1I94E

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
PETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1i94E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94E02
2A2DA 1T4NA 2DMYA 2ZBKB 2L2MA 4DUZE 4JG4A 2V2VA 2RS7A 1N34E 1NHHA 3VYYA 2J7KA 4DPYA 4YHHI 2HKEA 2B7TA 4DR7E 3LTOA 2EFGA 4P52A 1PIEA 2UUAI 1Z5CA 3QT8A 3V5RA 4UTGA 4JI3E 2UUBE 4DPWA 1UILA 4KQVA 2R42A 2UUAE 2DEIA 4B3MI 4GKKI 3ADIA 5A2QC 1HNWE 4DV2I 3GONA 1J5EI 3J80Q 1S4EA 3LNUA 4WUCA 4DV5E 2ZITA 4DU7A 4DR3E 4URLA 2UXDI 1KVKA 2NUGA 1HR0I 4YY3E 4PRVA 4DR3I 4DUZI 1RREA 3B82A 4X64E 1ELOA 3H4LA 2VF3A 2BV3A 1YYOA 1RR9A 4JI4I 2UUCE 4DR4E 2VQEE 4X62I 4P7AA 1FWKA 4JI8I 4LF9I 2HFSA 1N0VC 4MYTA 1J5EE 4X62E 2VQEI 3C4TA 4B3SI 4DV0E 3ADLA 3PYEA 1NHJA 3QT6A 4DV7I 4LF8E 1Z0CA 1Z0VA 2E5LE 5A2QQ 4LF5E 1XNRI 1IBLE 1EKZA 2B7VA 2WW4A 3B78A 4NXMI 2L2NA 4B3TE 1XNRE 2DEJA 3Q1QA 3F0NA 2DIXA 5L3JA 4DU8A 4FWDA 2Q2EB 4FW9A 3J7AM 1Z5AA 1HNXE 2B3TB 4DPTA 1H72C 1H7SA 4B3RI 4JI5E 1XMQI 5FLXC 4WUBA 4DR2I 4DPXA 1N36I 1Z0EA 4DPUA 2HHHI 5LMUE 4JI0I 2HFUA 2IHR1 4DV4E 4NXNE 1KKHA 2MDRA 1MX0A 1VISA 4LF8I 3ZKBA 2NPFA 1QZRA 5LMUI 4ED4A 1Z0BA 4PU9A 5GMDA 4B3TI 4FN5A 1FKAE 4DV6E 4YY3I 2V8PA 5BR8E 4DXLA 4DV1E 4USKA 1FWLA 1D6TA 2L2KB 4JI7I 4DR2E 1WUUA 1J26A 3T1YI 1X49A 4DKKA 1HNWI 4DR4I 1GQEA 1XNQE 4DR6I 4JI0E 3ZKDA 4JI7E 4Z7YA 3ZZUA 2HHHE 3ZZTA 1IBME 2X7IA 4DV4I 2UXCI 4KHPE 2LRSA 3K1JA 3K17A 2VQFI 2UU9E 1PKPA 2E1RA 3J81C 3WU5A 4DV6I 2JY9A 4XTJA 3JAMC 1MU5A 2X36A 1MG7A 3V2UC 4WUDA 1T4OA 1ZM2A 3T1YE 1YYWA 2L3CA 4LF6E 4GKJE 2RTXA 4JI2I 2UUBI 4LFCI 2V2ZA 4I3HA 4K0KI 1FJGI 1ZBTA 1RC7A 2OI2A 4HY1A 1OJ4A 5LMNI 2NA2A 2A2CA 1B63A 4M30A 1IBKE 5IWAI 4X8WA 3PYDA 2V2QA 5LMNE 3VYXA 1HR0E 4EMDA 1Z5BA 4X64I 3HTXA 3LPSA 2UUCI 1YYKA 1YZ9A 4RPFA 4M2ZA 1N36E 4GKKE 3WU6A 4AQYE 4UT4A 4LFAI 2LUQA 4LF9E 3J81Q 4LFCE 3QT7A 1ZM3A 1ZXMA 2UXBE 1STUA 1S16A 4USMA 3OTOI 4B3SE 4OX9I 1FI4A 4HACB 2E5LI 4LFBE 2L33A 3OTOE 1KIJA 4LF4E 1X48A 4KHPI 4X66I 5IT9Q 2LTSA 4YHHE 5CFFE 2ZM6I 4DR5I 2VQFE 4DR1E 4NXME 4HYMA 1N34I 2LBSB 4DR7I 1Z0TA 1A6FA 3JAMQ 4DR5E 2HK2A 1N32I 2LTRA 1EI1A 4JI5I 5IT9C 4M1KA 4JYAE 4B3ME 4OX9E 2HKJA 3LLHA 3CWVA 4WFTA 4NXNI 1WHNA 2R3VA 1NHIA 2BM0A 2UU9I 1ZXNA 3D4JA 3PYGA 3QT5A 4JI1E 1BKNA 1UEKA 1HNZE 5IWAE 4R1FA 5FLXQ 4X66E 4LF5I 1Z0WA 1ZM4A 2F4VI 1K47A 1X47A 3B8HA 1DI2A 5BR8I 4JI4E 1H74A 4DV3E 1FNMA 4LF7I 4X65E 1DARA 3ADJA 4FWGA 2CZ9A 1Z0GA 2N3HA 2GS8A 1XMOI 4JV5I 1N33E 4JI3I 2V34A 2XEXA 4LF7E 4JYAI 4AQYI 4LFAE 2RS6A 1I94E 1B62A 4OOGC 4DV7E 4DUYE 1O0WA 2UXCE 2HK3A 4JV5E 1QU6A 1N33I 1N0UA 4JI6E 3HULA 1I94I 3J7Yp 2KHXA 3T1HI 1ZM9A 2L3JA 4DV5I 4LFBI 2F4VE 3WU3A 2UXDE 4JI6I 4LF4I 4FWHA 3T1HE 3WU4A 2NUEA 2EZ6A 2RSMA 1H7UA 2ZM6E 4DR1I 1EA6A 4X65I 4MYUA 4DR6E 4B3RE 4DV3I 2N3GA 3PYFA 1HNXI 2LUPB 2LJHA 1IBMI 1H73A 3C4BA 4GKJI 2AJ4A 4Z7CA 1WHQA 3M6AA 3J80C 1XNQI 2BM1A 1PVGA 4DV0I 1KTVA 1IBKI 2CPNA 1NZ0A 5LL6R 2NUFA 1U2RA 5GMEA 1IBLI 1RQ0A 4DV1I 1N32E 3P1XA 4PRXA 4JI2E 1Z59A 2YT4A 4HXZA 2JVAA 4JI8E 1FJGE 3J7AG 4HACA 2DB2A 1UHZA 3ZM7A 2LJPA 1XMQE 3ADGA 1T4LB 1XHKA 4WYQB 1XMOE 4LF6I 2UXBI 4ZVIA 4JI1I 3ZZ0A 1HNZI 4DV2E 4K0KE 4DUYI
chains in the Genus database with same CATH superfamily
1X6HA 1Y6ZA 1WRJA 2A2DA 3VHTB 1A1LA 1T4NA 4FW3A 2DMIA 2DMYA 2EL5A 2GHFA 2EPUA 2M1SA 2ZBKB 2L2MA 4DUZE 4JG4A 5K36C 2V2VA 1KYQA 3DF6A 2RS7A 1N34E 1NHHA 3VYYA 2J7KA 2O1TA 4DPYA 1IQSA 5C0XC 2HKEA 2K7IA 2B7TA 5JEAF 2EMKA 4YHHI 2EMBA 4DR7E 1BBOA 4R03A 3LTOA 2EFGA 4P52A 1PIEA 2UUAI 1Z5CA 2EOYA 1N3GA 2EM3A 3OMLA 2LO3A 3QT8A 3V5RA 4UTGA 3M85G 4F6NA 4JI3E 1A1IA 1TF3A 2UUBE 5DRRA 4DPWA 1UILA 1HK7A 4KQVA 2EMAA 3PS1A 4ZYEA 2VE7C 2R42A 2EOZA 4R2AA 2UUAE 2DEIA 5FWKA 1A1KA 1T39A 2BA1D 4R2DA 4B3MI 2VESA 4GKKI 3ADIA 5A2QC 2EPLX 2H36X 1HNWE 2EQ3A 4DV2I 3GONA 2I13A 4IFDB 1J5EI 3J80Q 3TQMA 1S4EA 2YSPA 4OO1C 3MHSC 3LNUA 4WUCA 4DV5E 2ZITA 2EL4A 1DQ3A 1YH8A 2RQLA 2WBSA 4IZJB 4DU7A 4DR3E 1EH6A 2EN3A 2V89A 4URLA 4IFDE 3M7NG 2UXDI 2RPCA 2Z5CA 1KVKA 3P06A 2NUGA 2GO4A 3THOB 1HR0I 5AE3A 2WZOA 3JU0A 2J65A 4NZVA 1L4SA 4YY3E 2PO2B 4PRVA 3LMLA 2O1WA 4NHRA 5AASA 4DR3I 2LMZA 4IZKB 2CTDA 2EMXA 2V83A 2M4IA 1RREA 2PNMA 4O43A 3B82A 4DUZI 2YTEA 5A6BD 4X64E 1ELOA 5K36D 3H4LA 2JEBB 3P3GA 2VF3A 2BV3A 2Z5BA 1YYOA 1RR9A 3NZKA 1E3HA 4IFDA 4JI4I 2UUCE 4OZEA 4I8OA 4DR4E 