4OO1E

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
263
structure length
255
Chain Sequence
SLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 60
structure length 255
sequence length 263
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1E00
3GMEA 3M85D 4AM3A 2NN6D 5C0XB 2C37B 5C0XD 5JEAD 2BR2A 2PO0A 4IFDC 2C39B 4BA1A 3M7ND 2PNZB 4BA2A 3L7ZA 3CDIA 5K36B 3GLLA 2C38A 4OO1F 4IFDF 2JEBB 3DD6A 2WP8B 5K36E 2NN6F 1R6LA 5C0XF 4OO1C 2PO1B 2PO0B 5JEAF 4BA1B 3CDJA 4OO1A 4IFDA 2WNRB 1E3PA 1OYRA 2BA0G 2JEAA 2NN6C 4BA2B 3L7ZB 2NN6A 2JE6B 5K36D 5C0XC 2BA1G 5JEAC 2C38B 5C0XA 5JEAA 2PO2A 4NBQA 2C39A 3HKMA 4IFDD 1UDQA 1OYSA 2BR2B 3B4TA 3M85G 1OYPA 4IFDB 1UDOA 2JEBA 2NN6B 2WP8A 5K36F 3M7NG 4OO1E 4IFDE 2BA0D 2C37A 5JEAB 3KRNA 2PO2B 2PO1A 4AIMA 2BA1D 2NN6E 1R6MA 2WNRA 3H1CA 2PNZA 3U1KA 1UDSA 5K36C 1E3HA 4AIDA 5C0XE 5JEAE 5K36A 1UDNA 4OO1B 2JE6A 3GCMA 4OO1D 2JEAB
chains in the Genus database with same CATH superfamily
2F4VI 4IZJA 2UXDE 4B3RE 1Z59A 4LCFA 5A2QQ 2O3ZA 4UTGA 1B63A 4NXNE 4DU8A 4JI6I 4X62E 5JEAD 2BR2A 4IFDC 3LNUA 4M1KA 1RR9A 1K47A 4JI2E 3P3EA 3HULA 4DV1E 4NXME 2GS8A 4JI8E 4DR4I 4JI2I 5IWAI 2UUAE 4JI3I 4DR1E 1MX0A 2UU9I 5FWKA 4IZJB 4WUBA 4LF4E 1NZ0A 4LFCE 2NN6F 1J5EI 4RPFA 5IT9C 5LMUI 1N0UA 1Z0GA 1VISA 2HK2A 2PO1B 4JV5I 1PIEA 1EI1A 4PRVA 1E3PA 3T1HE 3PYEA 4IZKA 2ZBKB 2Q2EB 1XNRI 4LF5E 1MG7A 4FW4A 2NN6A 2A2DA 2JE6B 4LCHA 5K36D 2BA1G 1DARA 5JEAC 4DR6E 4Z7CA 1A6FA 2UUBI 2HKJA 3WU5A 4LF8I 1Z0VA 4OZEA 3B4TA 2V8PA 1XMQI 1FWKA 4DV7E 1Z0WA 1Z0EA 2PNLA 2Z5BA 4DR2I 4IZKB 2UUCI 1XNQI 4DV2I 5EL9A 2CG9A 1IBME 2NN6B 2ZITA 4JI5E 4GKKE 1Z5AA 1N36I 4OO1E 4LFAI 2C37A 1HNWI 3J7AG 5DRQA 2O1VA 4FW3A 1XMOE 2DEIA 3OTOE 3QT6A 1IBLI 4PU9A 2PNZA 3U1KA 4JI4I 5K36C 1QZRA 4KHPE 3Q1QA 2V2ZA 2O1UA 2V2VA 4DU7A 2EFGA 4X64E 2E1RA 2NPFA 4LFBE 4EMDA 2Z5BB 3P3GA 2CVEA 4IFDD 2AJ4A 3M85D 4FN5A 4JI0E 4YHHI 1H7UA 5C0XB 4JG4A 2C37B 5A2QC 5C0XD 3K17A 1ZM3A 4FW7A 1H72C 1Z0CA 4LPFA 3PS2A 4BA1A 4MU3A 4N3OA 2PNZB 2X36A 1YH8A 4LF7I 3L7ZA 3ZKBA 1N0VC 4MU1A 2E5LI 2UXBI 1HR0E 4QNJA 2JT2A 4OO1F 5LMNI 3P06A 1N32E 2WP8B 4MYTA 3WU3A 2HHHE 1FWLA 3PYGA 3Q6MA 2UXDI 2CZ9A 4B3RI 1R6LA 2Z5EA 