5C0XD

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 70
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xD00
3GMEA 2BA0G 4NBQA 3H1CA 2WNRB 5K36C 4OO1D 2WP8B 3KRNA 4IFDE 2BA1G 2JEBA 2C39B 1OYPA 4BA2A 1UDSA 3B4TA 2BR2A 2JE6A 5C0XC 4OO1E 5K36D 4AM3A 2PNZA 2PO1A 1OYSA 5K36A 5JEAC 3M7ND 4OO1B 5C0XD 2NN6C 2BA1D 2PO2B 2C37B 2C38A 3GCMA 3L7ZB 5K36F 5C0XA 4BA1B 1UDQA 3CDJA 3DD6A 3M85G 2NN6D 5JEAA 5C0XF 2NN6A 4IFDA 2JEAA 2PO0A 2BA0D 2JEBB 3CDIA 4BA2B 1R6MA 5K36E 4AIMA 4IFDC 5JEAF 2BR2B 2JE6B 2NN6F 4IFDF 2WNRA 2PNZB 1UDOA 5JEAD 2PO1B 3M85D 4OO1C 2C39A 5K36B 5C0XE 4IFDD 1R6LA 3U1KA 1E3PA 3M7NG 5JEAE 2C38B 5C0XB 2NN6E 3HKMA 1OYRA 4OO1A 3GLLA 1UDNA 2WP8A 5JEAB 2PO2A 2C37A 3L7ZA 2NN6B 4IFDB 4AIDA 1E3HA 4BA1A 2JEAB 2PO0B 4OO1F
chains in the Genus database with same CATH superfamily
2Z5CA 4DV6E 1IBKE 4FWHA 4DR5E 4KHPI 1MG7A 1Z0WA 1H7UA 2Q2EB 3T1HE 5BR8E 4LF7E 2V34A 4IFDE 4HY1A 1S4EA 1XMQI 3PRYA 1IBLI 4JV5I 4K0KI 2ZITA 4YY3E 1HNWI 1IBMI 2F4VE 3B4TA 4URLA 4JI4I 4MU3A 2V2QA 4UTGA 4ED4A 1ZXMA 2PNZA 1NZ0A 4U3BA 1VISA 1XMOE 4NXNI 3K85A 4NXMI 1Z5AA 3J81Q 3GONA 4DV5E 4DV6I 5IWAE 1IBKI 1N32E 4DR5I 2O3ZA 1DARA 2PO2B 1D6TA 1ZXNA 1Z5BA 3T1HI 1I94E 5BR8I 4LF7I 5C0XA 3J7AG 1Z0TA 4BA1B 4YY3I 2F4VI 3M85G 1EA6A 2NN6D 4DPUA 2Z5CB 4LOMA 2CG9A 3NZKA 5JEAA 4DR6E 3ZZTA 5C0XF 4DV1E 1B62A 4IFDA 2Z5EA 4FW3A 2V8PA 2WW4A 2JEAA 3K17A 1XMOI 1S16A 2A2DA 1H73A 1ZM9A 4LF9E 2UUCE 5JEAF 4DV5I 5IWAI 1N32I 4IFDF 2PNZB 4JI1E 2AE8A 1I94I 1KVKA 5LMUE 1HNZE 3M85D 2ZM6E 2C39A 2IOQA 2V2VA 2X36A 3U1KA 1N0VC 2UU9E 4DR6I 4DV1I 1FWKA 5C0XB 3B78A 4LF9I 1XNQE 4OKGA 2UUCI 4OO1A 4B3ME 2O1VA 4IZJA 2O1TA 5EKWA 5JEAB 4R1FA 1USUA 4JI1I 1N34E 4IFDB 5LMUI 1HNZI 2CGEA 2ZM6I 2JEAB 2HKJA 1OJ4A 4OO1F 2UUBE 1XXEA 4MU4A 4HACA 1Z0BA 2BA0G 4LPFA 3H1CA 2UU9I 1N33E 4FWDA 5DROA 3LNUA 3J80Q 3JAMC 2C39B 1OYPA 4BA2A 1PVGA 4LF5E 4RPFA 1XNQI 2CVEA 1B63A 4FW6A 5FLXC 2JE6A 4B3MI 5DNXA 4AM3A 2UXDE 2GO3A 4MDTA 3PS3A 2VQFE 1N34I 4JI0E 4YHHE 2OI2A 3PYDA 5K36A 2UUBI 5DRPA 4QNKA 4GKJE 4OO1B 4IZKA 2NN6C 5C0XD 2HK2A 1N33I 4IZJB 2VF3A 3P76A 4DV2E 5K36F 1HNXE 4LCFA 3ZM7A 3UHMA 2PNLA 5EL9A 4LF5I 4I3HA 