5C0XD

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 70
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xD00
2PO0B 2C37A 3GCMA 2PO2A 3GMEA 5C0XB 5K36B 2JE6A 4AIMA 2JEAB 4OO1F 5JEAE 3L7ZB 4IFDF 2NN6F 2BA0D 2C38A 2C37B 2PO2B 2PO0A 2JE6B 4OO1C 1UDQA 5C0XD 5K36D 1R6LA 1UDNA 4BA2A 4IFDC 2NN6C 3H1CA 3L7ZA 1R6MA 1E3HA 3U1KA 4OO1A 5K36E 4IFDA 2NN6A 4BA2B 1OYPA 3CDIA 1UDSA 4AIDA 3CDJA 3DD6A 4OO1B 2PO1A 1OYRA 2PNZB 2BA1G 3M85G 4IFDB 2NN6B 4BA1A 3M7ND 5JEAF 4OO1D 2PO1B 2BA0G 3HKMA 1E3PA 4IFDD 2NN6D 2PNZA 5C0XE 4BA1B 4NBQA 2BR2B 1UDOA 5JEAC 3B4TA 4IFDE 5JEAA 5C0XF 5K36F 2WNRA 2BR2A 2C39A 2BA1D 3M85D 4AM3A 3GLLA 2JEBB 3KRNA 5JEAB 5C0XC 5K36C 2WP8A 1OYSA 2WNRB 3M7NG 2C39B 4OO1E 5C0XA 5K36A 2JEAA 2JEBA 2WP8B 2NN6E 5JEAD 2C38B
chains in the Genus database with same CATH superfamily
3PS1A 2PO0B 4GKJE 4QNKA 1EA6A 2PO2A 5C0XB 2JE6A 1EI1A 1ZM9A 2CGEA 3Q1QA 4MQYA 4MYTA 2CVEA 3K1JA 1USUA 2ZBKB 3PS3A 1I94E 3J7AM 2V8PA 1ZM2A 2OI2A 3V5RA 2ZITA 2PO2B 3P76A 4JG4A 1B62A 2JE6B 5LMNE 5C0XD 4IZKA 4JI7I 4B3RE 4PRXA 4R1FA 4X64I 5IT9C 4NXME 3L7ZA 1XNQI 1R6MA 4OO1A 4M1KA 4FW6A 4LF4I 4JI8I 2HHHE 4JV5E 5K36E 4IZKB 1KTVA 1OYPA 2Z5BA 1H7UA 1NHIA 1UDSA 1Z0BA 4HY1A 1RR9A 1P42A 3CDJA 4AIDA 4OO1B 2HK2A 3ZM7A 2PNZB 3M85G 2UUBI 2A2DA 3PYDA 2Z5BB 3M6AA 1D6TA 4AQYE 4LCGA 4LOMA 3OTOE 4JI4I 4FW7A 3WU3A 1DARA 5DNXA 4FW5A 3U1YA 4OO1D 2VF3A 2LJPA 3K17A 2V2QA 2AE8A 1FWKA 4DV1I 1KIJA 1HNXE 1ZXMA 2F1DA 4X62I 3P3GA 3PYEA 1HNWE 3K85A 1YH8A 1I94I 5GMEA 2HFUA 3T1YE 1Z5AA 1N32E 1PIEA 4DPWA 3ZKBA 2BM0A 4J3DA 3ZZUA 5LMNI 5JEAA 1S16A 1IBLE 3B82A 5K36F 2IOPA 4MU3A 2BR2A 1Z0EA 4PU9A 1QZRA 3H4LA 1ELOA 2HHHI 4JV5I 4DU7A 5JEAB 5K36C 4DV3E 3M7NG 3PYFA 3ZZTA 4DPUA 2JEAA 1HNZI 4ZVIA 5JEAD 4B3TI 5IT9Q 5EL9A 3OTOI 4MU1A 2GQ0A 2C37A 3P3CA 4JI8E 4DR4E 5A2QQ 2JEAB 4UTGA 2EFGA 1HNWI 5DRPA 2BA0D 3ZKDA 2C37B 3T1YI 2PO0A 2UUBE 4URLA 1UDQA 2AJ4A 1UDNA 4BA2A 1Z0TA 1ZXNA 1IBLI 4JI4E 4LFCE 2UXCI 4LFAE 1MX0A 3D4JA 4DV1E 4YY3E 4BA2B 4X62E 2UUAE 4DV3I 4JI3I 3LPSA 4FW9A 3B8HA 5IWAE 2O1TA 1BKNA 2O3ZA 1VI7A 4DV7E 2GO4A 4LFBI 2V2ZA 3UHMA 1RREA 2J65A 4FWDA 1MG7A 1FNMA 1FKAE 4DR4I 4LF8E 2PNZA 