1I94E

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
PETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1i94E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94E02
3QT6A 1H72C 1YZ9A 2ZM6I 2EZ6A 1NHJA 4LF4I 4FWGA 4LF7I 3QT5A 1NHIA 4DKKA 2UU9I 2UXCE 1PIEA 2UXDE 4XTJA 4DUZI 3T1HI 1WHQA 4OX9E 5BR8E 1PVGA 4DV6E 4B3SE 4DR7I 1YYKA 5LMUI 4JI5I 4LFBE 1ELOA 4FWHA 4DR7E 3K1JA 4B3ME 3ADGA 4JI1E 4X66I 2X36A 4KHPI 4P52A 1FJGE 3WU6A 1XMOI 2RS6A 1XMQI 3QT7A 1Z0TA 4YY3I 1N34I 1J5EE 1QU6A 4X62E 4X65I 1IBMI 5IWAI 4JI6I 4B3MI 4WUBA 4LFAE 4B3SI 1WHNA 4DR3E 4P7AA 1UILA 2HK3A 3PYEA 4NXMI 4KQVA 1Z59A 1H7SA 4JG4A 3WU5A 2L3CA 1QZRA 4DV1E 4PRXA 3J81C 4DPTA 3C4BA 1J26A 1K47A 1J5EI 5BR8I 5L3JA 1HNWE 4DV0E 2UXBI 1N32I 2E5LI 1HNZE 2UUCE 2JVAA 1Z0EA 4KHPE 4WUCA 5GMEA 4DV1I 4DR4E 4ED4A 2VQEE 1MU5A 4M2ZA 4LFCI 3F0NA 4X8WA 1MX0A 2CZ9A 3B82A 1IBKE 4DPXA 2LUPB 2L33A 2BV3A 4JI8E 5FLXC 2LTRA 1ZM3A 3LNUA 2LRSA 1XNRE 1KIJA 2AJ4A 3LLHA 2DEIA 2HFSA 3ADIA 2Q2EB 3M6AA 1XMOE 4DV3I 3ADLA 4EMDA 3OTOE 4GKJE 1I94E 3HTXA 1Z0VA 2RS7A 5LMUE 4PU9A 3J7AG 3WU4A 4JI2I 4LF8I 1Z5CA 2V34A 3J81Q 4JI8I 1O0WA 4X64I 3J7Yp 1X48A 3Q1QA 4DR1I 1S16A 1ZM2A 2R3VA 3OTOI 4GKJI 5LMNI 1EA6A 2UUAI 2OI2A 4DV4E 1Z5AA 4B3RI 3LPSA 5CFFE 1HNXE 1KVKA 4LF6E 1YYOA 1IBLE 2UXBE 4DV0I 1RR9A 2A2CA 3CWVA 1N0VC 5FLXQ 4PRVA 4K0KE 4WYQB 4NXME 3GONA 3LTOA 1VISA 1ZBTA 3ZZUA 4MYTA 1I94I 1T4OA 2L2NA 2A2DA 4YHHI 1FNMA 1S4EA 2HKJA 1RC7A 1BKNA 4YY3E 4X65E 2HFUA 4DUYI 3J80Q 4NXNI 1XMQE 4DV2I 2NUGA 4LF4E 2LJPA 2LTSA 4DPUA 2LUQA 4UTGA 2L2KB 5IT9C 1A6FA 2IHR1 1N0UA 2BM1A 4UT4A 4DR1E 2NPFA 1N33I 1FI4A 1T4LB 4DV6I 3J7AM 4M30A 3ZM7A 2WW4A 2LBSB 1KTVA 1X49A 1B62A 3WU3A 2UXCI 1WUUA 5IWAE 4NXNE 4DR5I 4JYAE 3ZZ0A 4DV5I 3VYYA 4JI1I 2EFGA 3ZKBA 2CPNA 3V5RA 4JI3E 4LFBI 4JI5E 4LF9I 2N3HA 1ZM9A 3QT8A 4JV5I 4DV4I 4JI3I 1EKZA 4DR2I 2DMYA 1HR0E 1Z0GA 3ADJA 3B78A 4HACA 4HACB 2UUCI 4GKKI 2DB2A 3P1XA 3HULA 1STUA 2E5LE 1XNRI 4R1FA 4JV5E 4USMA 3JAMC 2NUFA 4K0KI 4JI7E 4JI4I 1FWKA 1YYWA 2BM0A 1IBKI 2YT4A 4JI2E 2L3JA 4B3TE 4DR6E 4LF6I 3JAMQ 1HNXI 4FN5A 3PYFA 4DR3I 2XEXA 1EI1A 2HK2A 4DV3E 2DEJA 2V2ZA 1U2RA 1DI2A 5IT9Q 1N34E 4DPWA 1ZXMA 3H4LA 4MYUA 4JI4E 1H74A 1FJGI 4FWDA 4Z7CA 3K17A 4I3HA 1N36I 2ZITA 4LF9E 4ZVIA 2R42A 4GKKE 3V2UC 1XHKA 2B3TB 2HKEA 4DR5E 1H73A 1Z0WA 1HNWI 4AQYE 4DPYA 1Z0BA 2B7VA 2N3GA 2MDRA 1HNZI 4RPFA 4DV5E 4AQYI 5A2QC 4LF7E 1B63A 4HY1A 4X66E 4JI7I 4HXZA 4DXLA 2UUBE 1ZXNA 4OOGC 5A2QQ 5GMDA 4WUDA 4LFAI 1RREA 2V2VA 2VQEI 2X7IA 4DUZE 3T1HE 2UXDI 1IBME 4X62I 2UUBI 1GQEA 4DV2E 4JI6E 2V8PA 4JYAI 2L2MA 1NHHA 1N32E 4B3RE 2ZM6E 1DARA 4YHHE 2E1RA 2KHXA 4USKA 1T4NA 4M1KA 1N33E 4DU7A 1N36E 1IBLI 3ZKDA 1KKHA 3PYGA 2JY9A 4DUYE 3B8HA 4DV7E 3VYXA 2VQFE 3ZZTA 2F4VE 2GS8A 4LF5I 2RTXA 1MG7A 1XNQE 1FWLA 4DU8A 3T1YI 2HHHI 1UHZA 1H7UA 2V2QA 2B7TA 4LF8E 2NA2A 4JI0E 4HYMA 4B3TI 4DR6I 4OX9I 4JI0I 2NUEA 4WFTA 1ZM4A 2UU9E 1NZ0A 2ZBKB 5LMNE 2UUAE 2F4VI 2VF3A 3C4TA 1HR0I 2DIXA 4DV7I 4DR2E 1OJ4A 4URLA 1D6TA 2RSMA 4X64E 4FW9A 4Z7YA 1RQ0A 2J7KA 1Z0CA 1X47A 1UEKA 1XNQI 2LJHA 1PKPA 3D4JA 4LF5E 3T1YE 2HHHE 3PYDA 4LFCE 3J80C 1Z5BA 2VQFI 1FKAE 5LL6R 4DR4I
chains in the Genus database with same CATH superfamily
3QT6A 4I8OA 1H72C 1YZ9A 2ZM6I 2EZ6A 1NHJA 4LF4I 4FWGA 4IFDE 4LF7I 3QT5A 1NHIA 4DKKA 2UU9I 2UXCE 4MLQA 1PIEA 2UXDE 2B9DA 4XTJA 4DUZI 3T1HI 2DRPA 1WHQA 2YPNA 4P78A 1SR9A 4OX9E 5BR8E 1PVGA 2F1DA 3NZKA 2EMLA 4DV6E 4B3SE 1BBOA 1USUA 4IZKA 1YYKA 5JEAA 4BS9A 5LMUI 4DR7I 4JI5I 4LFBE 1ELOA 4FWHA 2ENAA 4DR7E 3K1JA 4B3ME 3ADGA 4M9VC 2EPAA 3Q6NA 1NCSA 4JI1E 4X66I 2EL6A 2X36A 4KHPI 4P52A 1A1LA 2LE2A 1FJGE 3WU6A 1TF3A 1XMOI 2YTDA 4F6NA 5K36B 3K6QA 2RS6A 1XMQI 2EN2A 3ECRA 2YU5A 2EE8A 3QT7A 2BA1G 2IOQA 1Z0TA 4YY3I 1N34I 2MKDA 4R2CA 1J5EE 1QU6A 4X62E 4X65I 1IBMI 5IWAI 5EL9A 4JI6I 4B3MI 4J8ZA 4FW6A 4WUBA 4O5GA 4LFAE 1TN9A 2ODRC 5DNYA 4B3SI 2EPZA 3OMLA 1WHNA 2EPMX 2YTPA 4DR3E 1UILA 3PS2A 4P7AA 2YSOA 2CT1A 2HK3A 3PYEA 3MSWA 1MGTA 3EPJA 2EM9A 1B69A 1Z59A 1H7SA 4KQVA 4JG4A 4NXMI 2JEAA 2L3CA 3HPZA 1QZRA 4DV1E 4PRXA 3WU5A 2A25A 3J81C 5KL6A 2PRTA 1USVA 4AIMA 5KL2A 3C4BA 4DPTA 4MLVA 3RMPA 1J26A 2EMIA 1K47A 1J5EI 5BR8I 1T38A 2BR2A 5L3JA 3Q6MA 2YWQA 2DLQA 5JEAB 1HNWE 4DV0E 2UXBI 1N32I 2E5LI 2RPCA 1HNZE 3ZOQB 3H09A 5JEAE 2UUCE 2WP8A 2JVAA 3HPSA 1Z0EA 