4OO1E

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
255
Chain Sequence
SLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 60
structure length 255
sequence length 263
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1E00
3HKMA 4OO1B 3M85G 5K36D 2JEAA 5JEAF 1OYRA 3GMEA 4AIMA 2NN6B 4OO1D 2NN6C 2JEAB 4IFDE 1UDOA 4NBQA 3U1KA 2C38B 5K36C 2PNZA 5JEAA 2PNZB 1UDSA 3KRNA 3L7ZB 1OYPA 5C0XA 4IFDC 3CDIA 3DD6A 2PO1A 4BA2A 1UDNA 5K36A 2C38A 2BR2B 4OO1F 2PO1B 4BA2B 2BA0G 5C0XF 2WNRA 4BA1B 2JE6A 1OYSA 2JE6B 5K36F 2WP8B 2PO0A 1UDQA 4OO1A 2C39B 4BA1A 2WP8A 2PO0B 3B4TA 2NN6A 5JEAB 5C0XD 2BA0D 4AM3A 5JEAE 1E3PA 3CDJA 2C37B 2C37A 3M7ND 4IFDD 4OO1E 2BA1D 4OO1C 4IFDA 4IFDB 3L7ZA 2NN6F 2NN6D 5C0XB 1E3HA 4IFDF 2JEBB 5K36B 2JEBA 5C0XC 5C0XE 3GCMA 1R6MA 3M7NG 5K36E 1R6LA 4AIDA 3GLLA 2PO2A 2C39A 3H1CA 2PO2B 3M85D 2NN6E 2WNRB 2BR2A 5JEAC 5JEAD 2BA1G
chains in the Genus database with same CATH superfamily
4DV1I 3J80C 2J7KA 2GO4A 1KTVA 2V2ZA 4Z7YA 4DXLA 2VQFI 1I94I 1YHCA 5DNLA 1OYRA 4LCGA 3GMEA 4AIMA 2NN6B 2IERA 4M1KA 4ISAA 4OO1D 5DNXA 1EI1A 1FWKA 2IESA 1HNXE 4PRVA 4JI4I 1H7SA 3LTOA 1MU5A 2CVEA 2X7IA 3WU5A 5K36C 3QT7A 2ZITA 2UU9I 4DR1E 2AE8A 1XMQI 3J81Q 3DD6A 5BR8I 1UDNA 2HKJA 2F4VE 3PYEA 1YH8A 4DUZE 1HR0E 2BM0A 1FI4A 1BKNA 3QT8A 3D4JA 4PRXA 4NXNE 3T1YE 1DARA 4ED4A 4BA2B 2HFSA 4GKKI 3P76A 2HK2A 4DV2I 4IZKB 4BA1B 1QZRA 5K36F 2GO3A 2J65A 3K1JA 3PYDA 4U3DA 4LF7E 5FLXQ 3K17A 4BA1A 1IBKE 4KQVA 4LFAE 4DR4I 4X62E 4DR5E 2NN6A 4JV5I 2HFUA 1PIEA 1Y60A 3QT5A 4B3RI 4FW7A 4AQYE 1E3PA 3PS1A 3ZZUA 4WUDA 2HK3A 4UT4A 5IWAI 4FW9A 2C37A 4X65I 3WU4A 4IFDD 1VISA 1RREA 4IFDB 3L7ZA 4JI6I 5C0XB 1HNZI 4R1FA 1Y5YA 1XNQI 1RR9A 4JI7I 4X62I 4DR5I 2JEBA 1N0UA 3T1HE 4JV5E 2F1DA 1HNWI 5FWKA 5A2QQ 4AQYI 5A2QC 4YY3I 2C39A 4RPFA 1XNRE 2UXCE 1U2RA 5JEAC 3Q1QA 1HNZE 2R3VA 4HYMA 4JI7E 2JT2A 4OO1B 1K47A 1H74A 3M6AA 4DV3E 1NHHA 1ZM4A 5DROA 2JEAA 2Z5CB 3WU3A 2DEJA 4DU8A 3LPSA 3K85A 4OX9I 1WUUA 1Z5AA 4JI8I 4IFDE 2V8PA 4KHPE 3PS3A 2NPFA 2C38B 1J5EI 1H7UA 4MU1A 4EMDA 4FW5A 5JEAA 4LF4E 4K0KI 1PKPA 4B3TE 1ZM9A 1OYPA 5C0XA 1MG7A 4IFDC 2PO1A 4DR2E 3B82A 1N36E 2C38A 1FWLA 5L3JA 4GKJI 2VESA 4DV7I 