2VQEE 4X62I 1UBDC 4P7AA 1FWKA 2Z5CB 4ZYDA 4JI8I 4LF9I 2JPAA 1IQOA 2HFSA 1N0VC 2V86A 4MYTA 3JTZA 2BA1G 4N3OA 1J5EE 4X62E 2VQEI 2EMWA 3C4TA 3AUZA 3B4TA 2FGGA 1Y5YA 1QNTA 2EMHA 4B3SI 4DV0E 2EOXA 3ADLA 3PYEA 1NHJA 1G2DC 3QT6A 4DV7I 1YUJA 4LF8E 2YTGA 1Z0CA 1Z0VA 2E5LE 5A2QQ 4LF5E 3BBGA 3HPSA 1XNRI 2BR2A 2BBGA 2EMZA 1IBLE 1EKZA 2B7VA 4MQYA 2JT2A 2NN6A 2WW4A 2EPKX 2LV2A 2CSHA 1X6FA 4ZYHA 1ZR9A 2MKNA 3B78A 4NXMI 2L2NA 4B3TE 1XNRE 1UDQA 4IZJA 2DEJA 5JEAC 2PO1B 3Q1QA 3F0NA 1Y4SA 2DIXA 1A1JA 1YSAC 5L3JA 3HXLA 3EQ1A 4DU8A 1BBGA 4AM3A 4FWDA 1NEIA 2IOPA 2Q2EB 2EWLA 2GPIA 4FW9A 3J7AM 4IFDC 5T6JA 2C38B 1ZBQA 1IMUA 1Z5AA 3EPKA 1HNXE 2B3TB 4DPTA 2DGCA 2ADRA 1H7SA 1H72C 3U1KA 4R2QA 5LLQA 4BA2B 2EM9A 4JI5E 2EM8A 5FLXC 4WUBA 1XMQI 4ISAA 4MU1A 4DR2I 2Z5EA 4DPXA 1PJQA 2MC6A 1XXEA 1N36I 1Z0EA 4BHCA 4MLQA 1YPNA 5EKWA 4DPUA 2HHHI 3K6QA 4Q35B 5LMUE 4JI0I 2HFUA 4OO1D 1A1HA 4IS9A 2IHR1 4DV4E 2EN6A 4NXNE 2EM4A 2EOOA 2YU5A 1KKHA 4MDTA 2MDRA 1MX0A 1VISA 4LF8I 3ZKBA 5C0XB 4LOMA 4LTYA 2PNLA 5KL4A 2GQ0A 2NPFA 2PO0B 4BCAA 1QZRA 5LMUI 3EPHA 4ED4A 2YTFA 2RSIA 2J7JA 1F2IG 1Z0BA 4PU9A 5GMDA 4BA1A 2C37B 4B3TI 5EL9A 5AE2A 5A6AA 2EJ4A 4IJDA 2EPRA 4FN5A 3H09A 4OKGA 4U3BA 1FKAE 4DV6E 4HTGA 4YY3I 2EQ1A 2YSOA 2V8PA 2EOEA 5BR8E 1MEYC 4AIDA 4DXLA 4DV1E 1P42A 3M85D 2B9DA 4USKA 2JWOA 4RH8A 2ELYA 1FWLA 1D6TA 4N4RB 2L2KB 4JI7I 2HGHA 4LU9A 2PO1A 1Z1BA 4DR2E 3AV0A 4R2CA 3EPLA 1J26A 1WUUA 1X49A 4DKKA 2CGEA 3T1YI 2V87A 1HNWI 2EMLA 2CVEA 2YTPA 4M9VC 1GQEA 4M0VA 1XNQE 2BR2B 4JI0E 1X3CA 4FW4A 4DR4I 3ZKDA 4JI7E 4Z7YA 2EMCA 2C38A 3L7ZA 2EN1A 2WBUA 3ZZUA 2HHHE 3ZZTA 1IBME 2M7QA 3MHHC 4F9CB 2X7IA 5F3WA 1ZAAC 4DV4I 2UXCI 2NN6E 2EE8A 1RHYA 2M9AA 3P3EA 1UN6B 2LRSA 4KHPE 3K1JA 1OYSA 1RMDA 3THNA 3UHMA 3K17A 2VQFI 2UU9E 1PKPA 2E1RA 3J81C 4FW6A 2JOXA 4F9BB 4U3DA 3WU5A 4DV6I 2JY9A 4XTJA 4BA2A 3JAMC 2PRTA 1MU5A 2ENCA 1G2FC 2EMIA 3RMPA 1MG7A 2X36A 2ENHA 3V2UC 2O1UA 2EPNA 2GLIA 4GZNC 5JEAA 5K36E 4WUDA 1T4OA 3GMEA 1ZM2A 4P7DA 1PJSA 2LT7A 4WXCA 3T1YE 1YYWA 5A69A 5AE1A 1SFEA 2L3CA 4LF6E 4GKJE 2RTXA 5KL2A 4FK5C 4JI2I 1DGCA 2YTDA 4LFCI 2UUBI 2EOMA 2V2ZA 4I3HA 2ODRC 2BA0D 2R76A 4K0KI 1LLMC 4J8ZA 1FJGI 1ZBTA 1RC7A 2OI2A 1A1FA 3PRYA 2NN6D 2K4VA 4HY1A 2EN4A 1OJ4A 4IFDF 3C6KA 5LMNI 3L00A 2NA2A 2A2CA 1B63A 2VRDA 1OYRA 2JE6B 4M30A 1IBKE 4X9JA 5IWAI 4X8WA 1YFHA 2NN6C 1AAYA 2A25A 2PO2A 3PYDA 3U1YA 2V2QA 2C37A 5LMNE 3VYXA 4R2RA 5DRQA 3UK3C 2EOFA 1HR0E 1JK1A 2AE8A 4IZKA 3CDIA 1USVA 2EPCA 2LJUA 1GTKA 4EMDA 2IESA 3ECRA 3KWRA 1Z5BA 2N8XA 3DD6A 1BB8A 2IERA 2JOBA 4X64I 5AC4A 3EPJA 4DMIA 1TF6A 3HTXA 3LPSA 2UUCI 1YYKA 2DLQA 2WP8A 1YZ9A 4RPFA 3PS2A 4M2ZA 1N36E 4GKKE 3WU6A 4AQYE 4UT4A 4LFAI 2LUQA 2YTQA 4LF9E 2C39B 5JEAD 2JP9A 2E1MA 3Q6NA 3J81Q 2KOUA 2YRMA 3IWCA 2EPMX 4LFCE 2BA0G 3QT7A 1ZM3A 1ZXMA 5IV8B 2UXBE 1STUA 3HPZA 1S16A 4USMA 3OTOI 2EM5A 4B3SE 4F2JC 5DROA 1WJPA 1YUIA 5DRPA 1FI4A 2WNRB 4HACB 4OX9I 3FIGA 1T38A 2E5LI 4O24A 2L6MA 4LFBE 4WSGA 2L33A 3OTOE 5K36F 2EOIA 1KIJA 2VF1A 4LF4E 3GLLA 2YPNA 1X48A 4KHPI 4X66I 5IT9Q 2LTSA 4LCHA 3DJWA 3IWDA 2G7HA 5A6BA 5CFFE 4YHHE 1PDAA 5JEAE 5K36A 2ZM6I 4DR5I 2VQFE 4DR1E 2EMGA 4NXME 1UDOA 4HYMA 1N34I 4BBYA 5DNXA 2LBSB 2GO3A 3MSWA 2O3ZA 4DR7I 2YTIA 1Z0TA 1A6FA 2JEAB 3JAMQ 4DR5E 2HK2A 1P47A 1N32I 2LTRA 1EI1A 4O4KA 2R1FA 4KZSA 4JI5I 5IT9C 2EPOA 4WX9A 4L5NC 3F6HA 2L8TA 4M1KA 2YTJA 4KWYA 4JYAE 4Q28A 4B3ME 4OX9E 4BC9A 2HKJA 3LLHA 2ODRD 3CWVA 5TSEA 5C0XF 3M99B 4WFTA 2MKDA 4NXNI 1WHNA 2LCEA 2R3VA 1NHIA 5C0XA 2BM0A 2UU9I 1ZXNA 4O5GA 2EPAA 3C6MA 4ZYGA 4R2SA 1E3PA 3D4JA 3PYGA 4JI1E 1BKNA 1UEKA 3BF2A 1HNZE 3QT5A 2WBTA 5DNLA 5IWAE 2DSYA 4IZJD 4BMJA 4R1FA 5FLXQ 4X66E 1NCSA 3ZOQB 4LF5I 2WCC3 1Z0WA 3K85A 4LCFA 1ZM4A 4GQUA 2F4VI 2EMYA 2YRHA 1K47A 1USUA 1X47A 3B8HA 3HQ1A 5AC5A 2DLKA 2FV4B 2EQ0A 2C39A 1DI2A 3CDJA 4TUIA 1Y4UA 4JI4E 5C0XE 5BR8I 3QG5C 2YWQA 1H74A 3HKMA 2YRKA 1GZ6A 4WPYA 2YZTA 2EN2A 2EM2A 4DV3E 1FNMA 1B69A 2EMFA 4LF7I 4MLVA 4X65E 4B3RI 1DARA 2JR1A 3ADJA 4FWGA 2CZ9A 1Z0GA 3HJCA 2EPPA 2Z5BB 2NN6F 1WXRA 1JK2A 2N3HA 2GS8A 1XMOI 4JV5I 1N33E 4JI3I 2V34A 2XEXA 4F54A 5A6KA 2EOQA 4LF7E 4AQYI 2JEAA 4JYAI 4LFAE 2RS6A 2V88A 2HC5A 1I94E 1B62A 4QNKA 4OOGC 4DV7E 2EOHA 2MDGA 4DUYE 2YTNA 1O0WA 5A6JA 1EH8A 2UXCE 2HK3A 4JV5E 1QU6A 1N33I 3P3CA 2E72A 2EL6A 5JEAB 2O1VA 1N0UA 5KL7A 4JI6E 