1I94E

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
PETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1i94E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94E02
1XMOI 3C4BA 3ZKDA 4JI7I 3QT6A 4DKKA 4KHPI 4LFCI 2IHR1 5IWAI 1FWKA 1Z5CA 2F4VI 4HACA 2ZM6I 2ZBKB 2Q2EB 1UEKA 1Z59A 1RC7A 4WUDA 4DV4I 4USMA 2UUAI 3ADJA 3LLHA 2LUQA 1N34E 4HY1A 4X62E 1MX0A 4P7AA 3B82A 2DEJA 4JI0I 3J81C 1FI4A 2VQEI 4DXLA 1Z0BA 2HFUA 3VYXA 2HFSA 2R3VA 1N32E 5CFFE 1PVGA 5A2QC 2NUFA 1HR0I 4DR4E 4JYAI 3D4JA 3P1XA 3QT7A 4DV3E 1ELOA 4DPWA 5LMNE 1T4OA 4JI4I 1XNRE 1J26A 3ZZUA 4FWHA 2UXDE 2V2QA 4NXME 4JI8E 1Z0VA 3V2UC 4UT4A 1A6FA 4LF6I 2E1RA 1N34I 1ZXNA 4X62I 4DV5E 3HTXA 2RSMA 1Z0WA 4B3ME 4M1KA 4DV0I 3WU5A 1Z5BA 4PU9A 1N32I 4KQVA 2LJHA 2A2CA 4DV3I 1IBLE 1N36E 3HULA 1HNWE 5LMNI 1XNRI 2VQFE 5FLXQ 4AQYE 2UXDI 4WFTA 4NXMI 4X64I 4JI8I 1K47A 5FLXC 2E5LI 2VF3A 1IBKE 1UILA 3WU4A 1D6TA 4LF4I 4USKA 3K17A 4LF9E 2UUBI 1X48A 2HHHE 4HACB 3PYDA 4DV5I 4ED4A 4B3TI 2NUGA 3ZM7A 1Z0GA 1S16A 1MU5A 4B3MI 1STUA 4X66E 1N0VC 4WYQB 3ZKBA 1RR9A 1ZXMA 1NZ0A 1DARA 4PRVA 2KHXA 1NHIA 1IBLI 1N36I 4LFBE 1HNWI 2MDRA 2NPFA 2BM1A 1Z0CA 5L3JA 4M30A 1WHQA 1H7SA 1IBKI 1KVKA 2LRSA 4P52A 4GKKE 4LF9I 1S4EA 2HHHI 4DV6E 4PRXA 2L3CA 3J81Q 5IT9Q 1T4NA 4JG4A 2J7KA 4X66I 1KIJA 1EI1A 1KKHA 3ADGA 1EA6A 4K0KI 5A2QQ 1BKNA 5IT9C 5LMUI 4LFBI 4DPYA 1I94E 4B3SE 1FNMA 3WU3A 4JI5E 1YYOA 2YT4A 1N0UA 4DV2E 2V8PA 3PYEA 3M6AA 4ZVIA 5BR8E 2DEIA 1H73A 4DV7E 4I3HA 2CPNA 4GKKI 2OI2A 1MG7A 2V2VA 4DV6I 3WU6A 1XNQE 2LBSB 4DR1E 4B3RE 3Q1QA 2HK3A 4YY3E 3VYYA 4JI2E 1QU6A 1GQEA 4HXZA 4X8WA 4DUZE 4WUCA 3J7AM 2L2NA 1WHNA 3OTOE 1I94I 4B3SI 1RQ0A 4JI5I 1H72C 4DR4I 4XTJA 2L2KB 3B8HA 3ADIA 4DV2I 4HYMA 2HKEA 5BR8I 2CZ9A 1B62A 4DV7I 4JI3E 3K1JA 4EMDA 2L33A 1DI2A 4DPTA 1XNQI 4LF7E 2LTRA 2HK2A 4JV5E 4YY3I 1X49A 4JI2I 5GMEA 4UTGA 4URLA 2B3TB 1ZM2A 2RS7A 4FW9A 4YHHE 1YYKA 1YYWA 1KTVA 1HNZE 2GS8A 3LNUA 4DUZI 4KHPE 3T1HE 1OJ4A 2X36A 2NA2A 3OTOI 5IWAE 1O0WA 4Z7YA 1N33E 4DUYE 3QT5A 2DB2A 1FJGE 4NXNE 2VQFI 4AQYI 2DIXA 4DV4E 4R1FA 3T1YE 2UUAE 4JI3I 1ZM4A 1HNXE 4DU8A 3C4TA 1J5EE 2LJPA 4LF7I 2UXCE 2VQEE 1QZRA 1FKAE 4Z7CA 2UXBE 4DPXA 2UU9E 4DR5E 1HR0E 4JYAE 2ZITA 4YHHI 1WUUA 1HNZI 3ADLA 3PYGA 3T1HI 4LF8E 1H74A 4JI4E 3JAMQ 1IBME 1ZBTA 3J7Yp 1N33I 2V34A 4DUYI 3B78A 1FJGI 1VISA 2B7VA 3JAMC 4NXNI 4FWDA 4DU7A 5LL6R 1PIEA 4DR6E 3T1YI 4LF5E 1T4LB 2BV3A 2N3GA 4LF6E 2R42A 1HNXI 1RREA 1J5EI 1Z0EA 2UXCI 1NHHA 2BM0A 4DV0E 4DV1E 2UXBI 2RTXA 2A2DA 1XMQE 2EZ6A 2UU9I 4DR5I 2NUEA 4RPFA 2L3JA 4LF8I 2N3HA 4DR2E 4JI1E 2JVAA 1NHJA 1IBMI 4LFAE 1ZM9A 3F0NA 3ZZTA 4DR3E 4X64E 3LPSA 2E5LE 1B63A 1ZM3A 2XEXA 4LF4E 2EFGA 1H7UA 2AJ4A 1UHZA 1YZ9A 4DR6I 3QT8A 2UUCE 4LF5I 2UUBE 4MYUA 4B3TE 4FN5A 4JI6E 4MYTA 3PYFA 4DV1I 2L2MA 4DR7E 1XMQI 3J80Q 2WW4A 4X65E 4DR1I 4B3RI 3H4LA 4GKJE 4OX9E 5GMDA 1XMOE 3J80C 2B7TA 3LTOA 2LTSA 2LUPB 4JI1I 4DR2I 1U2RA 3GONA 4JI7E 4LFAI 3V5RA 2V2ZA 4LFCE 4DR3I 2JY9A 2HKJA 2DMYA 1EKZA 2F4VE 1FWLA 3ZZ0A 3J7AG 1PKPA 2ZM6E 2X7IA 4M2ZA 2UUCI 4WUBA 1XHKA 4JI6I 1Z5AA 1Z0TA 4DR7I 4FWGA 3CWVA 4K0KE 2RS6A 4JI0E 4DPUA 1X47A 4X65I 4JV5I 5LMUE 4GKJI 4OOGC 4OX9I
chains in the Genus database with same CATH superfamily
1YPNA 2JOBA 2CVEA 4OKGA 2RSIA 2EJ4A 2BA1G 1XMOI 2BA0G 2NN6B 3M7NG 2EWLA 3HPSA 4BHCA 3C4BA 5AC5A 2WNRB 3ZKDA 4JI7I 3QT6A 4GQUA 1WJPA 4DKKA 3L7ZB 4KHPI 5DROA 2EL4A 4IZJB 5AASA 4LFCI 3C6KA 4BA2B 2IHR1 5IWAI 4MDTA 1FWKA 2EM5A 1UN6B 1Z5CA 2V83A 4L5NC 5C0XB 2F4VI 4P78A 2MKDA 3BBGA 4HACA 2ZM6I 2EOOA 3DD6A 2EM4A 2ZBKB 3EPLA 2N8XA 3JU0A 2EOQA 2Q2EB 1UEKA 1USVA 1Z59A 2IOPA 4MU1A 1G2DC 1RC7A 1ZBQA 3PS1A 2LMZA 2EM3A 4WUDA 3AUZA 2YZTA 4DV4I 2V85A 1MGTA 2Q8UA 4B3TI 2YTFA 5A6KA 4USMA 2UUAI 2VF1A 3GLLA 4AIDA 3ADJA 3LLHA 2LUQA 1N34E 4HY1A 4X62E 5KL7A 1MX0A 4P7AA 3B82A 2DEJA 3J81C 4JI0I 1FI4A 2VQEI 4DXLA 1Z0BA 2EPNA 1EH6A 1YUIA 2HFUA 3VYXA 2GO3A 2EMLA 2HFSA 3F6HA 1N32E 2R3VA 1YUJA 5CFFE 1PVGA 5A2QC 3M85G 2CG9A 2R76A 2NUFA 4DR4E 2EN3A 1HR0I 4JYAI 3D4JA 3P1XA 2HC5A 3QT7A 4DV3E 1ELOA 5A6JA 4B3SI 3FIGA 2EM2A 4KZSA 4O4KA 4DPWA 5LMNE 2BA1D 1T4OA 2BA0D 4JI4I 1XNRE 1J26A 2EN4A 3ZZUA 4FWHA 2UXDE 1UDQA 2ADRA 3M99B 2EPOA 4NXME 1YHCA 2V2QA 4JI8E 3GMEA 4BA1A 2EN8A 2YSPA 1VI7A 3KRNA 2B9DA 5AE1A 2EMFA 4OZEA 2EOEA 1Z0VA 3QG5C 3V2UC 2BR2B 4UT4A 1A6FA 5LMUE 