3PYGA 4DPUA 3JAMQ 3H4LA 2PO1B 2Z5BA 2BA0G 2OI2A 4P52A 5DRQA 4UTGA 4X66I 4JYAI 2WNRA 1PVGA 4X65E 1NHJA 2WP8B 2ZM6I 1IBMI 1XHKA 4DR7I 4LCHA 4DV0I 1UDQA 2XEXA 2Z5BB 4DPXA 3T1HI 1Z0BA 3ZKBA 4LPFA 2BM1A 2WP8A 1USUA 2PO0B 4DV4E 1ZXMA 1KKHA 5FLXC 4JI1I 1Z0CA 5JEAB 1HNXI 2O1VA 3V2UC 5C0XD 2BA0D 4QNJA 4LF8I 2PNMA 1Z5BA 2C37B 1ELOA 2UU9E 3M7ND 3J80Q 3P3EA 4FN5A 5GMEA 5DRRA 2UXDE 5K36B 1HR0I 4IZJA 5C0XE 1Y6ZA 4DV6I 2UUCI 1D6TA 3B8HA 4HACA 1ZM2A 3LNUA 4LF9I 3J7AG 1S4EA 3NZKA 2PO2A 2UUAE 1J5EE 2VF3A 4K0KE 2UXDI 5JEAD 4HACB 2VQEI 4JI0I 4MQYA 3Q6MA 4DR3E 4ZVIA 1XMOI 1N36I 3CWVA 4LOMA 3PS2A 4USMA 3QT6A 1XXEA 4LF9E 4JI5I 1HK7A 4NXME 4MYUA 1H73A 4JYAE 1N33E 4DPYA 1HNWE 2NN6C 3F0NA 4USKA 5EKWA 4LCFA 2EFGA 4NBQA 4OX9E 5LMUI 1FJGI 2PNZA 1Z5CA 4JI6E 2UXCI 3ZM7A 4DV5I 3CDIA 2E5LE 4LF7I 4BA2A 2UUBI 2GQ0A 3PYFA 5K36A 5IT9C 1N34E 4JI3E 4LFCE 4HY1A 3ZZ0A 4X64I 4N3OA 4FWHA 4GQUA 2JE6A 1OYSA 4DV5E 4FW4A 4B3MI 4DV3I 2GS8A 4DV0E 5BR8E 4OO1A 1ZXNA 2C39B 5ELWA 4J3DA 1OJ4A 2V34A 4WUCA 2VQEE 5GMDA 4B3TI 1KVKA 2WW4A 1B63A 3B4TA 3B78A 3T1YI 4DR2I 4LFAI 4JI2I 4U3BA 4JI5E 5IWAE 4GKJE 1MX0A 5JEAE 4B3ME 1FKAE 1IBLI 4DPWA 2O1WA 3ZKDA 4DR3I 4OO1E 1KIJA 4Z7CA 1XNQE 1I94E 4LF6E 2HKEA 5IT9Q 2CG9A 4IFDF 5C0XC 4NXMI 3J7AM 4DV7E 3GCMA 4IZKA 4YY3E 1N33I 2Z5EA 2AJ4A 4HXZA 5K36E 4OKGA 3UHMA 2F4VI 1R6LA 4AIDA 4DV6E 2UUCE 4DUYE 2A2CA 4FW3A 1IBLE 4LFBI 3H1CA 2PO2B 3M85D 2R42A 2BR2A 4WUBA 4GKKE 4FW6A 4LF6I 2PNLA 4X64E 4JI8E 2DEIA 4KHPI 3P3GA 2BV3A 3HKMA 4DUZI 3HJCA 2CZ9A 4PU9A 3M85G 5LMNI 4JI3I 4DR6E 5K36D 1Y4SA 4DUYI 5JEAF 2X36A 4DV2E 3Q6NA 4DR4E 4LF8E 4LF5E 3P06A 2JEAB 4P7AA 2Z5CA 2UXBE 1UDOA 4MDTA 2IOQA 1P42A 4X66E 3U1KA 3U1YA 3JAMC 2PNZB 1VI7A 1UDSA 2E1RA 4MU4A 3KRNA 3L7ZB 1UEKA 2O1UA 4MU3A 4LF4I 3OTOE 2HHHI 1N0VC 2CGEA 2E5LI 3J81C 1Z0VA 2BR2B 1ZM3A 4B3RE 4NXNI 4JI2E 4DU7A 1FNMA 1N32I 2O1TA 2UXBI 2Q2EB 4OO1F 4JG4A 4YHHE 4B3SI 1Z0GA 5C0XF 1RHYA 2JE6B 1NZ0A 2V2QA 4DPTA 2PO0A 4FWGA 1Y4UA 2VQFE 1Z0EA 3OTOI 1EA6A 2HHHE 4XTJA 1Z59A 1FJGE 2ZM6E 1IBME 4DR7E 1S16A 1Z0TA 4DR1I 2ZBKB 1N32E 5DRPA 1Z0WA 2LJPA 4IZJD 4YHHI 1H72C 4OZEA 2UUBE 1XNRI 4LFBE 4LFCI 4I3HA 1N34I 4QNKA 3HULA 2IOPA 4AM3A 4MYTA 1B62A 3CDJA 1NHIA 2UUAI 2A2DA 1XMQE 2BA1D 4FWDA 4OO1C 4IFDA 2V2VA 5LMNE 5EL9A 2NN6F 2NN6D 4DR6I 1E3HA 4MU0A 1A6FA 2O3ZA 3GONA 4DV4I 2JEBB 4DV1E 4JI1E 4URLA 1R6MA 3P3CA 3M7NG 4LF5I 3GLLA 3PRYA 1USVA 3WU6A 4IZJB 2NN6E 4JI0E 2WNRB 3V5RA 5LL6R 4B3SE 1XMOE 4IS9A 4JI4E 5LMUE 2BA1G 3ZZTA 1IBKI