3HULA 4BC7A 1EH7A 4DV1I 1I94I 3J7Yp 2KHXA 2V8QB 1ZM9A 3T1HI 2L3JA 4LCGA 4DV5I 2EP3A 1VI7A 4LFBI 2IOQA 2EN8A 2F4VE 1TN9A 3WU3A 4R8OA 2EOSA 2UXDE 1UDSA 4FW7A 2EN7A 4JI6I 4MU3A 1A1GA 2LE2A 4LF4I 4FWHA 5ELWA 3T1HE 3WU4A 4HEIA 2NN6B 2NUEA 4F6MA 2EZ6A 2ENAA 3KZYA 2RSMA 2PNZA 2JXPA 4L8NA 1H7UA 2ZM6E 2FTXB 1OYPA 4DR1I 1EA6A 2F1DA 4X65I 1ZU1A 2EM0A 1X6EA 4DR6E 4B3RE 4MYUA 4DV3I 2N3GA 5KL6A 3PYFA 3GCMA 1HNXI 2LUPB 2EPZA 2LJHA 1IBMI 1X5WA 2YTOA 2V85A 2EPXA 1H73A 3C4BA 4GEQB 4TUGA 4J3DA 4GKJI 5KL5A 4OO1F 4OO1A 2AJ4A 2JYAA 3F6GA 4F9AB 3P76A 3PS3A 4DR6I 4Z7CA 2EM7A 2MC5A 2ELZA 2NABA 1WHQA 3J80C 3M6AA 2L92A 1XNQI 3Q6MA 2BM1A 1PVGA 4RHBB 2PNZB 2DRPA 4DV0I 1KTVA 4AIMA 1IBKI 2F8BA 4LPFA 4P78A 2CPNA 4BS9A 1NZ0A 2JE6A 5LL6R 2NUFA 1U2RA 5IXMB 4OO1E 1MGTA 1KJKA 5GMEA 1IBLI 1R6MA 4MU4A 1PJTA 1RQ0A 2EM6A 2KONA 5DNYA 1N32E 4MU0A 1SR9A 3P1XA 4PRXA 4BA1B 4OO1B 1AH5A 3BGHA 1Y60A 2WP8B 4JI2E 3IWBA 3KRNA 2EOJA 1Z59A 2YT4A 2PO0A 4HXZA 2JVAA 4JI8E 2LVHA 4BHBA 2D9HA 2BB8A 4NBQA 2YU8A 1FJGE 1UDNA 4IFDD 5ADZA 2Q8UA 3J7AG 3L7ZB 3H1CA 2CG9A 4WSPA 2WNRA 1R6LA 2JEBA 4HACA 5C0XD 2DB2A 3KZZA 1UHZA 2CT1A 4R2PA 2LJPA 3ZM7A 4R2EA 4QNJA 3BIDA 4IS1C 1XMQE 1YHCA 3ADGA 1T4LB 1XHKA 4WYQB 1XMOE 2I9IA 2EORA 4FW5A 4LF6I 2UXBI 4ZVIA 3VK6A 4JI1I 3ZZ0A 1HNZI 4WXDA 4DV2E 4K0KE 5KL3A 5K36B 2HJJA 3M7ND 4DUYI
chains in the Genus database with same CATH topology
1Y6ZA 2A2DA 1T4NA 2DMYA 2ZBKB 2M1SA 2L2MA 4DUZE 4JG4A 2V2VA 3DF6A 2RS7A 1N34E 1NHHA 3VYYA 2J7KA 2O1TA 4DPYA 4YHHI 2HKEA 2B7TA 4DR7E 4R03A 3LTOA 2EFGA 4P52A 1PIEA 2UUAI 1Z5CA 3OMLA 3QT8A 3V5RA 4UTGA 4JI3E 2UUBE 4DPWA 1UILA 1HK7A 4KQVA 2VE7C 2R42A 2UUAE 2DEIA 5FWKA 4B3MI 4GKKI 3ADIA 5A2QC 2H36X 1HNWE 4DV2I 3GONA 1J5EI 3J80Q 1S4EA 3LNUA 4WUCA 4DV5E 2ZITA 4DU7A 1DQ3A 4IZJB 4DR3E 4URLA 2V89A 2UXDI 2Z5CA 1KVKA 3P06A 2NUGA 1HR0I 5AE3A 2WZOA 3JU0A 4YY3E 4PRVA 3LMLA 2O1WA 5AASA 4DR3I 2LMZA 4IZKB 4DUZI 1RREA 2V83A 2M4IA 2PNMA 3B82A 4X64E 1ELOA 3H4LA 2VF3A 2BV3A 2Z5BA 1YYOA 1RR9A 4JI4I 2UUCE 4I8OA 4DR4E 2VQEE 4X62I 4P7AA 1FWKA 2Z5CB 4JI8I 4LF9I 2HFSA 1N0VC 2V86A 4MYTA 3JTZA 4N3OA 1J5EE 4X62E 2VQEI 3C4TA 3AUZA 2FGGA 4B3SI 4DV0E 3ADLA 3PYEA 1NHJA 3QT6A 4DV7I 4LF8E 1Z0CA 1Z0VA 2E5LE 5A2QQ 4LF5E 3HPSA 1XNRI 1IBLE 1EKZA 2B7VA 2WW4A 3B78A 4NXMI 2L2NA 4B3TE 1XNRE 4IZJA 2DEJA 3Q1QA 3F0NA 1Y4SA 2DIXA 5L3JA 3HXLA 4DU8A 4FWDA 2IOPA 2Q2EB 2EWLA 4FW9A 3J7AM 5T6JA 1ZBQA 1Z5AA 1HNXE 2B3TB 4DPTA 1H72C 1H7SA 4B3RI 4JI5E 1XMQI 5FLXC 4WUBA 4DR2I 2Z5EA 4DPXA 2MC6A 1N36I 1Z0EA 4DPUA 2HHHI 3K6QA 5LMUE 4JI0I 2HFUA 2IHR1 4DV4E 4NXNE 1KKHA 2MDRA 1MX0A 1VISA 4LF8I 3ZKBA 4LTYA 2PNLA 2GQ0A 2NPFA 4BCAA 1QZRA 5LMUI 4ED4A 1Z0BA 4PU9A 5GMDA 4B3TI 5AE2A 4FN5A 3H09A 1FKAE 4DV6E 4YY3I 2V8PA 5BR8E 4DXLA 4DV1E 2B9DA 4USKA 2JWOA 1FWLA 1D6TA 2L2KB 4JI7I 4LU9A 4DR2E 3AV0A 1WUUA 1J26A 2CGEA 1X49A 4DKKA 3T1YI 2V87A 1HNWI 4DR4I 1XNQE 1GQEA 4M0VA 4DR6I 4JI0E 3ZKDA 4JI7E 4Z7YA 3ZZUA 2HHHE 3ZZTA 1IBME 2M7QA 4F9CB 2X7IA 5F3WA 4DV4I 2UXCI 4KHPE 2LRSA 3K1JA 3K17A 2VQFI 2UU9E 1PKPA 2E1RA 3J81C 2JOXA 4F9BB 3WU5A 4DV6I 2JY9A 4XTJA 3JAMC 1MU5A 3RMPA 2X36A 1MG7A 3V2UC 2O1UA 4WUDA 1T4OA 1ZM2A 4P7DA 3T1YE 1YYWA 5AE1A 2L3CA 4LF6E 4GKJE 2RTXA 4JI2I 2UUBI 4LFCI 2V2ZA 4I3HA 2ODRC 4K0KI 4J8ZA 1FJGI 1ZBTA 1RC7A 2OI2A 3PRYA 2K4VA 4HY1A 1OJ4A 5LMNI 2NA2A 2A2CA 1B63A 4M30A 1IBKE 5IWAI 4X8WA 3PYDA 2V2QA 5LMNE 3VYXA 1HR0E 4IZKA 1USVA 4EMDA 3KWRA 1Z5BA 2JOBA 4X64I 4DMIA 3HTXA 3LPSA 2UUCI 1YYKA 1YZ9A 4RPFA 4M2ZA 1N36E 4GKKE 3WU6A 4AQYE 4UT4A 4LFAI 2LUQA 4LF9E 3J81Q 3Q6NA 2E1MA 2KOUA 3IWCA 4LFCE 3QT7A 1ZM3A 1ZXMA 2UXBE 1STUA 3HPZA 1S16A 4USMA 3OTOI 4B3SE 4OX9I 1FI4A 4HACB 3FIGA 2E5LI 4LFBE 2L6MA 2L33A 3OTOE 1KIJA 2VF1A 4LF4E 1X48A 4KHPI 4X66I 5IT9Q 2LTSA 3DJWA 3IWDA 2G7HA 4YHHE 5CFFE 2ZM6I 4DR5I 2VQFE 4DR1E 4NXME 4HYMA 1N34I 4BBYA 2LBSB 3MSWA 4DR7I 1Z0TA 1A6FA 3JAMQ 4DR5E 2HK2A 1N32I 2LTRA 1EI1A 4KZSA 4JI5I 5IT9C 4L5NC 3F6HA 2L8TA 4M1KA 4JYAE 4Q28A 4B3ME 4OX9E 4BC9A 2HKJA 2ODRD 3LLHA 3CWVA 4WFTA 4NXNI 1WHNA 2R3VA 1NHIA 2BM0A 2UU9I 1ZXNA 3D4JA 3PYGA 3QT5A 4JI1E 1BKNA 1UEKA 1HNZE 5IWAE 2DSYA 4IZJD 4BMJA 4R1FA 5FLXQ 4X66E 3ZOQB 4LF5I 1Z0WA 3K85A 1ZM4A 2F4VI 1K47A 1USUA 1X47A 3B8HA 3HQ1A 2FV4B 1DI2A 4TUIA 1Y4UA 4JI4E 5BR8I 1H74A 1GZ6A 4WPYA 2YZTA 1FNMA 4DV3E 4LF7I 4X65E 1DARA 2JR1A 