1I94E

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
b'PETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
molecule tags Ribosome
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1i94E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94E02
3WU4A 1Z0TA 1J5EE 1XMQE 2N3HA 4DV7E 4FN5A 1IBLI 3ADGA 4NXNE 1XNRI 2L2NA 4DPXA 4JYAI 1FI4A 2CPNA 3GONA 3J81Q 4X62I 1QZRA 3CWVA 4DR3I 4M30A 4B3RI 3OTOE 2JVAA 2UXBI 4JI3E 4KQVA 1I94I 4X66E 4DV5I 3LPSA 1KKHA 2E1RA 4X64E 1HNZE 1J26A 2VQEI 4DU7A 1NHJA 4LFCE 3OTOI 4JV5E 4JV5I 1IBME 4DV0I 4DR3E 1STUA 2UUBI 4X62E 2YT4A 1H74A 1N0UA 3F0NA 4R1FA 5FLXC 5LL6R 4LF5I 4JI0E 4EMDA 3J7Yp 4P7AA 3PYFA 1QU6A 3K17A 4RPFA 2VQEE 5IT9C 3K1JA 1BKNA 4DR6I 1Z0BA 4DV7I 3ADIA 4LF4I 4DPWA 2BM1A 4DV3E 4JI1E 2RS6A 4JI3I 4GKKE 3T1YE 4LFAE 3B82A 4AQYE 2J7KA 3QT6A 1Z5BA 1ZM2A 1O0WA 2V2VA 1Z0WA 3PYGA 4DPTA 4OX9E 4LF7I 2UUAE 1B62A 4WUDA 1N33E 1RREA 1YYOA 2L2KB 4JI7E 2AJ4A 1X49A 1U2RA 1MG7A 4DR4E 5LMUE 3ADLA 3JAMQ 2HFSA 1N32I 2LJPA 1N36E 4YHHE 2KHXA 2XEXA 3V5RA 5A2QQ 5BR8I 1S4EA 4DUYI 1RC7A 3ZKDA 4KHPE 4DPYA 4DR2E 1HNWE 2ZM6E 1YZ9A 2L3JA 4WUCA 4KHPI 3T1HE 4JI5E 1RR9A 2HKEA 2L2MA 2GS8A 4GKJI 4JI8E 2CZ9A 4GKJE 2UXCE 1PIEA 5IWAE 1WHNA 1Z5CA 1KVKA 2ZBKB 3LNUA 4YY3I 1PKPA 4WYQB 2UU9E 4WFTA 5LMUI 2LJHA 1DI2A 5IWAI 1UHZA 1ELOA 4DR7E 3LTOA 1KIJA 4K0KI 4P52A 3Q1QA 2UXDI 4JI4E 4DR5I 2UU9I 5GMEA 2IHR1 2A2DA 2X7IA 4DUYE 4GKKI 4DV3I 1T4LB 2LUPB 1DARA 3WU5A 2A2CA 2HFUA 4OX9I 4URLA 2UUCI 2DEJA 4FW9A 1PVGA 4I3HA 3HTXA 3PYEA 2V2ZA 4JI2E 1H73A 4MYUA 1EI1A 1X48A 4JI7I 4DV1I 3VYYA 4JI1I 2B7TA 4JI0I 2UUAI 2E5LE 2NPFA 5GMDA 4UT4A 4X65E 2HK3A 1T4NA 4LFBE 2LTSA 3C4TA 2UUBE 4XTJA 2F4VE 4DUZE 3VYXA 4MYTA 1HNXI 2N3GA 2EZ6A 4FWGA 3J7AG 5L3JA 3B8HA 2L3CA 1B63A 2LTRA 4LF6I 2HKJA 4B3ME 1Z0VA 1N34E 2DEIA 1I94E 4LF9I 4UTGA 4DV0E 2DIXA 4AQYI 1MU5A 1IBMI 1H7SA 4LFCI 3WU3A 1EKZA 1D6TA 4DR1E 2Q2EB 5IT9Q 2BM0A 4PRXA 4LF4E 4ED4A 1HR0E 3H4LA 4B3MI 4LF6E 1WHQA 4B3SI 4X66I 4DV2E 1J5EI 1Z5AA 1Z59A 4HACB 1VISA 4LF9E 4DPUA 1HR0I 4LFBI 2DB2A 4X64I 1HNZI 4JYAE 4NXNI 1ZBTA 3D4JA 1NHIA 2NUGA 3J80C 4DV1E 1XMQI 2UXBE 4B3RE 4USKA 4PRVA 4DV2I 4DUZI 4JI2I 2R3VA 2B7VA 4B3SE 3JAMC 3PYDA 1S16A 4JI6E 1N34I 2NA2A 1YYWA 1FKAE 4DXLA 1ZM3A 1FWLA 3C4BA 4DV5E 4DR1I 3ZKBA 4NXMI 2V8PA 1HNXE 1H7UA 4Z7CA 2B3TB 4DR5E 1GQEA 2V34A 1FNMA 3QT8A 1FJGI 3P1XA 4X65I 1IBLE 1XNRE 4K0KE 2E5LI 1EA6A 4FWDA 2LBSB 1ZM9A 2RS7A 4PU9A 3ZZUA 1XNQE 2F4VI 2NUEA 1UILA 4M2ZA 3QT7A 4JI4I 5CFFE 4M1KA 1ZM4A 4LF8I 2HK2A 2JY9A 2BV3A 1KTVA 1NZ0A 3WU6A 3HULA 1X47A 4DR7I 4DV6I 4Z7YA 1IBKE 1Z0EA 1MX0A 5FLXQ 1FWKA 4DV4E 2RSMA 4HACA 2UUCE 4DU8A 3B78A 4X8WA 1XMOI 1XMOE 2HHHE 2LRSA 4YHHI 1WUUA 3J81C 5LMNE 1OJ4A 2OI2A 3V2UC 2ZM6I 2EFGA 1NHHA 1HNWI 1A6FA 2ZITA 3J7AM 4DR2I 3M6AA 2UXDE 3ZM7A 4B3TE 2RTXA 2VQFE 2UXCI 1XHKA 2HHHI 4FWHA 5A2QC 1Z0CA 2X36A 3QT5A 1UEKA 2VQFI 4LF8E 1ZXMA 4B3TI 1N32E 1FJGE 4DKKA 3LLHA 4YY3E 4ZVIA 5LMNI 2V2QA 1XNQI 4HY1A 2NUFA 1Z0GA 4NXME 1N0VC 1T4OA 4JI8I 1H72C 3T1HI 4JI5I 4HYMA 1ZXNA 4DV4I 4DR6E 2LUQA 4HXZA 4OOGC 1K47A 4JI6I 4JG4A 1IBKI 1YYKA 3J80Q 2L33A 4WUBA 4USMA 3T1YI 5BR8E 4LFAI 2VF3A 1RQ0A 4DV6E 1N33I 3ADJA 2R42A 4LF5E 4LF7E 1N36I 3ZZ0A 2MDRA 2DMYA 3ZZTA 4DR4I 2WW4A
chains in the Genus database with same CATH superfamily
3WU4A 2VESA 3PS1A 2IESA 2ELZA 1Z0TA 2B9DA 1J5EE 1XMQE 1UDSA 3VK6A 5JEAC 1BBGA 3ECRA 2C39A 2EMAA 2N3HA 2YTOA 4DV7E 3TQMA 2EOHA 4FN5A 3ADGA 2YTEA 4WPYA 2L2NA 4GZNC 4NXNE 1P42A 1VI7A 2EPMX 4TUGA 2EN1A 2RSIA 1FI4A 4DPXA 4JYAI 1PJTA 2CPNA 2YTNA 2JP9A 3GONA 4IZJD 3J81Q 2MKDA 4X62I 3EPKA 1QZRA 3CWVA 3K6QA 4O4KA 4DR3I 1YSAC 4M30A 4IS1C 2PO2A 2EPKX 4BA2B 4B3RI 3OTOE 1TF3A 2L6MA 5JEAE 2JVAA 2UXBI 4JI3E 4KQVA 1I94I 4X66E 5A6JA 2D9HA 4BBYA 4DV5I 2LCEA 3LPSA 2V8QB 1WXRA 1KKHA 2E1RA 2LJUA 3JU0A 3F6HA 1DQ3A 4MQYA 2KONA 5F3WA 1GTKA 4X64E 1HNZE 3DD6A 3P76A 5DRQA 2VE7C 4F54A 1J26A 4IFDC 1IQOA 1A1HA 1USUA 2VQEI 4DU7A 1WJPA 3THNA 2EM6A 1NHJA 3HPSA 4LFCE 3OTOI 4JV5E 4JV5I 1IBME 4DV0I 5A6BA 4DR3E 3L00A 1STUA 2UUBI 4X62E 1KJKA 4BHCA 2YT4A 1H74A 3B4TA 4N3OA 2L92A 1N0UA 3F0NA 3H09A 4R1FA 5FLXC 2YRHA 4ZYGA 1JK2A 3DF6A 2CG9A 2BBGA 5LL6R 1A1GA 3M99B 3P3EA 4LF5I 4JI0E 4EMDA 4IS9A 4KWYA 5JEAF 2EOOA 3J7Yp 2PO0B 4OO1C 1Y60A 4P7AA 3PYFA 2EQ1A 1QU6A 5A6AA 3EPHA 1G2FC 1YUIA 3HJCA 3K17A 