4OO1E

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
255
Chain Sequence
SLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 60
structure length 255
sequence length 263
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1E00
1UDQA 2NN6D 2PNZB 2JEAA 4OO1F 1E3PA 2JE6B 1OYRA 3CDIA 3GCMA 4IFDD 3H1CA 5JEAB 5K36C 2WNRB 4BA2A 5JEAC 2BA0G 1OYPA 5C0XD 2WNRA 3GMEA 5C0XF 4BA1A 3M7ND 3KRNA 3M85G 2C38B 1R6MA 5C0XE 4OO1A 3B4TA 3U1KA 5K36A 3DD6A 2C38A 5JEAF 2C37B 5JEAD 4IFDB 4AIDA 2PO1A 4OO1E 2BA1D 4IFDA 4IFDC 3HKMA 2PO2A 3CDJA 2NN6F 2BR2B 5JEAE 2PO0A 2BA1G 1E3HA 2PO2B 1R6LA 2WP8B 2JE6A 4OO1B 2PO0B 2BA0D 5C0XC 2JEBA 2NN6A 4OO1C 1OYSA 5K36B 4IFDF 5C0XB 1UDNA 5K36F 2JEBB 5K36D 2C37A 2BR2A 4AIMA 5JEAA 4NBQA 1UDOA 5K36E 2WP8A 1UDSA 4AM3A 2C39A 2PO1B 4IFDE 5C0XA 4BA2B 2C39B 3L7ZB 4BA1B 2NN6C 4OO1D 3M85D 3M7NG 2NN6B 3GLLA 2PNZA 2JEAB 3L7ZA 2NN6E
chains in the Genus database with same CATH superfamily
1B62A 4OZEA 4DR3E 2UUCE 3Q1QA 1OYRA 3P3GA 4HY1A 1FWLA 3QT7A 3J7AG 2O1WA 4DPYA 1HNXE 4DUYI 1WUUA 4N3OA 3PYFA 1H7SA 4LF4E 4LFAI 5DRRA 4LFBI 1ZM3A 2O1VA 4FWDA 4MU1A 2BA0G 2HK3A 3T1YE 3J80Q 2HHHI 2BM1A 1RREA 1HNWI 2WNRA 4UT4A 1XNQE 3M85G 4JYAE 3HJCA 3K17A 4YHHI 4OO1A 1IBMI 1EA6A 3ZKBA 1XMQI 1N0VC 4HXZA 4X66E 4JI5E 4LF7E 4LF8E 1H7UA 2C37B 1A6FA 4DV7I 5JEAD 4NXNI 2IOQA 4URLA 4AIDA 3V5RA 3PYEA 4I3HA 1ZM9A 3JAMC 1NZ0A 3K85A 4NXME 2UXCI 2F1DA 1ZM4A 1YHCA 2PO2A 3LNUA 5JEAE 1E3HA 1KVKA 2HFUA 1Z5CA 5EKWA 1N32I 2HHHE 1QZRA 1HNWE 4LF5E 4FW4A 3U1YA 2UXBI 2R3VA 4JI3E 2GO4A 4DV6E 5A2QC 2BA0D 4LCFA 4KHPE 2JEBA 3CWVA 3QT5A 1HNZI 1XHKA 1KIJA 2A2CA 1H72C 4JI4E 2F4VI 1J5EI 1N0UA 4DR5E 2J7KA 2E5LI 2CZ9A 4P7AA 2BR2A 4AIMA 4FW6A 3P06A 2IERA 4DV4E 2WP8A 3PS2A 2VQFI 4B3SE 4K0KE 1UEKA 4DR4I 4MYUA 2CGEA 5EL9A 4BA1B 2PNLA 5A2QQ 4OO1D 1N36E 3M85D 3ZZTA 3OTOE 1ZM2A 3F0NA 4B3MI 1HK7A 4USKA 2NPFA 4JI3I 4FWHA 3P3EA 4IZKA 3GLLA 4LF4I 4GKKE 1NHIA 3ZM7A 2NN6E 4DPTA 4KHPI 4FW3A 4DV2E 1UDQA 2NN6D 2HKJA 5LMNI 2F4VE 4DUZE 4PRVA 1J5EE 1XNRI 2O3ZA 3H1CA 1Y6ZA 2IOPA 2PNMA 2Q2EB 4WUCA 1XNQI 3Q6MA 1N33E 1Z0VA 4DR3I 3P3CA 2Z5CB 4B3TI 3T1HI 4OKGA 4LF6I 4EMDA 4X66I 5FLXQ 1HNXI 4JI5I 4OX9E 4JI1I 