1XMQI

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmqI00
5LMNE 3PYDA 1XMQI 4DR6I 2NPFA 2VQEE 1XMOI 1FJGE 2VQFE 4DU7A 4NXNE 1N0UA 1Z59A 5A2QC 2VQFI 4NXNI 2ZM6E 2EFGA 4WUCA 4RPFA 4KQVA 1Z5AA 2HK3A 4DR5E 4DPXA 1J5EI 4AQYE 4OX9E 5LMUE 2DEIA 3B78A 4YHHE 1B63A 2V2QA 1Z0TA 4LFBE 4DR5I 1K47A 5GMEA 4OX9I 1PVGA 3GONA 4YHHI 3K1JA 4LF4E 4DR7E 3WU3A 5IWAI 2HKEA 4DV2I 1HNZE 4XTJA 1Z0EA 1KVKA 4GKJE 4JYAE 4DR7I 4FWDA 4JI4E 1ZM4A 2E1RA 1HR0I 1HNZI 4FW9A 1S4EA 4X62I 4JI4I 3LPSA 3QT5A 4DPWA 4JI2I 1VISA 4PU9A 4DR4I 4LF9E 2UUAE 2AJ4A 4LF9I 5FLXC 4B3MI 3WU4A 1Z0GA 4JV5I 4JI6I 1XNQE 4JI7E 3T1HE 3J81Q 2GS8A 1XNRI 3B8HA 3J80Q 3D4JA 4LF5E 3T1HI 4JI7I 2F4VE 1RR9A 1ZM3A 4B3TE 1NHIA 4LF5I 1N33E 3V2UC 4DV7E 2F4VI 1IBME 4X64I 1KIJA 4B3TI 5A2QQ 4FN5A 4LFAE 2WW4A 4DV4E 3QT6A 4LFAI 4DR1E 4DV4I 2VF3A 4LFCI 3LNUA 4DPYA 4DR1I 4DR6E 4JI1E 3JAMC 1XMOE 4JI0E 3ZZUA 2DEJA 4Z7YA 2UUBI 1Z0VA 4JI1I 4JI0I 5L3JA 5BR8I 1IBKE 3LTOA 4MYUA 4DR3E 3HULA 1IBKI 2XEXA 4LF8I 2UXDI 1Z5CA 3QT8A 3M6AA 4DR3I 1MX0A 4ZVIA 1J5EE 4JI8I 2BM0A 4USKA 4P52A 3PYGA 1XHKA 5FLXQ 5IWAE 2HFSA 3T1YE 4DV2E 4ED4A 1NHJA 1UEKA 1EA6A 4DUYI 3T1YI 4LF6I 1HR0E 3WU5A 4X62E 1FNMA 4DV3I 4DUZI 2R42A 4JI2E 1HNWE 4Z7CA 2E5LI 1MU5A 4DR4E 4M1KA 1HNWI 2LJPA 1N34I 4DV6I 5LL6R 4B3ME 2V34A 1KTVA 4FWHA 4JV5E 1FWKA 4JI6E 4GKKI 1D6TA 4JG4A 2OI2A 2CZ9A 1XNRE 4JI3E 4X66I 4PRVA 1ELOA 2HHHE 1U2RA 1KKHA 4HY1A 3JAMQ 4JI3I 4X64E 2HHHI 1H74A 3WU6A 4EMDA 1IBLE 4UTGA 1HNXI 1EI1A 1RREA 1IBLI 5IT9C 4B3RE 3H4LA 4P7AA 4LFCE 4R1FA 4UT4A 4B3RI 4DV5I 2UU9I 3J7AG 2UUBE 3J7AM 4K0KI 5BR8E 1S16A 1N0VC 1FI4A 1OJ4A 3ZZTA 4LF8E 4X65I 2BM1A 2UXDE 3OTOI 4DV0E 1QZRA 1Z0WA 3F0NA 4DPTA 4JI5E 2V2ZA 1I94E 4DV0I 2UXCI 4JI5I 1I94I 4JI8E 1B62A 2R3VA 2V8PA 5LMNI 3ZKDA 2A2CA 1Z5BA 2VQEI 1FWLA 1FJGI 1H72C 1H7SA 4FWGA 2UXBE 2Q2EB 2UUCE 4HACA 4DUYE 3ZKBA 2ZM6I 4LF6E 2V2VA 2UXBI 4DV3E 4DUZE 1PIEA 4PRXA 4HYMA 2ZITA 2UUCI 2E5LE 2X36A 3ZZ0A 1ZM2A 1Z0BA 1N34E 4YY3E 4DV6E 4WUBA 4WUDA 4AQYI 5LMUI 1DARA 1ZXMA 4DV1E 4DXLA 4YY3I 4LFBI 4NXME 5GMDA 4DR2E 4GKKE 4DV1I 4LF4I 1NHHA 4NXMI 2HKJA 3ZM7A 5IT9Q 4DR2I 4B3SE 4GKJI 4JYAI 3QT7A 1H73A 3PYFA 4X66E 2BV3A 2A2DA 2HFUA 1N32E 4B3SI 1WUUA 4URLA 4DPUA 1PKPA 1N32I 3K17A 3V5RA 2ZBKB 1MG7A 4DU8A 4USMA 2UUAI 1HNXE 1N36E 2J7KA 1A6FA 1N36I 4LF7E 4DV5E 1BKNA 4MYTA 1XNQI 2UU9E 4LF7I 4KHPE 1ZM9A 2X7IA 4I3HA 4K0KE 4HXZA 3PYEA 4KHPI 1N33I 4DV7I 1IBMI 3B82A 1H7UA 4X65E 3OTOE 1FKAE 3Q1QA 3CWVA 1Z0CA 2HK2A 3J81C 2UXCE 1XMQE 1ZXNA 3J80C 4HACB 1NZ0A
chains in the Genus database with same CATH superfamily