chains in the Genus database with same CATH topology
3HKMA 4OO1B 3M85G 5K36D 2JEAA 5JEAF 1OYRA 3GMEA 4AIMA 2NN6B 4OO1D 2NN6C 2JEAB 4IFDE 1UDOA 4NBQA 3U1KA 2C38B 5K36C 2PNZA 5JEAA 2PNZB 1UDSA 3KRNA 3L7ZB 1OYPA 5C0XA 4IFDC 3CDIA 3DD6A 2PO1A 4BA2A 1UDNA 5K36A 2C38A 2BR2B 4OO1F 2PO1B 4BA2B 2BA0G 5C0XF 2WNRA 4BA1B 2JE6A 1OYSA 2JE6B 5K36F 2WP8B 2PO0A 1UDQA 4OO1A 2C39B 4BA1A 2WP8A 2PO0B 3B4TA 2NN6A 5JEAB 5C0XD 2BA0D 4AM3A 5JEAE 1E3PA 3CDJA 2C37B 2C37A 3M7ND 4IFDD 4OO1E 2BA1D 4OO1C 4IFDA 4IFDB 3L7ZA 2NN6F 2NN6D 5C0XB 1E3HA 4IFDF 2JEBB 5K36B 2JEBA 5C0XC 5C0XE 3GCMA 1R6MA 3M7NG 5K36E 1R6LA 4AIDA 3GLLA 2PO2A 2C39A 3H1CA 2PO2B 3M85D 2NN6E 2WNRB 2BR2A 5JEAC 5JEAD 2BA1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKM A;  4OO1 B;  3M85 G;  5K36 D;  2JEA A;  5JEA F;  1OYR A;  3GME A;  4AIM A;  2NN6 B;  4OO1 D;  2NN6 C;  2JEA B;  4IFD E;  1UDO A;  4NBQ A;  3U1K A;  2C38 B;  5K36 C;  2PNZ A;  5JEA A;  2PNZ B;  1UDS A;  3KRN A;  3L7Z B;  1OYP A;  5C0X A;  4IFD C;  3CDI A;  3DD6 A;  2PO1 A;  4BA2 A;  1UDN A;  5K36 A;  2C38 A;  2BR2 B;  4OO1 F;  2PO1 B;  4BA2 B;  2BA0 G;  5C0X F;  2WNR A;  4BA1 B;  2JE6 A;  1OYS A;  2JE6 B;  5K36 F;  2WP8 B;  2PO0 A;  1UDQ A;  4OO1 A;  2C39 B;  4BA1 A;  2WP8 A;  2PO0 B;  3B4T A;  2NN6 A;  5JEA B;  5C0X D;  2BA0 D;  4AM3 A;  5JEA E;  1E3P A;  3CDJ A;  2C37 B;  2C37 A;  3M7N D;  4IFD D;  4OO1 E;  2BA1 D;  4OO1 C;  4IFD A;  4IFD B;  3L7Z A;  2NN6 F;  2NN6 D;  5C0X B;  1E3H A;  4IFD F;  2JEB B;  5K36 B;  2JEB A;  5C0X C;  5C0X E;  3GCM A;  1R6M A;  3M7N G;  5K36 E;  1R6L A;  4AID A;  3GLL A;  2PO2 A;  2C39 A;  3H1C A;  2PO2 B;  3M85 D;  2NN6 E;  2WNR B;  2BR2 A;  5JEA C;  5JEA D;  2BA1 G; 
#chains in the Genus database with same CATH topology
