1XMQI

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmqI00
4LFCI 4HYMA 1J5EE 1XMOE 3J80Q 4LF9E 1H7UA 5IT9C 4HY1A 4JI3E 3JAMC 4GKJE 4JI1I 4DR2E 1H72C 4DU8A 4B3SI 4DV7I 1PKPA 3F0NA 5LMNI 4YHHI 4DR5E 1MU5A 4JI5E 4DV4E 5GMDA 2AJ4A 4MYTA 4DR4I 1Z59A 2HFSA 3OTOE 2ZM6E 2HFUA 4DV1I 3K17A 2V8PA 3H4LA 4ED4A 1XMQE 1XNRE 2DEIA 4JI0I 4DV6I 2XEXA 1J5EI 2UUBI 2V2ZA 5FLXC 2UU9I 4LF4E 1Z0CA 3ZM7A 1HNXE 1U2RA 4HXZA 4GKJI 1RR9A 4DR2I 1IBKE 1ELOA 2LJPA 1FKAE 1HNWE 2Q2EB 1H73A 2X7IA 4Z7YA 1N34E 5BR8E 2HK2A 4DR3E 2UXCE 3ZZTA 3T1YE 4DV2E 2HHHE 3GONA 4UT4A 2ZM6I 4JI6E 2F4VE 1K47A 1MG7A 4DV3E 1Z0VA 4K0KE 4DR1E 4WUBA 2BM0A 3QT6A 2J7KA 1XNRI 4JI4I 2UUAI 2UXDI 5LMUI 2OI2A 1N32E 3B8HA 4DUYE 1FJGE 3T1HE 4DUZE 4FWGA 1ZM3A 2UUCE 4I3HA 4JI2E 1N33I 2HKJA 4B3ME 4X62E 3WU6A 5LL6R 4DV0E 3WU3A 1KKHA 4FWHA 3WU5A 4DR3I 3T1YI 2UXCI 1XHKA 3HULA 1ZXMA 2V34A 1XNQE 4DXLA 4LF8I 4PRVA 1RREA 2R42A 4DV3I 2ZBKB 5A2QC 4GKKE 4B3RE 1FNMA 1EI1A 4JI7E 4X65E 2R3VA 4NXMI 3ZKDA 1Z0BA 1HNZE 4LF5E 2CZ9A 1IBME 3J81Q 2UUCI 4M1KA 4HACA 1OJ4A 4USMA 2DEJA 3V5RA 4Z7CA 4X66I 3K1JA 4X64E 1N36E 1S4EA 4X62I 4KHPE 1XMOI 4WUDA 4DR6E 1KTVA 4LF9I 4LFBE 1ZXNA 4JI3I 2UXBE 5IT9Q 1BKNA 4LF7E 1UEKA 2HK3A 2HKEA 1XNQI 1Z0EA 3JAMQ 4DR7E 4DR5I 4JI5I 4LF6E 2A2DA 1I94E 4DV4I 2VQFE 1FI4A 4JI7I 3ZZ0A 5IWAE 3OTOI 3J7AG 4B3TE 3J80C 1Z0WA 1IBMI 1HR0E 3PYGA 4LFCE 3PYDA 4LFAE 1XMQI 2ZITA 3QT8A 1IBLE 4NXNE 4JI1E 1N36I 1N0VC 4B3SE 3PYEA 2VQEE 4DV7E 1B62A 4PRXA 5LMNE 1NZ0A 4YHHE 4DR6I 4LFBI 1QZRA 4LF4I 5FLXQ 1HNXI 4DPUA 4DPYA 1KVKA 1IBKI 4DR4E 1S16A 4DR7I 1HNWI 2E1RA 3PYFA 4JG4A 4FN5A 3ZZUA 4P52A 4P7AA 1N34I 1I94I 5BR8I 3QT5A 4XTJA 4DV2I 2HHHI 3LPSA 4JI0E 4JI6I 2F4VI 1NHJA 3ZKBA 4JYAE 1HR0I 4K0KI 4DR1I 2UUBE 2UU9E 4LFAI 4JV5E 1N0UA 3J7AM 1IBLI 4NXNI 2BV3A 4USKA 1N32I 1DARA 1Z5CA 4DUYI 1FJGI 3T1HI 4WUCA 2VQEI 4DUZI 1MX0A 4DU7A 4JI2I 4KQVA 2BM1A 3CWVA 5L3JA 1Z5AA 4EMDA 4B3MI 2NPFA 4UTGA 4JI8E 1NHIA 4YY3E 4OX9E 1Z0TA 1ZM4A 4DV0I 4DV5E 2X36A 3D4JA 4DPWA 2V2QA 4JI4E 3LTOA 4RPFA 2UUAE 1EA6A 2UXDE 2A2CA 4PU9A 5LMUE 1FWLA 2EFGA 4URLA 4JYAI 1ZM2A 1FWKA 4AQYE 3Q1QA 4GKKI 2V2VA 4B3RI 4DPTA 1N33E 5A2QQ 4JV5I 4X65I 2E5LE 1HNZI 2VF3A 4LF5I 1ZM9A 4ZVIA 3V2UC 1WUUA 1A6FA 2GS8A 4MYUA 4JI8I 4X64I 4LF8E 4KHPI 4YY3I 4OX9I 1Z5BA 3LNUA 4DV5I 1PVGA 3B82A 4FW9A 2UXBI 4FWDA 4LF7I 4DPXA 4NXME 1D6TA 3J81C 3M6AA 1H74A 2WW4A 4LF6I 4AQYI 4DV1E 1PIEA 1NHHA 2VQFI 3B78A 4R1FA 1H7SA 5GMEA 1B63A 5IWAI 4DV6E 4X66E 4HACB 2E5LI 1KIJA 3QT7A 1VISA 1Z0GA 4B3TI 3WU4A
chains in the Genus database with same CATH superfamily
