1I94E

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
PETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1i94E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1i94E02
4UTGA 1T4OA 2E5LE 2YT4A 3ZM7A 4NXNI 3QT8A 4DPWA 4AQYI 4JI7I 1Z5AA 4UT4A 2V8PA 2HKJA 3D4JA 4M30A 2EZ6A 2ZM6I 4X62E 3CWVA 2JVAA 1NZ0A 1IBLE 3PYEA 3WU6A 1XNRI 4DUYE 2OI2A 1RC7A 4DPTA 4URLA 2LUQA 4LFBI 1Z0EA 1RR9A 2LJPA 2RS7A 2DIXA 3T1YI 4HACB 1U2RA 2B3TB 1K47A 2UUCE 5A2QQ 1S16A 1I94E 4JI5E 1YZ9A 4LFCE 1J26A 4ED4A 4JI2E 1N32E 1X49A 4DR3I 3J7AM 4WUDA 2Q2EB 4JI4E 1XMQI 4GKKI 1WHNA 4YY3E 3JAMC 4HYMA 4USMA 2NUFA 4B3SE 2LRSA 1Z0GA 1ZXMA 4MYTA 4X64E 1N0UA 1ZXNA 5LL6R 1EI1A 1MX0A 1T4LB 4DR6I 4DV0I 4JYAI 1IBKI 2E1RA 5GMDA 2DEIA 2VQEI 4B3TI 3J7Yp 3QT6A 2RS6A 4GKJE 1PKPA 3LNUA 3QT5A 4LFAI 4B3RI 1NHIA 4LF5E 2DB2A 1WUUA 2X7IA 2VQFE 1B63A 5IT9C 2ZBKB 2N3GA 1STUA 4X8WA 1DARA 3Q1QA 1BKNA 3J81Q 3HULA 4LF8E 4DV7I 4JI6E 3P1XA 4NXMI 1FJGE 4DR2E 1HR0I 4HXZA 3OTOI 4X66E 1XNQI 4DV4E 4KHPE 5BR8I 1A6FA 1IBMI 4DU8A 1ZM9A 3WU5A 4LF7I 2UUBE 2UXBI 2RSMA 2LBSB 3V5RA 5IWAE 4FWDA 1HNWI 4DR5I 4LF6I 2L2NA 4NXNE 2R3VA 2F4VI 4AQYE 4JI1E 4R1FA 2LTSA 4JI7E 3ZZTA 2V2QA 4WUBA 2HFSA 4LF4E 1ZM2A 5IT9Q 2ZM6E 1UEKA 4K0KI 4YHHI 4JV5I 1Z5CA 1XNRE 1Z5BA 3K1JA 2BM0A 4LFBE 3C4BA 1OJ4A 2L2KB 4PRXA 3J80C 2HKEA 4Z7YA 4FW9A 2L3JA 4Z7CA 4DV6I 3VYXA 4LF9I 4DR3E 3V2UC 1N34I 4DR7I 4M1KA 5L3JA 4GKKE 2BV3A 2V2ZA 2NPFA 1HNXI 1WHQA 1Z0CA 1T4NA 1FWKA 4DV3I 5FLXC 4DV0E 3M6AA 1YYWA 4DR1E 1IBKE 4P52A 1N36I 4JI5I 4B3TE 1KTVA 2EFGA 1H72C 5LMNI 4DV1E 1Z59A 4JI2I 4B3RE 2UUAI 4XTJA 1PIEA 2R42A 2V34A 2UXDI 5LMUI 1O0WA 1J5EI 1UHZA 2L33A 1H73A 2NA2A 2IHR1 4DV5E 4JI0I 4JI8E 2JY9A 2B7TA 4OX9I 1XMOE 2UU9I 4DV2I 4HY1A 2X36A 1ELOA 1H7SA 1ZBTA 1NHJA 2DEJA 3T1HI 4DV7E 2A2CA 4DUZI 4NXME 1HR0E 1HNZI 4DPUA 2NUGA 3OTOE 1XNQE 1N0VC 5BR8E 2V2VA 4GKJI 3JAMQ 1N33I 2B7VA 4LF7E 5CFFE 2UXBE 4B3MI 3PYDA 3WU3A 2UXCI 1KIJA 1HNWE 4DPXA 4DR5E 4LF6E 1KKHA 1EA6A 2HFUA 4DKKA 2HHHE 5GMEA 4JI3E 1D6TA 2VF3A 4DPYA 3B8HA 1DI2A 4LF8I 1UILA 3LTOA 2L2MA 1FKAE 4K0KE 4X65I 1FNMA 2GS8A 5A2QC 4KQVA 4JV5E 2HK2A 3K17A 2J7KA 1FWLA 1KVKA 4WFTA 2DMYA 3T1YE 1XHKA 4EMDA 3ADLA 4DR4I 4P7AA 3PYFA 4DV6E 1Z0TA 4JI1I 1Z0BA 4LF9E 3F0NA 3ZZUA 2E5LI 1N34E 2LTRA 2HK3A 4DR7E 2RTXA 4LF4I 1NHHA 3J7AG 1ZM3A 1MU5A 3ADJA 4M2ZA 1MG7A 1HNXE 2XEXA 1RQ0A 1XMQE 4X62I 1IBLI 3LLHA 1QU6A 3LPSA 2LJHA 4DV3E 4DUYI 2AJ4A 1Z0VA 1N36E 4DR6E 1H7UA 4JYAE 5LMNE 2UUCI 2UUAE 2VQEE 1EKZA 1I94I 3J81C 2UXDE 4LFCI 5LMUE 1J5EE 4FWHA 4DXLA 1QZRA 1N32I 4LFAE 1VISA 4OOGC 3J80Q 4JI0E 4FN5A 2A2DA 3H4LA 1H74A 4JI4I 4OX9E 2UU9E 3QT7A 4YY3I 4DV2E 2N3HA 2BM1A 1X47A 4RPFA 3T1HE 4B3SI 2L3CA 2ZITA 4DUZE 4X64I 1HNZE 3ADIA 4PRVA 1B62A 4DR1I 1GQEA 2KHXA 3ZKDA 1N33E 4DV1I 4DU7A 4MYUA 4WUCA 1IBME 3HTXA 3B82A 3ADGA 4B3ME 2NUEA 2UXCE 4HACA 1X48A 4LF5I 3ZZ0A 4DV5I 4JI8I 2WW4A 4JG4A 2CZ9A 5FLXQ 2VQFI 2LUPB 3ZKBA 3B78A 1PVGA 3C4TA 1XMOI 1Z0WA 2F4VE 4ZVIA 4FWGA 1RREA 3GONA 3WU4A 2MDRA 4X65E 4WYQB 4JI6I 1FJGI 1S4EA 4DR2I 3VYYA 1FI4A 4USKA 4X66I 2CPNA 1YYOA 4DV4I 4KHPI 4PU9A 4YHHE 3PYGA 2UUBI 1YYKA 4I3HA 5IWAI 1ZM4A 2HHHI 4JI3I 4DR4E
chains in the Genus database with same CATH superfamily
4UTGA 4F6MA 2O3ZA 1T4OA 2Z5CA 1UDSA 4R2PA 2EM8A 2E5LE 2YT4A 2JOXA 2CSHA 3ZM7A 3F6HA 2EPMX 4NXNI 3QT8A 4DPWA 5K36B 4AQYI 1X6EA 4JI7I 1ZR9A 4QNKA 1Z5AA 4UT4A 5K36D 2V8PA 2HKJA 2GO3A 4IFDF 1NEIA 2EMHA 2EOJA 3D4JA 4P7DA 4M30A 2ODRC 5FWKA 3H09A 2EZ6A 2ZM6I 3HXLA 4X62E 3CWVA 2JVAA 1F2IG 1IBLE 1NZ0A 2K7IA 4NZVA 2EOOA 2C38A 1YSAC 2GQ0A 3B8HA 3WU6A 1EH6A 5JEAD 3OMLA 1XNRI 1A1KA 4DUYE 2OI2A 1RC7A 4DMIA 4DPTA 2PNLA 4URLA 2LUQA 4BHBA 1Z0EA 1RR9A 2NN6F 4LFBI 2LJPA 4F9AB 2BR2A 2RS7A 2JEAA 5C0XA 2DIXA 3T1YI 2O1WA 4NBQA 4HACB 5DRPA 4RHBB 1YFHA 2EOYA 1U2RA 4RH8A 4WX9A 2B3TB 1K47A 2RSIA 4IZKA 2UUCE 1KYQA 5A2QQ 1S16A 3K6QA 2YTGA 1I94E 4JI5E 1YZ9A 2EL4A 2WBUA 3B4TA 2EOEA 4LFCE 1J26A 1RHYA 2YTPA 4R8OA 4ED4A 4JI2E 1N32E 2KOUA 1ZBQA 2F8BA 1X49A 2YRKA 4DR3I 3J7AM 2GPIA 2IOPA 3M7ND 5AE3A 3Q6NA 4WUDA 2Q2EB 4OO1D 3EQ1A 4JI4E 5KL3A 1XMQI 4GKKI 1WHNA 1Y60A 5K36E 4LOMA 5DNLA 3JAMC 4YY3E 2E1MA 2EQ0A 2WP8A 2JOBA 2M7QA 4F9BB 3HKMA 4HYMA 2PO2A 2CVEA 1BB8A 4USMA 2NUFA 4B3SE 2LRSA 1Z0GA 1ZXMA 1UDQA 2NABA 4ZYEA 4MYTA 5KL2A 4O43A 4X64E 1N0UA 1ZXNA 5LL6R 