 4DV1 I;  3J80 C;  2J7K A;  2GO4 A;  1KTV A;  2V2Z A;  4Z7Y A;  4DXL A;  2VQF I;  1I94 I;  1YHC A;  5DNL A;  1OYR A;  4LCG A;  3GME A;  4AIM A;  2NN6 B;  2IER A;  4M1K A;  4ISA A;  4OO1 D;  5DNX A;  1EI1 A;  1FWK A;  2IES A;  1HNX E;  4PRV A;  4JI4 I;  1H7S A;  3LTO A;  1MU5 A;  2CVE A;  2X7I A;  3WU5 A;  5K36 C;  3QT7 A;  2ZIT A;  2UU9 I;  4DR1 E;  2AE8 A;  1XMQ I;  3J81 Q;  3DD6 A;  5BR8 I;  1UDN A;  2HKJ A;  2F4V E;  3PYE A;  1YH8 A;  4DUZ E;  1HR0 E;  2BM0 A;  1FI4 A;  1BKN A;  3QT8 A;  3D4J A;  4PRX A;  4NXN E;  3T1Y E;  1DAR A;  4ED4 A;  4BA2 B;  2HFS A;  4GKK I;  3P76 A;  2HK2 A;  4DV2 I;  4IZK B;  4BA1 B;  1QZR A;  5K36 F;  2GO3 A;  2J65 A;  3K1J A;  3PYD A;  4U3D A;  4LF7 E;  5FLX Q;  3K17 A;  4BA1 A;  1IBK E;  4KQV A;  4LFA E;  4DR4 I;  4X62 E;  4DR5 E;  2NN6 A;  4JV5 I;  2HFU A;  1PIE A;  1Y60 A;  3QT5 A;  4B3R I;  4FW7 A;  4AQY E;  1E3P A;  3PS1 A;  3ZZU A;  4WUD A;  2HK3 A;  4UT4 A;  5IWA I;  4FW9 A;  2C37 A;  4X65 I;  3WU4 A;  4IFD D;  1VIS A;  1RRE A;  4IFD B;  3L7Z A;  4JI6 I;  5C0X B;  1HNZ I;  4R1F A;  1Y5Y A;  1XNQ I;  1RR9 A;  4JI7 I;  4X62 I;  4DR5 I;  2JEB A;  1N0U A;  3T1H E;  4JV5 E;  2F1D A;  1HNW I;  5FWK A;  5A2Q Q;  4AQY I;  5A2Q C;  4YY3 I;  2C39 A;  4RPF A;  1XNR E;  2UXC E;  1U2R A;  5JEA C;  3Q1Q A;  1HNZ E;  2R3V A;  4HYM A;  4JI7 E;  2JT2 A;  4OO1 B;  1K47 A;  1H74 A;  3M6A A;  4DV3 E;  1NHH A;  1ZM4 A;  5DRO A;  2JEA A;  2Z5C B;  3WU3 A;  2DEJ A;  4DU8 A;  3LPS A;  3K85 A;  4OX9 I;  1WUU A;  1Z5A A;  4JI8 I;  4IFD E;  2V8P A;  4KHP E;  3PS3 A;  2NPF A;  2C38 B;  1J5E I;  1H7U A;  4MU1 A;  4EMD A;  4FW5 A;  5JEA A;  4LF4 E;  4K0K I;  1PKP A;  4B3T E;  1ZM9 A;  1OYP A;  5C0X A;  1MG7 A;  4IFD C;  2PO1 A;  4DR2 E;  3B82 A;  1N36 E;  2C38 A;  1FWL A;  5L3J A;  4GKJ I;  2VES A;  4DV7 I;  3PYG A;  4DPU A;  3JAM Q;  3H4L A;  2PO1 B;  2Z5B A;  2BA0 G;  2OI2 A;  4P52 A;  5DRQ A;  4UTG A;  4X66 I;  4JYA I;  2WNR A;  1PVG A;  4X65 E;  1NHJ A;  2WP8 B;  2ZM6 I;  1IBM I;  1XHK A;  4DR7 I;  4LCH A;  4DV0 I;  1UDQ A;  2XEX A;  2Z5B B;  4DPX A;  3T1H I;  1Z0B A;  3ZKB A;  4LPF A;  2BM1 A;  2WP8 A;  1USU A;  2PO0 B;  4DV4 E;  1ZXM A;  1KKH A;  5FLX C;  4JI1 I;  1Z0C A;  5JEA B;  1HNX I;  2O1V A;  3V2U C;  5C0X