1XMQI

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmqI00
2ZM6E 5FLXQ 4NXMI 3WU6A 1FWKA 4DR1I 4B3SE 1KKHA 2OI2A 4DPWA 4HACB 1S16A 4EMDA 4DUZI 4ZVIA 4JI7I 4LF6I 4DR7I 4YHHI 2WW4A 4RPFA 3ZZ0A 4GKJE 1HNWI 4UTGA 4B3ME 1MG7A 4DPXA 3T1HI 4DR4I 3WU3A 4DV1I 1I94I 4JI7E 4LF6E 4DR7E 1PIEA 4YHHE 1B63A 1Z5AA 2V2ZA 5IT9C 5BR8E 1ZM3A 4YY3I 1ELOA 3ZM7A 4DV3I 2BV3A 3T1HE 1XHKA 5FLXC 4LFCI 5LMNI 4DV1E 1I94E 1MU5A 4DUYI 3J7AM 2UXBI 1K47A 1EA6A 1KVKA 2UXCE 4PRXA 4LFBE 1NHHA 5LMUI 4DV3E 4Z7CA 4LF4I 4LFCE 4X64E 4JV5E 2VF3A 4K0KI 4DR3E 1Z0WA 1IBLI 4JG4A 2ZBKB 5IWAI 4HACA 1KIJA 4LF4E 1PVGA 4LFAI 3PYGA 1H73A 3ZKDA 4DR6I 4JI6I 4JI8I 4DV2E 4K0KE 4USMA 4USKA 2DEIA 4JI1E 1Z5BA 1J5EI 2HHHI 4JYAI 2VQEI 5IWAE 1S4EA 4DV4I 4JI2I 4X66E 4LFAE 4M1KA 4DR6E 1RREA 4X62I 2UUCE 1FKAE 1EI1A 1N36I 2HHHE 4JYAE 2VQEE 2A2CA 1BKNA 4HY1A 4DV4E 1H74A 4I3HA 4KHPE 1N32I 1N33E 4DV6E 1HNXI 1HR0I 1N36E 3LPSA 2F4VI 4XTJA 2UXDI 3WU5A 2XEXA 1Z5CA 2E1RA 2R3VA 4NXME 4DR1E 1H7UA 4WUCA 3ZKBA 1Z0CA 1HNZI 2UXDE 4DUZE 2HFSA 1KTVA 1NHJA 1XNRI 2EFGA 1NHIA 4DU8A 2A2DA 1HNWE 2R42A 3PYEA 3Q1QA 4LF5I 1PKPA 1XMQI 1HNZE 4DR4E 1ZXMA 1FNMA 2UUBI 2HK2A 2J7KA 4DPUA 4B3TI 4DPTA 4PU9A 1WUUA 1QZRA 5LL6R 4LF5E 3J81Q 4YY3E 3QT6A 1ZM9A 3PYDA 1IBKI 5LMNE 2HKJA 3J80Q 2UUBE 4DUYE 4LF8I 2UXBE 3J7AG 3OTOI 3CWVA 4AQYI 4OX9I 3B78A 5LMUE 4DR2I 1FJGI 4LF8E 4JI3I 4FWGA 1IBLE 4NXNI 1ZM4A 4AQYE 1N34I 4DR5I 3LNUA 2GS8A 1VISA 4JI4I 2V8PA 4HYMA 2V2QA 4JI6E 4JI8E 2HKEA 3J81C 1FJGE 1H72C 1NZ0A 3B82A 1J5EE 4NXNE 4DV5I 1N34E 4P52A 3J80C 4WUDA 4MYTA 4JI2E 2ZM6I 5GMDA 1MX0A 4ED4A 3K1JA 3HULA 1XMOI 2X36A 2X7IA 4JI0I 4X62E 4X65I 2V34A 1N0VC 4LF9I 4B3SI 1Z0EA 2E5LI 3ZZUA 4FWDA 1RR9A 4DV7I 2UU9I 1Z0TA 2VQFI 1N32E 3H4LA 5A2QQ 1XMOE 4MYUA 3V5RA 4UT4A 1HNXE 1HR0E 3F0NA 2HK3A 4JI0E 1XNQI 2ZITA 4X65E 1D6TA 1FI4A 4GKJI 4KQVA 4LF9E 2F4VE 1IBMI 4B3MI 2E5LE 1Z0BA 3JAMQ 2NPFA 3D4JA 4PRVA 1ZM2A 4DV7E 2UU9E 2VQFE 4LF7I 1Z0GA 3LTOA 1XNQE 2LJPA 5L3JA 4B3RI 1U2RA 5BR8I 1IBME 4DPYA 3QT7A 2BM0A 1XNRE 4LF7E 4P7AA 1B62A 4FW9A 4B3RE 4DV0I 2V2VA 4FWHA 5GMEA 4DXLA 1FWLA 4GKKI 2UXCI 4LFBI 1Z59A 1XMQE 4JI5I 2UUAI 5A2QC 1ZXNA 1N0UA 2HFUA 1OJ4A 4X64I 4JV5I 4B3TE 4R1FA 4DV0E 4DR3I 3B8HA 3JAMC 4GKKE 2AJ4A 4Z7YA 4JI5E 2UUAE 1IBKE 4DU7A 4URLA 2BM1A 4DV2I 2DEJA 1H7SA 3ZZTA 3OTOE 4JI1I 3K17A 4OX9E 3WU4A 2Q2EB 4X66I 3QT8A 2CZ9A 4DR2E 4WUBA 1DARA 4JI3E 1UEKA 1Z0VA 2UUCI 4HXZA 3M6AA 3QT5A 4DR5E 4FN5A 3T1YI 3GONA 3PYFA 4JI4E 4KHPI 3V2UC 1N33I 1A6FA 4DV6I 4DV5E 5IT9Q 3T1YE
chains in the Genus database with same CATH superfamily