4AM3A 2LVHA 2NN6D 4LF6I 2E1RA 2EMXA 1A1IA 4O43A 1N34I 1ZXNA 2O1VA 2EQ3A 4DV5E 3BGHA 2KONA 3HTXA 4X62I 1N3GA 2RSMA 1UDSA 1Z0WA 4IJDA 2R1FA 4B3ME 4M1KA 4DV0I 3KZYA 4R2SA 2GHFA 3UHMA 2O1WA 2EORA 2EMKA 2J7JA 2YTPA 4BS9A 3CDIA 3WU5A 2MDGA 1Z5BA 4PU9A 4HTGA 1N32I 1KJKA 2H36X 4WSGA 1AH5A 2YRKA 3BIDA 4KQVA 2Z5BA 4F54A 2EM8A 5C0XD 2LJHA 1BB8A 2A2CA 4F6NA 2V8QB 4DV3I 1IBLE 1N36E 3HULA 1HNWE 4MLVA 5LMNI 3C6MA 2D9HA 3K6QA 5F3WA 2EOXA 1XNRI 2VQFE 5FLXQ 4AQYE 3M85D 1ZR9A 3JTZA 2UXDI 4IFDE 2M1SA 4WFTA 4LCHA 4NXMI 4X64I 1B69A 4JI8I 1K47A 5FLXC 2E5LI 2VF3A 2EL5A 5K36A 3TQMA 1IBKE 1UILA 2FGGA 5TSEA 3WU4A 2CT1A 4LF4I 1D6TA 5DNLA 4USKA 2E1MA 5LLQA 3PS2A 3K17A 4OO1A 4O5GA 2C37A 4Q28A 1P42A 4J8ZA 4LF9E 2UUBI 5K36C 2K7IA 3EPKA 1X48A 2HHHE 1IMUA 2AE8A 3HXLA 3GCMA 4HACB 3PYDA 2YSOA 1IQOA 4BBYA 2PO0A 4ED4A 4DV5I 2NUGA 1UDOA 3EQ1A 1P47A 1DGCA 1S16A 1MU5A 1Z0GA 4DMIA 5DRQA 3ZM7A 4OO1C 4B3MI 3LMLA 1USUA 1GTKA 2EM9A 2WBTA 1G2FC 1STUA 4F9CB 4X66E 2JWOA 1N0VC 2PO2A 2VESA 4WYQB 3ZKBA 4R2RA 2EQ1A 2O3ZA 5KL2A 4IZKA 2DMIA 1RR9A 1ZXMA 1NZ0A 1DARA 4PRVA 2KHXA 3HQ1A 4ZYGA 2EL6A 4GZNC 5EKWA 1NHIA 1IBLI 2EMAA 5KL5A 2LE2A 1N36I 4LFBE 1HNWI 2MDRA 1NCSA 2YRHA 2NPFA 2EOMA 4MU4A 2BM1A 2EPPA 4BCAA 2F1DA 3P06A 3DF6A 1Z0CA 5L3JA 4M30A 1X6FA 1A1GA 1WHQA 1H7SA 3HJCA 4LOMA 1X6HA 1IBKI 5IXMB 3P76A 1KVKA 2LRSA 2EN1A 2JEBA 2GQ0A 1BBGA 2DRPA 4I8OA 5K36F 4MQYA 2GPIA 4P52A 1TF3A 4GKKE 4LF9I 1YSAC 1S4EA 4R03A 2HHHI 2MC6A 4DV6E 2Z5CA 4OO1F 4PRXA 3NZKA 4BA1B 4BMJA 5AC4A 2V86A 2L3CA 3J81Q 5IT9Q 1T4NA 4JG4A 2C39A 2J7KA 2C38A 4X66I 2V89A 1KIJA 1EI1A 1KKHA 3ADGA 1EA6A 4LCGA 1OYRA 4K0KI 3P3EA 5A2QQ 1BKNA 5IT9C 4F2JC 4FW6A 1ZAAC 4R2PA 5LMUI 4HEIA 2WBUA 2WCC3 2EOSA 4LFBI 1A1JA 4DPYA 1I94E 4B3SE 1FNMA 3MHHC 4JI5E 3WU3A 2MKNA 5EL9A 2FTXB 1YYOA 2JEAA 2YT4A 1N0UA 5JEAE 2HJJA 3B4TA 4DV2E 2LT7A 2V8PA 4FW3A 4RH8A 2Z5BB 2WZOA 3PYEA 3M6AA 2YPNA 3AV0A 2YTQA 4ZVIA 2PO1A 1YH8A 2M9AA 2EE8A 5BR8E 2DEIA 1MEYC 3M7ND 1H73A 3UK3C 5ADZA 2K4VA 1PDAA 2YTNA 4DV7E 4I3HA 4M0VA 2EM7A 2HGHA 1KYQA 2CPNA 4GKKI 2M4IA 2OI2A 2CTDA 1MG7A 1YFHA 2V2VA 4DV6I 5T6JA 4ZYHA 4P7DA 1DQ3A 3WU6A 1XNQE 2LBSB 4DR1E 4B3RE 5KL6A 2HK3A 3Q1QA 5K36B 4YY3E 2NN6E 3VYYA 2EN6A 4JI2E 1QU6A 4R2QA 4RHBB 1R6MA 4WXDA 4N4RB 1GQEA 1Y4SA 1Y6ZA 2O1TA 3CDJA 4HXZA 4X8WA 2C37B 2JE6A 2JPAA 4N3OA 4DUZE 2YU5A 3P3GA 2PO0B 2EN7A 4WUCA 3ECRA 3J7AM 2L2NA 2DSYA 4Q35B 1WHNA 2F8BA 3OTOE 5JEAF 1TN9A 4FW4A 1RQ0A 2EPUA 2EMYA 5DNXA 2PO2B 4JI5I 1H72C 4DR4I 2EN2A 4XTJA 2PNLA 2L2KB 3B8HA 2L8TA 1JK1A 4U3DA 3ADIA 4IFDA 2YTOA 4DV2I 4IZKB 4HYMA 2ENCA 3VK6A 2A25A 2FV4B 2HKEA 1ZU1A 4F9AB 5BR8I 2EMWA 3DJWA 3MSWA 2CZ9A 3H1CA 1Y5YA 4IFDC 2ENAA 2RPCA 1L4SA 2IOQA 1B62A 4IS9A 4AIMA 4DV7I 4JI3E 2WP8A 3K1JA 4EMDA 2L33A 2VE7C 1RMDA 1DI2A 4DPTA 1A1FA 2EOZA 1XNQI 4LF7E 4NBQA 2LTRA 2HK2A 4JV5E 4YY3I 1X49A 3IWBA 4JI2I 5GMEA 4UTGA 2EPXA 4URLA 2EPCA 2JEBB 5AE2A 4WXCA 2B3TB 4R2CA 4LCFA 1X6EA 1ZM2A 2EMIA 2RS7A 1Y4UA 1EH8A 4FW9A 2ODRC 4YHHE 1YYKA 1YYWA 2EOJA 1HNZE 1KTVA 2GS8A 2IESA 2Z5CB 3LNUA 4DUZI 4KHPE 5DNYA 3T1HE 1AAYA 1OJ4A 3KWRA 3RMPA 1R6LA 4LU9A 2NA2A 2M7QA 2X36A 3OTOI 5IWAE 3PRYA 4R2DA 1O0WA 2C39B 4Z7YA 1Z1BA 1EH7A 1RHYA 5A6AA 1N33E 1OYPA 4DUYE 4MLQA 3QT5A 2DB2A 4ZYEA 2DLQA 2EQ0A 5A69A 1FJGE 4IFDF 4NHRA 4NXNE 2VQFI 4AQYI 2DIXA 4DV4E 4R1FA 2J65A 5K36D 4OO1B 2RQLA 4O24A 4ZYDA 2PNMA 4TUIA 2Z5EA 1Y60A 3THNA 2BB8A 3VHTB 3T1YE 2UUAE 4JI3I 2JEAB 1ZM4A 4OO1D 1HNXE 4R8OA 4DU8A 3C4TA 1J5EE 2LJPA 2EMBA 4LF7I 2PO1B 1WXRA 2UXCE 2VQEE 1QZRA 1FKAE 2I13A 2DGCA 4Z7CA 4L8NA 4R2EA 2UXBE 4J3DA 2EPZA 2GO4A 4QNKA 4DPXA 2UU9E 4DR5E 3ZOQB 1PJSA 1HR0E 4JYAE 2PNZA 2ZITA 1T38A 4YHHI 2EOHA 1WUUA 1HNZI 3ADLA 4BC9A 2YTIA 4X9JA 3PYGA 3F6GA 3T1HI 2EP3A 2VRDA 4LF8E 1H74A 2EPMX 2CSHA 4JI4E 2EMCA 3JAMQ 1IBME 1ZBTA 5JEAA 3J7Yp 1N33I 4TUGA 2CGEA 2JE6B 2V34A 4DUYI 3B78A 1FJGI 1VISA 2B7VA 4KWYA 3JAMC 1A1LA 5AE3A 3EPJA 3Q6NA 4NXNI 5C0XE 5JEAC 1A1HA 2LO3A 4FWDA 1T39A 4DU7A 1TF6A 5LL6R 1UDNA 1PIEA 2EPKX 4DR6E 3T1YI 4LF5E 3THOB 1T4LB 2BV3A 2N3GA 4LF6E 2R42A 4FW5A 1HNXI 4IFDB 1RREA 4U3BA 1GZ6A 1IQSA 2E72A 1A1KA 3P3CA 1J5EI 4R2AA 1Z0EA 2UXCI 1NHHA 2YTJA 4WSPA 2NN6A 2BM0A 4DV0E 4LPFA 2MC5A 4DV1E 2WNRA 2UXBI 2RTXA 2YTEA 2A2DA 1XMQE 1WRJA 2EZ6A 3L7ZA 2UU9I 4DR5I 2WP8B 4IZJA 1BBOA 2NN6C 4LTYA 4BA2A 5DRRA 4BC7A 