D;  2BA0 D;  4QNJ A;  4LF8 I;  2PNM A;  1Z5B A;  2C37 B;  1ELO A;  2UU9 E;  3M7N D;  3J80 Q;  3P3E A;  4FN5 A;  5GME A;  5DRR A;  2UXD E;  5K36 B;  1HR0 I;  4IZJ A;  5C0X E;  1Y6Z A;  4DV6 I;  2UUC I;  1D6T A;  3B8H A;  4HAC A;  1ZM2 A;  3LNU A;  4LF9 I;  3J7A G;  1S4E A;  3NZK A;  2PO2 A;  2UUA E;  1J5E E;  2VF3 A;  4K0K E;  2UXD I;  5JEA D;  4HAC B;  2VQE I;  4JI0 I;  4MQY A;  3Q6M A;  4DR3 E;  4ZVI A;  1XMO I;  1N36 I;  3CWV A;  4LOM A;  3PS2 A;  4USM A;  3QT6 A;  1XXE A;  4LF9 E;  4JI5 I;  1HK7 A;  4NXM E;  4MYU A;  1H73 A;  4JYA E;  1N33 E;  4DPY A;  1HNW E;  2NN6 C;  3F0N A;  4USK A;  5EKW A;  4LCF A;  2EFG A;  4NBQ A;  4OX9 E;  5LMU I;  1FJG I;  2PNZ A;  1Z5C A;  4JI6 E;  2UXC I;  3ZM7 A;  4DV5 I;  3CDI A;  2E5L E;  4LF7 I;  4BA2 A;  2UUB I;  2GQ0 A;  3PYF A;  5K36 A;  5IT9 C;  1N34 E;  4JI3 E;  4LFC E;  4HY1 A;  3ZZ0 A;  4X64 I;  4N3O A;  4FWH A;  4GQU A;  2JE6 A;  1OYS A;  4DV5 E;  4FW4 A;  4B3M I;  4DV3 I;  2GS8 A;  4DV0 E;  5BR8 E;  4OO1 A;  1ZXN A;  2C39 B;  5ELW A;  4J3D A;  1OJ4 A;  2V34 A;  4WUC A;  2VQE E;  5GMD A;  4B3T I;  1KVK A;  2WW4 A;  1B63 A;  3B4T A;  3B78 A;  3T1Y I;  4DR2 I;  4LFA I;  4JI2 I;  4U3B A;  4JI5 E;  5IWA E;  4GKJ E;  1MX0 A;  5JEA E;  4B3M E;  1FKA E;  1IBL I;  4DPW A;  2O1W A;  3ZKD A;  4DR3 I;  4OO1 E;  1KIJ A;  4Z7C A;  1XNQ E;  1I94 E;  4LF6 E;  2HKE A;  5IT9 Q;  2CG9 A;  4IFD F;  5C0X C;  4NXM I;  3J7A M;  4DV7 E;  3GCM A;  4IZK A;  4YY3 E;  1N33 I;  2Z5E A;  2AJ4 A;  4HXZ A;  5K36 E;  4OKG A;  3UHM A;  2F4V I;  1R6L A;  4AID A;  4DV6 E;  2UUC E;  4DUY E;  2A2C A;  4FW3 A;  1IBL E;  4LFB I;  3H1C A;  2PO2 B;  3M85 D;  2R42 A;  2BR2 A;  4WUB A;  4GKK E;  4FW6 A;  4LF6 I;  2PNL A;  4X64 E;  4JI8 E;  2DEI A;  4KHP I;  3P3G A;  2BV3 A;  3HKM A;  4DUZ I;  3HJC A;  2CZ9 A;  4PU9 A;  3M85 G;  5LMN I;  4JI3 I;  4DR6 E;  5K36 D;  1Y4S A;  4DUY I;  5JEA F;  2X36 A;  4DV2 E;  3Q6N A;  4DR4 E;  4LF8 E;  4LF5 E;  3P06 A;  2JEA B;  4P7A A;  2Z5C A;  2UXB E;  1UDO A;  4MDT A;  2IOQ A;  1P42 A;  4X66 E;  3U1K A;  3U1Y A;  3JAM C;  2PNZ B;  1VI7 A;  1UDS A;  2E1R A;  4MU4 A;  3KRN A;  3L7Z B;  1UEK A;  2O1U