3ADJA 4FWGA 2CZ9A 1Z0GA 3HJCA 2Z5BB 1WXRA 2N3HA 2GS8A 1XMOI 4JV5I 1N33E 4JI3I 2V34A 2XEXA 4F54A 4LF7E 4JYAI 4AQYI 4LFAE 2RS6A 2V88A 1I94E 1B62A 4OOGC 4DV7E 4DUYE 1O0WA 2UXCE 2HK3A 4JV5E 1QU6A 1N33I 2O1VA 1N0UA 4JI6E 3HULA 4BC7A 1I94I 3J7Yp 2KHXA 2V8QB 1ZM9A 3T1HI 2L3JA 4DV5I 4LFBI 2IOQA 2F4VE 3WU3A 4R8OA 2UXDE 4JI6I 4LF4I 2LE2A 4FWHA 3T1HE 3WU4A 2NUEA 2EZ6A 2RSMA 4L8NA 1H7UA 2ZM6E 2FTXB 4DR1I 1EA6A 4X65I 4MYUA 4DR6E 4B3RE 4DV3I 2N3GA 3PYFA 1HNXI 2LUPB 2LJHA 1IBMI 2V85A 1H73A 3C4BA 4GEQB 4TUGA 4GKJI 2AJ4A 3F6GA 4F9AB 4Z7CA 2MC5A 1WHQA 3J80C 3M6AA 2L92A 1XNQI 3Q6MA 2BM1A 1PVGA 4DV0I 1KTVA 1IBKI 2F8BA 4P78A 2CPNA 4BS9A 1NZ0A 5LL6R 2NUFA 1U2RA 5GMEA 1IBLI 5DNYA 1RQ0A 2KONA 4DV1I 1N32E 1SR9A 3P1XA 4PRXA 4JI2E 3IWBA 1Z59A 2YT4A 4HXZA 2JVAA 4JI8E 1FJGE 5ADZA 3J7AG 2CG9A 4WSPA 4HACA 2DB2A 1UHZA 3ZM7A 2LJPA 1XMQE 3ADGA 1T4LB 1XHKA 4WYQB 1XMOE 4LF6I 2UXBI 4ZVIA 3VK6A 4JI1I 3ZZ0A 1HNZI 4DV2E 4K0KE 4DUYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2D A;  1T4N A;  2DMY A;  2ZBK B;  2L2M A;  4DUZ E;  4JG4 A;  2V2V A;  2RS7 A;  1N34 E;  1NHH A;  3VYY A;  2J7K A;  4DPY A;  4YHH I;  2HKE A;  2B7T A;  4DR7 E;  3LTO A;  2EFG A;  4P52 A;  1PIE A;  2UUA I;  1Z5C A;  3QT8 A;  3V5R A;  4UTG A;  4JI3 E;  2UUB E;  4DPW A;  1UIL A;  4KQV A;  2R42 A;  2UUA E;  2DEI A;  4B3M I;  4GKK I;  3ADI A;  5A2Q C;  1HNW E;  4DV2 I;  3GON A;  1J5E I;  3J80 Q;  1S4E A;  3LNU A;  4WUC A;  4DV5 E;  2ZIT A;  4DU7 A;  4DR3 E;  4URL A;  2UXD I;  1KVK A;  2NUG A;  1HR0 I;  4YY3 E;  4PRV A;  4DR3 I;  4DUZ I;  1RRE A;  3B82 A;  4X64 E;  1ELO A;  3H4L A;  2VF3 A;  2BV3 A;  1YYO A;  1RR9 A;  4JI4 I;  2UUC E;  4DR4 E;  2VQE E;  4X62 I;  4P7A A;  1FWK A;  4JI8 I;  4LF9 I;  2HFS A;  1N0V C;  4MYT A;  1J5E E;  4X62 E;  2VQE I;  3C4T A;  4B3S I;  4DV0 E;  3ADL A;  3PYE A;  1NHJ A;  3QT6 A;  4DV7 I;  4LF8 E;  1Z0C A;  1Z0V A;  2E5L E;  5A2Q Q;  4LF5 E;  1XNR I;  1IBL E;  1EKZ A;  2B7V A;  2WW4 A;  3B78 A;  4NXM I;  2L2N A;  4B3T E;  1XNR E;  2DEJ A;  3Q1Q A;  3F0N A;  2DIX A;  5L3J A;  4DU8 A;  4FWD A;  2Q2E B;  4FW9 A;  3J7A M;  1Z5A A;  1HNX E;  2B3T B;  4DPT A;  1H72 C;  1H7S A;  4B3R I;  4JI5 E;  1XMQ I;  5FLX C;  4WUB A;  4DR2 I;  4DPX A;  1N36 I;  1Z0E A;  4DPU A;  2HHH I;  5LMU E;  4JI0 I;  2HFU A;  2IHR 1;  4DV4 E;  4NXN E;  1KKH A;  2MDR A;  1MX0 A;  1VIS A;  4LF8 I;  3ZKB A;  2NPF A;  1QZR A;  5LMU I;  4ED4 A;  1Z0B A;  4PU9 A;  5GMD A;  4B3T I;  4FN5 A;  1FKA E;  4DV6 E;  4YY3 I;  2V8P A;  5BR8 E;  4DXL A;  4DV1 E;  4USK A;  1FWL A;  1D6T A;  2L2K B;  4JI7 I;  4DR2 E;  1WUU A;  1J26 A;  3T1Y I;  1X49 A;  4DKK A;  1HNW I;  4DR4 I;  1GQE A;  1XNQ E;  4DR6 I;  4JI0 E;  3ZKD A;  4JI7 E;  4Z7Y A;  3ZZU A;  2HHH E;  3ZZT A;  1IBM E;  2X7I A;  4DV4 I;  2UXC I;  4KHP E;  2LRS A;  3K1J A;  3K17 A;  2VQF I;  2UU9 E;  1PKP A;  2E1R A;  3J81 C;  3WU5 A;  4DV6 I;  2JY9 A;  4XTJ A;  3JAM C;  1MU5 A;  2X36 A;  1MG7 A;  3V2U C;  4WUD A;  1T4O A;  1ZM2 A;  3T1Y E;  1YYW A;  2L3C A;  4LF6 E;  4GKJ E;  2RTX A;  4JI2 I;  2UUB I;  4LFC I;  2V2Z A;  4I3H A;  4K0K I;  1FJG I;  1ZBT A;  1RC7 A;  2OI2 A;  4HY1 A;  1OJ4 A;  5LMN I;  2NA2 A;  2A2C A;  1B63 A;  4M30 A;  1IBK E;  5IWA I;  4X8W A;  3PYD A;  2V2Q A;  5LMN E;  3VYX A;  1HR0 E;  4EMD A;  1Z5B A;  4X64 I;  3HTX A;  3LPS A;  2UUC I;  1YYK A;  1YZ9 A;  4RPF A;  4M2Z A;  1N36 E;  4GKK E;  3WU6 A;  4AQY E;  4UT4 A;  4LFA I;  2LUQ A;  4LF9 E;  3J81 Q;  4LFC E;  3QT7 A;  1ZM3 A;  1ZXM A;  2UXB E;  1STU A;  1S16 A;  4USM A;  3OTO I;  4B3S E;  4OX9 I;  1FI4 A;  4HAC B;  2E5L I;  4LFB E;  2L33 A;  3OTO E;  1KIJ A;  4LF4 E;  1X48 A;  4KHP I;  4X66 I;  5IT9 Q;  2LTS A;  4YHH E;  5CFF E;  2ZM6 I;  4DR5 I;  2VQF E;  4DR1 E;  4NXM E;  4HYM A;  1N34 I;  2LBS B;  4DR7 I;  1Z0T A;  1A6F A;  3JAM Q;  4DR5 E;  2HK2 A;  1N32 I;  2LTR A;  1EI1 A;  4JI5 I;  5IT9 C;  4M1K A;  4JYA E;  4B3M E;  4OX9 E;  2HKJ A;  3LLH A;  3CWV A;  4WFT A;  4NXN I;  1WHN A;  2R3V A;  1NHI A;  2BM0 A;  2UU9 I;  1ZXN A;  3D4J A;  3PYG A;  3QT5 A;  4JI1 E;  1BKN A;  1UEK A;  1HNZ E;  5IWA E;  4R1F A;  5FLX Q;  4X66 E;  4LF5 I;  1Z0W A;  1ZM4 A;  2F4V I;  1K47 A;  1X47 A;  3B8H A;  1DI2 A;  5BR8 I;  4JI4 E;  1H74 A;  4DV3 E;  1FNM A;  4LF7 I;  4X65 