5LMNE 3PYDA 4BA2A 1XMQI 4DR6I 4U3BA 2NPFA 2VQEE 1XMOI 1FJGE 2CG9A 2VQFE 4DU7A 4NXNE 1N0UA 1Z59A 2CVEA 4AIDA 5A2QC 2VQFI 4NXNI 2ZM6E 2EFGA 4WUCA 4RPFA 4ISAA 3Q6NA 1Y6ZA 3UHMA 4KQVA 1Z5AA 4BA1B 3M7NG 3PS2A 2HK3A 1USVA 5DNLA 4DR5E 4DPXA 3P3EA 1J5EI 4AQYE 4OX9E 5LMUE 2DEIA 3B78A 4FW4A 4YHHE 1B63A 2V2QA 1Z0TA 2NN6F 4DR5I 4LFBE 1K47A 5GMEA 4OX9I 1PVGA 4GQUA 3GONA 4AIMA 4U3DA 4YHHI 3K1JA 4LF4E 4DR7E 4BA1A 3WU3A 5IWAI 1P42A 5ELWA 2HKEA 4DV2I 1HNZE 4XTJA 1Z0EA 1KVKA 5C0XE 2NN6C 4JYAE 4GKJE 4DR7I 3P76A 3HKMA 4FWDA 4JI4E 4OZEA 1ZM4A 2E1RA 5DNXA 1HR0I 1HNZI 4FW9A 1S4EA 2PO0B 1R6LA 4X62I 2Z5CB 1OYRA 4JI4I 3LPSA 3QT5A 4DPWA 4JI2I 1VISA 4PU9A 2JE6A 4DR4I 4LF9E 2UUAE 2JEBA 3CDIA 5K36A 2AJ4A 1OYPA 4LF9I 5FLXC 4B3MI 3PRYA 3WU4A 4OO1E 1Z0GA 3PS1A 4JV5I 2C38B 4OO1D 4JI6I 1XNQE 4JI7E 3T1HE 3J81Q 2GS8A 1XNRI 3B8HA 3J80Q 3D4JA 4LF5E 4IZJA 3T1HI 4JI7I 2F4VE 1RR9A 3M85D 2JT2A 4IFDB 1ZM3A 4B3TE 1NHIA 4LF5I 3GCMA 4J3DA 1N33E 2GO3A 3V2UC 4DV7E 1E3HA 1E3PA 2F4VI 4IS9A 1IBME 2J65A 1XXEA 4X64I 1KIJA 5JEAF 2Z5EA 4B3TI 5A2QQ 4FN5A 4LFAE 2WW4A 5DRPA 4NBQA 4DV4E 3QT6A 2WNRA 4LFAI 3KRNA 5JEAC 4FW6A 4DR1E 4DV4I 2VF3A 4LFCI 3LNUA 4DPYA 2BA1D 4DR1I 4DR6E 5EL9A 2C37A 4JI1E 3JAMC 5JEAD 1XMOE 4JI0E 3ZZUA 2DEJA 1YHCA 4Z7YA 2UUBI 1Z0VA 4MU3A 4JI1I 5C0XB 4JI0I 5L3JA 5BR8I 1IBKE 2BR2A 3LTOA 4MYUA 1UDQA 4DR3E 3HULA 4IZKA 4IFDF 1IBKI 2XEXA 1YH8A 5DRQA 3P3CA 4LF8I 2UXDI 1Z5CA 3QT8A 3M6AA 4DR3I 1MX0A 2BA0D 4ZVIA 1J5EE 4IFDC 4JI8I 2BM0A 5C0XA 3K85A 4USKA 2PNZA 4P52A 3PYGA 2IESA 4FW5A 1XHKA 3H1CA 4IFDD 5FLXQ 5IWAE 2JE6B 2HFSA 3T1YE 4DV2E 4ED4A 1NHJA 4LPFA 3L7ZA 1UEKA 1EA6A 2JEBB 4DUYI 5K36B 3T1YI 4LF6I 1HR0E 3WU5A 3NZKA 4X62E 1FNMA 2PO1B 2PNMA 4DV3I 4DUZI 1RHYA 2GO4A 2R42A 4JI2E 1HNWE 4OO1A 4Z7CA 2E5LI 1MU5A 4DR4E 2PO2A 4M1KA 5EKWA 2GQ0A 1HNWI 2LJPA 2NN6D 4FW3A 5DRRA 3HJCA 1N34I 4DV6I 4IZJB 5LL6R 4B3ME 2V34A 1KTVA 4FWHA 4JV5E 4LCHA 1FWKA 4JI6E 2PO1A 3Q6MA 4GKKI 1D6TA 4JG4A 2OI2A 2CZ9A 1XNRE 2IOPA 1OYSA 1Y60A 4JI3E 5FWKA 4OKGA 4X66I 2IERA 2WNRB 1ELOA 4PRVA 2HHHE 1U2RA 1KKHA 4HY1A 3JAMQ 4JI3I 5K36F 4X64E 2HHHI 2O1VA 2WP8A 1Y4UA 1H74A 3WU6A 4EMDA 2C37B 1IBLE 4UTGA 1HNXI 1EI1A 1RREA 3M7ND 5K36C 2O1UA 1IBLI 5IT9C 4B3RE 3H4LA 2F1DA 4P7AA 4LFCE 3B4TA 2BR2B 4AM3A 4R1FA 4UT4A 2VESA 4B3RI 4DV5I 3PS3A 4IZKB 2UU9I 3J7AG 5JEAE 4LCFA 2UUBE 3J7AM 4MU1A 4K0KI 5BR8E 1UDNA 1S16A 1N0VC 2Z5BA 1FI4A 4LCGA 1OJ4A 3P06A 2PNZB 3ZZTA 4LF8E 4X65I 2BM1A 2UXDE 3OTOI 4DV0E 1QZRA 1Z0WA 3F0NA 4DPTA 4JI5E 2V2ZA 1I94E 2JEAA 4MDTA 4DV0I 2UXCI 4JI5I 2PNLA 1I94I 3L7ZB 4JI8E 1B62A 3P3GA 2R3VA 2V8PA 1Y4SA 3ZKDA 5LMNI 2A2CA 1Z5BA 3M85G 3CDJA 2VQEI 4OO1B 2AE8A 1FWLA 1FJGI 1Y5YA 4IFDE 2PO2B 2NN6A 4N3OA 1H72C 1H7SA 4FWGA 2UXBE 2C39A 2Q2EB 2UUCE 4HACA 4DUYE 3ZKBA 2ZM6I 4LF6E 2V2VA 2UXBI 2O3ZA 3U1YA 4DV3E 4DUZE 1PIEA 4PRXA 4HYMA 2ZITA 2UUCI 1HK7A 2E5LE 2X36A 3GMEA 1USUA 3ZZ0A 5C0XF 5DROA 1ZM2A 1Z0BA 1N34E 2BA1G 2CGEA 1UDOA 2NN6E 4YY3E 4DV6E 4WUBA 4WUDA 4AQYI 5LMUI 1DARA 3U1KA 1ZXMA 4MQYA 2IOQA 4QNJA 5C0XC 4DV1E 4DXLA 4YY3I 4MU0A 