2NUEA 2O1UA 1LLMC 5JEAD 4RPFA 1I94I 1PJTA 2L3JA 1E3HA 1UBDC 5C0XA 4LF8I 2PRTA 1QNTA 2N3HA 2LJUA 4DR2E 1X3CA 2EPRA 4JI1E 4FW7A 2JVAA 1NHJA 2JYAA 5IV8B 1IBMI 4LFAE 1ZM9A 3Q6MA 1OYSA 3F0NA 3ZZTA 4DR3E 4MU0A 5C0XC 4X64E 3LPSA 2JOXA 2YTGA 2E5LE 1B63A 1ZM3A 2WBSA 2XEXA 4LF4E 2EFGA 2EMHA 1H7UA 2JT2A 2AJ4A 1UHZA 1YZ9A 2G7HA 3L00A 4DR6I 3QT8A 2UUCE 4LF5I 2UUBE 5A6BA 2IERA 4MYUA 4B3TE 3H09A 4FN5A 2JXPA 3HKMA 4IS1C 4JI6E 1HK7A 4IZJD 4MYTA 3PYFA 2ENHA 2KOUA 4DV1I 5FWKA 1X5WA 2L2MA 1JK2A 5KL3A 3EPHA 2NABA 4DR7E 4ISAA 1SFEA 2NN6F 3J80Q 1XMQI 2WW4A 2L92A 2EOYA 4X65E 2EPAA 4GEQB 4DR1I 3H4LA 4B3RI 2V88A 4GKJE 4OX9E 5GMDA 2GLIA 2DLKA 1PJQA 2I9IA 3J80C 2L6MA 2B7TA 2YRMA 3BF2A 1SR9A 1XMOE 3LTOA 2YU8A 2LTSA 2LUPB 4JI1I 3IWCA 4F9BB 4DR2I 1U2RA 2EMZA 3GONA 4JI7E 4LFAI 3OMLA 3IWDA 5C0XF 3V5RA 2V2ZA 2JR1A 4LFCE 4DR3I 2EM6A 4WPYA 2JY9A 2PNZB 4IFDD 4F6MA 4M9VC 2LCEA 2JP9A 2LV2A 2BR2A 2HKJA 2DMYA 1XXEA 1EKZA 2C38B 3PS3A 4MU3A 2EPLX 2F4VE 2YWQA 1FWLA 3J7AG 5A6BD 5KL4A 1PKPA 2V87A 4BHBA 2ZM6E 3U1KA 3ZZ0A 2X7IA 3HPZA 4M2ZA 2BBGA 4WUBA 2UUCI 5JEAB 5K36E 3KZZA 2ELZA 2EOIA 2EM0A 4NZVA 1XHKA 3MHSC 3K85A 3U1YA 4OO1E 4JI6I 2EOFA 2EMGA 2ELYA 1Z5AA 1E3PA 1F2IG 1Z0TA 4QNJA 2ODRD 1NEIA 4DR7I 4FWGA 3CWVA 4K0KE 2RS6A 4JI0E 2YTDA 1X47A 4WX9A 5DRPA 5ELWA 4DPUA 4X65I 4JV5I 4FK5C 4GKJI 4OOGC 4OX9I
chains in the Genus database with same CATH topology
2JOBA 1XMOI 2EWLA 3HPSA 3C4BA 3ZKDA 4JI7I 3QT6A 4DKKA 4KHPI 4IZJB 4LFCI 5AASA 2IHR1 5IWAI 1FWKA 1Z5CA 2V83A 4L5NC 2F4VI 4P78A 4HACA 2ZM6I 2ZBKB 3JU0A 2Q2EB 1UEKA 1USVA 1Z59A 2IOPA 1RC7A 1ZBQA 2LMZA 4WUDA 4DV4I 3AUZA 2YZTA 2V85A 4USMA 2UUAI 2VF1A 3ADJA 3LLHA 2LUQA 1N34E 4HY1A 4X62E 1MX0A 4P7AA 3B82A 2DEJA 3J81C 4JI0I 1FI4A 2VQEI 4DXLA 1Z0BA 2HFUA 3VYXA 2HFSA 2R3VA 3F6HA 1N32E 5CFFE 1PVGA 5A2QC 2CG9A 2NUFA 1HR0I 4DR4E 4JYAI 3D4JA 3P1XA 3QT7A 4DV3E 1ELOA 3FIGA 4KZSA 4DPWA 5LMNE 1T4OA 4JI4I 1XNRE 1J26A 3ZZUA 4FWHA 2UXDE 2V2QA 4NXME 4JI8E 2B9DA 5AE1A 1Z0VA 3V2UC 4UT4A 1A6FA 4LF6I 2E1RA 1N34I 1ZXNA 2O1VA 4DV5E 3HTXA 4X62I 2KONA 2RSMA 1Z0WA 4B3ME 4M1KA 4DV0I 2O1WA 4BS9A 3WU5A 1Z5BA 4PU9A 1N32I 2H36X 4KQVA 2Z5BA 4F54A 2LJHA 2A2CA 2V8QB 4DV3I 1IBLE 1N36E 3HULA 1HNWE 5LMNI 5F3WA 3K6QA 1XNRI 2VQFE 5FLXQ 4AQYE 3JTZA 2UXDI 2M1SA 4WFTA 4NXMI 4X64I 4JI8I 1K47A 5FLXC 2E5LI 2VF3A 1IBKE 1UILA 2FGGA 3WU4A 1D6TA 4LF4I 4USKA 2E1MA 3K17A 4Q28A 4J8ZA 4LF9E 2UUBI 1X48A 2HHHE 3HXLA 4HACB 3PYDA 4DV5I 4ED4A 4BBYA 4B3TI 2NUGA 3ZM7A 1Z0GA 1S16A 1MU5A 4DMIA 4B3MI 3LMLA 1USUA 1STUA 4F9CB 4X66E 2JWOA 1N0VC 4WYQB 3ZKBA 4IZKA 1RR9A 1ZXMA 1NZ0A 1DARA 4PRVA 2KHXA 3HQ1A 1NHIA 1IBLI 1N36I 2LE2A 4LFBE 1HNWI 2MDRA 2NPFA 2BM1A 4BCAA 3P06A 3DF6A 1Z0CA 5L3JA 4M30A 1WHQA 1H7SA 3HJCA 1IBKI 1KVKA 2LRSA 2GQ0A 4I8OA 4P52A 4GKKE 4LF9I 1S4EA 4R03A 2HHHI 2MC6A 4DV6E 2Z5CA 4PRXA 4BMJA 2L3CA 2V86A 3J81Q 5IT9Q 1T4NA 4JG4A 2J7KA 4X66I 2V89A 1KIJA 1EI1A 1KKHA 3ADGA 1EA6A 4K0KI 5A2QQ 1BKNA 5IT9C 5LMUI 4LFBI 4DPYA 1I94E 4B3SE 1FNMA 3WU3A 4JI5E 2FTXB 1YYOA 2YT4A 1N0UA 4DV2E 2V8PA 2Z5BB 2WZOA 3PYEA 3M6AA 4ZVIA 3AV0A 5BR8E 2DEIA 1H73A 5ADZA 2K4VA 4DV7E 4I3HA 4M0VA 2CPNA 4GKKI 2M4IA 2OI2A 1MG7A 2V2VA 4DV6I 5T6JA 4P7DA 1DQ3A 3WU6A 1XNQE 2LBSB 4DR1E 4B3RE 3Q1QA 2HK3A 4YY3E 3VYYA 4JI2E 1QU6A 1GQEA 1Y4SA 1Y6ZA 2O1TA 4HXZA 4X8WA 4N3OA 4DUZE 4WUCA 3J7AM 2L2NA 2DSYA 1WHNA 2F8BA 3OTOE 1I94I 4B3SI 1RQ0A 4JI5I 1H72C 4DR4I 4XTJA 2PNLA 2L2KB 3B8HA 2L8TA 3ADIA 4DV2I 4IZKB 4HYMA 2HKEA 3VK6A 2FV4B 4F9AB 5BR8I 3DJWA 3MSWA 2CZ9A 2IOQA 1B62A 4DV7I 4JI3E 3K1JA 4EMDA 2L33A 2VE7C 1DI2A 4DPTA 1XNQI 4LF7E 2LTRA 2HK2A 4JV5E 4YY3I 1X49A 3IWBA 4JI2I 5GMEA 4UTGA 4URLA 5AE2A 2B3TB 1ZM2A 1Y4UA 2RS7A 4FW9A 2ODRC 4YHHE 1YYKA 1YYWA 1KTVA 1HNZE 2GS8A 2Z5CB 3LNUA 4DUZI 4KHPE 5DNYA 3T1HE 1OJ4A 3KWRA 3RMPA 4LU9A 2NA2A 2M7QA 2X36A 3OTOI 5IWAE 3PRYA 1O0WA 4Z7YA 1N33E 4DUYE 3QT5A 2DB2A 1FJGE 4NXNE 2VQFI 4AQYI 2DIXA 4DV4E 4R1FA 2PNMA 4TUIA 2Z5EA 3T1YE 2UUAE 4JI3I 1ZM4A 1HNXE 4R8OA 4DU8A 3C4TA 1J5EE 2LJPA 4LF7I 1WXRA 2UXCE 2VQEE 1QZRA 1FKAE 4Z7CA 4L8NA 2UXBE 4DPXA 2UU9E 4DR5E 3ZOQB 1HR0E 4JYAE 2ZITA 4YHHI 1WUUA 1HNZI 3ADLA 4BC9A 3PYGA 3F6GA 3T1HI 4LF8E 1H74A 4JI4E 3JAMQ 1IBME 1ZBTA 3J7Yp 1N33I 4TUGA 2CGEA 2V34A 4DUYI 3B78A 1FJGI 1VISA 2B7VA 3JAMC 3Q6NA 5AE3A 4NXNI 4FWDA 4DU7A 5LL6R 1PIEA 4DR6E 3T1YI 