4BA1A 3M7ND 4DV7E 4XTJA 1R6MA 4NXNE 1HR0E 5DRPA 3OTOI 2R42A 4U3DA 1B63A 4JV5E 4DR2E 5JEAF 4DPWA 4IZJD 5L3JA 1IBME 4X64E 4FW5A 1S16A 4IFDC 2V34A 1H74A 4LF9I 3WU4A 5FLXC 1VI7A 1Z5BA 3PYGA 1MX0A 4JI0E 4JI4I 1IBKE 1USUA 2GO3A 4B3TE 1R6LA 4WUDA 3UHMA 2WP8B 2UXDI 2JE6A 4B3RI 1PIEA 4HYMA 1EI1A 2UXCE 1S4EA 5LL6R 4JI1E 4DV1E 4IZJB 2ZM6E 1XMOE 4R1FA 2NN6A 3JAMQ 4HACB 1Z0CA 5K36B 4X65E 5C0XB 4K0KI 1KTVA 1UDNA 4DR4E 3PRYA 2OI2A 4DU7A 3QT6A 2JEBB 1FJGE 2C37A 3J81Q 4GKJI 1N34I 3M6AA 1UDOA 5K36E 1HNZE 1Y60A 2IESA 4IFDE 4JI2E 1D6TA 2VESA 4BA2B 3L7ZB 4JYAI 5LMNE 1IBKI 4QNKA 2UXDE 1XNRE 2E1RA 4AQYI 4DV5E 1XMQE 2PNZA 2JEAB 4ZVIA 4IZJA 1Y4UA 1IBLE 2GQ0A 5FWKA 2AE8A 1VISA 1E3PA 2JE6B 5IWAE 4IZKB 3CDIA 4USMA 3GCMA 2LJPA 1FJGI 4YY3E 4U3BA 4MU0A 1N34E 3PYDA 4GKKI 4QNJA 1FI4A 4FN5A 1ZXMA 2WNRB 4DV2I 5JEAC 1OYPA 3V2UC 1N32E 1Z5AA 3GMEA 5C0XD 1NHHA 4DR2I 2UXBE 2Z5EA 3KRNA 1FWKA 2GS8A 4DR6E 4PRXA 2C38B 5C0XE 1YH8A 1Y5YA 3B4TA 4AQYE 4DV3E 2Z5BB 4DPXA 4DV5I 5BR8I 3B8HA 2V2VA 3DD6A 4DR5I 4J3DA 3ZZ0A 4JI0I 4IFDB 4UTGA 4M1KA 5IWAI 2UUCI 4GQUA 4P52A 3J7AM 4JI6E 2A2DA 1RHYA 1ZXNA 4OO1E 4Z7YA 2BA1D 4IFDA 5DROA 3WU6A 4JV5I 2DEJA 1Z0BA 2ZM6I 4JG4A 1XMOI 1OJ4A 1PKPA 1Z0EA 2BR2B 4LFCE 1Z0GA 2PO0A 4LOMA 2PO2B 1N36I 2VQEI 1MG7A 1MU5A 5GMEA 2X36A 4OO1B 4MDTA 3ZKDA 1USVA 4RPFA 4LF9E 5C0XC 4OO1C 4LCHA 2V8PA 5IT9C 2J65A 1OYSA 4DV3I 1K47A 4IFDF 5BR8E 4JI2I 4Z7CA 5K36F 4DR7E 3H4LA 4KQVA 1NHJA 4X62E 5K36D 1RR9A 5LMUE 1Z0WA 3B78A 4NBQA 2UUBI 2UUAI 4LPFA 3WU5A 2HKEA 5C0XA 3T1HE 4LFCI 2C39B 2HFSA 4GKJE 3ZZUA 2DEIA 5DNLA 2VQEE 2HK2A 2Z5CA 1H73A 3M7NG 4LCGA 3D4JA 2V2ZA 1FNMA 3L7ZA 2BM0A 2ZBKB 3PS3A 4DV0E 2PNZB 3T1YI 2JEAA 4OO1F 4IFDD 5ELWA 5JEAB 4X62I 5K36C 4JI8I 2UU9E 4JI7I 4IS9A 1KKHA 4ISAA 2XEXA 1IBLI 4ED4A 2CG9A 4BA2A 4B3SI 4B3RE 1BKNA 4LF7I 4FW7A 4DUYE 4LF8I 5C0XF 4DXLA 4DV1I 4WUBA 1I94E 1XXEA 4LFAE 4DPUA 4MQYA 1U2RA 5DNXA 4JI6I 4NXMI 4DU8A 4B3ME 3LTOA 4X65I 1DARA 3U1KA 5K36A 1Z0TA 2C38A 3LPSA 3GONA 3HULA 4DR6I 1P42A 4DUZI 2EFGA 3K1JA 4FW9A 4LF5I 2PO1A 2CVEA 2WW4A 4JI7E 4JI8E 3HKMA 4PU9A 3CDJA 4DR1E 2X7IA 1PVGA 2NN6F 4MU4A 1ELOA 1N33I 2BA1G 4MU3A 4LF6E 4OX9I 3J81C 4DR7I 2PO0B 1I94I 5DRQA 5LMUI 2O1UA 4MYTA 1HR0I 3NZKA 3QT8A 2O1TA 4FWGA 2AJ4A 2UUAE 2JT2A 3P76A 4YY3I 4DV6I 2BV3A 1Y4SA 5GMDA 4LFBE 5JEAA 3Q6NA 2Z5BA 1UDSA 1FKAE 4AM3A 4X64I 2PO1B 4DR1I 3J80C 2V2QA 1Z59A 5IT9Q 2E5LE 2NN6C 4DV0I 4YHHE 2UUBE 4DV4I 3PS1A 2VQFE 4HACA 2UU9I 2NN6B 2VF3A 3B82A 2ZITA 3WU3A 2C39A