4IJDA 3GMEA 1ZU1A 2V88A 4ZYDA 4KHPE 2O1VA 2PO2B 4WUCA 5GMEA 2HJJA 3BGHA 2EMZA 2M9AA 4ZYHA 4TUGA 2J65A 4DV1I 4DR4E 4ED4A 2VQEE 1WJPA 1MU5A 2EPXA 4MU0A 4O24A 4M2ZA 4X9JA 3GCMA 3EPKA 3F0NA 4LFCI 4X8WA 5JEAC 4BC9A 1MX0A 2V89A 2CZ9A 3B82A 1IBKE 1G2DC 1PJQA 4DPXA 3KZZA 2L33A 2KONA 4JI8E 2LUPB 5FLXC 2JPAA 2BV3A 5A6AA 2WNRB 3THNA 2LTRA 1ZM3A 3HKMA 3LNUA 2EPCA 5AE2A 4LCGA 2LRSA 2DSYA 1X5WA 2GO4A 1XNRE 1A1IA 1KIJA 2AJ4A 3HQ1A 3LLHA 2DEIA 3AUZA 3THOB 2HFSA 3ADIA 2EPLX 2Q2EB 2GLIA 3M6AA 2YTGA 2LCEA 1XMOE 4R8OA 2NN6D 2O1TA 4DV3I 3ADLA 2Z5EA 4Q35B 3VK6A 5A6JA 3P76A 3L00A 4EMDA 3OTOE 4GKJE 2EL4A 1I94E 2NN6F 3HTXA 2EOYA 1Z0VA 2V87A 2C37A 2RS7A 5LMUE 1L4SA 3J7AG 4PU9A 4F9CB 2JOBA 4BCAA 3PS3A 3WU4A 5K36A 2JWOA 5EKWA 4JI2I 1RMDA 4LF8I 1Z5CA 4ZYGA 2V34A 3J81Q 3TQMA 4JI8I 2EP3A 1O0WA 1A1FA 2AE8A 4X64I 2I9IA 3J7Yp 5C0XE 1P47A 1X48A 1A1GA 3U1KA 3IWBA 2Z5CA 2EMFA 5C0XB 4OO1A 5ELWA 3Q1QA 2MDGA 2NN6C 4LPFA 4DR1I 4BHBA 1TF6A 1S16A 1ZM2A 2R3VA 3OTOI 4GKJI 2FTXB 5LMNI 1EA6A 2UUAI 2CGEA 4F9BB 2CG9A 2OI2A 4DV4E 1Z5AA 4B3RI 3LPSA 5CFFE 2LO3A 1HNXE 1KVKA 4OKGA 4BA2B 5A6KA 4LF6E 1YYOA 1IBLE 2UXBE 4DV0I 1PJSA 2LV2A 4IFDD 1RR9A 5DNLA 2YTEA 2O1WA 2EOXA 2A2CA 3CWVA 1N0VC 2KOUA 5A6BA 4FW5A 5FLXQ 4F2JC 2N8XA 4PRVA 4K0KE 2WZOA 5C0XC 2DMIA 5C0XA 4WYQB 4NXME 3GONA 3LTOA 1VISA 1ZBTA 4ZYEA 1SFEA 3ZZUA 2M4IA 2NN6E 4MYTA 1IMUA 1I94I 1T4OA 4F6MA 1Y5YA 4MDTA 2G7HA 2L2NA 2A2DA 4YHHI 4OO1F 1FNMA 4IZJD 2YTNA 1S4EA 3DD6A 3P3CA 2HKJA 1A1JA 2E72A 2YTIA 2YTOA 4AM3A 1RC7A 2YRKA 1BKNA 4BA2A 4HTGA 4YY3E 2JE6B 4X65E 1NEIA 2EMAA 2HFUA 2Z5CB 2YU8A 1YSAC 2V8QB 4DUYI 3J80Q 4NXNI 3UK3C 1XMQE 4DV2I 2NUGA 2EOZA 4MU4A 4LF4E 2EMXA 2LJPA 3M7ND 4IFDC 2LTSA 5KL4A 4FW3A 2DGCA 4DPUA 2LUQA 1UDSA 2WP8B 4UTGA 2L2KB 4R2QA 5IT9C 1A6FA 2EL5A 2IHR1 2R1FA 1N0UA 2BM1A 4UT4A 4OO1B 4DR1E 2EOMA 1JK1A 2NPFA 1N33I 1T39A 2ODRD 2EQ1A 1FI4A 3BF2A 1T4LB 4DV6I 2EMWA 4O4KA 3U1YA 2CTDA 2FV4B 4M30A 3J7AM 3ZM7A 2WW4A 3HJCA 2LBSB 2MKNA 1KTVA 1X49A 1B62A 4LOMA 2EN6A 2EOOA 3JTZA 1PJTA 4GQUA 2LVHA 3WU3A 2UXCI 2JEBA 1WUUA 5IWAE 1BBGA 4NXNE 5FWKA 4BC7A 4DR5I 4JYAE 2PNZA 3F6GA 1VI7A 3ZZ0A 4DV5I 1YFHA 4FW4A 2C37B 2EMGA 2GHFA 4TUIA 2Z5BA 3VYYA 1ZAAC 1JK2A 4JI1I 4IZJB 2EFGA 2L6MA 4U3BA 3ZKBA 2CPNA 2EM2A 3M7NG 3V5RA 4JI3E 4LFBI 4JI5E 1UDNA 4KWYA 4LF9I 2ELZA 2N3HA 2JOXA 4FK5C 1ZM9A 1N3GA 5DROA 2EMCA 2PO2A 2EPUA 4BHCA 3CDIA 3QT8A 2ADRA 2EJ4A 4O43A 4JV5I 2EN7A 1Y4UA 4DV4I 4JI3I 2E1MA 2JXPA 2JYAA 2EQ3A 1EKZA 2M7QA 2MC5A 3BBGA 4DR2I 2DMYA 3VHTB 1HR0E 3PRYA 1Z0GA 1X6FA 2EOJA 4OO1D 3ADJA 2WBUA 2WCC3 2EM6A 5IV8B 3B78A 1OYRA 4NHRA 4HACA 2YZTA 4HACB 2UUCI 2WBTA 2HC5A 2J7JA 4GKKI 2DB2A 5C0XF 2VF1A 4L5NC 2CSHA 3P1XA 2GQ0A 1STUA 3HULA 2EM7A 4WSPA 3CDJA 2E5LE 3C6MA 2V86A 4N4RB 4LU9A 4R1FA 1XNRI 4JV5E 4USMA 5C0XD 4WXCA 3JAMC 5KL3A 2NUFA 4K0KI 2EM3A 2LMZA 4NZVA 3EPLA 4JI7E 2L8TA 5A6BD 4JI4I 2HGHA 5AC5A 1FWKA 1YYWA 2BM0A 4QNKA 2YT4A 2V83A 2EPPA 4JI2E 2L3JA 1IBKI 2EORA 2L92A 4B3TE 4DR6E 2YRHA 4LF6I 4J3DA 3JAMQ 1HNXI 2PNZB 4FN5A 5DRRA 2BA1D 1X6EA 3PYFA 2EPOA 5LLQA 4DR3I 3LMLA 2Q8UA 4IZJA 3H1CA 2ELYA 1BB8A 1R6LA 2XEXA 1UBDC 1YUJA 1EI1A 4HEIA 2HK2A 4LCFA 4DV3E 2DEJA 2V2ZA 1U2RA 1DI2A 5IT9Q 4IFDB 4IFDA 1LLMC 1YH8A 3PS1A 1ZR9A 5KL5A 1N34E 4DPWA 1ZXMA 3H4LA 4MYUA 2R76A 2EPNA 4Q28A 4JI4E 1H74A 2IESA 1X3CA 1OYSA 4FWDA 4Z7CA 1FJGI 3K17A 2M1SA 4I3HA 1N36I 2ZITA 4LF9E 1XXEA 3L7ZA 3L7ZB 4ZVIA 2H36X 2R42A 2PNLA 4GKKE 2YTJA 2LJUA 3M85G 4R2EA 4WSGA 3V2UC 2D9HA 3KZYA 4GEQB 1XHKA 2B3TB 1A1HA 4DR5E 2HKEA 2GPIA 2BA0G 2EOEA 4MU1A 2C39B 1H73A 2RQLA 1Z0WA 3KRNA 1HNWI 4AQYE 4DPYA 1GTKA 4GZNC 2B7VA 2N3GA 4KZSA 2MDRA 1Z0BA 4RPFA 1HNZI 4DV5E 1MEYC 4AIDA 4AQYI 3HXLA 2YTQA 5AE1A 4R2RA 2PNMA 3P3GA 5A2QC 1YUIA 4LF7E 3DF6A 1B63A 5K36F 2EOSA 1E3HA 4HY1A 5JEAD 4X66E 4JI7I 4HXZA 1IQOA 4P7DA 1YPNA 3GLLA 4DXLA 2UUBE 1ZXNA 2NN6B 5IXMB 5JEAF 2EMKA 4OOGC 5A2QQ 2O1UA 5GMDA 3F6HA 4WUDA 2GO3A 4LFAI 1RREA 2V2VA 2VQEI 4IS9A 3QG5C 3MHSC 2C38B 2X7IA 4DUZE 3T1HE 2UXDI 1IBME 4X62I 2UUBI 1GQEA 1P42A 4DV2E 1IQSA 1A1KA 4JI6E 2JEBB 2V8PA 4JYAI 5DRPA 2L2MA 2ENHA 4NBQA 1NHHA 1N32E 4B3RE 2O3ZA 2ZM6E 2EM5A 3M85D 2ENCA 1F2IG 2PO1A 1DARA 4YHHE 2EQ0A 2EPKX 1DQ3A 2EM0A 2Z5BB 1X6HA 1Y4SA 3P3EA 4IZKB 2YRMA 4OO1E 5AASA 2E1RA 1EH7A 1OYPA 2NABA 3FIGA 1WXRA 2EMYA 2WBSA 2KHXA 4USKA 4R2AA 1QNTA 1T4NA 4M1KA 3K85A 4LTYA 1N33E 3DJWA 4DU7A 1KYQA 2VRDA 2F8BA 2EN8A 2EN3A 2EOIA 1N36E 1IBLI 2EOFA 2FGGA 2JE6A 4FW7A 1G2FC 2PO0B 4MU3A 3ZKDA 1KKHA 3PYGA 5K36E 2EMBA 2EM8A 1AAYA 2JY9A 1EH6A 1KJKA 1UDOA 2BBGA 4DUYE 3B8HA 4DV7E 3IWCA 4OZEA 5TSEA 3VYXA 2EN1A 5DRQA 1DGCA 2VQFE 3ZZTA 2F4VE 2IERA 2EMHA 1AH5A 2VE7C 3IWDA 4R03A 1E3PA 1RHYA 5T6JA 1PDAA 4WX9A 2GS8A 4LF5I 2RTXA 3B4TA 1MG7A 2JP9A 4IS1C 1XNQE 1FWLA 4DU8A 4DMIA 3T1YI 2HHHI 2JEAB 2EOHA 4R2SA 3JU0A 1UHZA 2EPRA 2K7IA 1H7UA 2V2QA 2B7TA 4LF8E 3AV0A 2NA2A 4WPYA 1YHCA 4JI0E 4HYMA 4LCHA 5K36D 4B3TI 4DR6I 5A69A 4F9AB 3MHHC 4OX9I 4JI0I 4IFDF 4BA1B 2RSIA 2DLKA 2NUEA 4WFTA 1ZM4A 2C39A 2UU9E 5DNXA 3P06A 2I13A 1NZ0A 2ZBKB 5AC4A 4RHBB 5LMNE 2UUAE 2YTFA 2JT2A 4BBYA 4BMJA 3EQ1A 4L8NA 1R6MA 2VF3A 2F4VI 4OO1C 3C4TA 4F54A 4M0VA 4RH8A 2BR2B 2DIXA 1HR0I 2IOPA 1EH8A 2YSPA 4DR2E 4DV7I 2EWLA 1OJ4A 2EM4A 1HK7A 4URLA 5AE3A 1D6TA 2RSMA 2PO0A 4X64E 4R2DA 2WNRA 4FW9A 1Z1BA 3KWRA 3UHMA 4MQYA 3M99B 2CVEA 4ISAA 5F3WA 1UDQA 4Z7YA 2V85A 5K36C 1RQ0A 2J7KA 4U3DA 1Y6ZA 4WXDA 1ZBQA 2C38A 1Z0CA 2JR1A 2BB8A 1X47A 2EOQA 1GZ6A 3EPHA 1WRJA 2EN4A 1UEKA 2LJHA 2MC6A 2VQFI 2BA0D 1XNQI 1PKPA 1UN6B 2K4VA 1Y60A 2NN6A 3D4JA 3BIDA 4LF5E 3T1YE 2HHHE 5KL7A 3C6KA 2VESA 3PYDA 4LFCE 4R2PA 4QNJA 4BA1A 3J80C 2PO1B 5ADZA 1Z5BA 4N3OA 1FKAE 5LL6R 2LT7A 4DR4I
chains in the Genus database with same CATH topology
3QT6A 4I8OA 1H72C 1YZ9A 2ZM6I 2EZ6A 1NHJA 4LF4I 4FWGA 4LF7I 3QT5A 1NHIA 4DKKA 2UU9I 2UXCE 1PIEA 2UXDE 2B9DA 4XTJA 4DUZI 3T1HI 1WHQA 4P78A 1SR9A 4OX9E 5BR8E 1PVGA 4DV6E 1USUA 4B3SE 4IZKA 4DR7I 1YYKA 4BS9A 5LMUI 4JI5I 4LFBE 1ELOA 4FWHA 4DR7E 3K1JA 4B3ME 3ADGA 3Q6NA 4JI1E 4X66I 2X36A 4KHPI 4P52A 2LE2A 1FJGE 3WU6A 1XMOI 3K6QA 2RS6A 1XMQI 3QT7A 2IOQA 1Z0TA 4YY3I 1N34I 1J5EE 1QU6A 4X62E 4X65I 1IBMI 5IWAI 4JI6I 4B3MI 4J8ZA 4WUBA 4LFAE 2ODRC 5DNYA 4B3SI 3OMLA 1WHNA 4DR3E 4P7AA 1UILA 2HK3A 3PYEA 3MSWA 4NXMI 4KQVA 1Z59A 1H7SA 4JG4A 2L3CA 3HPZA 1QZRA 4DV1E 4PRXA 3WU5A 3J81C 1USVA 4DPTA 3C4BA 3RMPA 1J26A 1K47A 1J5EI 5BR8I 5L3JA 3Q6MA 1HNWE 4DV0E 2UXBI 1N32I 2E5LI 1HNZE 3ZOQB 3H09A 2UUCE 2JVAA 3HPSA 1Z0EA 2V88A 4KHPE 4WUCA 2O1VA 5GMEA 4TUGA 4DV1I 4DR4E 4ED4A 2VQEE 1MU5A 4M2ZA 4LFCI 3F0NA 4X8WA 4BC9A 1MX0A 2V89A 2CZ9A 3B82A 1IBKE 4DPXA 2LUPB 2L33A 2KONA 4JI8E 2BV3A 5FLXC 2LTRA 1ZM3A 3LNUA 5AE2A 2LRSA 2DSYA 1XNRE 1KIJA 2AJ4A 3HQ1A 3LLHA 2DEIA 3AUZA 2HFSA 3ADIA 2Q2EB 3M6AA 1XMOE 4R8OA 2O1TA 4DV3I 3ADLA 2Z5EA 4EMDA 3VK6A 3OTOE 4GKJE 1I94E 3HTXA 1Z0VA 2V87A 2RS7A 5LMUE 3J7AG 4PU9A 4F9CB 2JOBA 4BCAA 3WU4A 2JWOA 4JI2I 4LF8I 1Z5CA 2V34A 3J81Q 4JI8I 1O0WA 4X64I 3J7Yp 1X48A 3IWBA 2Z5CA 3Q1QA 4DR1I 1S16A 1ZM2A 2R3VA 3OTOI 4GKJI 2FTXB 5LMNI 1EA6A 2UUAI 2CGEA 4F9BB 2CG9A 2OI2A 4DV4E 1Z5AA 4B3RI 3LPSA 5CFFE 1HNXE 1KVKA 4LF6E 1YYOA 1IBLE 2UXBE 4DV0I 1RR9A 2O1WA 2A2CA 3CWVA 1N0VC 2KOUA 5FLXQ 4PRVA 4K0KE 2WZOA 4WYQB 4NXME 3GONA 3LTOA 1VISA 1ZBTA 3ZZUA 2M4IA 4MYTA 1I94I 1T4OA 2G7HA 2L2NA 2A2DA 4YHHI 1FNMA 4IZJD 1S4EA 2HKJA 1RC7A 1BKNA 4YY3E 4X65E 2HFUA 2Z5CB 4DUYI 2V8QB 3J80Q 4NXNI 1XMQE 4DV2I 2NUGA 4LF4E 2LJPA 2LTSA 4DPUA 2LUQA 4UTGA 2L2KB 5IT9C 1A6FA 2IHR1 1N0UA 2BM1A 4UT4A 4DR1E 2NPFA 1N33I 2ODRD 1FI4A 1T4LB 4DV6I 2FV4B 4M30A 3J7AM 3ZM7A 2WW4A 3HJCA 1KTVA 2LBSB 1X49A 1B62A 3JTZA 3WU3A 2UXCI 1WUUA 5IWAE 4NXNE 5FWKA 4BC7A 4DR5I 4JYAE 3ZZ0A 3F6GA 4DV5I 4TUIA 2Z5BA 3VYYA 4JI1I 4IZJB 2EFGA 2L6MA 3ZKBA 2CPNA 3V5RA 4JI3E 4LFBI 4JI5E 4LF9I 2N3HA 2JOXA 1ZM9A 3QT8A 4JV5I 1Y4UA 4DV4I 4JI3I 2E1MA 1EKZA 2M7QA 2MC5A 4DR2I 2DMYA 1HR0E 3PRYA 1Z0GA 3ADJA 3B78A 4HACA 2YZTA 4HACB 2UUCI 4GKKI 2DB2A 2VF1A 4L5NC 2GQ0A 3P1XA 3HULA 1STUA 4WSPA 2E5LE 2V86A 1XNRI 4LU9A 4R1FA 4JV5E 4USMA 3JAMC 2NUFA 4K0KI 2LMZA 4JI7E 2L8TA 4JI4I 1FWKA 1YYWA 2BM0A 1IBKI 2YT4A 2V83A 4JI2E 2L3JA 2L92A 4B3TE 4DR6E 4LF6I 3JAMQ 1HNXI 4FN5A 3PYFA 4DR3I 3LMLA 4IZJA 2XEXA 1EI1A 2HK2A 4DV3E 2DEJA 2V2ZA 1U2RA 1DI2A 5IT9Q 1N34E 4DPWA 1ZXMA 3H4LA 4MYUA 4Q28A 4JI4E 1H74A 1FJGI 4FWDA 4Z7CA 3K17A 2M1SA 4I3HA 1N36I 2ZITA 4LF9E 4ZVIA 2H36X 2R42A 2PNLA 4GKKE 3V2UC 4GEQB 1XHKA 2B3TB 2HKEA 4DR5E 1H73A 1Z0WA 1HNWI 4AQYE 4DPYA 1Z0BA 2B7VA 2N3GA 4KZSA 2MDRA 1HNZI 4RPFA 4DV5E 4AQYI 3HXLA 5AE1A 2PNMA 5A2QC 4LF7E 1B63A 3DF6A 4HY1A 4X66E 4JI7I 4HXZA 4P7DA 4DXLA 2UUBE 1ZXNA 4OOGC 5A2QQ 2O1UA 5GMDA 