4MDTA 4NXNI 4BA1B 3CDJA 4OO1A 3NZKA 3LTOA 4OX9E 4X62I 2VQEE 2JEAA 2BA0G 3QT5A 3L7ZB 3D4JA 3P3CA 4DV3E 5C0XC 2VQEI 4JI7E 1Y60A 3F0NA 4GQUA 3J81Q 4DV1I 4NXMI 3B82A 4DV5E 2GO4A 1N33E 4JI8I 5EKWA 4DV3I 2UUAI 2O1TA 4IZJD 2C39A 4DR1I 2Z5CA 1UDQA 4LF4I 4B3ME 1OYSA 4LFCI 4XTJA 2BR2B 3PYFA 3PRYA 3HJCA 2R42A 4HXZA 3ZKDA 2UXCE 3GONA 4USMA 4Z7YA 2R3VA 5BR8E 4U3BA 3J80Q 1MU5A 2JEBA 3T1HI 1HNZE 4MYUA 4LF5I 1FJGE 5BR8I 2OI2A 4HY1A 3KRNA 4ISAA 3PS3A 2GO3A 4DR6I 4DPYA 2IESA 4AIMA 1KTVA 2Z5CB 2WNRA 4DR5E 4B3TE 1Z0BA 4OKGA 2BV3A 2CGEA 5JEAE 4X66E 1UDNA 4HYMA 3WU4A 4K0KE 1VI7A 2ZM6E 4DV0E 4DUZE 4GKJE 4DV7I 4DR3E 4DUYE 1FKAE 1KKHA 2BM0A 4DV0I 4DUZI 2NN6D 4GKJI 1IBMI 5FLXQ 4AQYE 4JI5I 4JYAE 4GKKI 4MU0A 3ZZTA 3M7ND 1XMOI 1ZXMA 4DPUA 3OTOI 2V34A 1IBKE 4BA2A 1N34E 3LPSA 5DRPA 1HNXE 4FWGA 4X65E 2IERA 3GLLA 4KHPI 1XXEA 2C38A 1HNXI 4X64I 4QNKA 3DD6A 4LFBI 4J3DA 5K36E 1USUA 4PRXA 1ELOA 2J7KA 4LOMA 3ZZ0A 4YY3E 4JI0I 1S16A 5JEAF 4FW5A 4LF9E 4DPTA 2HFSA 1RHYA 1OYRA 2IOQA 2NN6C 5DNXA 4BA2B 2X7IA 2IOPA 4DPWA 4B3SE 4HACA 2C38B 1ZM4A 5JEAA 2PO2A 4U3DA 1U2RA 3J81C 4USKA 1HR0I 1YHCA 3UHMA 3V5RA 1ZXNA 1N32I 1Y4SA 3HKMA 5GMEA 4DV6E 1FI4A 2HHHI 1FNMA 3M85G 2F4VE 1OYPA 4DV6I 2HFUA 1UDOA 1NHHA 4OX9I 2XEXA 4JI6E 1BKNA 3J80C 2VQFE 4LCGA 5K36F 4HACB 4IFDE 3PS1A 5JEAB 1WUUA 2PO2B 1Y4UA 3QT8A 4JI7I 2GQ0A 2VQFI 2PO1A 1OJ4A 4WUCA 2BA1D 4DV5I 1KIJA 1N33I 4DR7E 3JAMQ 1S4EA 4DR4E 1UDSA 4LF6E 4FWDA 1H74A 5IWAE 1Y5YA 4URLA 5C0XE 5K36A 3ZM7A 4JI3E 2UU9E 4OO1B 4DR7I 2JE6A 3GCMA 4B3MI 4LF6I 3K1JA 1I94E 4OO1D 2JEAB 2AE8A 3GMEA 2UXCI 1J5EE 2BM1A 1Z5CA 1I94I 5LMUE 4AM3A 1B62A 4JI1E 4JV5E 1H73A 2DEJA 3QT7A 1HNZI 1Z0TA 3J7AM 2PO0A 5DROA 1FJGI 4JI1I 1NHJA 2C39B 5FLXC 1XNRE 1EA6A 1KVKA 1XHKA 3B8HA 3PYDA 4WUDA 3V2UC 4MU4A 3CDIA 5K36B 4B3TI 1USVA 4DR5I 1Z5BA 4ZVIA 4DPXA 2UUBE 4X66I 4IFDF 4K0KI 2JEBB 1PKPA 4LF8E 1Y6ZA 4I3HA 2ZM6I 4R1FA 3U1YA 5IT9Q 1XMQE 4DR3I 4DUYI 5C0XF 4OO1C 4DR2E 2PO0B 3ZZUA 4DXLA 2UUCE 1XNQE 3Q6NA 3M6AA 1ZM9A 4DV2E 4IFDA 4AQYI 2WNRB 4JYAI 3K85A 4KQVA 4P7AA 1P42A 1N36E 2O1WA 4LFAE 1HNWE 1UEKA 2J65A 5LL6R 1NHIA 1IBKI 1N34I 1RREA 5C0XA 1IBLE 2V2QA 1H7SA 4X65I 4FW9A 4IS9A 4NBQA 5DNLA 2WW4A 4JI4E 3CWVA 3H4LA 1ZM2A 4FWHA 5L3JA 4DV4E 4IFDB 4YY3I 2A2CA 2VESA 3B78A 3P76A 4YHHE 3WU6A 3T1YE 2VF3A 2F1DA 4DV4I 4LF9I 5GMDA 2WP8A 1HK7A 2PNMA 3M7NG 3T1YI 2BA0D 2HK3A 4ED4A 4FW6A 2HKEA 1PVGA 4MQYA 4B3SI 4LF7E 2NN6E 1R6MA 5ELWA 5DRRA 3H1CA 2E5LE 1D6TA 1E3HA 2LJPA 4AIDA 2UXBE 3JAMC 5LMNE 4UT4A 4P52A