4RPFA 5C0XA 3M85D 2VQEE 4X9JA 5IT9C 3K1JA 3U1KA 1BKNA 3KRNA 2F1DA 2NN6B 3GMEA 5JEAD 4DR6I 1Z0BA 1X6EA 2EMHA 2YSOA 5AE1A 2GHFA 5DNYA 1A1JA 2DRPA 3ADIA 1R6MA 2PNLA 4DV7I 4LF4I 1XNRI 4DPWA 1ZAAC 2BM1A 3BIDA 4DV3E 2YRKA 4JI1E 2RS6A 2C37B 2JOXA 4GKKE 3T1YE 4LFAE 4JI3I 2O1TA 2WBSA 3M85G 2EOJA 3B82A 4AQYE 2J7KA 5ELWA 4O5GA 3QT6A 1Z5BA 1ZM2A 1O0WA 1WRJA 2Z5BB 1R6LA 1EH8A 4F6NA 2V2VA 1Z0WA 1YH8A 3PYGA 4DPTA 4F2JC 4OX9E 4FW7A 4LF7I 2EM7A 2UUAE 2PNZB 3L7ZB 2DMIA 4L5NC 1B62A 4WUDA 2EN4A 2EOZA 4R2PA 1N33E 1RREA 1YYOA 4O24A 5IXMB 2L2KB 4JI7E 3BF2A 2R76A 2JPAA 2EN6A 4IFDA 2HC5A 1ZU1A 2AJ4A 1G2DC 1X49A 1U2RA 4J8ZA 2C38A 1MG7A 3EQ1A 2DGCA 4DR4E 3HQ1A 3K85A 4MU3A 5DRPA 5LMUE 3DJWA 4LOMA 3ADLA 2WP8B 2HFSA 3JAMQ 4OO1E 1N32I 2CTDA 2EN3A 1N36E 2LJPA 2WNRA 5IV8B 2WP8A 4YHHE 2KHXA 2XEXA 3V5RA 4N4RB 2CVEA 5A2QQ 5BR8I 2JEBA 5A6BD 1S4EA 5EL9A 4DUYI 1RC7A 2RQLA 1A1IA 3ZKDA 2E1MA 2PO2B 4KHPE 4NZVA 4DPYA 1AAYA 4BMJA 2CGEA 2EPOA 4DR2E 2YTFA 1X6FA 1UDQA 1YPNA 1HNWE 3F6GA 2ZM6E 3C6KA 1YZ9A 4HEIA 4IZJA 4AIMA 2L3JA 1A1KA 4WUCA 4KHPI 2YU5A 5TSEA 3T1HE 4JI5E 1RR9A 3GLLA 3UHMA 2HKEA 3P06A 3PS2A 4IZJB 2L2MA 2GS8A 4GKJI 1UDOA 2LT7A 4P7DA 1EH6A 4IZKB 4WXDA 4JI8E 2DLKA 4GKJE 2UXCE 1PIEA 2CZ9A 4MU1A 2Z5CA 5IWAE 4LTYA 1WHNA 4DMIA 2EN7A 2EMWA 1KVKA 1Z5CA 5JEAA 2ZBKB 4OO1B 3LNUA 4YY3I 1PKPA 4NBQA 4WYQB 2YTGA 3IWDA 4WFTA 2UU9E 3KZZA 5LMUI 2M1SA 2LJHA 2JWOA 1B69A 1YHCA 1DI2A 4LU9A 3VHTB 2EQ0A 2YWQA 1IQSA 1UHZA 5IWAI 2EL6A 1ELOA 2EMIA 2EMBA 2EPNA 4DR7E 3LTOA 5KL2A 1KIJA 2NN6A 4K0KI 2ENAA 2YTQA 3KZYA 2EMKA 2EOXA 1E3HA 2GO3A 4P52A 3Q1QA 2UXDI 4WSPA 1SFEA 4JI4E 2J65A 2EOFA 4DR5I 4R2AA 3NZKA 2V83A 2UU9I 5GMEA 2JE6B 2IHR1 2A2DA 1OYSA 2X7IA 2EOSA 4DUYE 4IZKA 2H36X 4GKKI 5C0XD 2K7IA 2JE6A 4DV3I 1T4LB 2LUPB 1DARA 4HTGA 2YZTA 3PS3A 2C37A 2KOUA 3WU5A 4IJDA 2A2CA 2HFUA 4OKGA 2EPXA 4OX9I 4BC7A 4R2SA 4URLA 2UUCI 2PNMA 2FV4B 2DEJA 5K36D 4FW6A 4FW9A 2YTJA 1PVGA 4I3HA 3HTXA 2WBUA 3PYEA 4KZSA 2V2ZA 1OYRA 2JEAA 4JI2E 4R2RA 1H73A 4MYUA 2EPUA 2EE8A 2M9AA 1EI1A 1X48A 3PRYA 4JI7I 4DV1I 3VYYA 4JI1I 5FWKA 2EMZA 2B7TA 2N8XA 4L8NA 2EMXA 4JI0I 2UUAI 2E5LE 2NPFA 1AH5A 4BA1A 5GMDA 2AE8A 4UT4A 4WX9A 4X65E 1YUJA 2J7JA 5A69A 4I8OA 2V86A 1XXEA 2HK3A 1T4NA 4LFBE 2I9IA 2LTSA 3U1YA 3KWRA 3C4TA 2EORA 2UUBE 4XTJA 2MKNA 2F4VE 2YU8A 4DUZE 5KL5A 1OYPA 4LCHA 3VYXA 4MYTA 2BB8A 1HNXI 2N3GA 3HPZA 2EZ6A 3J7AG 2IERA 3RMPA 4FWGA 3EPJA 2EMGA 4RH8A 3B8HA 2Q8UA 2K4VA 2L3CA 1B63A 5L3JA 2PO1A 2V85A 2LTRA 4LF6I 4ISAA 2HKJA 4FW3A 2O1VA 4B3ME 4BHBA 2JEBB 4WXCA 2EPZA 2A25A 4F9CB 4IFDD 1Z0VA 5AE3A 4O43A 2IOPA 2BA0G 3MHSC 1N34E 1E3PA 2DEIA 3HXLA 2JEAB 4LPFA 1JK1A 2NN6D 1I94E 4Q28A 2EN8A 4UTGA 2EN2A 2GLIA 4LF9I 2DIXA 4DV0E 4AQYI 2EOYA 4R2EA 1MU5A 1IBMI 1H7SA 2EM5A 2EOQA 4LFCI 3WU3A 1EKZA 2O1UA 1D6TA 4DR1E 1YFHA 2Q2EB 5IT9Q 2BM0A 4PRXA 1Z1BA 4LF4E 2O3ZA 2EOMA 1NCSA 1HK7A 4U3DA 4ED4A 2NN6F 4NHRA 3M7NG 2E72A 4OO1A 2WZOA 2ODRD 3Q6MA 5DNLA 3BBGA 1HR0E 3H4LA 4B3MI 1SR9A 2NN6E 4LF6E 1WHQA 4B3SI 2DLQA 4X66I 2YTIA 2Z5BA 2PNZA 4DV2E 2MC6A 2V88A 1J5EI 1Z5AA 1Z59A 4HACB 4IFDE 2EMFA 1VISA 2ODRC 4IFDF 5LLQA 4LF9E 2JXPA 2LE2A 3H1CA 4DPUA 2EP3A 1PJQA 4WSGA 2EM2A 5KL4A 3P3GA 1P47A 1HR0I 4LFBI 2DB2A 4X64I 1HNZI 4JYAE 4OZEA 2NN6C 4NXNI 1ZBTA 1LLMC 3D4JA 2PRTA 2O1WA 4GEQB 2EM4A 1A1FA 2EM9A 2NUGA 1NHIA 4BA1B 3J80C 4DV1E 1XMQI 2UXBE 2EPLX 2V87A 2M4IA 2JT2A 4B3RE 4USKA 4PRVA 4DV2I 4DUZI 4JI2I 2BR2B 2R3VA 2B7VA 4R2CA 4Q35B 4R2DA 4B3SE 3JAMC 4MU4A 3PYDA 1S16A 4JI6E 2L8TA 2BR2A 1N34I 4LCFA 2NA2A 1YYWA 1FKAE 4DXLA 1ZM3A 2EMCA 1IMUA 1EH7A 1FWLA 1Y4SA 3C4BA 1PDAA 4DV5E 3M7ND 2PO0A 4DR1I 3ZKBA 2FTXB 4NXMI 3AUZA 4F9BB 5ADZA 2V8PA 4P78A 1MEYC 1HNXE 3JTZA 3UK3C 3CDJA 2EWLA 1H7UA 4Z7CA 5JEAB 2G7HA 2B3TB 1A1LA 5DRRA 5AASA 4DR5E 1GQEA 1BB8A 2CSHA 2MDGA 2V34A 1FNMA 3QT8A 2BA1G 4ZYHA 4TUIA 1FJGI 3P1XA 4X65I 5K36A 1ZR9A 2FGGA 2LV2A 1IBLE 1XNRE 2EL4A 5KL6A 1T39A 4K0KE 2E5LI 5K36B 2PO1B 2LMZA 1EA6A 4FWDA 2LBSB 2MC5A 4MLVA 1Y6ZA 5EKWA 1ZM9A 5KL7A 2RS7A 4MLQA 3MSWA 1F2IG 4R8OA 3QG5C 1Y5YA 1RHYA 4PU9A 3ZZUA 1UBDC 1XNQE 1X5WA 1ZBQA 2F4VI 2NUEA 4FK5C 2VF1A 1UILA 4QNKA 4M2ZA 2V89A 4R2QA 2EOEA 3QT7A 5AC4A 2ELYA 4JI4I 5CFFE 5C0XF 4M1KA 1ZM4A 3L7ZA 4LF8I 2HK2A 2JY9A 2BV3A 1KTVA 5DROA 4OO1D 1TF6A 1NZ0A 2Z5EA 3WU6A 2RPCA 3HULA 1X47A 4DR7I 2R1FA 4R03A 4DV6I 4Z7YA 2EPCA 