4I3HA 4GQUA 4DUYE 4RPFA 2UXDE 1Y4UA 1UDOA 3B4TA 1Y6ZA 1FWLA 3PS2A 2R42A 4IFDE 1HNZE 1H72C 3CWVA 4LF9E 4B3TE 2HKEA 1Y5YA 1KKHA 2WNRA 2HFSA 4KQVA 3M85D 1J5EE 4LFCI 1NZ0A 3GLLA 4LFAI 1N34E 2JEBB 1H74A 3KRNA 3P3EA 5LL6R 4JI1E 4LF5E 4ED4A 2WP8A 4YY3I 4DR1E 2O1UA 2UUAI 4K0KE 2VESA 2E1RA 5FWKA 2WNRB 4DV5E 3J80C 4WUBA 2F4VE 5IWAI 5K36A 4DUZE 2BV3A 2WP8B 4DV7I 1Z5CA 2C38B 1Z0CA 1Z0WA 2O1WA 4WUDA 2UXCE 1N33E 3F0NA 3GCMA 3GMEA 4DPTA 5K36B 4DV4I 4DU8A 2GO3A 4LCHA 4LF8I 4XTJA 5DRRA 1N0VC 4DUYI 4JI3E 3QT5A 4IFDF 2NN6F 2VQEE 2UXDI 3LNUA 1WUUA 4JI0E 4DR6E 2IOQA 4Z7YA 5K36D 1R6LA 2PNLA 1ZM4A 4OX9E 1FJGE 2NN6C 4IFDC 4LFBE 4LF9I 1PVGA 3H1CA 2DEJA 4LCFA 5GMDA 5L3JA 4DV2I 1J5EI 3QT7A 1MU5A 1N34I 2UU9E 4ISAA 3J7AG 2HKJA 3Q6NA 3CDIA 4JI1I 3HULA 4LF5I 5ELWA 3QT6A 4DV0I 4DR1I 2UUCE 1NHHA 3PYGA 4U3BA 1H7SA 4K0KI 1K47A 4DV5I 1OYRA 1XMOI 1IBME 2BA1G 2F4VI 4DUZI 2DEIA 1Z0VA 4LF7E 1PKPA 4U3DA 2V34A 1USVA 2BA0G 1N33I 2E5LE 1E3PA 1N36E 3B78A 4LF6I 2NPFA 4UT4A 3V2UC 3PRYA 2XEXA 4DV6I 5LMUE 1XXEA 2VQEI 3J80Q 3J81C 2IESA 1U2RA 4JI0I 4DR6I 3WU5A 2Z5EA 2JT2A 4FN5A 1B63A 2VQFI 4USKA 5C0XF 4OX9I 1HK7A 4DR3I 1FJGI 2WW4A 2Q2EB 5DROA 1XMQI 2C39A 4DPYA 2UXBE 4DV4E 3JAMC 4HYMA 2UU9I 5C0XC 4X66E 4HACA 1OYSA 1HR0I 2A2CA 1Z5BA 4JI5E 2UUCI 2C39B 1OJ4A 4OKGA 4LPFA 4P52A 2ZM6I 2X36A 3Q6MA 4JI2E 2CZ9A 4EMDA 1IBMI 4X65E 2JEBA 4HXZA 4MDTA 2NN6E 4HACB 1Z0GA 3NZKA 4B3ME 4YHHI 4LF7I 4FWHA 4DV2E 5FLXC 5A2QC 4AIMA 4FW4A 2CG9A 4IZJA 2E5LI 4FW3A 1XNRE 1N36I 1UEKA 2HK3A 4IS9A 4DXLA 4OO1F 5DRQA 4GKKE 5JEAE 4NXNE 3L7ZB 4DV0E 3HJCA 2C38A 1Z59A 5LMUI 4B3SE 5BR8I 1XMOE 4OO1C 4IZJB 1IBKE 1A6FA 4OZEA 4KHPE 2PNMA 3U1KA 1E3HA 4GKJI 2UXBI 4LF6E 4IZJD 2NN6A 3T1HE 4IFDA 4MU4A 3WU4A 2IERA 2X7IA 4DV6E 3DD6A 4X66I 4FWGA 4JI5I 4DR2E 4P7AA 1NHJA 3J81Q 2PO1A 2J7KA 4JYAE 4IFDB 2NN6B 4DR7E 4JI2I 4PRVA 4N3OA 4X65I 4DR5E 4BA1A 1N0UA 4B3RI 2VQFE 4B3MI 4JI6E 4WUCA 3M7ND 2V2VA 1S4EA 4DR3E 3GONA 4MYUA 1Y60A 4NXMI 1XMQE 3WU6A 5JEAF 2PO1B 2BM1A 3HKMA 1VISA 1FI4A 1XHKA 3JAMQ 4IFDD 1ZM3A 2NN6D 5C0XE 2Z5CA 4BA1B 1XNRI 4NBQA 1HR0E 4GKKI 4NXNI 2BR2B 5JEAC 4B3SI 2ZM6E 1RHYA 3ZZ0A 2O1VA 4USMA 4JI7E 2Z5CB 4X64E 3P06A 4Z7CA 1KVKA 1IBKI 4AQYI 4YHHE 1XNQE 4KHPI 2BA1D 1H73A 4LF4E 4AM3A 5FLXQ 2R3VA 5DNLA 3LTOA 1HNXI 1YHCA 3T1HI 2GS8A 4DPXA 5BR8E 4DR2I 1N32I 4OO1E 3QT8A 5C0XA 4JYAI 4DR7I 4QNJA 5EKWA 4DR5I 1Y4SA 4MU0A 4JI6I
