4OO1E

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
255
Chain Sequence
SLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 60
structure length 255
sequence length 263
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1E00
2PNZA 4IFDF 2NN6A 4IFDE 5C0XF 4IFDA 5C0XE 2NN6D 3CDJA 3HKMA 1R6LA 5C0XA 2PNZB 2PO1A 2NN6B 3M7NG 3GLLA 1UDNA 2BR2A 2PO1B 2JEBA 3M85G 1UDQA 3DD6A 2C39A 2NN6C 5JEAD 4IFDC 4NBQA 4AM3A 2NN6F 2NN6E 5C0XC 3M7ND 2C39B 5JEAB 2BA0D 1OYRA 3GCMA 2C38A 1UDSA 1E3HA 2C38B 3U1KA 4BA1A 5JEAF 5JEAE 5K36D 5JEAA 2JE6A 5K36B 4AIMA 4BA1B 2JE6B 2JEAA 1OYSA 1R6MA 3M85D 4BA2A 3KRNA 5K36C 2JEAB 1OYPA 3H1CA 1E3PA 3CDIA 5K36F 5K36E 2BA1G 5JEAC 4OO1D 4BA2B 2PO0B 5K36A 2WP8A 4OO1B 3GMEA 1UDOA 2C37A 3B4TA 4AIDA 2WP8B 4IFDD 5C0XD 2BA0G 2WNRA 2C37B 4IFDB 2BA1D 4OO1C 5C0XB 2PO0A 2PO2A 4OO1F 4OO1E 3L7ZA 2WNRB 4OO1A 2BR2B 2PO2B 2JEBB 3L7ZB
chains in the Genus database with same CATH superfamily
2PNZA 4JI8E 4U3BA 4USMA 4LF4E 4IFDA 2O3ZA 4K0KI 1FJGI 3HKMA 5DRPA 4J3DA 1FNMA 2PO1A 2Z5CA 3M7NG 2Z5BA 2O1TA 4OZEA 1H73A 4MQYA 3B78A 4LCHA 2A2DA 4DV2E 4DV5I 1OJ4A 2VESA 2F1DA 4DR5E 2O1UA 2C39A 3PYEA 3LTOA 4JI5E 4KHPE 5JEAD 4JI2I 4IFDC 1KKHA 2VQEE 1XMOE 3M7ND 2J7KA 4DR1E 1FWLA 4HACA 1YHCA 4DPWA 3K17A 5DROA 5GMDA 4DV4I 4YY3I 4LF5I 4LF6E 4OX9I 1Z0VA 1XXEA 2V2ZA 4X62I 1B62A 5JEAF 1IBLI 5DRRA 2JE6A 2E1RA 5IWAI 1XNQI 4AQYI 4JI6I 1USUA 4FWGA 4RPFA 1USVA 1HNWI 1IBKE 4K0KE 4X64E 2UUAE 1FJGE 5IT9C 2HFUA 3OTOI 1R6MA 1IBMI 4QNKA 3KRNA 2PNLA 4YHHI 3H1CA 4JYAI 5K36E 4MU3A 3QT6A 4DV5E 2V34A 1ZM2A 2PO0B 4LF9I 4R1FA 4JI2E 1Z5AA 3B4TA 3F0NA 2J65A 3CWVA 5LL6R 1RR9A 1U2RA 2UXCI 5FLXQ 2EFGA 2IOPA 3LNUA 2C37B 4IFDB 1B63A 1Z0TA 4DV7E 4NXNE 3ZKDA 1Z0EA 4OO1E 4KQVA 4JI4E 3ZZTA 3HULA 4DV1E 3L7ZB 2AJ4A 1MX0A 1FKAE 4X65E 4WUDA 4WUCA 4LFCI 1XNQE 4MYTA 4AQYE 5C0XE 4DR7I 3CDJA 1R6LA 4MYUA 2NN6B 1H72C 3OTOE 1IBME 1NHIA 2UXBE 1I94I 4JYAE 4P7AA 3PYDA 2Z5EA 4JI1I 3ZM7A 4LF9E 4ED4A 4NBQA 3T1HI 3ZKBA 1XMQI 2BA0D 2VQFI 1ELOA 4JV5I 1ZM4A 1J5EE 5A2QQ 2UXCE 4JI3I 4Z7YA 3WU6A 4DR2E 3ZZ0A 1E3HA 1KVKA 1HK7A 1HNXI 4DPXA 2C38B 5K36D 3NZKA 5JEAA 1RHYA 2UXDI 3Q6MA 2CZ9A 1FWKA 5FWKA 4BA1B 4JI7I 