1I94E

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
PETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1i94E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94E02
2HFSA 1PVGA 2VQFI 1T4OA 4GKKE 2HK3A 2MDRA 3VYXA 2VQEE 4Z7CA 4X65I 3C4TA 4DUZE 2F4VI 1Z0GA 4DPWA 4X64E 4P52A 4JYAE 1EI1A 4LF8I 2UU9E 1RQ0A 4DV2E 3J7AM 2NUFA 1X48A 1ZM2A 3QT6A 2R3VA 1FJGE 4JI5I 4DR2E 1N32I 3B82A 5BR8I 1MX0A 5CFFE 4DV7E 4X66E 3T1YI 4MYUA 2UXCI 3PYDA 4HYMA 4JI4E 1I94I 1UILA 1Z0CA 2CZ9A 2A2DA 4K0KE 1H7UA 2LJHA 1Z0TA 1ZM3A 4X62E 4GKJI 4DR7E 4PRXA 4DR5E 1J26A 1MU5A 4WUBA 1Z0VA 2EFGA 4ZVIA 1H74A 3VYYA 4WFTA 1H7SA 1HNXE 3ZZUA 1ZXMA 4B3RI 1XNRI 1U2RA 4DR6E 1Z0BA 1WHNA 1ZXNA 4DPYA 4LF5I 2KHXA 3OTOI 3ZKDA 2A2CA 1UHZA 4OOGC 2R42A 2B3TB 4K0KI 4DV6E 1YYKA 3J7AG 3ZZTA 2UUAI 2B7VA 4LF9E 1VISA 4B3ME 4DR4I 4DV4I 2HK2A 3T1HE 4DR1I 3ZZ0A 1A6FA 4B3TI 1WUUA 4LFAI 4GKKI 4M30A 3JAMC 3ADGA 3V5RA 2EZ6A 1YZ9A 1XNRE 1XMQI 2RS7A 3HULA 2V2ZA 1J5EI 3HTXA 4LF6I 3J81C 1ZBTA 4KHPE 2ZBKB 2UXBI 1Z0WA 2B7TA 1HR0E 1PIEA 4JI8E 1ZM4A 5FLXQ 3V2UC 2DIXA 2VQEI 4DR4E 4WYQB 4JI6I 3ADIA 4DV5I 4JV5E 4I3HA 4JI0I 4USKA 2UXDE 1K47A 1H73A 2HKJA 2OI2A 2UUCI 4JI8I 1RREA 4JI1I 1FJGI 1Z5AA 1HNZI 4NXMI 5LMNI 2L3JA 5LMUI 4X8WA 2JY9A 4AQYI 4UTGA 1YYWA 4DR5I 1N36E 4R1FA 4DXLA 4JI1E 4JI4I 1J5EE 4LF6E 2VQFE 4XTJA 2VF3A 1N0UA 4HXZA 2Q2EB 2LUQA 2BM1A 2HFUA 3K17A 1S16A 2LBSB 3QT5A 1N33E 4JI6E 4MYTA 4DR1E 3T1HI 3F0NA 2E1RA 2HKEA 1Z5BA 4JI0E 4FN5A 4YY3E 1NHIA 5LL6R 4GKJE 4DV3E 4DPXA 4JI7E 1IBLE 5A2QQ 1MG7A 3LTOA 1WHQA 4KQVA 1HNZE 4NXME 2F4VE 4DKKA 1IBMI 1NHHA 1D6TA 1ZM9A 2N3GA 4B3RE 1O0WA 1HNXI 4HACB 1FWKA 5IT9C 4LFBI 3PYGA 4LF5E 3LPSA 1N36I 4M1KA 4DV4E 4YHHI 2N3HA 1XHKA 2NA2A 1YYOA 2V34A 4YY3I 1DARA 4DR7I 1KIJA 4DU7A 1KKHA 1PKPA 3LLHA 4DU8A 4B3TE 4DR2I 2HHHE 4WUCA 3ADLA 3WU6A 4LFCI 2UUCE 1B62A 4YHHE 3WU3A 2DMYA 4DR3E 1KVKA 3H4LA 5FLXC 2X7IA 4LF8E 4LF9I 5IWAE 3P1XA 1X49A 1EA6A 1UEKA 4DR6I 2L2MA 1KTVA 1RR9A 1N33I 2IHR1 2AJ4A 1T4LB 4DV1E 4USMA 5GMDA 1T4NA 2L3CA 4X65E 3T1YE 4UT4A 2LRSA 4DV0I 2UUBE 4FWGA 1H72C 4EMDA 4DUYI 1OJ4A 1DI2A 3QT7A 4JI2E 3C4BA 1ELOA 2NUEA 4DV7I 1FKAE 4B3MI 1QZRA 5GMEA 1HR0I 4RPFA 4DPTA 5L3JA 2JVAA 3PYEA 4LF4E 2UUBI 4DV5E 3J80C 2DEJA 2UXDI 4JG4A 2DB2A 4ED4A 3WU4A 4KHPI 1XMQE 2CPNA 4B3SI 3J7Yp 2ZITA 3M6AA 4LF4I 1FI4A 4JV5I 1IBME 4LF7I 4P7AA 1RC7A 4JI3I 1IBKI 5LMUE 1Z5CA 4URLA 4X62I 1XNQI 3GONA 1N0VC 1EKZA 1N34I 4OX9I 4DV0E 1GQEA 4HACA 3ZM7A 1NHJA 4DUYE 4DV6I 2LJPA 4NXNE 4FW9A 2HHHI 2L2NA 5BR8E 5A2QC 2WW4A 4LFCE 4Z7YA 3B78A 3ADJA 2ZM6E 2NUGA 3K1JA 4WUDA 3LNUA 1IBKE 4JI5E 4LF7E 1XMOE 1X47A 3QT8A 4HY1A 2X36A 3B8HA 3J80Q 4JYAI 2UUAE 3ZKBA 1IBLI 4JI7I 1XNQE 4DV3I 4FWDA 2UXBE 2ZM6I 1STUA 3JAMQ 2UXCE 3PYFA 4X64I 4DPUA 2J7KA 1Z0EA 4LFAE 1N32E 1NZ0A 1HNWE 4LFBE 3CWVA 2RSMA 2V2VA 1Z59A 4PU9A 4X66I 4OX9E 1N34E 3D4JA 1BKNA 4PRVA 1FWLA 1I94E 4JI2I 4DV1I 4NXNI 5IWAI 2V2QA 2BV3A 2V8PA 1S4EA 3OTOE 4DUZI 2XEXA 2LTSA 2GS8A 5LMNE 2E5LE 1XMOI 4JI3E 1HNWI 2NPFA 2LUPB 3Q1QA 2L2KB 4B3SE 3J81Q 4DR3I 4M2ZA 4FWHA 2E5LI 3WU5A 2LTRA 2RTXA 1QU6A 2RS6A 2UU9I 1B63A 2YT4A 1FNMA 4AQYE 5IT9Q 4DV2I 2BM0A 2L33A 2DEIA
chains in the Genus database with same CATH superfamily
4R2RA 4HEIA 2C39B 2HFSA 2EOFA 2YRKA 5A69A 5KL3A 2C38B 4F6NA 3LMLA 2DSYA 3HXLA 2CTDA 3VK6A 1YUJA 4JI3I 4L8NA 1PVGA 3U1KA 3RMPA 2EPOA 4RH8A 5KL6A 4WXCA 1T4OA 2VQFI 2EOOA 4GKKE 4IZJB 2GO3A 4JYAI 2HK3A 2MDRA 2EPAA 3VYXA 2EM2A 2NN6B 4L5NC 2VQEE 4Z7CA 4X65I 2NN6A 2BR2B 3K6QA 3C4TA 3HJCA 4DUZE 2JT2A 2EP3A 4IZJA 2F4VI 2LMZA 2EL5A 4IFDF 1Z0GA 3EPKA 4DPWA 4X64E 2DEIA 4P52A 2C37B 4JYAE 1DQ3A 2PNLA 2EMXA 1EI1A 4LF8I 2UU9E 4FW4A 2PO2B 1RQ0A 4DV2E 2JEBB 2NN6E 3J7AM 4N3OA 3KRNA 4WX9A 2NUFA 1EH6A 2VE7C 2PNZA 1GTKA 1A1GA 1X48A 1ZM2A 3QT6A 3PS1A 2DLKA 1FJGE 2R3VA 1FJGI 4NZVA 4BS9A 4JI5I 2FGGA 3GCMA 2JP9A 4DR2E 1N32I 5AE1A 3B82A 4AIDA 2GHFA 5BR8I 1PJQA 4BHCA 5C0XB 4ZYGA 1MX0A 1A1KA 1RHYA 2IOPA 2EOEA 2LJUA 5CFFE 4DV7E 4X66E 3T1YI 4ZYDA 5DNYA 4MYUA 2UXCI 2EE8A 3PYDA 4WXDA 4HYMA 4JI4E 5DRRA 4FK5C 1I94I 1X6EA 5K36A 2R76A 2WCC3 3P06A 1UILA 1Z0CA 2ODRD 4LCHA 2CZ9A 2A2DA 4K0KE 2EPPA 1H7UA 2LJHA 4KWYA 1Z0TA 2V85A 2YTJA 4BCAA 1PJTA 1ZM3A 4X62E 2O1UA 2YRHA 4GKJI 4OO1B 4DR7E 2EORA 4PRXA 4DR5E 1SFEA 2NN6D 1J26A 3BIDA 1MU5A 2RSIA 4WUBA 2E1MA 1Z0VA 2WBSA 