4AM3A 2EMYA 3CDIA 2EM0A 3OMLA 1IBKE 1NEIA 2Z5CB 5C0XB 2YPNA 2M7QA 1KYQA 2ENHA 1L4SA 3EPLA 1PJSA 2EOIA 1MX0A 1Z0EA 5FLXQ 1FWKA 2CT1A 2C39B 5C0XE 1IBLI 3BGHA 4BA2A 1TN9A 4DV4E 2RSMA 3FIGA 4HACA 2UUCE 4DU8A 1GZ6A 3B78A 1MGTA 1RMDA 4X8WA 1XMOI 1XMOE 2HHHE 2IOQA 3HKMA 2LRSA 1X6HA 3LMLA 3C6MA 4ZYDA 3AV0A 4YHHI 1WUUA 2EPAA 3J81C 5LMNE 1OJ4A 2OI2A 3V2UC 2ZM6I 3IWCA 2EFGA 1NHHA 1HNWI 2WBTA 4M9VC 1A6FA 2LVHA 2ZITA 3J7AM 2WCC3 3MHHC 4DR2I 2GQ0A 2UXDE 3M6AA 3ZM7A 2JR1A 4B3TE 4MDTA 4QNJA 2RTXA 2VQFE 2HJJA 2C38B 2EQ3A 4ZYEA 2GPIA 2UXCI 1XHKA 2HHHI 1UN6B 4M0VA 1BBOA 4FWHA 5K36E 4LCGA 2ADRA 5A2QC 1Z0CA 2X36A 2WNRB 3QT5A 1UEKA 5AC5A 2VQFI 3THOB 4LF8E 1ZXMA 4B3TI 1N32E 2GO4A 1DGCA 2EPPA 1FJGE 2EMLA 4RHBB 4DKKA 2NABA 2F8BA 3LLHA 2JOBA 2EL5A 3P3CA 4U3BA 5KL3A 3GCMA 4YY3E 4ZVIA 5LMNI 2V2QA 1XNQI 4HY1A 5K36F 2YTDA 2VRDA 2NUFA 2ENCA 4AIDA 1QNTA 1Z0GA 4FW5A 2EPRA 4NXME 1N0VC 4GQUA 1T4OA 4JI8I 1USVA 2YSPA 4BC9A 5DNXA 4OO1F 1H72C 3T1HI 4JI5I 4HYMA 2HGHA 1N3GA 1ZXNA 2BA0D 4F6MA 2EM3A 2LUQA 2I13A 4DR6E 4HXZA 5C0XC 4DV4I 4OOGC 1K47A 4JI6I 2YTPA 4JG4A 2BA1D 2EJ4A 2JYAA 1IBKI 1YYKA 1Y4UA 3Q6NA 3J80Q 2L33A 1UDNA 4WUBA 5T6JA 4USMA 5BR8E 4BS9A 3T1YI 4LFAI 2VF3A 1RQ0A 4DV6E 1N33I 5AE2A 3ADJA 2R42A 4FW4A 4F9AB 4LF5E 4LF7E 1N36I 5A6KA 3ZZ0A 3ZOQB 2MDRA 3IWBA 1T38A 1X3CA 5K36C 2DMYA 3ZZTA 4DR4I 2YRMA 2WW4A 4BCAA 4IFDB 2DSYA 2EM8A 4MU0A 4J3DA 2LO3A
chains in the Genus database with same CATH topology
3WU4A 1Z0TA 2B9DA 1J5EE 1XMQE 3VK6A 2N3HA 4DV7E 4FN5A 1IBLI 3ADGA 4WPYA 4NXNE 2L2NA 1XNRI 4DPXA 4JYAI 4TUGA 1FI4A 2CPNA 3GONA 4IZJD 3J81Q 4X62I 1QZRA 3CWVA 3K6QA 4DR3I 4M30A 4B3RI 3OTOE 2L6MA 2JVAA 2UXBI 4JI3E 4KQVA 1I94I 4X66E 4BBYA 4DV5I 3LPSA 2V8QB 1WXRA 1KKHA 2E1RA 3JU0A 3F6HA 1DQ3A 2KONA 5F3WA 4X64E 1HNZE 2VE7C 4F54A 1J26A 2VQEI 1USUA 4DU7A 1NHJA 3HPSA 4LFCE 3OTOI 4JV5E 4JV5I 1IBME 4DV0I 4DR3E 1STUA 2UUBI 4X62E 2YT4A 1H74A 4N3OA 2L92A 1N0UA 3F0NA 3H09A 4R1FA 5FLXC 3DF6A 2CG9A 5LL6R 4LF5I 4JI0E 4EMDA 3J7Yp 4P7AA 3PYFA 1QU6A 3HJCA 3K17A 4RPFA 2VQEE 5IT9C 3K1JA 1BKNA 4DR6I 1Z0BA 5AE1A 5DNYA 4DV7I 2PNLA 3ADIA 4LF4I 4DPWA 2BM1A 4DV3E 4JI1E 2RS6A 4JI3I 2JOXA 4GKKE 3T1YE 4LFAE 2O1TA 3B82A 4AQYE 2J7KA 3QT6A 1Z5BA 1ZM2A 1O0WA 2Z5BB 2V2VA 1Z0WA 3PYGA 4DPTA 4OX9E 4LF7I 2UUAE 4L5NC 1B62A 4WUDA 1N33E 1RREA 1YYOA 2L2KB 4JI7E 2AJ4A 1X49A 1U2RA 4J8ZA 1MG7A 4DR4E 3HQ1A 3K85A 5LMUE 3DJWA 3ADLA 3JAMQ 2HFSA 1N32I 2LJPA 1N36E 4YHHE 2KHXA 2XEXA 3V5RA 5A2QQ 5BR8I 1S4EA 4DUYI 1RC7A 3ZKDA 2E1MA 4KHPE 4DPYA 4BMJA 2CGEA 4DR2E 1HNWE 3F6GA 2ZM6E 1YZ9A 4IZJA 2L3JA 4WUCA 4KHPI 3T1HE 4JI5E 1RR9A 2HKEA 3P06A 4IZJB 2L2MA 2GS8A 4GKJI 4P7DA 4IZKB 4JI8E 2CZ9A 4GKJE 2UXCE 1PIEA 2Z5CA 5IWAE 4LTYA 1WHNA 4DMIA 1Z5CA 1KVKA 2ZBKB 3LNUA 4YY3I 1PKPA 4WYQB 3IWDA 2UU9E 4WFTA 5LMUI 2M1SA 2LJHA 2JWOA 1DI2A 4LU9A 5IWAI 1UHZA 1ELOA 4DR7E 3LTOA 1KIJA 4K0KI 4P52A 3Q1QA 2UXDI 4WSPA 4JI4E 4DR5I 2V83A 2UU9I 5GMEA 2IHR1 2A2DA 2X7IA 4DUYE 4IZKA 2H36X 4GKKI 4DV3I 1T4LB 2LUPB 1DARA 2YZTA 2KOUA 3WU5A 2A2CA 2HFUA 4OX9I 4BC7A 4URLA 2UUCI 2PNMA 2FV4B 2DEJA 4FW9A 1PVGA 4I3HA 3HTXA 3PYEA 4KZSA 2V2ZA 4JI2E 1H73A 4MYUA 1EI1A 1X48A 3PRYA 4JI7I 4DV1I 3VYYA 4JI1I 5FWKA 2B7TA 4L8NA 4JI0I 2UUAI 2E5LE 2NPFA 5GMDA 4UT4A 4X65E 2HK3A 4I8OA 2V86A 1T4NA 4LFBE 2LTSA 3C4TA 3KWRA 2UUBE 4XTJA 2F4VE 4DUZE 3VYXA 4MYTA 1HNXI 2N3GA 3HPZA 2EZ6A 3J7AG 4FWGA 3RMPA 5L3JA 3B8HA 2L3CA 2K4VA 1B63A 2V85A 2LTRA 4LF6I 2HKJA 2O1VA 4B3ME 4F9CB 1Z0VA 5AE3A 2IOPA 1N34E 2DEIA 3HXLA 1I94E 4Q28A 4LF9I 4UTGA 2DIXA 4DV0E 4AQYI 1MU5A 1IBMI 1H7SA 4LFCI 3WU3A 1EKZA 2O1UA 1D6TA 4DR1E 2Q2EB 5IT9Q 2BM0A 4PRXA 4LF4E 1HK7A 4ED4A 2WZOA 2ODRD 3Q6MA 1HR0E 3H4LA 4B3MI 1SR9A 4LF6E 1WHQA 4B3SI 4X66I 2Z5BA 4DV2E 2MC6A 2V88A 1J5EI 1Z5AA 1Z59A 4HACB 1VISA 2ODRC 4LF9E 2LE2A 4DPUA 1HR0I 4LFBI 2DB2A 4X64I 1HNZI 4JYAE 4NXNI 1ZBTA 3D4JA 2O1WA 4GEQB 1NHIA 2NUGA 3J80C 4DV1E 1XMQI 2UXBE 2V87A 2M4IA 4B3RE 4USKA 4PRVA 4DV2I 4DUZI 4JI2I 2R3VA 2B7VA 4B3SE 3JAMC 3PYDA 1S16A 4JI6E 2L8TA 1N34I 2NA2A 1YYWA 1FKAE 4DXLA 1ZM3A 1FWLA 1Y4SA 3C4BA 4DV5E 4DR1I 3ZKBA 2FTXB 4NXMI 3AUZA 4F9BB 5ADZA 2V8PA 4P78A 1HNXE 3JTZA 2EWLA 1H7UA 4Z7CA 2G7HA 2B3TB 5AASA 4DR5E 1GQEA 2V34A 1FNMA 3QT8A 4TUIA 1FJGI 3P1XA 4X65I 2FGGA 1IBLE 1XNRE 4K0KE 2E5LI 2LMZA 1EA6A 4FWDA 2LBSB 2MC5A 1Y6ZA 1ZM9A 2RS7A 3MSWA 