4LFBI 4NXME 5GMDA 4DR2E 4GKKE 4DV1I 4LF4I 1NHHA 2WP8B 4MU4A 2HKJA 4NXMI 3ZM7A 5C0XD 5IT9Q 4DR2I 5JEAB 1R6MA 4B3SE 4OO1F 4GKJI 4JYAI 3QT7A 1H73A 3PYFA 4X66E 2BV3A 2A2DA 2HFUA 1N32E 4QNKA 4B3SI 2BA0G 1WUUA 4URLA 4DPUA 1PKPA 1N32I 4OO1C 4FW7A 3K17A 3V5RA 2ZBKB 1MG7A 4DU8A 4USMA 2UUAI 1HNXE 5JEAA 1N36E 2J7KA 2PO0A 2Z5CA 1A6FA 2Z5BB 1N36I 4LF7E 4DV5E 1BKNA 4MYTA 1XNQI 2O1TA 2UU9E 1VI7A 5K36E 4LOMA 4LF7I 4KHPE 1ZM9A 5K36D 2X7IA 3GLLA 4I3HA 2JEAB 4K0KE 4HXZA 3PYEA 4BA2B 4KHPI 1N33I 2C38A 4DV7I 2O1WA 1IBMI 3DD6A 3B82A 1H7UA 4X65E 3OTOE 1FKAE 3Q1QA 3CWVA 1Z0CA 4IZJD 2HK2A 3J81C 4IFDA 2NN6B 2UXCE 1UDSA 1XMQE 1ZXNA 2C39B 3J80C 4HACB 1NZ0A
chains in the Genus database with same CATH topology
5LMNE 3PYDA 1XMQI 4DR6I 2NPFA 2VQEE 1XMOI 1FJGE 2CG9A 2VQFE 4DU7A 4NXNE 1N0UA 1Z59A 5A2QC 2VQFI 4NXNI 2ZM6E 2EFGA 4WUCA 4RPFA 3Q6NA 1Y6ZA 4KQVA 1Z5AA 2HK3A 1USVA 4DR5E 4DPXA 1J5EI 4AQYE 4OX9E 5LMUE 2DEIA 3B78A 4YHHE 1B63A 2V2QA 1Z0TA 4LFBE 4DR5I 1K47A 5GMEA 4OX9I 1PVGA 3GONA 4YHHI 3K1JA 4LF4E 4DR7E 3WU3A 5IWAI 2HKEA 4DV2I 1HNZE 4XTJA 1Z0EA 1KVKA 4GKJE 4JYAE 4DR7I 4FWDA 4JI4E 1ZM4A 2E1RA 1HR0I 1HNZI 4FW9A 1S4EA 4X62I 2Z5CB 4JI4I 3LPSA 3QT5A 4DPWA 4JI2I 1VISA 4PU9A 4DR4I 4LF9E 2UUAE 2AJ4A 4LF9I 5FLXC 4B3MI 3PRYA 3WU4A 1Z0GA 4JV5I 4JI6I 1XNQE 4JI7E 3T1HE 3J81Q 2GS8A 1XNRI 3B8HA 3J80Q 3D4JA 4LF5E 4IZJA 3T1HI 4JI7I 2F4VE 1RR9A 1ZM3A 4B3TE 1NHIA 4LF5I 1N33E 3V2UC 4DV7E 2F4VI 1IBME 4X64I 1KIJA 2Z5EA 4B3TI 5A2QQ 4FN5A 4LFAE 2WW4A 4DV4E 3QT6A 4LFAI 4DR1E 4DV4I 2VF3A 4LFCI 3LNUA 4DPYA 4DR1I 4DR6E 4JI1E 3JAMC 1XMOE 4JI0E 3ZZUA 2DEJA 4Z7YA 2UUBI 1Z0VA 4JI1I 4JI0I 5L3JA 5BR8I 1IBKE 3LTOA 4MYUA 4DR3E 3HULA 4IZKA 1IBKI 2XEXA 4LF8I 2UXDI 1Z5CA 3QT8A 3M6AA 4DR3I 1MX0A 4ZVIA 1J5EE 4JI8I 2BM0A 3K85A 4USKA 4P52A 3PYGA 1XHKA 5FLXQ 5IWAE 2HFSA 3T1YE 4DV2E 4ED4A 1NHJA 1UEKA 1EA6A 4DUYI 3T1YI 4LF6I 1HR0E 3WU5A 4X62E 1FNMA 2PNMA 4DV3I 4DUZI 2R42A 4JI2E 1HNWE 4Z7CA 2E5LI 1MU5A 4DR4E 4M1KA 2GQ0A 1HNWI 2LJPA 3HJCA 1N34I 4DV6I 4IZJB 5LL6R 4B3ME 2V34A 1KTVA 4FWHA 4JV5E 1FWKA 4JI6E 3Q6MA 4GKKI 1D6TA 4JG4A 2OI2A 2CZ9A 1XNRE 2IOPA 4JI3E 5FWKA 4X66I 4PRVA 1ELOA 2HHHE 1U2RA 1KKHA 4HY1A 3JAMQ 4JI3I 4X64E 2HHHI 2O1VA 1Y4UA 1H74A 3WU6A 4EMDA 1IBLE 4UTGA 1HNXI 1EI1A 1RREA 2O1UA 1IBLI 5IT9C 4B3RE 3H4LA 4P7AA 4LFCE 4R1FA 4UT4A 4B3RI 4DV5I 4IZKB 2UU9I 3J7AG 2UUBE 3J7AM 4K0KI 5BR8E 1S16A 1N0VC 2Z5BA 1FI4A 1OJ4A 3P06A 3ZZTA 4LF8E 4X65I 2BM1A 2UXDE 3OTOI 4DV0E 1QZRA 1Z0WA 3F0NA 4DPTA 4JI5E 2V2ZA 1I94E 4DV0I 2UXCI 4JI5I 2PNLA 1I94I 4JI8E 1B62A 2R3VA 2V8PA 1Y4SA 3ZKDA 5LMNI 2A2CA 1Z5BA 2VQEI 1FWLA 1FJGI 4N3OA 1H72C 1H7SA 4FWGA 2UXBE 2Q2EB 2UUCE 4HACA 4DUYE 3ZKBA 2ZM6I 4LF6E 2V2VA 2UXBI 4DV3E 4DUZE 1PIEA 4PRXA 4HYMA 2ZITA 2UUCI 1HK7A 2E5LE 2X36A 3ZZ0A 1USUA 1ZM2A 1Z0BA 1N34E 2CGEA 4YY3E 