4OO1E

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
255
Chain Sequence
SLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 60
structure length 255
sequence length 263
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1E00
3CDJA 2PO1A 2BA0G 2PO1B 2BA0D 3CDIA 5C0XB 2JEAA 2PO0A 4IFDD 3H1CA 1OYRA 5C0XF 3M7NG 4OO1B 5JEAB 2PNZA 4BA1A 5K36E 2WNRA 1E3PA 2WNRB 4OO1F 4AIDA 4IFDA 5JEAC 5K36C 2C37B 3L7ZB 2NN6B 1UDNA 4IFDF 2BA1G 2BA1D 2NN6F 3HKMA 2WP8A 2JEAB 4AIMA 1E3HA 2PO0B 5C0XE 1OYPA 4NBQA 5C0XC 3GLLA 3GCMA 2PO2A 2PNZB 4OO1E 5JEAE 4BA1B 3M85G 3M85D 3U1KA 4OO1C 5K36D 4IFDB 3B4TA 2NN6E 4IFDC 2NN6C 3DD6A 2BR2A 2WP8B 5K36A 1UDSA 4BA2A 2JEBA 2JE6A 1OYSA 2C38A 5C0XD 1UDOA 2PO2B 4OO1D 5JEAD 2C39A 2C39B 1UDQA 5C0XA 4IFDE 2NN6D 4OO1A 5JEAA 2BR2B 3M7ND 3KRNA 4AM3A 5K36B 3GMEA 1R6MA 4BA2B 2JEBB 2JE6B 1R6LA 2C38B 5JEAF 5K36F 2C37A 3L7ZA 2NN6A
chains in the Genus database with same CATH superfamily
2OI2A 2IESA 4IZJA 4QNJA 2UUBE 2PO1A 2PO1B 2A2DA 4MU1A 4RPFA 1PIEA 4DPTA 5C0XF 2UUAI 1NZ0A 1MX0A 5DRRA 1FWLA 1Y6ZA 5EKWA 2J65A 4X65I 2WNRA 4DV0E 2WNRB 4OO1F 2O1UA 1RR9A 2E5LE 4AIDA 5JEAC 2HFSA 3LNUA 3L7ZB 3HJCA 2PNMA 4LF8E 2AE8A 4U3DA 4X62E 2NN6F 4NXME 3D4JA 3HKMA 1A6FA 3PYDA 2HK3A 1E3HA 4NXNI 1OYPA 1IBLI 4ED4A 1XNRE 4LFAE 1FI4A 4DR2E 2X36A 3WU4A 3B82A 3LTOA 4USMA 4DR1I 3GCMA 2UU9I 4Z7CA 5GMDA 3P76A 2PNZB 2F4VE 3K1JA 4WUBA 4K0KI 4B3TI 4LCHA 3ZZ0A 4LF7I 4DPUA 2DEIA 2DEJA 1N34E 4B3MI 4N3OA 3F0NA 4ZVIA 5DRQA 4R1FA 1Z5BA 2WP8B 4MQYA 1UDSA 4DR7I 4KHPE 2BM0A 2Z5BB 4WUDA 3QT6A 4DV7E 1FJGI 4GKJE 4URLA 5LMNE 4OKGA 2HHHI 4YHHE 3WU6A 2VQEE 2CGEA 5IT9Q 1H73A 2E1RA 5DROA 3ZKDA 4IZKB 4LFCE 1KVKA 3ZZTA 3LPSA 4DV6E 1UDQA 5C0XA 4FW4A 5LL6R 4DR5E 3J80Q 1S16A 2HK2A 4OO1A 4DUZI 5FLXQ 4J3DA 1I94E 4LF5E 3KRNA 4AM3A 5DNXA 3GMEA 4ISAA 4DPWA 4LFBE 4I3HA 4DPYA 3P3CA 2NN6A 4HACB 2UXCE 3CDJA 2E5LI 2BV3A 2GO4A 2BA0G 2BA0D 1Z0CA 2V2VA 2ZM6E 3CDIA 3GONA 4LF8I 3J80C 1K47A 5BR8E 2UXDE 1U2RA 2JEAA 4X62I 4JI4E 5FLXC 2PO0A 4OZEA 3M7NG 4B3SE 5JEAB 4DR4I 1ZXNA 4OX9E 4LFAI 4FW5A 1IBME 2UXBE 4DR2I 4GKKI 2O1TA 1YHCA 2VESA 4IFDA 4MDTA 2F4VI 3Q6MA 3ZKBA 3JAMQ 4IZJB 5A2QC 4JV5E 4DV1I 1N34I 