E;  1DAR A;  3ADJ A;  4FWG A;  2CZ9 A;  1Z0G A;  2N3H A;  2GS8 A;  1XMO I;  4JV5 I;  1N33 E;  4JI3 I;  2V34 A;  2XEX A;  4LF7 E;  4JYA I;  4AQY I;  4LFA E;  2RS6 A;  1I94 E;  1B62 A;  4OOG C;  4DV7 E;  4DUY E;  1O0W A;  2UXC E;  2HK3 A;  4JV5 E;  1QU6 A;  1N33 I;  1N0U A;  4JI6 E;  3HUL A;  1I94 I;  3J7Y p;  2KHX A;  3T1H I;  1ZM9 A;  2L3J A;  4DV5 I;  4LFB I;  2F4V E;  3WU3 A;  2UXD E;  4JI6 I;  4LF4 I;  4FWH A;  3T1H E;  3WU4 A;  2NUE A;  2EZ6 A;  2RSM A;  1H7U A;  2ZM6 E;  4DR1 I;  1EA6 A;  4X65 I;  4MYU A;  4DR6 E;  4B3R E;  4DV3 I;  2N3G A;  3PYF A;  1HNX I;  2LUP B;  2LJH A;  1IBM I;  1H73 A;  3C4B A;  4GKJ I;  2AJ4 A;  4Z7C A;  1WHQ A;  3M6A A;  3J80 C;  1XNQ I;  2BM1 A;  1PVG A;  4DV0 I;  1KTV A;  1IBK I;  2CPN A;  1NZ0 A;  5LL6 R;  2NUF A;  1U2R A;  5GME A;  1IBL I;  1RQ0 A;  4DV1 I;  1N32 E;  3P1X A;  4PRX A;  4JI2 E;  1Z59 A;  2YT4 A;  4HXZ A;  2JVA A;  4JI8 E;  1FJG E;  3J7A G;  4HAC A;  2DB2 A;  1UHZ A;  3ZM7 A;  2LJP A;  1XMQ E;  3ADG A;  1T4L B;  1XHK A;  4WYQ B;  1XMO E;  4LF6 I;  2UXB I;  4ZVI A;  4JI1 I;  3ZZ0 A;  1HNZ I;  4DV2 E;  4K0K E;  4DUY I; 
#chains in the Genus database with same CATH topology
 1X6H A;  1Y6Z A;  1WRJ A;  2A2D A;  3VHT B;  1A1L A;  1T4N A;  4FW3 A;  2DMI A;  2DMY A;  2EL5 A;  2GHF A;  2EPU A;  2M1S A;  2ZBK B;  2L2M A;  4DUZ E;  4JG4 A;  5K36 C;  2V2V A;  1KYQ A;  3DF6 A;  2RS7 A;  1N34 E;  1NHH A;  3VYY A;  2J7K A;  2O1T A;  4DPY A;  1IQS A;  5C0X C;  2HKE A;  2K7I A;  2B7T A;  5JEA F;  2EMK A;  4YHH I;  2EMB A;  4DR7 E;  1BBO A;  4R03 A;  3LTO A;  2EFG A;  4P52 A;  1PIE A;  2UUA I;  1Z5C A;  2EOY A;  1N3G A;  2EM3 A;  3OML A;  2LO3 A;  3QT8 A;  3V5R A;  4UTG A;  3M85 G;  4F6N A;  4JI3 E;  1A1I A;  1TF3 A;  2UUB E;  5DRR A;  4DPW A;  1UIL A;  1HK7 A;  4KQV A;  2EMA A;  3PS1 A;  4ZYE A;  2VE7 C;  2R42 A;  2EOZ A;  4R2A A;  2UUA E;  2DEI A;  5FWK A;  1A1K A;  1T39 A;  2BA1 D;  4R2D A;  4B3M I;  2VES A;  4GKK I;  3ADI A;  5A2Q C;  2EPL X;  2H36 X;  1HNW E;  2EQ3 A;  4DV2 I;  3GON A;  2I13 A;  4IFD B;  1J5E I;  3J80 Q;  3TQM A;  1S4E A;  2YSP A;  4OO1 C;  3MHS C;  3LNU A;  4WUC A;  4DV5 E;  2ZIT A;  2EL4 A;  1DQ3 A;  1YH8 A;  2RQL A;  2WBS A;  4IZJ B;  4DU7 A;  4DR3 E;  1EH6 A;  2EN3 A;  2V89 A;  4URL A;  4IFD E;  3M7N G;  2UXD I;  2RPC A;  2Z5C A;  1KVK A;  3P06 A;  2NUG A;  2GO4 A;  3THO B;  1HR0 I;  5AE3 A;  2WZO A;  3JU0 A;  2J65 A;  4NZV A;  1L4S A;  4YY3 E;  2PO2 B;  4PRV A;  3LML A;  2O1W A;  4NHR A;  5AAS A;  4DR3 I;  2LMZ A;  4IZK B;  2CTD A;  2EMX A;  2V83 A;  2M4I A;  1RRE A;  2PNM A;  4O43 A;  3B82 A;  4DUZ I;  2YTE A;  5A6B D;  4X64 E;  1ELO A;  5K36 D;  3H4L A;  2JEB B;  3P3G A;  2VF3 A;  2BV3 A;  2Z5B A;  1YYO A;  1RR9 A;  3NZK A;  1E3H A;  4IFD A;  4JI4 I;  2UUC E;  4OZE A;  4I8O A;  4DR4 E;  2VQE E;  4X62 I;  1UBD C;  4P7A A;  1FWK A;  2Z5C B;  4ZYD A;  4JI8 I;  4LF9 I;  2JPA A;  1IQO A;  2HFS A;  1N0V C;  2V86 A;  4MYT A;  3JTZ A;  2BA1 G;  4N3O A;  1J5E E;  4X62 E;  2VQE I;  2EMW A;  3C4T A;  3AUZ A;  3B4T A;  2FGG A;  1Y5Y A;  1QNT A;  2EMH A;  4B3S I;  4DV0 E;  2EOX A;  3ADL A;  3PYE A;  1NHJ A;  1G2D C;  3QT6 A;  4DV7 I;  1YUJ A;  4LF8 E;  2YTG A;  1Z0C A;  1Z0V A;  2E5L E;  5A2Q Q;  4LF5 E;  3BBG A;  3HPS A;  1XNR I;  2BR2 A;  2BBG A;  2EMZ A;  1IBL E;  1EKZ A;  2B7V A;  4MQY A;  2JT2 A;  2NN6 A;  2WW4 A;  2EPK X;  2LV2 A;  2CSH A;  1X6F A;  4ZYH A;  1ZR9 A;  2MKN A;  3B78 A;  4NXM I;  2L2N A;  4B3T E;  1XNR E;  1UDQ A;  4IZJ A;  2DEJ A;  5JEA C;  2PO1 B;  3Q1Q A;  3F0N A;  1Y4S A;  2DIX A;  1A1J A;  1YSA C;  5L3J A;  3HXL A;  3EQ1 A;  4DU8 A;  1BBG A;  4AM3 A;  4FWD A;  1NEI A;  2IOP A;  2Q2E B;  2EWL A;  2GPI A;  4FW9 A;  3J7A M;  4IFD C;  5T6J A;  2C38 B;  1ZBQ A;  1IMU A;  1Z5A A;  3EPK A;  1HNX E;  2B3T B;  4DPT A;  2DGC A;  2ADR A;  1H7S A;  1H72 C;  3U1K A;  4R2Q A;  5LLQ A;  4BA2 B;  2EM9 A;  4JI5 E;  2EM8 A;  5FLX C;  4WUB A;  1XMQ I;  4ISA A;  4MU1 A;  4DR2 I;  2Z5E A;  4DPX A;  1PJQ A;  2MC6 A;  1XXE A;  1N36 I;  1Z0E A;  4BHC A;  4MLQ A;  1YPN A;  5EKW A;  4DPU A;  2HHH I;  3K6Q A;  4Q35 B;  5LMU E;  4JI0 I;  2HFU A;  4OO1 D;  1A1H A;  4IS9 A;  2IHR 1;  4DV4 E;  2EN6 A;  4NXN E;  2EM4 A;  2EOO A;  2YU5 A;  1KKH A;  4MDT A;  2MDR