4LPFA 5EL9A 4LF7E 4FW4A 2AE8A 1N36E 3JAMQ 5BR8E 2F4VE 1Y4SA 2JEAA 4NXMI 3PRYA 1PVGA 3J81Q 4B3MI 4DPTA 2UU9I 1Z0CA 4BA2A 5K36C 1OYPA 1QZRA 3J7AM 2IERA 2BM1A 5DNLA 5K36F 4LCFA 3U1YA 5JEAC 2HK3A 4OO1D 4DR4E 1I94E 4LF8I 4LFBE 2WP8A 2HFSA 4FW9A 4B3TI 1XMQE 2HHHI 1N33I 1NZ0A 2ZM6I 4DV6I 3T1YI 2VQFE 5C0XD 3H4LA 1S4EA 2E5LI 2WNRA 1HR0I 1DARA 5GMEA 3J80Q 4OO1C 1Z0BA 4JI3E 2V8PA 2UUBI 4QNJA 2PO2A 3PYFA 4OO1F 4IZJD 4DV3I 3HJCA 3UHMA 2O1WA 4ISAA 4DUZI 2ZITA 2UXDE 4IFDE 4DV0I 2R3VA 5C0XF 3PS3A 4X66I 2PNZB 5FLXC 2V2QA 2GQ0A 4IZKA 2CVEA 4LFAI 2WW4A 1XNRI 4N3OA 3D4JA 3QT7A 1N0VC 2PO1B 4DV4E 2Z5CB 4YY3E 1Z59A 2JEBA 2Z5BB 3M85G 4DPUA 1YH8A 1UDQA 3B82A 5LMUI 4LF5E 4OX9E 3DD6A 4GKKI 4LCGA 4X62E 4DUYI 4LF8E 4OKGA 4JI8I 1IBLE 4DU7A 4LF4I 2NN6E 3QT8A 2C39B 5JEAB 5IWAE 2HHHE 2BM0A 4JI6E 4FWDA 2ZM6E 4DV6E 3K1JA 2LJPA 3P3CA 4FW5A 1HNWE 3GCMA 4I3HA 4URLA 4JI0I 3B8HA 4DV2I 2V2VA 1HR0E 1UDSA 4HACB 2XEXA 4DR5I 2DEIA 1HNZI 4YHHE 4HY1A 4B3SI 4JI5I 1Z5BA 1Z5CA 5DRQA 4GKJI 4MDTA 4AIMA 4UTGA 1K47A 2X7IA 4DR6I 4WUBA 4UT4A 3P3GA 2JE6B 1NHJA 2GO4A 1H7SA 2VF3A 5A2QC 4X66E 1S16A 3J7AG 1MG7A 2GS8A 3CDIA 2BA1G 4LOMA 5K36A 5LMUE 1N32I 4FN5A 4ZVIA 4DUYE 5EKWA 3GMEA 1Y6ZA 3WU3A 1D6TA 3WU5A 4PU9A 5LMNI 2C37A 1IBKI 4X64I 2UUAI 4AIDA 3JAMC 4IFDD 4LFCE 4DR7E 2R42A 3J81C 1PKPA 1FI4A 4DU8A 2BA1D 4JI0E 4FWHA 3PS1A 1ZXNA 3L7ZA 4IZKB 4OO1A 3P76A 5L3JA 1HNZE 1Y60A 1KIJA 4B3SE 3GONA 2JEBB 1N0UA 2O1VA 1H7UA 4JI1E 1KTVA 4HXZA 4GKJE 3Q6NA 3K85A 4IFDF 2NN6A 4MU0A 3LPSA 4DR6E 2IESA 2NN6D 3T1HE 1RREA 5C0XA 4P52A 4DR3I 4HYMA 1ZXMA 1PIEA 1VISA 4JV5E 4DV7I 3GLLA 1EA6A 3M6AA 4NXNI 3ZZUA 3J80C 1UDNA 1N34I 2GO3A 4IZJA 4XTJA 2BR2A 4JI4I 4Z7CA 1VI7A 4B3RI 2IOQA 2HKEA 1HNXE 4PRXA 4FW7A 4DV1I 1P42A 3P3EA 1Z0WA 4MU1A 1N32E 2NN6C 4X65I 5DNXA 2Q2EB 4AM3A 2NN6F 3V5RA 5C0XC 1H74A 5LMNE 1ZM9A 1OYRA 5ELWA 1XHKA 1WUUA 2CG9A 4JI7E 4IS9A 1Y4UA 4JG4A 1A6FA 4PRVA 5IT9Q 2PNMA 2C38A 4NXME 4DXLA 2HK2A 2UXBI 4B3ME 2UU9E 2BV3A 2ZBKB 4FW3A 3U1KA 4GQUA 4BA1A 5JEAE 2UUCI 1Y5YA 4M1KA 5K36B 1EI1A 4USKA 4DPYA 2CGEA 1BKNA 1J5EI 1ZM3A 4B3TE 1OYSA 1N33E 1UEKA 4EMDA 4DR2I 4DR3E 3T1YE 1MU5A 3V2UC 3Q1QA 2X36A 3M85D 3QT5A 2E5LE 4FW6A 2JEAB 1N34E 1E3PA 2UUBE 4B3RE 4BA2B 4DV3E 2JT2A 4KHPI 2A2CA 2VQEI 4OO1B 1XMOI 4LF7I 4DUZE 1N36I 1UDOA 1NHHA 3P06A 3WU4A 5BR8I 2F4VI 4DR1I 1Z0GA 2WP8B 4DV0E 2OI2A 2BA0G 4U3DA 4MU4A 2DEJA 5C0XB 4LF6I 2PO0A 3PYGA 3PS2A 4LFAE 1XNRE 4DR4I 2WNRB 4LFBI 4IZJB 2NPFA 2BR2B 2HKJA 2PO2B 4GKKE 2UUCE