3F6HA 4WUDA 4LFAI 1RREA 2V2VA 2VQEI 2X7IA 4DUZE 3T1HE 2UXDI 1IBME 4X62I 2UUBI 1GQEA 4DV2E 4JI6E 2V8PA 4JYAI 2L2MA 1NHHA 1N32E 4B3RE 2ZM6E 1DARA 4YHHE 1DQ3A 2Z5BB 1Y4SA 4IZKB 5AASA 2E1RA 3FIGA 1WXRA 2KHXA 4USKA 1T4NA 4M1KA 3K85A 4LTYA 1N33E 3DJWA 4DU7A 2F8BA 1N36E 1IBLI 2FGGA 3ZKDA 1KKHA 3PYGA 2JY9A 4DUYE 3B8HA 4DV7E 3IWCA 3VYXA 2VQFE 3ZZTA 2F4VE 2VE7C 3IWDA 4R03A 5T6JA 2GS8A 4LF5I 2RTXA 1MG7A 1XNQE 1FWLA 4DU8A 4DMIA 3T1YI 2HHHI 3JU0A 1UHZA 1H7UA 2V2QA 2B7TA 4LF8E 3AV0A 2NA2A 4WPYA 4JI0E 4HYMA 4B3TI 4DR6I 4F9AB 4OX9I 4JI0I 2NUEA 4WFTA 1ZM4A 2UU9E 3P06A 1NZ0A 2ZBKB 5LMNE 2UUAE 4BBYA 4BMJA 2F4VI 4L8NA 2VF3A 3C4TA 4F54A 4M0VA 1HR0I 2DIXA 2IOPA 4DV7I 4DR2E 2EWLA 1OJ4A 1HK7A 4URLA 5AE3A 1D6TA 2RSMA 4X64E 4FW9A 3KWRA 5F3WA 4Z7YA 2V85A 1RQ0A 2J7KA 1Y6ZA 1ZBQA 1Z0CA 2JR1A 1X47A 1GZ6A 1UEKA 2VQFI 1XNQI 2LJHA 2MC6A 1PKPA 2K4VA 3D4JA 4LF5E 3T1YE 2HHHE 3PYDA 4LFCE 3J80C 5ADZA 1Z5BA 4N3OA 1FKAE 5LL6R 4DR4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT6 A;  1H72 C;  1YZ9 A;  2ZM6 I;  2EZ6 A;  1NHJ A;  4LF4 I;  4FWG A;  4LF7 I;  3QT5 A;  1NHI A;  4DKK A;  2UU9 I;  2UXC E;  1PIE A;  2UXD E;  4XTJ A;  4DUZ I;  3T1H I;  1WHQ A;  4OX9 E;  5BR8 E;  1PVG A;  4DV6 E;  4B3S E;  4DR7 I;  1YYK A;  5LMU I;  4JI5 I;  4LFB E;  1ELO A;  4FWH A;  4DR7 E;  3K1J A;  4B3M E;  3ADG A;  4JI1 E;  4X66 I;  2X36 A;  4KHP I;  4P52 A;  1FJG E;  3WU6 A;  1XMO I;  2RS6 A;  1XMQ I;  3QT7 A;  1Z0T A;  4YY3 I;  1N34 I;  1J5E E;  1QU6 A;  4X62 E;  4X65 I;  1IBM I;  5IWA I;  4JI6 I;  4B3M I;  4WUB A;  4LFA E;  4B3S I;  1WHN A;  4DR3 E;  4P7A A;  1UIL A;  2HK3 A;  3PYE A;  4NXM I;  4KQV A;  1Z59 A;  1H7S A;  4JG4 A;  3WU5 A;  2L3C A;  1QZR A;  4DV1 E;  4PRX A;  3J81 C;  4DPT A;  3C4B A;  1J26 A;  1K47 A;  1J5E I;  5BR8 I;  5L3J A;  1HNW E;  4DV0 E;  2UXB I;  1N32 I;  2E5L I;  1HNZ E;  2UUC E;  2JVA A;  1Z0E A;  4KHP E;  4WUC A;  5GME A;  4DV1 I;  4DR4 E;  4ED4 A;  2VQE E;  1MU5 A;  4M2Z A;  4LFC I;  3F0N A;  4X8W A;  1MX0 A;  2CZ9 A;  3B82 A;  1IBK E;  4DPX A;  2LUP B;  2L33 A;  2BV3 A;  4JI8 E;  5FLX C;  2LTR A;  1ZM3 A;  3LNU A;  2LRS A;  1XNR E;  1KIJ A;  2AJ4 A;  3LLH A;  2DEI A;  2HFS A;  3ADI A;  2Q2E B;  3M6A A;  1XMO E;  4DV3 I;  3ADL A;  4EMD A;  3OTO E;  4GKJ E;  1I94 E;  3HTX A;  1Z0V A;  2RS7 A;  5LMU E;  4PU9 A;  3J7A G;  3WU4 A;  4JI2 I;  4LF8 I;  1Z5C A;  2V34 A;  3J81 Q;  4JI8 I;  1O0W A;  4X64 I;  3J7Y p;  1X48 A;  3Q1Q A;  4DR1 I;  1S16 A;  1ZM2 A;  2R3V A;  3OTO I;  4GKJ I;  5LMN I;  1EA6 A;  2UUA I;  2OI2 A;  4DV4 E;  1Z5A A;  4B3R I;  3LPS A;  5CFF E;  1HNX E;  1KVK A;  4LF6 E;  1YYO A;  1IBL E;  2UXB E;  4DV0 I;  1RR9 A;  2A2C A;  3CWV A;  1N0V C;  5FLX Q;  4PRV A;  4K0K E;  4WYQ B;  4NXM E;  3GON A;  3LTO A;  1VIS A;  1ZBT A;  3ZZU A;  4MYT A;  1I94 I;  1T4O A;  2L2N A;  2A2D A;  4YHH I;  1FNM A;  1S4E A;  2HKJ A;  1RC7 A;  1BKN A;  4YY3 E;  4X65 E;  2HFU A;  4DUY I;  3J80 Q;  4NXN I;  1XMQ E;  4DV2 I;  2NUG A;  4LF4 E;  2LJP A;  2LTS A;  4DPU A;  2LUQ A;  4UTG A;  2L2K B;  5IT9 C;  1A6F A;  2IHR 1;  1N0U A;  2BM1 A;  4UT4 A;  4DR1 E;  2NPF A;  1N33 I;  1FI4 A;  1T4L B;  4DV6 I;  3J7A M;  4M30 A;  3ZM7 A;  2WW4 A;  2LBS B;  1KTV A;  1X49 A;  1B62 A;  3WU3 A;  2UXC I;  1WUU A;  5IWA E;  4NXN E;  4DR5 I;  4JYA E;  3ZZ0 A;  4DV5 I;  3VYY A;  4JI1 I;  2EFG A;  3ZKB A;  2CPN A;  3V5R A;  4JI3 E;  4LFB I;  4JI5 E;  4LF9 I;  2N3H A;  1ZM9 A;  3QT8 A;  4JV5 I;  4DV4 I;  4JI3 I;  1EKZ A;  4DR2 I;  2DMY A;  1HR0 E;  1Z0G A;  3ADJ A;  3B78 A;  4HAC A;  4HAC B;  2UUC I;  4GKK I;  2DB2 A;  3P1X A;  3HUL A;  1STU A;  2E5L E;  1XNR I;  4R1F A;  4JV5 E;  4USM A;  3JAM C;  2NUF A;  4K0K I;  4JI7 E;  4JI4 I;  1FWK A;  1YYW A;  2BM0 A;  1IBK I;  2YT4 A;  4JI2 E;  2L3J A;  4B3T E;  4DR6 E;  4LF6 I;  3JAM Q;  1HNX I;  4FN5 A;  3PYF A;  4DR3 I;  2XEX A;  1EI1 A;  2HK2 A;  4DV3 E;  2DEJ A;  2V2Z A;  1U2R A;  1DI2 A;  5IT9 Q;  1N34 E;  4DPW A;  1ZXM A;  3H4L A;  4MYU A;  4JI4 E;  1H74 A;  1FJG I;  4FWD A;  4Z7C A;  3K17 A;  4I3H A;  1N36 I;  2ZIT A;  4LF9 E;  4ZVI A;  2R42 A;  4GKK E;  3V2U C;  1XHK A;  2B3T B;  2HKE A;  4DR5 E;  1H73 A;  1Z0W A;  1HNW I;  4AQY E;  4DPY A;  1Z0B A;  2B7V A;  2N3G A;  2MDR A;  1HNZ I;  4RPF A;  4DV5 E;  4AQY