A;  1MX0 A;  1VIS A;  4LF8 I;  3ZKB A;  5C0X B;  4LOM A;  4LTY A;  2PNL A;  5KL4 A;  2GQ0 A;  2NPF A;  2PO0 B;  4BCA A;  1QZR A;  5LMU I;  3EPH A;  4ED4 A;  2YTF A;  2RSI A;  2J7J A;  1F2I G;  1Z0B A;  4PU9 A;  5GMD A;  4BA1 A;  2C37 B;  4B3T I;  5EL9 A;  5AE2 A;  5A6A A;  2EJ4 A;  4IJD A;  2EPR A;  4FN5 A;  3H09 A;  4OKG A;  4U3B A;  1FKA E;  4DV6 E;  4HTG A;  4YY3 I;  2EQ1 A;  2YSO A;  2V8P A;  2EOE A;  5BR8 E;  1MEY C;  4AID A;  4DXL A;  4DV1 E;  1P42 A;  3M85 D;  2B9D A;  4USK A;  2JWO A;  4RH8 A;  2ELY A;  1FWL A;  1D6T A;  4N4R B;  2L2K B;  4JI7 I;  2HGH A;  4LU9 A;  2PO1 A;  1Z1B A;  4DR2 E;  3AV0 A;  4R2C A;  3EPL A;  1J26 A;  1WUU A;  1X49 A;  4DKK A;  2CGE A;  3T1Y I;  2V87 A;  1HNW I;  2EML A;  2CVE A;  2YTP A;  4M9V C;  1GQE A;  4M0V A;  1XNQ E;  2BR2 B;  4JI0 E;  1X3C A;  4FW4 A;  4DR4 I;  3ZKD A;  4JI7 E;  4Z7Y A;  2EMC A;  2C38 A;  3L7Z A;  2EN1 A;  2WBU A;  3ZZU A;  2HHH E;  3ZZT A;  1IBM E;  2M7Q A;  3MHH C;  4F9C B;  2X7I A;  5F3W A;  1ZAA C;  4DV4 I;  2UXC I;  2NN6 E;  2EE8 A;  1RHY A;  2M9A A;  3P3E A;  1UN6 B;  2LRS A;  4KHP E;  3K1J A;  1OYS A;  1RMD A;  3THN A;  3UHM A;  3K17 A;  2VQF I;  2UU9 E;  1PKP A;  2E1R A;  3J81 C;  4FW6 A;  2JOX A;  4F9B B;  4U3D A;  3WU5 A;  4DV6 I;  2JY9 A;  4XTJ A;  4BA2 A;  3JAM C;  2PRT A;  1MU5 A;  2ENC A;  1G2F C;  2EMI A;  3RMP A;  1MG7 A;  2X36 A;  2ENH A;  3V2U C;  2O1U A;  2EPN A;  2GLI A;  4GZN C;  5JEA A;  5K36 E;  4WUD A;  1T4O A;  3GME A;  1ZM2 A;  4P7D A;  1PJS A;  2LT7 A;  4WXC A;  3T1Y E;  1YYW A;  5A69 A;  5AE1 A;  1SFE A;  2L3C A;  4LF6 E;  4GKJ E;  2RTX A;  5KL2 A;  4FK5 C;  4JI2 I;  1DGC A;  2YTD A;  4LFC I;  2UUB I;  2EOM A;  2V2Z A;  4I3H A;  2ODR C;  2BA0 D;  2R76 A;  4K0K I;  1LLM C;  4J8Z A;  1FJG I;  1ZBT A;  1RC7 A;  2OI2 A;  1A1F A;  3PRY A;  2NN6 D;  2K4V A;  4HY1 A;  2EN4 A;  1OJ4 A;  4IFD F;  3C6K A;  5LMN I;  3L00 A;  2NA2 A;  2A2C A;  1B63 A;  2VRD A;  1OYR A;  2JE6 B;  4M30 A;  1IBK E;  4X9J A;  5IWA I;  4X8W A;  1YFH A;  2NN6 C;  1AAY A;  2A25 A;  2PO2 A;  3PYD A;  3U1Y A;  2V2Q A;  2C37 A;  5LMN E;  3VYX A;  4R2R A;  5DRQ A;  3UK3 C;  2EOF A;  1HR0 E;  1JK1 A;  2AE8 A;  4IZK A;  3CDI A;  1USV A;  2EPC A;  2LJU A;  1GTK A;  4EMD A;  2IES A;  3ECR A;  3KWR A;  1Z5B A;  2N8X A;  3DD6 A;  1BB8 A;  2IER A;  2JOB A;  4X64 I;  5AC4 A;  3EPJ A;  4DMI A;  1TF6 A;  3HTX A;  3LPS A;  2UUC I;  1YYK A;  2DLQ A;  2WP8 A;  1YZ9 A;  4RPF A;  3PS2 A;  4M2Z A;  1N36 E;  4GKK E;  3WU6 A;  4AQY E;  4UT4 A;  4LFA I;  2LUQ A;  2YTQ A;  4LF9 E;  2C39 B;  5JEA D;  2JP9 A;  2E1M A;  3Q6N A;  3J81 Q;  2KOU A;  2YRM A;  3IWC A;  2EPM X;  4LFC E;  2BA0 G;  3QT7 A;  1ZM3 A;  1ZXM A;  5IV8 B;  2UXB E;  1STU A;  3HPZ A;  1S16 A;  4USM A;  3OTO I;  2EM5 A;  4B3S E;  4F2J C;  5DRO A;  1WJP A;  1YUI A;  5DRP A;  1FI4 A;  2WNR B;  4HAC B;  4OX9 I;  3FIG A;  1T38 A;  2E5L I;  4O24 A;  2L6M A;  4LFB E;  4WSG A;  2L33 A;  3OTO E;  5K36 F;  2EOI A;  1KIJ A;  2VF1 A;  4LF4 E;  3GLL A;  2YPN A;  1X48 A;  4KHP I;  4X66 I;  5IT9 Q;  2LTS A;  4LCH A;  3DJW A;  3IWD A;  2G7H A;  5A6B A;  5CFF E;  4YHH E;  1PDA A;  5JEA E;  5K36 A;  2ZM6 I;  4DR5 I;  2VQF E;  4DR1 E;  2EMG A;  4NXM E;  1UDO A;  4HYM A;  1N34 I;  4BBY A;  5DNX A;  2LBS B;  2GO3 A;  3MSW A;  2O3Z A;  4DR7 I;  2YTI A;  1Z0T A;  1A6F A;  2JEA B;  3JAM Q;  4DR5 E;  2HK2 A;  1P47 A;  1N32 I;  2LTR A;  1EI1 A;  4O4K A;  2R1F A;  4KZS A;  4JI5 I;  5IT9 C;  2EPO A;  4WX9 A;  4L5N C;  3F6H A;  2L8T A;  4M1K A;  2YTJ A;  4KWY A;  4JYA E;  4Q28 A;  4B3M E;  4OX9 E;  4BC9 A;  2HKJ A;  3LLH A;  2ODR D;  3CWV A;  5TSE A;  5C0X F;  3M99 B;  4WFT A;  2MKD A;  4NXN I;  1WHN A;  2LCE A;  2R3V A;  1NHI A;  5C0X A;  2BM0 A;  2UU9 I;  1ZXN A;  4O5G A;  2EPA A;  3C6M A;  4ZYG A;  4R2S A;  1E3P A;  3D4J A;  3PYG A;  4JI1 E;  1BKN A;  1UEK A;  3BF2 A;  1HNZ E;  3QT5 A;  2WBT A;  5DNL A;  5IWA E;  2DSY A;  4IZJ D;  4BMJ A;  4R1F A;  5FLX Q;  4X66 E;  1NCS A;  3ZOQ B;  4LF5 I;  2WCC 3;  1Z0W A;  3K85 A;  4LCF A;  1ZM4 A;  4GQU A;  2F4V I;  2EMY A;  2YRH A;  1K47 A;  1USU A;  1X47 A;  3B8H A;  3HQ1 A;  5AC5 A;  2DLK A;  2FV4 B;  2EQ0 A;  2C39 A;  1DI2 A;  3CDJ A;  4TUI A;  1Y4U A;  4JI4 E;  5C0X E;  5BR8 I;  3QG5 C;  