2ZM6E 2C39A 5FLXQ 4FW4A 4FW6A 4NXMI 3WU6A 1FWKA 4DR1I 4B3SE 1KKHA 2OI2A 2C38B 4FW5A 3K85A 4DPWA 4HACB 1S16A 2BA0D 1UDSA 4EMDA 4DUZI 4ZVIA 4JI7I 2PO0B 4MQYA 4LF6I 3HKMA 4DR7I 4YHHI 2IESA 3P3GA 2WW4A 4RPFA 3ZZ0A 4GKJE 1HNWI 4UTGA 2C37B 4MDTA 4B3ME 3H1CA 4OKGA 1MG7A 4DPXA 5C0XC 3T1HI 4DR4I 3WU3A 3L7ZB 4DV1I 4OO1F 1I94I 4JI7E 4LF6E 3KRNA 4DR7E 1Y60A 1PIEA 4YHHE 1B63A 1Z5AA 4LCHA 2V2ZA 2JEAA 5IT9C 3M85D 3HJCA 5BR8E 4IFDA 4MU1A 1ZM3A 4J3DA 1ELOA 4YY3I 1USVA 3ZM7A 5K36A 4DV3I 2BV3A 2NN6D 3T1HE 1XHKA 5FLXC 4LFCI 5LMNI 5K36E 4DV1E 3GLLA 1I94E 1MU5A 4DUYI 3J7AM 3CDIA 2Z5EA 4MU3A 2UXBI 5K36D 1K47A 1EA6A 1KVKA 2UXCE 4PRXA 4LFBE 1NHHA 4BA1B 2WP8B 1UDQA 5LMUI 4DV3E 4Z7CA 4LF4I 1OYRA 4MU0A 3GCMA 4LFCE 5ELWA 4X64E 4JV5E 2O1UA 2VF3A 5DROA 3M85G 4K0KI 4DR3E 1Z0WA 1IBLI 4JG4A 2ZBKB 2C38A 1UDOA 5IWAI 4HACA 1KIJA 2F1DA 4LF4E 1PVGA 4LFAI 3PYGA 1H73A 2PO0A 2WNRB 3ZKDA 4DR6I 4JI6I 4JI8I 4DV2E 4K0KE 3P3EA 4USMA 2C37A 2DEIA 4USKA 1Z5BA 5FWKA 4JI1E 1J5EI 2HHHI 4JYAI 2VQEI 5K36C 4OO1B 5IWAE 1S4EA 4DV4I 4JI2I 4X66E 4LFAE 4M1KA 4DR6E 1RREA 4X62I 2UUCE 4BA2A 1YH8A 1FKAE 1EI1A 5JEAF 5C0XF 1N36I 2HHHE 4JYAE 2VQEE 2A2CA 1BKNA 4HY1A 4DV4E 1H74A 1VI7A 4I3HA 2VESA 2BR2B 4KHPE 1N32I 3PS3A 1N33E 4DV6E 1HNXI 1HR0I 2JEBB 2AE8A 4QNKA 1N36E 4AIDA 3LPSA 2F4VI 2PNMA 2WP8A 4XTJA 4NBQA 1Y6ZA 2UXDI 3WU5A 2XEXA 1Z5CA 2E1RA 3P06A 2R3VA 4NXME 2CVEA 2JT2A 4DR1E 5DNXA 4AIMA 2PO2B 1H7UA 2PNZA 4WUCA 3ZKBA 2PO1B 1HK7A 1Z0CA 1HNZI 2UXDE 4IZJB 4DUZE 2HFSA 2WNRA 1KTVA 1NHJA 1XNRI 2EFGA 4FW3A 1NHIA 4DU8A 2A2DA 1HNWE 2R42A 3PYEA 3Q1QA 4LF5I 1RHYA 1PKPA 4OO1A 4LOMA 2BA0G 2NN6F 3B4TA 1XMQI 4IFDE 1HNZE 3PRYA 4DR4E 2IOQA 1ZXMA 2J65A 1FNMA 5JEAB 5C0XB 2HK2A 2UUBI 4IFDD 2J7KA 4DPUA 4B3TI 4DPTA 5K36F 4PU9A 1WUUA 1QZRA 5LL6R 2GQ0A 2O3ZA 4LF5E 3J81Q 4YY3E 3QT6A 3NZKA 3M7ND 1ZM9A 3PYDA 1IBKI 2BR2A 5LMNE 1YHCA 2HKJA 3J80Q 2UUBE 4DUYE 4LF8I 4LPFA 2UXBE 3J7AG 2GO4A 4OZEA 3OTOI 3CWVA 1Y5YA 4AQYI 4OX9I 1E3HA 3B78A 5LMUE 2Z5CB 3PS1A 4DR2I 4N3OA 4U3DA 1FJGI 4LF8E 4JI3I 4FWGA 4IFDC 1IBLE 4NXNI 2JE6B 2PO2A 1ZM4A 4AQYE 1N34I 4DR5I 4IZKB 3LNUA 2PO1A 2GS8A 1VISA 4AM3A 3L7ZA 4JI4I 2V8PA 2Z5BB 1USUA 4HYMA 2V2QA 4JI6E 4JI8E 2HKEA 4U3BA 3J81C 1FJGE 3U1YA 1H72C 1NZ0A 2NN6B 3B82A 1J5EE 4NXNE 4DV5I 1N34E 4P52A 3J80C 4WUDA 4MYTA 4JI2E 2ZM6I 5K36B 5GMDA 3P3CA 1MX0A 1XXEA 3U1KA 4ED4A 5JEAA 5C0XA 3K1JA 3HULA 1XMOI 2X36A 2X7IA 4JI0I 5JEAE 2IOPA 4X62E 4X65I 2V34A 1N0VC 4LF9I 4LCGA 4B3SI 5JEAD 1Z0EA 4BA1A 2E5LI 3ZZUA 4FWDA 3UHMA 1RR9A 4DV7I 2PNLA 2UU9I 1Z0TA 2VQFI 1N32E 3H4LA 5A2QQ 1XMOE 4MYUA 3V5RA 4UT4A 1HNXE 1HR0E 2BA1D 3F0NA 2HK3A 4JI0E 1XNQI 5DRPA 2ZITA 4X65E 1D6TA 1FI4A 4GKJI 4KQVA 1OYSA 4LF9E 2F4VE 1IBMI 4B3MI 3P76A 1Z0BA 2E5LE 2Z5CA 1UDNA 2O1TA 3JAMQ 2NPFA 3DD6A 5EL9A 3D4JA 4PRVA 1ZM2A 4DV7E 1Y4UA 2UU9E 2VQFE 4LF7I 1Z0GA 3LTOA 1XNQE 2LJPA 5L3JA 4B3RI 1U2RA 2JE6A 1R6LA 5BR8I 1IBME 4IZKA 4DPYA 3QT7A 4IS9A 4OO1E 2BM0A 5JEAC 4IFDF 2CG9A 2Z5BA 1XNRE 4LF7E 2BA1G 5DRQA 3GMEA 4OO1D 4QNJA 4P7AA 2NN6A 1B62A 4FW9A 4B3RE 4DV0I 2V2VA 