4EMDA 4UT4A 4HACB 3P3CA 1MU5A 2UXDI 4JI6E 3J81C 2VQFI 2LJPA 4JG4A 4JI0I 4YHHI 3QT5A 5A2QQ 2PO0A 3F0NA 1KKHA 2R3VA 4BA2B 1N0UA 2PNMA 2BM1A 4DU8A 4GKJI 1J5EE 3HJCA 3PYGA 1Y60A 2JE6B 2WNRA 2BV3A 4DPTA 4DV2I 4MU1A 1UDOA 1HNXI 1HK7A 1K47A 2X7IA 1Z0CA 5K36B 2VQEE 4USKA 3WU3A 1UEKA 4MYUA 2R42A 4PRVA 4IZKB 3V2UC 5IT9Q 4JI6I 3M7NG 1WUUA 1KTVA 4MU0A 2DEJA 2NN6E 1P42A 4JI7E 1OYRA 3ZKBA 1J5EI 1UDNA 4DUYE 3QT8A 4GQUA 3H4LA 2C37A 1FNMA 3L7ZA 4JYAE 1RR9A 4AIDA 3ZZUA 4DV3E 2PO0B 4FN5A 2VQEI 4ISAA 2DEIA 4LFCE 2WNRB 4ZVIA 3KRNA 4DR4E 2E5LE 1MX0A 5DRRA 4X64E 3OTOE 4JI7I 1NHJA 4B3RE 1YHCA 1H7SA 4DUYI 4JI2E 1Z0VA 5C0XC 5K36D 5DNLA 4JYAI 1NHHA 4DV3I 2AJ4A 3M6AA 4LF6E 3Q1QA 5LL6R 5JEAC 4Z7CA 1Z5CA 1PKPA 2JT2A 2HK3A 3J80C 3T1YE 4LFCI 1RHYA 4X66E 2C37B 3L7ZB 3ZZ0A 4DR4I 4OX9E 2E5LI 2HFSA 1UDQA 4LF8E 3DD6A 4B3TE 1HR0E 4X64I 3OTOI 4JI3E 3CWVA 3LTOA 4HXZA 4B3RI 4DU7A 4USMA 4JI2I 4GKKE 2IESA 2BA0D 4LF6I 2UXBE 3PYEA 4DV7E 4AIMA 4FW7A 4FW9A 1ZM4A 2E1RA 1U2RA 3T1YI 2O1WA 2UXCE 4DR3E 2F1DA 4X66I 1RREA 4FW5A 4LCHA 5JEAD 4OX9I 4OO1C 2Z5BA 5C0XE 4LF8I 4M1KA 1Z0EA 5FLXQ 4IFDD 3Q6NA 4B3TI 3QT7A 1R6LA 1HR0I 4LFBE 2GQ0A 4JI3I 3WU6A 2V2ZA 5A2QC 4WUBA 4FWGA 3LPSA 1ZM3A 4FW4A 4GKKI 3Q6MA 5JEAE 3B82A 1BKNA 4J3DA 2UXBI 4DV7I 1EI1A 3PS2A 5DRQA 4OZEA 1H72C 2BM0A 4LCGA 2UXCI 4DR3I 2VESA 1QZRA 1YH8A 5IT9C 3ZKDA 4LFBI 3GMEA 3PYFA 3V5RA 4NBQA 1XNRE 1H74A 5K36C 2IOPA 4OO1D 2WP8B 4P52A 4IZJD 2BA1G 3PS1A 2JEBA 2Z5BB 5GMEA 1UDSA 1Y4SA 1FKAE 2BR2A 2ZBKB 4DPYA 2IERA 4OO1E 4JI5E 4MQYA 3K1JA 4X62E 3QT6A 4LF4E 3D4JA 2PO1A 1OYSA 4DR2E 2J65A 4DV0E 5ELWA 2XEXA 3WU4A 4DUZE 1PIEA 2HKEA 4DR1E 3M7ND 2GO4A 1XHKA 3P3GA 1XNRI 3B8HA 2BA1D 1KIJA 2C38A 3GCMA 2NPFA 1FI4A 2A2CA 4XTJA 1Y6ZA 3CDJA 2UUAE 1Y4UA 1NHIA 2HHHE 1ELOA 4B3SE 4LFAE 1N36E 4JI5I 5LMNE 2HFUA 4X62I 2NN6A 4WUDA 3P06A 4LF4I 4DR2I 1Z59A 1ZM2A 4KQVA 4DV0I 5FWKA 2JEBB 5L3JA 1FJGE 2EFGA 1FWLA 3CDIA 4DUZI 4DV4E 1R6MA 4PRXA 5K36E 1Z0GA 4DR1I 4IFDC 2BR2B 4P7AA 3HULA 4X65E 4AQYE 2NN6F 4U3DA 3U1YA 4HYMA 2GS8A 4DPWA 2CZ9A 2PO1B 3P3EA 4DR7E 4JI8E 2J7KA 2UUAI 2O1UA 3J7AM 1Y5YA 2HHHI 5GMDA 4WUCA 4Z7YA 1E3PA 4KHPE 4B3SI 4LFAI 1N36I 4MYTA 5LMNI 2C38B 1IBLE 1XMQE 4JV5E 4K0KE 1VI7A 1FJGI 3HKMA 4DXLA 4DV4I 1HNWE 1IBME 4JI4E 3GLLA 4X65I 4IS9A 4AQYI 3WU5A 2WP8A 3JAMQ 2PO2A 4DPXA 4PU9A 1A6FA 2NN6B 4QNJA 1E3HA 4N3OA 4BA1A 4DR7I 4NXNE 1USVA 4NXME 4JI8I