chains in the Genus database with same CATH topology
3GMEA 3M85D 4AM3A 2NN6D 5C0XB 2C37B 5C0XD 5JEAD 2BR2A 2PO0A 4IFDC 2C39B 4BA1A 3M7ND 2PNZB 4BA2A 3L7ZA 3CDIA 5K36B 3GLLA 2C38A 4OO1F 4IFDF 2JEBB 3DD6A 2WP8B 5K36E 2NN6F 1R6LA 5C0XF 4OO1C 2PO1B 2PO0B 5JEAF 4BA1B 3CDJA 4OO1A 4IFDA 2WNRB 1E3PA 1OYRA 2BA0G 2JEAA 2NN6C 4BA2B 3L7ZB 2NN6A 2JE6B 5K36D 5C0XC 2BA1G 5JEAC 2C38B 5C0XA 5JEAA 2PO2A 4NBQA 2C39A 3HKMA 4IFDD 1UDQA 1OYSA 2BR2B 3B4TA 3M85G 1OYPA 4IFDB 1UDOA 2JEBA 2NN6B 2WP8A 5K36F 3M7NG 4OO1E 4IFDE 2BA0D 2C37A 5JEAB 3KRNA 2PO2B 2PO1A 4AIMA 2BA1D 2NN6E 1R6MA 2WNRA 3H1CA 2PNZA 3U1KA 1UDSA 5K36C 1E3HA 4AIDA 5C0XE 5JEAE 5K36A 1UDNA 4OO1B 2JE6A 3GCMA 4OO1D 2JEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GME A;  3M85 D;  4AM3 A;  2NN6 D;  5C0X B;  2C37 B;  5C0X D;  5JEA D;  2BR2 A;  2PO0 A;  4IFD C;  2C39 B;  4BA1 A;  3M7N D;  2PNZ B;  4BA2 A;  3L7Z A;  3CDI A;  5K36 B;  3GLL A;  2C38 A;  4OO1 F;  4IFD F;  2JEB B;  3DD6 A;  2WP8 B;  5K36 E;  2NN6 F;  1R6L A;  5C0X F;  4OO1 C;  2PO1 B;  2PO0 B;  5JEA F;  4BA1 B;  3CDJ A;  4OO1 A;  4IFD A;  2WNR B;  1E3P A;  1OYR A;  2BA0 G;  2JEA A;  2NN6 C;  4BA2 B;  3L7Z B;  2NN6 A;  2JE6 B;  5K36 D;  5C0X C;  2BA1 G;  5JEA C;  2C38 B;  5C0X A;  5JEA A;  2PO2 A;  4NBQ A;  2C39 A;  3HKM A;  4IFD D;  1UDQ A;  1OYS A;  2BR2 B;  3B4T A;  3M85 G;  1OYP A;  4IFD B;  1UDO A;  2JEB A;  2NN6 B;  2WP8 A;  5K36 F;  3M7N G;  4OO1 E;  4IFD E;  2BA0 D;  2C37 A;  5JEA B;  3KRN A;  2PO2 B;  2PO1 A;  4AIM A;  2BA1 D;  2NN6 E;  1R6M A;  2WNR A;  3H1C A;  2PNZ A;  3U1K A;  1UDS A;  5K36 C;  1E3H A;  4AID A;  5C0X E;  5JEA E;  5K36 A;  1UDN A;  4OO1 B;  2JE6 A;  3GCM A;  4OO1 D;  2JEA B; 
#chains in the Genus database with same CATH topology