4PU9A 4R8OA 3ZZUA 1XNQE 1ZBQA 2F4VI 2NUEA 2VF1A 1UILA 4M2ZA 2V89A 3QT7A 4JI4I 5CFFE 4M1KA 1ZM4A 4LF8I 2HK2A 2JY9A 2BV3A 1KTVA 1NZ0A 2Z5EA 3WU6A 3HULA 1X47A 4DR7I 4DV6I 4R03A 4Z7YA 3OMLA 1IBKE 2Z5CB 2M7QA 1Z0EA 1MX0A 5FLXQ 1FWKA 4DV4E 2RSMA 3FIGA 4HACA 2UUCE 4DU8A 1GZ6A 3B78A 4X8WA 1XMOI 1XMOE 2HHHE 2IOQA 2LRSA 3LMLA 3AV0A 4YHHI 1WUUA 3J81C 5LMNE 1OJ4A 2OI2A 3V2UC 2ZM6I 3IWCA 2EFGA 1NHHA 1HNWI 1A6FA 2ZITA 3J7AM 4DR2I 2GQ0A 2UXDE 3M6AA 3ZM7A 2JR1A 4B3TE 2RTXA 2VQFE 2UXCI 1XHKA 2HHHI 4FWHA 4M0VA 5A2QC 1Z0CA 2X36A 3QT5A 1UEKA 2VQFI 4LF8E 1ZXMA 4B3TI 1N32E 1FJGE 4DKKA 2F8BA 3LLHA 2JOBA 4YY3E 4ZVIA 5LMNI 2V2QA 1XNQI 4HY1A 2NUFA 1Z0GA 4NXME 1N0VC 1T4OA 4JI8I 1USVA 4BC9A 1H72C 3T1HI 4JI5I 4HYMA 1ZXNA 4DV4I 4DR6E 2LUQA 4HXZA 4OOGC 1K47A 4JI6I 4JG4A 1IBKI 1YYKA 1Y4UA 3Q6NA 3J80Q 2L33A 4WUBA 5T6JA 4USMA 5BR8E 4BS9A 3T1YI 4LFAI 2VF3A 1RQ0A 4DV6E 1N33I 5AE2A 3ADJA 2R42A 4F9AB 4LF5E 4LF7E 1N36I 3ZZ0A 3ZOQB 2MDRA 3IWBA 2DMYA 3ZZTA 4DR4I 2WW4A 4BCAA 2DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU4 A;  1Z0T A;  1J5E E;  1XMQ E;  2N3H A;  4DV7 E;  4FN5 A;  1IBL I;  3ADG A;  4NXN E;  1XNR I;  2L2N A;  4DPX A;  4JYA I;  1FI4 A;  2CPN A;  3GON A;  3J81 Q;  4X62 I;  1QZR A;  3CWV A;  4DR3 I;  4M30 A;  4B3R I;  3OTO E;  2JVA A;  2UXB I;  4JI3 E;  4KQV A;  1I94 I;  4X66 E;  4DV5 I;  3LPS A;  1KKH A;  2E1R A;  4X64 E;  1HNZ E;  1J26 A;  2VQE I;  4DU7 A;  1NHJ A;  4LFC E;  3OTO I;  4JV5 E;  4JV5 I;  1IBM E;  4DV0 I;  4DR3 E;  1STU A;  2UUB I;  4X62 E;  2YT4 A;  1H74 A;  1N0U A;  3F0N A;  4R1F A;  5FLX C;  5LL6 R;  4LF5 I;  4JI0 E;  4EMD A;  3J7Y p;  4P7A A;  3PYF A;  1QU6 A;  3K17 A;  4RPF A;  2VQE E;  5IT9 C;  3K1J A;  1BKN A;  4DR6 I;  1Z0B A;  4DV7 I;  3ADI A;  4LF4 I;  4DPW A;  2BM1 A;  4DV3 E;  4JI1 E;  2RS6 A;  4JI3 I;  4GKK E;  3T1Y E;  4LFA E;  3B82 A;  4AQY E;  2J7K A;  3QT6 A;  1Z5B A;  1ZM2 A;  1O0W A;  2V2V A;  1Z0W A;  3PYG A;  4DPT A;  4OX9 E;  4LF7 I;  2UUA E;  1B62 A;  4WUD A;  1N33 E;  1RRE A;  1YYO A;  2L2K B;  4JI7 E;  2AJ4 A;  1X49 A;  1U2R A;  1MG7 A;  4DR4 E;  5LMU E;  3ADL A;  3JAM Q;  2HFS A;  1N32 I;  2LJP A;  1N36 E;  4YHH E;  2KHX A;  2XEX A;  3V5R A;  5A2Q Q;  5BR8 I;  1S4E A;  4DUY I;  1RC7 A;  3ZKD A;  4KHP E;  4DPY A;  4DR2 E;  1HNW E;  2ZM6 E;  1YZ9 A;  2L3J A;  4WUC A;  4KHP I;  3T1H E;  4JI5 E;  1RR9 A;  2HKE A;  2L2M A;  2GS8 A;  4GKJ I;  4JI8 E;  2CZ9 A;  4GKJ E;  2UXC E;  1PIE A;  5IWA E;  1WHN A;  1Z5C A;  1KVK A;  2ZBK B;  3LNU A;  4YY3 I;  1PKP A;  4WYQ B;  2UU9 E;  4WFT A;  5LMU I;  2LJH A;  1DI2 A;  5IWA I;  1UHZ A;  1ELO A;  4DR7 E;  3LTO A;  1KIJ A;  4K0K I;  4P52 A;  3Q1Q A;  2UXD I;  4JI4 E;  4DR5 I;  2UU9 I;  5GME A;  2IHR 1;  2A2D A;  2X7I A;  4DUY E;  4GKK I;  4DV3 I;  1T4L B;  2LUP B;  1DAR A;  3WU5 A;  2A2C A;  2HFU A;  4OX9 I;  4URL A;  2UUC I;  2DEJ A;  4FW9 A;  1PVG A;  4I3H A;  3HTX A;  3PYE A;  2V2Z A;  4JI2 E;  1H73 A;  4MYU A;  1EI1 A;  1X48 A;  4JI7 I;  4DV1 I;  3VYY A;  4JI1 I;  2B7T A;  4JI0 I;  2UUA I;  2E5L E;  2NPF A;  5GMD A;  4UT4 A;  4X65 E;  2HK3 A;  1T4N A;  4LFB E;  2LTS A;  3C4T A;  2UUB E;  4XTJ A;  2F4V E;  4DUZ E;  3VYX A;  4MYT A;  1HNX I;  2N3G A;  2EZ6 A;  4FWG A;  3J7A G;  5L3J A;  3B8H A;  2L3C A;  1B63 A;  2LTR A;  4LF6 I;  2HKJ A;  4B3M E;  1Z0V A;  1N34 E;  2DEI A;  1I94 E;  4LF9 I;  4UTG A;  4DV0 E;  2DIX A;  4AQY I;  1MU5 A;  1IBM I;  1H7S A;  4LFC I;  3WU3 A;  1EKZ A;  1D6T A;  4DR1 E;  2Q2E B;  5IT9 Q;  2BM0 A;  4PRX A;  4LF4 E;  4ED4 A;  1HR0 E;  3H4L A;  4B3M I;  4LF6 E;  1WHQ A;  4B3S I;  4X66 I;  4DV2 E;  1J5E I;  1Z5A A;  1Z59 A;  4HAC B;  1VIS A;  4LF9 E;  4DPU A;  1HR0 I;  4LFB I;  2DB2 A;  4X64 I;  1HNZ I;  4JYA E;  4NXN I;  1ZBT A;  3D4J A;  1NHI A;  2NUG A;  3J80 C;  4DV1 E;  1XMQ I;  2UXB E;  4B3R E;  4USK A;  4PRV A;  4DV2 I;  4DUZ I;  4JI2 I;  2R3V A;  2B7V A;  4B3S E;  3JAM C;  3PYD A;  1S16 A;  4JI6 E;  1N34 I;  2NA2 A;  1YYW A;  1FKA E;  4DXL A;  1ZM3 A;  1FWL A;  3C4B A;  4DV5 E;  4DR1 I;  3ZKB A;  4NXM I;  2V8P A;  1HNX E;  1H7U A;  4Z7C A;  2B3T B;  4DR5 E;  1GQE A;  2V34 A;  1FNM A;  3QT8 A;  1FJG I;  3P1X A;  4X65 I;  1IBL E;  1XNR E;  4K0K E;  2E5L I;  1EA6 A;  4FWD A;  2LBS B;  1ZM9 A;  2RS7 A;  4PU9 A;  3ZZU A;  1XNQ E;  2F4V I;  2NUE A;  1UIL A;  4M2Z A;  3QT7 A;  4JI4 I;  5CFF E;  4M1K A;  1ZM4 A;  4LF8 I;  2HK2 A;  2JY9 A;  2BV3 A;  1KTV A;  1NZ0 A;  3WU6 A;  3HUL A;  1X47 A;  4DR7 I;  4DV6 I;  4Z7Y A;  1IBK E;  1Z0E A;  1MX0 A;  5FLX Q;  1FWK A;  4DV4 E;  2RSM A;  4HAC A;  2UUC E;  4DU8 A;  3B78 A;  4X8W A;  1XMO I;  1XMO E;  2HHH E;  2LRS A;  4YHH I;  1WUU A;  3J81 C;  5LMN E;  1OJ4 A;  2OI2 A;  3V2U C;  2ZM6 I;  2EFG A;  1NHH A;  1HNW I;  1A6F A;  2ZIT A;  3J7A M;  4DR2 I;  3M6A A;  2UXD E;  3ZM7 A;  4B3T E;  2RTX A;  2VQF E;  2UXC I;  1XHK A;  2HHH I;  4FWH A;  5A2Q C;  1Z0C A;  2X36 A;  3QT5 A;  1UEK A;  2VQF I;  4LF8 E;  1ZXM A;  4B3T I;  1N32 E;  1FJG E;  4DKK A;  3LLH A;  4YY3 E;  4ZVI A;  5LMN I;  2V2Q A;  1XNQ I;  4HY1 A;  2NUF A;  1Z0G A;  4NXM E;  1N0V C;  1T4O A;  4JI8 I;  1H72 C;  3T1H I;  4JI5 I;  4HYM A;  1ZXN A;  4DV4 I;  4DR6 E;  2LUQ A;  4HXZ A;  4OOG C;  1K47 A;  4JI6 I;  4JG4 A;  1IBK I;  1YYK A;  3J80 Q;  2L33 A;  4WUB A;  4USM A;  3T1Y I;  5BR8 E;  4LFA I;  2VF3 A;  1RQ0 A;  4DV6 E;  1N33 I;  3ADJ A;  2R42 A;  4LF5 E;  4LF7 E;  1N36 I;  3ZZ0 A;  2MDR A;  2DMY A;  3ZZT A;  4DR4 I;  2WW4 A; 
#chains in the Genus database with same CATH topology
 3WU4 A;  2VES A;  3PS1 A;  2IES A;  2ELZ A;  1Z0T A;  2B9D A;  1J5E E;  1XMQ E;  1UDS A;  3VK6 A;  5JEA C;  1BBG A;  3ECR A;  2C39 A;  2EMA A;  2N3H A;  2YTO A;  4DV7 E;  3TQM A;  2EOH A;  4FN5 A;  3ADG A;  2YTE A;  4WPY A;  2L2N A;  4GZN C;  4NXN E;  1P42 A;  1VI7 A;  2EPM X;  4TUG A;  2EN1 A;  2RSI A;  1FI4 A;  4DPX A;  4JYA I;  1PJT A;  2CPN A;  2YTN A;  2JP9 A;  3GON A;  4IZJ D;  3J81 Q;  2MKD A;  4X62 I;  3EPK A;  1QZR A;  3CWV A;  3K6Q A;  4O4K A;  4DR3 I;  1YSA C;  4M30 A;  4IS1 C;  2PO2 A;  2EPK X;  4BA2 B;  4B3R I;  3OTO E;  1TF3 A;  2L6M A;  5JEA E;  2JVA A;  2UXB I;  4JI3 E;  4KQV A;  1I94 I;  4X66 E;  5A6J A;  2D9H A;  4BBY A;  4DV5 I;  2LCE A;  3LPS A;  2V8Q B;  1WXR A;  1KKH A;  2E1R A;  2LJU A;  3JU0 A;  3F6H A;  1DQ3 A;  4MQY A;  2KON A;  5F3W A;  1GTK A;  4X64 E;  1HNZ E;  3DD6 A;  3P76 A;  5DRQ A;  2VE7 C;  4F54 A;  1J26 A;  4IFD C;  1IQO A;  1A1H A;  1USU A;  2VQE I;  4DU7 A;  1WJP A;  3THN A;  2EM6 A;  1NHJ A;  3HPS A;  4LFC E;  3OTO I;  4JV5 E;  4JV5 I;  1IBM E;  4DV0 I;  5A6B A;  4DR3 E;  3L00 A;  1STU A;  2UUB I;  4X62 E;  1KJK A;  4BHC A;  2YT4 A;  1H74 A;  3B4T A;  4N3O A;  2L92 A;  1N0U A;  3F0N A;  3H09 A;  4R1F A;  5FLX C;  2YRH A;  4ZYG A;  1JK2 A;  3DF6 A;  2CG9 A;  2BBG A;  5LL6 R;  1A1G A;  3M99 B;  3P3E A;  4LF5 I;  4JI0 E;  4EMD A;  4IS9 A;  4KWY A;  5JEA F;  2EOO A;  3J7Y p;  2PO0 B;  4OO1 C;  1Y60 A;  4P7A A;  3PYF A;  2EQ1 A;  1QU6 A;  5A6A A;  3EPH A;  1G2F C;  1YUI A;  3HJC A;  3K17 A;  4RPF A;  5C0X A;  3M85 D;  2VQE E;  4X9J A;  5IT9 C;  3K1J A;  3U1K A;  1BKN A;  3KRN A;  2F1D A;  2NN6 B;  3GME A;  5JEA D;  4DR6 I;  1Z0B A;  1X6E A;  2EMH A;  2YSO A;  5AE1 A;  2GHF A;  5DNY A;  1A1J A;  2DRP A;  3ADI A;  1R6M A;  2PNL A;  4DV7 I;  4LF4 I;  1XNR I;  4DPW A;  1ZAA C;  2BM1 A;  3BID A;  4DV3 E;  2YRK A;  4JI1 E;  2RS6 A;  2C37 B;  2JOX A;  4GKK E;  3T1Y E;  4LFA E;  4JI3 I;  2O1T A;  2WBS A;  3M85 G;  2EOJ A;  3B82 A;  4AQY E;  2J7K A;  5ELW A;  4O5G A;  3QT6 A;  1Z5B A;  1ZM2 A;  1O0W A;  1WRJ A;  2Z5B B;  1R6L A;  1EH8 A;  4F6N A;  2V2V A;  1Z0W A;  1YH8 A;  3PYG A;  4DPT A;  4F2J C;  4OX9 E;  4FW7 A;  4LF7 I;  2EM7 A;  2UUA E;  2PNZ B;  3L7Z B;  2DMI A;  4L5N C;  1B62 A;  4WUD A;  2EN4 A;  2EOZ A;  4R2P A;  1N33 E;  1RRE A;  1YYO A;  4O24 A;  5IXM B;  2L2K B;  4JI7 E;  3BF2 A;  2R76 A;  2JPA A;  2EN6 A;  4IFD A;  2HC5 A;  1ZU1 A;  2AJ4 A;  1G2D C;  1X49 A;  1U2R A;  4J8Z A;  2C38 A;  1MG7 A;  3EQ1 A;  2DGC A;  4DR4 E;  3HQ1 A;  3K85 A;  4MU3 A;  5DRP A;  5LMU E;  3DJW A;  4LOM A;  3ADL A;  2WP8 B;  2HFS A;  3JAM Q;  4OO1 E;  1N32 I;  2CTD A;  2EN3 A;  1N36 E;  2LJP A;  2WNR A;  5IV8 B;  2WP8 A;  4YHH E;  2KHX A;  2XEX A;  3V5R A;  4N4R B;  2CVE A;  5A2Q Q;  5BR8 I;  2JEB A;  5A6B D;  1S4E A;  5EL9 A;  4DUY I;  1RC7 A;  2RQL A;  1A1I A;  3ZKD A;  2E1M A;  2PO2 B;  4KHP E;  4NZV A;  4DPY A;  1AAY A;  4BMJ A;  2CGE A;  2EPO A;  4DR2 E;  2YTF A;  1X6F A;  1UDQ A;  1YPN A;  1HNW E;  3F6G A;  2ZM6 E;  3C6K A;  1YZ9 A;  