I;  5A2Q C;  4LF7 E;  1B63 A;  4HY1 A;  4X66 E;  4JI7 I;  4HXZ A;  4DXL A;  2UUB E;  1ZXN A;  4OOG C;  5A2Q Q;  5GMD A;  4WUD A;  4LFA I;  1RRE A;  2V2V A;  2VQE I;  2X7I A;  4DUZ E;  3T1H E;  2UXD I;  1IBM E;  4X62 I;  2UUB I;  1GQE A;  4DV2 E;  4JI6 E;  2V8P A;  4JYA I;  2L2M A;  1NHH A;  1N32 E;  4B3R E;  2ZM6 E;  1DAR A;  4YHH E;  2E1R A;  2KHX A;  4USK A;  1T4N A;  4M1K A;  1N33 E;  4DU7 A;  1N36 E;  1IBL I;  3ZKD A;  1KKH A;  3PYG A;  2JY9 A;  4DUY E;  3B8H A;  4DV7 E;  3VYX A;  2VQF E;  3ZZT A;  2F4V E;  2GS8 A;  4LF5 I;  2RTX A;  1MG7 A;  1XNQ E;  1FWL A;  4DU8 A;  3T1Y I;  2HHH I;  1UHZ A;  1H7U A;  2V2Q A;  2B7T A;  4LF8 E;  2NA2 A;  4JI0 E;  4HYM A;  4B3T I;  4DR6 I;  4OX9 I;  4JI0 I;  2NUE A;  4WFT A;  1ZM4 A;  2UU9 E;  1NZ0 A;  2ZBK B;  5LMN E;  2UUA E;  2F4V I;  2VF3 A;  3C4T A;  1HR0 I;  2DIX A;  4DV7 I;  4DR2 E;  1OJ4 A;  4URL A;  1D6T A;  2RSM A;  4X64 E;  4FW9 A;  4Z7Y A;  1RQ0 A;  2J7K A;  1Z0C A;  1X47 A;  1UEK A;  1XNQ I;  2LJH A;  1PKP A;  3D4J A;  4LF5 E;  3T1Y E;  2HHH E;  3PYD A;  4LFC E;  3J80 C;  1Z5B A;  2VQF I;  1FKA E;  5LL6 R;  4DR4 I; 
#chains in the Genus database with same CATH topology
 3QT6 A;  4I8O A;  1H72 C;  1YZ9 A;  2ZM6 I;  2EZ6 A;  1NHJ A;  4LF4 I;  4FWG A;  4IFD E;  4LF7 I;  3QT5 A;  1NHI A;  4DKK A;  2UU9 I;  2UXC E;  4MLQ A;  1PIE A;  2UXD E;  2B9D A;  4XTJ A;  4DUZ I;  3T1H I;  2DRP A;  1WHQ A;  2YPN A;  4P78 A;  1SR9 A;  4OX9 E;  5BR8 E;  1PVG A;  2F1D A;  3NZK A;  2EML A;  4DV6 E;  4B3S E;  1BBO A;  1USU A;  4IZK A;  1YYK A;  5JEA A;  4BS9 A;  5LMU I;  4DR7 I;  4JI5 I;  4LFB E;  1ELO A;  4FWH A;  2ENA A;  4DR7 E;  3K1J A;  4B3M E;  3ADG A;  4M9V C;  2EPA A;  3Q6N A;  1NCS A;  4JI1 E;  4X66 I;  2EL6 A;  2X36 A;  4KHP I;  4P52 A;  1A1L A;  2LE2 A;  1FJG E;  3WU6 A;  1TF3 A;  1XMO I;  2YTD A;  4F6N A;  5K36 B;  3K6Q A;  2RS6 A;  1XMQ I;  2EN2 A;  3ECR A;  2YU5 A;  2EE8 A;  3QT7 A;  2BA1 G;  2IOQ A;  1Z0T A;  4YY3 I;  1N34 I;  2MKD A;  4R2C A;  1J5E E;  1QU6 A;  4X62 E;  4X65 I;  1IBM I;  5IWA I;  5EL9 A;  4JI6 I;  4B3M I;  4J8Z A;  4FW6 A;  4WUB A;  4O5G A;  4LFA E;  1TN9 A;  2ODR C;  5DNY A;  4B3S I;  2EPZ A;  3OML A;  1WHN A;  2EPM X;  2YTP A;  4DR3 E;  1UIL A;  3PS2 A;  4P7A A;  2YSO A;  2CT1 A;  2HK3 A;  3PYE A;  3MSW A;  1MGT A;  3EPJ A;  2EM9 A;  1B69 A;  1Z59 A;  1H7S A;  4KQV A;  4JG4 A;  4NXM I;  2JEA A;  2L3C A;  3HPZ A;  1QZR A;  4DV1 E;  4PRX A;  3WU5 A;  2A25 A;  3J81 C;  5KL6 A;  2PRT A;  1USV A;  4AIM A;  5KL2 A;  3C4B A;  4DPT A;  4MLV A;  3RMP A;  1J26 A;  2EMI A;  1K47 A;  1J5E I;  5BR8 I;  1T38 A;  2BR2 A;  5L3J A;  3Q6M A;  2YWQ A;  2DLQ A;  5JEA B;  1HNW E;  4DV0 E;  2UXB I;  1N32 I;  2E5L I;  2RPC A;  1HNZ E;  3ZOQ B;  3H09 A;  5JEA E;  2UUC E;  2WP8 A;  2JVA A;  3HPS A;  1Z0E A;  4IJD A;  3GME A;  1ZU1 A;  2V88 A;  4ZYD A;  4KHP E;  2O1V A;  2PO2 B;  4WUC A;  5GME A;  2HJJ A;  3BGH A;  2EMZ A;  2M9A A;  4ZYH A;  4TUG A;  2J65 A;  4DV1 I;  4DR4 E;  4ED4 A;  2VQE E;  1WJP A;  1MU5 A;  2EPX A;  4MU0 A;  4O24 A;  4M2Z A;  4X9J A;  3GCM A;  3EPK A;  3F0N A;  4LFC I;  4X8W A;  5JEA C;  4BC9 A;  1MX0 A;  2V89 A;  2CZ9 A;  3B82 A;  1IBK E;  1G2D C;  1PJQ A;  4DPX A;  3KZZ A;  2L33 A;  2KON A;  4JI8 E;  2LUP B;  5FLX C;  2JPA A;  2BV3 A;  5A6A A;  2WNR B;  3THN A;  2LTR A;  1ZM3 A;  3HKM A;  3LNU A;  2EPC A;  5AE2 A;  4LCG A;  2LRS A;  2DSY A;  1X5W A;  2GO4 A;  1XNR E;  1A1I A;  1KIJ A;  2AJ4 A;  3HQ1 A;  3LLH A;  2DEI A;  3AUZ A;  3THO B;  2HFS A;  3ADI A;  2EPL X;  2Q2E B;  2GLI A;  3M6A A;  2YTG A;  2LCE A;  1XMO E;  4R8O A;  2NN6 D;  2O1T A;  4DV3 I;  3ADL A;  2Z5E A;  4Q35 B;  3VK6 A;  5A6J A;  3P76 A;  3L00 A;  4EMD A;  3OTO E;  4GKJ E;  2EL4 A;  1I94 E;  2NN6 F;  3HTX A;  2EOY A;  1Z0V A;  2V87 A;  2C37 A;  2RS7 A;  5LMU E;  1L4S A;  3J7A G;  4PU9 A;  4F9C B;  2JOB A;  4BCA A;  3PS3 A;  3WU4 A;  5K36 A;  2JWO A;  5EKW A;  4JI2 I;  1RMD A;  4LF8 I;  1Z5C A;  4ZYG A;  2V34 A;  3J81 Q;  3TQM A;  4JI8 I;  2EP3 A;  1O0W A;  1A1F A;  2AE8 A;  4X64 I;  2I9I A;  3J7Y p;  5C0X E;  1P47 A;  1X48 A;  1A1G A;  3U1K A;  3IWB A;  2Z5C A;  2EMF A;  5C0X B;  4OO1 A;  5ELW A;  3Q1Q A;  2MDG A;  2NN6 C;  4LPF A;  4DR1 I;  4BHB A;  1TF6 A;  1S16 A;  1ZM2 