4QNKA 2JT2A 4IFDA 4LFCI 4LOMA 4HYMA 1J5EE 1XMOE 3J80Q 3M7ND 4LF9E 1H7UA 5IT9C 3P06A 4HY1A 4BA1B 4JI3E 4MU1A 3JAMC 4GKJE 4JI1I 2BA0G 4DR2E 2JEBA 5JEAD 1H72C 4DU8A 4B3SI 4DV7I 2C38B 1PKPA 3F0NA 5EKWA 5LMNI 4YHHI 4DR5E 1MU5A 3UHMA 2PNMA 4JI5E 2PO1B 4DV4E 5GMDA 5JEAF 2AJ4A 4MYTA 4MU4A 4DR4I 1Z59A 2HFSA 3OTOE 2ZM6E 5FWKA 2HFUA 4DV1I 3K17A 2V8PA 3H4LA 4ED4A 1XMQE 3DD6A 1XNRE 2DEIA 4JI0I 4DV6I 2WNRA 2BA1D 2PO0A 2IERA 4B3TI 3NZKA 2XEXA 2PNZA 2O1TA 1J5EI 1YHCA 2UUBI 3HKMA 2V2ZA 5FLXC 2UU9I 5K36E 4LF4E 1Y6ZA 1Z0CA 4OO1A 3ZM7A 1HNXE 1U2RA 4HXZA 4GKJI 1RR9A 4DR2I 1IBKE 1ELOA 2LJPA 1FKAE 1HNWE 2Q2EB 1H73A 2X7IA 2C37A 5K36D 3Q6NA 4Z7YA 1USVA 1N34E 2CG9A 4LCFA 2HK2A 4OKGA 5BR8E 4DR3E 3ZZTA 3T1YE 2UXCE 4DV2E 2HHHE 3GONA 4UT4A 2ZM6I 4JI6E 5C0XE 2F4VE 1K47A 5K36F 4IZJB 1MG7A 4IZJD 4DV3E 4IS9A 5C0XC 1Z0VA 4K0KE 4DR1E 4WUBA 4AIMA 2BM0A 5DNXA 3QT6A 4FW6A 2J7KA 2GO4A 1XNRI 4JI4I 2NN6A 5C0XB 4FW5A 4MDTA 2UUAI 2IESA 2IOPA 4J3DA 5LMUI 2UXDI 2OI2A 1N32E 3B8HA 4DUYE 1Y60A 4NBQA 3T1HE 1FJGE 4DUZE 2PO2A 3P3CA 3PS3A 4FWGA 1ZM3A 2UUCE 4IFDF 3P76A 4I3HA 3M85D 4JI2E 1N33I 2HKJA 2PNLA 4BA2B 4B3ME 4U3DA 4N3OA 1R6LA 2BR2B 2GO3A 4X62E 3WU6A 5JEAC 5LL6R 4DV0E 3WU3A 4AM3A 3PRYA 4IZKA 1KKHA 4FWHA 4MQYA 3WU5A 4DR3I 3P3EA 3T1YI 2UXCI 3H1CA 4MU3A 1XHKA 5JEAB 4U3BA 3HULA 1ZXMA 2V34A 1XNQE 4DXLA 4LF8I 4PRVA 1RREA 2R42A 4DV3I 4OO1E 2ZBKB 5A2QC 4GKKE 4B3RE 1FNMA 1EI1A 4JI7E 4X65E 2R3VA 4NXMI 3ZKDA 1Z0BA 2WP8B 2Z5BB 2JE6B 1HNZE 4OZEA 4OO1B 4LF5E 2CZ9A 1IBME 4OO1D 3J81Q 3L7ZA 2Z5CB 2UUCI 4M1KA 4HACA 1OJ4A 4USMA 2C39A 2DEJA 3V5RA 1Y4SA 4ISAA 5ELWA 4Z7CA 4X66I 2O1WA 4OO1F 3K1JA 4X64E 1N36E 1S4EA 4X62I 4KHPE 1XMOI 4WUDA 2NN6E 4BA1A 4DR6E 1KTVA 4LF9I 4FW4A 3GMEA 4LFBE 1ZXNA 2Z5EA 2J65A 2BA0D 4JI3I 5K36C 3CDIA 2UXBE 5IT9Q 2C38A 1BKNA 4LF7E 1UEKA 2HK3A 2HKEA 1Y5YA 1Z0EA 1XNQI 2PO1A 3JAMQ 4DR7E 2GQ0A 5K36B 4DR5I 2NN6D 4JI5I 4LF6E 2A2DA 2O1UA 1I94E 4DV4I 2VQFE 1FI4A 4JI7I 1XXEA 3ZZ0A 4IFDE 4LCGA 5IWAE 3OTOI 2NN6F 3J7AG 3PS1A 4B3TE 4IFDC 3J80C 1Z0WA 2F1DA 1IBMI 5DRRA 1HR0E 3PYGA 4LFCE 3PYDA 3U1YA 4LFAE 1XMQI 4IFDB 3KRNA 5DRQA 2ZITA 3M7NG 4IFDD 3QT8A 1IBLE 4NXNE 4JI1E 1P42A 1N36I 1N0VC 4B3SE 3PYEA 2VQEE 4DV7E 1YH8A 1B62A 4PRXA 5LMNE 2JEBB 1NZ0A 4YHHE 2JEAA 4DR6I 4LFBI 1QZRA 4LF4I 5FLXQ 1HNXI 5DRPA 4DPUA 3CDJA 4DPYA 1KVKA 1OYRA 1IBKI 4DR4E 1S16A 4DR7I 2AE8A 1HNWI 2E1RA 3PYFA 4JG4A 4QNJA 5DNLA 4FN5A 3ZZUA 4P52A 4P7AA 1N34I 1I94I 5BR8I 3QT5A 4XTJA 4DV2I 2HHHI 3LPSA 4IZJA 4JI0E 1HK7A 4JI6I 2F4VI 1NHJA 4LPFA 2BA1G 1USUA 2WNRB 3ZKBA 4JYAE 1HR0I 4K0KI 4DR1I 5C0XA 2PO0B 2UUBE 2UU9E 4LFAI 4LCHA 2PNZB 4OO1C 4JV5E 1N0UA 3J7AM 1IBLI 4NXNI 5EL9A 2BV3A 2CGEA 1UDQA 4USKA 1N32I 1DARA 1Z5CA 3U1KA 4DUYI 1FJGI 3T1HI 4WUCA 2VQEI 4DUZI 1MX0A 4DU7A 4BA2A 4JI2I 4KQVA 2BM1A 3CWVA 1OYSA 5L3JA 1Z5AA 2C37B 2BR2A 4EMDA 4B3MI 2NPFA 4UTGA 4JI8E 1NHIA 4YY3E 4OX9E 1Z0TA 1ZM4A 4DV0I 4DV5E 5JEAA 2X36A 3D4JA 4FW7A 2NN6C 1UDOA 4DPWA 2V2QA 2O3ZA 4MU0A 4JI4E 3LTOA 4RPFA 2UUAE 3K85A 1EA6A 2UXDE 2A2CA 4PU9A 4FW3A 2CVEA 5LMUE 2NN6B 