4HEI A;  4IZJ A;  4AIM A;  2L3J A;  1A1K A;  4WUC A;  4KHP I;  2YU5 A;  5TSE A;  3T1H E;  4JI5 E;  1RR9 A;  3GLL A;  3UHM A;  2HKE A;  3P06 A;  3PS2 A;  4IZJ B;  2L2M A;  2GS8 A;  4GKJ I;  1UDO A;  2LT7 A;  4P7D A;  1EH6 A;  4IZK B;  4WXD A;  4JI8 E;  2DLK A;  4GKJ E;  2UXC E;  1PIE A;  2CZ9 A;  4MU1 A;  2Z5C A;  5IWA E;  4LTY A;  1WHN A;  4DMI A;  2EN7 A;  2EMW A;  1KVK A;  1Z5C A;  5JEA A;  2ZBK B;  4OO1 B;  3LNU A;  4YY3 I;  1PKP A;  4NBQ A;  4WYQ B;  2YTG A;  3IWD A;  4WFT A;  2UU9 E;  3KZZ A;  5LMU I;  2M1S A;  2LJH A;  2JWO A;  1B69 A;  1YHC A;  1DI2 A;  4LU9 A;  3VHT B;  2EQ0 A;  2YWQ A;  1IQS A;  1UHZ A;  5IWA I;  2EL6 A;  1ELO A;  2EMI A;  2EMB A;  2EPN A;  4DR7 E;  3LTO A;  5KL2 A;  1KIJ A;  2NN6 A;  4K0K I;  2ENA A;  2YTQ A;  3KZY A;  2EMK A;  2EOX A;  1E3H A;  2GO3 A;  4P52 A;  3Q1Q A;  2UXD I;  4WSP A;  1SFE A;  4JI4 E;  2J65 A;  2EOF A;  4DR5 I;  4R2A A;  3NZK A;  2V83 A;  2UU9 I;  5GME A;  2JE6 B;  2IHR 1;  2A2D A;  1OYS A;  2X7I A;  2EOS A;  4DUY E;  4IZK A;  2H36 X;  4GKK I;  5C0X D;  2K7I A;  2JE6 A;  4DV3 I;  1T4L B;  2LUP B;  1DAR A;  4HTG A;  2YZT A;  3PS3 A;  2C37 A;  2KOU A;  3WU5 A;  4IJD A;  2A2C A;  2HFU A;  4OKG A;  2EPX A;  4OX9 I;  4BC7 A;  4R2S A;  4URL A;  2UUC I;  2PNM A;  2FV4 B;  2DEJ A;  5K36 D;  4FW6 A;  4FW9 A;  2YTJ A;  1PVG A;  4I3H A;  3HTX A;  2WBU A;  3PYE A;  4KZS A;  2V2Z A;  1OYR A;  2JEA A;  4JI2 E;  4R2R A;  1H73 A;  4MYU A;  2EPU A;  2EE8 A;  2M9A A;  1EI1 A;  1X48 A;  3PRY A;  4JI7 I;  4DV1 I;  3VYY A;  4JI1 I;  5FWK A;  2EMZ A;  2B7T A;  2N8X A;  4L8N A;  2EMX A;  4JI0 I;  2UUA I;  2E5L E;  2NPF A;  1AH5 A;  4BA1 A;  5GMD A;  2AE8 A;  4UT4 A;  4WX9 A;  4X65 E;  1YUJ A;  2J7J A;  5A69 A;  4I8O A;  2V86 A;  1XXE A;  2HK3 A;  1T4N A;  4LFB E;  2I9I A;  2LTS A;  3U1Y A;  3KWR A;  3C4T A;  2EOR A;  2UUB E;  4XTJ A;  2MKN A;  2F4V E;  2YU8 A;  4DUZ E;  5KL5 A;  1OYP A;  4LCH A;  3VYX A;  4MYT A;  2BB8 A;  1HNX I;  2N3G A;  3HPZ A;  2EZ6 A;  3J7A G;  2IER A;  3RMP A;  4FWG A;  3EPJ A;  2EMG A;  4RH8 A;  3B8H A;  2Q8U A;  2K4V A;  2L3C A;  1B63 A;  5L3J A;  2PO1 A;  2V85 A;  2LTR A;  4LF6 I;  4ISA A;  2HKJ A;  4FW3 A;  2O1V A;  4B3M E;  4BHB A;  2JEB B;  4WXC A;  2EPZ A;  2A25 A;  4F9C B;  4IFD D;  1Z0V A;  5AE3 A;  4O43 A;  2IOP A;  2BA0 G;  3MHS C;  1N34 E;  1E3P A;  2DEI A;  3HXL A;  2JEA B;  4LPF A;  1JK1 A;  2NN6 D;  1I94 E;  4Q28 A;  2EN8 A;  4UTG A;  2EN2 A;  2GLI A;  4LF9 I;  2DIX A;  4DV0 E;  4AQY I;  2EOY A;  4R2E A;  1MU5 A;  1IBM I;  1H7S A;  2EM5 A;  2EOQ A;  4LFC I;  3WU3 A;  1EKZ A;  2O1U A;  1D6T A;  4DR1 E;  1YFH A;  2Q2E B;  5IT9 Q;  2BM0 A;  4PRX A;  1Z1B A;  4LF4 E;  2O3Z A;  2EOM A;  1NCS A;  1HK7 A;  4U3D A;  4ED4 A;  2NN6 F;  4NHR A;  3M7N G;  2E72 A;  4OO1 A;  2WZO A;  2ODR D;  3Q6M A;  5DNL A;  3BBG A;  1HR0 E;  3H4L A;  4B3M I;  1SR9 A;  2NN6 E;  4LF6 E;  1WHQ A;  4B3S I;  2DLQ A;  4X66 I;  2YTI A;  2Z5B A;  2PNZ A;  4DV2 E;  2MC6 A;  2V88 A;  1J5E I;  1Z5A A;  1Z59 A;  4HAC B;  4IFD E;  2EMF A;  1VIS A;  2ODR C;  4IFD F;  5LLQ A;  4LF9 E;  2JXP A;  2LE2 A;  3H1C A;  4DPU A;  2EP3 A;  1PJQ A;  4WSG A;  2EM2 A;  5KL4 A;  3P3G A;  1P47 A;  1HR0 I;  4LFB I;  2DB2 A;  4X64 I;  1HNZ I;  4JYA E;  4OZE A;  2NN6 C;  4NXN I;  1ZBT A;  1LLM C;  3D4J A;  2PRT A;  2O1W A;  4GEQ B;  2EM4 A;  1A1F A;  2EM9 A;  2NUG A;  1NHI A;  4BA1 B;  3J80 C;  4DV1 E;  1XMQ I;  2UXB E;  2EPL X;  2V87 A;  2M4I A;  2JT2 A;  4B3R E;  4USK A;  4PRV A;  4DV2 I;  4DUZ I;  4JI2 I;  2BR2 B;  2R3V A;  2B7V A;  4R2C A;  4Q35 B;  4R2D A;  4B3S E;  3JAM C;  4MU4 A;  3PYD A;  1S16 A;  4JI6 E;  2L8T A;  2BR2 A;  1N34 I;  4LCF A;  2NA2 A;  1YYW A;  1FKA E;  4DXL A;  1ZM3 A;  2EMC A;  1IMU A;  1EH7 A;  1FWL A;  1Y4S A;  3C4B A;  1PDA A;  4DV5 E;  3M7N D;  2PO0 A;  4DR1 I;  3ZKB A;  2FTX B;  4NXM I;  3AUZ A;  4F9B B;  5ADZ A;  2V8P A;  4P78 A;  1MEY C;  1HNX E;  3JTZ A;  3UK3 C;  3CDJ A;  2EWL A;  1H7U A;  4Z7C A;  5JEA B;  2G7H A;  2B3T B;  1A1L A;  5DRR A;  5AAS A;  4DR5 E;  1GQE A;  1BB8 A;  2CSH A;  2MDG A;  2V34 A;  1FNM A;  3QT8 A;  2BA1 G;  4ZYH A;  4TUI A;  1FJG I;  3P1X A;  4X65 I;  5K36 A;  1ZR9 A;  2FGG A;  2LV2 A;  1IBL E;  1XNR E;  2EL4 A;  5KL6 A;  1T39 A;  4K0K E;  2E5L I;  