chains in the Genus database with same CATH topology
2PNZA 4IFDF 2NN6A 4IFDE 5C0XF 4IFDA 5C0XE 2NN6D 3CDJA 3HKMA 1R6LA 5C0XA 2PNZB 2PO1A 2NN6B 3M7NG 3GLLA 1UDNA 2BR2A 2PO1B 2JEBA 3M85G 1UDQA 3DD6A 2C39A 2NN6C 5JEAD 4IFDC 4NBQA 4AM3A 2NN6F 2NN6E 5C0XC 3M7ND 2C39B 5JEAB 2BA0D 1OYRA 3GCMA 2C38A 1UDSA 1E3HA 2C38B 3U1KA 4BA1A 5JEAF 5JEAE 5K36D 5JEAA 2JE6A 5K36B 4AIMA 4BA1B 2JE6B 2JEAA 1OYSA 1R6MA 3M85D 4BA2A 3KRNA 5K36C 2JEAB 1OYPA 3H1CA 1E3PA 3CDIA 5K36F 5K36E 2BA1G 5JEAC 4OO1D 4BA2B 2PO0B 5K36A 2WP8A 4OO1B 3GMEA 1UDOA 2C37A 3B4TA 4AIDA 2WP8B 4IFDD 5C0XD 2BA0G 2WNRA 2C37B 4IFDB 2BA1D 4OO1C 5C0XB 2PO0A 2PO2A 4OO1F 4OO1E 3L7ZA 2WNRB 4OO1A 2BR2B 2PO2B 2JEBB 3L7ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNZ A;  4IFD F;  2NN6 A;  4IFD E;  5C0X F;  4IFD A;  5C0X E;  2NN6 D;  3CDJ A;  3HKM A;  1R6L A;  5C0X A;  2PNZ B;  2PO1 A;  2NN6 B;  3M7N G;  3GLL A;  1UDN A;  2BR2 A;  2PO1 B;  2JEB A;  3M85 G;  1UDQ A;  3DD6 A;  2C39 A;  2NN6 C;  5JEA D;  4IFD C;  4NBQ A;  4AM3 A;  2NN6 F;  2NN6 E;  5C0X C;  3M7N D;  2C39 B;  5JEA B;  2BA0 D;  1OYR A;  3GCM A;  2C38 A;  1UDS A;  1E3H A;  2C38 B;  3U1K A;  4BA1 A;  5JEA F;  5JEA E;  5K36 D;  5JEA A;  2JE6 A;  5K36 B;  4AIM A;  4BA1 B;  2JE6 B;  2JEA A;  1OYS A;  1R6M A;  3M85 D;  4BA2 A;  3KRN A;  5K36 C;  2JEA B;  1OYP A;  3H1C A;  1E3P A;  3CDI A;  5K36 F;  5K36 E;  2BA1 G;  5JEA C;  4OO1 D;  4BA2 B;  2PO0 B;  5K36 A;  2WP8 A;  4OO1 B;  3GME A;  1UDO A;  2C37 A;  3B4T A;  4AID A;  2WP8 B;  4IFD D;  5C0X D;  2BA0 G;  2WNR A;  2C37 B;  4IFD B;  2BA1 D;  4OO1 C;  5C0X B;  2PO0 A;  2PO2 A;  4OO1 F;  4OO1 E;  3L7Z A;  2WNR B;  4OO1 A;  2BR2 B;  2PO2 B;  2JEB B;  3L7Z B; 
#chains in the Genus database with same CATH topology