4FWHA 5GMEA 4BA2B 4DXLA 1FWLA 4GKKI 2NN6E 2UXCI 1P42A 4LFBI 1Z59A 1XMQE 4JI5I 2UUAI 5A2QC 1ZXNA 1N0UA 2HFUA 2C39B 4MU4A 2O1WA 4GQUA 1OJ4A 4X64I 4JV5I 2JEBA 4B3TE 5DRRA 4R1FA 4DV0E 4DR3I 3B8HA 2GO3A 3JAMC 4GKKE 2AJ4A 4Z7YA 4JI5E 2UUAE 2O1VA 1IBKE 1OYPA 4DU7A 4URLA 2BM1A 4DV2I 2DEJA 1H7SA 3ZZTA 3OTOE 4JI1I 4OO1C 3K17A 4OX9E 5DNLA 2CGEA 3M7NG 3Q6MA 2PNZB 3WU4A 4IZJA 2Q2EB 4ISAA 4X66I 3QT8A 2CZ9A 4DR2E 4WUBA 2NN6C 1DARA 4JI3E 1UEKA 1Z0VA 2UUCI 2JEAB 4IZJD 4HXZA 4LCFA 3PS2A 5EKWA 3M6AA 3QT5A 4DR5E 4IFDB 4FN5A 3T1YI 3GONA 3PYFA 4JI4E 4KHPI 3V2UC 5C0XE 3Q6NA 1A6FA 3CDJA 4DV6I 1R6MA 1N33I 2IERA 1E3PA 4DV5E 4FW7A 5C0XD 1Y4SA 5IT9Q 3T1YE
chains in the Genus database with same CATH topology
2ZM6E 5FLXQ 4NXMI 3WU6A 1FWKA 4DR1I 4B3SE 1KKHA 2OI2A 3K85A 4DPWA 4HACB 1S16A 4EMDA 4DUZI 4ZVIA 4JI7I 4LF6I 4DR7I 4YHHI 2WW4A 4RPFA 3ZZ0A 4GKJE 1HNWI 4UTGA 4B3ME 1MG7A 4DPXA 3T1HI 4DR4I 3WU3A 4DV1I 1I94I 4JI7E 4LF6E 4DR7E 1PIEA 4YHHE 1B63A 1Z5AA 2V2ZA 5IT9C 3HJCA 5BR8E 1ZM3A 4YY3I 1ELOA 1USVA 3ZM7A 4DV3I 2BV3A 3T1HE 1XHKA 5FLXC 4LFCI 5LMNI 4DV1E 1I94E 1MU5A 4DUYI 3J7AM 2Z5EA 2UXBI 1K47A 1EA6A 1KVKA 2UXCE 4PRXA 4LFBE 1NHHA 5LMUI 4DV3E 4Z7CA 4LF4I 4LFCE 4X64E 4JV5E 2O1UA 2VF3A 4K0KI 4DR3E 1Z0WA 1IBLI 4JG4A 2ZBKB 5IWAI 4HACA 1KIJA 4LF4E 1PVGA 4LFAI 3PYGA 1H73A 3ZKDA 4DR6I 4JI6I 4JI8I 4DV2E 4K0KE 4USMA 4USKA 2DEIA 4JI1E 1Z5BA 5FWKA 1J5EI 2HHHI 4JYAI 2VQEI 5IWAE 1S4EA 4DV4I 4JI2I 4X66E 4LFAE 4M1KA 4DR6E 1RREA 4X62I 2UUCE 1FKAE 1EI1A 1N36I 2HHHE 4JYAE 2VQEE 2A2CA 1BKNA 4HY1A 4DV4E 1H74A 4I3HA 4KHPE 1N32I 1N33E 4DV6E 1HNXI 1HR0I 1N36E 3LPSA 2F4VI 2PNMA 4XTJA 1Y6ZA 2UXDI 3WU5A 2XEXA 1Z5CA 2E1RA 3P06A 2R3VA 4NXME 4DR1E 1H7UA 4WUCA 3ZKBA 1HK7A 1Z0CA 1HNZI 2UXDE 4IZJB 4DUZE 2HFSA 1KTVA 1NHJA 1XNRI 2EFGA 1NHIA 4DU8A 2A2DA 1HNWE 2R42A 3PYEA 3Q1QA 4LF5I 1PKPA 1XMQI 1HNZE 3PRYA 4DR4E 2IOQA 1ZXMA 1FNMA 2UUBI 2HK2A 2J7KA 4DPUA 4B3TI 4DPTA 4PU9A 1WUUA 1QZRA 5LL6R 2GQ0A 4LF5E 3J81Q 4YY3E 3QT6A 1ZM9A 3PYDA 1IBKI 5LMNE 2HKJA 3J80Q 2UUBE 4DUYE 4LF8I 2UXBE 3J7AG 3OTOI 3CWVA 4AQYI 4OX9I 3B78A 5LMUE 2Z5CB 4DR2I 4N3OA 1FJGI 4LF8E 4JI3I 4FWGA 1IBLE 4NXNI 1ZM4A 4AQYE 1N34I 4DR5I 4IZKB 3LNUA 2GS8A 1VISA 4JI4I 2V8PA 2Z5BB 1USUA 4HYMA 2V2QA 4JI6E 4JI8E 2HKEA 3J81C 1FJGE 1H72C 1NZ0A 3B82A 1J5EE 4NXNE 4DV5I 1N34E 4P52A 3J80C 4WUDA 4MYTA 4JI2E 2ZM6I 5GMDA 1MX0A 4ED4A 3K1JA 3HULA 1XMOI 2X36A 2X7IA 4JI0I 2IOPA 4X62E 4X65I 2V34A 1N0VC 4LF9I 4B3SI 1Z0EA 2E5LI 3ZZUA 4FWDA 1RR9A 4DV7I 2PNLA 2UU9I 1Z0TA 2VQFI 1N32E 3H4LA 5A2QQ 1XMOE 4MYUA 3V5RA 4UT4A 1HNXE 1HR0E 3F0NA 2HK3A 4JI0E 1XNQI 2ZITA 4X65E 1D6TA 1FI4A 4GKJI 4KQVA 4LF9E 2F4VE 1IBMI 4B3MI 2E5LE 1Z0BA 2Z5CA 2O1TA 3JAMQ 2NPFA 3D4JA 4PRVA 1ZM2A 4DV7E 1Y4UA 2UU9E 2VQFE 4LF7I 1Z0GA 3LTOA 1XNQE 2LJPA 5L3JA 4B3RI 1U2RA 5BR8I 1IBME 