4LF5E 1T4LB 2BV3A 2N3GA 4LF6E 2R42A 1HNXI 1RREA 1GZ6A 1J5EI 1Z0EA 2UXCI 1NHHA 4WSPA 2BM0A 4DV0E 2MC5A 4DV1E 2UXBI 2RTXA 2A2DA 1XMQE 2EZ6A 2UU9I 4DR5I 4IZJA 4LTYA 4BC7A 2NUEA 2O1UA 4RPFA 2L3JA 4LF8I 2N3HA 4DR2E 4JI1E 2JVAA 1NHJA 1IBMI 4LFAE 1ZM9A 3Q6MA 3F0NA 3ZZTA 4DR3E 4X64E 3LPSA 2JOXA 2E5LE 1B63A 1ZM3A 2XEXA 4LF4E 2EFGA 1H7UA 2AJ4A 1UHZA 1YZ9A 2G7HA 4DR6I 3QT8A 2UUCE 4LF5I 2UUBE 4MYUA 4B3TE 3H09A 4FN5A 4JI6E 1HK7A 4IZJD 4MYTA 3PYFA 2KOUA 4DV1I 5FWKA 2L2MA 4DR7E 1XMQI 3J80Q 2WW4A 2L92A 4X65E 4GEQB 4DR1I 4B3RI 3H4LA 2V88A 4GKJE 4OX9E 5GMDA 3J80C 1XMOE 2L6MA 2B7TA 3LTOA 1SR9A 2LTSA 2LUPB 4JI1I 3IWCA 4F9BB 4DR2I 1U2RA 3GONA 4JI7E 4LFAI 3OMLA 3IWDA 3V5RA 2V2ZA 2JR1A 4LFCE 4DR3I 4WPYA 2JY9A 2HKJA 2DMYA 1EKZA 2F4VE 1FWLA 3ZZ0A 3J7AG 1PKPA 2V87A 2ZM6E 2X7IA 3HPZA 4M2ZA 2UUCI 4WUBA 1XHKA 3K85A 4JI6I 1Z5AA 1Z0TA 2ODRD 4DR7I 4FWGA 3CWVA 4K0KE 2RS6A 4JI0E 4DPUA 1X47A 4X65I 4JV5I 5LMUE 4GKJI 4OOGC 4OX9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO I;  3C4B A;  3ZKD A;  4JI7 I;  3QT6 A;  4DKK A;  4KHP I;  4LFC I;  2IHR 1;  5IWA I;  1FWK A;  1Z5C A;  2F4V I;  4HAC A;  2ZM6 I;  2ZBK B;  2Q2E B;  1UEK A;  1Z59 A;  1RC7 A;  4WUD A;  4DV4 I;  4USM A;  2UUA I;  3ADJ A;  3LLH A;  2LUQ A;  1N34 E;  4HY1 A;  4X62 E;  1MX0 A;  4P7A A;  3B82 A;  2DEJ A;  4JI0 I;  3J81 C;  1FI4 A;  2VQE I;  4DXL A;  1Z0B A;  2HFU A;  3VYX A;  2HFS A;  2R3V A;  1N32 E;  5CFF E;  1PVG A;  5A2Q C;  2NUF A;  1HR0 I;  4DR4 E;  4JYA I;  3D4J A;  3P1X A;  3QT7 A;  4DV3 E;  1ELO A;  4DPW A;  5LMN E;  1T4O A;  4JI4 I;  1XNR E;  1J26 A;  3ZZU A;  4FWH A;  2UXD E;  2V2Q A;  4NXM E;  4JI8 E;  1Z0V A;  3V2U C;  4UT4 A;  1A6F A;  4LF6 I;  2E1R A;  1N34 I;  1ZXN A;  4X62 I;  4DV5 E;  3HTX A;  2RSM A;  1Z0W A;  4B3M E;  4M1K A;  4DV0 I;  3WU5 A;  1Z5B A;  4PU9 A;  1N32 I;  4KQV A;  2LJH A;  2A2C A;  4DV3 I;  1IBL E;  1N36 E;  3HUL A;  1HNW E;  5LMN I;  1XNR I;  2VQF E;  5FLX Q;  4AQY E;  2UXD I;  4WFT A;  4NXM I;  4X64 I;  4JI8 I;  1K47 A;  5FLX C;  2E5L I;  2VF3 A;  1IBK E;  1UIL A;  3WU4 A;  1D6T A;  4LF4 I;  4USK A;  3K17 A;  4LF9 E;  2UUB I;  1X48 A;  2HHH E;  4HAC B;  3PYD A;  4DV5 I;  4ED4 A;  4B3T I;  2NUG A;  3ZM7 A;  1Z0G A;  1S16 A;  1MU5 A;  4B3M I;  1STU A;  4X66 E;  1N0V C;  4WYQ B;  3ZKB A;  1RR9 A;  1ZXM A;  1NZ0 A;  1DAR A;  4PRV A;  2KHX A;  1NHI A;  1IBL I;  1N36 I;  4LFB E;  1HNW I;  2MDR A;  2NPF A;  2BM1 A;  1Z0C A;  5L3J A;  4M30 A;  1WHQ A;  1H7S A;  1IBK I;  1KVK A;  2LRS A;  4P52 A;  4GKK E;  4LF9 I;  1S4E A;  2HHH I;  4DV6 E;  4PRX A;  2L3C A;  3J81 Q;  5IT9 Q;  1T4N A;  4JG4 A;  2J7K A;  4X66 I;  1KIJ A;  1EI1 A;  1KKH A;  3ADG A;  1EA6 A;  4K0K I;  5A2Q Q;  1BKN A;  5IT9 C;  5LMU I;  4LFB I;  4DPY A;  1I94 E;  4B3S E;  1FNM A;  3WU3 A;  4JI5 E;  1YYO A;  2YT4 A;  1N0U A;  4DV2 E;  2V8P A;  3PYE A;  3M6A A;  4ZVI A;  5BR8 E;  2DEI A;  1H73 A;  4DV7 E;  4I3H A;  2CPN A;  4GKK I;  2OI2 A;  1MG7 A;  2V2V A;  4DV6 I;  3WU6 A;  1XNQ E;  2LBS B;  4DR1 E;  4B3R E;  3Q1Q A;  2HK3 A;  4YY3 E;  3VYY A;  4JI2 E;  1QU6 A;  1GQE A;  4HXZ A;  4X8W A;  4DUZ E;  4WUC A;  3J7A M;  2L2N A;  1WHN A;  3OTO E;  1I94 I;  4B3S I;  1RQ0 A;  4JI5 I;  1H72 C;  4DR4 I;  4XTJ A;  2L2K B;  3B8H A;  3ADI A;  4DV2 I;  4HYM A;  2HKE A;  5BR8 I;  2CZ9 A;  1B62 A;  4DV7 I;  4JI3 E;  3K1J A;  4EMD A;  2L33 A;  1DI2 A;  4DPT A;  1XNQ I;  4LF7 E;  2LTR A;  2HK2 A;  4JV5 E;  4YY3 I;  1X49 A;  4JI2 I;  5GME A;  4UTG A;  4URL A;  2B3T B;  1ZM2 A;  2RS7 A;  4FW9 A;  4YHH E;  1YYK A;  1YYW A;  1KTV A;  1HNZ E;  2GS8 A;  3LNU A;  4DUZ I;  4KHP E;  3T1H E;  1OJ4 A;  2X36 A;  2NA2 A;  3OTO I;  5IWA E;  1O0W A;  4Z7Y A;  1N33 E;  4DUY E;  3QT5 A;  2DB2 A;  1FJG E;  4NXN E;  2VQF I;  4AQY I;  2DIX A;  4DV4 E;  4R1F A;  3T1Y E;  2UUA E;  4JI3 I;  1ZM4 A;  1HNX E;  4DU8 A;  3C4T A;  1J5E E;  2LJP A;  4LF7 I;  2UXC E;  2VQE E;  1QZR A;  1FKA E;  4Z7C A;  2UXB E;  4DPX A;  2UU9 E;  4DR5 E;  1HR0 E;  4JYA E;  2ZIT A;  4YHH I;  1WUU A;  1HNZ I;  3ADL A;  3PYG A;  3T1H I;  4LF8 E;  1H74 A;  4JI4 E;  3JAM Q;  1IBM E;  1ZBT A;  3J7Y p;  1N33 I;  2V34 A;  4DUY I;  3B78 A;  1FJG I;  1VIS A;  2B7V A;  3JAM C;  4NXN I;  4FWD A;  4DU7 A;  5LL6 R;  1PIE A;  4DR6 E;  3T1Y I;  4LF5 E;  