2YWQ A;  1H74 A;  3HKM A;  2YRK A;  1GZ6 A;  4WPY A;  2YZT A;  2EN2 A;  2EM2 A;  4DV3 E;  1FNM A;  1B69 A;  2EMF A;  4LF7 I;  4MLV A;  4X65 E;  4B3R I;  1DAR A;  2JR1 A;  3ADJ A;  4FWG A;  2CZ9 A;  1Z0G A;  3HJC A;  2EPP A;  2Z5B B;  2NN6 F;  1WXR A;  1JK2 A;  2N3H A;  2GS8 A;  1XMO I;  4JV5 I;  1N33 E;  4JI3 I;  2V34 A;  2XEX A;  4F54 A;  5A6K A;  2EOQ A;  4LF7 E;  4AQY I;  2JEA A;  4JYA I;  4LFA E;  2RS6 A;  2V88 A;  2HC5 A;  1I94 E;  1B62 A;  4QNK A;  4OOG C;  4DV7 E;  2EOH A;  2MDG A;  4DUY E;  2YTN A;  1O0W A;  5A6J A;  1EH8 A;  2UXC E;  2HK3 A;  4JV5 E;  1QU6 A;  1N33 I;  3P3C A;  2E72 A;  2EL6 A;  5JEA B;  2O1V A;  1N0U A;  5KL7 A;  4JI6 E;  3HUL A;  4BC7 A;  1EH7 A;  4DV1 I;  1I94 I;  3J7Y p;  2KHX A;  2V8Q B;  1ZM9 A;  3T1H I;  2L3J A;  4LCG A;  4DV5 I;  2EP3 A;  1VI7 A;  4LFB I;  2IOQ A;  2EN8 A;  2F4V E;  1TN9 A;  3WU3 A;  4R8O A;  2EOS A;  2UXD E;  1UDS A;  4FW7 A;  2EN7 A;  4JI6 I;  4MU3 A;  1A1G A;  2LE2 A;  4LF4 I;  4FWH A;  5ELW A;  3T1H E;  3WU4 A;  4HEI A;  2NN6 B;  2NUE A;  4F6M A;  2EZ6 A;  2ENA A;  3KZY A;  2RSM A;  2PNZ A;  2JXP A;  4L8N A;  1H7U A;  2ZM6 E;  2FTX B;  1OYP A;  4DR1 I;  1EA6 A;  2F1D A;  4X65 I;  1ZU1 A;  2EM0 A;  1X6E A;  4DR6 E;  4B3R E;  4MYU A;  4DV3 I;  2N3G A;  5KL6 A;  3PYF A;  3GCM A;  1HNX I;  2LUP B;  2EPZ A;  2LJH A;  1IBM I;  1X5W A;  2YTO A;  2V85 A;  2EPX A;  1H73 A;  3C4B A;  4GEQ B;  4TUG A;  4J3D A;  4GKJ I;  5KL5 A;  4OO1 F;  4OO1 A;  2AJ4 A;  2JYA A;  3F6G A;  4F9A B;  3P76 A;  3PS3 A;  4DR6 I;  4Z7C A;  2EM7 A;  2MC5 A;  2ELZ A;  2NAB A;  1WHQ A;  3J80 C;  3M6A A;  2L92 A;  1XNQ I;  3Q6M A;  2BM1 A;  1PVG A;  4RHB B;  2PNZ B;  2DRP A;  4DV0 I;  1KTV A;  4AIM A;  1IBK I;  2F8B A;  4LPF A;  4P78 A;  2CPN A;  4BS9 A;  1NZ0 A;  2JE6 A;  5LL6 R;  2NUF A;  1U2R A;  5IXM B;  4OO1 E;  1MGT A;  1KJK A;  5GME A;  1IBL I;  1R6M A;  4MU4 A;  1PJT A;  1RQ0 A;  2EM6 A;  2KON A;  5DNY A;  1N32 E;  4MU0 A;  1SR9 A;  3P1X A;  4PRX A;  4BA1 B;  4OO1 B;  1AH5 A;  3BGH A;  1Y60 A;  2WP8 B;  4JI2 E;  3IWB A;  3KRN A;  2EOJ A;  1Z59 A;  2YT4 A;  2PO0 A;  4HXZ A;  2JVA A;  4JI8 E;  2LVH A;  4BHB A;  2D9H A;  2BB8 A;  4NBQ A;  2YU8 A;  1FJG E;  1UDN A;  4IFD D;  5ADZ A;  2Q8U A;  3J7A G;  3L7Z B;  3H1C A;  2CG9 A;  4WSP A;  2WNR A;  1R6L A;  2JEB A;  4HAC A;  5C0X D;  2DB2 A;  3KZZ A;  1UHZ A;  2CT1 A;  4R2P A;  2LJP A;  3ZM7 A;  4R2E A;  4QNJ A;  3BID A;  4IS1 C;  1XMQ E;  1YHC A;  3ADG A;  1T4L B;  1XHK A;  4WYQ B;  1XMO E;  2I9I A;  2EOR A;  4FW5 A;  4LF6 I;  2UXB I;  4ZVI A;  3VK6 A;  4JI1 I;  3ZZ0 A;  1HNZ I;  4WXD A;  4DV2 E;  4K0K E;  5KL3 A;  5K36 B;  2HJJ A;  3M7N D;  4DUY I; 
#chains in the Genus database with same CATH homology
 1Y6Z A;  2A2D A;  1T4N A;  2DMY A;  2ZBK B;  2M1S A;  2L2M A;  4DUZ E;  4JG4 A;  2V2V A;  3DF6 A;  2RS7 A;  1N34 E;  1NHH A;  3VYY A;  2J7K A;  2O1T A;  4DPY A;  4YHH I;  2HKE A;  2B7T A;  4DR7 E;  4R03 A;  3LTO A;  2EFG A;  4P52 A;  1PIE A;  2UUA I;  1Z5C A;  3OML A;  3QT8 A;  3V5R A;  4UTG A;  4JI3 E;  2UUB E;  4DPW A;  1UIL A;  1HK7 A;  4KQV A;  2VE7 C;  2R42 A;  2UUA E;  2DEI A;  5FWK A;  4B3M I;  4GKK I;  3ADI A;  5A2Q C;  2H36 X;  1HNW E;  4DV2 I;  3GON A;  1J5E I;  3J80 Q;  1S4E A;  3LNU A;  4WUC A;  4DV5 E;  2ZIT A;  4DU7 A;  1DQ3 A;  4IZJ B;  4DR3 E;  4URL A;  2V89 A;  2UXD I;  2Z5C A;  1KVK A;  3P06 A;  2NUG A;  1HR0 I;  5AE3 A;  2WZO A;  3JU0 A;  4YY3 E;  4PRV A;  3LML A;  2O1W A;  5AAS A;  4DR3 I;  2LMZ A;  4IZK B;  4DUZ I;  1RRE A;  2V83 A;  2M4I A;  2PNM A;  3B82 A;  4X64 E;  1ELO A;  3H4L A;  2VF3 A;  2BV3 A;  2Z5B A;  1YYO A;  1RR9 A;  4JI4 I;  2UUC E;  4I8O A;  4DR4 E;  2VQE E;  4X62 I;  4P7A A;  1FWK A;  2Z5C B;  4JI8 I;  4LF9 I;  2HFS A;  1N0V C;  2V86 A;  4MYT A;  3JTZ A;  4N3O A;  1J5E E;  4X62 E;  2VQE I;  3C4T A;  3AUZ A;  2FGG A;  4B3S I;  4DV0 E;  3ADL A;  3PYE A;  1NHJ A;  3QT6 A;  4DV7 I;  4LF8 E;  1Z0C A;  1Z0V A;  2E5L E;  5A2Q Q;  4LF5 E;  3HPS A;  1XNR I;  1IBL E;  1EKZ A;  2B7V A;  2WW4 A;  3B78 A;  4NXM I;  2L2N A;  4B3T E;  1XNR E;  4IZJ A;  2DEJ A;  3Q1Q A;  3F0N A;  1Y4S A;  2DIX A;  5L3J A;  3HXL A;  4DU8 A;  4FWD A;  2IOP A;  2Q2E B;  2EWL A;  4FW9 A;  3J7A M;  5T6J A;  1ZBQ A;  1Z5A A;  1HNX E;  