2EFGA 4IZJD 4ZVIA 1H74A 3VYYA 4WFTA 1H7SA 2EPLX 1HNXE 2I9IA 4F6MA 1ZXMA 3ZZUA 3P3CA 3IWCA 3PS3A 4B3RI 1XNRI 1U2RA 4NHRA 3FIGA 4DR6E 1Z0BA 2GPIA 1WHNA 2NN6C 3PS2A 1ZXNA 4MLQA 2EMGA 4DPYA 2KHXA 1A1IA 1USUA 4LF5I 2EPZA 4MLVA 3OTOI 3ZKDA 2L92A 2G7HA 4Q28A 4WPYA 1OYPA 1XXEA 2CGEA 5A6KA 2A2CA 1UHZA 2C37A 4OOGC 2EOJA 2B3TB 2MDGA 2IESA 4DV6E 4BMJA 1YYKA 2EPXA 2R42A 4K0KI 3ZZTA 2DRPA 2EN1A 2YTFA 4J3DA 2UUAI 2EMZA 2B7VA 4Z7YA 4LF9E 2JEAA 2D9HA 2EJ4A 2F1DA 2LVHA 4DV6I 2V83A 1VISA 5K36E 4O4KA 4B3ME 4DR4I 3AV0A 5A6BA 4MQYA 4DV4I 2HK2A 3T1HE 4DR1I 3ZZ0A 1A6FA 4O43A 2MKNA 3IWDA 5EKWA 4B3TI 1WUUA 2JOXA 2EL4A 4LFAI 4GKKI 2YTQA 3CDJA 4M30A 3JAMC 2V87A 3ADGA 3V5RA 2BA1D 5C0XC 2EZ6A 1YZ9A 4F54A 4WSPA 1XNRE 1XMQI 3P76A 2RS7A 3HULA 2V2ZA 3PRYA 1JK2A 4O24A 1J5EI 3HTXA 2ENHA 1UBDC 4IS9A 2Z5CA 4R2AA 2LV2A 4AIMA 4LF6I 1VI7A 1DGCA 3CDIA 4ZYHA 2JYAA 3J81C 1ZBTA 4KHPE 2ZBKB 4OO1C 2B9DA 2UXBI 1Z0WA 2B7TA 1HR0E 1PDAA 4JI8E 1PIEA 1ZM4A 3V2UC 5FLXQ 2DIXA 2EM9A 2VQEI 4DR4E 2Z5BB 4WYQB 1A1HA 4JI6I 2ELYA 4GEQB 1TF6A 1MGTA 3ADIA 4DV5I 2EPKX 2M4IA 4JV5E 2CT1A 4R03A 4I3HA 2NABA 1Y4SA 4USKA 4JI0I 2UXDE 1K47A 2K4VA 2BBGA 5T6JA 3VHTB 2EOXA 1H73A 2HKJA 2OI2A 2UUCI 4JI8I 4IFDA 1RREA 1KJKA 2EPNA 3M7ND 2EOQA 3K85A 2F8BA 2FTXB 5DRQA 1Z5AA 4JI1I 1HNZI 2WP8B 5LMNI 1A1JA 1Y4UA 2NN6F 2VRDA 2PRTA 4NXMI 1KYQA 2YTNA 2YSOA 5DROA 2L3JA 2V89A 2EPMX 5JEAD 2YRMA 5LMUI 4BBYA 4IS1C 1BB8A 4X8WA 2JY9A 4AQYI 4UTGA 2LCEA 2EOSA 2EMIA 2EQ1A 1ZU1A 1YYWA 1YSAC 5K36D 4DR5I 1X6FA 1N36E 4R1FA 4DXLA 4JI1E 4JI4I 1J5EE 4R8OA 4KZSA 1Z1BA 1OYSA 4LF6E 2VQFE 4XTJA 1GZ6A 3M7NG 2VF3A 1B69A 1N0UA 2YTPA 4BHBA 2EN8A 4HXZA 2Q2EB 2LUQA 2BM1A 2HFUA 4AM3A 3K17A 1S16A 4OO1D 2LBSB 3QT5A 1N33E 4JI6E 4MYTA 1X5WA 1Y5YA 4DR1E 3T1HI 2EMAA 4FW6A 3F0NA 5TSEA 2E1RA 2HKEA 2JE6A 1R6MA 4P78A 1Z5BA 4JI0E 2JWOA 3NZKA 3GLLA 2EN6A 5AASA 4FN5A 2M9AA 4YY3E 1NHIA 3KZYA 5LL6R 5JEAB 2JXPA 4GKJE 4DV3E 4DPXA 4RHBB 2VESA 4JI7E 1IBLE 2Z5BA 5KL5A 2BA0G 5A2QQ 1MG7A 2WBUA 1P42A 2EOZA 1WXRA 3DD6A 1WHQA 3F6HA 2I13A 1R6LA 3LTOA 2Q8UA 4KQVA 1HNZE 4NXME 2F4VE 5C0XA 4DKKA 1X6HA 3EPLA 4QNKA 1IBMI 4IFDD 1RMDA 1BBOA 1NHHA 2EN7A 1D6TA 1G2DC 3C6MA 5K36C 1ZM9A 1USVA 2N3GA 4B3RE 1O0WA 1BBGA 2WBTA 4HACB 1HNXI 2O3ZA 1IQSA 4Q35B 1FWKA 5IT9C 3H1CA 4LFBI 3PYGA 3KZZA 4LF5E 1YH8A 5AC4A 2IOQA 3Q6MA 1UN6B 1F2IG 3LPSA 1N36I 4M1KA 4R2DA 3BF2A 2PO2A 4DV4E 4YHHI 2V88A 4IJDA 2PNMA 2YU8A 2EN3A 5ADZA 3HPZA 2N3HA 2EOIA 2NA2A 1YYOA 1XHKA 2V34A 2IERA 1DARA 4R2QA 2EQ3A 4BC7A 4QNJA 4YY3I 4DR7I 2L8TA 3KWRA 5LLQA 1KIJA 4DU7A 1P47A 1UDSA 5C0XF 2EOYA 1YHCA 4MU4A 1KKHA 1JK1A 1PKPA 1X3CA 2JEAB 4M0VA 3LLHA 4DU8A 4B3TE 4DR2I 4R2PA 2HHHE 2YTGA 2AE8A 4P7DA 1MEYC 4WUCA 3ADLA 2ENCA 3DJWA 5IV8B 4LFCI 3WU6A 5A6AA 2UUCE 2C39A 4FW3A 1B62A 4YHHE 4F2JC 4NBQA 2DMYA 4DR3E 2MKDA 1KVKA 2YPNA 3WU3A 4BA1B 2YTOA 3H4LA 2MC5A 4LPFA 1Y60A 2EM8A 5FLXC 4ZYEA 1EH7A 4TUIA 2PO0B 1SR9A 2X7IA 3U1YA 4LF8E 5AC5A 2HGHA 5JEAC 2EM6A 5IWAE 4LF9I 1N3GA 3P1XA 1X49A 2M7QA 1EA6A 1UEKA 4ISAA 4DR6I 2EWLA 2L2MA 3DF6A 3AUZA 4LCFA 3BBGA 3MHHC 1KTVA 2BA1G 2HC5A 4MDTA 1RR9A 2PO1B 1N33I 5JEAA 2WNRB 3HKMA 2IHR1 2AJ4A 1T4LB 2JE6B 3OMLA 4IFDE 4DV1E 2WNRA 5DNLA 4USMA 5GMDA 1T4NA 1ZR9A 2L3CA 2DLQA 4MU1A 2E72A 2R1FA 4X65E 3T1YE 4FW5A 4UT4A 2O1VA 2EMYA 2LRSA 2EPUA 4TUGA 2Z5EA 4DV0I 2UUBE 4FWGA 1H72C 4EMDA 4DUYI 1OJ4A 1DI2A 2J7JA 4BA2A 2YWQA 2PO0A 3QT7A 2EPCA 5KL7A 4JI2E 4M9VC 3Q6NA 2K7IA 1ZAAC 5IXMB 3C4BA 3EPJA 3L7ZA 1NCSA 1ELOA 2NUEA 2JPAA 4DV7I 1AAYA 2EMBA 1FKAE 4WSGA 4MU3A 2EN4A 1QZRA 5GMEA 1HR0I 4B3MI 4RPFA 4DPTA 2JOBA 5L3JA 2JVAA 2JEBA 3PYEA 2EL6A 2EM7A 4LF4E 2UUBI 4DV5E 3J80C 3THOB 2V86A 2DEJA 4N4RB 4OZEA 3TQMA 5DRPA 2YSPA 2EMHA 2UXDI 2WP8A 4JG4A 3F6GA 1LLMC 2DB2A 4ED4A 1YUIA 1A1LA 3WU4A 3JTZA 5AE3A 3ZOQB 4KHPI 4DMIA 1XMQE 2BR2A 3HPSA 2CPNA 3MHSC 4U3DA 4B3SI 1UDNA 3J7Yp 4FW7A 2GQ0A 2ZITA 3M6AA 4LF4I 4F9CB 1FI4A 1OYRA 2RPCA 4JV5I 1IBME 5AE2A 4LF7I 3EPHA 4P7AA 2LO3A 3HQ1A 1RC7A 2ADRA 5LMUE 5ELWA 1IBKI 1UDQA 4I8OA 1E3PA 2EMWA 1Z5CA 4U3BA 4URLA 4X62I 1IMUA 1XNQI 2EN2A 3QG5C 3GONA 2JR1A 2C38A 1N0VC 5C0XE 1EKZA 1N34I 4X9JA 4OX9I 2N8XA 3THNA 2M1SA 1A1FA 4DV0E 1GQEA 2V8QB 4HACA 3ZM7A 1YPNA 1NHJA 4DUYE 2YU5A 2EMFA 3UK3C 4NXNE 2LJPA 4FW9A 3H09A 1AH5A 2EPRA 1YFHA 2YTEA 2EMCA 2O1WA 2L2NA 2Z5CB 2HHHI 2A25A 2EM5A 