chains in the Genus database with same CATH topology
1UDQA 2NN6D 2PNZB 2JEAA 4OO1F 1E3PA 2JE6B 1OYRA 3CDIA 3GCMA 4IFDD 3H1CA 5JEAB 5K36C 2WNRB 4BA2A 5JEAC 2BA0G 1OYPA 5C0XD 2WNRA 3GMEA 5C0XF 4BA1A 3M7ND 3KRNA 3M85G 2C38B 1R6MA 5C0XE 4OO1A 3B4TA 3U1KA 5K36A 3DD6A 2C38A 5JEAF 2C37B 5JEAD 4IFDB 4AIDA 2PO1A 4OO1E 2BA1D 4IFDA 4IFDC 3HKMA 2PO2A 3CDJA 2NN6F 2BR2B 5JEAE 2PO0A 2BA1G 1E3HA 2PO2B 1R6LA 2WP8B 2JE6A 4OO1B 2PO0B 2BA0D 5C0XC 2JEBA 2NN6A 4OO1C 1OYSA 5K36B 4IFDF 5C0XB 1UDNA 5K36F 2JEBB 5K36D 2C37A 2BR2A 4AIMA 5JEAA 4NBQA 1UDOA 5K36E 2WP8A 1UDSA 4AM3A 2C39A 2PO1B 4IFDE 5C0XA 4BA2B 2C39B 3L7ZB 4BA1B 2NN6C 4OO1D 3M85D 3M7NG 2NN6B 3GLLA 2PNZA 2JEAB 3L7ZA 2NN6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDQ A;  2NN6 D;  2PNZ B;  2JEA A;  4OO1 F;  1E3P A;  2JE6 B;  1OYR A;  3CDI A;  3GCM A;  4IFD D;  3H1C A;  5JEA B;  5K36 C;  2WNR B;  4BA2 A;  5JEA C;  2BA0 G;  1OYP A;  5C0X D;  2WNR A;  3GME A;  5C0X F;  4BA1 A;  3M7N D;  3KRN A;  3M85 G;  2C38 B;  1R6M A;  5C0X E;  4OO1 A;  3B4T A;  3U1K A;  5K36 A;  3DD6 A;  2C38 A;  5JEA F;  2C37 B;  5JEA D;  4IFD B;  4AID A;  2PO1 A;  4OO1 E;  2BA1 D;  4IFD A;  4IFD C;  3HKM A;  2PO2 A;  3CDJ A;  2NN6 F;  2BR2 B;  5JEA E;  2PO0 A;  2BA1 G;  1E3H A;  2PO2 B;  1R6L A;  2WP8 B;  2JE6 A;  4OO1 B;  2PO0 B;  2BA0 D;  5C0X C;  2JEB A;  2NN6 A;  4OO1 C;  1OYS A;  5K36 B;  4IFD F;  5C0X B;  1UDN A;  5K36 F;  2JEB B;  5K36 D;  2C37 A;  2BR2 A;  4AIM A;  5JEA A;  4NBQ A;  1UDO A;  5K36 E;  2WP8 A;  1UDS A;  4AM3 A;  2C39 A;  2PO1 B;  4IFD E;  5C0X A;  4BA2 B;  2C39 B;  3L7Z B;  4BA1 B;  2NN6 C;  4OO1 D;  3M85 D;  3M7N G;  2NN6 B;  3GLL A;  2PNZ A;  2JEA B;  3L7Z A;  2NN6 E; 
#chains in the Genus database with same CATH topology