3PS3A 1HR0I 1IBKE 1HNXE 4FWHA 4DV5E 2PNLA 4DV2E 4KQVA 3B78A 1ZM4A 4KHPI 1EI1A 4JI3I 1NHJA 4LCFA 3GLLA 1N33I 4X66E 3T1HE 2PO2A 2X7IA 4AQYI 4DUYI 2UUCI 4YHHI 2VQEI 4B3RI 1Y4SA 3T1YI 1Z0BA 1MG7A 3U1KA 1XMQI 2CZ9A 1XHKA 3PS1A 4LFCI 3P06A 1HNWI 4DU8A 4JI1I 1XNQE 4IFDC 1FNMA 3DD6A 1J5EE 4DR5I 4LF6E 3HULA 2ZITA 2AJ4A 4FN5A 2JE6A 2C38A 4JI6I 3UHMA 4LF4E 1UDOA 1D6TA 2IOPA 4LFBI 3CWVA 1N0VC 5EL9A 2R3VA 3ZM7A 3Q1QA 5JEAD 2C39A 2EFGA 3WU3A 2C39B 2VQFE 2ZM6I 4P52A 5LMUE 1Y5YA 1N32E 2GQ0A 1ZM9A 4MU0A 2HKEA 1Z5AA 1Z0EA 1HNZE 1YH8A 4IZJD 1N36E 5K36B 3NZKA 4DXLA 4DV4E 4U3BA 4DV3I 4JG4A 5JEAF 2C37A 3QT7A 4JI8E 1IBMI 4JYAE 1OJ4A 2WW4A 1KIJA 4HY1A 5K36A 1UEKA 2UUBI 4JV5I 3M6AA 1Z0VA 5C0XB 4MYTA 2UUAE 4HXZA 1BKNA 3B8HA 1FKAE 1OYRA 2GS8A 2V34A 4DV5I 4OO1B 1XMOE 4X65E 5IT9C 4BA1A 3K85A 4JI7E 3T1HI 1NHHA 5K36C 2BM1A 4DV0I 1DARA 2NN6B 4X64E 4XTJA 1Z5CA 2BA1G 2BA1D 4WUCA 3U1YA 4LF9E 5DNLA 1Z0TA 2O1WA 4FWDA 4YY3E 4NXNE 4AIMA 2JEAB 4NXMI 2F1DA 2PO0B 2R42A 2UU9E 3OTOE 1N0UA 4PU9A 5C0XC 4K0KE 2GO3A 1XNRI 4B3TE 1PKPA 5JEAE 4LF7E 4Z7YA 1RHYA 4PRXA 4LF4I 2Z5EA 4DR3E 1USUA 1WUUA 4B3ME 4OO1C 5K36D 4IFDB 2J7KA 1H74A 2JT2A 4DR7E 1FJGE 2Z5CA 2NN6C 2BR2A 5IWAE 5GMEA 2HHHE 3PS2A 1HNZI 4BA2A 2JEBA 4JI5E 3H4LA 4DV7I 5C0XD 4USKA 4GKJI 2O3ZA 2CG9A 5LMNI 1KTVA 2PO2B 3V2UC 4IS9A 3JAMC 1ZXMA 4JI8I 4OO1D 1B63A 1VI7A 4MYUA 4JYAI 4UT4A 4DV6I 4DUZE 4FW7A 2NN6D 5FWKA 2IOQA 3ZZUA 4JI2E 3PYGA 1R6MA 1XMOI 1I94I 1P42A 4LF5I 1Z0GA 3WU5A 2JE6B 1R6LA 2C38B 3PYEA 4DR6E 3L7ZA 3K17A 2LJPA 4JI7I 4HYMA 1ELOA 4FW9A 2UXCI 4X64I 2VF3A 1H7UA 4JI0E 3QT5A 4FW3A 4LF9I 5BR8I 4YY3I 3H1CA 4IFDD 2UXDI 2NPFA 4DR4E 1H72C 4JI4I 3QT8A 4GKKE 3J81Q 2PNZA 4MU3A 4DPXA 4DU7A 3OTOI 4B3SI 3J7AM 5K36E 1E3PA 4OX9I 2C37B 2UXBI 4DR3I 1Y4UA 4DV1E 1RREA 1VISA 1HR0E 1UDNA 3J7AG 4IFDF 2V8PA 1HK7A 2WP8A 4LOMA 4FW6A 2Z5BA 1Y60A 4JI3E 1IBKI 5C0XE 1HNXI 1N33E 3Q6NA 5IWAI 2A2CA 2Q2EB 2XEXA 4NBQA 3J81C 4LCGA 4AQYE 4DUYE 4DV2I 2UUCE 1EA6A 4B3RE 5DRPA 3T1YE 4JI5I 1XMQE 4OO1E 4BA1B 4IZKA 1S4EA 4GQUA 1XXEA 4X66I 3M85G 3M85D 1H7SA 1HNWE 4PRVA 2HKJA 3B4TA 4JI1E 2V2ZA 3V5RA 2NN6E 1USVA 1QZRA 1MU5A 1IBLE 1XNQI 4JI6E 5ELWA 3P3GA 3PRYA 1J5EI 2O1VA 4DR1E 4LF6I 1KKHA 1Z59A 4UTGA 4JI2I 1OYSA 3PYFA 4M1KA 1PVGA 1ZM2A 4HACA 2V2QA 1B62A 4DR6I 2ZBKB 3P3EA 5L3JA 1NHIA 5A2QQ 4QNKA 4IFDE 4LPFA 1FWKA 2VQFI 4P7AA 4JI0I 5LMUI 2Z5CB 2HFUA 5JEAA 1N32I 2BR2B 1ZM3A 4MU4A 4DV3E 2CVEA 3M7ND 1Z0WA 4BA2B 4FWGA 2JEBB 1N36I 5K36F 4DV4I 2IERA 4EMDA