2B3T B;  4DPT A;  1H72 C;  1H7S A;  4B3R I;  4JI5 E;  1XMQ I;  5FLX C;  4WUB A;  4DR2 I;  2Z5E A;  4DPX A;  2MC6 A;  1N36 I;  1Z0E A;  4DPU A;  2HHH I;  3K6Q A;  5LMU E;  4JI0 I;  2HFU A;  2IHR 1;  4DV4 E;  4NXN E;  1KKH A;  2MDR A;  1MX0 A;  1VIS A;  4LF8 I;  3ZKB A;  4LTY A;  2PNL A;  2GQ0 A;  2NPF A;  4BCA A;  1QZR A;  5LMU I;  4ED4 A;  1Z0B A;  4PU9 A;  5GMD A;  4B3T I;  5AE2 A;  4FN5 A;  3H09 A;  1FKA E;  4DV6 E;  4YY3 I;  2V8P A;  5BR8 E;  4DXL A;  4DV1 E;  2B9D A;  4USK A;  2JWO A;  1FWL A;  1D6T A;  2L2K B;  4JI7 I;  4LU9 A;  4DR2 E;  3AV0 A;  1WUU A;  1J26 A;  2CGE A;  1X49 A;  4DKK A;  3T1Y I;  2V87 A;  1HNW I;  4DR4 I;  1XNQ E;  1GQE A;  4M0V A;  4DR6 I;  4JI0 E;  3ZKD A;  4JI7 E;  4Z7Y A;  3ZZU A;  2HHH E;  3ZZT A;  1IBM E;  2M7Q A;  4F9C B;  2X7I A;  5F3W A;  4DV4 I;  2UXC I;  4KHP E;  2LRS A;  3K1J A;  3K17 A;  2VQF I;  2UU9 E;  1PKP A;  2E1R A;  3J81 C;  2JOX A;  4F9B B;  3WU5 A;  4DV6 I;  2JY9 A;  4XTJ A;  3JAM C;  1MU5 A;  3RMP A;  2X36 A;  1MG7 A;  3V2U C;  2O1U A;  4WUD A;  1T4O A;  1ZM2 A;  4P7D A;  3T1Y E;  1YYW A;  5AE1 A;  2L3C A;  4LF6 E;  4GKJ E;  2RTX A;  4JI2 I;  2UUB I;  4LFC I;  2V2Z A;  4I3H A;  2ODR C;  4K0K I;  4J8Z A;  1FJG I;  1ZBT A;  1RC7 A;  2OI2 A;  3PRY A;  2K4V A;  4HY1 A;  1OJ4 A;  5LMN I;  2NA2 A;  2A2C A;  1B63 A;  4M30 A;  1IBK E;  5IWA I;  4X8W A;  3PYD A;  2V2Q A;  5LMN E;  3VYX A;  1HR0 E;  4IZK A;  1USV A;  4EMD A;  3KWR A;  1Z5B A;  2JOB A;  4X64 I;  4DMI A;  3HTX A;  3LPS A;  2UUC I;  1YYK A;  1YZ9 A;  4RPF A;  4M2Z A;  1N36 E;  4GKK E;  3WU6 A;  4AQY E;  4UT4 A;  4LFA I;  2LUQ A;  4LF9 E;  3J81 Q;  3Q6N A;  2E1M A;  2KOU A;  3IWC A;  4LFC E;  3QT7 A;  1ZM3 A;  1ZXM A;  2UXB E;  1STU A;  3HPZ A;  1S16 A;  4USM A;  3OTO I;  4B3S E;  4OX9 I;  1FI4 A;  4HAC B;  3FIG A;  2E5L I;  4LFB E;  2L6M A;  2L33 A;  3OTO E;  1KIJ A;  2VF1 A;  4LF4 E;  1X48 A;  4KHP I;  4X66 I;  5IT9 Q;  2LTS A;  3DJW A;  3IWD A;  2G7H A;  4YHH E;  5CFF E;  2ZM6 I;  4DR5 I;  2VQF E;  4DR1 E;  4NXM E;  4HYM A;  1N34 I;  4BBY A;  2LBS B;  3MSW A;  4DR7 I;  1Z0T A;  1A6F A;  3JAM Q;  4DR5 E;  2HK2 A;  1N32 I;  2LTR A;  1EI1 A;  4KZS A;  4JI5 I;  5IT9 C;  4L5N C;  3F6H A;  2L8T A;  4M1K A;  4JYA E;  4Q28 A;  4B3M E;  4OX9 E;  4BC9 A;  2HKJ A;  2ODR D;  3LLH A;  3CWV A;  4WFT A;  4NXN I;  1WHN A;  2R3V A;  1NHI A;  2BM0 A;  2UU9 I;  1ZXN A;  3D4J A;  3PYG A;  3QT5 A;  4JI1 E;  1BKN A;  1UEK A;  1HNZ E;  5IWA E;  2DSY A;  4IZJ D;  4BMJ A;  4R1F A;  5FLX Q;  4X66 E;  3ZOQ B;  4LF5 I;  1Z0W A;  3K85 A;  1ZM4 A;  2F4V I;  1K47 A;  1USU A;  1X47 A;  3B8H A;  3HQ1 A;  2FV4 B;  1DI2 A;  4TUI A;  1Y4U A;  4JI4 E;  5BR8 I;  1H74 A;  1GZ6 A;  4WPY A;  2YZT A;  1FNM A;  4DV3 E;  4LF7 I;  4X65 E;  1DAR A;  2JR1 A;  3ADJ A;  4FWG A;  2CZ9 A;  1Z0G A;  3HJC A;  2Z5B B;  1WXR A;  2N3H A;  2GS8 A;  1XMO I;  4JV5 I;  1N33 E;  4JI3 I;  2V34 A;  2XEX A;  4F54 A;  4LF7 E;  4JYA I;  4AQY I;  4LFA E;  2RS6 A;  2V88 A;  1I94 E;  1B62 A;  4OOG C;  4DV7 E;  4DUY E;  1O0W A;  2UXC E;  2HK3 A;  4JV5 E;  1QU6 A;  1N33 I;  2O1V A;  1N0U A;  4JI6 E;  3HUL A;  4BC7 A;  1I94 I;  3J7Y p;  2KHX A;  2V8Q B;  1ZM9 A;  3T1H I;  2L3J A;  4DV5 I;  4LFB I;  2IOQ A;  2F4V E;  3WU3 A;  4R8O A;  2UXD E;  4JI6 I;  4LF4 I;  2LE2 A;  4FWH A;  3T1H E;  3WU4 A;  2NUE A;  2EZ6 A;  2RSM A;  4L8N A;  1H7U A;  2ZM6 E;  2FTX B;  4DR1 I;  1EA6 A;  4X65 I;  4MYU A;  4DR6 E;  4B3R E;  4DV3 I;  2N3G A;  3PYF A;  1HNX I;  2LUP B;  2LJH A;  1IBM I;  2V85 A;  1H73 A;  3C4B A;  4GEQ B;  4TUG A;  4GKJ I;  2AJ4 A;  3F6G A;  4F9A B;  4Z7C A;  2MC5 A;  1WHQ A;  3J80 C;  3M6A A;  2L92 A;  1XNQ I;  3Q6M A;  2BM1 A;  1PVG A;  4DV0 I;  1KTV A;  1IBK I;  2F8B A;  4P78 A;  2CPN A;  4BS9 A;  1NZ0 A;  5LL6 R;  2NUF A;  1U2R A;  5GME A;  1IBL I;  5DNY A;  1RQ0 A;  2KON A;  4DV1 I;  1N32 E;  1SR9 A;  3P1X A;  4PRX A;  4JI2 E;  3IWB A;  1Z59 A;  2YT4 A;  4HXZ A;  2JVA A;  4JI8 E;  1FJG E;  5ADZ A;  3J7A G;  2CG9 A;  4WSP A;  4HAC A;  2DB2 A;  1UHZ A;  3ZM7 A;  2LJP A;  1XMQ E;  3ADG A;  1T4L B;  1XHK A;  4WYQ B;  1XMO E;  4LF6 I;  2UXB I;  4ZVI A;  3VK6 A;  4JI1 I;  3ZZ0 A;  1HNZ I;  4DV2 E;  4K0K E;  4DUY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...