4IZKA 4DPYA 3QT7A 2BM0A 2CG9A 2Z5BA 1XNRE 4LF7E 4P7AA 1B62A 4FW9A 4B3RE 4DV0I 2V2VA 4FWHA 5GMEA 4DXLA 1FWLA 4GKKI 2UXCI 4LFBI 1Z59A 1XMQE 4JI5I 2UUAI 5A2QC 1ZXNA 1N0UA 2HFUA 2O1WA 1OJ4A 4X64I 4JV5I 4B3TE 4R1FA 4DV0E 4DR3I 3B8HA 3JAMC 4GKKE 2AJ4A 4Z7YA 4JI5E 2UUAE 2O1VA 1IBKE 4DU7A 4URLA 2BM1A 4DV2I 2DEJA 1H7SA 3ZZTA 3OTOE 4JI1I 3K17A 4OX9E 2CGEA 3Q6MA 3WU4A 4IZJA 2Q2EB 4X66I 3QT8A 2CZ9A 4DR2E 4WUBA 1DARA 4JI3E 1UEKA 1Z0VA 2UUCI 4IZJD 4HXZA 3M6AA 3QT5A 4DR5E 4FN5A 3T1YI 3GONA 3PYFA 4JI4E 4KHPI 3V2UC 3Q6NA 1A6FA 4DV6I 1N33I 4DV5E 1Y4SA 5IT9Q 3T1YE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 E;  5FLX Q;  4NXM I;  3WU6 A;  1FWK A;  4DR1 I;  4B3S E;  1KKH A;  2OI2 A;  4DPW A;  4HAC B;  1S16 A;  4EMD A;  4DUZ I;  4ZVI A;  4JI7 I;  4LF6 I;  4DR7 I;  4YHH I;  2WW4 A;  4RPF A;  3ZZ0 A;  4GKJ E;  1HNW I;  4UTG A;  4B3M E;  1MG7 A;  4DPX A;  3T1H I;  4DR4 I;  3WU3 A;  4DV1 I;  1I94 I;  4JI7 E;  4LF6 E;  4DR7 E;  1PIE A;  4YHH E;  1B63 A;  1Z5A A;  2V2Z A;  5IT9 C;  5BR8 E;  1ZM3 A;  4YY3 I;  1ELO A;  3ZM7 A;  4DV3 I;  2BV3 A;  3T1H E;  1XHK A;  5FLX C;  4LFC I;  5LMN I;  4DV1 E;  1I94 E;  1MU5 A;  4DUY I;  3J7A M;  2UXB I;  1K47 A;  1EA6 A;  1KVK A;  2UXC E;  4PRX A;  4LFB E;  1NHH A;  5LMU I;  4DV3 E;  4Z7C A;  4LF4 I;  4LFC E;  4X64 E;  4JV5 E;  2VF3 A;  4K0K I;  4DR3 E;  1Z0W A;  1IBL I;  4JG4 A;  2ZBK B;  5IWA I;  4HAC A;  1KIJ A;  4LF4 E;  1PVG A;  4LFA I;  3PYG A;  1H73 A;  3ZKD A;  4DR6 I;  4JI6 I;  4JI8 I;  4DV2 E;  4K0K E;  4USM A;  4USK A;  2DEI A;  4JI1 E;  1Z5B A;  1J5E I;  2HHH I;  4JYA I;  2VQE I;  5IWA E;  1S4E A;  4DV4 I;  4JI2 I;  4X66 E;  4LFA E;  4M1K A;  4DR6 E;  1RRE A;  4X62 I;  2UUC E;  1FKA E;  1EI1 A;  1N36 I;  2HHH E;  4JYA E;  2VQE E;  2A2C A;  1BKN A;  4HY1 A;  4DV4 E;  1H74 A;  4I3H A;  4KHP E;  1N32 I;  1N33 E;  4DV6 E;  1HNX I;  1HR0 I;  1N36 E;  3LPS A;  2F4V I;  4XTJ A;  2UXD I;  3WU5 A;  2XEX A;  1Z5C A;  2E1R A;  2R3V A;  4NXM E;  4DR1 E;  1H7U A;  4WUC A;  3ZKB A;  1Z0C A;  1HNZ I;  2UXD E;  4DUZ E;  2HFS A;  1KTV A;  1NHJ A;  1XNR I;  2EFG A;  1NHI A;  4DU8 A;  2A2D A;  1HNW E;  2R42 A;  3PYE A;  3Q1Q A;  4LF5 I;  1PKP A;  1XMQ I;  1HNZ E;  4DR4 E;  1ZXM A;  1FNM A;  2UUB I;  2HK2 A;  2J7K A;  4DPU A;  4B3T I;  4DPT A;  4PU9 A;  1WUU A;  1QZR A;  5LL6 R;  4LF5 E;  3J81 Q;  4YY3 E;  3QT6 A;  1ZM9 A;  3PYD A;  1IBK I;  5LMN E;  2HKJ A;  3J80 Q;  2UUB E;  4DUY E;  4LF8 I;  2UXB E;  3J7A G;  3OTO I;  3CWV A;  4AQY I;  4OX9 I;  3B78 A;  5LMU E;  4DR2 I;  1FJG I;  4LF8 E;  4JI3 I;  4FWG A;  1IBL E;  4NXN I;  1ZM4 A;  4AQY E;  1N34 I;  4DR5 I;  3LNU A;  2GS8 A;  1VIS A;  4JI4 I;  2V8P A;  4HYM A;  2V2Q A;  4JI6 E;  4JI8 E;  2HKE A;  3J81 C;  1FJG E;  1H72 C;  1NZ0 A;  3B82 A;  1J5E E;  