1FWLA 2EFGA 4URLA 4JYAI 1ZM2A 1FWKA 4AQYE 3Q1QA 4GKKI 2V2VA 3HJCA 3GCMA 4B3RI 4DPTA 2WP8A 1N33E 5A2QQ 2PO2B 2Z5BA 2JE6A 4JV5I 4X65I 3M85G 2JEAB 2E5LE 3P3GA 1HNZI 2Z5CA 2VF3A 4LF5I 1ZM9A 3PS2A 4ZVIA 3V2UC 5DROA 1WUUA 1A6FA 4IZKB 2GS8A 4MYUA 4JI8I 1UDSA 4X64I 4LF8E 4KHPI 4YY3I 4OX9I 2IOQA 1Y4UA 1Z5BA 3LNUA 4AIDA 3Q6MA 4DV5I 1R6MA 1RHYA 2VESA 1PVGA 3B82A 4FW9A 2UXBI 4FWDA 4LF7I 5K36A 4DPXA 1E3PA 4NXME 1D6TA 1OYPA 3GLLA 5C0XD 3J81C 3M6AA 1H74A 2WW4A 5JEAE 4LF6I 4AQYI 1UDNA 4DV1E 1PIEA 1NHHA 4GQUA 2VQFI 1E3HA 3B78A 4R1FA 1H7SA 3B4TA 5GMEA 1B63A 3L7ZB 5C0XF 5IWAI 4DV6E 4X66E 4HACB 2E5LI 1KIJA 2O1VA 3QT7A 1VISA 1Z0GA 2C39B 3WU4A 1VI7A
chains in the Genus database with same CATH topology
4LFCI 4HYMA 1J5EE 1XMOE 3J80Q 4LF9E 1H7UA 5IT9C 3P06A 4HY1A 4JI3E 3JAMC 4GKJE 4JI1I 4DR2E 1H72C 4DU8A 4B3SI 4DV7I 1PKPA 3F0NA 5LMNI 4YHHI 4DR5E 1MU5A 2PNMA 4JI5E 4DV4E 5GMDA 2AJ4A 4MYTA 4DR4I 1Z59A 2HFSA 3OTOE 2ZM6E 5FWKA 2HFUA 4DV1I 3K17A 2V8PA 3H4LA 4ED4A 1XMQE 1XNRE 2DEIA 4JI0I 4DV6I 2XEXA 2O1TA 1J5EI 2UUBI 2V2ZA 5FLXC 2UU9I 4LF4E 1Y6ZA 1Z0CA 3ZM7A 1HNXE 1U2RA 4HXZA 4GKJI 1RR9A 4DR2I 1IBKE 1ELOA 2LJPA 1FKAE 1HNWE 2Q2EB 1H73A 2X7IA 3Q6NA 4Z7YA 1USVA 1N34E 2CG9A 5BR8E 2HK2A 4DR3E 2UXCE 3ZZTA 3T1YE 4DV2E 2HHHE 3GONA 4UT4A 2ZM6I 4JI6E 2F4VE 1K47A 4IZJB 1MG7A 4IZJD 4DV3E 1Z0VA 4K0KE 4DR1E 4WUBA 2BM0A 3QT6A 2J7KA 1XNRI 4JI4I 2UUAI 2UXDI 2IOPA 5LMUI 2OI2A 1N32E 3B8HA 4DUYE 1FJGE 3T1HE 4DUZE 4FWGA 1ZM3A 2UUCE 4I3HA 4JI2E 1N33I 2HKJA 2PNLA 4B3ME 4N3OA 4X62E 3WU6A 5LL6R 4DV0E 3WU3A 3PRYA 4IZKA 1KKHA 4FWHA 3WU5A 4DR3I 3T1YI 2UXCI 1XHKA 3HULA 1ZXMA 2V34A 1XNQE 4DXLA 4LF8I 4PRVA 1RREA 2R42A 4DV3I 2ZBKB 5A2QC 4GKKE 4B3RE 1FNMA 1EI1A 4JI7E 4X65E 2R3VA 4NXMI 3ZKDA 1Z0BA 2Z5BB 1HNZE 4LF5E 2CZ9A 1IBME 3J81Q 2Z5CB 2UUCI 4M1KA 4HACA 1OJ4A 4USMA 2DEJA 3V5RA 1Y4SA 4Z7CA 4X66I 2O1WA 3K1JA 4X64E 1N36E 1S4EA 4X62I 4KHPE 1XMOI 4WUDA 4DR6E 1KTVA 4LF9I 4LFBE 1ZXNA 2Z5EA 4JI3I 2UXBE 5IT9Q 1BKNA 4LF7E 1UEKA 2HK3A 2HKEA 1XNQI 1Z0EA 3JAMQ 4DR7E 2GQ0A 4DR5I 4JI5I 4LF6E 2A2DA 2O1UA 1I94E 4DV4I 2VQFE 1FI4A 4JI7I 3ZZ0A 5IWAE 3OTOI 3J7AG 4B3TE 3J80C 1Z0WA 1IBMI 1HR0E 3PYGA 4LFCE 3PYDA 4LFAE 1XMQI 2ZITA 3QT8A 1IBLE 4NXNE 4JI1E 1N36I 1N0VC 4B3SE 3PYEA 2VQEE 4DV7E 1B62A 4PRXA 5LMNE 1NZ0A 4YHHE 4DR6I 4LFBI 1QZRA 4LF4I 5FLXQ 1HNXI 4DPUA 4DPYA 1KVKA 1IBKI 4DR4E 1S16A 4DR7I 1HNWI 2E1RA 3PYFA 4JG4A 4FN5A 3ZZUA 4P52A 4P7AA 1N34I 1I94I 5BR8I 3QT5A 4XTJA 4DV2I 2HHHI 3LPSA 4IZJA 4JI0E 1HK7A 4JI6I 2F4VI 1NHJA 1USUA 3ZKBA 4JYAE 1HR0I 4K0KI 4DR1I 2UUBE 2UU9E 4LFAI 4JV5E 1N0UA 3J7AM 1IBLI 4NXNI 2BV3A 2CGEA 4USKA 1N32I 1DARA 1Z5CA 4DUYI 1FJGI 3T1HI 4WUCA 2VQEI 4DUZI 1MX0A 4DU7A 4JI2I 4KQVA 2BM1A 3CWVA 5L3JA 1Z5AA 4EMDA 4B3MI 2NPFA 4UTGA 4JI8E 1NHIA 4YY3E 4OX9E 1Z0TA 1ZM4A 4DV0I 4DV5E 2X36A 