 1B62 A;  4OZE A;  4DR3 E;  2UUC E;  3Q1Q A;  1OYR A;  3P3G A;  4HY1 A;  1FWL A;  3QT7 A;  3J7A G;  2O1W A;  4DPY A;  1HNX E;  4DUY I;  1WUU A;  4N3O A;  3PYF A;  1H7S A;  4LF4 E;  4LFA I;  5DRR A;  4LFB I;  1ZM3 A;  2O1V A;  4FWD A;  4MU1 A;  2BA0 G;  2HK3 A;  3T1Y E;  3J80 Q;  2HHH I;  2BM1 A;  1RRE A;  1HNW I;  2WNR A;  4UT4 A;  1XNQ E;  3M85 G;  4JYA E;  3HJC A;  3K17 A;  4YHH I;  4OO1 A;  1IBM I;  1EA6 A;  3ZKB A;  1XMQ I;  1N0V C;  4HXZ A;  4X66 E;  4JI5 E;  4LF7 E;  4LF8 E;  1H7U A;  2C37 B;  1A6F A;  4DV7 I;  5JEA D;  4NXN I;  2IOQ A;  4URL A;  4AID A;  3V5R A;  3PYE A;  4I3H A;  1ZM9 A;  3JAM C;  1NZ0 A;  3K85 A;  4NXM E;  2UXC I;  2F1D A;  1ZM4 A;  1YHC A;  2PO2 A;  3LNU A;  5JEA E;  1E3H A;  1KVK A;  2HFU A;  1Z5C A;  5EKW A;  1N32 I;  2HHH E;  1QZR A;  1HNW E;  4LF5 E;  4FW4 A;  3U1Y A;  2UXB I;  2R3V A;  4JI3 E;  2GO4 A;  4DV6 E;  5A2Q C;  2BA0 D;  4LCF A;  4KHP E;  2JEB A;  3CWV A;  3QT5 A;  1HNZ I;  1XHK A;  1KIJ A;  2A2C A;  1H72 C;  4JI4 E;  2F4V I;  1J5E I;  1N0U A;  4DR5 E;  2J7K A;  2E5L I;  2CZ9 A;  4P7A A;  2BR2 A;  4AIM A;  4FW6 A;  3P06 A;  2IER A;  4DV4 E;  2WP8 A;  3PS2 A;  2VQF I;  4B3S E;  4K0K E;  1UEK A;  4DR4 I;  4MYU A;  2CGE A;  5EL9 A;  4BA1 B;  2PNL A;  5A2Q Q;  4OO1 D;  1N36 E;  3M85 D;  3ZZT A;  3OTO E;  1ZM2 A;  3F0N A;  4B3M I;  1HK7 A;  4USK A;  2NPF A;  4JI3 I;  4FWH A;  3P3E A;  4IZK A;  3GLL A;  4LF4 I;  4GKK E;  1NHI A;  3ZM7 A;  2NN6 E;  4DPT A;  4KHP I;  4FW3 A;  4DV2 E;  1UDQ A;  2NN6 D;  2HKJ A;  5LMN I;  2F4V E;  4DUZ E;  4PRV A;  1J5E E;  1XNR I;  2O3Z A;  3H1C A;  1Y6Z A;  2IOP A;  2PNM A;  2Q2E B;  4WUC A;  1XNQ I;  3Q6M A;  1N33 E;  1Z0V A;  4DR3 I;  3P3C A;  2Z5C B;  4B3T I;  3T1H I;  4OKG A;  4LF6 I;  4EMD A;  4X66 I;  5FLX Q;  1HNX I;  4JI5 I;  4OX9 E;  4JI1 I;  4BA1 A;  3M7N D;  4DV7 E;  4XTJ A;  1R6M A;  4NXN E;  1HR0 E;  5DRP A;  3OTO I;  2R42 A;  4U3D A;  1B63 A;  4JV5 E;  4DR2 E;  5JEA F;  4DPW A;  4IZJ D;  5L3J A;  1IBM E;  4X64 E;  4FW5 A;  1S16 A;  4IFD C;  2V34 A;  1H74 A;  4LF9 I;  3WU4 A;  5FLX C;  1VI7 A;  1Z5B A;  3PYG A;  1MX0 A;  4JI0 E;  4JI4 I;  1IBK E;  1USU A;  2GO3 A;  4B3T E;  1R6L A;  4WUD A;  3UHM A;  2WP8 B;  2UXD I;  2JE6 A;  4B3R I;  1PIE A;  4HYM