chains in the Genus database with same CATH topology
3GMEA 2BA0G 4NBQA 3H1CA 2WNRB 5K36C 4OO1D 2WP8B 3KRNA 4IFDE 2BA1G 2JEBA 2C39B 1OYPA 4BA2A 1UDSA 3B4TA 2BR2A 2JE6A 5C0XC 4OO1E 5K36D 4AM3A 2PNZA 2PO1A 1OYSA 5K36A 5JEAC 3M7ND 4OO1B 5C0XD 2NN6C 2BA1D 2PO2B 2C37B 2C38A 3GCMA 3L7ZB 5K36F 5C0XA 4BA1B 1UDQA 3CDJA 3DD6A 3M85G 2NN6D 5JEAA 5C0XF 2NN6A 4IFDA 2JEAA 2PO0A 2BA0D 2JEBB 3CDIA 4BA2B 1R6MA 5K36E 4AIMA 4IFDC 5JEAF 2BR2B 2JE6B 2NN6F 4IFDF 2WNRA 2PNZB 1UDOA 5JEAD 2PO1B 3M85D 4OO1C 2C39A 5K36B 5C0XE 4IFDD 1R6LA 3U1KA 1E3PA 3M7NG 5JEAE 2C38B 5C0XB 2NN6E 3HKMA 1OYRA 4OO1A 3GLLA 1UDNA 2WP8A 5JEAB 2PO2A 2C37A 3L7ZA 2NN6B 4IFDB 4AIDA 1E3HA 4BA1A 2JEAB 2PO0B 4OO1F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GME A;  2BA0 G;  4NBQ A;  3H1C A;  2WNR B;  5K36 C;  4OO1 D;  2WP8 B;  3KRN A;  4IFD E;  2BA1 G;  2JEB A;  2C39 B;  1OYP A;  4BA2 A;  1UDS A;  3B4T A;  2BR2 A;  2JE6 A;  5C0X C;  4OO1 E;  5K36 D;  4AM3 A;  2PNZ A;  2PO1 A;  1OYS A;  5K36 A;  5JEA C;  3M7N D;  4OO1 B;  5C0X D;  2NN6 C;  2BA1 D;  2PO2 B;  2C37 B;  2C38 A;  3GCM A;  3L7Z B;  5K36 F;  5C0X A;  4BA1 B;  1UDQ A;  3CDJ A;  3DD6 A;  3M85 G;  2NN6 D;  5JEA A;  5C0X F;  2NN6 A;  4IFD A;  2JEA A;  2PO0 A;  2BA0 D;  2JEB B;  3CDI A;  4BA2 B;  1R6M A;  5K36 E;  4AIM A;  4IFD C;  5JEA F;  2BR2 B;  2JE6 B;  2NN6 F;  4IFD F;  2WNR A;  2PNZ B;  1UDO A;  5JEA D;  2PO1 B;  3M85 D;  4OO1 C;  2C39 A;  5K36 B;  5C0X E;  4IFD D;  1R6L A;  3U1K A;  1E3P A;  3M7N G;  5JEA E;  2C38 B;  5C0X B;  2NN6 E;  3HKM A;  1OYR A;  4OO1 A;  3GLL A;  1UDN A;  2WP8 A;  5JEA B;  2PO2 A;  2C37 A;  3L7Z A;  2NN6 B;  4IFD B;  4AID A;  1E3H A;  4BA1 A;  2JEA B;  2PO0 B;  4OO1 F; 
#chains in the Genus database with same CATH topology