1T4L B;  2BV3 A;  2N3G A;  4LF6 E;  2R42 A;  1HNX I;  1RRE A;  1J5E I;  1Z0E A;  2UXC I;  1NHH A;  2BM0 A;  4DV0 E;  4DV1 E;  2UXB I;  2RTX A;  2A2D A;  1XMQ E;  2EZ6 A;  2UU9 I;  4DR5 I;  2NUE A;  4RPF A;  2L3J A;  4LF8 I;  2N3H A;  4DR2 E;  4JI1 E;  2JVA A;  1NHJ A;  1IBM I;  4LFA E;  1ZM9 A;  3F0N A;  3ZZT A;  4DR3 E;  4X64 E;  3LPS A;  2E5L E;  1B63 A;  1ZM3 A;  2XEX A;  4LF4 E;  2EFG A;  1H7U A;  2AJ4 A;  1UHZ A;  1YZ9 A;  4DR6 I;  3QT8 A;  2UUC E;  4LF5 I;  2UUB E;  4MYU A;  4B3T E;  4FN5 A;  4JI6 E;  4MYT A;  3PYF A;  4DV1 I;  2L2M A;  4DR7 E;  1XMQ I;  3J80 Q;  2WW4 A;  4X65 E;  4DR1 I;  4B3R I;  3H4L A;  4GKJ E;  4OX9 E;  5GMD A;  1XMO E;  3J80 C;  2B7T A;  3LTO A;  2LTS A;  2LUP B;  4JI1 I;  4DR2 I;  1U2R A;  3GON A;  4JI7 E;  4LFA I;  3V5R A;  2V2Z A;  4LFC E;  4DR3 I;  2JY9 A;  2HKJ A;  2DMY A;  1EKZ A;  2F4V E;  1FWL A;  3ZZ0 A;  3J7A G;  1PKP A;  2ZM6 E;  2X7I A;  4M2Z A;  2UUC I;  4WUB A;  1XHK A;  4JI6 I;  1Z5A A;  1Z0T A;  4DR7 I;  4FWG A;  3CWV A;  4K0K E;  2RS6 A;  4JI0 E;  4DPU A;  1X47 A;  4X65 I;  4JV5 I;  5LMU E;  4GKJ I;  4OOG C;  4OX9 I; 
#chains in the Genus database with same CATH topology
 1YPN A;  2JOB A;  2CVE A;  4OKG A;  2RSI A;  2EJ4 A;  2BA1 G;  1XMO I;  2BA0 G;  2NN6 B;  3M7N G;  2EWL A;  3HPS A;  4BHC A;  3C4B A;  5AC5 A;  2WNR B;  3ZKD A;  4JI7 I;  3QT6 A;  4GQU A;  1WJP A;  4DKK A;  3L7Z B;  4KHP I;  5DRO A;  2EL4 A;  4IZJ B;  5AAS A;  4LFC I;  3C6K A;  4BA2 B;  2IHR 1;  5IWA I;  4MDT A;  1FWK A;  2EM5 A;  1UN6 B;  1Z5C A;  2V83 A;  4L5N C;  5C0X B;  2F4V I;  4P78 A;  2MKD A;  3BBG A;  4HAC A;  2ZM6 I;  2EOO A;  3DD6 A;  2EM4 A;  2ZBK B;  3EPL A;  2N8X A;  3JU0 A;  2EOQ A;  2Q2E B;  1UEK A;  1USV A;  1Z59 A;  2IOP A;  4MU1 A;  1G2D C;  1RC7 A;  1ZBQ A;  3PS1 A;  2LMZ A;  2EM3 A;  4WUD A;  3AUZ A;  2YZT A;  4DV4 I;  2V85 A;  1MGT A;  2Q8U A;  4B3T I;  2YTF A;  5A6K A;  4USM A;  2UUA I;  2VF1 A;  3GLL A;  4AID A;  3ADJ A;  3LLH A;  2LUQ A;  1N34 E;  4HY1 A;  4X62 E;  5KL7 A;  1MX0 A;  4P7A A;  3B82 A;  2DEJ A;  3J81 C;  4JI0 I;  1FI4 A;  2VQE I;  4DXL A;  1Z0B A;  2EPN A;  1EH6 A;  1YUI A;  2HFU A;  3VYX A;  2GO3 A;  2EML A;  2HFS A;  3F6H A;  1N32 E;  2R3V A;  1YUJ A;  5CFF E;  1PVG A;  5A2Q C;  3M85 G;  2CG9 A;  2R76 A;  2NUF A;  4DR4 E;  2EN3 A;  1HR0 I;  4JYA I;  3D4J A;  3P1X A;  2HC5 A;  3QT7 A;  4DV3 E;  1ELO A;  5A6J A;  4B3S I;  3FIG A;  2EM2 A;  4KZS A;  4O4K A;  4DPW A;  5LMN E;  2BA1 D;  1T4O A;  2BA0 D;  4JI4 I;  1XNR E;  1J26 A;  2EN4 A;  3ZZU A;  4FWH A;  2UXD E;  1UDQ A;  2ADR A;  3M99 B;  2EPO A;  4NXM E;  1YHC A;  2V2Q A;  4JI8 E;  3GME A;  4BA1 A;  2EN8 A;  2YSP A;  1VI7 A;  3KRN A;  2B9D A;  5AE1 A;  2EMF A;  4OZE A;  2EOE A;  1Z0V A;  3QG5 C;  3V2U C;  2BR2 B;  4UT4 A;  1A6F A;  5LMU E;  4AM3 A;  2LVH A;  2NN6 D;  4LF6 I;  2E1R A;  2EMX A;  1A1I A;  4O43 A;  1N34 I;  1ZXN A;  2O1V A;  2EQ3 A;  4DV5 E;  3BGH A;  2KON A;  3HTX A;  4X62 I;  1N3G A;  2RSM A;  1UDS A;  1Z0W A;  4IJD A;  2R1F A;  4B3M E;  4M1K A;  4DV0 I;  3KZY A;  4R2S A;  2GHF A;  3UHM A;  2O1W A;  2EOR A;  2EMK A;  2J7J A;  2YTP A;  4BS9 A;  3CDI A;  3WU5 A;  2MDG A;  1Z5B A;  4PU9 A;  4HTG A;  1N32 I;  1KJK A;  2H36 X;  4WSG A;  1AH5 A;  2YRK A;  3BID A;  4KQV A;  2Z5B A;  4F54 A;  2EM8 A;  5C0X D;  2LJH A;  1BB8 A;  2A2C A;  4F6N A;  2V8Q B;  4DV3 I;  1IBL E;  1N36 E;  3HUL A;  1HNW E;  4MLV A;  5LMN I;  3C6M A;  2D9H A;  3K6Q A;  5F3W A;  2EOX A;  1XNR I;  2VQF E;  5FLX Q;  4AQY E;  3M85 D;  1ZR9 A;  3JTZ A;  2UXD I;  4IFD E;  2M1S A;  4WFT A;  4LCH A;  4NXM I;  4X64 I;  1B69 A;  4JI8 I;  1K47 A;  5FLX C;  2E5L I;  2VF3 A;  2EL5 A;  5K36 A;  3TQM A;  1IBK E;  1UIL A;  2FGG A;  5TSE A;  3WU4 A;  2CT1 A;  4LF4 I;  1D6T A;  5DNL A;  4USK A;  2E1M A;  5LLQ A;  3PS2 A;  3K17 A;  4OO1 A;  4O5G A;  2C37 A;  4Q28 A;  1P42 A;  4J8Z A;  4LF9 E;  2UUB I;  5K36 C;  2K7I A;  3EPK A;  1X48 A;  2HHH E;  1IMU A;  2AE8 A;  3HXL A;  3GCM A;  4HAC B;  3PYD A;  2YSO A;  1IQO A;  4BBY A;  2PO0 A;  4ED4 A;  4DV5 I;  2NUG A;  1UDO A;  3EQ1 A;  1P47 A;  1DGC A;  1S16 A;  1MU5 A;  1Z0G A;  4DMI A;  5DRQ A;  3ZM7 A;  4OO1 C;  4B3M I;  3LML A;  1USU A;  1GTK A;  2EM9 A;  2WBT A;  1G2F C;  1STU A;  4F9C