1EI1A 1MX0A 3F6GA 1A1IA 4BA1B 1NCSA 1T4LB 2BBGA 2MKNA 2EM4A 2D9HA 2EMKA 2MDGA 5T6JA 4DR6I 4DV0I 1UDOA 4JYAI 4R03A 1IBKI 2EPPA 3P3EA 2E1RA 5GMDA 2DEIA 4IFDD 2VE7C 2VQEI 4MU4A 2EN4A 4B3TI 2ENCA 4ISAA 3J7Yp 3QT6A 2RS6A 4GKJE 1PKPA 3LNUA 2Z5CB 2EN1A 3QT5A 4LFAI 4GZNC 4B3RI 1NHIA 4LF5E 1BBGA 2DB2A 1WUUA 4FW4A 2EMBA 4MDTA 2EN2A 2X7IA 2VQFE 2EOXA 2NN6D 1B63A 2HC5A 4JI2I 2EE8A 5IT9C 2EOZA 2ZBKB 2N3GA 2YTOA 1STUA 4X8WA 2N8XA 2MC6A 1DARA 3M85D 3KRNA 2EPAA 2Q8UA 2VRDA 2EOIA 1A1GA 5EL9A 4M9VC 1LLMC 1BKNA 2C38B 2PNZA 3J81Q 3Q1QA 5TSEA 4GQUA 2CTDA 4L5NC 4LF8E 2YU5A 3HULA 4DV7I 3P1XA 3EPKA 1A1FA 4JI6E 1FJGE 2JEBB 4DR2E 1HR0I 4HXZA 1BBOA 2BR2B 4NXMI 2JEAB 5KL6A 4X66E 3OTOI 1XNQI 5JEAC 4DV4E 3HPZA 4KHPE 1A6FA 4U3BA 1EH7A 2IESA 5BR8I 1IBMI 4DU8A 4IZKB 1ZM9A 3WU5A 2AE8A 3L00A 4LF7I 2UUBE 2UXBI 2RSMA 2LBSB 1Y4UA 5IWAE 5DRRA 5A69A 3PS1A 3V5RA 4FWDA 4F6NA 1YH8A 1RMDA 3DF6A 2K4VA 1HNWI 4DR5I 4LF6I 4ZYHA 5JEAA 2V83A 4OZEA 2L2NA 5A6BD 5KL7A 3HJCA 1GTKA 4NXNE 2EMWA 2R3VA 2WP8B 2F4VI 4AQYE 5KL4A 4JI1E 4IZJD 2LTSA 4JI7E 4R1FA 2PO2B 1Z1BA 3ZZTA 2V2QA 3P06A 4FW6A 3JU0A 4WUBA 2IOQA 4OO1C 2LO3A 1AH5A 2HFSA 2EOSA 2DGCA 2WBSA 4LF4E 2EOQA 2E72A 2VESA 5A6AA 1ZM2A 3P3GA 5IT9Q 4AIMA 4IS9A 5C0XC 2ZM6E 2EM7A 1UEKA 2ADRA 4K0KI 2HJJA 4O5GA 4YHHI 2LT7A 4IS1C 1TF3A 4JV5I 1XXEA 1Z5CA 2Z5BA 1XNRE 1Z5BA 3K1JA 2BM0A 2EM3A 1X3CA 2EPOA 3C4BA 4LFBE 4FW5A 3P76A 1SFEA 2WNRA 2JP9A 1OJ4A 2FGGA 2I9IA 2L2KB 4OO1A 2V87A 3THOB 3J80C 4PRXA 2HKEA 2EPRA 2PO1A 1WRJA 3CDJA 4Z7YA 4IFDC 1T39A 4FK5C 4BC7A 4FW9A 3M7NG 2L3JA 4BA2A 4P78A 4Z7CA 3KWRA 4NHRA 4I8OA 2BA0D 4DV6I 3IWDA 2YSOA 2EQ1A 3VYXA 4LF9I 4DR3E 3V2UC 1N34I 4DR7I 2NN6C 4M1KA 4R2CA 4O4KA 3BBGA 5L3JA 3GLLA 2PNZB 1X6HA 4ZYGA 2JE6A 4GKKE 4IFDA 2BV3A 3PS2A 2EORA 4X9JA 2V2ZA 2EPKX 5K36F 2NPFA 1HNXI 1TF6A 2GLIA 1WHQA 2YZTA 1Z0CA 2PNMA 1JK2A 1E3HA 2EOMA 4BBYA 2V85A 2FTXB 4KZSA 1T4NA 1FWKA 1G2DC 2NN6A 4DV3I 3JTZA 2JPAA 4WXDA 2EN6A 5FLXC 4DV0E 2BA1G 3M6AA 2ENHA 1YYWA 4DR1E 1IBKE 4P52A 4AIDA 1B69A 3KZZA 1UDNA 1PDAA 2M4IA 2LE2A 1N36I 2YTQA 4JI5I 2EPUA 1DGCA 4B3TE 1KTVA 2LMZA 2EFGA 4F9CB 1H72C 4LCGA 1ZU1A 1IQSA 4DV1E 1Z59A 4LCFA 4B3RE 2ELZA 3GCMA 5JEAB 4XTJA 5LMNI 1PIEA 2UUAI 3M99B 2R42A 1UN6B 2V34A 3ECRA 3M85G 2UXDI 1X6FA 4N4RB 5LMUI 1O0WA 2EJ4A 4M0VA 1UHZA 2L33A 1J5EI 1H73A 2NA2A 2IHR1 5AASA 2JXPA 4LTYA 3RMPA 4DV5E 5ELWA 4JI0I 2ODRD 4JI8E 1R6LA 2H36X 2JY9A 1T38A 2B7TA 1Y5YA 2VF1A 4HEIA 4OX9I 2L6MA 1XMOE 2UU9I 2FV4B 4BHCA 4R2QA 4DV2I 4HY1A 2YTJA 2X36A 1ELOA 1H7SA 2EMAA 5AE1A 1ZBTA 5F3WA 4Q28A 1NHJA 2DEJA 2Z5BB 2YTDA 3T1HI 4DV7E 2EM2A 2A2CA 4WXCA 4DUZI 4NXME 1HR0E 2WNRB 1HNZI 4DPUA 4MU1A 2A25A 2NUGA 5LLQA 3OTOE 4OO1B 1XNQE 5A6BA 2L92A 2ELYA 1N0VC 5BR8E 2WBTA 2YTNA 4MU0A 2WCC3 2V2VA 4IZJA 4GKJI 3C6MA 3JAMQ 3MSWA 5C0XB 1N33I 2O1TA 1A1LA 2B7VA 4LF7E 4U3DA 5KL5A 2EMYA 2EL6A 1SR9A 5CFFE 1A1HA 2UXBE 2EMIA 4F2JC 2O1UA 4B3MI 3PYDA 3WU3A 2UXCI 2EOFA 2EN7A 1KIJA 3QG5C 1HNWE 4DPXA 4DR5E 2EMZA 4LF6E 1KKHA 1EA6A 1PJTA 2HFUA 4DKKA 3EPHA 3EPLA 2HHHE 2JE6B 4JI3E 5GMEA 4LF4I 4IFDB 1D6TA 2RQLA 3HQ1A 1PJQA 2EMFA 2YRMA 4LCHA 2EN8A 2VF3A 3Q6MA 4DPYA 2EM5A 2MC5A 2CG9A 2B9DA 2YU8A 5AC4A 2PO0A 5IXMB 4R2EA 4R2AA 1N3GA 2PRTA 1DI2A 4LF8I 3BIDA 1R6MA 3THNA 4BS9A 1UILA 3LTOA 2L2MA 2DLQA 5IV8B 1FKAE 1USUA 4K0KE 2NN6B 4X65I 1FNMA 2GS8A 5A2QC 3L7ZA 3P3CA 4FW7A 4KQVA 4JV5E 2HK2A 2BB8A 2EPCA 3K17A 5A6JA 2EQ3A 2YTIA 4OO1E 2J7KA 2IERA 5C0XF 1X5WA 3VK6A 1FWLA 1KVKA 4GEQB 2BA0G 4WFTA 3MHHC 5C0XE 2C37A 2DMYA 2EP3A 3T1YE 1XHKA 4EMDA 3ADLA 2YTFA 2EMGA 3AV0A 5DNYA 4DR4I 4J3DA 4P7AA 1A1JA 3UHMA 3PYFA 2M9AA 2J7JA 4DV6E 1Z0TA 4JI1I 1Z0BA 4LF9E 3F0NA 3ZZUA 2E5LI 1N34E 2LTRA 2HK3A 2R1FA 4TUGA 4DR7E 4FW3A 2RTXA 1YUIA 4F54A 4WSPA 2EMXA 4HTGA 4BC9A 4O24A 1NHHA 3J7AG 1OYPA 1ZM3A 3U1YA 2EM0A 4IFDE 1Y4SA 5ADZA 3PRYA 1MU5A 3ADJA 1G2FC 1MEYC 1PJSA 1IQOA 4M2ZA 1MG7A 1HNXE 2XEXA 1RQ0A 1XMQE 2GO4A 2CGEA 4X62I 4R2RA 1KJKA 2JEBA 1TN9A 1IBLI 3LLHA 4BCAA 1Y6ZA 1QU6A 3LPSA 1GZ6A 4IZJB 2NN6E 2LJHA 3FIGA 3UK3C 4DV3E 2YWQA 1AAYA 2AJ4A 1Z0VA 4DUYI 2M1SA 5A6KA 2EOHA 1MGTA 4MQYA 2GHFA 4ZYDA 3DD6A 5DRQA 2DMIA 3PYEA 1EH8A 3MHSC 3TQMA 1N36E 3C6KA 4DR6E 3U1KA 1H7UA 1IMUA 4JYAE 4MLVA 5K36C 5LMNE 1JK1A 2UUCI 2KONA 2UUAE 2VQEE 1EKZA 2F1DA 1I94I 3J81C 2EM9A 2UXDE 4TUIA 2C39A 4LFCI 5DNXA 5LMUE 3ZOQB 