 2F4V I;  4IZJ A;  2UXD E;  4B3R E;  1Z59 A;  4LCF A;  5A2Q Q;  2O3Z A;  4UTG A;  1B63 A;  4NXN E;  4DU8 A;  4JI6 I;  4X62 E;  5JEA D;  2BR2 A;  4IFD C;  3LNU A;  4M1K A;  1RR9 A;  1K47 A;  4JI2 E;  3P3E A;  3HUL A;  4DV1 E;  4NXM E;  2GS8 A;  4JI8 E;  4DR4 I;  4JI2 I;  5IWA I;  2UUA E;  4JI3 I;  4DR1 E;  1MX0 A;  2UU9 I;  5FWK A;  4IZJ B;  4WUB A;  4LF4 E;  1NZ0 A;  4LFC E;  2NN6 F;  1J5E I;  4RPF A;  5IT9 C;  5LMU I;  1N0U A;  1Z0G A;  1VIS A;  2HK2 A;  2PO1 B;  4JV5 I;  1PIE A;  1EI1 A;  4PRV A;  1E3P A;  3T1H E;  3PYE A;  4IZK A;  2ZBK B;  2Q2E B;  1XNR I;  4LF5 E;  1MG7 A;  4FW4 A;  2NN6 A;  2A2D A;  2JE6 B;  4LCH A;  5K36 D;  2BA1 G;  1DAR A;  5JEA C;  4DR6 E;  4Z7C A;  1A6F A;  2UUB I;  2HKJ A;  3WU5 A;  4LF8 I;  1Z0V A;  4OZE A;  3B4T A;  2V8P A;  1XMQ I;  1FWK A;  4DV7 E;  1Z0W A;  1Z0E A;  2PNL A;  2Z5B A;  4DR2 I;  4IZK B;  2UUC I;  1XNQ I;  4DV2 I;  5EL9 A;  2CG9 A;  1IBM E;  2NN6 B;  2ZIT A;  4JI5 E;  4GKK E;  1Z5A A;  1N36 I;  4OO1 E;  4LFA I;  2C37 A;  1HNW I;  3J7A G;  5DRQ A;  2O1V A;  4FW3 A;  1XMO E;  2DEI A;  3OTO E;  3QT6 A;  1IBL I;  4PU9 A;  2PNZ A;  3U1K A;  4JI4 I;  5K36 C;  1QZR A;  4KHP E;  3Q1Q A;  2V2Z A;  2O1U A;  2V2V A;  4DU7 A;  2EFG A;  4X64 E;  2E1R A;  2NPF A;  4LFB E;  4EMD A;  2Z5B B;  3P3G A;  2CVE A;  4IFD D;  2AJ4 A;  3M85 D;  4FN5 A;  4JI0 E;  4YHH I;  1H7U A;  5C0X B;  4JG4 A;  2C37 B;  5A2Q C;  5C0X D;  3K17 A;  1ZM3 A;  4FW7 A;  1H72 C;  1Z0C A;  4LPF A;  3PS2 A;  4BA1 A;  4MU3 A;  4N3O A;  2PNZ B;  2X36 A;  1YH8 A;  4LF7 I;  3L7Z A;  3ZKB A;  1N0V C;  4MU1 A;  2E5L I;  2UXB I;  1HR0 E;  4QNJ A;  2JT2 A;  4OO1 F;  5LMN I;  3P06 A;  1N32 E;  2WP8 B;  4MYT A;  3WU3 A;  2HHH E;  1FWL A;  3PYG A;  3Q6M A;  2UXD I;  2CZ9 A;  4B3R I;  1R6L A;  2Z5E A;  4MDT A;  4NXN I;  4BA1 B;  3CDJ A;  4OO1 A;  3NZK A;  3LTO A;  4OX9 E;  4X62 I;  2VQE E;  2JEA A;  2BA0 G;  3QT5 A;  3L7Z B;  3D4J A;  3P3C A;  4DV3 E;  5C0X C;  2VQE I;  4JI7 E;  1Y60 A;  3F0N A;  4GQU A;  3J81 Q;  4DV1 I;  4NXM I;  3B82 A;  4DV5 E;  2GO4 A;  1N33 E;  4JI8 I;  5EKW A;  4DV3 I;  2UUA I;  2O1T A;  4IZJ D;  2C39 A;  4DR1 I;  2Z5C A;  1UDQ A;  4LF4 I;  4B3M E;  1OYS A;  4LFC I;  4XTJ A;  2BR2 B;  3PYF A;  3PRY A;  3HJC A;  