4DV6E 4WUBA 4WUDA 4AQYI 5LMUI 1DARA 1ZXMA 2IOQA 4DV1E 4DXLA 4YY3I 4LFBI 4NXME 5GMDA 4DR2E 4GKKE 4DV1I 4LF4I 1NHHA 4NXMI 2HKJA 3ZM7A 5IT9Q 4DR2I 4B3SE 4GKJI 4JYAI 3QT7A 1H73A 3PYFA 4X66E 2BV3A 2A2DA 2HFUA 1N32E 4B3SI 1WUUA 4URLA 4DPUA 1PKPA 1N32I 3K17A 3V5RA 2ZBKB 1MG7A 4DU8A 4USMA 2UUAI 1HNXE 1N36E 2J7KA 2Z5CA 1A6FA 2Z5BB 1N36I 4LF7E 4DV5E 1BKNA 4MYTA 1XNQI 2O1TA 2UU9E 4LF7I 4KHPE 1ZM9A 2X7IA 4I3HA 4K0KE 4HXZA 3PYEA 4KHPI 1N33I 4DV7I 2O1WA 1IBMI 3B82A 1H7UA 4X65E 3OTOE 1FKAE 3Q1QA 3CWVA 1Z0CA 4IZJD 2HK2A 3J81C 2UXCE 1XMQE 1ZXNA 3J80C 4HACB 1NZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN E;  3PYD A;  1XMQ I;  4DR6 I;  2NPF A;  2VQE E;  1XMO I;  1FJG E;  2VQF E;  4DU7 A;  4NXN E;  1N0U A;  1Z59 A;  5A2Q C;  2VQF I;  4NXN I;  2ZM6 E;  2EFG A;  4WUC A;  4RPF A;  4KQV A;  1Z5A A;  2HK3 A;  4DR5 E;  4DPX A;  1J5E I;  4AQY E;  4OX9 E;  5LMU E;  2DEI A;  3B78 A;  4YHH E;  1B63 A;  2V2Q A;  1Z0T A;  4LFB E;  4DR5 I;  1K47 A;  5GME A;  4OX9 I;  1PVG A;  3GON A;  4YHH I;  3K1J A;  4LF4 E;  4DR7 E;  3WU3 A;  5IWA I;  2HKE A;  4DV2 I;  1HNZ E;  4XTJ A;  1Z0E A;  1KVK A;  4GKJ E;  4JYA E;  4DR7 I;  4FWD A;  4JI4 E;  1ZM4 A;  2E1R A;  1HR0 I;  1HNZ I;  4FW9 A;  1S4E A;  4X62 I;  4JI4 I;  3LPS A;  3QT5 A;  4DPW A;  4JI2 I;  1VIS A;  4PU9 A;  4DR4 I;  4LF9 E;  2UUA E;  2AJ4 A;  4LF9 I;  5FLX C;  4B3M I;  3WU4 A;  1Z0G A;  4JV5 I;  4JI6 I;  1XNQ E;  4JI7 E;  3T1H E;  3J81 Q;  2GS8 A;  1XNR I;  3B8H A;  3J80 Q;  3D4J A;  4LF5 E;  3T1H I;  4JI7 I;  2F4V E;  1RR9 A;  1ZM3 A;  4B3T E;  1NHI A;  4LF5 I;  1N33 E;  3V2U C;  4DV7 E;  2F4V I;  1IBM E;  4X64 I;  1KIJ A;  4B3T I;  5A2Q Q;  4FN5 A;  4LFA E;  2WW4 A;  4DV4 E;  3QT6 A;  4LFA I;  4DR1 E;  4DV4 I;  2VF3 A;  4LFC I;  3LNU A;  4DPY A;  4DR1 I;  4DR6 E;  4JI1 E;  3JAM C;  1XMO E;  4JI0 E;  3ZZU A;  2DEJ A;  4Z7Y A;  2UUB I;  1Z0V A;  4JI1 I;  4JI0 I;  5L3J A;  5BR8 I;  1IBK E;  3LTO A;  4MYU A;  4DR3 E;  3HUL A;  1IBK I;  2XEX A;  4LF8 I;  2UXD I;  1Z5C A;  3QT8 A;  3M6A A;  4DR3 I;  1MX0 A;  4ZVI A;  1J5E E;  4JI8 I;  2BM0 A;  4USK A;  4P52 A;  3PYG A;  1XHK A;  5FLX Q;  5IWA E;  2HFS A;  3T1Y E;  4DV2 E;  4ED4 A;  1NHJ A;  1UEK A;  1EA6 A;  4DUY I;  3T1Y I;  4LF6 I;  1HR0 E;  3WU5 A;  4X62 E;  1FNM A;  4DV3 I;  4DUZ I;  2R42 A;  4JI2 E;  1HNW E;  4Z7C A;  2E5L I;  1MU5 A;  4DR4 E;  4M1K A;  1HNW I;  2LJP A;  1N34 I;  4DV6 I;  5LL6 R;  4B3M E;  2V34 A;  1KTV A;  4FWH A;  4JV5 E;  1FWK A;  4JI6 E;  4GKK I;  1D6T A;  4JG4 A;  2OI2 A;  2CZ9 A;  1XNR E;  4JI3 E;  4X66 I;  4PRV A;  1ELO A;  2HHH E;  1U2R A;  1KKH A;  4HY1 A;  3JAM Q;  4JI3 I;  4X64 E;  2HHH I;  1H74 A;  3WU6 A;  4EMD A;  1IBL E;  4UTG A;  1HNX I;  1EI1 A;  1RRE A;  1IBL I;  5IT9 C;  4B3R E;  3H4L A;  4P7A A;  