3EQ1A 5BR8E 5A2QC 5DNXA 2WW4A 2EM3A 5KL4A 2KONA 4LFCE 2CSHA 3ADJA 2YZTA 2ENAA 3B78A 2ZM6E 1T39A 4OO1E 4R2SA 1T38A 2NUGA 1TN9A 5K36F 2HJJA 3K1JA 3LNUA 4WUDA 3M85G 1IBKE 4F9BB 4JI5E 4LF7E 3IWBA 1XMOE 1X47A 3QT8A 2RQLA 2VF1A 4HTGA 4GZNC 2X36A 3B8HA 1ZBQA 2UUAE 2O1TA 4HY1A 3ZKBA 3J80Q 1IBLI 2ODRC 1XNQE 4JI7I 4DV3I 4FWDA 2UXBE 2EQ0A 2ZM6I 1STUA 3JAMQ 2DMIA 2MC6A 2UXCE 2BB8A 4IZKB 3PYFA 5JEAE 4X64I 2EOHA 3L00A 4DPUA 2J7KA 1Z0EA 4LFAE 2FV4B 1N32E 4OKGA 2EMLA 1NZ0A 1HNWE 4LFBE 2CG9A 4F9AB 3CWVA 2RSMA 2DGCA 2L6MA 1EH8A 1Z59A 2V2VA 4PU9A 4R2EA 4X66I 3MSWA 4OX9E 2BA0D 2LE2A 4R2CA 1N34E 4LCGA 3D4JA 3L7ZB 1BKNA 3JU0A 2H36X 4PRVA 3P3EA 1FWLA 1L4SA 1I94E 4JI2I 3GMEA 4DV1I 3M99B 4NXNI 4BA2B 1E3HA 5IWAI 3UHMA 2V2QA 2BV3A 4IZKA 2V8PA 2CVEA 3P3GA 1Y6ZA 4IFDB 1S4EA 3OTOE 5F3WA 4DUZI 4OO1A 3M85D 3BGHA 5A6JA 2XEXA 1G2FC 2LTSA 2GS8A 5LMNE 1PJSA 1HK7A 2EM0A 2E5LE 1XMOI 2KOUA 4JI3E 5JEAF 5K36B 4J8ZA 1UDOA 1HNWI 3B4TA 2NPFA 2LUPB 3Q1QA 2PO1A 1NEIA 2L2KB 4B3SE 4LOMA 2GO4A 3J81Q 5FWKA 4DR3I 2GLIA 5C0XD 3ECRA 4M2ZA 4FWHA 1TF3A 4BC9A 2LT7A 4O5GA 2J65A 1WRJA 2YTIA 2EMKA 4LTYA 1IQOA 4MU0A 5A6BD 2E5LI 4LU9A 3WU5A 2ELZA 2LTRA 1QNTA 2EOMA 2RTXA 2WZOA 5EL9A 1QU6A 2RS6A 2EM4A 1B63A 2UU9I 2YT4A 5KL2A 3C6KA 4GQUA 1FNMA 4BA1A 4IFDC 4AQYE 5IT9Q 1WJPA 2BM0A 2L33A 2PNZB 4DV2I 2YTDA 4OO1F 3J7AG
chains in the Genus database with same CATH topology
2HFSA 3LMLA 2DSYA 3HXLA 3VK6A 4L8NA 1PVGA 3RMPA 2VQFI 1T4OA 4GKKE 4IZJB 2HK3A 2MDRA 3VYXA 4L5NC 2VQEE 4Z7CA 4X65I 3K6QA 3C4TA 3HJCA 4DUZE 4IZJA 2F4VI 2LMZA 1Z0GA 4DPWA 4X64E 2DEIA 4P52A 4JYAE 1DQ3A 2PNLA 1EI1A 4LF8I 2UU9E 1RQ0A 4DV2E 3J7AM 4N3OA 2NUFA 2VE7C 1X48A 1ZM2A 3QT6A 2R3VA 1FJGE 4BS9A 4JI5I 2FGGA 4DR2E 1N32I 5AE1A 3B82A 5BR8I 1MX0A 2IOPA 5CFFE 4DV7E 4X66E 3T1YI 5DNYA 4MYUA 2UXCI 3PYDA 4HYMA 4JI4E 1I94I 3P06A 1UILA 1Z0CA 2ODRD 2CZ9A 2A2DA 4K0KE 1H7UA 2LJHA 1Z0TA 1ZM3A 2V85A 4BCAA 4X62E 2O1UA 4GKJI 4DR7E 4PRXA 4DR5E 1J26A 1MU5A 4WUBA 2E1MA 1Z0VA 2EFGA 4IZJD 4ZVIA 1H74A 3VYYA 4WFTA 1H7SA 1HNXE 3ZZUA 1ZXMA 4B3RI 3IWCA 1XNRI 1U2RA 3FIGA 4DR6E 1Z0BA 1WHNA 1ZXNA 4DPYA 4LF5I 2KHXA 1USUA 3OTOI 3ZKDA 2L92A 2G7HA 4Q28A 4WPYA 2CGEA 2A2CA 1UHZA 4OOGC 2R42A 2B3TB 4K0KI 4DV6E 4BMJA 1YYKA 3ZZTA 2UUAI 2B7VA 4LF9E 2V83A 1VISA 4B3ME 4DR4I 3AV0A 4DV4I 2HK2A 3T1HE 4DR1I 3ZZ0A 1A6FA 3IWDA 4B3TI 1WUUA 2JOXA 4LFAI 4GKKI 4M30A 3JAMC 2V87A 3ADGA 3V5RA 2EZ6A 1YZ9A 4F54A 4WSPA 1XNRE 1XMQI 2RS7A 3HULA 2V2ZA 3PRYA 1J5EI 3HTXA 2Z5CA 4LF6I 3J81C 1ZBTA 4KHPE 2ZBKB 2B9DA 2UXBI 1Z0WA 2B7TA 1HR0E 1PIEA 4JI8E 1ZM4A 5FLXQ 3V2UC 2DIXA 2VQEI 4DR4E 2Z5BB 4WYQB 4JI6I 4GEQB 3ADIA 4DV5I 2M4IA 4JV5E 4R03A 4I3HA 1Y4SA 4USKA 4JI0I 2UXDE 1K47A 2K4VA 5T6JA 1H73A 2HKJA 2OI2A 2UUCI 4JI8I 1RREA 3K85A 2F8BA 2FTXB 4JI1I 1Z5AA 1HNZI 4NXMI 1FJGI 5LMNI 1Y4UA 2L3JA 2V89A 5LMUI 4BBYA 4X8WA 2JY9A 4AQYI 4UTGA 1YYWA 4DR5I 1N36E 4R1FA 4DXLA 4JI1E 4JI4I 1J5EE 4R8OA 4KZSA 4LF6E 2VQFE 4XTJA 1GZ6A 2VF3A 1N0UA 4HXZA 2Q2EB 2LUQA 2BM1A 2HFUA 3K17A 1S16A 2LBSB 3QT5A 1N33E 4JI6E 4MYTA 4DR1E 3T1HI 3F0NA 2E1RA 2HKEA 4P78A 1Z5BA 4JI0E 2JWOA 5AASA 4FN5A 4YY3E 1NHIA 5LL6R 4GKJE 4DV3E 4DPXA 4JI7E 1IBLE 2Z5BA 5A2QQ 1MG7A 1WXRA 3LTOA 1WHQA 3F6HA 4KQVA 1HNZE 4NXME 2F4VE 4DKKA 1IBMI 1NHHA 1D6TA 1ZM9A 1USVA 2N3GA 4B3RE 1O0WA 1HNXI 4HACB 1FWKA 5IT9C 4LFBI 3PYGA 4LF5E 2IOQA 3Q6MA 3LPSA 1N36I 4M1KA 4DV4E 4YHHI 2V88A 2PNMA 5ADZA 3HPZA 2N3HA 1XHKA 2NA2A 1YYOA 2V34A 4YY3I 1DARA 4BC7A 4DR7I 2L8TA 3KWRA 1KIJA 4DU7A 1KKHA 1PKPA 4M0VA 3LLHA 4DU8A 4B3TE 4DR2I 2HHHE 4P7DA 4WUCA 3ADLA 3DJWA 3WU6A 4LFCI 2UUCE 1B62A 4YHHE 2DMYA 4DR3E 1KVKA 3WU3A 3H4LA 2MC5A 5FLXC 4TUIA 1SR9A 2X7IA 4LF8E 4LF9I 5IWAE 3P1XA 1X49A 2M7QA 1EA6A 1UEKA 4DR6I 2EWLA 2L2MA 3DF6A 3AUZA 1KTVA 1RR9A 1N33I 2IHR1 2AJ4A 1T4LB 3OMLA 4DV1E 4USMA 5GMDA 1T4NA 2L3CA 4X65E 3T1YE 4UT4A 2O1VA 2LRSA 4TUGA 2Z5EA 4DV0I 2UUBE 4FWGA 1H72C 4EMDA 4DUYI 1OJ4A 1DI2A 3QT7A 4JI2E 3Q6NA 3C4BA 1ELOA 2NUEA 4DV7I 1FKAE 4B3MI 1QZRA 5GMEA 1HR0I 4RPFA 4DPTA 2JOBA 5L3JA 2JVAA 3PYEA 4LF4E 2UUBI 4DV5E 3J80C 2DEJA 2V86A 2UXDI 4JG4A 3F6GA 2DB2A 4ED4A 3WU4A 3JTZA 5AE3A 3ZOQB 4KHPI 4DMIA 1XMQE 3HPSA 2CPNA 4B3SI 3J7Yp 2GQ0A 2ZITA 3M6AA 4LF4I 4F9CB 1FI4A 4JV5I 1IBME 5AE2A 4LF7I 4P7AA 1RC7A 3HQ1A 1IBKI 5LMUE 4JI3I 4I8OA 1Z5CA 4URLA 4X62I 1XNQI 3GONA 2JR1A 