A;  1EI1 A;  2UXC E;  1S4E A;  5LL6 R;  4JI1 E;  4DV1 E;  4IZJ B;  2ZM6 E;  1XMO E;  4R1F A;  2NN6 A;  3JAM Q;  4HAC B;  1Z0C A;  5K36 B;  4X65 E;  5C0X B;  4K0K I;  1KTV A;  1UDN A;  4DR4 E;  3PRY A;  2OI2 A;  4DU7 A;  3QT6 A;  2JEB B;  1FJG E;  2C37 A;  3J81 Q;  4GKJ I;  1N34 I;  3M6A A;  1UDO A;  5K36 E;  1HNZ E;  1Y60 A;  2IES A;  4IFD E;  4JI2 E;  1D6T A;  2VES A;  4BA2 B;  3L7Z B;  4JYA I;  5LMN E;  1IBK I;  4QNK A;  2UXD E;  1XNR E;  2E1R A;  4AQY I;  4DV5 E;  1XMQ E;  2PNZ A;  2JEA B;  4ZVI A;  4IZJ A;  1Y4U A;  1IBL E;  2GQ0 A;  5FWK A;  2AE8 A;  1VIS A;  1E3P A;  2JE6 B;  5IWA E;  4IZK B;  3CDI A;  4USM A;  3GCM A;  2LJP A;  1FJG I;  4YY3 E;  4U3B A;  4MU0 A;  1N34 E;  3PYD A;  4GKK I;  4QNJ A;  1FI4 A;  4FN5 A;  1ZXM A;  2WNR B;  4DV2 I;  5JEA C;  1OYP A;  3V2U C;  1N32 E;  1Z5A A;  3GME A;  5C0X D;  1NHH A;  4DR2 I;  2UXB E;  2Z5E A;  3KRN A;  1FWK A;  2GS8 A;  4DR6 E;  4PRX A;  2C38 B;  5C0X E;  1YH8 A;  1Y5Y A;  3B4T A;  4AQY E;  4DV3 E;  2Z5B B;  4DPX A;  4DV5 I;  5BR8 I;  3B8H A;  2V2V A;  3DD6 A;  4DR5 I;  4J3D A;  3ZZ0 A;  4JI0 I;  4IFD B;  4UTG A;  4M1K A;  5IWA I;  2UUC I;  4GQU A;  4P52 A;  3J7A M;  4JI6 E;  2A2D A;  1RHY A;  1ZXN A;  4OO1 E;  4Z7Y A;  2BA1 D;  4IFD A;  5DRO A;  3WU6 A;  4JV5 I;  2DEJ A;  1Z0B A;  2ZM6 I;  4JG4 A;  1XMO I;  1OJ4 A;  1PKP A;  1Z0E A;  2BR2 B;  4LFC E;  1Z0G A;  2PO0 A;  4LOM A;  2PO2 B;  1N36 I;  2VQE I;  1MG7 A;  1MU5 A;  5GME A;  2X36 A;  4OO1 B;  4MDT A;  3ZKD A;  1USV A;  4RPF A;  4LF9 E;  5C0X C;  4OO1 C;  4LCH A;  2V8P A;  5IT9 C;  2J65 A;  1OYS A;  4DV3 I;  1K47 A;  4IFD F;  5BR8 E;  4JI2 I;  4Z7C A;  5K36 F;  4DR7 E;  3H4L A;  4KQV A;  1NHJ A;  4X62 E;  5K36 D;  1RR9 A;  5LMU E;  1Z0W A;  3B78 A;  4NBQ A;  2UUB I;  2UUA I;  4LPF A;  3WU5 A;  2HKE A;  5C0X A;  3T1H E;  4LFC I;  2C39 B;  2HFS A;  4GKJ E;  3ZZU A;  2DEI A;  5DNL A;  2VQE E;  2HK2 A;  2Z5C A;  1H73 A;  3M7N G;  4LCG A;  3D4J A;  2V2Z A;  1FNM A;  3L7Z A;  2BM0 A;  2ZBK B;  3PS3 A;  4DV0 E;  2PNZ B;  3T1Y I;  2JEA A;  4OO1 F;  4IFD D;  5ELW A;  5JEA B;  4X62 I;  5K36 C;  4JI8 I;  2UU9 E;  4JI7 I;  4IS9 A;  1KKH