4LFC E;  4R1F A;  4UT4 A;  4B3R I;  4DV5 I;  2UU9 I;  3J7A G;  2UUB E;  3J7A M;  4K0K I;  5BR8 E;  1S16 A;  1N0V C;  1FI4 A;  1OJ4 A;  3ZZT A;  4LF8 E;  4X65 I;  2BM1 A;  2UXD E;  3OTO I;  4DV0 E;  1QZR A;  1Z0W A;  3F0N A;  4DPT A;  4JI5 E;  2V2Z A;  1I94 E;  4DV0 I;  2UXC I;  4JI5 I;  1I94 I;  4JI8 E;  1B62 A;  2R3V A;  2V8P A;  5LMN I;  3ZKD A;  2A2C A;  1Z5B A;  2VQE I;  1FWL A;  1FJG I;  1H72 C;  1H7S A;  4FWG A;  2UXB E;  2Q2E B;  2UUC E;  4HAC A;  4DUY E;  3ZKB A;  2ZM6 I;  4LF6 E;  2V2V A;  2UXB I;  4DV3 E;  4DUZ E;  1PIE A;  4PRX A;  4HYM A;  2ZIT A;  2UUC I;  2E5L E;  2X36 A;  3ZZ0 A;  1ZM2 A;  1Z0B A;  1N34 E;  4YY3 E;  4DV6 E;  4WUB A;  4WUD A;  4AQY I;  5LMU I;  1DAR A;  1ZXM A;  4DV1 E;  4DXL A;  4YY3 I;  4LFB I;  4NXM E;  5GMD A;  4DR2 E;  4GKK E;  4DV1 I;  4LF4 I;  1NHH A;  4NXM I;  2HKJ A;  3ZM7 A;  5IT9 Q;  4DR2 I;  4B3S E;  4GKJ I;  4JYA I;  3QT7 A;  1H73 A;  3PYF A;  4X66 E;  2BV3 A;  2A2D A;  2HFU A;  1N32 E;  4B3S I;  1WUU A;  4URL A;  4DPU A;  1PKP A;  1N32 I;  3K17 A;  3V5R A;  2ZBK B;  1MG7 A;  4DU8 A;  4USM A;  2UUA I;  1HNX E;  1N36 E;  2J7K A;  1A6F A;  1N36 I;  4LF7 E;  4DV5 E;  1BKN A;  4MYT A;  1XNQ I;  2UU9 E;  4LF7 I;  4KHP E;  1ZM9 A;  2X7I A;  4I3H A;  4K0K E;  4HXZ A;  3PYE A;  4KHP I;  1N33 I;  4DV7 I;  1IBM I;  3B82 A;  1H7U A;  4X65 E;  3OTO E;  1FKA E;  3Q1Q A;  3CWV A;  1Z0C A;  2HK2 A;  3J81 C;  2UXC E;  1XMQ E;  1ZXN A;  3J80 C;  4HAC B;  1NZ0 A; 
#chains in the Genus database with same CATH topology
 5LMN E;  3PYD A;  4BA2 A;  1XMQ I;  4DR6 I;  4U3B A;  2NPF A;  2VQE E;  1XMO I;  1FJG E;  2CG9 A;  2VQF E;  4DU7 A;  4NXN E;  1N0U A;  1Z59 A;  2CVE A;  4AID A;  5A2Q C;  2VQF I;  4NXN I;  2ZM6 E;  2EFG A;  4WUC A;  4RPF A;  4ISA A;  3Q6N A;  1Y6Z A;  3UHM A;  4KQV A;  1Z5A A;  4BA1 B;  3M7N G;  3PS2 A;  2HK3 A;  1USV A;  5DNL A;  4DR5 E;  4DPX A;  3P3E A;  1J5E I;  4AQY E;  4OX9 E;  5LMU E;  2DEI A;  3B78 A;  4FW4 A;  4YHH E;  1B63 A;  2V2Q A;  1Z0T A;  2NN6 F;  4DR5 I;  4LFB E;  1K47 A;  5GME A;  4OX9 I;  1PVG A;  4GQU A;  3GON A;  4AIM A;  4U3D A;  4YHH I;  3K1J A;  4LF4 E;  4DR7 E;  4BA1 A;  3WU3 A;  5IWA I;  1P42 A;  5ELW A;  2HKE A;  4DV2 I;  1HNZ E;  4XTJ A;  1Z0E A;  1KVK A;  5C0X E;  2NN6 C;  4JYA E;  4GKJ E;  4DR7 I;  3P76 A;  3HKM A;  4FWD A;  4JI4 E;  4OZE A;  1ZM4 A;  2E1R A;  5DNX A;  1HR0 I;  1HNZ I;  4FW9 A;  1S4E A;  2PO0 B;  1R6L A;  4X62 I;  2Z5C B;  1OYR A;  4JI4 I;  3LPS A;  3QT5 A;  4DPW A;  4JI2 I;  1VIS A;  4PU9 A;  2JE6 A;  4DR4 I;  4LF9 E;  2UUA E;  2JEB A;  3CDI A;  5K36 A;  2AJ4 A;  1OYP A;  4LF9 I;  5FLX C;  4B3M I;  3PRY A;  3WU4 A;  4OO1 E;  1Z0G A;  3PS1 A;  4JV5 I;  2C38 B;  4OO1 D;  4JI6 I;  1XNQ E;  4JI7 E;  3T1H E;  3J81 Q;  2GS8 A;  1XNR