1N0VC 1EKZA 1N34I 4OX9I 2M1SA 4DV0E 1GQEA 2V8QB 4HACA 3ZM7A 1NHJA 4DUYE 4DV6I 2LJPA 4NXNE 4FW9A 3H09A 2O1WA 2Z5CB 2HHHI 2L2NA 5BR8E 5A2QC 2WW4A 4LFCE 4Z7YA 2KONA 3B78A 3ADJA 2YZTA 2ZM6E 2NUGA 3K1JA 4WUDA 3LNUA 1IBKE 4F9BB 4JI5E 4LF7E 3IWBA 1XMOE 1X47A 3QT8A 2VF1A 4HY1A 2X36A 3B8HA 3J80Q 1ZBQA 2UUAE 2O1TA 4JYAI 3ZKBA 1IBLI 4JI7I 2ODRC 1XNQE 4DV3I 4FWDA 2UXBE 2ZM6I 1STUA 3JAMQ 2MC6A 2UXCE 4IZKB 3PYFA 4X64I 4DPUA 2J7KA 1Z0EA 4LFAE 2FV4B 1N32E 1NZ0A 1HNWE 4LFBE 2CG9A 4F9AB 3CWVA 2RSMA 2V2VA 2L6MA 1Z59A 4PU9A 4X66I 3MSWA 4OX9E 2LE2A 1N34E 3D4JA 1BKNA 3JU0A 2H36X 4PRVA 1FWLA 1I94E 4JI2I 4DV1I 4NXNI 5IWAI 2V2QA 2BV3A 4IZKA 2V8PA 1Y6ZA 1S4EA 3OTOE 5F3WA 4DUZI 2XEXA 2LTSA 2GS8A 5LMNE 1HK7A 2E5LE 1XMOI 2KOUA 4JI3E 4J8ZA 1HNWI 2NPFA 2LUPB 3Q1QA 2L2KB 4B3SE 3J81Q 5FWKA 4DR3I 4M2ZA 4FWHA 4BC9A 4LTYA 2E5LI 4LU9A 3WU5A 2LTRA 2WZOA 2RTXA 1QU6A 2RS6A 2UU9I 1B63A 2YT4A 1FNMA 4AQYE 5IT9Q 4DV2I 2BM0A 2L33A 3J7AG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFS A;  1PVG A;  2VQF I;  1T4O A;  4GKK E;  2HK3 A;  2MDR A;  3VYX A;  2VQE E;  4Z7C A;  4X65 I;  3C4T A;  4DUZ E;  2F4V I;  1Z0G A;  4DPW A;  4X64 E;  4P52 A;  4JYA E;  1EI1 A;  4LF8 I;  2UU9 E;  1RQ0 A;  4DV2 E;  3J7A M;  2NUF A;  1X48 A;  1ZM2 A;  3QT6 A;  2R3V A;  1FJG E;  4JI5 I;  4DR2 E;  1N32 I;  3B82 A;  5BR8 I;  1MX0 A;  5CFF E;  4DV7 E;  4X66 E;  3T1Y I;  4MYU A;  2UXC I;  3PYD A;  4HYM A;  4JI4 E;  1I94 I;  1UIL A;  1Z0C A;  2CZ9 A;  2A2D A;  4K0K E;  1H7U A;  2LJH A;  1Z0T A;  1ZM3 A;  4X62 E;  4GKJ I;  4DR7 E;  4PRX A;  4DR5 E;  1J26 A;  1MU5 A;  4WUB A;  1Z0V A;  2EFG A;  4ZVI A;  1H74 A;  3VYY A;  4WFT A;  1H7S A;  1HNX E;  3ZZU A;  1ZXM A;  4B3R I;  1XNR I;  1U2R A;  4DR6 E;  1Z0B A;  1WHN A;  1ZXN A;  4DPY A;  4LF5 I;  2KHX A;  3OTO I;  3ZKD A;  2A2C A;  1UHZ A;  4OOG C;  2R42 A;  2B3T B;  4K0K I;  4DV6 E;  1YYK A;  3J7A G;  3ZZT A;  2UUA I;  2B7V A;  4LF9 E;  1VIS A;  4B3M E;  4DR4 I;  4DV4 I;  2HK2 A;  3T1H E;  4DR1 I;  3ZZ0 A;  1A6F A;  4B3T I;  1WUU A;  4LFA I;  4GKK I;  4M30 A;  3JAM C;  3ADG A;  3V5R A;  2EZ6 A;  1YZ9 A;  1XNR E;  1XMQ I;  2RS7 A;  3HUL A;  2V2Z A;  1J5E I;  3HTX A;  4LF6 I;  3J81 C;  1ZBT A;  4KHP E;  2ZBK B;  2UXB I;  1Z0W A;  2B7T A;  1HR0 E;  1PIE A;  4JI8 E;  1ZM4 A;  5FLX Q;  3V2U C;  2DIX A;  2VQE I;  4DR4 E;  4WYQ B;  4JI6 I;  3ADI A;  4DV5 I;  4JV5 E;  4I3H A;  4JI0 I;  4USK A;  2UXD E;  1K47 A;  1H73 A;  2HKJ A;  2OI2 A;  2UUC I;  4JI8 I;  1RRE A;  4JI1 I;  1FJG I;  1Z5A A;  1HNZ I;  4NXM I;  5LMN I;  2L3J A;  5LMU I;  4X8W A;  2JY9 A;  4AQY I;  4UTG A;  1YYW A;  4DR5 I;  1N36 E;  4R1F A;  4DXL A;  4JI1 E;  4JI4 I;  1J5E E;  4LF6 E;  2VQF E;  4XTJ A;  2VF3 A;  1N0U A;  4HXZ A;  2Q2E B;  2LUQ A;  2BM1 A;  2HFU A;  3K17 A;  1S16 A;  2LBS B;  3QT5 A;  1N33 E;  4JI6 E;  4MYT A;  4DR1 E;  3T1H I;  3F0N A;  2E1R A;  2HKE A;  1Z5B A;  4JI0 E;  4FN5 A;  4YY3 E;  1NHI A;  5LL6 R;  4GKJ E;  4DV3 E;  4DPX A;  4JI7 E;  1IBL E;  5A2Q Q;  1MG7 A;  3LTO A;  1WHQ A;  4KQV A;  1HNZ E;  4NXM E;  2F4V E;  4DKK A;  1IBM I;  1NHH A;  1D6T A;  1ZM9 A;  2N3G A;  4B3R E;  1O0W A;  1HNX I;  4HAC B;  1FWK A;  5IT9 C;  4LFB I;  3PYG A;  4LF5 E;  3LPS A;  1N36 I;  4M1K A;  4DV4 E;  4YHH I;  2N3H A;  1XHK A;  2NA2 A;  1YYO A;  2V34 A;  4YY3 I;  1DAR A;  4DR7 I;  1KIJ A;  4DU7 A;  1KKH A;  1PKP A;  3LLH A;  4DU8 A;  4B3T E;  4DR2 I;  2HHH E;  4WUC A;  3ADL A;  3WU6 A;  4LFC I;  2UUC E;  1B62 A;  4YHH E;  3WU3 A;  2DMY A;  4DR3 E;  1KVK A;  3H4L A;  5FLX C;  2X7I A;  4LF8 E;  4LF9 I;  5IWA E;  3P1X A;  1X49 A;  1EA6 A;  1UEK A;  4DR6 I;  2L2M A;  1KTV A;  1RR9 A;  1N33 I;  2IHR 1;  2AJ4 A;  1T4L B;  4DV1 E;  4USM A;  5GMD A;  1T4N A;  2L3C A;  4X65 E;  3T1Y E;  4UT4 A;  2LRS A;  4DV0 I;  2UUB E;  4FWG A;  1H72 C;  4EMD A;  4DUY I;  1OJ4 A;  1DI2 A;  3QT7 A;  4JI2 E;  3C4B A;  1ELO A;  2NUE A;  4DV7 I;  1FKA E;  4B3M I;  1QZR A;  5GME A;  1HR0 I;  4RPF A;  4DPT A;  5L3J A;  2JVA A;  3PYE A;  4LF4 E;  2UUB I;  4DV5 E;  3J80 C;  2DEJ A;  2UXD I;  4JG4 A;  2DB2 A;  4ED4 A;  3WU4 A;  4KHP I;  1XMQ E;  2CPN A;  4B3S I;  3J7Y p;  2ZIT A;  3M6A A;  4LF4 I;  1FI4 A;  4JV5 I;  1IBM E;  4LF7 I;  4P7A A;  1RC7 A;  4JI3 I;  1IBK I;  5LMU E;  1Z5C A;  4URL A;  