;  4LF4 I;  3ZZT A;  3M6A A;  3GME A;  4X65 E;  4X66 E;  1U2R A;  2PNZ B;  2BM1 A;  4U3D A;  4U3B A;  4LF7 E;  1Z0W A;  4FWD A;  4OO1 E;  4FW7 A;  2AE8 A;  1Y5Y A;  2VQF I;  4HAC B;  4DPT A;  4JI2 I;  2V2V A;  5JEA A;  4DV2 I;  4IZJ D;  1KVK A;  5FLX Q;  2CVE A;  1YHC A; 
#chains in the Genus database with same CATH homology
 2WP8 B;  2BA0 G;  5K36 E;  4OO1 B;  4IFD E;  5JEA E;  2JEB B;  2NN6 D;  2JEA B;  2C38 B;  4AM3 A;  3GLL A;  2PO1 A;  4AIM A;  5K36 F;  2NN6 C;  4IFD F;  3B4T A;  2PO2 A;  2PNZ A;  5JEA F;  3CDJ A;  2PO0 A;  2WNR A;  3L7Z B;  5K36 B;  3M7N D;  4OO1 D;  5C0X A;  2C37 A;  4IFD C;  4IFD B;  4BA2 A;  4BA1 B;  5JEA B;  1UDN A;  2C39 B;  4OO1 C;  2BA1 D;  1OYR A;  3M7N G;  1R6L A;  2BR2 B;  5C0X E;  1UDQ A;  1UDS A;  5K36 D;  1E3H A;  2BA1 G;  2JE6 B;  3CDI A;  4NBQ A;  4IFD D;  2JEA A;  5JEA D;  1R6M A;  5K36 C;  5C0X F;  2NN6 A;  2PO2 B;  5JEA C;  2PO0 B;  2WNR B;  1OYS A;  2BA0 D;  4AID A;  3L7Z A;  1OYP A;  2WP8 A;  5C0X B;  4IFD A;  3DD6 A;  1E3P A;  3M85 D;  3KRN A;  4OO1 A;  2NN6 E;  3H1C A;  3U1K A;  3GCM A;  2JEB A;  2C38 A;  3GME A;  2PO1 B;  2BR2 A;  3HKM A;  3M85 G;  2NN6 F;  2PNZ B;  5C0X D;  2JE6 A;  4OO1 E;  1UDO A;  5C0X C;  5K36 A;  2C37 B;  2NN6 B;  4BA2 B;  4BA1 A;  5JEA A;  2C39 A;  4OO1 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...