3D4JA 4DPWA 2V2QA 4JI4E 3LTOA 4RPFA 2UUAE 3K85A 1EA6A 2UXDE 2A2CA 4PU9A 5LMUE 1FWLA 2EFGA 4URLA 4JYAI 1ZM2A 1FWKA 4AQYE 3Q1QA 4GKKI 2V2VA 3HJCA 4B3RI 4DPTA 1N33E 5A2QQ 2Z5BA 4JV5I 4X65I 2E5LE 1HNZI 2Z5CA 2VF3A 4LF5I 1ZM9A 4ZVIA 3V2UC 1WUUA 1A6FA 4IZKB 2GS8A 4MYUA 4JI8I 4X64I 4LF8E 4KHPI 4YY3I 4OX9I 2IOQA 1Y4UA 1Z5BA 3LNUA 3Q6MA 4DV5I 1PVGA 3B82A 4FW9A 2UXBI 4FWDA 4LF7I 4DPXA 4NXME 1D6TA 3J81C 3M6AA 1H74A 2WW4A 4LF6I 4AQYI 4DV1E 1PIEA 1NHHA 2VQFI 3B78A 4R1FA 1H7SA 5GMEA 1B63A 5IWAI 4DV6E 4X66E 4HACB 2E5LI 1KIJA 2O1VA 3QT7A 1VISA 1Z0GA 4B3TI 3WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC I;  4HYM A;  1J5E E;  1XMO E;  3J80 Q;  4LF9 E;  1H7U A;  5IT9 C;  4HY1 A;  4JI3 E;  3JAM C;  4GKJ E;  4JI1 I;  4DR2 E;  1H72 C;  4DU8 A;  4B3S I;  4DV7 I;  1PKP A;  3F0N A;  5LMN I;  4YHH I;  4DR5 E;  1MU5 A;  4JI5 E;  4DV4 E;  5GMD A;  2AJ4 A;  4MYT A;  4DR4 I;  1Z59 A;  2HFS A;  3OTO E;  2ZM6 E;  2HFU A;  4DV1 I;  3K17 A;  2V8P A;  3H4L A;  4ED4 A;  1XMQ E;  1XNR E;  2DEI A;  4JI0 I;  4DV6 I;  2XEX A;  1J5E I;  2UUB I;  2V2Z A;  5FLX C;  2UU9 I;  4LF4 E;  1Z0C A;  3ZM7 A;  1HNX E;  1U2R A;  4HXZ A;  4GKJ I;  1RR9 A;  4DR2 I;  1IBK E;  1ELO A;  2LJP A;  1FKA E;  1HNW E;  2Q2E B;  1H73 A;  2X7I A;  4Z7Y A;  1N34 E;  5BR8 E;  2HK2 A;  4DR3 E;  2UXC E;  3ZZT A;  3T1Y E;  4DV2 E;  2HHH E;  3GON A;  4UT4 A;  2ZM6 I;  4JI6 E;  2F4V E;  1K47 A;  1MG7 A;  4DV3 E;  1Z0V A;  4K0K E;  4DR1 E;  4WUB A;  2BM0 A;  3QT6 A;  2J7K A;  1XNR I;  4JI4 I;  2UUA I;  2UXD I;  5LMU I;  2OI2 A;  1N32 E;  3B8H A;  4DUY E;  1FJG E;  3T1H E;  4DUZ E;  4FWG A;  1ZM3 A;  2UUC E;  4I3H A;  4JI2 E;  1N33 I;  2HKJ A;  4B3M E;  4X62 E;  3WU6 A;  5LL6 R;  4DV0 E;  3WU3 A;  1KKH A;  4FWH A;  3WU5 A;  4DR3 I;  3T1Y I;  2UXC I;  1XHK A;  3HUL A;  1ZXM A;  2V34 A;  1XNQ E;  4DXL A;  4LF8 I;  4PRV A;  1RRE A;  2R42 A;  4DV3 I;  2ZBK B;  5A2Q C;  4GKK E;  4B3R E;  1FNM A;  1EI1 A;  4JI7 E;  4X65 E;  2R3V A;  4NXM I;  3ZKD A;  1Z0B A;  1HNZ E;  4LF5 E;  2CZ9 A;  1IBM E;  3J81 Q;  2UUC I;  4M1K A;  4HAC A;  1OJ4 A;  4USM A;  2DEJ A;  3V5R A;  4Z7C A;  4X66 I;  3K1J A;  4X64 E;  1N36 E;  1S4E A;  4X62 I;  4KHP E;  1XMO I;  4WUD A;  4DR6 E;  1KTV A;  4LF9 I;  4LFB E;  1ZXN A;  4JI3 I;  2UXB E;  5IT9 Q;  1BKN A;  4LF7 E;  1UEK A;  2HK3 A;  2HKE A;  1XNQ I;  1Z0E A;  3JAM Q;  4DR7 E;  4DR5 I;  4JI5 I;  4LF6 E;  2A2D A;  1I94 E;  4DV4 I;  2VQF E;  1FI4 A;  4JI7 I;  3ZZ0 A;  5IWA E;  3OTO I;  3J7A G;  4B3T E;  3J80 C;  1Z0W A;  1IBM I;  1HR0 E;  3PYG A;  4LFC E;  3PYD A;  4LFA E;  1XMQ I;  2ZIT A;  3QT8 A;  1IBL E;  4NXN E;  4JI1 E;  1N36 I;  1N0V C;  4B3S E;  3PYE A;  2VQE E;  4DV7 E;  1B62 A;  4PRX A;  5LMN E;  1NZ0 A;  4YHH E;  4DR6 I;  4LFB I;  1QZR A;  4LF4 I;  