4X62 I;  1XNQ I;  3GON A;  1N0V C;  1EKZ A;  1N34 I;  4OX9 I;  4DV0 E;  1GQE A;  4HAC A;  3ZM7 A;  1NHJ A;  4DUY E;  4DV6 I;  2LJP A;  4NXN E;  4FW9 A;  2HHH I;  2L2N A;  5BR8 E;  5A2Q C;  2WW4 A;  4LFC E;  4Z7Y A;  3B78 A;  3ADJ A;  2ZM6 E;  2NUG A;  3K1J A;  4WUD A;  3LNU A;  1IBK E;  4JI5 E;  4LF7 E;  1XMO E;  1X47 A;  3QT8 A;  4HY1 A;  2X36 A;  3B8H A;  3J80 Q;  4JYA I;  2UUA E;  3ZKB A;  1IBL I;  4JI7 I;  1XNQ E;  4DV3 I;  4FWD A;  2UXB E;  2ZM6 I;  1STU A;  3JAM Q;  2UXC E;  3PYF A;  4X64 I;  4DPU A;  2J7K A;  1Z0E A;  4LFA E;  1N32 E;  1NZ0 A;  1HNW E;  4LFB E;  3CWV A;  2RSM A;  2V2V A;  1Z59 A;  4PU9 A;  4X66 I;  4OX9 E;  1N34 E;  3D4J A;  1BKN A;  4PRV A;  1FWL A;  1I94 E;  4JI2 I;  4DV1 I;  4NXN I;  5IWA I;  2V2Q A;  2BV3 A;  2V8P A;  1S4E A;  3OTO E;  4DUZ I;  2XEX A;  2LTS A;  2GS8 A;  5LMN E;  2E5L E;  1XMO I;  4JI3 E;  1HNW I;  2NPF A;  2LUP B;  3Q1Q A;  2L2K B;  4B3S E;  3J81 Q;  4DR3 I;  4M2Z A;  4FWH A;  2E5L I;  3WU5 A;  2LTR A;  2RTX A;  1QU6 A;  2RS6 A;  2UU9 I;  1B63 A;  2YT4 A;  1FNM A;  4AQY E;  5IT9 Q;  4DV2 I;  2BM0 A;  2L33 A;  2DEI A; 
#chains in the Genus database with same CATH topology
 4R2R A;  4HEI A;  2C39 B;  2HFS A;  2EOF A;  2YRK A;  5A69 A;  5KL3 A;  2C38 B;  4F6N A;  3LML A;  2DSY A;  3HXL A;  2CTD A;  3VK6 A;  1YUJ A;  4JI3 I;  4L8N A;  1PVG A;  3U1K A;  3RMP A;  2EPO A;  4RH8 A;  5KL6 A;  4WXC A;  1T4O A;  2VQF I;  2EOO A;  4GKK E;  4IZJ B;  2GO3 A;  4JYA I;  2HK3 A;  2MDR A;  2EPA A;  3VYX A;  2EM2 A;  2NN6 B;  4L5N C;  2VQE E;  4Z7C A;  4X65 I;  2NN6 A;  2BR2 B;  3K6Q A;  3C4T A;  3HJC A;  4DUZ E;  2JT2 A;  2EP3 A;  4IZJ A;  2F4V I;  2LMZ A;  2EL5 A;  4IFD F;  1Z0G A;  3EPK A;  4DPW A;  4X64 E;  2DEI A;  4P52 A;  2C37 B;  4JYA E;  1DQ3 A;  2PNL A;  2EMX A;  1EI1 A;  4LF8 I;  2UU9 E;  4FW4 A;  2PO2 B;  1RQ0 A;  4DV2 E;  2JEB B;  2NN6 E;  3J7A M;  4N3O A;  3KRN A;  4WX9 A;  2NUF A;  1EH6 A;  2VE7 C;  2PNZ A;  1GTK A;  1A1G A;  1X48 A;  1ZM2 A;  3QT6 A;  3PS1 A;  2DLK A;  1FJG E;  2R3V A;  1FJG I;  4NZV A;  4BS9 A;  4JI5 I;  2FGG A;  3GCM A;  2JP9 A;  4DR2 E;  1N32 I;  5AE1 A;  3B82 A;  4AID A;  2GHF A;  5BR8 I;  1PJQ A;  4BHC A;  5C0X B;  4ZYG A;  1MX0 A;  1A1K A;  1RHY A;  2IOP A;  2EOE A;  2LJU A;  5CFF E;  4DV7 E;  4X66 E;  3T1Y I;  4ZYD A;  5DNY A;  4MYU A;  2UXC I;  2EE8 A;  3PYD A;  4WXD A;  4HYM A;  4JI4 E;  5DRR A;  4FK5 C;  1I94 I;  1X6E A;  5K36 A;  2R76 A;  2WCC 3;  3P06 A;  1UIL A;  1Z0C A;  2ODR D;  4LCH A;  2CZ9 A;  2A2D A;  4K0K E;  2EPP A;  1H7U A;  2LJH A;  4KWY A;  1Z0T A;  2V85 A;  2YTJ A;  4BCA A;  1PJT A;  1ZM3 A;  4X62 E;  2O1U A;  2YRH A;  4GKJ I;  4OO1 B;  4DR7 E;  2EOR A;  4PRX A;  4DR5 E;  1SFE A;  2NN6 D;  1J26 A;  3BID A;  1MU5 A;  2RSI A;  4WUB A;  2E1M A;  1Z0V A;  2WBS A;  2EFG A;  4IZJ D;  4ZVI A;  1H74 A;  3VYY A;  4WFT A;  1H7S A;  2EPL X;  1HNX E;  2I9I A;  4F6M A;  1ZXM A;  3ZZU A;  3P3C A;  3IWC A;  3PS3 A;  4B3R I;  1XNR I;  1U2R A;  4NHR A;  3FIG A;  4DR6 E;  1Z0B A;  2GPI A;  1WHN A;  2NN6 C;  3PS2 A;  1ZXN A;  4MLQ A;  2EMG A;  4DPY A;  2KHX A;  1A1I A;  1USU A;  4LF5 I;  2EPZ A;  4MLV A;  3OTO I;  3ZKD A;  2L92 A;  2G7H A;  4Q28 A;  4WPY A;  1OYP A;  1XXE A;  2CGE A;  5A6K A;  2A2C A;  1UHZ A;  2C37 A;  4OOG C;  2EOJ A;  2B3T B;  2MDG A;  2IES A;  4DV6 E;  4BMJ A;  1YYK A;  2EPX A;  2R42 A;  4K0K I;  3ZZT A;  2DRP A;  2EN1 A;  2YTF A;  4J3D A;  2UUA I;  2EMZ A;  2B7V A;  4Z7Y A;  4LF9 E;  2JEA A;  2D9H A;  2EJ4 A;  2F1D A;  2LVH A;  4DV6 I;  2V83 A;  1VIS A;  5K36 E;  4O4K A;  4B3M E;  4DR4 I;  3AV0 A;  5A6B A;  4MQY A;  4DV4 I;  2HK2 A;  3T1H E;  4DR1 I;  3ZZ0 A;  1A6F A;  4O43 A;  2MKN A;  3IWD A;  5EKW A;  4B3T I;  1WUU A;  2JOX A;  2EL4 A;  4LFA I;  4GKK I;  2YTQ A;  3CDJ A;  4M30 A;  3JAM C;  2V87 A;  3ADG A;  3V5R A;  2BA1 D;  5C0X C;  2EZ6 A;  1YZ9 A;  4F54 A;  4WSP A;  1XNR E;  1XMQ I;  3P76 A;  2RS7 A;  3HUL A;  2V2Z A;  3PRY A;  1JK2 A;  4O24 A;  1J5E I;  3HTX A;  2ENH A;  1UBD C;  4IS9 A;  2Z5C A;  4R2A A;  2LV2 A;  4AIM A;  4LF6 I;  1VI7 A;  1DGC A;  3CDI A;  4ZYH A;  2JYA A;  3J81 C;  1ZBT A;  4KHP E;  2ZBK B;  4OO1 C;  2B9D A;  2UXB I;  1Z0W A;  2B7T A;  1HR0 E;  1PDA A;  4JI8 E;  1PIE A;  1ZM4 A;  3V2U