B;  4X66 E;  2JWO A;  1N0V C;  2PO2 A;  2VES A;  4WYQ B;  3ZKB A;  4R2R A;  2EQ1 A;  2O3Z A;  5KL2 A;  4IZK A;  2DMI A;  1RR9 A;  1ZXM A;  1NZ0 A;  1DAR A;  4PRV A;  2KHX A;  3HQ1 A;  4ZYG A;  2EL6 A;  4GZN C;  5EKW A;  1NHI A;  1IBL I;  2EMA A;  5KL5 A;  2LE2 A;  1N36 I;  4LFB E;  1HNW I;  2MDR A;  1NCS A;  2YRH A;  2NPF A;  2EOM A;  4MU4 A;  2BM1 A;  2EPP A;  4BCA A;  2F1D A;  3P06 A;  3DF6 A;  1Z0C A;  5L3J A;  4M30 A;  1X6F A;  1A1G A;  1WHQ A;  1H7S A;  3HJC A;  4LOM A;  1X6H A;  1IBK I;  5IXM B;  3P76 A;  1KVK A;  2LRS A;  2EN1 A;  2JEB A;  2GQ0 A;  1BBG A;  2DRP A;  4I8O A;  5K36 F;  4MQY A;  2GPI A;  4P52 A;  1TF3 A;  4GKK E;  4LF9 I;  1YSA C;  1S4E A;  4R03 A;  2HHH I;  2MC6 A;  4DV6 E;  2Z5C A;  4OO1 F;  4PRX A;  3NZK A;  4BA1 B;  4BMJ A;  5AC4 A;  2V86 A;  2L3C A;  3J81 Q;  5IT9 Q;  1T4N A;  4JG4 A;  2C39 A;  2J7K A;  2C38 A;  4X66 I;  2V89 A;  1KIJ A;  1EI1 A;  1KKH A;  3ADG A;  1EA6 A;  4LCG A;  1OYR A;  4K0K I;  3P3E A;  5A2Q Q;  1BKN A;  5IT9 C;  4F2J C;  4FW6 A;  1ZAA C;  4R2P A;  5LMU I;  4HEI A;  2WBU A;  2WCC 3;  2EOS A;  4LFB I;  1A1J A;  4DPY A;  1I94 E;  4B3S E;  1FNM A;  3MHH C;  4JI5 E;  3WU3 A;  2MKN A;  5EL9 A;  2FTX B;  1YYO A;  2JEA A;  2YT4 A;  1N0U A;  5JEA E;  2HJJ A;  3B4T A;  4DV2 E;  2LT7 A;  2V8P A;  4FW3 A;  4RH8 A;  2Z5B B;  2WZO A;  3PYE A;  3M6A A;  2YPN A;  3AV0 A;  2YTQ A;  4ZVI A;  2PO1 A;  1YH8 A;  2M9A A;  2EE8 A;  5BR8 E;  2DEI A;  1MEY C;  3M7N D;  1H73 A;  3UK3 C;  5ADZ A;  2K4V A;  1PDA A;  2YTN A;  4DV7 E;  4I3H A;  4M0V A;  2EM7 A;  2HGH A;  1KYQ A;  2CPN A;  4GKK I;  2M4I A;  2OI2 A;  2CTD A;  1MG7 A;  1YFH A;  2V2V A;  4DV6 I;  5T6J A;  4ZYH A;  4P7D A;  1DQ3 A;  3WU6 A;  1XNQ E;  2LBS B;  4DR1 E;  4B3R E;  5KL6 A;  2HK3 A;  3Q1Q A;  5K36 B;  4YY3 E;  2NN6 E;  3VYY A;  2EN6 A;  4JI2 E;  1QU6 A;  4R2Q A;  4RHB B;  1R6M A;  4WXD A;  4N4R B;  1GQE A;  1Y4S A;  1Y6Z A;  2O1T A;  3CDJ A;  4HXZ A;  4X8W A;  2C37 B;  2JE6 A;  2JPA A;  4N3O A;  4DUZ E;  2YU5 A;  3P3G A;  2PO0 B;  2EN7 A;  4WUC A;  3ECR A;  3J7A M;  2L2N A;  2DSY A;  4Q35 B;  1WHN A;  2F8B A;  3OTO E;  5JEA F;  1TN9 A;  4FW4 A;  1RQ0 A;  2EPU A;  2EMY A;  5DNX A;  2PO2 B;  4JI5 I;  1H72 C;  4DR4 I;  2EN2 A;  4XTJ A;  2PNL A;  2L2K B;  3B8H A;  2L8T A;  1JK1 A;  4U3D A;  3ADI A;  4IFD A;  2YTO A;  4DV2 I;  4IZK B;  4HYM A;  2ENC A;  3VK6 A;  2A25 A;  2FV4 B;  2HKE A;  1ZU1 A;  4F9A B;  5BR8 I;  2EMW A;  3DJW A;  3MSW A;  2CZ9 A;  3H1C A;  1Y5Y A;  4IFD C;  2ENA A;  2RPC A;  1L4S A;  2IOQ A;  1B62 A;  4IS9 A;  4AIM A;  4DV7 I;  4JI3 E;  2WP8 A;  3K1J A;  4EMD A;  2L33 A;  2VE7 C;  1RMD A;  1DI2 A;  4DPT A;  1A1F A;  2EOZ A;  1XNQ I;  4LF7 E;  4NBQ A;  2LTR A;  2HK2 A;  4JV5 E;  4YY3 I;  1X49 A;  3IWB A;  4JI2 I;  5GME A;  4UTG A;  2EPX A;  4URL A;  2EPC A;  2JEB B;  5AE2 A;  4WXC A;  2B3T B;  4R2C A;  4LCF A;  1X6E A;  1ZM2 A;  2EMI A;  2RS7 A;  1Y4U A;  1EH8 A;  4FW9 A;  2ODR C;  4YHH E;  1YYK A;  1YYW A;  2EOJ A;  1HNZ E;  1KTV A;  2GS8 A;  2IES A;  2Z5C B;  3LNU A;  4DUZ I;  4KHP E;  5DNY A;  3T1H E;  1AAY A;  1OJ4 A;  3KWR A;  3RMP A;  1R6L A;  4LU9 A;  2NA2 A;  2M7Q A;  2X36 A;  3OTO I;  5IWA E;  3PRY A;  4R2D A;  1O0W A;  2C39 B;  4Z7Y A;  1Z1B A;  1EH7 A;  1RHY A;  5A6A A;  1N33 E;  1OYP A;  4DUY E;  4MLQ A;  3QT5 A;  2DB2 A;  4ZYE A;  2DLQ A;  2EQ0 A;  5A69 A;  1FJG E;  4IFD F;  4NHR A;  4NXN E;  2VQF I;  4AQY I;  2DIX A;  4DV4 E;  4R1F A;  2J65 A;  5K36 D;  4OO1 B;  2RQL A;  4O24 A;  4ZYD A;  2PNM A;  4TUI A;  2Z5E A;  1Y60 A;  3THN A;  2BB8 A;  3VHT B;  3T1Y E;  2UUA E;  4JI3 I;  2JEA B;  1ZM4 A;  4OO1 D;  1HNX E;  4R8O A;  4DU8 A;  3C4T A;  1J5E E;  2LJP A;  2EMB A;  4LF7 I;  2PO1 B;  1WXR A;  2UXC E;  2VQE E;  1QZR A;  1FKA E;  2I13 A;  2DGC A;  4Z7C A;  4L8N A;  4R2E A;  2UXB E;  4J3D A;  2EPZ A;  2GO4 A;  4QNK A;  4DPX A;  2UU9 E;  4DR5 E;  3ZOQ B;  1PJS A;  1HR0 E;  4JYA E;  2PNZ A;  2ZIT A;  1T38 A;  4YHH I;  2EOH A;  1WUU A;  1HNZ I;  3ADL A;  4BC9 A;  2YTI A;  4X9J A;  3PYG A;  3F6G A;  3T1H I;  2EP3 A;  2VRD A;  4LF8 E;  1H74 A;  2EPM X;  2CSH A;  4JI4 E;  2EMC A;  3JAM Q;  1IBM E;  1ZBT A;  5JEA A;  3J7Y p;  1N33 I;  4TUG A;  2CGE A;  2JE6 B;  2V34 A;  4DUY I;  3B78 A;  