4L8NA 1J5EE 4FWHA 4DXLA 1QZRA 1N32I 4LFAE 2JR1A 1VISA 2PO0B 4OOGC 3J80Q 4JI0E 2EPXA 3DJWA 2DLKA 4WPYA 2EPNA 1L4SA 2A2DA 3H4LA 3VHTB 1H74A 4FN5A 5C0XD 2LCEA 2YPNA 4JI4I 4OX9E 4J8ZA 2UU9E 2WZOA 3QT7A 5K36A 4YY3I 3KZYA 4DV2E 1VI7A 2N3HA 2BM1A 2Z5EA 3L7ZB 1X47A 2V8QB 2YTEA 2O1VA 4RPFA 1WJPA 4AM3A 1YPNA 4R2SA 3T1HE 4B3SI 4LU9A 2L3CA 2ZITA 4KWYA 4DUZE 2EMLA 5AC5A 1HNZE 4X64I 2V86A 1UBDC 3ADIA 4PRVA 1B62A 4DR1I 4MU3A 1OYRA 4OKGA 1GQEA 2JWOA 2KHXA 1YHCA 4N3OA 3ZKDA 2EMCA 2C37B 1N33E 4DV1I 4DU7A 4MYUA 2V88A 4WUCA 2YSPA 2LVHA 2BA1D 2PO1B 2J65A 1IBME 3HTXA 3B82A 3ADGA 2ENAA 1WXRA 4B3ME 2NUEA 2EN3A 2UXCE 5AE2A 4LPFA 4HACA 1QNTA 3BGHA 3GMEA 1X48A 1E3PA 4LF5I 3ZZ0A 4BA2B 2EWLA 4DV5I 1YUJA 4Q35B 4JI8I 2V89A 2WW4A 3LMLA 4JG4A 2CZ9A 4IJDA 5FLXQ 2VQFI 2LUPB 3ZKBA 3HPSA 3B78A 3CDIA 5JEAF 1PVGA 3C4TA 5EKWA 1ZAAC 1XMOI 5JEAE 1Z0WA 2L8TA 2LV2A 3BF2A 2R76A 4BMJA 3IWBA 2JT2A 2JYAA 5DROA 2F4VE 4ZVIA 4FWGA 3AUZA 1RREA 2I13A 3GONA 1P47A 2EL5A 2CT1A 3K85A 2MDRA 3WU4A 4X65E 3EPJA 2RPCA 4WYQB 3PS3A 4MLQA 4JI6I 1FJGI 1S4EA 1USVA 3H1CA 3NZKA 3VYYA 1FI4A 4DR2I 4USKA 1P42A 4X66I 2CPNA 1YYOA 2DRPA 2HGHA 4QNJA 4DV4I 4KHPI 3IWCA 4WSGA 2G7HA 4YHHE 4PU9A 2LJUA 2EPLX 4BA1A 1DQ3A 4OO1F 3PYGA 2UUBI 2DSYA 1YYKA 4I3HA 5IWAI 2C39B 2YRHA 2MKDA 2EM6A 4R2DA 1OYSA 1ZM4A 2HHHI 4JI3I 1HK7A 4DR4E 2EPZA
chains in the Genus database with same CATH topology
4UTGA 1T4OA 2Z5CA 2E5LE 2YT4A 2JOXA 3ZM7A 3F6HA 4NXNI 3QT8A 4DPWA 4AQYI 4JI7I 1Z5AA 4UT4A 2V8PA 2HKJA 3D4JA 4P7DA 4M30A 2ODRC 5FWKA 3H09A 2EZ6A 2ZM6I 3HXLA 4X62E 3CWVA 2JVAA 1NZ0A 1IBLE 2GQ0A 3PYEA 3WU6A 3OMLA 1XNRI 4DUYE 2OI2A 1RC7A 4DMIA 4DPTA 2PNLA 4URLA 2LUQA 4LFBI 1Z0EA 1RR9A 2LJPA 4F9AB 2RS7A 2DIXA 3T1YI 2O1WA 4HACB 1U2RA 2B3TB 1K47A 4IZKA 2UUCE 5A2QQ 1S16A 3K6QA 1I94E 4JI5E 1YZ9A 4LFCE 1J26A 4R8OA 4ED4A 4JI2E 1N32E 2KOUA 1ZBQA 2F8BA 1X49A 4DR3I 3J7AM 2IOPA 5AE3A 3Q6NA 4WUDA 2Q2EB 4JI4E 1XMQI 4GKKI 1WHNA 3JAMC 4YY3E 2E1MA 2JOBA 2M7QA 4F9BB 4HYMA 4USMA 2NUFA 4B3SE 2LRSA 1Z0GA 1ZXMA 4MYTA 4X64E 1N0UA 1ZXNA 5LL6R 1EI1A 1MX0A 3F6GA 1T4LB 4DR6I 5T6JA 4DV0I 4JYAI 4R03A 1IBKI 2E1RA 5GMDA 2DEIA 2VE7C 2VQEI 4B3TI 3J7Yp 3QT6A 2RS6A 4GKJE 1PKPA 3LNUA 2Z5CB 3QT5A 4LFAI 4B3RI 1NHIA 4LF5E 2DB2A 1WUUA 2X7IA 2VQFE 1B63A 5IT9C 2ZBKB 2N3GA 1STUA 4X8WA 2MC6A 1DARA 3Q1QA 1BKNA 3J81Q 4L5NC 4LF8E 3HULA 4DV7I 4JI6E 3P1XA 4NXMI 1FJGE 4DR2E 1HR0I 4HXZA 3OTOI 4X66E 1XNQI 4DV4E 3HPZA 4KHPE 1A6FA 5BR8I 1IBMI 4DU8A 4IZKB 1ZM9A 3WU5A 4LF7I 2UUBE 2UXBI 2RSMA 2LBSB 1Y4UA 5IWAE 3V5RA 4FWDA 3DF6A 2K4VA 1HNWI 4DR5I 4LF6I 2V83A 2L2NA 3HJCA 4NXNE 2R3VA 2F4VI 4AQYE 4JI1E 4IZJD 4R1FA 2LTSA 4JI7E 3ZZTA 2V2QA 3P06A 4WUBA 3JU0A 2IOQA 2HFSA 4LF4E 1ZM2A 5IT9Q 2ZM6E 1UEKA 4K0KI 4YHHI 4JV5I 1Z5CA 2Z5BA 1XNRE 1Z5BA 3K1JA 2BM0A 4LFBE 3C4BA 1OJ4A 2FGGA 2L2KB 2V87A 3J80C 4PRXA 2HKEA 4Z7YA 4BC7A 4FW9A 2L3JA 4P78A 4Z7CA 3KWRA 4I8OA 4DV6I 3IWDA 3VYXA 4LF9I 4DR3E 3V2UC 1N34I 4DR7I 4M1KA 5L3JA 4GKKE 2BV3A 2V2ZA 2NPFA 1HNXI 1WHQA 2YZTA 1Z0CA 2PNMA 4BBYA 2V85A 2FTXB 4KZSA 1T4NA 1FWKA 4DV3I 3JTZA 5FLXC 4DV0E 3M6AA 1YYWA 4DR1E 1IBKE 4P52A 2M4IA 2LE2A 1N36I 4JI5I 4B3TE 1KTVA 2LMZA 2EFGA 4F9CB 1H72C 5LMNI 4DV1E 1Z59A 4JI2I 4B3RE 2UUAI 4XTJA 1PIEA 2R42A 2V34A 2UXDI 5LMUI 1O0WA 4M0VA 1UHZA 2L33A 1J5EI 1H73A 2NA2A 2IHR1 5AASA 4LTYA 3RMPA 4DV5E 4JI0I 2ODRD 4JI8E 2H36X 2JY9A 2B7TA 2VF1A 4OX9I 2L6MA 1XMOE 2UU9I 2FV4B 4DV2I 4HY1A 2X36A 1ELOA 1H7SA 5AE1A 1ZBTA 5F3WA 4Q28A 1NHJA 2DEJA 2Z5BB 3T1HI 4DV7E 2A2CA 4DUZI 4NXME 1HR0E 1HNZI 4DPUA 2NUGA 3OTOE 1XNQE 1N0VC 2L92A 5BR8E 2V2VA 4IZJA 4GKJI 3JAMQ 3MSWA 1N33I 2O1TA 2B7VA 4LF7E 5CFFE 1SR9A 2O1UA 2UXBE 4B3MI 3PYDA 3WU3A 2UXCI 1KIJA 1HNWE 4DPXA 4DR5E 4LF6E 1KKHA 1EA6A 2HFUA 4DKKA 2HHHE 5GMEA 4JI3E 1D6TA 3HQ1A 2VF3A 3Q6MA 4DPYA 2MC5A 2CG9A 2B9DA 3B8HA 1DI2A 4LF8I 4BS9A 1UILA 3LTOA 2L2MA 1FKAE 1USUA 4K0KE 4X65I 1FNMA 2GS8A 5A2QC 4KQVA 4JV5E 2HK2A 3K17A 2J7KA 3VK6A 1FWLA 1KVKA 4GEQB 4WFTA 2DMYA 3T1YE 1XHKA 4EMDA 3ADLA 3AV0A 5DNYA 4DR4I 4P7AA 3PYFA 4DV6E 1Z0TA 4JI1I 1Z0BA 4LF9E 3F0NA 3ZZUA 2E5LI 1N34E 2LTRA 2HK3A 4TUGA 4DR7E 2RTXA 4F54A 4WSPA 1NHHA 4BC9A 4LF4I 3J7AG 1ZM3A 1Y4SA 5ADZA 3PRYA 1MU5A 3ADJA 4M2ZA 1MG7A 1HNXE 2XEXA 1RQ0A 1XMQE 4X62I 2CGEA 1IBLI 4BCAA 3LLHA 1Y6ZA 1QU6A 3LPSA 1GZ6A 4IZJB 2LJHA 3FIGA 4DV3E 4DUYI 