2R42 A;  4HXZ A;  3ZKD A;  2UXC E;  3GON A;  4USM A;  4Z7Y A;  2R3V A;  5BR8 E;  4U3B A;  3J80 Q;  1MU5 A;  2JEB A;  3T1H I;  1HNZ E;  4MYU A;  4LF5 I;  1FJG E;  5BR8 I;  2OI2 A;  4HY1 A;  3KRN A;  4ISA A;  3PS3 A;  2GO3 A;  4DR6 I;  4DPY A;  2IES A;  4AIM A;  1KTV A;  2Z5C B;  2WNR A;  4DR5 E;  4B3T E;  1Z0B A;  4OKG A;  2BV3 A;  2CGE A;  5JEA E;  4X66 E;  1UDN A;  4HYM A;  3WU4 A;  4K0K E;  1VI7 A;  2ZM6 E;  4DV0 E;  4DUZ E;  4GKJ E;  4DV7 I;  4DR3 E;  4DUY E;  1FKA E;  1KKH A;  2BM0 A;  4DV0 I;  4DUZ I;  2NN6 D;  4GKJ I;  1IBM I;  5FLX Q;  4AQY E;  4JI5 I;  4JYA E;  4GKK I;  4MU0 A;  3ZZT A;  3M7N D;  1XMO I;  1ZXM A;  4DPU A;  3OTO I;  2V34 A;  1IBK E;  4BA2 A;  1N34 E;  3LPS A;  5DRP A;  1HNX E;  4FWG A;  4X65 E;  2IER A;  3GLL A;  4KHP I;  1XXE A;  2C38 A;  1HNX I;  4X64 I;  4QNK A;  3DD6 A;  4LFB I;  4J3D A;  5K36 E;  1USU A;  4PRX A;  1ELO A;  2J7K A;  4LOM A;  3ZZ0 A;  4YY3 E;  4JI0 I;  1S16 A;  5JEA F;  4FW5 A;  4LF9 E;  4DPT A;  2HFS A;  1RHY A;  1OYR A;  2IOQ A;  2NN6 C;  5DNX A;  4BA2 B;  2X7I A;  2IOP A;  4DPW A;  4B3S E;  4HAC A;  2C38 B;  1ZM4 A;  5JEA A;  2PO2 A;  4U3D A;  1U2R A;  3J81 C;  4USK A;  1HR0 I;  1YHC A;  3UHM A;  3V5R A;  1ZXN A;  1N32 I;  1Y4S A;  3HKM A;  5GME A;  4DV6 E;  1FI4 A;  2HHH I;  1FNM A;  3M85 G;  2F4V E;  1OYP A;  4DV6 I;  2HFU A;  1UDO A;  1NHH A;  4OX9 I;  2XEX A;  4JI6 E;  1BKN A;  3J80 C;  2VQF E;  4LCG A;  5K36 F;  4HAC B;  4IFD E;  3PS1 A;  5JEA B;  1WUU A;  2PO2 B;  1Y4U A;  3QT8 A;  4JI7 I;  2GQ0 A;  2VQF I;  2PO1 A;  1OJ4 A;  4WUC A;  2BA1 D;  4DV5 I;  1KIJ A;  1N33 I;  4DR7 E;  3JAM Q;  1S4E A;  4DR4 E;  1UDS A;  4LF6 E;  4FWD A;  1H74 A;  5IWA E;  1Y5Y A;  4URL A;  5C0X E;  5K36 A;  3ZM7 A;  4JI3 E;  2UU9 E;  4OO1 B;  4DR7 I;  2JE6 A;  3GCM A;  4B3M I;  4LF6 I;  3K1J A;  1I94 E;  4OO1 D;  2JEA B;  2AE8 A;  3GME A;  2UXC I;  1J5E E;  2BM1 A;  1Z5C A;  1I94 I;  5LMU E;  4AM3 A;  1B62 A;  4JI1 E;  4JV5 E;  1H73 A;  2DEJ A;  3QT7 A;  1HNZ I;  1Z0T A;  3J7A M;  2PO0 A;  5DRO A;  1FJG I;  4JI1 I;  1NHJ A;  2C39 B;  5FLX C;  1XNR E;  1EA6 A;  1KVK A;  1XHK A;  3B8H A;  3PYD A;  4WUD A;  