1FJG I;  1VIS A;  2B7V A;  4KWY A;  3JAM C;  1A1L A;  5AE3 A;  3EPJ A;  3Q6N A;  4NXN I;  5C0X E;  5JEA C;  1A1H A;  2LO3 A;  4FWD A;  1T39 A;  4DU7 A;  1TF6 A;  5LL6 R;  1UDN A;  1PIE A;  2EPK X;  4DR6 E;  3T1Y I;  4LF5 E;  3THO B;  1T4L B;  2BV3 A;  2N3G A;  4LF6 E;  2R42 A;  4FW5 A;  1HNX I;  4IFD B;  1RRE A;  4U3B A;  1GZ6 A;  1IQS A;  2E72 A;  1A1K A;  3P3C A;  1J5E I;  4R2A A;  1Z0E A;  2UXC I;  1NHH A;  2YTJ A;  4WSP A;  2NN6 A;  2BM0 A;  4DV0 E;  4LPF A;  2MC5 A;  4DV1 E;  2WNR A;  2UXB I;  2RTX A;  2YTE A;  2A2D A;  1XMQ E;  1WRJ A;  2EZ6 A;  3L7Z A;  2UU9 I;  4DR5 I;  2WP8 B;  4IZJ A;  1BBO A;  2NN6 C;  4LTY A;  4BA2 A;  5DRR A;  4BC7 A;  2NUE A;  2O1U A;  1LLM C;  5JEA D;  4RPF A;  1I94 I;  1PJT A;  2L3J A;  1E3H A;  1UBD C;  5C0X A;  4LF8 I;  2PRT A;  1QNT A;  2N3H A;  2LJU A;  4DR2 E;  1X3C A;  2EPR A;  4JI1 E;  4FW7 A;  2JVA A;  1NHJ A;  2JYA A;  5IV8 B;  1IBM I;  4LFA E;  1ZM9 A;  3Q6M A;  1OYS A;  3F0N A;  3ZZT A;  4DR3 E;  4MU0 A;  5C0X C;  4X64 E;  3LPS A;  2JOX A;  2YTG A;  2E5L E;  1B63 A;  1ZM3 A;  2WBS A;  2XEX A;  4LF4 E;  2EFG A;  2EMH A;  1H7U A;  2JT2 A;  2AJ4 A;  1UHZ A;  1YZ9 A;  2G7H A;  3L00 A;  4DR6 I;  3QT8 A;  2UUC E;  4LF5 I;  2UUB E;  5A6B A;  2IER A;  4MYU A;  4B3T E;  3H09 A;  4FN5 A;  2JXP A;  3HKM A;  4IS1 C;  4JI6 E;  1HK7 A;  4IZJ D;  4MYT A;  3PYF A;  2ENH A;  2KOU A;  4DV1 I;  5FWK A;  1X5W A;  2L2M A;  1JK2 A;  5KL3 A;  3EPH A;  2NAB A;  4DR7 E;  4ISA A;  1SFE A;  2NN6 F;  3J80 Q;  1XMQ I;  2WW4 A;  2L92 A;  2EOY A;  4X65 E;  2EPA A;  4GEQ B;  4DR1 I;  3H4L A;  4B3R I;  2V88 A;  4GKJ E;  4OX9 E;  5GMD A;  2GLI A;  2DLK A;  1PJQ A;  2I9I A;  3J80 C;  2L6M A;  2B7T A;  2YRM A;  3BF2 A;  1SR9 A;  1XMO E;  3LTO A;  2YU8 A;  2LTS A;  2LUP B;  4JI1 I;  3IWC A;  4F9B B;  4DR2 I;  1U2R A;  2EMZ A;  3GON A;  4JI7 E;  4LFA I;  3OML A;  3IWD A;  5C0X F;  3V5R A;  2V2Z A;  2JR1 A;  4LFC E;  4DR3 I;  2EM6 A;  4WPY A;  2JY9 A;  2PNZ B;  4IFD D;  4F6M A;  4M9V C;  2LCE A;  2JP9 A;  2LV2 A;  2BR2 A;  2HKJ A;  2DMY A;  1XXE A;  1EKZ A;  2C38 B;  3PS3 A;  4MU3 A;  2EPL X;  2F4V E;  2YWQ A;  1FWL A;  3J7A G;  5A6B D;  5KL4 A;  1PKP A;  2V87 A;  4BHB A;  2ZM6 E;  3U1K A;  3ZZ0 A;  2X7I A;  3HPZ A;  4M2Z A;  2BBG A;  4WUB A;  2UUC I;  5JEA B;  5K36 E;  3KZZ A;  2ELZ A;  2EOI A;  2EM0 A;  4NZV A;  1XHK A;  3MHS C;  3K85 A;  3U1Y A;  4OO1 E;  4JI6 I;  2EOF A;  2EMG A;  2ELY A;  1Z5A A;  1E3P A;  1F2I G;  1Z0T A;  4QNJ A;  2ODR D;  1NEI A;  4DR7 I;  4FWG A;  3CWV A;  4K0K E;  2RS6 A;  4JI0 E;  2YTD A;  1X47 A;  4WX9 A;  5DRP A;  5ELW A;  4DPU A;  4X65 I;  4JV5 I;  4FK5 C;  4GKJ I;  4OOG C;  4OX9 I; 
#chains in the Genus database with same CATH homology
 2JOB A;  1XMO I;  2EWL A;  3HPS A;  3C4B A;  3ZKD A;  4JI7 I;  3QT6 A;  4DKK A;  4KHP I;  4IZJ B;  4LFC I;  5AAS A;  2IHR 1;  5IWA I;  1FWK A;  1Z5C A;  2V83 A;  4L5N C;  2F4V I;  4P78 A;  4HAC A;  2ZM6 I;  2ZBK B;  3JU0 A;  2Q2E B;  1UEK A;  1USV A;  1Z59 A;  2IOP A;  1RC7 A;  1ZBQ A;  2LMZ A;  4WUD A;  4DV4 I;  3AUZ A;  2YZT A;  2V85 A;  4USM A;  2UUA I;  2VF1 A;  3ADJ A;  3LLH A;  2LUQ A;  1N34 E;  4HY1 A;  4X62 E;  1MX0 A;  4P7A A;  3B82 A;  2DEJ A;  3J81 C;  4JI0 I;  1FI4 A;  2VQE I;  4DXL A;  1Z0B A;  2HFU A;  3VYX A;  2HFS A;  2R3V A;  3F6H A;  1N32 E;  5CFF E;  1PVG A;  5A2Q C;  2CG9 A;  2NUF A;  1HR0 I;  4DR4 E;  4JYA I;  3D4J A;  3P1X A;  3QT7 A;  4DV3 E;  1ELO A;  3FIG A;  4KZS A;  4DPW A;  5LMN E;  1T4O A;  4JI4 I;  1XNR E;  1J26 A;  3ZZU A;  4FWH A;  2UXD E;  2V2Q A;  4NXM E;  4JI8 E;  2B9D A;  5AE1 A;  1Z0V A;  3V2U C;  4UT4 A;  1A6F A;  4LF6 I;  2E1R A;  1N34 I;  1ZXN A;  2O1V A;  4DV5 E;  3HTX A;  4X62 I;  2KON A;  2RSM A;  1Z0W A;  4B3M E;  4M1K A;  4DV0 I;  2O1W A;  4BS9 A;  3WU5 A;  1Z5B A;  4PU9 A;  1N32 I;  2H36 X;  4KQV A;  2Z5B A;  4F54 A;  2LJH A;  2A2C A;  2V8Q B;  4DV3 I;  1IBL E;  1N36 E;  3HUL A;  1HNW E;  5LMN I;  5F3W A;  3K6Q A;  1XNR I;  2VQF E;  5FLX Q;  4AQY E;  3JTZ A;  2UXD I;  2M1S A;  4WFT A;  4NXM I;  4X64 I;  4JI8 I;  1K47 A;  5FLX C;  2E5L I;  2VF3 A;  1IBK E;  1UIL A;  2FGG A;  3WU4 A;  1D6T A;  4LF4 I;  4USK A;  2E1M A;  3K17 A;  4Q28 A;  4J8Z A;  4LF9 E;  2UUB I;  1X48 A;  2HHH E;  3HXL A;  