 2PNZ A;  4JI8 E;  4U3B A;  4USM A;  4LF4 E;  4IFD A;  2O3Z A;  4K0K I;  1FJG I;  3HKM A;  5DRP A;  4J3D A;  1FNM A;  2PO1 A;  2Z5C A;  3M7N G;  2Z5B A;  2O1T A;  4OZE A;  1H73 A;  4MQY A;  3B78 A;  4LCH A;  2A2D A;  4DV2 E;  4DV5 I;  1OJ4 A;  2VES A;  2F1D A;  4DR5 E;  2O1U A;  2C39 A;  3PYE A;  3LTO A;  4JI5 E;  4KHP E;  5JEA D;  4JI2 I;  4IFD C;  1KKH A;  2VQE E;  1XMO E;  3M7N D;  2J7K A;  4DR1 E;  1FWL A;  4HAC A;  1YHC A;  4DPW A;  3K17 A;  5DRO A;  5GMD A;  4DV4 I;  4YY3 I;  4LF5 I;  4LF6 E;  4OX9 I;  1Z0V A;  1XXE A;  2V2Z A;  4X62 I;  1B62 A;  5JEA F;  1IBL I;  5DRR A;  2JE6 A;  2E1R A;  5IWA I;  1XNQ I;  4AQY I;  4JI6 I;  1USU A;  4FWG A;  4RPF A;  1USV A;  1HNW I;  1IBK E;  4K0K E;  4X64 E;  2UUA E;  1FJG E;  5IT9 C;  2HFU A;  3OTO I;  1R6M A;  1IBM I;  4QNK A;  3KRN A;  2PNL A;  4YHH I;  3H1C A;  4JYA I;  5K36 E;  4MU3 A;  3QT6 A;  4DV5 E;  2V34 A;  1ZM2 A;  2PO0 B;  4LF9 I;  4R1F A;  4JI2 E;  1Z5A A;  3B4T A;  3F0N A;  2J65 A;  3CWV A;  5LL6 R;  1RR9 A;  1U2R A;  2UXC I;  5FLX Q;  2EFG A;  2IOP A;  3LNU A;  2C37 B;  4IFD B;  1B63 A;  1Z0T A;  4DV7 E;  4NXN E;  3ZKD A;  1Z0E A;  4OO1 E;  4KQV A;  4JI4 E;  3ZZT A;  3HUL A;  4DV1 E;  3L7Z B;  2AJ4 A;  1MX0 A;  1FKA E;  4X65 E;  4WUD A;  4WUC A;  4LFC I;  1XNQ E;  4MYT A;  4AQY E;  5C0X E;  4DR7 I;  3CDJ A;  1R6L A;  4MYU A;  2NN6 B;  1H72 C;  3OTO E;  1IBM E;  1NHI A;  2UXB E;  1I94 I;  4JYA E;  4P7A A;  3PYD A;  2Z5E A;  4JI1 I;  3ZM7 A;  4LF9 E;  4ED4 A;  4NBQ A;  3T1H I;  3ZKB A;  1XMQ I;  2BA0 D;  2VQF I;  1ELO A;  4JV5 I;  1ZM4 A;  1J5E E;  5A2Q Q;  2UXC E;  4JI3 I;  4Z7Y A;  3WU6 A;  4DR2 E;  3ZZ0 A;  1E3H A;  1KVK A;  1HK7 A;  1HNX I;  4DPX A;  2C38 B;  5K36 D;  3NZK A;  5JEA A;  1RHY A;  2UXD I;  3Q6M A;  2CZ9 A;  1FWK A;  5FWK A;  4BA1 B;  4JI7 I;  4LPF A;  5EL9 A;  4LF7 E;  4FW4 A;  2AE8 A;  1N36 E;  3JAM Q;  5BR8 E;  2F4V E;  1Y4S A;  2JEA A;  4NXM I;  3PRY A;  1PVG A;  3J81 Q;  4B3M I;  4DPT A;  2UU9 I;  1Z0C A;  4BA2 A;  5K36 C;  1OYP A;  1QZR A;  3J7A M;  2IER A;  2BM1 A;  5DNL A;  5K36 F;  4LCF A;  3U1Y A;  5JEA C;  2HK3 A;  4OO1 D;  4DR4 E;  1I94 E;  4LF8 I;  4LFB E;  2WP8 A;  2HFS A;  4FW9 A;  4B3T I;  1XMQ E;  2HHH I;  1N33 I;  1NZ0 A;  2ZM6 I;  4DV6 