5FLX Q;  1HNX I;  4DPU A;  4DPY A;  1KVK A;  1IBK I;  4DR4 E;  1S16 A;  4DR7 I;  1HNW I;  2E1R A;  3PYF A;  4JG4 A;  4FN5 A;  3ZZU A;  4P52 A;  4P7A A;  1N34 I;  1I94 I;  5BR8 I;  3QT5 A;  4XTJ A;  4DV2 I;  2HHH I;  3LPS A;  4JI0 E;  4JI6 I;  2F4V I;  1NHJ A;  3ZKB A;  4JYA E;  1HR0 I;  4K0K I;  4DR1 I;  2UUB E;  2UU9 E;  4LFA I;  4JV5 E;  1N0U A;  3J7A M;  1IBL I;  4NXN I;  2BV3 A;  4USK A;  1N32 I;  1DAR A;  1Z5C A;  4DUY I;  1FJG I;  3T1H I;  4WUC A;  2VQE I;  4DUZ I;  1MX0 A;  4DU7 A;  4JI2 I;  4KQV A;  2BM1 A;  3CWV A;  5L3J A;  1Z5A A;  4EMD A;  4B3M I;  2NPF A;  4UTG A;  4JI8 E;  1NHI A;  4YY3 E;  4OX9 E;  1Z0T A;  1ZM4 A;  4DV0 I;  4DV5 E;  2X36 A;  3D4J A;  4DPW A;  2V2Q A;  4JI4 E;  3LTO A;  4RPF A;  2UUA E;  1EA6 A;  2UXD E;  2A2C A;  4PU9 A;  5LMU E;  1FWL A;  2EFG A;  4URL A;  4JYA I;  1ZM2 A;  1FWK A;  4AQY E;  3Q1Q A;  4GKK I;  2V2V A;  4B3R I;  4DPT A;  1N33 E;  5A2Q Q;  4JV5 I;  4X65 I;  2E5L E;  1HNZ I;  2VF3 A;  4LF5 I;  1ZM9 A;  4ZVI A;  3V2U C;  1WUU A;  1A6F A;  2GS8 A;  4MYU A;  4JI8 I;  4X64 I;  4LF8 E;  4KHP I;  4YY3 I;  4OX9 I;  1Z5B A;  3LNU A;  4DV5 I;  1PVG A;  3B82 A;  4FW9 A;  2UXB I;  4FWD A;  4LF7 I;  4DPX A;  4NXM E;  1D6T A;  3J81 C;  3M6A A;  1H74 A;  2WW4 A;  4LF6 I;  4AQY I;  4DV1 E;  1PIE A;  1NHH A;  2VQF I;  3B78 A;  4R1F A;  1H7S A;  5GME A;  1B63 A;  5IWA I;  4DV6 E;  4X66 E;  4HAC B;  2E5L I;  1KIJ A;  3QT7 A;  1VIS A;  1Z0G A;  4B3T I;  3WU4 A; 
#chains in the Genus database with same CATH topology
 4QNK A;  2JT2 A;  4IFD A;  4LFC I;  4LOM A;  4HYM A;  1J5E E;  1XMO E;  3J80 Q;  3M7N D;  4LF9 E;  1H7U A;  5IT9 C;  3P06 A;  4HY1 A;  4BA1 B;  4JI3 E;  4MU1 A;  3JAM C;  4GKJ E;  4JI1 I;  2BA0 G;  4DR2 E;  2JEB A;  5JEA D;  1H72 C;  4DU8 A;  4B3S I;  4DV7 I;  2C38 B;  1PKP A;  3F0N A;  5EKW A;  5LMN I;  4YHH I;  4DR5 E;  1MU5 A;  3UHM A;  2PNM A;  4JI5 E;  2PO1 B;  4DV4 E;  5GMD A;  5JEA F;  2AJ4 A;  4MYT A;  4MU4 A;  4DR4 I;  1Z59 A;  2HFS A;  3OTO E;  2ZM6 E;  5FWK A;  2HFU A;  4DV1 I;  3K17 A;  2V8P A;  3H4L A;  4ED4 A;  1XMQ E;  3DD6 A;  1XNR E;  2DEI A;  4JI0 I;  4DV6 I;  2WNR A;  2BA1 D;  2PO0 A;  2IER A;  4B3T I;  3NZK A;  2XEX A;  2PNZ A;  2O1T A;  1J5E I;  1YHC A;  2UUB I;  3HKM A;  2V2Z A;  5FLX C;  2UU9 I;  5K36 E;  4LF4 E;  1Y6Z A;  1Z0C A;  4OO1 A;  3ZM7 A;  1HNX E;  1U2R A;  4HXZ A;  4GKJ I;  1RR9 A;  4DR2 I;  1IBK E;  1ELO A;  2LJP A;  1FKA E;  1HNW E;  2Q2E B;  1H73 A;  2X7I A;  2C37 A;  5K36 D;  3Q6N A;  4Z7Y A;  1USV A;  1N34 E;  2CG9 A;  4LCF A;  2HK2 A;  4OKG A;  5BR8 E;  4DR3 E;  3ZZT A;  3T1Y E;  2UXC E;  4DV2 E;  2HHH E;  3GON A;  4UT4 A;  2ZM6 I;  4JI6 E;  5C0X E;  2F4V E;  1K47 A;  5K36 F;  4IZJ B;  1MG7 A;  4IZJ D;  4DV3 E;  4IS9 A;  5C0X C;  1Z0V