C;  5FLX Q;  2DIX A;  2EM9 A;  2VQE I;  4DR4 E;  2Z5B B;  4WYQ B;  1A1H A;  4JI6 I;  2ELY A;  4GEQ B;  1TF6 A;  1MGT A;  3ADI A;  4DV5 I;  2EPK X;  2M4I A;  4JV5 E;  2CT1 A;  4R03 A;  4I3H A;  2NAB A;  1Y4S A;  4USK A;  4JI0 I;  2UXD E;  1K47 A;  2K4V A;  2BBG A;  5T6J A;  3VHT B;  2EOX A;  1H73 A;  2HKJ A;  2OI2 A;  2UUC I;  4JI8 I;  4IFD A;  1RRE A;  1KJK A;  2EPN A;  3M7N D;  2EOQ A;  3K85 A;  2F8B A;  2FTX B;  5DRQ A;  1Z5A A;  4JI1 I;  1HNZ I;  2WP8 B;  5LMN I;  1A1J A;  1Y4U A;  2NN6 F;  2VRD A;  2PRT A;  4NXM I;  1KYQ A;  2YTN A;  2YSO A;  5DRO A;  2L3J A;  2V89 A;  2EPM X;  5JEA D;  2YRM A;  5LMU I;  4BBY A;  4IS1 C;  1BB8 A;  4X8W A;  2JY9 A;  4AQY I;  4UTG A;  2LCE A;  2EOS A;  2EMI A;  2EQ1 A;  1ZU1 A;  1YYW A;  1YSA C;  5K36 D;  4DR5 I;  1X6F A;  1N36 E;  4R1F A;  4DXL A;  4JI1 E;  4JI4 I;  1J5E E;  4R8O A;  4KZS A;  1Z1B A;  1OYS A;  4LF6 E;  2VQF E;  4XTJ A;  1GZ6 A;  3M7N G;  2VF3 A;  1B69 A;  1N0U A;  2YTP A;  4BHB A;  2EN8 A;  4HXZ A;  2Q2E B;  2LUQ A;  2BM1 A;  2HFU A;  4AM3 A;  3K17 A;  1S16 A;  4OO1 D;  2LBS B;  3QT5 A;  1N33 E;  4JI6 E;  4MYT A;  1X5W A;  1Y5Y A;  4DR1 E;  3T1H I;  2EMA A;  4FW6 A;  3F0N A;  5TSE A;  2E1R A;  2HKE A;  2JE6 A;  1R6M A;  4P78 A;  1Z5B A;  4JI0 E;  2JWO A;  3NZK A;  3GLL A;  2EN6 A;  5AAS A;  4FN5 A;  2M9A A;  4YY3 E;  1NHI A;  3KZY A;  5LL6 R;  5JEA B;  2JXP A;  4GKJ E;  4DV3 E;  4DPX A;  4RHB B;  2VES A;  4JI7 E;  1IBL E;  2Z5B A;  5KL5 A;  2BA0 G;  5A2Q Q;  1MG7 A;  2WBU A;  1P42 A;  2EOZ A;  1WXR A;  3DD6 A;  1WHQ A;  3F6H A;  2I13 A;  1R6L A;  3LTO A;  2Q8U A;  4KQV A;  1HNZ E;  4NXM E;  2F4V E;  5C0X A;  4DKK A;  1X6H A;  3EPL A;  4QNK A;  1IBM I;  4IFD D;  1RMD A;  1BBO A;  1NHH A;  2EN7 A;  1D6T A;  1G2D C;  3C6M A;  5K36 C;  1ZM9 A;  1USV A;  2N3G A;  4B3R E;  1O0W A;  1BBG A;  2WBT A;  4HAC B;  1HNX I;  2O3Z A;  1IQS A;  4Q35 B;  1FWK A;  5IT9 C;  3H1C A;  4LFB I;  3PYG A;  3KZZ A;  4LF5 E;  1YH8 A;  5AC4 A;  2IOQ A;  3Q6M A;  1UN6 B;  1F2I G;  3LPS A;  1N36 I;  4M1K A;  4R2D A;  3BF2 A;  2PO2 A;  4DV4 E;  4YHH I;  2V88 A;  4IJD A;  2PNM A;  2YU8 A;  2EN3 A;  5ADZ A;  3HPZ A;  2N3H A;  2EOI A;  2NA2 A;  1YYO A;  1XHK A;  2V34 A;  2IER A;  1DAR A;  4R2Q A;  2EQ3 A;  4BC7 A;  4QNJ A;  4YY3 I;  4DR7 I;  2L8T A;  3KWR A;  5LLQ A;  1KIJ A;  4DU7 A;  1P47 A;  1UDS A;  5C0X F;  2EOY A;  1YHC A;  4MU4 A;  1KKH A;  1JK1 A;  1PKP A;  1X3C A;  2JEA B;  4M0V A;  3LLH A;  4DU8 A;  4B3T E;  4DR2 I;  4R2P A;  2HHH E;  2YTG A;  2AE8 A;  4P7D A;  1MEY C;  4WUC A;  3ADL A;  2ENC A;  3DJW A;  5IV8 B;  4LFC I;  3WU6 A;  5A6A A;  2UUC E;  2C39 A;  4FW3 A;  1B62 A;  4YHH E;  4F2J C;  4NBQ A;  2DMY A;  4DR3 E;  2MKD A;  1KVK A;  2YPN A;  3WU3 A;  4BA1 B;  2YTO A;  3H4L A;  2MC5 A;  4LPF A;  1Y60 A;  2EM8 A;  5FLX C;  4ZYE A;  1EH7 A;  4TUI A;  2PO0 B;  1SR9 A;  2X7I A;  3U1Y A;  4LF8 E;  5AC5 A;  2HGH A;  5JEA C;  2EM6 A;  5IWA E;  4LF9 I;  1N3G A;  3P1X A;  1X49 A;  2M7Q A;  1EA6 A;  1UEK A;  4ISA A;  4DR6 I;  2EWL A;  2L2M A;  3DF6 A;  3AUZ A;  4LCF A;  3BBG A;  3MHH C;  1KTV A;  2BA1 G;  2HC5 A;  4MDT A;  1RR9 A;  2PO1 B;  1N33 I;  5JEA A;  2WNR B;  3HKM A;  2IHR 1;  2AJ4 A;  1T4L B;  2JE6 B;  3OML A;  4IFD E;  4DV1 E;  2WNR A;  5DNL A;  4USM A;  5GMD A;  1T4N A;  1ZR9 A;  2L3C A;  2DLQ A;  4MU1 A;  2E72 A;  2R1F A;  4X65 E;  3T1Y E;  4FW5 A;  4UT4 A;  2O1V A;  2EMY A;  2LRS A;  2EPU A;  4TUG A;  2Z5E A;  4DV0 I;  2UUB E;  4FWG A;  1H72 C;  4EMD A;  4DUY I;  1OJ4 A;  1DI2 A;  2J7J A;  4BA2 A;  2YWQ A;  2PO0 A;  3QT7 A;  2EPC A;  5KL7 A;  4JI2 E;  4M9V C;  3Q6N A;  2K7I A;  1ZAA C;  5IXM B;  3C4B A;  3EPJ A;  3L7Z A;  1NCS A;  1ELO A;  2NUE A;  2JPA A;  4DV7 I;  1AAY A;  2EMB A;  1FKA E;  4WSG A;  4MU3 A;  2EN4 A;  1QZR A;  5GME A;  1HR0 I;  4B3M I;  4RPF A;  4DPT A;  2JOB A;  5L3J A;  2JVA A;  2JEB A;  3PYE A;  2EL6 A;  2EM7 A;  4LF4 E;  2UUB I;  4DV5 E;  3J80 C;  3THO B;  2V86 A;  2DEJ A;  4N4R B;  4OZE A;  3TQM A;  5DRP A;  2YSP A;  2EMH A;  2UXD I;  2WP8 A;  4JG4 A;  3F6G A;  1LLM C;  2DB2 A;  4ED4 A;  1YUI A;  1A1L A;  3WU4 A;  3JTZ A;  5AE3 A;  3ZOQ B;  4KHP I;  4DMI A;  1XMQ E;  2BR2 A;  3HPS A;  2CPN A;  3MHS C;  4U3D A;  4B3S I;  1UDN A;  3J7Y p;  4FW7 