chains in the Genus database with same CATH topology
3CDJA 2PO1A 2BA0G 2PO1B 2BA0D 3CDIA 5C0XB 2JEAA 2PO0A 4IFDD 3H1CA 1OYRA 5C0XF 3M7NG 4OO1B 5JEAB 2PNZA 4BA1A 5K36E 2WNRA 1E3PA 2WNRB 4OO1F 4AIDA 4IFDA 5JEAC 5K36C 2C37B 3L7ZB 2NN6B 1UDNA 4IFDF 2BA1G 2BA1D 2NN6F 3HKMA 2WP8A 2JEAB 4AIMA 1E3HA 2PO0B 5C0XE 1OYPA 4NBQA 5C0XC 3GLLA 3GCMA 2PO2A 2PNZB 4OO1E 5JEAE 4BA1B 3M85G 3M85D 3U1KA 4OO1C 5K36D 4IFDB 3B4TA 2NN6E 4IFDC 2NN6C 3DD6A 2BR2A 2WP8B 5K36A 1UDSA 4BA2A 2JEBA 2JE6A 1OYSA 2C38A 5C0XD 1UDOA 2PO2B 4OO1D 5JEAD 2C39A 2C39B 1UDQA 5C0XA 4IFDE 2NN6D 4OO1A 5JEAA 2BR2B 3M7ND 3KRNA 4AM3A 5K36B 3GMEA 1R6MA 4BA2B 2JEBB 2JE6B 1R6LA 2C38B 5JEAF 5K36F 2C37A 3L7ZA 2NN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDJ A;  2PO1 A;  2BA0 G;  2PO1 B;  2BA0 D;  3CDI A;  5C0X B;  2JEA A;  2PO0 A;  4IFD D;  3H1C A;  1OYR A;  5C0X F;  3M7N G;  4OO1 B;  5JEA B;  2PNZ A;  4BA1 A;  5K36 E;  2WNR A;  1E3P A;  2WNR B;  4OO1 F;  4AID A;  4IFD A;  5JEA C;  5K36 C;  2C37 B;  3L7Z B;  2NN6 B;  1UDN A;  4IFD F;  2BA1 G;  2BA1 D;  2NN6 F;  3HKM A;  2WP8 A;  2JEA B;  4AIM A;  1E3H A;  2PO0 B;  5C0X E;  1OYP A;  4NBQ A;  5C0X C;  3GLL A;  3GCM A;  2PO2 A;  2PNZ B;  4OO1 E;  5JEA E;  4BA1 B;  3M85 G;  3M85 D;  3U1K A;  4OO1 C;  5K36 D;  4IFD B;  3B4T A;  2NN6 E;  4IFD C;  2NN6 C;  3DD6 A;  2BR2 A;  2WP8 B;  5K36 A;  1UDS A;  4BA2 A;  2JEB A;  2JE6 A;  1OYS A;  2C38 A;  5C0X D;  1UDO A;  2PO2 B;  4OO1 D;  5JEA D;  2C39 A;  2C39 B;  1UDQ A;  5C0X A;  4IFD E;  2NN6 D;  4OO1 A;  5JEA A;  2BR2 B;  3M7N D;  3KRN A;  4AM3 A;  5K36 B;  3GME A;  1R6M A;  4BA2 B;  2JEB B;  2JE6 B;  1R6L A;  2C38 B;  5JEA F;  5K36 F;  2C37 A;  3L7Z A;  2NN6 A; 
#chains in the Genus database with same CATH topology