A;  4K0K E;  4DR1 E;  4WUB A;  4AIM A;  2BM0 A;  5DNX A;  3QT6 A;  4FW6 A;  2J7K A;  2GO4 A;  1XNR I;  4JI4 I;  2NN6 A;  5C0X B;  4FW5 A;  4MDT A;  2UUA I;  2IES A;  2IOP A;  4J3D A;  5LMU I;  2UXD I;  2OI2 A;  1N32 E;  3B8H A;  4DUY E;  1Y60 A;  4NBQ A;  3T1H E;  1FJG E;  4DUZ E;  2PO2 A;  3P3C A;  3PS3 A;  4FWG A;  1ZM3 A;  2UUC E;  4IFD F;  3P76 A;  4I3H A;  3M85 D;  4JI2 E;  1N33 I;  2HKJ A;  2PNL A;  4BA2 B;  4B3M E;  4U3D A;  4N3O A;  1R6L A;  2BR2 B;  2GO3 A;  4X62 E;  3WU6 A;  5JEA C;  5LL6 R;  4DV0 E;  3WU3 A;  4AM3 A;  3PRY A;  4IZK A;  1KKH A;  4FWH A;  4MQY A;  3WU5 A;  4DR3 I;  3P3E A;  3T1Y I;  2UXC I;  3H1C A;  4MU3 A;  1XHK A;  5JEA B;  4U3B A;  3HUL A;  1ZXM A;  2V34 A;  1XNQ E;  4DXL A;  4LF8 I;  4PRV A;  1RRE A;  2R42 A;  4DV3 I;  4OO1 E;  2ZBK B;  5A2Q C;  4GKK E;  4B3R E;  1FNM A;  1EI1 A;  4JI7 E;  4X65 E;  2R3V A;  4NXM I;  3ZKD A;  1Z0B A;  2WP8 B;  2Z5B B;  2JE6 B;  1HNZ E;  4OZE A;  4OO1 B;  4LF5 E;  2CZ9 A;  1IBM E;  4OO1 D;  3J81 Q;  3L7Z A;  2Z5C B;  2UUC I;  4M1K A;  4HAC A;  1OJ4 A;  4USM A;  2C39 A;  2DEJ A;  3V5R A;  1Y4S A;  4ISA A;  5ELW A;  4Z7C A;  4X66 I;  2O1W A;  4OO1 F;  3K1J A;  4X64 E;  1N36 E;  1S4E A;  4X62 I;  4KHP E;  1XMO I;  4WUD A;  2NN6 E;  4BA1 A;  4DR6 E;  1KTV A;  4LF9 I;  4FW4 A;  3GME A;  4LFB E;  1ZXN A;  2Z5E A;  2J65 A;  2BA0 D;  4JI3 I;  5K36 C;  3CDI A;  2UXB E;  5IT9 Q;  2C38 A;  1BKN A;  4LF7 E;  1UEK A;  2HK3 A;  2HKE A;  1Y5Y A;  1Z0E A;  1XNQ I;  2PO1 A;  3JAM Q;  4DR7 E;  2GQ0 A;  5K36 B;  4DR5 I;  2NN6 D;  4JI5 I;  4LF6 E;  2A2D A;  2O1U A;  1I94 E;  4DV4 I;  2VQF E;  1FI4 A;  4JI7 I;  1XXE A;  3ZZ0 A;  4IFD E;  4LCG A;  5IWA E;  3OTO I;  2NN6 F;  3J7A G;  3PS1 A;  4B3T E;  4IFD C;  3J80 C;  1Z0W A;  2F1D A;  1IBM I;  5DRR A;  1HR0 E;  3PYG A;  4LFC E;  3PYD A;  3U1Y A;  4LFA E;  1XMQ I;  4IFD B;  3KRN A;  5DRQ A;  2ZIT A;  3M7N G;  4IFD D;  3QT8 A;  1IBL E;  4NXN E;  4JI1 E;  1P42 A;  1N36 I;  1N0V C;  4B3S E;  3PYE A;  2VQE E;  4DV7 E;  1YH8 A;  1B62 A;  4PRX A;  5LMN E;  2JEB B;  1NZ0 A;  4YHH E;  2JEA A;  4DR6 I;  4LFB I;  1QZR A;  4LF4 I;  5FLX Q;  1HNX I;  5DRP A;  4DPU A;  3CDJ A;  4DPY A;  1KVK A;  1OYR A;  1IBK I;  4DR4 E;  1S16 A;  4DR7 I;  2AE8 A;  1HNW I;  2E1R A;  3PYF A;  4JG4 A;  4QNJ A;  5DNL A;  4FN5 A;  3ZZU A;  4P52 A;  4P7A A;  1N34 I;  1I94 I;  5BR8 I;  3QT5 A;  4XTJ A;  4DV2 I;  2HHH I;  3LPS A;  4IZJ A;  4JI0 E;  1HK7 A;  4JI6 I;  2F4V I;  1NHJ A;  4LPF A;  2BA1 G;  1USU A;  2WNR B;  3ZKB A;  4JYA E;  1HR0 I;  4K0K I;  4DR1 I;  5C0X A;  2PO0 B;  2UUB E;  2UU9 E;  4LFA I;  4LCH A;  2PNZ B;  4OO1 C;  4JV5 E;  1N0U A;  3J7A M;  1IBL I;  4NXN I;  5EL9 A;  2BV3 A;  2CGE A;  1UDQ A;  4USK A;  1N32 I;  1DAR A;  1Z5C A;  3U1K A;  