I;  3T1Y I;  2VQF E;  5C0X D;  3H4L A;  1S4E A;  2E5L I;  2WNR A;  1HR0 I;  1DAR A;  5GME A;  3J80 Q;  4OO1 C;  1Z0B A;  4JI3 E;  2V8P A;  2UUB I;  4QNJ A;  2PO2 A;  3PYF A;  4OO1 F;  4IZJ D;  4DV3 I;  3HJC A;  3UHM A;  2O1W A;  4ISA A;  4DUZ I;  2ZIT A;  2UXD E;  4IFD E;  4DV0 I;  2R3V A;  5C0X F;  3PS3 A;  4X66 I;  2PNZ B;  5FLX C;  2V2Q A;  2GQ0 A;  4IZK A;  2CVE A;  4LFA I;  2WW4 A;  1XNR I;  4N3O A;  3D4J A;  3QT7 A;  1N0V C;  2PO1 B;  4DV4 E;  2Z5C B;  4YY3 E;  1Z59 A;  2JEB A;  2Z5B B;  3M85 G;  4DPU A;  1YH8 A;  1UDQ A;  3B82 A;  5LMU I;  4LF5 E;  4OX9 E;  3DD6 A;  4GKK I;  4LCG A;  4X62 E;  4DUY I;  4LF8 E;  4OKG A;  4JI8 I;  1IBL E;  4DU7 A;  4LF4 I;  2NN6 E;  3QT8 A;  2C39 B;  5JEA B;  5IWA E;  2HHH E;  2BM0 A;  4JI6 E;  4FWD A;  2ZM6 E;  4DV6 E;  3K1J A;  2LJP A;  3P3C A;  4FW5 A;  1HNW E;  3GCM A;  4I3H A;  4URL A;  4JI0 I;  3B8H A;  4DV2 I;  2V2V A;  1HR0 E;  1UDS A;  4HAC B;  2XEX A;  4DR5 I;  2DEI A;  1HNZ I;  4YHH E;  4HY1 A;  4B3S I;  4JI5 I;  1Z5B A;  1Z5C A;  5DRQ A;  4GKJ I;  4MDT A;  4AIM A;  4UTG A;  1K47 A;  2X7I A;  4DR6 I;  4WUB A;  4UT4 A;  3P3G A;  2JE6 B;  1NHJ A;  2GO4 A;  1H7S A;  2VF3 A;  5A2Q C;  4X66 E;  1S16 A;  3J7A G;  1MG7 A;  2GS8 A;  3CDI A;  2BA1 G;  4LOM A;  5K36 A;  5LMU E;  1N32 I;  4FN5 A;  4ZVI A;  4DUY E;  5EKW A;  3GME A;  1Y6Z A;  3WU3 A;  1D6T A;  3WU5 A;  4PU9 A;  5LMN I;  2C37 A;  1IBK I;  4X64 I;  2UUA I;  4AID A;  3JAM C;  4IFD D;  4LFC E;  4DR7 E;  2R42 A;  3J81 C;  1PKP A;  1FI4 A;  4DU8 A;  2BA1 D;  4JI0 E;  4FWH A;  3PS1 A;  1ZXN A;  3L7Z A;  4IZK B;  4OO1 A;  3P76 A;  5L3J A;  1HNZ E;  1Y60 A;  1KIJ A;  4B3S E;  3GON A;  2JEB B;  1N0U A;  2O1V A;  1H7U A;  4JI1 E;  1KTV A;  4HXZ A;  4GKJ E;  3Q6N A;  3K85 A;  4IFD F;  2NN6 A;  4MU0 A;  3LPS A;  4DR6 E;  2IES A;  2NN6 D;  3T1H E;  1RRE A;  5C0X A;  4P52 A;  4DR3 I;  4HYM A;  1ZXM A;  1PIE A;  1VIS A;  4JV5 E;  4DV7 I;  3GLL A;  1EA6 A;  3M6A A;  4NXN I;  3ZZU A;  3J80 C;  1UDN A;  1N34 I;  2GO3 A;  4IZJ A;  4XTJ A;  2BR2 A;  4JI4 I;  4Z7C A;  1VI7 A;  4B3R I;  2IOQ A;  2HKE A;  1HNX E;  4PRX A;  4FW7 A;  4DV1 I;  1P42 A;  3P3E