I;  3B8H A;  3J80 Q;  3D4J A;  4LF5 E;  4IZJ A;  3T1H I;  4JI7 I;  2F4V E;  1RR9 A;  3M85 D;  2JT2 A;  4IFD B;  1ZM3 A;  4B3T E;  1NHI A;  4LF5 I;  3GCM A;  4J3D A;  1N33 E;  2GO3 A;  3V2U C;  4DV7 E;  1E3H A;  1E3P A;  2F4V I;  4IS9 A;  1IBM E;  2J65 A;  1XXE A;  4X64 I;  1KIJ A;  5JEA F;  2Z5E A;  4B3T I;  5A2Q Q;  4FN5 A;  4LFA E;  2WW4 A;  5DRP A;  4NBQ A;  4DV4 E;  3QT6 A;  2WNR A;  4LFA I;  3KRN A;  5JEA C;  4FW6 A;  4DR1 E;  4DV4 I;  2VF3 A;  4LFC I;  3LNU A;  4DPY A;  2BA1 D;  4DR1 I;  4DR6 E;  5EL9 A;  2C37 A;  4JI1 E;  3JAM C;  5JEA D;  1XMO E;  4JI0 E;  3ZZU A;  2DEJ A;  1YHC A;  4Z7Y A;  2UUB I;  1Z0V A;  4MU3 A;  4JI1 I;  5C0X B;  4JI0 I;  5L3J A;  5BR8 I;  1IBK E;  2BR2 A;  3LTO A;  4MYU A;  1UDQ A;  4DR3 E;  3HUL A;  4IZK A;  4IFD F;  1IBK I;  2XEX A;  1YH8 A;  5DRQ A;  3P3C A;  4LF8 I;  2UXD I;  1Z5C A;  3QT8 A;  3M6A A;  4DR3 I;  1MX0 A;  2BA0 D;  4ZVI A;  1J5E E;  4IFD C;  4JI8 I;  2BM0 A;  5C0X A;  3K85 A;  4USK A;  2PNZ A;  4P52 A;  3PYG A;  2IES A;  4FW5 A;  1XHK A;  3H1C A;  4IFD D;  5FLX Q;  5IWA E;  2JE6 B;  2HFS A;  3T1Y E;  4DV2 E;  4ED4 A;  1NHJ A;  4LPF A;  3L7Z A;  1UEK A;  1EA6 A;  2JEB B;  4DUY I;  5K36 B;  3T1Y I;  4LF6 I;  1HR0 E;  3WU5 A;  3NZK A;  4X62 E;  1FNM A;  2PO1 B;  2PNM A;  4DV3 I;  4DUZ I;  1RHY A;  2GO4 A;  2R42 A;  4JI2 E;  1HNW E;  4OO1 A;  4Z7C A;  2E5L I;  1MU5 A;  4DR4 E;  2PO2 A;  4M1K A;  5EKW A;  2GQ0 A;  1HNW I;  2LJP A;  2NN6 D;  4FW3 A;  5DRR A;  3HJC A;  1N34 I;  4DV6 I;  4IZJ B;  5LL6 R;  4B3M E;  2V34 A;  1KTV A;  4FWH A;  4JV5 E;  4LCH A;  1FWK A;  4JI6 E;  2PO1 A;  3Q6M A;  4GKK I;  1D6T A;  4JG4 A;  2OI2 A;  2CZ9 A;  1XNR E;  2IOP A;  1OYS A;  1Y60 A;  4JI3 E;  5FWK A;  4OKG A;  4X66 I;  2IER A;  2WNR B;  1ELO A;  4PRV A;  2HHH E;  1U2R A;  1KKH A;  4HY1 A;  3JAM Q;  4JI3 I;  5K36 F;  4X64 E;  2HHH I;  2O1V A;  2WP8 A;  1Y4U A;  1H74 A;  3WU6 A;  4EMD A;  2C37 B;  1IBL E;  4UTG A;  1HNX I;  1EI1 A;  1RRE A;  3M7N D;  5K36 C;  2O1U A;  1IBL I;  5IT9 C;  4B3R E;  3H4L A;  2F1D A;  4P7A A;  4LFC E;  3B4T A;  2BR2 B;  4AM3 A;  4R1F A;  4UT4 A;  2VES A;  4B3R I;  4DV5 I;  3PS3 A;  4IZK B;  2UU9 I;  3J7A G;  5JEA E;  4LCF A;  2UUB E;  3J7A M;  4MU1 A;  4K0K I;  5BR8 E;  1UDN A;  1S16 A;  1N0V C;  2Z5B A;  1FI4 A;  4LCG A;  1OJ4 A;  3P06 A;  2PNZ B;  3ZZT A;  4LF8 E;  4X65 I;  2BM1 A;  2UXD E;  3OTO I;  4DV0 E;  1QZR A;  1Z0W A;  3F0N A;  4DPT A;  4JI5 E;  2V2Z A;  1I94 E;  2JEA A;  4MDT A;  4DV0 I;  2UXC I;  4JI5 I;  2PNL A;  1I94 I;  3L7Z B;  4JI8 E;  1B62 A;  3P3G A;  2R3V A;  2V8P A;  1Y4S A;  3ZKD A;  5LMN I;  2A2C A;  1Z5B A;  3M85 G;  3CDJ A;  2VQE I;  4OO1 B;  2AE8 A;  1FWL A;  1FJG I;  1Y5Y A;  4IFD E;  2PO2 B;  2NN6 A;  4N3O A;  1H72 C;  1H7S A;  