4NXN E;  4DV5 I;  1N34 E;  4P52 A;  3J80 C;  4WUD A;  4MYT A;  4JI2 E;  2ZM6 I;  5GMD A;  1MX0 A;  4ED4 A;  3K1J A;  3HUL A;  1XMO I;  2X36 A;  2X7I A;  4JI0 I;  4X62 E;  4X65 I;  2V34 A;  1N0V C;  4LF9 I;  4B3S I;  1Z0E A;  2E5L I;  3ZZU A;  4FWD A;  1RR9 A;  4DV7 I;  2UU9 I;  1Z0T A;  2VQF I;  1N32 E;  3H4L A;  5A2Q Q;  1XMO E;  4MYU A;  3V5R A;  4UT4 A;  1HNX E;  1HR0 E;  3F0N A;  2HK3 A;  4JI0 E;  1XNQ I;  2ZIT A;  4X65 E;  1D6T A;  1FI4 A;  4GKJ I;  4KQV A;  4LF9 E;  2F4V E;  1IBM I;  4B3M I;  2E5L E;  1Z0B A;  3JAM Q;  2NPF A;  3D4J A;  4PRV A;  1ZM2 A;  4DV7 E;  2UU9 E;  2VQF E;  4LF7 I;  1Z0G A;  3LTO A;  1XNQ E;  2LJP A;  5L3J A;  4B3R I;  1U2R A;  5BR8 I;  1IBM E;  4DPY A;  3QT7 A;  2BM0 A;  1XNR E;  4LF7 E;  4P7A A;  1B62 A;  4FW9 A;  4B3R E;  4DV0 I;  2V2V A;  4FWH A;  5GME A;  4DXL A;  1FWL A;  4GKK I;  2UXC I;  4LFB I;  1Z59 A;  1XMQ E;  4JI5 I;  2UUA I;  5A2Q C;  1ZXN A;  1N0U A;  2HFU A;  1OJ4 A;  4X64 I;  4JV5 I;  4B3T E;  4R1F A;  4DV0 E;  4DR3 I;  3B8H A;  3JAM C;  4GKK E;  2AJ4 A;  4Z7Y A;  4JI5 E;  2UUA E;  1IBK E;  4DU7 A;  4URL A;  2BM1 A;  4DV2 I;  2DEJ A;  1H7S A;  3ZZT A;  3OTO E;  4JI1 I;  3K17 A;  4OX9 E;  3WU4 A;  2Q2E B;  4X66 I;  3QT8 A;  2CZ9 A;  4DR2 E;  4WUB A;  1DAR A;  4JI3 E;  1UEK A;  1Z0V A;  2UUC I;  4HXZ A;  3M6A A;  3QT5 A;  4DR5 E;  4FN5 A;  3T1Y I;  3GON A;  3PYF A;  4JI4 E;  4KHP I;  3V2U C;  1N33 I;  1A6F A;  4DV6 I;  4DV5 E;  5IT9 Q;  3T1Y E; 
#chains in the Genus database with same CATH topology
 2ZM6 E;  2C39 A;  5FLX Q;  4FW4 A;  4FW6 A;  4NXM I;  3WU6 A;  1FWK A;  4DR1 I;  4B3S E;  1KKH A;  2OI2 A;  2C38 B;  4FW5 A;  3K85 A;  4DPW A;  4HAC B;  1S16 A;  2BA0 D;  1UDS A;  4EMD A;  4DUZ I;  4ZVI A;  4JI7 I;  2PO0 B;  4MQY A;  4LF6 I;  3HKM A;  4DR7 I;  4YHH I;  2IES A;  3P3G A;  2WW4 A;  4RPF A;  3ZZ0 A;  4GKJ E;  1HNW I;  4UTG A;  2C37 B;  4MDT A;  4B3M E;  3H1C A;  4OKG A;  1MG7 A;  4DPX A;  5C0X C;  3T1H I;  4DR4 I;  3WU3 A;  3L7Z B;  4DV1 I;  4OO1 F;  1I94 I;  4JI7 E;  4LF6 E;  3KRN A;  4DR7 E;  1Y60 A;  1PIE A;  4YHH E;  1B63 A;  1Z5A A;  4LCH A;  2V2Z A;  2JEA A;  5IT9 C;  3M85 D;  3HJC A;  5BR8 E;  4IFD A;  4MU1 A;  1ZM3 A;  4J3D A;  1ELO A;  4YY3 I;  1USV A;  3ZM7 A;  5K36 A;  4DV3 I;  2BV3 A;  2NN6 D;  3T1H E;  1XHK A;  5FLX C;  4LFC I;  5LMN I;  5K36 E;  4DV1 E;  3GLL A;  1I94 E;  1MU5 A;  4DUY I;  3J7A M;  3CDI A;  2Z5E A;  4MU3 A;  2UXB I;  5K36 D;  1K47 A;  1EA6 A;  1KVK A;  2UXC E;  4PRX A;  4LFB E;  1NHH A;  4BA1 B;  2WP8 B;  1UDQ A;  5LMU I;  4DV3 E;  4Z7C A;  4LF4 I;  1OYR A;  4MU0 A;  3GCM A;  4LFC E;  5ELW A;  4X64 E;  4JV5 E;  2O1U A;  2VF3 A;  5DRO A;  3M85 G;  4K0K I;  4DR3 E;  1Z0W A;  1IBL I;  4JG4 A;  2ZBK B;  2C38 A;  1UDO A;  5IWA I;  4HAC