 2Z5C A;  4DV6 E;  1IBK E;  4FWH A;  4DR5 E;  4KHP I;  1MG7 A;  1Z0W A;  1H7U A;  2Q2E B;  3T1H E;  5BR8 E;  4LF7 E;  2V34 A;  4IFD E;  4HY1 A;  1S4E A;  1XMQ I;  3PRY A;  1IBL I;  4JV5 I;  4K0K I;  2ZIT A;  4YY3 E;  1HNW I;  1IBM I;  2F4V E;  3B4T A;  4URL A;  4JI4 I;  4MU3 A;  2V2Q A;  4UTG A;  4ED4 A;  1ZXM A;  2PNZ A;  1NZ0 A;  4U3B A;  1VIS A;  1XMO E;  4NXN I;  3K85 A;  4NXM I;  1Z5A A;  3J81 Q;  3GON A;  4DV5 E;  4DV6 I;  5IWA E;  1IBK I;  1N32 E;  4DR5 I;  2O3Z A;  1DAR A;  2PO2 B;  1D6T A;  1ZXN A;  1Z5B A;  3T1H I;  1I94 E;  5BR8 I;  4LF7 I;  5C0X A;  3J7A G;  1Z0T A;  4BA1 B;  4YY3 I;  2F4V I;  3M85 G;  1EA6 A;  2NN6 D;  4DPU A;  2Z5C B;  4LOM A;  2CG9 A;  3NZK A;  5JEA A;  4DR6 E;  3ZZT A;  5C0X F;  4DV1 E;  1B62 A;  4IFD A;  2Z5E A;  4FW3 A;  2V8P A;  2WW4 A;  2JEA A;  3K17 A;  1XMO I;  1S16 A;  2A2D A;  1H73 A;  1ZM9 A;  4LF9 E;  2UUC E;  5JEA F;  4DV5 I;  5IWA I;  1N32 I;  4IFD F;  2PNZ B;  4JI1 E;  2AE8 A;  1I94 I;  1KVK A;  5LMU E;  1HNZ E;  3M85 D;  2ZM6 E;  2C39 A;  2IOQ A;  2V2V A;  2X36 A;  3U1K A;  1N0V C;  2UU9 E;  4DR6 I;  4DV1 I;  1FWK A;  5C0X B;  3B78 A;  4LF9 I;  1XNQ E;  4OKG A;  2UUC I;  4OO1 A;  4B3M E;  2O1V A;  4IZJ A;  2O1T A;  5EKW A;  5JEA B;  4R1F A;  1USU A;  4JI1 I;  1N34 E;  4IFD B;  5LMU I;  1HNZ I;  2CGE A;  2ZM6 I;  2JEA B;  2HKJ A;  1OJ4 A;  4OO1 F;  2UUB E;  1XXE A;  4MU4 A;  4HAC A;  1Z0B A;  2BA0 G;  4LPF A;  3H1C A;  2UU9 I;  1N33 E;  4FWD A;  5DRO A;  3LNU A;  3J80 Q;  3JAM C;  2C39 B;  1OYP A;  4BA2 A;  1PVG A;  4LF5 E;  4RPF A;  1XNQ I;  2CVE A;  1B63 A;  4FW6 A;  5FLX C;  2JE6 A;  4B3M I;  5DNX A;  4AM3 A;  2UXD E;  2GO3 A;  4MDT A;  3PS3 A;  2VQF E;  1N34 I;  4JI0 E;  4YHH E;  2OI2 A;  3PYD A;  5K36 A;  2UUB I;  5DRP A;  4QNK A;  4GKJ E;  4OO1 B;  4IZK A;  2NN6 C;  5C0X D;  2HK2 A;  1N33 I;  4IZJ B;  2VF3 A;  3P76 A;  4DV2 E;  5K36 F;  1HNX E;  4LCF A;  3ZM7 A;  3UHM A;  2PNL A;  5EL9 A;  4LF5 I;  4I3H A;  4EMD A;  4UT4 A;  4HAC B;  3P3C A;  1MU5 A;  2UXD I;  4JI6 E;  3J81 C;  2VQF I;  2LJP A;  4JG4 A;  4JI0 I;  4YHH I;  3QT5 A;  5A2Q Q;  2PO0 A;  3F0N A;  1KKH A;  2R3V A;  4BA2 B;  1N0U A;  2PNM A;  2BM1 A;  4DU8 A;  4GKJ I;  1J5E E;  3HJC A;  3PYG A;  1Y60 A;  2JE6 B;  2WNR A;  2BV3 A;  4DPT A;  4DV2 I;  4MU1 A;  