5K36 B;  2PO1 B;  2LMZ A;  1EA6 A;  4FWD A;  2LBS B;  2MC5 A;  4MLV A;  1Y6Z A;  5EKW A;  1ZM9 A;  5KL7 A;  2RS7 A;  4MLQ A;  3MSW A;  1F2I G;  4R8O A;  3QG5 C;  1Y5Y A;  1RHY A;  4PU9 A;  3ZZU A;  1UBD C;  1XNQ E;  1X5W A;  1ZBQ A;  2F4V I;  2NUE A;  4FK5 C;  2VF1 A;  1UIL A;  4QNK A;  4M2Z A;  2V89 A;  4R2Q A;  2EOE A;  3QT7 A;  5AC4 A;  2ELY A;  4JI4 I;  5CFF E;  5C0X F;  4M1K A;  1ZM4 A;  3L7Z A;  4LF8 I;  2HK2 A;  2JY9 A;  2BV3 A;  1KTV A;  5DRO A;  4OO1 D;  1TF6 A;  1NZ0 A;  2Z5E A;  3WU6 A;  2RPC A;  3HUL A;  1X47 A;  4DR7 I;  2R1F A;  4R03 A;  4DV6 I;  4Z7Y A;  2EPC A;  4AM3 A;  2EMY A;  3CDI A;  2EM0 A;  3OML A;  1IBK E;  1NEI A;  2Z5C B;  5C0X B;  2YPN A;  2M7Q A;  1KYQ A;  2ENH A;  1L4S A;  3EPL A;  1PJS A;  2EOI A;  1MX0 A;  1Z0E A;  5FLX Q;  1FWK A;  2CT1 A;  2C39 B;  5C0X E;  1IBL I;  3BGH A;  4BA2 A;  1TN9 A;  4DV4 E;  2RSM A;  3FIG A;  4HAC A;  2UUC E;  4DU8 A;  1GZ6 A;  3B78 A;  1MGT A;  1RMD A;  4X8W A;  1XMO I;  1XMO E;  2HHH E;  2IOQ A;  3HKM A;  2LRS A;  1X6H A;  3LML A;  3C6M A;  4ZYD A;  3AV0 A;  4YHH I;  1WUU A;  2EPA A;  3J81 C;  5LMN E;  1OJ4 A;  2OI2 A;  3V2U C;  2ZM6 I;  3IWC A;  2EFG A;  1NHH A;  1HNW I;  2WBT A;  4M9V C;  1A6F A;  2LVH A;  2ZIT A;  3J7A M;  2WCC 3;  3MHH C;  4DR2 I;  2GQ0 A;  2UXD E;  3M6A A;  3ZM7 A;  2JR1 A;  4B3T E;  4MDT A;  4QNJ A;  2RTX A;  2VQF E;  2HJJ A;  2C38 B;  2EQ3 A;  4ZYE A;  2GPI A;  2UXC I;  1XHK A;  2HHH I;  1UN6 B;  4M0V A;  1BBO A;  4FWH A;  5K36 E;  4LCG A;  2ADR A;  5A2Q C;  1Z0C A;  2X36 A;  2WNR B;  3QT5 A;  1UEK A;  5AC5 A;  2VQF I;  3THO B;  4LF8 E;  1ZXM A;  4B3T I;  1N32 E;  2GO4 A;  1DGC A;  2EPP A;  1FJG E;  2EML A;  4RHB B;  4DKK A;  2NAB A;  2F8B A;  3LLH A;  2JOB A;  2EL5 A;  3P3C A;  4U3B A;  5KL3 A;  3GCM A;  4YY3 E;  4ZVI A;  5LMN I;  2V2Q A;  1XNQ I;  4HY1 A;  5K36 F;  2YTD A;  2VRD A;  2NUF A;  2ENC A;  4AID A;  1QNT A;  1Z0G A;  4FW5 A;  2EPR A;  4NXM E;  1N0V C;  4GQU A;  1T4O A;  4JI8 I;  1USV A;  2YSP A;  4BC9 A;  5DNX A;  4OO1 F;  1H72 C;  3T1H I;  4JI5 I;  4HYM A;  2HGH A;  1N3G A;  1ZXN A;  2BA0 D;  4F6M A;  2EM3 A;  2LUQ A;  2I13 A;  4DR6 E;  4HXZ A;  5C0X C;  4DV4 I;  4OOG C;  1K47 A;  4JI6 I;  2YTP A;  4JG4 A;  2BA1 D;  2EJ4 A;  2JYA A;  1IBK I;  1YYK A;  1Y4U A;  3Q6N A;  3J80 Q;  2L33 A;  1UDN A;  4WUB A;  5T6J A;  4USM A;  5BR8 E;  4BS9 A;  3T1Y I;  4LFA I;  2VF3 A;  1RQ0 A;  4DV6 E;  1N33 I;  5AE2 A;  3ADJ A;  2R42 A;  4FW4 A;  4F9A B;  4LF5 E;  4LF7 E;  1N36 I;  5A6K A;  3ZZ0 A;  3ZOQ B;  2MDR A;  3IWB A;  1T38 A;  1X3C A;  5K36 C;  2DMY A;  3ZZT A;  4DR4 I;  2YRM A;  2WW4 A;  4BCA A;  4IFD B;  2DSY A;  2EM8 A;  4MU0 A;  4J3D A;  2LO3 A; 
#chains in the Genus database with same CATH homology
 3WU4 A;  1Z0T A;  2B9D A;  1J5E E;  1XMQ E;  3VK6 A;  2N3H A;  4DV7 E;  4FN5 A;  1IBL I;  3ADG A;  4WPY A;  4NXN E;  2L2N A;  1XNR I;  4DPX A;  4JYA I;  4TUG A;  1FI4 A;  2CPN A;  3GON A;  4IZJ D;  3J81 Q;  4X62 I;  1QZR A;  3CWV A;  3K6Q A;  4DR3 I;  4M30 A;  4B3R I;  3OTO E;  2L6M A;  2JVA A;  2UXB I;  4JI3 E;  4KQV A;  1I94 I;  4X66 E;  4BBY A;  4DV5 I;  3LPS A;  2V8Q B;  1WXR A;  1KKH A;  2E1R A;  3JU0 A;  3F6H A;  1DQ3 A;  2KON A;  5F3W A;  4X64 E;  1HNZ E;  2VE7 C;  4F54 A;  1J26 A;  2VQE I;  1USU A;  4DU7 A;  1NHJ A;  3HPS A;  4LFC E;  3OTO I;  4JV5 E;  4JV5 I;  1IBM E;  4DV0 I;  4DR3 E;  1STU A;  2UUB I;  4X62 E;  2YT4 A;  1H74 A;  4N3O A;  2L92 A;  1N0U A;  3F0N A;  3H09 A;  4R1F A;  5FLX C;  3DF6 A;  2CG9 A;  5LL6 R;  4LF5 I;  4JI0 E;  4EMD A;  3J7Y p;  4P7A A;  3PYF A;  1QU6 A;  3HJC A;  3K17 A;  4RPF A;  2VQE E;  5IT9 C;  3K1J A;  1BKN A;  4DR6 I;  1Z0B A;  5AE1 A;  5DNY A;  4DV7 I;  2PNL A;  3ADI A;  4LF4 I;  4DPW A;  2BM1 A;  4DV3 E;  4JI1 E;  2RS6 A;  4JI3 I;  2JOX A;  4GKK E;  3T1Y E;  4LFA E;  2O1T A;  3B82 A;  4AQY E;  2J7K A;  3QT6 A;  1Z5B A;  1ZM2 A;  1O0W A;  2Z5B B;  2V2V A;  1Z0W A;  3PYG A;  4DPT A;  4OX9 E;  4LF7 I;  2UUA E;  4L5N C;  1B62 A;  4WUD A;  1N33 E;  1RRE A;  1YYO A;  2L2K B;  4JI7 E;  2AJ4 A;  1X49 A;  1U2R A;  4J8Z A;  1MG7 A;  4DR4 E;  3HQ1 A;  3K85 A;  5LMU E;  3DJW A;  3ADL A;  3JAM Q;  2HFS A;  1N32 I;  2LJP A;  1N36 E;  4YHH E;  2KHX A;  2XEX A;  3V5R A;  5A2Q Q;  5BR8 I;  1S4E