4DUY I;  1FJG I;  3T1H I;  4WUC A;  2VQE I;  4DUZ I;  1MX0 A;  4DU7 A;  4BA2 A;  4JI2 I;  4KQV A;  2BM1 A;  3CWV A;  1OYS A;  5L3J A;  1Z5A A;  2C37 B;  2BR2 A;  4EMD A;  4B3M I;  2NPF A;  4UTG A;  4JI8 E;  1NHI A;  4YY3 E;  4OX9 E;  1Z0T A;  1ZM4 A;  4DV0 I;  4DV5 E;  5JEA A;  2X36 A;  3D4J A;  4FW7 A;  2NN6 C;  1UDO A;  4DPW A;  2V2Q A;  2O3Z A;  4MU0 A;  4JI4 E;  3LTO A;  4RPF A;  2UUA E;  3K85 A;  1EA6 A;  2UXD E;  2A2C A;  4PU9 A;  4FW3 A;  2CVE A;  5LMU E;  2NN6 B;  1FWL A;  2EFG A;  4URL A;  4JYA I;  1ZM2 A;  1FWK A;  4AQY E;  3Q1Q A;  4GKK I;  2V2V A;  3HJC A;  3GCM A;  4B3R I;  4DPT A;  2WP8 A;  1N33 E;  5A2Q Q;  2PO2 B;  2Z5B A;  2JE6 A;  4JV5 I;  4X65 I;  3M85 G;  2JEA B;  2E5L E;  3P3G A;  1HNZ I;  2Z5C A;  2VF3 A;  4LF5 I;  1ZM9 A;  3PS2 A;  4ZVI A;  3V2U C;  5DRO A;  1WUU A;  1A6F A;  4IZK B;  2GS8 A;  4MYU A;  4JI8 I;  1UDS A;  4X64 I;  4LF8 E;  4KHP I;  4YY3 I;  4OX9 I;  2IOQ A;  1Y4U A;  1Z5B A;  3LNU A;  4AID A;  3Q6M A;  4DV5 I;  1R6M A;  1RHY A;  2VES A;  1PVG A;  3B82 A;  4FW9 A;  2UXB I;  4FWD A;  4LF7 I;  5K36 A;  4DPX A;  1E3P A;  4NXM E;  1D6T A;  1OYP A;  3GLL A;  5C0X D;  3J81 C;  3M6A A;  1H74 A;  2WW4 A;  5JEA E;  4LF6 I;  4AQY I;  1UDN A;  4DV1 E;  1PIE A;  1NHH A;  4GQU A;  2VQF I;  1E3H A;  3B78 A;  4R1F A;  1H7S A;  3B4T A;  5GME A;  1B63 A;  3L7Z B;  5C0X F;  5IWA I;  4DV6 E;  4X66 E;  4HAC B;  2E5L I;  1KIJ A;  2O1V A;  3QT7 A;  1VIS A;  1Z0G A;  2C39 B;  3WU4 A;  1VI7 A; 
#chains in the Genus database with same CATH homology
 4LFC I;  4HYM A;  1J5E E;  1XMO E;  3J80 Q;  4LF9 E;  1H7U A;  5IT9 C;  3P06 A;  4HY1 A;  4JI3 E;  3JAM C;  4GKJ E;  4JI1 I;  4DR2 E;  1H72 C;  4DU8 A;  4B3S I;  4DV7 I;  1PKP A;  3F0N A;  5LMN I;  4YHH I;  4DR5 E;  1MU5 A;  2PNM A;  4JI5 E;  4DV4 E;  5GMD A;  2AJ4 A;  4MYT A;  4DR4 I;  1Z59 A;  2HFS A;  3OTO E;  2ZM6 E;  5FWK A;  2HFU A;  4DV1 I;  3K17 A;  2V8P A;  3H4L A;  4ED4 A;  1XMQ E;  1XNR E;  2DEI A;  4JI0 I;  4DV6 I;  2XEX A;  2O1T A;  1J5E I;  2UUB I;  2V2Z A;  5FLX C;  2UU9 I;  4LF4 E;  1Y6Z A;  1Z0C A;  3ZM7 A;  1HNX E;  1U2R A;  4HXZ A;  4GKJ I;  1RR9 A;  4DR2 I;  1IBK E;  1ELO A;  2LJP A;  1FKA E;  1HNW E;  2Q2E B;  1H73 A;  2X7I A;  3Q6N A;  4Z7Y A;  1USV A;  1N34 E;  2CG9 A;  5BR8 E;  2HK2 A;  4DR3 E;  2UXC E;  3ZZT A;  3T1Y E;  4DV2 E;  2HHH E;  3GON A;  4UT4 A;  2ZM6 I;  4JI6 E;  2F4V E;  1K47 A;  4IZJ B;  1MG7 A;  4IZJ D;  4DV3 E;  1Z0V A;  4K0K E;  4DR1 E;  4WUB A;  2BM0 A;  3QT6 A;  2J7K A;  1XNR I;  4JI4 I;  2UUA I;  2UXD I;  2IOP A;  5LMU I;  2OI2 A;  1N32 E;  3B8H A;  4DUY E;  1FJG E;  3T1H E;  4DUZ E;  4FWG A;  1ZM3 A;  2UUC E;  4I3H A;  4JI2 E;  1N33 I;  2HKJ A;  2PNL A;  4B3M E;  4N3O A;  4X62 E;  3WU6 A;  5LL6 R;  4DV0 E;  3WU3 A;  