4FWG A;  2UXB E;  2C39 A;  2Q2E B;  2UUC E;  4HAC A;  4DUY E;  3ZKB A;  2ZM6 I;  4LF6 E;  2V2V A;  2UXB I;  2O3Z A;  3U1Y A;  4DV3 E;  4DUZ E;  1PIE A;  4PRX A;  4HYM A;  2ZIT A;  2UUC I;  1HK7 A;  2E5L E;  2X36 A;  3GME A;  1USU A;  3ZZ0 A;  5C0X F;  5DRO A;  1ZM2 A;  1Z0B A;  1N34 E;  2BA1 G;  2CGE A;  1UDO A;  2NN6 E;  4YY3 E;  4DV6 E;  4WUB A;  4WUD A;  4AQY I;  5LMU I;  1DAR A;  3U1K A;  1ZXM A;  4MQY A;  2IOQ A;  4QNJ A;  5C0X C;  4DV1 E;  4DXL A;  4YY3 I;  4MU0 A;  4LFB I;  4NXM E;  5GMD A;  4DR2 E;  4GKK E;  4DV1 I;  4LF4 I;  1NHH A;  2WP8 B;  4MU4 A;  2HKJ A;  4NXM I;  3ZM7 A;  5C0X D;  5IT9 Q;  4DR2 I;  5JEA B;  1R6M A;  4B3S E;  4OO1 F;  4GKJ I;  4JYA I;  3QT7 A;  1H73 A;  3PYF A;  4X66 E;  2BV3 A;  2A2D A;  2HFU A;  1N32 E;  4QNK A;  4B3S I;  2BA0 G;  1WUU A;  4URL A;  4DPU A;  1PKP A;  1N32 I;  4OO1 C;  4FW7 A;  3K17 A;  3V5R A;  2ZBK B;  1MG7 A;  4DU8 A;  4USM A;  2UUA I;  1HNX E;  5JEA A;  1N36 E;  2J7K A;  2PO0 A;  2Z5C A;  1A6F A;  2Z5B B;  1N36 I;  4LF7 E;  4DV5 E;  1BKN A;  4MYT A;  1XNQ I;  2O1T A;  2UU9 E;  1VI7 A;  5K36 E;  4LOM A;  4LF7 I;  4KHP E;  1ZM9 A;  5K36 D;  2X7I A;  3GLL A;  4I3H A;  2JEA B;  4K0K E;  4HXZ A;  3PYE A;  4BA2 B;  4KHP I;  1N33 I;  2C38 A;  4DV7 I;  2O1W A;  1IBM I;  3DD6 A;  3B82 A;  1H7U A;  4X65 E;  3OTO E;  1FKA E;  3Q1Q A;  3CWV A;  1Z0C A;  4IZJ D;  2HK2 A;  3J81 C;  4IFD A;  2NN6 B;  2UXC E;  1UDS A;  1XMQ E;  1ZXN A;  2C39 B;  3J80 C;  4HAC B;  1NZ0 A; 
#chains in the Genus database with same CATH homology
 5LMN E;  3PYD A;  1XMQ I;  4DR6 I;  2NPF A;  2VQE E;  1XMO I;  1FJG E;  2CG9 A;  2VQF E;  4DU7 A;  4NXN E;  1N0U A;  1Z59 A;  5A2Q C;  2VQF I;  4NXN I;  2ZM6 E;  2EFG A;  4WUC A;  4RPF A;  3Q6N A;  1Y6Z A;  4KQV A;  1Z5A A;  2HK3 A;  1USV A;  4DR5 E;  4DPX A;  1J5E I;  4AQY E;  4OX9 E;  5LMU E;  2DEI A;  3B78 A;  4YHH E;  1B63 A;  2V2Q A;  1Z0T A;  4LFB E;  4DR5 I;  1K47 A;  5GME A;  4OX9 I;  1PVG A;  3GON A;  4YHH I;  3K1J A;  4LF4 E;  4DR7 E;  3WU3 A;  5IWA I;  2HKE A;  4DV2 I;  1HNZ E;  4XTJ A;  1Z0E A;  1KVK A;  4GKJ E;  4JYA E;  4DR7 I;  4FWD A;  4JI4 E;  1ZM4 A;  2E1R A;  1HR0 I;  1HNZ I;  4FW9 A;  1S4E A;  4X62 I;  2Z5C B;  4JI4 I;  3LPS A;  3QT5 A;  4DPW A;  4JI2 I;  1VIS A;  4PU9 A;  4DR4 I;  4LF9 E;  2UUA E;  2AJ4 A;  4LF9 I;  5FLX C;  4B3M I;  3PRY A;  3WU4 A;  1Z0G A;  4JV5 I;  4JI6 I;  1XNQ E;  4JI7 E;  3T1H E;  3J81 Q;  2GS8 A;  1XNR I;  3B8H A;  3J80 Q;  3D4J A;  4LF5 E;  4IZJ A;  3T1H I;  4JI7 I;  2F4V E;  1RR9 A;  1ZM3 A;  4B3T E;  1NHI A;  4LF5 I;  1N33 E;  3V2U C;  4DV7 E;  2F4V I;  1IBM E;  4X64 I;  1KIJ A;  2Z5E A;  4B3T I;  5A2Q Q;  4FN5 A;  4LFA E;  2WW4 A;  4DV4 E;  3QT6 A;  4LFA I;  4DR1 E;  4DV4 I;  2VF3 A;  4LFC I;  3LNU A;  4DPY A;  