2AJ4A 1Z0VA 2M1SA 1N36E 4DR6E 1H7UA 4JYAE 5LMNE 2UUCI 2KONA 2UUAE 2VQEE 1EKZA 1I94I 3J81C 2UXDE 4TUIA 4LFCI 5LMUE 3ZOQB 4L8NA 1J5EE 4FWHA 4DXLA 1QZRA 1N32I 4LFAE 2JR1A 1VISA 4OOGC 3J80Q 4JI0E 3DJWA 4FN5A 4WPYA 2A2DA 3H4LA 1H74A 4JI4I 4OX9E 4J8ZA 2UU9E 2WZOA 3QT7A 4YY3I 4DV2E 2Z5EA 2N3HA 2BM1A 1X47A 2V8QB 2O1VA 4RPFA 3T1HE 4B3SI 4LU9A 2L3CA 2ZITA 4DUZE 4X64I 1HNZE 2V86A 3ADIA 4PRVA 1B62A 4DR1I 1GQEA 2JWOA 2KHXA 4N3OA 3ZKDA 1N33E 4DV1I 4DU7A 4MYUA 2V88A 4WUCA 1IBME 3HTXA 3B82A 3ADGA 1WXRA 4B3ME 2NUEA 2UXCE 5AE2A 4HACA 1X48A 4LF5I 3ZZ0A 2EWLA 4DV5I 4JI8I 2V89A 2WW4A 3LMLA 4JG4A 2CZ9A 5FLXQ 2VQFI 2LUPB 3ZKBA 3HPSA 3B78A 1PVGA 3C4TA 1XMOI 1Z0WA 2L8TA 4BMJA 3IWBA 2F4VE 4ZVIA 4FWGA 3AUZA 1RREA 3GONA 3K85A 3WU4A 2MDRA 4X65E 4WYQB 4JI6I 1FJGI 1S4EA 1USVA 4DR2I 3VYYA 1FI4A 4USKA 4X66I 2CPNA 1YYOA 4DV4I 4KHPI 3IWCA 2G7HA 4YHHE 4PU9A 1DQ3A 3PYGA 2UUBI 2DSYA 1YYKA 4I3HA 5IWAI 1ZM4A 2HHHI 4JI3I 1HK7A 4DR4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UTG A;  1T4O A;  2E5L E;  2YT4 A;  3ZM7 A;  4NXN I;  3QT8 A;  4DPW A;  4AQY I;  4JI7 I;  1Z5A A;  4UT4 A;  2V8P A;  2HKJ A;  3D4J A;  4M30 A;  2EZ6 A;  2ZM6 I;  4X62 E;  3CWV A;  2JVA A;  1NZ0 A;  1IBL E;  3PYE A;  3WU6 A;  1XNR I;  4DUY E;  2OI2 A;  1RC7 A;  4DPT A;  4URL A;  2LUQ A;  4LFB I;  1Z0E A;  1RR9 A;  2LJP A;  2RS7 A;  2DIX A;  3T1Y I;  4HAC B;  1U2R A;  2B3T B;  1K47 A;  2UUC E;  5A2Q Q;  1S16 A;  1I94 E;  4JI5 E;  1YZ9 A;  4LFC E;  1J26 A;  4ED4 A;  4JI2 E;  1N32 E;  1X49 A;  4DR3 I;  3J7A M;  4WUD A;  2Q2E B;  4JI4 E;  1XMQ I;  4GKK I;  1WHN A;  4YY3 E;  3JAM C;  4HYM A;  4USM A;  2NUF A;  4B3S E;  2LRS A;  1Z0G A;  1ZXM A;  4MYT A;  4X64 E;  1N0U A;  1ZXN A;  5LL6 R;  1EI1 A;  1MX0 A;  1T4L B;  4DR6 I;  4DV0 I;  4JYA I;  1IBK I;  2E1R A;  5GMD A;  2DEI A;  2VQE I;  4B3T I;  3J7Y p;  3QT6 A;  2RS6 A;  4GKJ E;  1PKP A;  3LNU A;  3QT5 A;  4LFA I;  4B3R I;  1NHI A;  4LF5 E;  2DB2 A;  1WUU A;  2X7I A;  2VQF E;  1B63 A;  5IT9 C;  2ZBK B;  2N3G A;  1STU A;  4X8W A;  1DAR A;  3Q1Q A;  1BKN A;  3J81 Q;  3HUL A;  4LF8 E;  4DV7 I;  4JI6 E;  3P1X A;  4NXM I;  1FJG E;  4DR2 E;  1HR0 I;  4HXZ A;  3OTO I;  4X66 E;  1XNQ I;  4DV4 E;  4KHP E;  5BR8 I;  1A6F A;  1IBM I;  4DU8 A;  1ZM9 A;  3WU5 A;  4LF7 I;  2UUB E;  2UXB I;  2RSM A;  2LBS B;  3V5R A;  5IWA E;  4FWD A;  1HNW I;  4DR5 I;  4LF6 I;  2L2N A;  4NXN E;  2R3V A;  2F4V I;  4AQY E;  4JI1 E;  4R1F A;  2LTS A;  4JI7 E;  3ZZT A;  2V2Q A;  4WUB A;  2HFS A;  4LF4 E;  1ZM2 A;  5IT9 Q;  2ZM6 E;  1UEK A;  4K0K I;  4YHH I;  4JV5 I;  1Z5C A;  1XNR E;  1Z5B A;  3K1J A;  2BM0 A;  4LFB E;  3C4B A;  1OJ4 A;  2L2K B;  4PRX A;  3J80 C;  2HKE A;  4Z7Y A;  4FW9 A;  2L3J A;  4Z7C A;  4DV6 I;  3VYX A;  4LF9 I;  4DR3 E;  3V2U C;  1N34 I;  4DR7 I;  4M1K A;  5L3J A;  4GKK E;  2BV3 A;  2V2Z A;  2NPF A;  1HNX I;  1WHQ A;  1Z0C A;  1T4N A;  1FWK A;  4DV3 I;  5FLX C;  4DV0 E;  3M6A A;  1YYW A;  4DR1 E;  1IBK E;  4P52 A;  1N36 I;  4JI5 I;  4B3T E;  1KTV A;  2EFG A;  1H72 C;  5LMN I;  4DV1 E;  1Z59 A;  4JI2 I;  4B3R E;  2UUA I;  4XTJ A;  1PIE A;  2R42 A;  2V34 A;  2UXD I;  5LMU I;  1O0W A;  1J5E I;  1UHZ A;  2L33 A;  1H73 A;  2NA2 A;  2IHR 1;  4DV5 E;  4JI0 I;  4JI8 E;  2JY9 A;  2B7T A;  4OX9 I;  1XMO E;  2UU9 I;  4DV2 I;  4HY1 A;  2X36 A;  1ELO A;  1H7S A;  1ZBT A;  1NHJ A;  2DEJ A;  3T1H I;  4DV7 E;  2A2C A;  4DUZ I;  4NXM E;  1HR0 E;  1HNZ I;  4DPU A;  2NUG A;  3OTO E;  1XNQ E;  1N0V C;  5BR8 E;  2V2V A;  4GKJ I;  3JAM Q;  1N33 I;  2B7V A;  4LF7 E;  5CFF E;  2UXB E;  4B3M I;  3PYD A;  3WU3 A;  2UXC I;  1KIJ A;  1HNW E;  4DPX A;  4DR5 E;  4LF6 E;  1KKH A;  1EA6 A;  2HFU A;  4DKK A;  2HHH E;  5GME A;  4JI3 E;  1D6T A;  2VF3 A;  4DPY A;  3B8H A;  1DI2 A;  4LF8 I;  1UIL A;  3LTO A;  2L2M A;  1FKA E;  4K0K E;  4X65 I;  1FNM A;  2GS8 A;  5A2Q C;  4KQV A;  4JV5 E;  2HK2 A;  3K17 A;  2J7K A;  1FWL A;  1KVK A;  4WFT A;  2DMY A;  3T1Y E;  1XHK A;  4EMD A;  3ADL A;  4DR4 I;  4P7A A;  3PYF A;  4DV6 E;  1Z0T A;  4JI1 I;  1Z0B A;  4LF9 E;  3F0N A;  3ZZU A;  2E5L I;  1N34 E;  2LTR A;  2HK3 A;  4DR7 E;  2RTX A;  4LF4 I;  1NHH A;  3J7A G;  1ZM3 A;  1MU5 A;  3ADJ A;  4M2Z A;  1MG7 A;  1HNX E;  2XEX A;  1RQ0 A;  1XMQ E;  4X62 I;  1IBL I;  3LLH A;  1QU6 