A;  4MU3 A;  4LF4 I;  3OTO E;  2HHH I;  1N0V C;  2CGE A;  2E5L I;  3J81 C;  1Z0V A;  2BR2 B;  1ZM3 A;  4B3R E;  4NXN I;  4JI2 E;  4DU7 A;  1FNM A;  1N32 I;  2O1T A;  2UXB I;  2Q2E B;  4OO1 F;  4JG4 A;  4YHH E;  4B3S I;  1Z0G A;  5C0X F;  1RHY A;  2JE6 B;  1NZ0 A;  2V2Q A;  4DPT A;  2PO0 A;  4FWG A;  1Y4U A;  2VQF E;  1Z0E A;  3OTO I;  1EA6 A;  2HHH E;  4XTJ A;  1Z59 A;  1FJG E;  2ZM6 E;  1IBM E;  4DR7 E;  1S16 A;  1Z0T A;  4DR1 I;  2ZBK B;  1N32 E;  5DRP A;  1Z0W A;  2LJP A;  4IZJ D;  4YHH I;  1H72 C;  4OZE A;  2UUB E;  1XNR I;  4LFB E;  4LFC I;  4I3H A;  1N34 I;  4QNK A;  3HUL A;  2IOP A;  4AM3 A;  4MYT A;  1B62 A;  3CDJ A;  1NHI A;  2UUA I;  2A2D A;  1XMQ E;  2BA1 D;  4FWD A;  4OO1 C;  4IFD A;  2V2V A;  5LMN E;  5EL9 A;  2NN6 F;  2NN6 D;  4DR6 I;  1E3H A;  4MU0 A;  1A6F A;  2O3Z A;  3GON A;  4DV4 I;  2JEB B;  4DV1 E;  4JI1 E;  4URL A;  1R6M A;  3P3C A;  3M7N G;  4LF5 I;  3GLL A;  3PRY A;  1USV A;  3WU6 A;  4IZJ B;  2NN6 E;  4JI0 E;  2WNR B;  3V5R A;  5LL6 R;  4B3S E;  1XMO E;  4IS9 A;  4JI4 E;  5LMU E;  2BA1 G;  3ZZT A;  1IBK I; 
#chains in the Genus database with same CATH homology
 3HKM A;  4OO1 B;  3M85 G;  5K36 D;  2JEA A;  5JEA F;  1OYR A;  3GME A;  4AIM A;  2NN6 B;  4OO1 D;  2NN6 C;  2JEA B;  4IFD E;  1UDO A;  4NBQ A;  3U1K A;  2C38 B;  5K36 C;  2PNZ A;  5JEA A;  2PNZ B;  1UDS A;  3KRN A;  3L7Z B;  1OYP A;  5C0X A;  4IFD C;  3CDI A;  3DD6 A;  2PO1 A;  4BA2 A;  1UDN A;  5K36 A;  2C38 A;  2BR2 B;  4OO1 F;  2PO1 B;  4BA2 B;  2BA0 G;  5C0X F;  2WNR A;  4BA1 B;  2JE6 A;  1OYS A;  2JE6 B;  5K36 F;  2WP8 B;  2PO0 A;  1UDQ A;  4OO1 A;  2C39 B;  4BA1 A;  2WP8 A;  2PO0 B;  3B4T A;  2NN6 A;  5JEA B;  5C0X D;  2BA0 D;  4AM3 A;  5JEA E;  1E3P A;  3CDJ A;  2C37 B;  2C37 A;  3M7N D;  4IFD D;  4OO1 E;  2BA1 D;  4OO1 C;  4IFD A;  4IFD B;  3L7Z A;  2NN6 F;  2NN6 D;  5C0X B;  1E3H A;  4IFD F;  2JEB B;  5K36 B;  2JEB A;  5C0X C;  5C0X E;  3GCM A;  1R6M A;  3M7N G;  5K36 E;  1R6L A;  4AID A;  3GLL A;  2PO2 A;  2C39 A;  3H1C A;  2PO2 B;  3M85 D;  2NN6 E;  2WNR B;  2BR2 A;  5JEA C;  5JEA D;  2BA1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...