A;  1Z0W A;  4MU1 A;  1N32 E;  2NN6 C;  4X65 I;  5DNX A;  2Q2E B;  4AM3 A;  2NN6 F;  3V5R A;  5C0X C;  1H74 A;  5LMN E;  1ZM9 A;  1OYR A;  5ELW A;  1XHK A;  1WUU A;  2CG9 A;  4JI7 E;  4IS9 A;  1Y4U A;  4JG4 A;  1A6F A;  4PRV A;  5IT9 Q;  2PNM A;  2C38 A;  4NXM E;  4DXL A;  2HK2 A;  2UXB I;  4B3M E;  2UU9 E;  2BV3 A;  2ZBK B;  4FW3 A;  3U1K A;  4GQU A;  4BA1 A;  5JEA E;  2UUC I;  1Y5Y A;  4M1K A;  5K36 B;  1EI1 A;  4USK A;  4DPY A;  2CGE A;  1BKN A;  1J5E I;  1ZM3 A;  4B3T E;  1OYS A;  1N33 E;  1UEK A;  4EMD A;  4DR2 I;  4DR3 E;  3T1Y E;  1MU5 A;  3V2U C;  3Q1Q A;  2X36 A;  3M85 D;  3QT5 A;  2E5L E;  4FW6 A;  2JEA B;  1N34 E;  1E3P A;  2UUB E;  4B3R E;  4BA2 B;  4DV3 E;  2JT2 A;  4KHP I;  2A2C A;  2VQE I;  4OO1 B;  1XMO I;  4LF7 I;  4DUZ E;  1N36 I;  1UDO A;  1NHH A;  3P06 A;  3WU4 A;  5BR8 I;  2F4V I;  4DR1 I;  1Z0G A;  2WP8 B;  4DV0 E;  2OI2 A;  2BA0 G;  4U3D A;  4MU4 A;  2DEJ A;  5C0X B;  4LF6 I;  2PO0 A;  3PYG A;  3PS2 A;  4LFA E;  1XNR E;  4DR4 I;  2WNR B;  4LFB I;  4IZJ B;  2NPF A;  2BR2 B;  2HKJ A;  2PO2 B;  4GKK E;  2UUC E; 
#chains in the Genus database with same CATH homology
 2PNZ A;  4IFD F;  2NN6 A;  4IFD E;  5C0X F;  4IFD A;  5C0X E;  2NN6 D;  3CDJ A;  3HKM A;  1R6L A;  5C0X A;  2PNZ B;  2PO1 A;  2NN6 B;  3M7N G;  3GLL A;  1UDN A;  2BR2 A;  2PO1 B;  2JEB A;  3M85 G;  1UDQ A;  3DD6 A;  2C39 A;  2NN6 C;  5JEA D;  4IFD C;  4NBQ A;  4AM3 A;  2NN6 F;  2NN6 E;  5C0X C;  3M7N D;  2C39 B;  5JEA B;  2BA0 D;  1OYR A;  3GCM A;  2C38 A;  1UDS A;  1E3H A;  2C38 B;  3U1K A;  4BA1 A;  5JEA F;  5JEA E;  5K36 D;  5JEA A;  2JE6 A;  5K36 B;  4AIM A;  4BA1 B;  2JE6 B;  2JEA A;  1OYS A;  1R6M A;  3M85 D;  4BA2 A;  3KRN A;  5K36 C;  2JEA B;  1OYP A;  3H1C A;  1E3P A;  3CDI A;  5K36 F;  5K36 E;  2BA1 G;  5JEA C;  4OO1 D;  4BA2 B;  2PO0 B;  5K36 A;  2WP8 A;  4OO1 B;  3GME A;  1UDO A;  2C37 A;  3B4T A;  4AID A;  2WP8 B;  4IFD D;  5C0X D;  2BA0 G;  2WNR A;  2C37 B;  4IFD B;  2BA1 D;  4OO1 C;  5C0X B;  2PO0 A;  2PO2 A;  4OO1 F;  4OO1 E;  3L7Z A;  2WNR B;  4OO1 A;  2BR2 B;  2PO2 B;  2JEB B;  3L7Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...