A;  3LPS A;  2LJH A;  4DV3 E;  4DUY I;  2AJ4 A;  1Z0V A;  1N36 E;  4DR6 E;  1H7U A;  4JYA E;  5LMN E;  2UUC I;  2UUA E;  2VQE E;  1EKZ A;  1I94 I;  3J81 C;  2UXD E;  4LFC I;  5LMU E;  1J5E E;  4FWH A;  4DXL A;  1QZR A;  1N32 I;  4LFA E;  1VIS A;  4OOG C;  3J80 Q;  4JI0 E;  4FN5 A;  2A2D A;  3H4L A;  1H74 A;  4JI4 I;  4OX9 E;  2UU9 E;  3QT7 A;  4YY3 I;  4DV2 E;  2N3H A;  2BM1 A;  1X47 A;  4RPF A;  3T1H E;  4B3S I;  2L3C A;  2ZIT A;  4DUZ E;  4X64 I;  1HNZ E;  3ADI A;  4PRV A;  1B62 A;  4DR1 I;  1GQE A;  2KHX A;  3ZKD A;  1N33 E;  4DV1 I;  4DU7 A;  4MYU A;  4WUC A;  1IBM E;  3HTX A;  3B82 A;  3ADG A;  4B3M E;  2NUE A;  2UXC E;  4HAC A;  1X48 A;  4LF5 I;  3ZZ0 A;  4DV5 I;  4JI8 I;  2WW4 A;  4JG4 A;  2CZ9 A;  5FLX Q;  2VQF I;  2LUP B;  3ZKB A;  3B78 A;  1PVG A;  3C4T A;  1XMO I;  1Z0W A;  2F4V E;  4ZVI A;  4FWG A;  1RRE A;  3GON A;  3WU4 A;  2MDR A;  4X65 E;  4WYQ B;  4JI6 I;  1FJG I;  1S4E A;  4DR2 I;  3VYY A;  1FI4 A;  4USK A;  4X66 I;  2CPN A;  1YYO A;  4DV4 I;  4KHP I;  4PU9 A;  4YHH E;  3PYG A;  2UUB I;  1YYK A;  4I3H A;  5IWA I;  1ZM4 A;  2HHH I;  4JI3 I;  4DR4 E; 
#chains in the Genus database with same CATH topology
 4UTG A;  4F6M A;  2O3Z A;  1T4O A;  2Z5C A;  1UDS A;  4R2P A;  2EM8 A;  2E5L E;  2YT4 A;  2JOX A;  2CSH A;  3ZM7 A;  3F6H A;  2EPM X;  4NXN I;  3QT8 A;  4DPW A;  5K36 B;  4AQY I;  1X6E A;  4JI7 I;  1ZR9 A;  4QNK A;  1Z5A A;  4UT4 A;  5K36 D;  2V8P A;  2HKJ A;  2GO3 A;  4IFD F;  1NEI A;  2EMH A;  2EOJ A;  3D4J A;  4P7D A;  4M30 A;  2ODR C;  5FWK A;  3H09 A;  2EZ6 A;  2ZM6 I;  3HXL A;  4X62 E;  3CWV A;  2JVA A;  1F2I G;  1IBL E;  1NZ0 A;  2K7I A;  4NZV A;  2EOO A;  2C38 A;  1YSA C;  2GQ0 A;  3B8H A;  3WU6 A;  1EH6 A;  5JEA D;  3OML A;  1XNR I;  1A1K A;  4DUY E;  2OI2 A;  1RC7 A;  4DMI A;  4DPT A;  2PNL A;  4URL A;  2LUQ A;  4BHB A;  1Z0E A;  1RR9 A;  2NN6 F;  4LFB I;  2LJP A;  4F9A B;  2BR2 A;  2RS7 A;  2JEA A;  5C0X A;  2DIX A;  3T1Y I;  2O1W A;  4NBQ A;  4HAC B;  5DRP A;  4RHB B;  1YFH A;  2EOY A;  1U2R A;  4RH8 A;  4WX9 A;  2B3T B;  1K47 A;  2RSI A;  4IZK A;  2UUC E;  1KYQ A;  5A2Q Q;  1S16 A;  3K6Q A;  2YTG A;  1I94 E;  4JI5 E;  1YZ9 A;  2EL4 A;  2WBU A;  3B4T A;  2EOE A;  4LFC E;  1J26 A;  1RHY A;  2YTP A;  4R8O A;  4ED4 A;  4JI2 E;  1N32 E;  2KOU A;  1ZBQ A;  2F8B A;  1X49 A;  2YRK A;  4DR3 I;  3J7A M;  2GPI A;  2IOP A;  3M7N D;  5AE3 A;  3Q6N A;  4WUD A;  2Q2E B;  4OO1 D;  3EQ1 A;  4JI4 E;  5KL3 A;  1XMQ I;  4GKK I;  1WHN A;  1Y60 A;  5K36 E;  4LOM A;  5DNL A;  3JAM C;  4YY3 E;  2E1M A;  2EQ0 A;  2WP8 A;  2JOB A;  2M7Q A;  4F9B B;  3HKM A;  4HYM A;  2PO2 A;  2CVE A;  1BB8 A;  4USM A;  2NUF A;  4B3S E;  2LRS A;  1Z0G A;  1ZXM A;  1UDQ A;  2NAB A;  4ZYE A;  4MYT A;  5KL2 A;  4O43 A;  4X64 E;  1N0U A;  1ZXN A;  5LL6 R;  1EI1 A;  1MX0 A;  3F6G A;  1A1I A;  4BA1 B;  1NCS A;  1T4L B;  2BBG A;  2MKN A;  2EM4 A;  2D9H A;  2EMK A;  2MDG A;  5T6J A;  4DR6 I;  4DV0 I;  1UDO A;  4JYA I;  4R03 A;  1IBK I;  2EPP A;  3P3E A;  2E1R A;  5GMD A;  2DEI A;  4IFD D;  2VE7 C;  2VQE I;  4MU4 A;  2EN4 A;  4B3T I;  2ENC A;  4ISA A;  3J7Y p;  3QT6 A;  2RS6 A;  4GKJ E;  1PKP A;  3LNU A;  2Z5C B;  2EN1 A;  3QT5 A;  4LFA I;  4GZN C;  4B3R I;  1NHI A;  4LF5 E;  1BBG A;  2DB2 A;  1WUU A;  4FW4 A;  2EMB A;  4MDT A;  2EN2 A;  2X7I A;  2VQF E;  2EOX A;  2NN6 D;  1B63 A;  2HC5 A;  4JI2 I;  2EE8 A;  5IT9 C;  2EOZ A;  2ZBK B;  2N3G A;  2YTO A;  1STU A;  4X8W A;  2N8X A;  2MC6 A;  1DAR A;  3M85 D;  3KRN A;  2EPA A;  2Q8U A;  2VRD A;  2EOI A;  1A1G A;  5EL9 A;  4M9V C;  1LLM C;  1BKN A;  2C38 B;  2PNZ A;  3J81 Q;  3Q1Q A;  5TSE A;  4GQU A;  2CTD A;  4L5N C;  4LF8 E;  2YU5 A;  3HUL A;  4DV7 I;  3P1X A;  3EPK A;  1A1F A;  4JI6 E;  1FJG E;  2JEB B;  4DR2 E;  1HR0 I;  4HXZ A;  1BBO A;  2BR2 B;  4NXM I;  2JEA B;  5KL6 A;  4X66 E;  3OTO I;  1XNQ I;  5JEA C;  4DV4 E;  3HPZ A;  4KHP E;  1A6F A;  4U3B A;  1EH7 A;  2IES A;  5BR8 I;  1IBM I;  4DU8 A;  4IZK B;  1ZM9 A;  3WU5 A;  2AE8 A;  3L00 A;  4LF7 I;  2UUB E;  2UXB I;  2RSM A;  2LBS B;  1Y4U A;  5IWA E;  5DRR A;  5A69 A;  3PS1 A;  3V5R A;  4FWD A;  4F6N A;  1YH8 A;  1RMD A;  3DF6 A;  2K4V A;  1HNW I;  4DR5 I;  4LF6 I;  4ZYH A;  5JEA A;  2V83 A;  4OZE A;  2L2N A;  5A6B D;  5KL7 