 2OI2 A;  2IES A;  4IZJ A;  4QNJ A;  2UUB E;  2PO1 A;  2PO1 B;  2A2D A;  4MU1 A;  4RPF A;  1PIE A;  4DPT A;  5C0X F;  2UUA I;  1NZ0 A;  1MX0 A;  5DRR A;  1FWL A;  1Y6Z A;  5EKW A;  2J65 A;  4X65 I;  2WNR A;  4DV0 E;  2WNR B;  4OO1 F;  2O1U A;  1RR9 A;  2E5L E;  4AID A;  5JEA C;  2HFS A;  3LNU A;  3L7Z B;  3HJC A;  2PNM A;  4LF8 E;  2AE8 A;  4U3D A;  4X62 E;  2NN6 F;  4NXM E;  3D4J A;  3HKM A;  1A6F A;  3PYD A;  2HK3 A;  1E3H A;  4NXN I;  1OYP A;  1IBL I;  4ED4 A;  1XNR E;  4LFA E;  1FI4 A;  4DR2 E;  2X36 A;  3WU4 A;  3B82 A;  3LTO A;  4USM A;  4DR1 I;  3GCM A;  2UU9 I;  4Z7C A;  5GMD A;  3P76 A;  2PNZ B;  2F4V E;  3K1J A;  4WUB A;  4K0K I;  4B3T I;  4LCH A;  3ZZ0 A;  4LF7 I;  4DPU A;  2DEI A;  2DEJ A;  1N34 E;  4B3M I;  4N3O A;  3F0N A;  4ZVI A;  5DRQ A;  4R1F A;  1Z5B A;  2WP8 B;  4MQY A;  1UDS A;  4DR7 I;  4KHP E;  2BM0 A;  2Z5B B;  4WUD A;  3QT6 A;  4DV7 E;  1FJG I;  4GKJ E;  4URL A;  5LMN E;  4OKG A;  2HHH I;  4YHH E;  3WU6 A;  2VQE E;  2CGE A;  5IT9 Q;  1H73 A;  2E1R A;  5DRO A;  3ZKD A;  4IZK B;  4LFC E;  1KVK A;  3ZZT A;  3LPS A;  4DV6 E;  1UDQ A;  5C0X A;  4FW4 A;  5LL6 R;  4DR5 E;  3J80 Q;  1S16 A;  2HK2 A;  4OO1 A;  4DUZ I;  5FLX Q;  4J3D A;  1I94 E;  4LF5 E;  3KRN A;  4AM3 A;  5DNX A;  3GME A;  4ISA A;  4DPW A;  4LFB E;  4I3H A;  4DPY A;  3P3C A;  2NN6 A;  4HAC B;  2UXC E;  3CDJ A;  2E5L I;  2BV3 A;  2GO4 A;  2BA0 G;  2BA0 D;  1Z0C A;  2V2V A;  2ZM6 E;  3CDI A;  3GON A;  4LF8 I;  3J80 C;  1K47 A;  5BR8 E;  2UXD E;  1U2R A;  2JEA A;  4X62 I;  4JI4 E;  5FLX C;  2PO0 A;  4OZE A;  3M7N G;  4B3S E;  5JEA B;  4DR4 I;  1ZXN A;  4OX9 E;  4LFA I;  4FW5 A;  1IBM E;  2UXB E;  4DR2 I;  4GKK I;  2O1T A;  1YHC A;  2VES A;  4IFD A;  4MDT A;  2F4V I;  3Q6M A;  3ZKB A;  3JAM Q;  4IZJ B;  5A2Q C;  4JV5 E;  4DV1 I;  1N34 I;  3PS3 A;  1HR0 I;  1IBK E;  1HNX E;  4FWH A;  4DV5 E;  2PNL A;  4DV2 E;  4KQV A;  3B78 A;  1ZM4 A;  4KHP I;  1EI1 A;  4JI3 I;  1NHJ A;  4LCF A;  3GLL A;  1N33 I;  4X66 E;  3T1H E;  2PO2 A;  2X7I A;  4AQY I;  4DUY I;  2UUC I;  4YHH I;  2VQE I;  4B3R I;  1Y4S A;  3T1Y I;  1Z0B A;  1MG7 A;  3U1K A;  1XMQ I;  2CZ9 A;  1XHK A;  3PS1 A;  4LFC I;  3P06 A;  1HNW I;  4DU8 A;  4JI1 I;  1XNQ E;  4IFD C;  1FNM A;  3DD6 A;  1J5E