3PRY A;  4IZK A;  1KKH A;  4FWH A;  3WU5 A;  4DR3 I;  3T1Y I;  2UXC I;  1XHK A;  3HUL A;  1ZXM A;  2V34 A;  1XNQ E;  4DXL A;  4LF8 I;  4PRV A;  1RRE A;  2R42 A;  4DV3 I;  2ZBK B;  5A2Q C;  4GKK E;  4B3R E;  1FNM A;  1EI1 A;  4JI7 E;  4X65 E;  2R3V A;  4NXM I;  3ZKD A;  1Z0B A;  2Z5B B;  1HNZ E;  4LF5 E;  2CZ9 A;  1IBM E;  3J81 Q;  2Z5C B;  2UUC I;  4M1K A;  4HAC A;  1OJ4 A;  4USM A;  2DEJ A;  3V5R A;  1Y4S A;  4Z7C A;  4X66 I;  2O1W A;  3K1J A;  4X64 E;  1N36 E;  1S4E A;  4X62 I;  4KHP E;  1XMO I;  4WUD A;  4DR6 E;  1KTV A;  4LF9 I;  4LFB E;  1ZXN A;  2Z5E A;  4JI3 I;  2UXB E;  5IT9 Q;  1BKN A;  4LF7 E;  1UEK A;  2HK3 A;  2HKE A;  1XNQ I;  1Z0E A;  3JAM Q;  4DR7 E;  2GQ0 A;  4DR5 I;  4JI5 I;  4LF6 E;  2A2D A;  2O1U A;  1I94 E;  4DV4 I;  2VQF E;  1FI4 A;  4JI7 I;  3ZZ0 A;  5IWA E;  3OTO I;  3J7A G;  4B3T E;  3J80 C;  1Z0W A;  1IBM I;  1HR0 E;  3PYG A;  4LFC E;  3PYD A;  4LFA E;  1XMQ I;  2ZIT A;  3QT8 A;  1IBL E;  4NXN E;  4JI1 E;  1N36 I;  1N0V C;  4B3S E;  3PYE A;  2VQE E;  4DV7 E;  1B62 A;  4PRX A;  5LMN E;  1NZ0 A;  4YHH E;  4DR6 I;  4LFB I;  1QZR A;  4LF4 I;  5FLX Q;  1HNX I;  4DPU A;  4DPY A;  1KVK A;  1IBK I;  4DR4 E;  1S16 A;  4DR7 I;  1HNW I;  2E1R A;  3PYF A;  4JG4 A;  4FN5 A;  3ZZU A;  4P52 A;  4P7A A;  1N34 I;  1I94 I;  5BR8 I;  3QT5 A;  4XTJ A;  4DV2 I;  2HHH I;  3LPS A;  4IZJ A;  4JI0 E;  1HK7 A;  4JI6 I;  2F4V I;  1NHJ A;  1USU A;  3ZKB A;  4JYA E;  1HR0 I;  4K0K I;  4DR1 I;  2UUB E;  2UU9 E;  4LFA I;  4JV5 E;  1N0U A;  3J7A M;  1IBL I;  4NXN I;  2BV3 A;  2CGE A;  4USK A;  1N32 I;  1DAR A;  1Z5C A;  4DUY I;  1FJG I;  3T1H I;  4WUC A;  2VQE I;  4DUZ I;  1MX0 A;  4DU7 A;  4JI2 I;  4KQV A;  2BM1 A;  3CWV A;  5L3J A;  1Z5A A;  4EMD A;  4B3M I;  2NPF A;  4UTG A;  4JI8 E;  1NHI A;  4YY3 E;  4OX9 E;  1Z0T A;  1ZM4 A;  4DV0 I;  4DV5 E;  2X36 A;  3D4J A;  4DPW A;  2V2Q A;  4JI4 E;  3LTO A;  4RPF A;  2UUA E;  3K85 A;  1EA6 A;  2UXD E;  2A2C A;  4PU9 A;  5LMU E;  1FWL A;  2EFG A;  4URL A;  4JYA I;  1ZM2 A;  1FWK A;  4AQY E;  3Q1Q A;  4GKK I;  2V2V A;  3HJC A;  4B3R I;  4DPT A;  1N33 E;  5A2Q Q;  2Z5B A;  4JV5 I;  4X65 I;  2E5L E;  1HNZ I;  2Z5C A;  2VF3 A;  4LF5 I;  1ZM9 A;  4ZVI A;  3V2U C;  1WUU A;  1A6F A;  4IZK B;  2GS8 A;  4MYU A;  4JI8 I;  4X64 I;  4LF8 E;  4KHP I;  4YY3 I;  4OX9 I;  2IOQ A;  1Y4U A;  1Z5B A;  3LNU A;  3Q6M A;  4DV5 I;  1PVG A;  3B82 A;  4FW9 A;  2UXB I;  4FWD A;  4LF7 I;  4DPX A;  4NXM E;  1D6T A;  3J81 C;  3M6A A;  1H74 A;  2WW4 A;  4LF6 I;  4AQY I;  4DV1 E;  1PIE A;  1NHH A;  2VQF I;  3B78 A;  4R1F A;  1H7S A;  5GME A;  1B63 A;  5IWA I;  4DV6 E;  4X66 E;  4HAC B;  2E5L I;  1KIJ A;  2O1V A;  3QT7 A;  1VIS A;  1Z0G A;  4B3T I;  3WU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...