A;  3HJC A;  1GTK A;  4NXN E;  2EMW A;  2R3V A;  2WP8 B;  2F4V I;  4AQY E;  5KL4 A;  4JI1 E;  4IZJ D;  2LTS A;  4JI7 E;  4R1F A;  2PO2 B;  1Z1B A;  3ZZT A;  2V2Q A;  3P06 A;  4FW6 A;  3JU0 A;  4WUB A;  2IOQ A;  4OO1 C;  2LO3 A;  1AH5 A;  2HFS A;  2EOS A;  2DGC A;  2WBS A;  4LF4 E;  2EOQ A;  2E72 A;  2VES A;  5A6A A;  1ZM2 A;  3P3G A;  5IT9 Q;  4AIM A;  4IS9 A;  5C0X C;  2ZM6 E;  2EM7 A;  1UEK A;  2ADR A;  4K0K I;  2HJJ A;  4O5G A;  4YHH I;  2LT7 A;  4IS1 C;  1TF3 A;  4JV5 I;  1XXE A;  1Z5C A;  2Z5B A;  1XNR E;  1Z5B A;  3K1J A;  2BM0 A;  2EM3 A;  1X3C A;  2EPO A;  3C4B A;  4LFB E;  4FW5 A;  3P76 A;  1SFE A;  2WNR A;  2JP9 A;  1OJ4 A;  2FGG A;  2I9I A;  2L2K B;  4OO1 A;  2V87 A;  3THO B;  3J80 C;  4PRX A;  2HKE A;  2EPR A;  2PO1 A;  1WRJ A;  3CDJ A;  4Z7Y A;  4IFD C;  1T39 A;  4FK5 C;  4BC7 A;  4FW9 A;  3M7N G;  2L3J A;  4BA2 A;  4P78 A;  4Z7C A;  3KWR A;  4NHR A;  4I8O A;  2BA0 D;  4DV6 I;  3IWD A;  2YSO A;  2EQ1 A;  3VYX A;  4LF9 I;  4DR3 E;  3V2U C;  1N34 I;  4DR7 I;  2NN6 C;  4M1K A;  4R2C A;  4O4K A;  3BBG A;  5L3J A;  3GLL A;  2PNZ B;  1X6H A;  4ZYG A;  2JE6 A;  4GKK E;  4IFD A;  2BV3 A;  3PS2 A;  2EOR A;  4X9J A;  2V2Z A;  2EPK X;  5K36 F;  2NPF A;  1HNX I;  1TF6 A;  2GLI A;  1WHQ A;  2YZT A;  1Z0C A;  2PNM A;  1JK2 A;  1E3H A;  2EOM A;  4BBY A;  2V85 A;  2FTX B;  4KZS A;  1T4N A;  1FWK A;  1G2D C;  2NN6 A;  4DV3 I;  3JTZ A;  2JPA A;  4WXD A;  2EN6 A;  5FLX C;  4DV0 E;  2BA1 G;  3M6A A;  2ENH A;  1YYW A;  4DR1 E;  1IBK E;  4P52 A;  4AID A;  1B69 A;  3KZZ A;  1UDN A;  1PDA A;  2M4I A;  2LE2 A;  1N36 I;  2YTQ A;  4JI5 I;  2EPU A;  1DGC A;  4B3T E;  1KTV A;  2LMZ A;  2EFG A;  4F9C B;  1H72 C;  4LCG A;  1ZU1 A;  1IQS A;  4DV1 E;  1Z59 A;  4LCF A;  4B3R E;  2ELZ A;  3GCM A;  5JEA B;  4XTJ A;  5LMN I;  1PIE A;  2UUA I;  3M99 B;  2R42 A;  1UN6 B;  2V34 A;  3ECR A;  3M85 G;  2UXD I;  1X6F A;  4N4R B;  5LMU I;  1O0W A;  2EJ4 A;  4M0V A;  1UHZ A;  2L33 A;  1J5E I;  1H73 A;  2NA2 A;  2IHR 1;  5AAS A;  2JXP A;  4LTY A;  3RMP A;  4DV5 E;  5ELW A;  4JI0 I;  2ODR D;  4JI8 E;  1R6L A;  2H36 X;  2JY9 A;  1T38 A;  2B7T A;  1Y5Y A;  2VF1 A;  4HEI A;  4OX9 I;  2L6M A;  1XMO E;  2UU9 I;  2FV4 B;  4BHC A;  4R2Q A;  4DV2 I;  4HY1 A;  2YTJ A;  2X36 A;  1ELO A;  1H7S A;  2EMA A;  5AE1 A;  1ZBT A;  5F3W A;  4Q28 A;  1NHJ A;  2DEJ A;  2Z5B B;  2YTD A;  3T1H I;  4DV7 E;  2EM2 A;  2A2C A;  4WXC A;  4DUZ I;  4NXM E;  1HR0 E;  2WNR B;  1HNZ I;  4DPU A;  4MU1 A;  2A25 A;  2NUG A;  5LLQ A;  3OTO E;  4OO1 B;  1XNQ E;  5A6B A;  2L92 A;  2ELY A;  1N0V C;  5BR8 E;  2WBT A;  2YTN A;  4MU0 A;  2WCC 3;  2V2V A;  4IZJ A;  4GKJ I;  3C6M A;  3JAM Q;  3MSW A;  5C0X B;  1N33 I;  2O1T A;  1A1L A;  2B7V A;  4LF7 E;  4U3D A;  5KL5 A;  2EMY A;  2EL6 A;  1SR9 A;  5CFF E;  1A1H A;  2UXB E;  2EMI A;  4F2J C;  2O1U A;  4B3M I;  3PYD A;  3WU3 A;  2UXC I;  2EOF A;  2EN7 A;  1KIJ A;  3QG5 C;  1HNW E;  4DPX A;  4DR5 E;  2EMZ A;  4LF6 E;  1KKH A;  1EA6 A;  1PJT A;  2HFU A;  4DKK A;  3EPH A;  3EPL A;  2HHH E;  2JE6 B;  4JI3 E;  5GME A;  4LF4 I;  4IFD B;  1D6T A;  2RQL A;  3HQ1 A;  1PJQ A;  2EMF A;  2YRM A;  4LCH A;  2EN8 A;  2VF3 A;  3Q6M A;  4DPY A;  2EM5 A;  2MC5 A;  2CG9 A;  2B9D A;  2YU8 A;  5AC4 A;  2PO0 A;  5IXM B;  4R2E A;  4R2A A;  1N3G A;  2PRT A;  1DI2 A;  4LF8 I;  3BID A;  1R6M A;  3THN A;  4BS9 A;  1UIL A;  3LTO A;  2L2M A;  2DLQ A;  5IV8 B;  1FKA E;  1USU A;  4K0K E;  2NN6 B;  4X65 I;  1FNM A;  2GS8 A;  5A2Q C;  3L7Z A;  3P3C A;  4FW7 A;  4KQV A;  4JV5 E;  2HK2 A;  2BB8 A;  2EPC A;  3K17 A;  5A6J A;  2EQ3 A;  2YTI A;  4OO1 E;  2J7K A;  2IER A;  5C0X F;  1X5W A;  3VK6 A;  1FWL A;  1KVK A;  4GEQ B;  2BA0 G;  4WFT A;  3MHH C;  5C0X E;  2C37 A;  2DMY A;  2EP3 A;  3T1Y E;  1XHK A;  4EMD A;  3ADL A;  2YTF A;  2EMG A;  3AV0 A;  5DNY A;  4DR4 I;  4J3D A;  4P7A A;  1A1J A;  3UHM A;  3PYF A;  2M9A A;  2J7J A;  4DV6 E;  1Z0T A;  4JI1 I;  1Z0B A;  4LF9 E;  3F0N A;  3ZZU A;  2E5L I;  1N34 E;  2LTR A;  2HK3 A;  2R1F A;  4TUG A;  4DR7 E;  4FW3 A;  2RTX A;  1YUI A;  4F54 A;  4WSP A;  2EMX A;  4HTG A;  4BC9 A;  4O24 A;  1NHH A;  3J7A G;  1OYP A;  1ZM3 A;  3U1Y A;  2EM0 A;  4IFD E;  1Y4S A;  5ADZ A;  3PRY A;  1MU5 A;  3ADJ A;  1G2F C;  1MEY C;  1PJS A;  