A;  2R3V A;  3OTO I;  4GKJ I;  2FTX B;  5LMN I;  1EA6 A;  2UUA I;  2CGE A;  4F9B B;  2CG9 A;  2OI2 A;  4DV4 E;  1Z5A A;  4B3R I;  3LPS A;  5CFF E;  2LO3 A;  1HNX E;  1KVK A;  4OKG A;  4BA2 B;  5A6K A;  4LF6 E;  1YYO A;  1IBL E;  2UXB E;  4DV0 I;  1PJS A;  2LV2 A;  4IFD D;  1RR9 A;  5DNL A;  2YTE A;  2O1W A;  2EOX A;  2A2C A;  3CWV A;  1N0V C;  2KOU A;  5A6B A;  4FW5 A;  5FLX Q;  4F2J C;  2N8X A;  4PRV A;  4K0K E;  2WZO A;  5C0X C;  2DMI A;  5C0X A;  4WYQ B;  4NXM E;  3GON A;  3LTO A;  1VIS A;  1ZBT A;  4ZYE A;  1SFE A;  3ZZU A;  2M4I A;  2NN6 E;  4MYT A;  1IMU A;  1I94 I;  1T4O A;  4F6M A;  1Y5Y A;  4MDT A;  2G7H A;  2L2N A;  2A2D A;  4YHH I;  4OO1 F;  1FNM A;  4IZJ D;  2YTN A;  1S4E A;  3DD6 A;  3P3C A;  2HKJ A;  1A1J A;  2E72 A;  2YTI A;  2YTO A;  4AM3 A;  1RC7 A;  2YRK A;  1BKN A;  4BA2 A;  4HTG A;  4YY3 E;  2JE6 B;  4X65 E;  1NEI A;  2EMA A;  2HFU A;  2Z5C B;  2YU8 A;  1YSA C;  2V8Q B;  4DUY I;  3J80 Q;  4NXN I;  3UK3 C;  1XMQ E;  4DV2 I;  2NUG A;  2EOZ A;  4MU4 A;  4LF4 E;  2EMX A;  2LJP A;  3M7N D;  4IFD C;  2LTS A;  5KL4 A;  4FW3 A;  2DGC A;  4DPU A;  2LUQ A;  1UDS A;  2WP8 B;  4UTG A;  2L2K B;  4R2Q A;  5IT9 C;  1A6F A;  2EL5 A;  2IHR 1;  2R1F A;  1N0U A;  2BM1 A;  4UT4 A;  4OO1 B;  4DR1 E;  2EOM A;  1JK1 A;  2NPF A;  1N33 I;  1T39 A;  2ODR D;  2EQ1 A;  1FI4 A;  3BF2 A;  1T4L B;  4DV6 I;  2EMW A;  4O4K A;  3U1Y A;  2CTD A;  2FV4 B;  4M30 A;  3J7A M;  3ZM7 A;  2WW4 A;  3HJC A;  2LBS B;  2MKN A;  1KTV A;  1X49 A;  1B62 A;  4LOM A;  2EN6 A;  2EOO A;  3JTZ A;  1PJT A;  4GQU A;  2LVH A;  3WU3 A;  2UXC I;  2JEB A;  1WUU A;  5IWA E;  1BBG A;  4NXN E;  5FWK A;  4BC7 A;  4DR5 I;  4JYA E;  2PNZ A;  3F6G A;  1VI7 A;  3ZZ0 A;  4DV5 I;  1YFH A;  4FW4 A;  2C37 B;  2EMG A;  2GHF A;  4TUI A;  2Z5B A;  3VYY A;  1ZAA C;  1JK2 A;  4JI1 I;  4IZJ B;  2EFG A;  2L6M A;  4U3B A;  3ZKB A;  2CPN A;  2EM2 A;  3M7N G;  3V5R A;  4JI3 E;  4LFB I;  4JI5 E;  1UDN A;  4KWY A;  4LF9 I;  2ELZ A;  2N3H A;  2JOX A;  4FK5 C;  1ZM9 A;  1N3G A;  5DRO A;  2EMC A;  2PO2 A;  2EPU A;  4BHC A;  3CDI A;  3QT8 A;  2ADR A;  2EJ4 A;  4O43 A;  4JV5 I;  2EN7 A;  1Y4U A;  4DV4 I;  4JI3 I;  2E1M A;  2JXP A;  2JYA A;  2EQ3 A;  1EKZ A;  2M7Q A;  2MC5 A;  3BBG A;  4DR2 I;  2DMY A;  3VHT B;  1HR0 E;  3PRY A;  1Z0G A;  1X6F A;  2EOJ A;  4OO1 D;  3ADJ A;  2WBU A;  2WCC 3;  2EM6 A;  5IV8 B;  3B78 A;  1OYR A;  4NHR A;  4HAC A;  2YZT A;  4HAC B;  2UUC I;  2WBT A;  2HC5 A;  2J7J A;  4GKK I;  2DB2 A;  5C0X F;  2VF1 A;  4L5N C;  2CSH A;  3P1X A;  2GQ0 A;  1STU A;  3HUL A;  2EM7 A;  4WSP A;  3CDJ A;  2E5L E;  3C6M A;  2V86 A;  4N4R B;  4LU9 A;  4R1F A;  1XNR I;  4JV5 E;  4USM A;  5C0X D;  4WXC A;  3JAM C;  5KL3 A;  2NUF A;  4K0K I;  2EM3 A;  2LMZ A;  4NZV A;  3EPL A;  4JI7 E;  2L8T A;  5A6B D;  4JI4 I;  2HGH A;  5AC5 A;  1FWK A;  1YYW A;  2BM0 A;  4QNK A;  2YT4 A;  2V83 A;  2EPP A;  4JI2 E;  2L3J A;  1IBK I;  2EOR A;  2L92 A;  4B3T E;  4DR6 E;  2YRH A;  4LF6 I;  4J3D A;  3JAM Q;  1HNX I;  2PNZ B;  4FN5 A;  5DRR A;  2BA1 D;  1X6E A;  3PYF A;  2EPO A;  5LLQ A;  4DR3 I;  3LML A;  2Q8U A;  4IZJ A;  3H1C A;  2ELY A;  1BB8 A;  1R6L A;  2XEX A;  1UBD C;  1YUJ A;  1EI1 A;  4HEI A;  2HK2 A;  4LCF A;  4DV3 E;  2DEJ A;  2V2Z A;  1U2R A;  1DI2 A;  5IT9 Q;  4IFD B;  4IFD A;  1LLM C;  1YH8 A;  3PS1 A;  1ZR9 A;  5KL5 A;  1N34 E;  4DPW A;  1ZXM A;  3H4L A;  4MYU A;  2R76 A;  2EPN A;  4Q28 A;  4JI4 E;  1H74 A;  2IES A;  1X3C A;  1OYS A;  4FWD A;  4Z7C A;  1FJG I;  3K17 A;  2M1S A;  4I3H A;  1N36 I;  2ZIT A;  4LF9 E;  1XXE A;  3L7Z A;  3L7Z B;  4ZVI A;  2H36 X;  2R42 A;  2PNL A;  4GKK E;  2YTJ A;  2LJU A;  3M85 G;  4R2E A;  4WSG A;  3V2U C;  2D9H A;  3KZY A;  4GEQ B;  1XHK A;  2B3T B;  1A1H A;  4DR5 E;  2HKE A;  2GPI A;  2BA0 G;  2EOE A;  4MU1 A;  2C39 B;  1H73 A;  2RQL A;  1Z0W A;  3KRN A;  1HNW I;  4AQY E;  4DPY A;  1GTK A;  4GZN C;  2B7V A;  2N3G A;  4KZS A;  2MDR A;  1Z0B A;  4RPF A;  1HNZ I;  4DV5 E;  1MEY C;  4AID A;  4AQY I;  3HXL A;  2YTQ A;  5AE1 A;  4R2R A;  2PNM A;  3P3G A;  5A2Q C;  1YUI A;  4LF7 E;  3DF6 A;  1B63 A;  5K36 F;  2EOS A;  1E3H A;  4HY1 A;  5JEA D;  4X66 E;  4JI7 I;  4HXZ A;  1IQO A;  4P7D A;  1YPN A;  3GLL A;  4DXL A;  2UUB E;  1ZXN A;  2NN6 B;  