A;  4DUY I;  1RC7 A;  3ZKD A;  2E1M A;  4KHP E;  4DPY A;  4BMJ A;  2CGE A;  4DR2 E;  1HNW E;  3F6G A;  2ZM6 E;  1YZ9 A;  4IZJ A;  2L3J A;  4WUC A;  4KHP I;  3T1H E;  4JI5 E;  1RR9 A;  2HKE A;  3P06 A;  4IZJ B;  2L2M A;  2GS8 A;  4GKJ I;  4P7D A;  4IZK B;  4JI8 E;  2CZ9 A;  4GKJ E;  2UXC E;  1PIE A;  2Z5C A;  5IWA E;  4LTY A;  1WHN A;  4DMI A;  1Z5C A;  1KVK A;  2ZBK B;  3LNU A;  4YY3 I;  1PKP A;  4WYQ B;  3IWD A;  2UU9 E;  4WFT A;  5LMU I;  2M1S A;  2LJH A;  2JWO A;  1DI2 A;  4LU9 A;  5IWA I;  1UHZ A;  1ELO A;  4DR7 E;  3LTO A;  1KIJ A;  4K0K I;  4P52 A;  3Q1Q A;  2UXD I;  4WSP A;  4JI4 E;  4DR5 I;  2V83 A;  2UU9 I;  5GME A;  2IHR 1;  2A2D A;  2X7I A;  4DUY E;  4IZK A;  2H36 X;  4GKK I;  4DV3 I;  1T4L B;  2LUP B;  1DAR A;  2YZT A;  2KOU A;  3WU5 A;  2A2C A;  2HFU A;  4OX9 I;  4BC7 A;  4URL A;  2UUC I;  2PNM A;  2FV4 B;  2DEJ A;  4FW9 A;  1PVG A;  4I3H A;  3HTX A;  3PYE A;  4KZS A;  2V2Z A;  4JI2 E;  1H73 A;  4MYU A;  1EI1 A;  1X48 A;  3PRY A;  4JI7 I;  4DV1 I;  3VYY A;  4JI1 I;  5FWK A;  2B7T A;  4L8N A;  4JI0 I;  2UUA I;  2E5L E;  2NPF A;  5GMD A;  4UT4 A;  4X65 E;  2HK3 A;  4I8O A;  2V86 A;  1T4N A;  4LFB E;  2LTS A;  3C4T A;  3KWR A;  2UUB E;  4XTJ A;  2F4V E;  4DUZ E;  3VYX A;  4MYT A;  1HNX I;  2N3G A;  3HPZ A;  2EZ6 A;  3J7A G;  4FWG A;  3RMP A;  5L3J A;  3B8H A;  2L3C A;  2K4V A;  1B63 A;  2V85 A;  2LTR A;  4LF6 I;  2HKJ A;  2O1V A;  4B3M E;  4F9C B;  1Z0V A;  5AE3 A;  2IOP A;  1N34 E;  2DEI A;  3HXL A;  1I94 E;  4Q28 A;  4LF9 I;  4UTG A;  2DIX A;  4DV0 E;  4AQY I;  1MU5 A;  1IBM I;  1H7S A;  4LFC I;  3WU3 A;  1EKZ A;  2O1U A;  1D6T A;  4DR1 E;  2Q2E B;  5IT9 Q;  2BM0 A;  4PRX A;  4LF4 E;  1HK7 A;  4ED4 A;  2WZO A;  2ODR D;  3Q6M A;  1HR0 E;  3H4L A;  4B3M I;  1SR9 A;  4LF6 E;  1WHQ A;  4B3S I;  4X66 I;  2Z5B A;  4DV2 E;  2MC6 A;  2V88 A;  1J5E I;  1Z5A A;  1Z59 A;  4HAC B;  1VIS A;  2ODR C;  4LF9 E;  2LE2 A;  4DPU A;  1HR0 I;  4LFB I;  2DB2 A;  4X64 I;  1HNZ I;  4JYA E;  4NXN I;  1ZBT A;  3D4J A;  2O1W A;  4GEQ B;  1NHI A;  2NUG A;  3J80 C;  4DV1 E;  1XMQ I;  2UXB E;  2V87 A;  2M4I A;  4B3R E;  4USK A;  4PRV A;  4DV2 I;  4DUZ I;  4JI2 I;  2R3V A;  2B7V A;  4B3S E;  3JAM C;  3PYD A;  1S16 A;  4JI6 E;  2L8T A;  1N34 I;  2NA2 A;  1YYW A;  1FKA E;  4DXL A;  1ZM3 A;  1FWL A;  1Y4S A;  3C4B A;  4DV5 E;  4DR1 I;  3ZKB A;  2FTX B;  4NXM I;  3AUZ A;  4F9B B;  5ADZ A;  2V8P A;  4P78 A;  1HNX E;  3JTZ A;  2EWL A;  1H7U A;  4Z7C A;  2G7H A;  2B3T B;  5AAS A;  4DR5 E;  1GQE A;  2V34 A;  1FNM A;  3QT8 A;  4TUI A;  1FJG I;  3P1X A;  4X65 I;  2FGG A;  1IBL E;  1XNR E;  4K0K E;  2E5L I;  2LMZ A;  1EA6 A;  4FWD A;  2LBS B;  2MC5 A;  1Y6Z A;  1ZM9 A;  2RS7 A;  3MSW A;  4PU9 A;  4R8O A;  3ZZU A;  1XNQ E;  1ZBQ A;  2F4V I;  2NUE A;  2VF1 A;  1UIL A;  4M2Z A;  2V89 A;  3QT7 A;  4JI4 I;  5CFF E;  4M1K A;  1ZM4 A;  4LF8 I;  2HK2 A;  2JY9 A;  2BV3 A;  1KTV A;  1NZ0 A;  2Z5E A;  3WU6 A;  3HUL A;  1X47 A;  4DR7 I;  4DV6 I;  4R03 A;  4Z7Y A;  3OML A;  1IBK E;  2Z5C B;  2M7Q A;  1Z0E A;  1MX0 A;  5FLX Q;  1FWK A;  4DV4 E;  2RSM A;  3FIG A;  4HAC A;  2UUC E;  4DU8 A;  1GZ6 A;  3B78 A;  4X8W A;  1XMO I;  1XMO E;  2HHH E;  2IOQ A;  2LRS A;  3LML A;  3AV0 A;  4YHH I;  1WUU A;  3J81 C;  5LMN E;  1OJ4 A;  2OI2 A;  3V2U C;  2ZM6 I;  3IWC A;  2EFG A;  1NHH A;  1HNW I;  1A6F A;  2ZIT A;  3J7A M;  4DR2 I;  2GQ0 A;  2UXD E;  3M6A A;  3ZM7 A;  2JR1 A;  4B3T E;  2RTX A;  2VQF E;  2UXC I;  1XHK A;  2HHH I;  4FWH A;  4M0V A;  5A2Q C;  1Z0C A;  2X36 A;  3QT5 A;  1UEK A;  2VQF I;  4LF8 E;  1ZXM A;  4B3T I;  1N32 E;  1FJG E;  4DKK A;  2F8B A;  3LLH A;  2JOB A;  4YY3 E;  4ZVI A;  5LMN I;  2V2Q A;  1XNQ I;  4HY1 A;  2NUF A;  1Z0G A;  4NXM E;  1N0V C;  1T4O A;  4JI8 I;  1USV A;  4BC9 A;  1H72 C;  3T1H I;  4JI5 I;  4HYM A;  1ZXN A;  4DV4 I;  4DR6 E;  2LUQ A;  4HXZ A;  4OOG C;  1K47 A;  4JI6 I;  4JG4 A;  1IBK I;  1YYK A;  1Y4U A;  3Q6N A;  3J80 Q;  2L33 A;  4WUB A;  5T6J A;  4USM A;  5BR8 E;  4BS9 A;  3T1Y I;  4LFA I;  2VF3 A;  1RQ0 A;  4DV6 E;  1N33 I;  5AE2 A;  3ADJ A;  2R42 A;  4F9A B;  4LF5 E;  4LF7 E;  1N36 I;  3ZZ0 A;  3ZOQ B;  2MDR A;  3IWB A;  2DMY A;  3ZZT A;  4DR4 I;  2WW4 A;  4BCA A;  2DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...