1IQO A;  4M2Z A;  1MG7 A;  1HNX E;  2XEX A;  1RQ0 A;  1XMQ E;  2GO4 A;  2CGE A;  4X62 I;  4R2R A;  1KJK A;  2JEB A;  1TN9 A;  1IBL I;  3LLH A;  4BCA A;  1Y6Z A;  1QU6 A;  3LPS A;  1GZ6 A;  4IZJ B;  2NN6 E;  2LJH A;  3FIG A;  3UK3 C;  4DV3 E;  2YWQ A;  1AAY A;  2AJ4 A;  1Z0V A;  4DUY I;  2M1S A;  5A6K A;  2EOH A;  1MGT A;  4MQY A;  2GHF A;  4ZYD A;  3DD6 A;  5DRQ A;  2DMI A;  3PYE A;  1EH8 A;  3MHS C;  3TQM A;  1N36 E;  3C6K A;  4DR6 E;  3U1K A;  1H7U A;  1IMU A;  4JYA E;  4MLV A;  5K36 C;  5LMN E;  1JK1 A;  2UUC I;  2KON A;  2UUA E;  2VQE E;  1EKZ A;  2F1D A;  1I94 I;  3J81 C;  2EM9 A;  2UXD E;  4TUI A;  2C39 A;  4LFC I;  5DNX A;  5LMU E;  3ZOQ B;  4L8N A;  1J5E E;  4FWH A;  4DXL A;  1QZR A;  1N32 I;  4LFA E;  2JR1 A;  1VIS A;  2PO0 B;  4OOG C;  3J80 Q;  4JI0 E;  2EPX A;  3DJW A;  2DLK A;  4WPY A;  2EPN A;  1L4S A;  2A2D A;  3H4L A;  3VHT B;  1H74 A;  4FN5 A;  5C0X D;  2LCE A;  2YPN A;  4JI4 I;  4OX9 E;  4J8Z A;  2UU9 E;  2WZO A;  3QT7 A;  5K36 A;  4YY3 I;  3KZY A;  4DV2 E;  1VI7 A;  2N3H A;  2BM1 A;  2Z5E A;  3L7Z B;  1X47 A;  2V8Q B;  2YTE A;  2O1V A;  4RPF A;  1WJP A;  4AM3 A;  1YPN A;  4R2S A;  3T1H E;  4B3S I;  4LU9 A;  2L3C A;  2ZIT A;  4KWY A;  4DUZ E;  2EML A;  5AC5 A;  1HNZ E;  4X64 I;  2V86 A;  1UBD C;  3ADI A;  4PRV A;  1B62 A;  4DR1 I;  4MU3 A;  1OYR A;  4OKG A;  1GQE A;  2JWO A;  2KHX A;  1YHC A;  4N3O A;  3ZKD A;  2EMC A;  2C37 B;  1N33 E;  4DV1 I;  4DU7 A;  4MYU A;  2V88 A;  4WUC A;  2YSP A;  2LVH A;  2BA1 D;  2PO1 B;  2J65 A;  1IBM E;  3HTX A;  3B82 A;  3ADG A;  2ENA A;  1WXR A;  4B3M E;  2NUE A;  2EN3 A;  2UXC E;  5AE2 A;  4LPF A;  4HAC A;  1QNT A;  3BGH A;  3GME A;  1X48 A;  1E3P A;  4LF5 I;  3ZZ0 A;  4BA2 B;  2EWL A;  4DV5 I;  1YUJ A;  4Q35 B;  4JI8 I;  2V89 A;  2WW4 A;  3LML A;  4JG4 A;  2CZ9 A;  4IJD A;  5FLX Q;  2VQF I;  2LUP B;  3ZKB A;  3HPS A;  3B78 A;  3CDI A;  5JEA F;  1PVG A;  3C4T A;  5EKW A;  1ZAA C;  1XMO I;  5JEA E;  1Z0W A;  2L8T A;  2LV2 A;  3BF2 A;  2R76 A;  4BMJ A;  3IWB A;  2JT2 A;  2JYA A;  5DRO A;  2F4V E;  4ZVI A;  4FWG A;  3AUZ A;  1RRE A;  2I13 A;  3GON A;  1P47 A;  2EL5 A;  2CT1 A;  3K85 A;  2MDR A;  3WU4 A;  4X65 E;  3EPJ A;  2RPC A;  4WYQ B;  3PS3 A;  4MLQ A;  4JI6 I;  1FJG I;  1S4E A;  1USV A;  3H1C A;  3NZK A;  3VYY A;  1FI4 A;  4DR2 I;  4USK A;  1P42 A;  4X66 I;  2CPN A;  1YYO A;  2DRP A;  2HGH A;  4QNJ A;  4DV4 I;  4KHP I;  3IWC A;  4WSG A;  2G7H A;  4YHH E;  4PU9 A;  2LJU A;  2EPL X;  4BA1 A;  1DQ3 A;  4OO1 F;  3PYG A;  2UUB I;  2DSY A;  1YYK A;  4I3H A;  5IWA I;  2C39 B;  2YRH A;  2MKD A;  2EM6 A;  4R2D A;  1OYS A;  1ZM4 A;  2HHH I;  4JI3 I;  1HK7 A;  4DR4 E;  2EPZ A; 
#chains in the Genus database with same CATH homology
 4UTG A;  1T4O A;  2Z5C A;  2E5L E;  2YT4 A;  2JOX A;  3ZM7 A;  3F6H A;  4NXN I;  3QT8 A;  4DPW A;  4AQY I;  4JI7 I;  1Z5A A;  4UT4 A;  2V8P A;  2HKJ A;  3D4J A;  4P7D A;  4M30 A;  2ODR C;  5FWK A;  3H09 A;  2EZ6 A;  2ZM6 I;  3HXL A;  4X62 E;  3CWV A;  2JVA A;  1NZ0 A;  1IBL E;  2GQ0 A;  3PYE A;  3WU6 A;  3OML A;  1XNR I;  4DUY E;  2OI2 A;  1RC7 A;  4DMI A;  4DPT A;  2PNL A;  4URL A;  2LUQ A;  4LFB I;  1Z0E A;  1RR9 A;  2LJP A;  4F9A B;  2RS7 A;  2DIX A;  3T1Y I;  2O1W A;  4HAC B;  1U2R A;  2B3T B;  1K47 A;  4IZK A;  2UUC E;  5A2Q Q;  1S16 A;  3K6Q A;  1I94 E;  4JI5 E;  1YZ9 A;  4LFC E;  1J26 A;  4R8O A;  4ED4 A;  4JI2 E;  1N32 E;  2KOU A;  1ZBQ A;  2F8B A;  1X49 A;  4DR3 I;  3J7A M;  2IOP A;  5AE3 A;  3Q6N A;  4WUD A;  2Q2E B;  4JI4 E;  1XMQ I;  4GKK I;  1WHN A;  3JAM C;  4YY3 E;  2E1M A;  2JOB A;  2M7Q A;  4F9B B;  4HYM A;  4USM A;  2NUF A;  4B3S E;  2LRS A;  1Z0G A;  1ZXM A;  4MYT A;  4X64 E;  1N0U A;  1ZXN A;  5LL6 R;  1EI1 A;  1MX0 A;  3F6G A;  1T4L B;  4DR6 I;  5T6J A;  4DV0 I;  4JYA I;  4R03 A;  1IBK I;  2E1R A;  5GMD A;  2DEI A;  2VE7 C;  2VQE I;  4B3T I;  3J7Y p;  3QT6 A;  2RS6 A;  4GKJ E;  1PKP A;  3LNU A;  2Z5C B;  3QT5 A;  4LFA I;  4B3R I;  1NHI A;  4LF5 E;  2DB2 A;  1WUU A;  2X7I A;  2VQF E;  1B63 A;  5IT9 C;  2ZBK B;  2N3G A;  1STU A;  4X8W A;  2MC6 A;  1DAR A;  3Q1Q A;  1BKN A;  3J81 Q;  4L5N C;  4LF8 E;  3HUL A;  4DV7 I;  4JI6 E;  3P1X A;  4NXM I;  1FJG E;  4DR2 E;  1HR0 I;  4HXZ A;  3OTO I;  4X66 E;  1XNQ I;  4DV4 E;  