1UDO A;  1HNX I;  1HK7 A;  1K47 A;  2X7I A;  1Z0C A;  5K36 B;  2VQE E;  4USK A;  3WU3 A;  1UEK A;  4MYU A;  2R42 A;  4PRV A;  4IZK B;  3V2U C;  5IT9 Q;  4JI6 I;  3M7N G;  1WUU A;  1KTV A;  4MU0 A;  2DEJ A;  2NN6 E;  1P42 A;  4JI7 E;  1OYR A;  3ZKB A;  1J5E I;  1UDN A;  4DUY E;  3QT8 A;  4GQU A;  3H4L A;  2C37 A;  1FNM A;  3L7Z A;  4JYA E;  1RR9 A;  4AID A;  3ZZU A;  4DV3 E;  2PO0 B;  4FN5 A;  2VQE I;  4ISA A;  2DEI A;  4LFC E;  2WNR B;  4ZVI A;  3KRN A;  4DR4 E;  2E5L E;  1MX0 A;  5DRR A;  4X64 E;  3OTO E;  4JI7 I;  1NHJ A;  4B3R E;  1YHC A;  1H7S A;  4DUY I;  4JI2 E;  1Z0V A;  5C0X C;  5K36 D;  5DNL A;  4JYA I;  1NHH A;  4DV3 I;  2AJ4 A;  3M6A A;  4LF6 E;  3Q1Q A;  5LL6 R;  5JEA C;  4Z7C A;  1Z5C A;  1PKP A;  2JT2 A;  2HK3 A;  3J80 C;  3T1Y E;  4LFC I;  1RHY A;  4X66 E;  2C37 B;  3L7Z B;  3ZZ0 A;  4DR4 I;  4OX9 E;  2E5L I;  2HFS A;  1UDQ A;  4LF8 E;  3DD6 A;  4B3T E;  1HR0 E;  4X64 I;  3OTO I;  4JI3 E;  3CWV A;  3LTO A;  4HXZ A;  4B3R I;  4DU7 A;  4USM A;  4JI2 I;  4GKK E;  2IES A;  2BA0 D;  4LF6 I;  2UXB E;  3PYE A;  4DV7 E;  4AIM A;  4FW7 A;  4FW9 A;  1ZM4 A;  2E1R A;  1U2R A;  3T1Y I;  2O1W A;  2UXC E;  4DR3 E;  2F1D A;  4X66 I;  1RRE A;  4FW5 A;  4LCH A;  5JEA D;  4OX9 I;  4OO1 C;  2Z5B A;  5C0X E;  4LF8 I;  4M1K A;  1Z0E A;  5FLX Q;  4IFD D;  3Q6N A;  4B3T I;  3QT7 A;  1R6L A;  1HR0 I;  4LFB E;  2GQ0 A;  4JI3 I;  3WU6 A;  2V2Z A;  5A2Q C;  4WUB A;  4FWG A;  3LPS A;  1ZM3 A;  4FW4 A;  4GKK I;  3Q6M A;  5JEA E;  3B82 A;  1BKN A;  4J3D A;  2UXB I;  4DV7 I;  1EI1 A;  3PS2 A;  5DRQ A;  4OZE A;  1H72 C;  2BM0 A;  4LCG A;  2UXC I;  4DR3 I;  2VES A;  1QZR A;  1YH8 A;  5IT9 C;  3ZKD A;  4LFB I;  3GME A;  3PYF A;  3V5R A;  4NBQ A;  1XNR E;  1H74 A;  5K36 C;  2IOP A;  4OO1 D;  2WP8 B;  4P52 A;  4IZJ D;  2BA1 G;  3PS1 A;  2JEB A;  2Z5B B;  5GME A;  1UDS A;  1Y4S A;  1FKA E;  2BR2 A;  2ZBK B;  4DPY A;  2IER A;  4OO1 E;  4JI5 E;  4MQY A;  3K1J A;  4X62 E;  3QT6 A;  4LF4 E;  3D4J A;  2PO1 A;  1OYS A;  4DR2 E;  2J65 A;  4DV0 E;  5ELW A;  2XEX A;  3WU4 A;  4DUZ E;  1PIE A;  2HKE A;  4DR1 E;  3M7N D;  2GO4 A;  1XHK A;  3P3G A;  