3V2U C;  4MU4 A;  3CDI A;  5K36 B;  4B3T I;  1USV A;  4DR5 I;  1Z5B A;  4ZVI A;  4DPX A;  2UUB E;  4X66 I;  4IFD F;  4K0K I;  2JEB B;  1PKP A;  4LF8 E;  1Y6Z A;  4I3H A;  2ZM6 I;  4R1F A;  3U1Y A;  5IT9 Q;  1XMQ E;  4DR3 I;  4DUY I;  5C0X F;  4OO1 C;  4DR2 E;  2PO0 B;  3ZZU A;  4DXL A;  2UUC E;  1XNQ E;  3Q6N A;  3M6A A;  1ZM9 A;  4DV2 E;  4IFD A;  4AQY I;  2WNR B;  4JYA I;  3K85 A;  4KQV A;  4P7A A;  1P42 A;  1N36 E;  2O1W A;  4LFA E;  1HNW E;  1UEK A;  2J65 A;  5LL6 R;  1NHI A;  1IBK I;  1N34 I;  1RRE A;  5C0X A;  1IBL E;  2V2Q A;  1H7S A;  4X65 I;  4FW9 A;  4IS9 A;  4NBQ A;  5DNL A;  2WW4 A;  4JI4 E;  3CWV A;  3H4L A;  1ZM2 A;  4FWH A;  5L3J A;  4DV4 E;  4IFD B;  4YY3 I;  2A2C A;  2VES A;  3B78 A;  3P76 A;  4YHH E;  3WU6 A;  3T1Y E;  2VF3 A;  2F1D A;  4DV4 I;  4LF9 I;  5GMD A;  2WP8 A;  1HK7 A;  2PNM A;  3M7N G;  3T1Y I;  2BA0 D;  2HK3 A;  4ED4 A;  4FW6 A;  2HKE A;  1PVG A;  4MQY A;  4B3S I;  4LF7 E;  2NN6 E;  1R6M A;  5ELW A;  5DRR A;  3H1C A;  2E5L E;  1D6T A;  1E3H A;  2LJP A;  4AID A;  2UXB E;  3JAM C;  5LMN E;  4UT4 A;  4P52 A; 
#chains in the Genus database with same CATH homology
 3GME A;  3M85 D;  4AM3 A;  2NN6 D;  5C0X B;  2C37 B;  5C0X D;  5JEA D;  2BR2 A;  2PO0 A;  4IFD C;  2C39 B;  4BA1 A;  3M7N D;  2PNZ B;  4BA2 A;  3L7Z A;  3CDI A;  5K36 B;  3GLL A;  2C38 A;  4OO1 F;  4IFD F;  2JEB B;  3DD6 A;  2WP8 B;  5K36 E;  2NN6 F;  1R6L A;  5C0X F;  4OO1 C;  2PO1 B;  2PO0 B;  5JEA F;  4BA1 B;  3CDJ A;  4OO1 A;  4IFD A;  2WNR B;  1E3P A;  1OYR A;  2BA0 G;  2JEA A;  2NN6 C;  4BA2 B;  3L7Z B;  2NN6 A;  2JE6 B;  5K36 D;  5C0X C;  2BA1 G;  5JEA C;  2C38 B;  5C0X A;  5JEA A;  2PO2 A;  4NBQ A;  2C39 A;  3HKM A;  4IFD D;  1UDQ A;  1OYS A;  2BR2 B;  3B4T A;  3M85 G;  1OYP A;  4IFD B;  1UDO A;  2JEB A;  2NN6 B;  2WP8 A;  5K36 F;  3M7N G;  4OO1 E;  4IFD E;  2BA0 D;  2C37 A;  5JEA B;  3KRN A;  2PO2 B;  2PO1 A;  4AIM A;  2BA1 D;  2NN6 E;  1R6M A;  2WNR A;  3H1C A;  2PNZ A;  3U1K A;  1UDS A;  5K36 C;  1E3H A;  4AID A;  5C0X E;  5JEA E;  5K36 A;  1UDN A;  4OO1 B;  2JE6 A;  3GCM A;  4OO1 D;  2JEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...