E;  4DR5 I;  4LF6 E;  3HUL A;  2ZIT A;  2AJ4 A;  4FN5 A;  2JE6 A;  2C38 A;  4JI6 I;  3UHM A;  4LF4 E;  1UDO A;  1D6T A;  2IOP A;  4LFB I;  3CWV A;  1N0V C;  5EL9 A;  2R3V A;  3ZM7 A;  3Q1Q A;  5JEA D;  2C39 A;  2EFG A;  3WU3 A;  2C39 B;  2VQF E;  2ZM6 I;  4P52 A;  5LMU E;  1Y5Y A;  1N32 E;  2GQ0 A;  1ZM9 A;  4MU0 A;  2HKE A;  1Z5A A;  1Z0E A;  1HNZ E;  1YH8 A;  4IZJ D;  1N36 E;  5K36 B;  3NZK A;  4DXL A;  4DV4 E;  4U3B A;  4DV3 I;  4JG4 A;  5JEA F;  2C37 A;  3QT7 A;  4JI8 E;  1IBM I;  4JYA E;  1OJ4 A;  2WW4 A;  1KIJ A;  4HY1 A;  5K36 A;  1UEK A;  2UUB I;  4JV5 I;  3M6A A;  1Z0V A;  5C0X B;  4MYT A;  2UUA E;  4HXZ A;  1BKN A;  3B8H A;  1FKA E;  1OYR A;  2GS8 A;  2V34 A;  4DV5 I;  4OO1 B;  1XMO E;  4X65 E;  5IT9 C;  4BA1 A;  3K85 A;  4JI7 E;  3T1H I;  1NHH A;  5K36 C;  2BM1 A;  4DV0 I;  1DAR A;  2NN6 B;  4X64 E;  4XTJ A;  1Z5C A;  2BA1 G;  2BA1 D;  4WUC A;  3U1Y A;  4LF9 E;  5DNL A;  1Z0T A;  2O1W A;  4FWD A;  4YY3 E;  4NXN E;  4AIM A;  2JEA B;  4NXM I;  2F1D A;  2PO0 B;  2R42 A;  2UU9 E;  3OTO E;  1N0U A;  4PU9 A;  5C0X C;  4K0K E;  2GO3 A;  1XNR I;  4B3T E;  1PKP A;  5JEA E;  4LF7 E;  4Z7Y A;  1RHY A;  4PRX A;  4LF4 I;  2Z5E A;  4DR3 E;  1USU A;  1WUU A;  4B3M E;  4OO1 C;  5K36 D;  4IFD B;  2J7K A;  1H74 A;  2JT2 A;  4DR7 E;  1FJG E;  2Z5C A;  2NN6 C;  2BR2 A;  5IWA E;  5GME A;  2HHH E;  3PS2 A;  1HNZ I;  4BA2 A;  2JEB A;  4JI5 E;  3H4L A;  4DV7 I;  5C0X D;  4USK A;  4GKJ I;  2O3Z A;  2CG9 A;  5LMN I;  1KTV A;  2PO2 B;  3V2U C;  4IS9 A;  3JAM C;  1ZXM A;  4JI8 I;  4OO1 D;  1B63 A;  1VI7 A;  4MYU A;  4JYA I;  4UT4 A;  4DV6 I;  4DUZ E;  4FW7 A;  2NN6 D;  5FWK A;  2IOQ A;  3ZZU A;  4JI2 E;  3PYG A;  1R6M A;  1XMO I;  1I94 I;  1P42 A;  4LF5 I;  1Z0G A;  3WU5 A;  2JE6 B;  1R6L A;  2C38 B;  3PYE A;  4DR6 E;  3L7Z A;  3K17 A;  2LJP A;  4JI7 I;  4HYM A;  1ELO A;  4FW9 A;  2UXC I;  4X64 I;  2VF3 A;  1H7U A;  4JI0 E;  3QT5 A;  4FW3 A;  4LF9 I;  5BR8 I;  4YY3 I;  3H1C A;  4IFD D;  2UXD I;  2NPF A;  4DR4 E;  1H72 C;  4JI4 I;  3QT8 A;  4GKK E;  3J81 Q;  2PNZ A;  4MU3 A;  4DPX A;  4DU7 A;  3OTO I;  4B3S I;  3J7A M;  5K36 E;  1E3P A;  4OX9 I;  2C37 