chains in the Genus database with same CATH topology
2PO0B 2C37A 3GCMA 2PO2A 3GMEA 5C0XB 5K36B 2JE6A 4AIMA 2JEAB 4OO1F 5JEAE 3L7ZB 4IFDF 2NN6F 2BA0D 2C38A 2C37B 2PO2B 2PO0A 2JE6B 4OO1C 1UDQA 5C0XD 5K36D 1R6LA 1UDNA 4BA2A 4IFDC 2NN6C 3H1CA 3L7ZA 1R6MA 1E3HA 3U1KA 4OO1A 5K36E 4IFDA 2NN6A 4BA2B 1OYPA 3CDIA 1UDSA 4AIDA 3CDJA 3DD6A 4OO1B 2PO1A 1OYRA 2PNZB 2BA1G 3M85G 4IFDB 2NN6B 4BA1A 3M7ND 5JEAF 4OO1D 2PO1B 2BA0G 3HKMA 1E3PA 4IFDD 2NN6D 2PNZA 5C0XE 4BA1B 4NBQA 2BR2B 1UDOA 5JEAC 3B4TA 4IFDE 5JEAA 5C0XF 5K36F 2WNRA 2BR2A 2C39A 2BA1D 3M85D 4AM3A 3GLLA 2JEBB 3KRNA 5JEAB 5C0XC 5K36C 2WP8A 1OYSA 2WNRB 3M7NG 2C39B 4OO1E 5C0XA 5K36A 2JEAA 2JEBA 2WP8B 2NN6E 5JEAD 2C38B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PO0 B;  2C37 A;  3GCM A;  2PO2 A;  3GME A;  5C0X B;  5K36 B;  2JE6 A;  4AIM A;  2JEA B;  4OO1 F;  5JEA E;  3L7Z B;  4IFD F;  2NN6 F;  2BA0 D;  2C38 A;  2C37 B;  2PO2 B;  2PO0 A;  2JE6 B;  4OO1 C;  1UDQ A;  5C0X D;  5K36 D;  1R6L A;  1UDN A;  4BA2 A;  4IFD C;  2NN6 C;  3H1C A;  3L7Z A;  1R6M A;  1E3H A;  3U1K A;  4OO1 A;  5K36 E;  4IFD A;  2NN6 A;  4BA2 B;  1OYP A;  3CDI A;  1UDS A;  4AID A;  3CDJ A;  3DD6 A;  4OO1 B;  2PO1 A;  1OYR A;  2PNZ B;  2BA1 G;  3M85 G;  4IFD B;  2NN6 B;  4BA1 A;  3M7N D;  5JEA F;  4OO1 D;  2PO1 B;  2BA0 G;  3HKM A;  1E3P A;  4IFD D;  2NN6 D;  2PNZ A;  5C0X E;  4BA1 B;  4NBQ A;  2BR2 B;  1UDO A;  5JEA C;  3B4T A;  4IFD E;  5JEA A;  5C0X F;  5K36 F;  2WNR A;  2BR2 A;  2C39 A;  2BA1 D;  3M85 D;  4AM3 A;  3GLL A;  2JEB B;  3KRN A;  5JEA B;  5C0X C;  5K36 C;  2WP8 A;  1OYS A;  2WNR B;  3M7N G;  2C39 B;  4OO1 E;  5C0X A;  5K36 A;  2JEA A;  2JEB A;  2WP8 B;  2NN6 E;  5JEA D;  2C38 B; 
#chains in the Genus database with same CATH topology