4HAC B;  3PYD A;  4DV5 I;  4ED4 A;  4BBY A;  4B3T I;  2NUG A;  3ZM7 A;  1Z0G A;  1S16 A;  1MU5 A;  4DMI A;  4B3M I;  3LML A;  1USU A;  1STU A;  4F9C B;  4X66 E;  2JWO A;  1N0V C;  4WYQ B;  3ZKB A;  4IZK A;  1RR9 A;  1ZXM A;  1NZ0 A;  1DAR A;  4PRV A;  2KHX A;  3HQ1 A;  1NHI A;  1IBL I;  1N36 I;  2LE2 A;  4LFB E;  1HNW I;  2MDR A;  2NPF A;  2BM1 A;  4BCA A;  3P06 A;  3DF6 A;  1Z0C A;  5L3J A;  4M30 A;  1WHQ A;  1H7S A;  3HJC A;  1IBK I;  1KVK A;  2LRS A;  2GQ0 A;  4I8O A;  4P52 A;  4GKK E;  4LF9 I;  1S4E A;  4R03 A;  2HHH I;  2MC6 A;  4DV6 E;  2Z5C A;  4PRX A;  4BMJ A;  2L3C A;  2V86 A;  3J81 Q;  5IT9 Q;  1T4N A;  4JG4 A;  2J7K A;  4X66 I;  2V89 A;  1KIJ A;  1EI1 A;  1KKH A;  3ADG A;  1EA6 A;  4K0K I;  5A2Q Q;  1BKN A;  5IT9 C;  5LMU I;  4LFB I;  4DPY A;  1I94 E;  4B3S E;  1FNM A;  3WU3 A;  4JI5 E;  2FTX B;  1YYO A;  2YT4 A;  1N0U A;  4DV2 E;  2V8P A;  2Z5B B;  2WZO A;  3PYE A;  3M6A A;  4ZVI A;  3AV0 A;  5BR8 E;  2DEI A;  1H73 A;  5ADZ A;  2K4V A;  4DV7 E;  4I3H A;  4M0V A;  2CPN A;  4GKK I;  2M4I A;  2OI2 A;  1MG7 A;  2V2V A;  4DV6 I;  5T6J A;  4P7D A;  1DQ3 A;  3WU6 A;  1XNQ E;  2LBS B;  4DR1 E;  4B3R E;  3Q1Q A;  2HK3 A;  4YY3 E;  3VYY A;  4JI2 E;  1QU6 A;  1GQE A;  1Y4S A;  1Y6Z A;  2O1T A;  4HXZ A;  4X8W A;  4N3O A;  4DUZ E;  4WUC A;  3J7A M;  2L2N A;  2DSY A;  1WHN A;  2F8B A;  3OTO E;  1I94 I;  4B3S I;  1RQ0 A;  4JI5 I;  1H72 C;  4DR4 I;  4XTJ A;  2PNL A;  2L2K B;  3B8H A;  2L8T A;  3ADI A;  4DV2 I;  4IZK B;  4HYM A;  2HKE A;  3VK6 A;  2FV4 B;  4F9A B;  5BR8 I;  3DJW A;  3MSW A;  2CZ9 A;  2IOQ A;  1B62 A;  4DV7 I;  4JI3 E;  3K1J A;  4EMD A;  2L33 A;  2VE7 C;  1DI2 A;  4DPT A;  1XNQ I;  4LF7 E;  2LTR A;  2HK2 A;  4JV5 E;  4YY3 I;  1X49 A;  3IWB A;  4JI2 I;  5GME A;  4UTG A;  4URL A;  5AE2 A;  2B3T B;  1ZM2 A;  1Y4U A;  2RS7 A;  4FW9 A;  2ODR C;  4YHH E;  1YYK A;  1YYW A;  1KTV A;  1HNZ E;  2GS8 A;  2Z5C B;  3LNU A;  4DUZ I;  4KHP E;  5DNY A;  3T1H E;  1OJ4 A;  3KWR A;  3RMP A;  4LU9 A;  2NA2 A;  2M7Q A;  2X36 A;  3OTO I;  5IWA E;  3PRY A;  1O0W A;  4Z7Y A;  1N33 E;  4DUY E;  3QT5 A;  2DB2 A;  1FJG E;  4NXN E;  2VQF I;  4AQY I;  2DIX A;  4DV4 E;  4R1F A;  2PNM A;  4TUI A;  2Z5E A;  3T1Y E;  2UUA E;  4JI3 I;  1ZM4 A;  1HNX E;  4R8O A;  4DU8 A;  3C4T A;  1J5E E;  2LJP A;  4LF7 I;  1WXR A;  2UXC E;  2VQE E;  1QZR A;  1FKA E;  4Z7C A;  4L8N A;  2UXB E;  4DPX A;  2UU9 E;  4DR5 E;  3ZOQ B;  1HR0 E;  4JYA E;  2ZIT A;  4YHH I;  1WUU A;  1HNZ I;  3ADL A;  4BC9 A;  3PYG A;  3F6G A;  3T1H I;  4LF8 E;  1H74 A;  4JI4 E;  3JAM Q;  1IBM E;  1ZBT A;  3J7Y p;  1N33 I;  4TUG A;  2CGE A;  2V34 A;  4DUY I;  3B78 A;  1FJG I;  1VIS A;  2B7V A;  3JAM C;  3Q6N A;  5AE3 A;  4NXN I;  4FWD A;  4DU7 A;  5LL6 R;  1PIE A;  4DR6 E;  3T1Y I;  4LF5 E;  1T4L B;  2BV3 A;  2N3G A;  4LF6 E;  2R42 A;  1HNX I;  1RRE A;  1GZ6 A;  1J5E I;  1Z0E A;  2UXC I;  1NHH A;  4WSP A;  2BM0 A;  4DV0 E;  2MC5 A;  4DV1 E;  2UXB I;  2RTX A;  2A2D A;  1XMQ E;  2EZ6 A;  2UU9 I;  4DR5 I;  4IZJ A;  4LTY A;  4BC7 A;  2NUE A;  2O1U A;  4RPF A;  2L3J A;  4LF8 I;  2N3H A;  4DR2 E;  4JI1 E;  2JVA A;  1NHJ A;  1IBM I;  4LFA E;  1ZM9 A;  3Q6M A;  3F0N A;  3ZZT A;  4DR3 E;  4X64 E;  3LPS A;  2JOX A;  2E5L E;  1B63 A;  1ZM3 A;  2XEX A;  4LF4 E;  2EFG A;  1H7U A;  2AJ4 A;  1UHZ A;  1YZ9 A;  2G7H A;  4DR6 I;  3QT8 A;  2UUC E;  4LF5 I;  2UUB E;  4MYU A;  4B3T E;  3H09 A;  4FN5 A;  4JI6 E;  1HK7 A;  4IZJ D;  4MYT A;  3PYF A;  2KOU A;  4DV1 I;  5FWK A;  2L2M A;  4DR7 E;  1XMQ I;  3J80 Q;  2WW4 A;  2L92 A;  4X65 E;  4GEQ B;  4DR1 I;  4B3R I;  3H4L A;  2V88 A;  4GKJ E;  4OX9 E;  5GMD A;  3J80 C;  1XMO E;  2L6M A;  2B7T A;  3LTO A;  1SR9 A;  2LTS A;  2LUP B;  4JI1 I;  3IWC A;  4F9B B;  4DR2 I;  1U2R A;  3GON A;  4JI7 E;  4LFA I;  3OML A;  3IWD A;  3V5R A;  2V2Z A;  2JR1 A;  4LFC E;  4DR3 I;  4WPY A;  2JY9 A;  2HKJ A;  2DMY A;  1EKZ A;  2F4V E;  1FWL A;  3ZZ0 A;  3J7A G;  1PKP A;  2V87 A;  2ZM6 E;  2X7I A;  3HPZ A;  4M2Z A;  2UUC I;  4WUB A;  1XHK A;  3K85 A;  4JI6 I;  1Z5A A;  1Z0T A;  2ODR D;  4DR7 I;  4FWG A;  3CWV A;  4K0K E;  2RS6 A;  4JI0 E;  4DPU A;  1X47 A;  4X65 I;  4JV5 I;  5LMU E;  4GKJ I;  4OOG C;  4OX9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...