A;  2GQ0 A;  2ZIT A;  3M6A A;  4LF4 I;  4F9C B;  1FI4 A;  1OYR A;  2RPC A;  4JV5 I;  1IBM E;  5AE2 A;  4LF7 I;  3EPH A;  4P7A A;  2LO3 A;  3HQ1 A;  1RC7 A;  2ADR A;  5LMU E;  5ELW A;  1IBK I;  1UDQ A;  4I8O A;  1E3P A;  2EMW A;  1Z5C A;  4U3B A;  4URL A;  4X62 I;  1IMU A;  1XNQ I;  2EN2 A;  3QG5 C;  3GON A;  2JR1 A;  2C38 A;  1N0V C;  5C0X E;  1EKZ A;  1N34 I;  4X9J A;  4OX9 I;  2N8X A;  3THN A;  2M1S A;  1A1F A;  4DV0 E;  1GQE A;  2V8Q B;  4HAC A;  3ZM7 A;  1YPN A;  1NHJ A;  4DUY E;  2YU5 A;  2EMF A;  3UK3 C;  4NXN E;  2LJP A;  4FW9 A;  3H09 A;  1AH5 A;  2EPR A;  1YFH A;  2YTE A;  2EMC A;  2O1W A;  2L2N A;  2Z5C B;  2HHH I;  2A25 A;  2EM5 A;  3EQ1 A;  5BR8 E;  5A2Q C;  5DNX A;  2WW4 A;  2EM3 A;  5KL4 A;  2KON A;  4LFC E;  2CSH A;  3ADJ A;  2YZT A;  2ENA A;  3B78 A;  2ZM6 E;  1T39 A;  4OO1 E;  4R2S A;  1T38 A;  2NUG A;  1TN9 A;  5K36 F;  2HJJ A;  3K1J A;  3LNU A;  4WUD A;  3M85 G;  1IBK E;  4F9B B;  4JI5 E;  4LF7 E;  3IWB A;  1XMO E;  1X47 A;  3QT8 A;  2RQL A;  2VF1 A;  4HTG A;  4GZN C;  2X36 A;  3B8H A;  1ZBQ A;  2UUA E;  2O1T A;  4HY1 A;  3ZKB A;  3J80 Q;  1IBL I;  2ODR C;  1XNQ E;  4JI7 I;  4DV3 I;  4FWD A;  2UXB E;  2EQ0 A;  2ZM6 I;  1STU A;  3JAM Q;  2DMI A;  2MC6 A;  2UXC E;  2BB8 A;  4IZK B;  3PYF A;  5JEA E;  4X64 I;  2EOH A;  3L00 A;  4DPU A;  2J7K A;  1Z0E A;  4LFA E;  2FV4 B;  1N32 E;  4OKG A;  2EML A;  1NZ0 A;  1HNW E;  4LFB E;  2CG9 A;  4F9A B;  3CWV A;  2RSM A;  2DGC A;  2L6M A;  1EH8 A;  1Z59 A;  2V2V A;  4PU9 A;  4R2E A;  4X66 I;  3MSW A;  4OX9 E;  2BA0 D;  2LE2 A;  4R2C A;  1N34 E;  4LCG A;  3D4J A;  3L7Z B;  1BKN A;  3JU0 A;  2H36 X;  4PRV A;  3P3E A;  1FWL A;  1L4S A;  1I94 E;  4JI2 I;  3GME A;  4DV1 I;  3M99 B;  4NXN I;  4BA2 B;  1E3H A;  5IWA I;  3UHM A;  2V2Q A;  2BV3 A;  4IZK A;  2V8P A;  2CVE A;  3P3G A;  1Y6Z A;  4IFD B;  1S4E A;  3OTO E;  5F3W A;  4DUZ I;  4OO1 A;  3M85 D;  3BGH A;  5A6J A;  2XEX A;  1G2F C;  2LTS A;  2GS8 A;  5LMN E;  1PJS A;  1HK7 A;  2EM0 A;  2E5L E;  1XMO I;  2KOU A;  4JI3 E;  5JEA F;  5K36 B;  4J8Z A;  1UDO A;  1HNW I;  3B4T A;  2NPF A;  2LUP B;  3Q1Q A;  2PO1 A;  1NEI A;  2L2K B;  4B3S E;  4LOM A;  2GO4 A;  3J81 Q;  5FWK A;  4DR3 I;  2GLI A;  5C0X D;  3ECR A;  4M2Z A;  4FWH A;  1TF3 A;  4BC9 A;  2LT7 A;  4O5G A;  2J65 A;  1WRJ A;  2YTI A;  2EMK A;  4LTY A;  1IQO A;  4MU0 A;  5A6B D;  2E5L I;  4LU9 A;  3WU5 A;  2ELZ A;  2LTR A;  1QNT A;  2EOM A;  2RTX A;  2WZO A;  5EL9 A;  1QU6 A;  2RS6 A;  2EM4 A;  1B63 A;  2UU9 I;  2YT4 A;  5KL2 A;  3C6K A;  4GQU A;  1FNM A;  4BA1 A;  4IFD C;  4AQY E;  5IT9 Q;  1WJP A;  2BM0 A;  2L33 A;  2PNZ B;  4DV2 I;  2YTD A;  4OO1 F;  3J7A G; 
#chains in the Genus database with same CATH homology
 2HFS A;  3LML A;  2DSY A;  3HXL A;  3VK6 A;  4L8N A;  1PVG A;  3RMP A;  2VQF I;  1T4O A;  4GKK E;  4IZJ B;  2HK3 A;  2MDR A;  3VYX A;  4L5N C;  2VQE E;  4Z7C A;  4X65 I;  3K6Q A;  3C4T A;  3HJC A;  4DUZ E;  4IZJ A;  2F4V I;  2LMZ A;  1Z0G A;  4DPW A;  4X64 E;  2DEI A;  4P52 A;  4JYA E;  1DQ3 A;  2PNL A;  1EI1 A;  4LF8 I;  2UU9 E;  1RQ0 A;  4DV2 E;  3J7A M;  4N3O A;  2NUF A;  2VE7 C;  1X48 A;  1ZM2 A;  3QT6 A;  2R3V A;  1FJG E;  4BS9 A;  4JI5 I;  2FGG A;  4DR2 E;  1N32 I;  5AE1 A;  3B82 A;  5BR8 I;  1MX0 A;  2IOP A;  5CFF E;  4DV7 E;  4X66 E;  3T1Y I;  5DNY A;  4MYU A;  2UXC I;  3PYD A;  4HYM A;  4JI4 E;  1I94 I;  3P06 A;  1UIL A;  1Z0C A;  2ODR D;  2CZ9 A;  2A2D A;  4K0K E;  1H7U A;  2LJH A;  1Z0T A;  1ZM3 A;  2V85 A;  4BCA A;  4X62 E;  2O1U A;  4GKJ I;  4DR7 E;  4PRX A;  4DR5 E;  1J26 A;  1MU5 A;  4WUB A;  2E1M A;  1Z0V A;  2EFG A;  4IZJ D;  4ZVI A;  1H74 A;  3VYY A;  4WFT A;  1H7S A;  1HNX E;  3ZZU A;  1ZXM A;  4B3R I;  3IWC A;  1XNR I;  1U2R A;  3FIG A;  4DR6 E;  1Z0B A;  1WHN A;  1ZXN A;  4DPY A;  4LF5 I;  2KHX A;  1USU A;  3OTO I;  3ZKD A;  2L92 A;  2G7H A;  4Q28 A;  4WPY A;  2CGE A;  2A2C A;  1UHZ A;  4OOG C;  2R42 A;  2B3T B;  4K0K I;  4DV6 E;  4BMJ A;  1YYK A;  3ZZT A;  2UUA I;  2B7V A;  4LF9 E;  2V83 A;  1VIS A;  4B3M E;  4DR4 I;  3AV0 A;  4DV4 I;  2HK2 A;  3T1H E;  4DR1 I;  3ZZ0 A;  1A6F A;  3IWD A;  4B3T I;  1WUU A;  2JOX A;  4LFA I;  4GKK I;  4M30 A;  3JAM C;  2V87 A;  3ADG A;  3V5R A;  2EZ6 A;  1YZ9 A;  4F54 A;  4WSP A;  