5IXM B;  5JEA F;  2EMK A;  4OOG C;  5A2Q Q;  2O1U A;  5GMD A;  3F6H A;  4WUD A;  2GO3 A;  4LFA I;  1RRE A;  2V2V A;  2VQE I;  4IS9 A;  3QG5 C;  3MHS C;  2C38 B;  2X7I A;  4DUZ E;  3T1H E;  2UXD I;  1IBM E;  4X62 I;  2UUB I;  1GQE A;  1P42 A;  4DV2 E;  1IQS A;  1A1K A;  4JI6 E;  2JEB B;  2V8P A;  4JYA I;  5DRP A;  2L2M A;  2ENH A;  4NBQ A;  1NHH A;  1N32 E;  4B3R E;  2O3Z A;  2ZM6 E;  2EM5 A;  3M85 D;  2ENC A;  1F2I G;  2PO1 A;  1DAR A;  4YHH E;  2EQ0 A;  2EPK X;  1DQ3 A;  2EM0 A;  2Z5B B;  1X6H A;  1Y4S A;  3P3E A;  4IZK B;  2YRM A;  4OO1 E;  5AAS A;  2E1R A;  1EH7 A;  1OYP A;  2NAB A;  3FIG A;  1WXR A;  2EMY A;  2WBS A;  2KHX A;  4USK A;  4R2A A;  1QNT A;  1T4N A;  4M1K A;  3K85 A;  4LTY A;  1N33 E;  3DJW A;  4DU7 A;  1KYQ A;  2VRD A;  2F8B A;  2EN8 A;  2EN3 A;  2EOI A;  1N36 E;  1IBL I;  2EOF A;  2FGG A;  2JE6 A;  4FW7 A;  1G2F C;  2PO0 B;  4MU3 A;  3ZKD A;  1KKH A;  3PYG A;  5K36 E;  2EMB A;  2EM8 A;  1AAY A;  2JY9 A;  1EH6 A;  1KJK A;  1UDO A;  2BBG A;  4DUY E;  3B8H A;  4DV7 E;  3IWC A;  4OZE A;  5TSE A;  3VYX A;  2EN1 A;  5DRQ A;  1DGC A;  2VQF E;  3ZZT A;  2F4V E;  2IER A;  2EMH A;  1AH5 A;  2VE7 C;  3IWD A;  4R03 A;  1E3P A;  1RHY A;  5T6J A;  1PDA A;  4WX9 A;  2GS8 A;  4LF5 I;  2RTX A;  3B4T A;  1MG7 A;  2JP9 A;  4IS1 C;  1XNQ E;  1FWL A;  4DU8 A;  4DMI A;  3T1Y I;  2HHH I;  2JEA B;  2EOH A;  4R2S A;  3JU0 A;  1UHZ A;  2EPR A;  2K7I A;  1H7U A;  2V2Q A;  2B7T A;  4LF8 E;  3AV0 A;  2NA2 A;  4WPY A;  1YHC A;  4JI0 E;  4HYM A;  4LCH A;  5K36 D;  4B3T I;  4DR6 I;  5A69 A;  4F9A B;  3MHH C;  4OX9 I;  4JI0 I;  4IFD F;  4BA1 B;  2RSI A;  2DLK A;  2NUE A;  4WFT A;  1ZM4 A;  2C39 A;  2UU9 E;  5DNX A;  3P06 A;  2I13 A;  1NZ0 A;  2ZBK B;  5AC4 A;  4RHB B;  5LMN E;  2UUA E;  2YTF A;  2JT2 A;  4BBY A;  4BMJ A;  3EQ1 A;  4L8N A;  1R6M A;  2VF3 A;  2F4V I;  4OO1 C;  3C4T A;  4F54 A;  4M0V A;  4RH8 A;  2BR2 B;  2DIX A;  1HR0 I;  2IOP A;  1EH8 A;  2YSP A;  4DR2 E;  4DV7 I;  2EWL A;  1OJ4 A;  2EM4 A;  1HK7 A;  4URL A;  5AE3 A;  1D6T A;  2RSM A;  2PO0 A;  4X64 E;  4R2D A;  2WNR A;  4FW9 A;  1Z1B A;  3KWR A;  3UHM A;  4MQY A;  3M99 B;  2CVE A;  4ISA A;  5F3W A;  1UDQ A;  4Z7Y A;  2V85 A;  5K36 C;  1RQ0 A;  2J7K A;  4U3D A;  1Y6Z A;  4WXD A;  1ZBQ A;  2C38 A;  1Z0C A;  2JR1 A;  2BB8 A;  1X47 A;  2EOQ A;  1GZ6 A;  3EPH A;  1WRJ A;  2EN4 A;  1UEK A;  2LJH A;  2MC6 A;  2VQF I;  2BA0 D;  1XNQ I;  1PKP A;  1UN6 B;  2K4V A;  1Y60 A;  2NN6 A;  3D4J A;  3BID A;  4LF5 E;  3T1Y E;  2HHH E;  5KL7 A;  3C6K A;  2VES A;  3PYD A;  4LFC E;  4R2P A;  4QNJ A;  4BA1 A;  3J80 C;  2PO1 B;  5ADZ A;  1Z5B A;  4N3O A;  1FKA E;  5LL6 R;  2LT7 A;  4DR4 I; 
#chains in the Genus database with same CATH homology
 3QT6 A;  4I8O A;  1H72 C;  1YZ9 A;  2ZM6 I;  2EZ6 A;  1NHJ A;  4LF4 I;  4FWG A;  4LF7 I;  3QT5 A;  1NHI A;  4DKK A;  2UU9 I;  2UXC E;  1PIE A;  2UXD E;  2B9D A;  4XTJ A;  4DUZ I;  3T1H I;  1WHQ A;  4P78 A;  1SR9 A;  4OX9 E;  5BR8 E;  1PVG A;  4DV6 E;  1USU A;  4B3S E;  4IZK A;  4DR7 I;  1YYK A;  4BS9 A;  5LMU I;  4JI5 I;  4LFB E;  1ELO A;  4FWH A;  4DR7 E;  3K1J A;  4B3M E;  3ADG A;  3Q6N A;  4JI1 E;  4X66 I;  2X36 A;  4KHP I;  4P52 A;  2LE2 A;  1FJG E;  3WU6 A;  1XMO I;  3K6Q A;  2RS6 A;  1XMQ I;  3QT7 A;  2IOQ A;  1Z0T A;  4YY3 I;  1N34 I;  1J5E E;  1QU6 A;  4X62 E;  4X65 I;  1IBM I;  5IWA I;  4JI6 I;  4B3M I;  4J8Z A;  4WUB A;  4LFA E;  2ODR C;  5DNY A;  4B3S I;  3OML A;  1WHN A;  4DR3 E;  4P7A A;  1UIL A;  2HK3 A;  3PYE A;  3MSW A;  4NXM I;  4KQV A;  1Z59 A;  1H7S A;  4JG4 A;  2L3C A;  3HPZ A;  1QZR A;  4DV1 E;  4PRX A;  3WU5 A;  3J81 C;  1USV A;  4DPT A;  3C4B A;  3RMP A;  1J26 A;  1K47 A;  1J5E I;  5BR8 I;  5L3J A;  3Q6M A;  1HNW E;  4DV0 E;  2UXB I;  1N32 I;  2E5L I;  1HNZ E;  3ZOQ B;  3H09 A;  2UUC E;  2JVA A;  3HPS A;  1Z0E A;  2V88 A;  4KHP E;  4WUC A;  2O1V A;  5GME A;  4TUG A;  4DV1 I;  4DR4 E;  4ED4 A;  2VQE E;  1MU5 A;  4M2Z A;  4LFC I;  3F0N A;  4X8W A;  4BC9 A;  1MX0 A;  2V89 A;  2CZ9 A;  3B82 A;  1IBK E;  4DPX A;  2LUP B;  2L33 A;  2KON A;  4JI8 E;  2BV3 A;  5FLX C;  2LTR A;  1ZM3 A;  3LNU A;  5AE2 A;  2LRS A;  2DSY A;  1XNR E;  1KIJ A;  2AJ4 A;  3HQ1 A;  3LLH A;  2DEI A;  3AUZ A;  2HFS A;  3ADI A;  2Q2E B;  3M6A A;  