 3PS1 A;  2PO0 B;  4GKJ E;  4QNK A;  1EA6 A;  2PO2 A;  5C0X B;  2JE6 A;  1EI1 A;  1ZM9 A;  2CGE A;  3Q1Q A;  4MQY A;  4MYT A;  2CVE A;  3K1J A;  1USU A;  2ZBK B;  3PS3 A;  1I94 E;  3J7A M;  2V8P A;  1ZM2 A;  2OI2 A;  3V5R A;  2ZIT A;  2PO2 B;  3P76 A;  4JG4 A;  1B62 A;  2JE6 B;  5LMN E;  5C0X D;  4IZK A;  4JI7 I;  4B3R E;  4PRX A;  4R1F A;  4X64 I;  5IT9 C;  4NXM E;  3L7Z A;  1XNQ I;  1R6M A;  4OO1 A;  4M1K A;  4FW6 A;  4LF4 I;  4JI8 I;  2HHH E;  4JV5 E;  5K36 E;  4IZK B;  1KTV A;  1OYP A;  2Z5B A;  1H7U A;  1NHI A;  1UDS A;  1Z0B A;  4HY1 A;  1RR9 A;  1P42 A;  3CDJ A;  4AID A;  4OO1 B;  2HK2 A;  3ZM7 A;  2PNZ B;  3M85 G;  2UUB I;  2A2D A;  3PYD A;  2Z5B B;  3M6A A;  1D6T A;  4AQY E;  4LCG A;  4LOM A;  3OTO E;  4JI4 I;  4FW7 A;  3WU3 A;  1DAR A;  5DNX A;  4FW5 A;  3U1Y A;  4OO1 D;  2VF3 A;  2LJP A;  3K17 A;  2V2Q A;  2AE8 A;  1FWK A;  4DV1 I;  1KIJ A;  1HNX E;  1ZXM A;  2F1D A;  4X62 I;  3P3G A;  3PYE A;  1HNW E;  3K85 A;  1YH8 A;  1I94 I;  5GME A;  2HFU A;  3T1Y E;  1Z5A A;  1N32 E;  1PIE A;  4DPW A;  3ZKB A;  2BM0 A;  4J3D A;  3ZZU A;  5LMN I;  5JEA A;  1S16 A;  1IBL E;  3B82 A;  5K36 F;  2IOP A;  4MU3 A;  2BR2 A;  1Z0E A;  4PU9 A;  1QZR A;  3H4L A;  1ELO A;  2HHH I;  4JV5 I;  4DU7 A;  5JEA B;  5K36 C;  4DV3 E;  3M7N G;  3PYF A;  3ZZT A;  4DPU A;  2JEA A;  1HNZ I;  4ZVI A;  5JEA D;  4B3T I;  5IT9 Q;  5EL9 A;  3OTO I;  4MU1 A;  2GQ0 A;  2C37 A;  3P3C A;  4JI8 E;  4DR4 E;  5A2Q Q;  2JEA B;  4UTG A;  2EFG A;  1HNW I;  5DRP A;  2BA0 D;  3ZKD A;  2C37 B;  3T1Y I;  2PO0 A;  2UUB E;  4URL A;  1UDQ A;  2AJ4 A;  1UDN A;  4BA2 A;  1Z0T A;  1ZXN A;  1IBL I;  4JI4 E;  4LFC E;  2UXC I;  4LFA E;  1MX0 A;  3D4J A;  4DV1 E;  4YY3 E;  4BA2 B;  4X62 E;  2UUA E;  4DV3 I;  4JI3 I;  3LPS A;  4FW9 A;  3B8H A;  5IWA E;  2O1T A;  1BKN A;  2O3Z A;  1VI7 A;  4DV7 E;  2GO4 A;  4LFB I;  2V2Z A;  3UHM A;  1RRE A;  2J65 A;  4FWD A;  1MG7 A;  1FNM A;  1FKA E;  4DR4 I;  4LF8 E;  2PNZ A;  4I3H A;  4GQU A;  4DUY E;  4RPF A;  2UXD E;  1Y4U A;  1UDO A;  3B4T A;  1Y6Z A;  1FWL A;  3PS2 A;  2R42 A;  4IFD E;  1HNZ E;  1H72 C;  3CWV A;  4LF9 E;  4B3T E;  2HKE A;  1Y5Y A;  1KKH A;  2WNR A;  2HFS A;  4KQV A;  3M85 D;  1J5E E;  4LFC I;  1NZ0 A;  3GLL A;  4LFA I;  1N34 E;  2JEB B;  1H74 A;  3KRN A;  3P3E A;  