4DR1 I;  4DR6 E;  4JI1 E;  3JAM C;  1XMO E;  4JI0 E;  3ZZU A;  2DEJ A;  4Z7Y A;  2UUB I;  1Z0V A;  4JI1 I;  4JI0 I;  5L3J A;  5BR8 I;  1IBK E;  3LTO A;  4MYU A;  4DR3 E;  3HUL A;  4IZK A;  1IBK I;  2XEX A;  4LF8 I;  2UXD I;  1Z5C A;  3QT8 A;  3M6A A;  4DR3 I;  1MX0 A;  4ZVI A;  1J5E E;  4JI8 I;  2BM0 A;  3K85 A;  4USK A;  4P52 A;  3PYG A;  1XHK A;  5FLX Q;  5IWA E;  2HFS A;  3T1Y E;  4DV2 E;  4ED4 A;  1NHJ A;  1UEK A;  1EA6 A;  4DUY I;  3T1Y I;  4LF6 I;  1HR0 E;  3WU5 A;  4X62 E;  1FNM A;  2PNM A;  4DV3 I;  4DUZ I;  2R42 A;  4JI2 E;  1HNW E;  4Z7C A;  2E5L I;  1MU5 A;  4DR4 E;  4M1K A;  2GQ0 A;  1HNW I;  2LJP A;  3HJC A;  1N34 I;  4DV6 I;  4IZJ B;  5LL6 R;  4B3M E;  2V34 A;  1KTV A;  4FWH A;  4JV5 E;  1FWK A;  4JI6 E;  3Q6M A;  4GKK I;  1D6T A;  4JG4 A;  2OI2 A;  2CZ9 A;  1XNR E;  2IOP A;  4JI3 E;  5FWK A;  4X66 I;  4PRV A;  1ELO A;  2HHH E;  1U2R A;  1KKH A;  4HY1 A;  3JAM Q;  4JI3 I;  4X64 E;  2HHH I;  2O1V A;  1Y4U A;  1H74 A;  3WU6 A;  4EMD A;  1IBL E;  4UTG A;  1HNX I;  1EI1 A;  1RRE A;  2O1U A;  1IBL I;  5IT9 C;  4B3R E;  3H4L A;  4P7A A;  4LFC E;  4R1F A;  4UT4 A;  4B3R I;  4DV5 I;  4IZK B;  2UU9 I;  3J7A G;  2UUB E;  3J7A M;  4K0K I;  5BR8 E;  1S16 A;  1N0V C;  2Z5B A;  1FI4 A;  1OJ4 A;  3P06 A;  3ZZT A;  4LF8 E;  4X65 I;  2BM1 A;  2UXD E;  3OTO I;  4DV0 E;  1QZR A;  1Z0W A;  3F0N A;  4DPT A;  4JI5 E;  2V2Z A;  1I94 E;  4DV0 I;  2UXC I;  4JI5 I;  2PNL A;  1I94 I;  4JI8 E;  1B62 A;  2R3V A;  2V8P A;  1Y4S A;  3ZKD A;  5LMN I;  2A2C A;  1Z5B A;  2VQE I;  1FWL A;  1FJG I;  4N3O A;  1H72 C;  1H7S A;  4FWG A;  2UXB E;  2Q2E B;  2UUC E;  4HAC A;  4DUY E;  3ZKB A;  2ZM6 I;  4LF6 E;  2V2V A;  2UXB I;  4DV3 E;  4DUZ E;  1PIE A;  4PRX A;  4HYM A;  2ZIT A;  2UUC I;  1HK7 A;  2E5L E;  2X36 A;  3ZZ0 A;  1USU A;  1ZM2 A;  1Z0B A;  1N34 E;  2CGE A;  4YY3 E;  4DV6 E;  4WUB A;  4WUD A;  4AQY I;  5LMU I;  1DAR A;  1ZXM A;  2IOQ A;  4DV1 E;  4DXL A;  4YY3 I;  4LFB I;  4NXM E;  5GMD A;  4DR2 E;  4GKK E;  4DV1 I;  4LF4 I;  1NHH A;  4NXM I;  2HKJ A;  3ZM7 A;  5IT9 Q;  4DR2 I;  4B3S E;  4GKJ I;  4JYA I;  3QT7 A;  1H73 A;  3PYF A;  4X66 E;  2BV3 A;  2A2D A;  2HFU A;  1N32 E;  4B3S I;  1WUU A;  4URL A;  4DPU A;  1PKP A;  1N32 I;  3K17 A;  3V5R A;  2ZBK B;  1MG7 A;  4DU8 A;  4USM A;  2UUA I;  1HNX E;  1N36 E;  2J7K A;  2Z5C A;  1A6F A;  2Z5B B;  1N36 I;  4LF7 E;  4DV5 E;  1BKN A;  4MYT A;  1XNQ I;  2O1T A;  2UU9 E;  4LF7 I;  4KHP E;  1ZM9 A;  2X7I A;  4I3H A;  4K0K E;  4HXZ A;  3PYE A;  4KHP I;  1N33 I;  4DV7 I;  2O1W A;  1IBM I;  3B82 A;  1H7U A;  4X65 E;  3OTO E;  1FKA E;  3Q1Q A;  3CWV A;  1Z0C A;  4IZJ D;  2HK2 A;  3J81 C;  2UXC E;  1XMQ E;  1ZXN A;  3J80 C;  4HAC B;  1NZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...