A;  4ISA A;  2XEX A;  1IBL I;  4ED4 A;  2CG9 A;  4BA2 A;  4B3S I;  4B3R E;  1BKN A;  4LF7 I;  4FW7 A;  4DUY E;  4LF8 I;  5C0X F;  4DXL A;  4DV1 I;  4WUB A;  1I94 E;  1XXE A;  4LFA E;  4DPU A;  4MQY A;  1U2R A;  5DNX A;  4JI6 I;  4NXM I;  4DU8 A;  4B3M E;  3LTO A;  4X65 I;  1DAR A;  3U1K A;  5K36 A;  1Z0T A;  2C38 A;  3LPS A;  3GON A;  3HUL A;  4DR6 I;  1P42 A;  4DUZ I;  2EFG A;  3K1J A;  4FW9 A;  4LF5 I;  2PO1 A;  2CVE A;  2WW4 A;  4JI7 E;  4JI8 E;  3HKM A;  4PU9 A;  3CDJ A;  4DR1 E;  2X7I A;  1PVG A;  2NN6 F;  4MU4 A;  1ELO A;  1N33 I;  2BA1 G;  4MU3 A;  4LF6 E;  4OX9 I;  3J81 C;  4DR7 I;  2PO0 B;  1I94 I;  5DRQ A;  5LMU I;  2O1U A;  4MYT A;  1HR0 I;  3NZK A;  3QT8 A;  2O1T A;  4FWG A;  2AJ4 A;  2UUA E;  2JT2 A;  3P76 A;  4YY3 I;  4DV6 I;  2BV3 A;  1Y4S A;  5GMD A;  4LFB E;  5JEA A;  3Q6N A;  2Z5B A;  1UDS A;  1FKA E;  4AM3 A;  4X64 I;  2PO1 B;  4DR1 I;  3J80 C;  2V2Q A;  1Z59 A;  5IT9 Q;  2E5L E;  2NN6 C;  4DV0 I;  4YHH E;  2UUB E;  4DV4 I;  3PS1 A;  2VQF E;  4HAC A;  2UU9 I;  2NN6 B;  2VF3 A;  3B82 A;  2ZIT A;  3WU3 A;  2C39 A; 
#chains in the Genus database with same CATH homology
 1UDQ A;  2NN6 D;  2PNZ B;  2JEA A;  4OO1 F;  1E3P A;  2JE6 B;  1OYR A;  3CDI A;  3GCM A;  4IFD D;  3H1C A;  5JEA B;  5K36 C;  2WNR B;  4BA2 A;  5JEA C;  2BA0 G;  1OYP A;  5C0X D;  2WNR A;  3GME A;  5C0X F;  4BA1 A;  3M7N D;  3KRN A;  3M85 G;  2C38 B;  1R6M A;  5C0X E;  4OO1 A;  3B4T A;  3U1K A;  5K36 A;  3DD6 A;  2C38 A;  5JEA F;  2C37 B;  5JEA D;  4IFD B;  4AID A;  2PO1 A;  4OO1 E;  2BA1 D;  4IFD A;  4IFD C;  3HKM A;  2PO2 A;  3CDJ A;  2NN6 F;  2BR2 B;  5JEA E;  2PO0 A;  2BA1 G;  1E3H A;  2PO2 B;  1R6L A;  2WP8 B;  2JE6 A;  4OO1 B;  2PO0 B;  2BA0 D;  5C0X C;  2JEB A;  2NN6 A;  4OO1 C;  1OYS A;  5K36 B;  4IFD F;  5C0X B;  1UDN A;  5K36 F;  2JEB B;  5K36 D;  2C37 A;  2BR2 A;  4AIM A;  5JEA A;  4NBQ A;  1UDO A;  5K36 E;  2WP8 A;  1UDS A;  4AM3 A;  2C39 A;  2PO1 B;  4IFD E;  5C0X A;  4BA2 B;  2C39 B;  3L7Z B;  4BA1 B;  2NN6 C;  4OO1 D;  3M85 D;  3M7N G;  2NN6 B;  3GLL A;  2PNZ A;  2JEA B;  3L7Z A;  2NN6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...