1XNR I;  3B8H A;  2BA1 D;  1KIJ A;  2C38 A;  3GCM A;  2NPF A;  1FI4 A;  2A2C A;  4XTJ A;  1Y6Z A;  3CDJ A;  2UUA E;  1Y4U A;  1NHI A;  2HHH E;  1ELO A;  4B3S E;  4LFA E;  1N36 E;  4JI5 I;  5LMN E;  2HFU A;  4X62 I;  2NN6 A;  4WUD A;  3P06 A;  4LF4 I;  4DR2 I;  1Z59 A;  1ZM2 A;  4KQV A;  4DV0 I;  5FWK A;  2JEB B;  5L3J A;  1FJG E;  2EFG A;  1FWL A;  3CDI A;  4DUZ I;  4DV4 E;  1R6M A;  4PRX A;  5K36 E;  1Z0G A;  4DR1 I;  4IFD C;  2BR2 B;  4P7A A;  3HUL A;  4X65 E;  4AQY E;  2NN6 F;  4U3D A;  3U1Y A;  4HYM A;  2GS8 A;  4DPW A;  2CZ9 A;  2PO1 B;  3P3E A;  4DR7 E;  4JI8 E;  2J7K A;  2UUA I;  2O1U A;  3J7A M;  1Y5Y A;  2HHH I;  5GMD A;  4WUC A;  4Z7Y A;  1E3P A;  4KHP E;  4B3S I;  4LFA I;  1N36 I;  4MYT A;  5LMN I;  2C38 B;  1IBL E;  1XMQ E;  4JV5 E;  4K0K E;  1VI7 A;  1FJG I;  3HKM A;  4DXL A;  4DV4 I;  1HNW E;  1IBM E;  4JI4 E;  3GLL A;  4X65 I;  4IS9 A;  4AQY I;  3WU5 A;  2WP8 A;  3JAM Q;  2PO2 A;  4DPX A;  4PU9 A;  1A6F A;  2NN6 B;  4QNJ A;  1E3H A;  4N3O A;  4BA1 A;  4DR7 I;  4NXN E;  1USV A;  4NXM E;  4JI8 I; 
#chains in the Genus database with same CATH homology
 3GME A;  2BA0 G;  4NBQ A;  3H1C A;  2WNR B;  5K36 C;  4OO1 D;  2WP8 B;  3KRN A;  4IFD E;  2BA1 G;  2JEB A;  2C39 B;  1OYP A;  4BA2 A;  1UDS A;  3B4T A;  2BR2 A;  2JE6 A;  5C0X C;  4OO1 E;  5K36 D;  4AM3 A;  2PNZ A;  2PO1 A;  1OYS A;  5K36 A;  5JEA C;  3M7N D;  4OO1 B;  5C0X D;  2NN6 C;  2BA1 D;  2PO2 B;  2C37 B;  2C38 A;  3GCM A;  3L7Z B;  5K36 F;  5C0X A;  4BA1 B;  1UDQ A;  3CDJ A;  3DD6 A;  3M85 G;  2NN6 D;  5JEA A;  5C0X F;  2NN6 A;  4IFD A;  2JEA A;  2PO0 A;  2BA0 D;  2JEB B;  3CDI A;  4BA2 B;  1R6M A;  5K36 E;  4AIM A;  4IFD C;  5JEA F;  2BR2 B;  2JE6 B;  2NN6 F;  4IFD F;  2WNR A;  2PNZ B;  1UDO A;  5JEA D;  2PO1 B;  3M85 D;  4OO1 C;  2C39 A;  5K36 B;  5C0X E;  4IFD D;  1R6L A;  3U1K A;  1E3P A;  3M7N G;  5JEA E;  2C38 B;  5C0X B;  2NN6 E;  3HKM A;  1OYR A;  4OO1 A;  3GLL A;  1UDN A;  2WP8 A;  5JEA B;  2PO2 A;  2C37 A;  3L7Z A;  2NN6 B;  4IFD B;  4AID A;  1E3H A;  4BA1 A;  2JEA B;  2PO0 B;  4OO1 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...