A;  1KIJ A;  2F1D A;  4LF4 E;  1PVG A;  4LFA I;  3PYG A;  1H73 A;  2PO0 A;  2WNR B;  3ZKD A;  4DR6 I;  4JI6 I;  4JI8 I;  4DV2 E;  4K0K E;  3P3E A;  4USM A;  2C37 A;  2DEI A;  4USK A;  1Z5B A;  5FWK A;  4JI1 E;  1J5E I;  2HHH I;  4JYA I;  2VQE I;  5K36 C;  4OO1 B;  5IWA E;  1S4E A;  4DV4 I;  4JI2 I;  4X66 E;  4LFA E;  4M1K A;  4DR6 E;  1RRE A;  4X62 I;  2UUC E;  4BA2 A;  1YH8 A;  1FKA E;  1EI1 A;  5JEA F;  5C0X F;  1N36 I;  2HHH E;  4JYA E;  2VQE E;  2A2C A;  1BKN A;  4HY1 A;  4DV4 E;  1H74 A;  1VI7 A;  4I3H A;  2VES A;  2BR2 B;  4KHP E;  1N32 I;  3PS3 A;  1N33 E;  4DV6 E;  1HNX I;  1HR0 I;  2JEB B;  2AE8 A;  4QNK A;  1N36 E;  4AID A;  3LPS A;  2F4V I;  2PNM A;  2WP8 A;  4XTJ A;  4NBQ A;  1Y6Z A;  2UXD I;  3WU5 A;  2XEX A;  1Z5C A;  2E1R A;  3P06 A;  2R3V A;  4NXM E;  2CVE A;  2JT2 A;  4DR1 E;  5DNX A;  4AIM A;  2PO2 B;  1H7U A;  2PNZ A;  4WUC A;  3ZKB A;  2PO1 B;  1HK7 A;  1Z0C A;  1HNZ I;  2UXD E;  4IZJ B;  4DUZ E;  2HFS A;  2WNR A;  1KTV A;  1NHJ A;  1XNR I;  2EFG A;  4FW3 A;  1NHI A;  4DU8 A;  2A2D A;  1HNW E;  2R42 A;  3PYE A;  3Q1Q A;  4LF5 I;  1RHY A;  1PKP A;  4OO1 A;  4LOM A;  2BA0 G;  2NN6 F;  3B4T A;  1XMQ I;  4IFD E;  1HNZ E;  3PRY A;  4DR4 E;  2IOQ A;  1ZXM A;  2J65 A;  1FNM A;  5JEA B;  5C0X B;  2HK2 A;  2UUB I;  4IFD D;  2J7K A;  4DPU A;  4B3T I;  4DPT A;  5K36 F;  4PU9 A;  1WUU A;  1QZR A;  5LL6 R;  2GQ0 A;  2O3Z A;  4LF5 E;  3J81 Q;  4YY3 E;  3QT6 A;  3NZK A;  3M7N D;  1ZM9 A;  3PYD A;  1IBK I;  2BR2 A;  5LMN E;  1YHC A;  2HKJ A;  3J80 Q;  2UUB E;  4DUY E;  4LF8 I;  4LPF A;  2UXB E;  3J7A G;  2GO4 A;  4OZE A;  3OTO I;  3CWV A;  1Y5Y A;  4AQY I;  4OX9 I;  1E3H A;  3B78 A;  5LMU E;  2Z5C B;  3PS1 A;  4DR2 I;  4N3O A;  4U3D A;  1FJG I;  4LF8 E;  4JI3 I;  4FWG A;  4IFD C;  1IBL E;  4NXN I;  2JE6 B;  2PO2 A;  1ZM4 A;  4AQY E;  1N34 I;  4DR5 I;  4IZK B;  3LNU A;  2PO1 A;  2GS8 A;  1VIS A;  4AM3 A;  3L7Z A;  4JI4 I;  2V8P A;  2Z5B B;  1USU A;  4HYM A;  2V2Q A;  4JI6 E;  4JI8 E;  2HKE A;  4U3B A;  3J81 C;  1FJG E;  3U1Y A;  1H72 C;  1NZ0 A;  2NN6 B;  3B82 A;  1J5E E;  4NXN E;  4DV5 I;  1N34 E;  4P52 A;  3J80 C;  4WUD A;  4MYT A;  4JI2 E;  2ZM6 I;  5K36 B;  5GMD A;  3P3C A;  1MX0 A;  1XXE A;  3U1K A;  4ED4 A;  5JEA A;  5C0X A;  3K1J A;  3HUL A;  1XMO I;  2X36 A;  2X7I A;  4JI0 I;  5JEA E;  2IOP A;  4X62 E;  4X65 I;  2V34 A;  1N0V C;  4LF9 I;  4LCG A;  4B3S I;  5JEA D;  1Z0E A;  4BA1 A;  2E5L I;  3ZZU A;  4FWD A;  3UHM A;  1RR9 A;  4DV7 I;  2PNL A;  2UU9 I;  1Z0T A;  2VQF I;  1N32 E;  3H4L A;  5A2Q Q;  1XMO E;  4MYU A;  3V5R A;  4UT4 A;  1HNX E;  1HR0 E;  2BA1 D;  3F0N A;  2HK3 A;  4JI0 E;  1XNQ I;  5DRP A;  2ZIT A;  4X65 E;  1D6T A;  1FI4 A;  4GKJ I;  4KQV A;  1OYS A;  4LF9 E;  2F4V E;  1IBM I;  4B3M I;  3P76 