1XNR E;  1XMQ I;  2RS7 A;  3HUL A;  2V2Z A;  3PRY A;  1J5E I;  3HTX A;  2Z5C A;  4LF6 I;  3J81 C;  1ZBT A;  4KHP E;  2ZBK B;  2B9D A;  2UXB I;  1Z0W A;  2B7T A;  1HR0 E;  1PIE A;  4JI8 E;  1ZM4 A;  5FLX Q;  3V2U C;  2DIX A;  2VQE I;  4DR4 E;  2Z5B B;  4WYQ B;  4JI6 I;  4GEQ B;  3ADI A;  4DV5 I;  2M4I A;  4JV5 E;  4R03 A;  4I3H A;  1Y4S A;  4USK A;  4JI0 I;  2UXD E;  1K47 A;  2K4V A;  5T6J A;  1H73 A;  2HKJ A;  2OI2 A;  2UUC I;  4JI8 I;  1RRE A;  3K85 A;  2F8B A;  2FTX B;  4JI1 I;  1Z5A A;  1HNZ I;  4NXM I;  1FJG I;  5LMN I;  1Y4U A;  2L3J A;  2V89 A;  5LMU I;  4BBY A;  4X8W A;  2JY9 A;  4AQY I;  4UTG A;  1YYW A;  4DR5 I;  1N36 E;  4R1F A;  4DXL A;  4JI1 E;  4JI4 I;  1J5E E;  4R8O A;  4KZS A;  4LF6 E;  2VQF E;  4XTJ A;  1GZ6 A;  2VF3 A;  1N0U A;  4HXZ A;  2Q2E B;  2LUQ A;  2BM1 A;  2HFU A;  3K17 A;  1S16 A;  2LBS B;  3QT5 A;  1N33 E;  4JI6 E;  4MYT A;  4DR1 E;  3T1H I;  3F0N A;  2E1R A;  2HKE A;  4P78 A;  1Z5B A;  4JI0 E;  2JWO A;  5AAS A;  4FN5 A;  4YY3 E;  1NHI A;  5LL6 R;  4GKJ E;  4DV3 E;  4DPX A;  4JI7 E;  1IBL E;  2Z5B A;  5A2Q Q;  1MG7 A;  1WXR A;  3LTO A;  1WHQ A;  3F6H A;  4KQV A;  1HNZ E;  4NXM E;  2F4V E;  4DKK A;  1IBM I;  1NHH A;  1D6T A;  1ZM9 A;  1USV A;  2N3G A;  4B3R E;  1O0W A;  1HNX I;  4HAC B;  1FWK A;  5IT9 C;  4LFB I;  3PYG A;  4LF5 E;  2IOQ A;  3Q6M A;  3LPS A;  1N36 I;  4M1K A;  4DV4 E;  4YHH I;  2V88 A;  2PNM A;  5ADZ A;  3HPZ A;  2N3H A;  1XHK A;  2NA2 A;  1YYO A;  2V34 A;  4YY3 I;  1DAR A;  4BC7 A;  4DR7 I;  2L8T A;  3KWR A;  1KIJ A;  4DU7 A;  1KKH A;  1PKP A;  4M0V A;  3LLH A;  4DU8 A;  4B3T E;  4DR2 I;  2HHH E;  4P7D A;  4WUC A;  3ADL A;  3DJW A;  3WU6 A;  4LFC I;  2UUC E;  1B62 A;  4YHH E;  2DMY A;  4DR3 E;  1KVK A;  3WU3 A;  3H4L A;  2MC5 A;  5FLX C;  4TUI A;  1SR9 A;  2X7I A;  4LF8 E;  4LF9 I;  5IWA E;  3P1X A;  1X49 A;  2M7Q A;  1EA6 A;  1UEK A;  4DR6 I;  2EWL A;  2L2M A;  3DF6 A;  3AUZ A;  1KTV A;  1RR9 A;  1N33 I;  2IHR 1;  2AJ4 A;  1T4L B;  3OML A;  4DV1 E;  4USM A;  5GMD A;  1T4N A;  2L3C A;  4X65 E;  3T1Y E;  4UT4 A;  2O1V A;  2LRS A;  4TUG A;  2Z5E A;  4DV0 I;  2UUB E;  4FWG A;  1H72 C;  4EMD A;  4DUY I;  1OJ4 A;  1DI2 A;  3QT7 A;  4JI2 E;  3Q6N A;  3C4B A;  1ELO A;  2NUE A;  4DV7 I;  1FKA E;  4B3M I;  1QZR A;  5GME A;  1HR0 I;  4RPF A;  4DPT A;  2JOB A;  5L3J A;  2JVA A;  3PYE A;  4LF4 E;  2UUB I;  4DV5 E;  3J80 C;  2DEJ A;  2V86 A;  2UXD I;  4JG4 A;  3F6G A;  2DB2 A;  4ED4 A;  3WU4 A;  3JTZ A;  5AE3 A;  3ZOQ B;  4KHP I;  4DMI A;  1XMQ E;  3HPS A;  2CPN A;  4B3S I;  3J7Y p;  2GQ0 A;  2ZIT A;  3M6A A;  4LF4 I;  4F9C B;  1FI4 A;  4JV5 I;  1IBM E;  5AE2 A;  4LF7 I;  4P7A A;  1RC7 A;  3HQ1 A;  1IBK I;  5LMU E;  4JI3 I;  4I8O A;  1Z5C A;  4URL A;  4X62 I;  1XNQ I;  3GON A;  2JR1 A;  1N0V C;  1EKZ A;  1N34 I;  4OX9 I;  2M1S A;  4DV0 E;  1GQE A;  2V8Q B;  4HAC A;  3ZM7 A;  1NHJ A;  4DUY E;  4DV6 I;  2LJP A;  4NXN E;  4FW9 A;  3H09 A;  2O1W A;  2Z5C B;  2HHH I;  2L2N A;  5BR8 E;  5A2Q C;  2WW4 A;  4LFC E;  4Z7Y A;  2KON A;  3B78 A;  3ADJ A;  2YZT A;  2ZM6 E;  2NUG A;  3K1J A;  4WUD A;  3LNU A;  1IBK E;  4F9B B;  4JI5 E;  4LF7 E;  3IWB A;  1XMO E;  1X47 A;  3QT8 A;  2VF1 A;  4HY1 A;  2X36 A;  3B8H A;  3J80 Q;  1ZBQ A;  2UUA E;  2O1T A;  4JYA I;  3ZKB A;  1IBL I;  4JI7 I;  2ODR C;  1XNQ E;  4DV3 I;  4FWD A;  2UXB E;  2ZM6 I;  1STU A;  3JAM Q;  2MC6 A;  2UXC E;  4IZK B;  3PYF A;  4X64 I;  4DPU A;  2J7K A;  1Z0E A;  4LFA E;  2FV4 B;  1N32 E;  1NZ0 A;  1HNW E;  4LFB E;  2CG9 A;  4F9A B;  3CWV A;  2RSM A;  2V2V A;  2L6M A;  1Z59 A;  4PU9 A;  4X66 I;  3MSW A;  4OX9 E;  2LE2 A;  1N34 E;  3D4J A;  1BKN A;  3JU0 A;  2H36 X;  4PRV A;  1FWL A;  1I94 E;  4JI2 I;  4DV1 I;  4NXN I;  5IWA I;  2V2Q A;  2BV3 A;  4IZK A;  2V8P A;  1Y6Z A;  1S4E A;  3OTO E;  5F3W A;  4DUZ I;  2XEX A;  2LTS A;  2GS8 A;  5LMN E;  1HK7 A;  2E5L E;  1XMO I;  2KOU A;  4JI3 E;  4J8Z A;  1HNW I;  2NPF A;  2LUP B;  3Q1Q A;  2L2K B;  4B3S E;  3J81 Q;  5FWK A;  4DR3 I;  4M2Z A;  4FWH A;  4BC9 A;  4LTY A;  2E5L I;  4LU9 A;  3WU5 A;  2LTR A;  2WZO A;  2RTX A;  1QU6 A;  2RS6 A;  2UU9 I;  1B63 A;  2YT4 A;  1FNM A;  4AQY E;  5IT9 Q;  4DV2 I;  2BM0 A;  2L33 A;  3J7A G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...