1XMO E;  4R8O A;  2O1T A;  4DV3 I;  3ADL A;  2Z5E A;  4EMD A;  3VK6 A;  3OTO E;  4GKJ E;  1I94 E;  3HTX A;  1Z0V A;  2V87 A;  2RS7 A;  5LMU E;  3J7A G;  4PU9 A;  4F9C B;  2JOB A;  4BCA A;  3WU4 A;  2JWO A;  4JI2 I;  4LF8 I;  1Z5C A;  2V34 A;  3J81 Q;  4JI8 I;  1O0W A;  4X64 I;  3J7Y p;  1X48 A;  3IWB A;  2Z5C A;  3Q1Q A;  4DR1 I;  1S16 A;  1ZM2 A;  2R3V A;  3OTO I;  4GKJ I;  2FTX B;  5LMN I;  1EA6 A;  2UUA I;  2CGE A;  4F9B B;  2CG9 A;  2OI2 A;  4DV4 E;  1Z5A A;  4B3R I;  3LPS A;  5CFF E;  1HNX E;  1KVK A;  4LF6 E;  1YYO A;  1IBL E;  2UXB E;  4DV0 I;  1RR9 A;  2O1W A;  2A2C A;  3CWV A;  1N0V C;  2KOU A;  5FLX Q;  4PRV A;  4K0K E;  2WZO A;  4WYQ B;  4NXM E;  3GON A;  3LTO A;  1VIS A;  1ZBT A;  3ZZU A;  2M4I A;  4MYT A;  1I94 I;  1T4O A;  2G7H A;  2L2N A;  2A2D A;  4YHH I;  1FNM A;  4IZJ D;  1S4E A;  2HKJ A;  1RC7 A;  1BKN A;  4YY3 E;  4X65 E;  2HFU A;  2Z5C B;  4DUY I;  2V8Q B;  3J80 Q;  4NXN I;  1XMQ E;  4DV2 I;  2NUG A;  4LF4 E;  2LJP A;  2LTS A;  4DPU A;  2LUQ A;  4UTG A;  2L2K B;  5IT9 C;  1A6F A;  2IHR 1;  1N0U A;  2BM1 A;  4UT4 A;  4DR1 E;  2NPF A;  1N33 I;  2ODR D;  1FI4 A;  1T4L B;  4DV6 I;  2FV4 B;  4M30 A;  3J7A M;  3ZM7 A;  2WW4 A;  3HJC A;  1KTV A;  2LBS B;  1X49 A;  1B62 A;  3JTZ A;  3WU3 A;  2UXC I;  1WUU A;  5IWA E;  4NXN E;  5FWK A;  4BC7 A;  4DR5 I;  4JYA E;  3ZZ0 A;  3F6G A;  4DV5 I;  4TUI A;  2Z5B A;  3VYY A;  4JI1 I;  4IZJ B;  2EFG A;  2L6M A;  3ZKB A;  2CPN A;  3V5R A;  4JI3 E;  4LFB I;  4JI5 E;  4LF9 I;  2N3H A;  2JOX A;  1ZM9 A;  3QT8 A;  4JV5 I;  1Y4U A;  4DV4 I;  4JI3 I;  2E1M A;  1EKZ A;  2M7Q A;  2MC5 A;  4DR2 I;  2DMY A;  1HR0 E;  3PRY A;  1Z0G A;  3ADJ A;  3B78 A;  4HAC A;  2YZT A;  4HAC B;  2UUC I;  4GKK I;  2DB2 A;  2VF1 A;  4L5N C;  2GQ0 A;  3P1X A;  3HUL A;  1STU A;  4WSP A;  2E5L E;  2V86 A;  1XNR I;  4LU9 A;  4R1F A;  4JV5 E;  4USM A;  3JAM C;  2NUF A;  4K0K I;  2LMZ A;  4JI7 E;  2L8T A;  4JI4 I;  1FWK A;  1YYW A;  2BM0 A;  1IBK I;  2YT4 A;  2V83 A;  4JI2 E;  2L3J A;  2L92 A;  4B3T E;  4DR6 E;  4LF6 I;  3JAM Q;  1HNX I;  4FN5 A;  3PYF A;  4DR3 I;  3LML A;  4IZJ A;  2XEX A;  1EI1 A;  2HK2 A;  4DV3 E;  2DEJ A;  2V2Z A;  1U2R A;  1DI2 A;  5IT9 Q;  1N34 E;  4DPW A;  1ZXM A;  3H4L A;  4MYU A;  4Q28 A;  4JI4 E;  1H74 A;  1FJG I;  4FWD A;  4Z7C A;  3K17 A;  2M1S A;  4I3H A;  1N36 I;  2ZIT A;  4LF9 E;  4ZVI A;  2H36 X;  2R42 A;  2PNL A;  4GKK E;  3V2U C;  4GEQ B;  1XHK A;  2B3T B;  2HKE A;  4DR5 E;  1H73 A;  1Z0W A;  1HNW I;  4AQY E;  4DPY A;  1Z0B A;  2B7V A;  2N3G A;  4KZS A;  2MDR A;  1HNZ I;  4RPF A;  4DV5 E;  4AQY I;  3HXL A;  5AE1 A;  2PNM A;  5A2Q C;  4LF7 E;  1B63 A;  3DF6 A;  4HY1 A;  4X66 E;  4JI7 I;  4HXZ A;  4P7D A;  4DXL A;  2UUB E;  1ZXN A;  4OOG C;  5A2Q Q;  2O1U A;  5GMD A;  3F6H A;  4WUD A;  4LFA I;  1RRE A;  2V2V A;  2VQE I;  2X7I A;  4DUZ E;  3T1H E;  2UXD I;  1IBM E;  4X62 I;  2UUB I;  1GQE A;  4DV2 E;  4JI6 E;  2V8P A;  4JYA I;  2L2M A;  1NHH A;  1N32 E;  4B3R E;  2ZM6 E;  1DAR A;  4YHH E;  1DQ3 A;  2Z5B B;  1Y4S A;  4IZK B;  5AAS A;  2E1R A;  3FIG A;  1WXR A;  2KHX A;  4USK A;  1T4N A;  4M1K A;  3K85 A;  4LTY A;  1N33 E;  3DJW A;  4DU7 A;  2F8B A;  1N36 E;  1IBL I;  2FGG A;  3ZKD A;  1KKH A;  3PYG A;  2JY9 A;  4DUY E;  3B8H A;  4DV7 E;  3IWC A;  3VYX A;  2VQF E;  3ZZT A;  2F4V E;  2VE7 C;  3IWD A;  4R03 A;  5T6J A;  2GS8 A;  4LF5 I;  2RTX A;  1MG7 A;  1XNQ E;  1FWL A;  4DU8 A;  4DMI A;  3T1Y I;  2HHH I;  3JU0 A;  1UHZ A;  1H7U A;  2V2Q A;  2B7T A;  4LF8 E;  3AV0 A;  2NA2 A;  4WPY A;  4JI0 E;  4HYM A;  4B3T I;  4DR6 I;  4F9A B;  4OX9 I;  4JI0 I;  2NUE A;  4WFT A;  1ZM4 A;  2UU9 E;  3P06 A;  1NZ0 A;  2ZBK B;  5LMN E;  2UUA E;  4BBY A;  4BMJ A;  2F4V I;  4L8N A;  2VF3 A;  3C4T A;  4F54 A;  4M0V A;  1HR0 I;  2DIX A;  2IOP A;  4DV7 I;  4DR2 E;  2EWL A;  1OJ4 A;  1HK7 A;  4URL A;  5AE3 A;  1D6T A;  2RSM A;  4X64 E;  4FW9 A;  3KWR A;  5F3W A;  4Z7Y A;  2V85 A;  1RQ0 A;  2J7K A;  1Y6Z A;  1ZBQ A;  1Z0C A;  2JR1 A;  1X47 A;  1GZ6 A;  1UEK A;  2VQF I;  1XNQ I;  2LJH A;  2MC6 A;  1PKP A;  2K4V A;  3D4J A;  4LF5 E;  3T1Y E;  2HHH E;  3PYD A;  4LFC E;  3J80 C;  5ADZ A;  1Z5B A;  4N3O A;  1FKA E;  5LL6 R;  4DR4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...