A;  1Z0B A;  2E5L E;  2Z5C A;  1UDN A;  2O1T A;  3JAM Q;  2NPF A;  3DD6 A;  5EL9 A;  3D4J A;  4PRV A;  1ZM2 A;  4DV7 E;  1Y4U A;  2UU9 E;  2VQF E;  4LF7 I;  1Z0G A;  3LTO A;  1XNQ E;  2LJP A;  5L3J A;  4B3R I;  1U2R A;  2JE6 A;  1R6L A;  5BR8 I;  1IBM E;  4IZK A;  4DPY A;  3QT7 A;  4IS9 A;  4OO1 E;  2BM0 A;  5JEA C;  4IFD F;  2CG9 A;  2Z5B A;  1XNR E;  4LF7 E;  2BA1 G;  5DRQ A;  3GME A;  4OO1 D;  4QNJ A;  4P7A A;  2NN6 A;  1B62 A;  4FW9 A;  4B3R E;  4DV0 I;  2V2V A;  4FWH A;  5GME A;  4BA2 B;  4DXL A;  1FWL A;  4GKK I;  2NN6 E;  2UXC I;  1P42 A;  4LFB I;  1Z59 A;  1XMQ E;  4JI5 I;  2UUA I;  5A2Q C;  1ZXN A;  1N0U A;  2HFU A;  2C39 B;  4MU4 A;  2O1W A;  4GQU A;  1OJ4 A;  4X64 I;  4JV5 I;  2JEB A;  4B3T E;  5DRR A;  4R1F A;  4DV0 E;  4DR3 I;  3B8H A;  2GO3 A;  3JAM C;  4GKK E;  2AJ4 A;  4Z7Y A;  4JI5 E;  2UUA E;  2O1V A;  1IBK E;  1OYP A;  4DU7 A;  4URL A;  2BM1 A;  4DV2 I;  2DEJ A;  1H7S A;  3ZZT A;  3OTO E;  4JI1 I;  4OO1 C;  3K17 A;  4OX9 E;  5DNL A;  2CGE A;  3M7N G;  3Q6M A;  2PNZ B;  3WU4 A;  4IZJ A;  2Q2E B;  4ISA A;  4X66 I;  3QT8 A;  2CZ9 A;  4DR2 E;  4WUB A;  2NN6 C;  1DAR A;  4JI3 E;  1UEK A;  1Z0V A;  2UUC I;  2JEA B;  4IZJ D;  4HXZ A;  4LCF A;  3PS2 A;  5EKW A;  3M6A A;  3QT5 A;  4DR5 E;  4IFD B;  4FN5 A;  3T1Y I;  3GON A;  3PYF A;  4JI4 E;  4KHP I;  3V2U C;  5C0X E;  3Q6N A;  1A6F A;  3CDJ A;  4DV6 I;  1R6M A;  1N33 I;  2IER A;  1E3P A;  4DV5 E;  4FW7 A;  5C0X D;  1Y4S A;  5IT9 Q;  3T1Y E; 
#chains in the Genus database with same CATH homology
 2ZM6 E;  5FLX Q;  4NXM I;  3WU6 A;  1FWK A;  4DR1 I;  4B3S E;  1KKH A;  2OI2 A;  3K85 A;  4DPW A;  4HAC B;  1S16 A;  4EMD A;  4DUZ I;  4ZVI A;  4JI7 I;  4LF6 I;  4DR7 I;  4YHH I;  2WW4 A;  4RPF A;  3ZZ0 A;  4GKJ E;  1HNW I;  4UTG A;  4B3M E;  1MG7 A;  4DPX A;  3T1H I;  4DR4 I;  3WU3 A;  4DV1 I;  1I94 I;  4JI7 E;  4LF6 E;  4DR7 E;  1PIE A;  4YHH E;  1B63 A;  1Z5A A;  2V2Z A;  5IT9 C;  3HJC A;  5BR8 E;  1ZM3 A;  4YY3 I;  1ELO A;  1USV A;  3ZM7 A;  4DV3 I;  2BV3 A;  3T1H E;  1XHK A;  5FLX C;  4LFC I;  5LMN I;  4DV1 E;  1I94 E;  1MU5 A;  4DUY I;  3J7A M;  2Z5E A;  2UXB I;  1K47 A;  1EA6 A;  1KVK A;  2UXC E;  4PRX A;  4LFB E;  1NHH A;  5LMU I;  4DV3 E;  4Z7C A;  4LF4 I;  4LFC E;  4X64 E;  4JV5 E;  2O1U A;  2VF3 A;  4K0K I;  4DR3 E;  1Z0W A;  1IBL I;  4JG4 A;  2ZBK B;  5IWA I;  4HAC A;  1KIJ A;  4LF4 E;  1PVG A;  4LFA I;  3PYG A;  1H73 A;  3ZKD A;  4DR6 I;  4JI6 I;  4JI8 I;  4DV2 E;  4K0K E;  4USM A;  4USK A;  2DEI A;  4JI1 E;  1Z5B A;  5FWK A;  1J5E I;  2HHH I;  4JYA I;  2VQE I;  5IWA E;  1S4E A;  4DV4 I;  4JI2 I;  4X66 E;  4LFA E;  4M1K A;  4DR6 E;  1RRE A;  4X62 I;  2UUC E;  1FKA E;  1EI1 A;  1N36 I;  2HHH E;  4JYA E;  2VQE E;  2A2C A;  1BKN A;  4HY1 A;  4DV4 E;  