3HPZ A;  4KHP E;  1A6F A;  5BR8 I;  1IBM I;  4DU8 A;  4IZK B;  1ZM9 A;  3WU5 A;  4LF7 I;  2UUB E;  2UXB I;  2RSM A;  2LBS B;  1Y4U A;  5IWA E;  3V5R A;  4FWD A;  3DF6 A;  2K4V A;  1HNW I;  4DR5 I;  4LF6 I;  2V83 A;  2L2N A;  3HJC A;  4NXN E;  2R3V A;  2F4V I;  4AQY E;  4JI1 E;  4IZJ D;  4R1F A;  2LTS A;  4JI7 E;  3ZZT A;  2V2Q A;  3P06 A;  4WUB A;  3JU0 A;  2IOQ A;  2HFS A;  4LF4 E;  1ZM2 A;  5IT9 Q;  2ZM6 E;  1UEK A;  4K0K I;  4YHH I;  4JV5 I;  1Z5C A;  2Z5B A;  1XNR E;  1Z5B A;  3K1J A;  2BM0 A;  4LFB E;  3C4B A;  1OJ4 A;  2FGG A;  2L2K B;  2V87 A;  3J80 C;  4PRX A;  2HKE A;  4Z7Y A;  4BC7 A;  4FW9 A;  2L3J A;  4P78 A;  4Z7C A;  3KWR A;  4I8O A;  4DV6 I;  3IWD A;  3VYX A;  4LF9 I;  4DR3 E;  3V2U C;  1N34 I;  4DR7 I;  4M1K A;  5L3J A;  4GKK E;  2BV3 A;  2V2Z A;  2NPF A;  1HNX I;  1WHQ A;  2YZT A;  1Z0C A;  2PNM A;  4BBY A;  2V85 A;  2FTX B;  4KZS A;  1T4N A;  1FWK A;  4DV3 I;  3JTZ A;  5FLX C;  4DV0 E;  3M6A A;  1YYW A;  4DR1 E;  1IBK E;  4P52 A;  2M4I A;  2LE2 A;  1N36 I;  4JI5 I;  4B3T E;  1KTV A;  2LMZ A;  2EFG A;  4F9C B;  1H72 C;  5LMN I;  4DV1 E;  1Z59 A;  4JI2 I;  4B3R E;  2UUA I;  4XTJ A;  1PIE A;  2R42 A;  2V34 A;  2UXD I;  5LMU I;  1O0W A;  4M0V A;  1UHZ A;  2L33 A;  1J5E I;  1H73 A;  2NA2 A;  2IHR 1;  5AAS A;  4LTY A;  3RMP A;  4DV5 E;  4JI0 I;  2ODR D;  4JI8 E;  2H36 X;  2JY9 A;  2B7T A;  2VF1 A;  4OX9 I;  2L6M A;  1XMO E;  2UU9 I;  2FV4 B;  4DV2 I;  4HY1 A;  2X36 A;  1ELO A;  1H7S A;  5AE1 A;  1ZBT A;  5F3W A;  4Q28 A;  1NHJ A;  2DEJ A;  2Z5B B;  3T1H I;  4DV7 E;  2A2C A;  4DUZ I;  4NXM E;  1HR0 E;  1HNZ I;  4DPU A;  2NUG A;  3OTO E;  1XNQ E;  1N0V C;  2L92 A;  5BR8 E;  2V2V A;  4IZJ A;  4GKJ I;  3JAM Q;  3MSW A;  1N33 I;  2O1T A;  2B7V A;  4LF7 E;  5CFF E;  1SR9 A;  2O1U A;  2UXB E;  4B3M I;  3PYD A;  3WU3 A;  2UXC I;  1KIJ A;  1HNW E;  4DPX A;  4DR5 E;  4LF6 E;  1KKH A;  1EA6 A;  2HFU A;  4DKK A;  2HHH E;  5GME A;  4JI3 E;  1D6T A;  3HQ1 A;  2VF3 A;  3Q6M A;  4DPY A;  2MC5 A;  2CG9 A;  2B9D A;  3B8H A;  1DI2 A;  4LF8 I;  4BS9 A;  1UIL A;  3LTO A;  2L2M A;  1FKA E;  1USU A;  4K0K E;  4X65 I;  1FNM A;  2GS8 A;  5A2Q C;  4KQV A;  4JV5 E;  2HK2 A;  3K17 A;  2J7K A;  3VK6 A;  1FWL A;  1KVK A;  4GEQ B;  4WFT A;  2DMY A;  3T1Y E;  1XHK A;  4EMD A;  3ADL A;  3AV0 A;  5DNY A;  4DR4 I;  4P7A A;  3PYF A;  4DV6 E;  1Z0T A;  4JI1 I;  1Z0B A;  4LF9 E;  3F0N A;  3ZZU A;  2E5L I;  1N34 E;  2LTR A;  2HK3 A;  4TUG A;  4DR7 E;  2RTX A;  4F54 A;  4WSP A;  1NHH A;  4BC9 A;  4LF4 I;  3J7A G;  1ZM3 A;  1Y4S A;  5ADZ A;  3PRY A;  1MU5 A;  3ADJ A;  4M2Z A;  1MG7 A;  1HNX E;  2XEX A;  1RQ0 A;  1XMQ E;  4X62 I;  2CGE A;  1IBL I;  4BCA A;  3LLH A;  1Y6Z A;  1QU6 A;  3LPS A;  1GZ6 A;  4IZJ B;  2LJH A;  3FIG A;  4DV3 E;  4DUY I;  2AJ4 A;  1Z0V A;  2M1S A;  1N36 E;  4DR6 E;  1H7U A;  4JYA E;  5LMN E;  2UUC I;  2KON A;  2UUA E;  2VQE E;  1EKZ A;  1I94 I;  3J81 C;  2UXD E;  4TUI A;  4LFC I;  5LMU E;  3ZOQ B;  4L8N A;  1J5E E;  4FWH A;  4DXL A;  1QZR A;  1N32 I;  4LFA E;  2JR1 A;  1VIS A;  4OOG C;  3J80 Q;  4JI0 E;  3DJW A;  4FN5 A;  4WPY A;  2A2D A;  3H4L A;  1H74 A;  4JI4 I;  4OX9 E;  4J8Z A;  2UU9 E;  2WZO A;  3QT7 A;  4YY3 I;  4DV2 E;  2Z5E A;  2N3H A;  2BM1 A;  1X47 A;  2V8Q B;  2O1V A;  4RPF A;  3T1H E;  4B3S I;  4LU9 A;  2L3C A;  2ZIT A;  4DUZ E;  4X64 I;  1HNZ E;  2V86 A;  3ADI A;  4PRV A;  1B62 A;  4DR1 I;  1GQE A;  2JWO A;  2KHX A;  4N3O A;  3ZKD A;  1N33 E;  4DV1 I;  4DU7 A;  4MYU A;  2V88 A;  4WUC A;  1IBM E;  3HTX A;  3B82 A;  3ADG A;  1WXR A;  4B3M E;  2NUE A;  2UXC E;  5AE2 A;  4HAC A;  1X48 A;  4LF5 I;  3ZZ0 A;  2EWL A;  4DV5 I;  4JI8 I;  2V89 A;  2WW4 A;  3LML A;  4JG4 A;  2CZ9 A;  5FLX Q;  2VQF I;  2LUP B;  3ZKB A;  3HPS A;  3B78 A;  1PVG A;  3C4T A;  1XMO I;  1Z0W A;  2L8T A;  4BMJ A;  3IWB A;  2F4V E;  4ZVI A;  4FWG A;  3AUZ A;  1RRE A;  3GON A;  3K85 A;  3WU4 A;  2MDR A;  4X65 E;  4WYQ B;  4JI6 I;  1FJG I;  1S4E A;  1USV A;  4DR2 I;  3VYY A;  1FI4 A;  4USK A;  4X66 I;  2CPN A;  1YYO A;  4DV4 I;  4KHP I;  3IWC A;  2G7H A;  4YHH E;  4PU9 A;  1DQ3 A;  3PYG A;  2UUB I;  2DSY A;  1YYK A;  4I3H A;  5IWA I;  1ZM4 A;  2HHH I;  4JI3 I;  1HK7 A;  4DR4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...