B;  2UXB I;  4DR3 I;  1Y4U A;  4DV1 E;  1RRE A;  1VIS A;  1HR0 E;  1UDN A;  3J7A G;  4IFD F;  2V8P A;  1HK7 A;  2WP8 A;  4LOM A;  4FW6 A;  2Z5B A;  1Y60 A;  4JI3 E;  1IBK I;  5C0X E;  1HNX I;  1N33 E;  3Q6N A;  5IWA I;  2A2C A;  2Q2E B;  2XEX A;  4NBQ A;  3J81 C;  4LCG A;  4AQY E;  4DUY E;  4DV2 I;  2UUC E;  1EA6 A;  4B3R E;  5DRP A;  3T1Y E;  4JI5 I;  1XMQ E;  4OO1 E;  4BA1 B;  4IZK A;  1S4E A;  4GQU A;  1XXE A;  4X66 I;  3M85 G;  3M85 D;  1H7S A;  1HNW E;  4PRV A;  2HKJ A;  3B4T A;  4JI1 E;  2V2Z A;  3V5R A;  2NN6 E;  1USV A;  1QZR A;  1MU5 A;  1IBL E;  1XNQ I;  4JI6 E;  5ELW A;  3P3G A;  3PRY A;  1J5E I;  2O1V A;  4DR1 E;  4LF6 I;  1KKH A;  1Z59 A;  4UTG A;  4JI2 I;  1OYS A;  3PYF A;  4M1K A;  1PVG A;  1ZM2 A;  4HAC A;  2V2Q A;  1B62 A;  4DR6 I;  2ZBK B;  3P3E A;  5L3J A;  1NHI A;  5A2Q Q;  4QNK A;  4IFD E;  4LPF A;  1FWK A;  2VQF I;  4P7A A;  4JI0 I;  5LMU I;  2Z5C B;  2HFU A;  5JEA A;  1N32 I;  2BR2 B;  1ZM3 A;  4MU4 A;  4DV3 E;  2CVE A;  3M7N D;  1Z0W A;  4BA2 B;  4FWG A;  2JEB B;  1N36 I;  5K36 F;  4DV4 I;  2IER A;  4EMD A; 
#chains in the Genus database with same CATH homology
 3CDJ A;  2PO1 A;  2BA0 G;  2PO1 B;  2BA0 D;  3CDI A;  5C0X B;  2JEA A;  2PO0 A;  4IFD D;  3H1C A;  1OYR A;  5C0X F;  3M7N G;  4OO1 B;  5JEA B;  2PNZ A;  4BA1 A;  5K36 E;  2WNR A;  1E3P A;  2WNR B;  4OO1 F;  4AID A;  4IFD A;  5JEA C;  5K36 C;  2C37 B;  3L7Z B;  2NN6 B;  1UDN A;  4IFD F;  2BA1 G;  2BA1 D;  2NN6 F;  3HKM A;  2WP8 A;  2JEA B;  4AIM A;  1E3H A;  2PO0 B;  5C0X E;  1OYP A;  4NBQ A;  5C0X C;  3GLL A;  3GCM A;  2PO2 A;  2PNZ B;  4OO1 E;  5JEA E;  4BA1 B;  3M85 G;  3M85 D;  3U1K A;  4OO1 C;  5K36 D;  4IFD B;  3B4T A;  2NN6 E;  4IFD C;  2NN6 C;  3DD6 A;  2BR2 A;  2WP8 B;  5K36 A;  1UDS A;  4BA2 A;  2JEB A;  2JE6 A;  1OYS A;  2C38 A;  5C0X D;  1UDO A;  2PO2 B;  4OO1 D;  5JEA D;  2C39 A;  2C39 B;  1UDQ A;  5C0X A;  4IFD E;  2NN6 D;  4OO1 A;  5JEA A;  2BR2 B;  3M7N D;  3KRN A;  4AM3 A;  5K36 B;  3GME A;  1R6M A;  4BA2 B;  2JEB B;  2JE6 B;  1R6L A;  2C38 B;  5JEA F;  5K36 F;  2C37 A;  3L7Z A;  2NN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...