1H74 A;  4I3H A;  4KHP E;  1N32 I;  1N33 E;  4DV6 E;  1HNX I;  1HR0 I;  1N36 E;  3LPS A;  2F4V I;  2PNM A;  4XTJ A;  1Y6Z A;  2UXD I;  3WU5 A;  2XEX A;  1Z5C A;  2E1R A;  3P06 A;  2R3V A;  4NXM E;  4DR1 E;  1H7U A;  4WUC A;  3ZKB A;  1HK7 A;  1Z0C A;  1HNZ I;  2UXD E;  4IZJ B;  4DUZ E;  2HFS A;  1KTV A;  1NHJ A;  1XNR I;  2EFG A;  1NHI A;  4DU8 A;  2A2D A;  1HNW E;  2R42 A;  3PYE A;  3Q1Q A;  4LF5 I;  1PKP A;  1XMQ I;  1HNZ E;  3PRY A;  4DR4 E;  2IOQ A;  1ZXM A;  1FNM A;  2UUB I;  2HK2 A;  2J7K A;  4DPU A;  4B3T I;  4DPT A;  4PU9 A;  1WUU A;  1QZR A;  5LL6 R;  2GQ0 A;  4LF5 E;  3J81 Q;  4YY3 E;  3QT6 A;  1ZM9 A;  3PYD A;  1IBK I;  5LMN E;  2HKJ A;  3J80 Q;  2UUB E;  4DUY E;  4LF8 I;  2UXB E;  3J7A G;  3OTO I;  3CWV A;  4AQY I;  4OX9 I;  3B78 A;  5LMU E;  2Z5C B;  4DR2 I;  4N3O A;  1FJG I;  4LF8 E;  4JI3 I;  4FWG A;  1IBL E;  4NXN I;  1ZM4 A;  4AQY E;  1N34 I;  4DR5 I;  4IZK B;  3LNU A;  2GS8 A;  1VIS A;  4JI4 I;  2V8P A;  2Z5B B;  1USU A;  4HYM A;  2V2Q A;  4JI6 E;  4JI8 E;  2HKE A;  3J81 C;  1FJG E;  1H72 C;  1NZ0 A;  3B82 A;  1J5E E;  4NXN E;  4DV5 I;  1N34 E;  4P52 A;  3J80 C;  4WUD A;  4MYT A;  4JI2 E;  2ZM6 I;  5GMD A;  1MX0 A;  4ED4 A;  3K1J A;  3HUL A;  1XMO I;  2X36 A;  2X7I A;  4JI0 I;  2IOP A;  4X62 E;  4X65 I;  2V34 A;  1N0V C;  4LF9 I;  4B3S I;  1Z0E A;  2E5L I;  3ZZU A;  4FWD A;  1RR9 A;  4DV7 I;  2PNL A;  2UU9 I;  1Z0T A;  2VQF I;  1N32 E;  3H4L A;  5A2Q Q;  1XMO E;  4MYU A;  3V5R A;  4UT4 A;  1HNX E;  1HR0 E;  3F0N A;  2HK3 A;  4JI0 E;  1XNQ I;  2ZIT A;  4X65 E;  1D6T A;  1FI4 A;  4GKJ I;  4KQV A;  4LF9 E;  2F4V E;  1IBM I;  4B3M I;  2E5L E;  1Z0B A;  2Z5C A;  2O1T A;  3JAM Q;  2NPF A;  3D4J A;  4PRV A;  1ZM2 A;  4DV7 E;  1Y4U A;  2UU9 E;  2VQF E;  4LF7 I;  1Z0G A;  3LTO A;  1XNQ E;  2LJP A;  5L3J A;  4B3R I;  1U2R A;  5BR8 I;  1IBM E;  4IZK A;  4DPY A;  3QT7 A;  2BM0 A;  2CG9 A;  2Z5B A;  1XNR E;  4LF7 E;  4P7A A;  1B62 A;  4FW9 A;  4B3R E;  4DV0 I;  2V2V A;  4FWH A;  5GME A;  4DXL A;  1FWL A;  4GKK I;  2UXC I;  4LFB I;  1Z59 A;  1XMQ E;  4JI5 I;  2UUA I;  5A2Q C;  1ZXN A;  1N0U A;  2HFU A;  2O1W A;  1OJ4 A;  4X64 I;  4JV5 I;  4B3T E;  4R1F A;  4DV0 E;  4DR3 I;  3B8H A;  3JAM C;  4GKK E;  2AJ4 A;  4Z7Y A;  4JI5 E;  2UUA E;  2O1V A;  1IBK E;  4DU7 A;  4URL A;  2BM1 A;  4DV2 I;  2DEJ A;  1H7S A;  3ZZT A;  3OTO E;  4JI1 I;  3K17 A;  4OX9 E;  2CGE A;  3Q6M A;  3WU4 A;  4IZJ A;  2Q2E B;  4X66 I;  3QT8 A;  2CZ9 A;  4DR2 E;  4WUB A;  1DAR A;  4JI3 E;  1UEK A;  1Z0V A;  2UUC I;  4IZJ D;  4HXZ A;  3M6A A;  3QT5 A;  4DR5 E;  4FN5 A;  3T1Y I;  3GON A;  3PYF A;  4JI4 E;  4KHP I;  3V2U C;  3Q6N A;  1A6F A;  4DV6 I;  1N33 I;  4DV5 E;  1Y4S A;  5IT9 Q;  3T1Y E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...