5LL6 R;  4JI1 E;  4LF5 E;  4ED4 A;  2WP8 A;  4YY3 I;  4DR1 E;  2O1U A;  2UUA I;  4K0K E;  2VES A;  2E1R A;  5FWK A;  2WNR B;  4DV5 E;  3J80 C;  4WUB A;  2F4V E;  5IWA I;  5K36 A;  4DUZ E;  2BV3 A;  2WP8 B;  4DV7 I;  1Z5C A;  2C38 B;  1Z0C A;  1Z0W A;  2O1W A;  4WUD A;  2UXC E;  1N33 E;  3F0N A;  3GCM A;  3GME A;  4DPT A;  5K36 B;  4DV4 I;  4DU8 A;  2GO3 A;  4LCH A;  4LF8 I;  4XTJ A;  5DRR A;  1N0V C;  4DUY I;  4JI3 E;  3QT5 A;  4IFD F;  2NN6 F;  2VQE E;  2UXD I;  3LNU A;  1WUU A;  4JI0 E;  4DR6 E;  2IOQ A;  4Z7Y A;  5K36 D;  1R6L A;  2PNL A;  1ZM4 A;  4OX9 E;  1FJG E;  2NN6 C;  4IFD C;  4LFB E;  4LF9 I;  1PVG A;  3H1C A;  2DEJ A;  4LCF A;  5GMD A;  5L3J A;  4DV2 I;  1J5E I;  3QT7 A;  1MU5 A;  1N34 I;  2UU9 E;  4ISA A;  3J7A G;  2HKJ A;  3Q6N A;  3CDI A;  4JI1 I;  3HUL A;  4LF5 I;  5ELW A;  3QT6 A;  4DV0 I;  4DR1 I;  2UUC E;  1NHH A;  3PYG A;  4U3B A;  1H7S A;  4K0K I;  1K47 A;  4DV5 I;  1OYR A;  1XMO I;  1IBM E;  2BA1 G;  2F4V I;  4DUZ I;  2DEI A;  1Z0V A;  4LF7 E;  1PKP A;  4U3D A;  2V34 A;  1USV A;  2BA0 G;  1N33 I;  2E5L E;  1E3P A;  1N36 E;  3B78 A;  4LF6 I;  2NPF A;  4UT4 A;  3V2U C;  3PRY A;  2XEX A;  4DV6 I;  5LMU E;  1XXE A;  2VQE I;  3J80 Q;  3J81 C;  2IES A;  1U2R A;  4JI0 I;  4DR6 I;  3WU5 A;  2Z5E A;  2JT2 A;  4FN5 A;  1B63 A;  2VQF I;  4USK A;  5C0X F;  4OX9 I;  1HK7 A;  4DR3 I;  1FJG I;  2WW4 A;  2Q2E B;  5DRO A;  1XMQ I;  2C39 A;  4DPY A;  2UXB E;  4DV4 E;  3JAM C;  4HYM A;  2UU9 I;  5C0X C;  4X66 E;  4HAC A;  1OYS A;  1HR0 I;  2A2C A;  1Z5B A;  4JI5 E;  2UUC I;  2C39 B;  1OJ4 A;  4OKG A;  4LPF A;  4P52 A;  2ZM6 I;  2X36 A;  3Q6M A;  4JI2 E;  2CZ9 A;  4EMD A;  1IBM I;  4X65 E;  2JEB A;  4HXZ A;  4MDT A;  2NN6 E;  4HAC B;  1Z0G A;  3NZK A;  4B3M E;  4YHH I;  4LF7 I;  4FWH A;  4DV2 E;  5FLX C;  5A2Q C;  4AIM A;  4FW4 A;  2CG9 A;  4IZJ A;  2E5L I;  4FW3 A;  1XNR E;  1N36 I;  1UEK A;  2HK3 A;  4IS9 A;  4DXL A;  4OO1 F;  5DRQ A;  4GKK E;  5JEA E;  4NXN E;  3L7Z B;  4DV0 E;  3HJC A;  2C38 A;  1Z59 A;  5LMU I;  4B3S E;  5BR8 I;  1XMO E;  4OO1 C;  4IZJ B;  1IBK E;  1A6F A;  4OZE A;  4KHP E;  2PNM A;  3U1K A;  1E3H A;  4GKJ I;  2UXB I;  4LF6 E;  4IZJ D;  2NN6 A;  3T1H E;  4IFD A;  4MU4 A;  3WU4 A;  2IER A;  2X7I A;  4DV6 E;  3DD6 A;  4X66 I;  4FWG A;  4JI5 I;  4DR2 E;  4P7A A;  1NHJ A;  3J81 Q;  2PO1 A;  2J7K A;  4JYA E;  4IFD B;  2NN6 B;  4DR7 E;  4JI2 I;  4PRV A;  4N3O A;  4X65 I;  4DR5 E;  4BA1 A;  1N0U A;  4B3R I;  2VQF E;  4B3M I;  4JI6 E;  4WUC A;  3M7N D;  2V2V A;  1S4E A;  4DR3 E;  3GON A;  4MYU A;  1Y60 A;  4NXM I;  1XMQ E;  3WU6 A;  5JEA F;  2PO1 B;  2BM1 A;  3HKM A;  1VIS A;  1FI4 A;  1XHK A;  3JAM Q;  4IFD D;  1ZM3 A;  2NN6 D;  5C0X E;  2Z5C A;  4BA1 B;  1XNR I;  4NBQ A;  1HR0 E;  4GKK I;  4NXN I;  2BR2 B;  5JEA C;  4B3S I;  2ZM6 E;  1RHY A;  3ZZ0 A;  2O1V A;  4USM A;  4JI7 E;  2Z5C B;  4X64 E;  3P06 A;  4Z7C A;  1KVK A;  1IBK I;  4AQY I;  4YHH E;  1XNQ E;  4KHP I;  2BA1 D;  1H73 A;  4LF4 E;  4AM3 A;  5FLX Q;  2R3V A;  5DNL A;  3LTO A;  1HNX I;  1YHC A;  3T1H I;  2GS8 A;  4DPX A;  5BR8 E;  4DR2 I;  1N32 I;  4OO1 E;  3QT8 A;  5C0X A;  4JYA I;  4DR7 I;  4QNJ A;  5EKW A;  4DR5 I;  1Y4S A;  4MU0 A;  4JI6 I; 
#chains in the Genus database with same CATH homology
 2PO0 B;  2C37 A;  3GCM A;  2PO2 A;  3GME A;  5C0X B;  5K36 B;  2JE6 A;  4AIM A;  2JEA B;  4OO1 F;  5JEA E;  3L7Z B;  4IFD F;  2NN6 F;  2BA0 D;  2C38 A;  2C37 B;  2PO2 B;  2PO0 A;  2JE6 B;  4OO1 C;  1UDQ A;  5C0X D;  5K36 D;  1R6L A;  1UDN A;  4BA2 A;  4IFD C;  2NN6 C;  3H1C A;  3L7Z A;  1R6M A;  1E3H A;  3U1K A;  4OO1 A;  5K36 E;  4IFD A;  2NN6 A;  4BA2 B;  1OYP A;  3CDI A;  1UDS A;  4AID A;  3CDJ A;  3DD6 A;  4OO1 B;  2PO1 A;  1OYR A;  2PNZ B;  2BA1 G;  3M85 G;  4IFD B;  2NN6 B;  4BA1 A;  3M7N D;  5JEA F;  4OO1 D;  2PO1 B;  2BA0 G;  3HKM A;  1E3P A;  4IFD D;  2NN6 D;  2PNZ A;  5C0X E;  4BA1 B;  4NBQ A;  2BR2 B;  1UDO A;  5JEA C;  3B4T A;  4IFD E;  5JEA A;  5C0X F;  5K36 F;  2WNR A;  2BR2 A;  2C39 A;  2BA1 D;  3M85 D;  4AM3 A;  3GLL A;  2JEB B;  3KRN A;  5JEA B;  5C0X C;  5K36 C;  2WP8 A;  1OYS A;  2WNR B;  3M7N G;  2C39 B;  4OO1 E;  5C0X A;  5K36 A;  2JEA A;  2JEB A;  2WP8 B;  2NN6 E;  5JEA D;  2C38 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...