4DV6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv6E02
1N32E 4LF5I 1YYKA 4DV6E 1HNWE 2X36A 2E1RA 3HTXA 4P7AA 1X49A 3J80Q 3F0NA 2R3VA 1O0WA 2L2MA 2UU9I 4DU7A 1HNXI 3J81C 1FKAE 3P1XA 2EFGA 4DPYA 1HR0E 4AQYE 1XMOI 4YHHE 2LTRA 2UUCI 1PVGA 1HNZE 4DV5E 3VYYA 5BR8E 2UXBE 2OI2A 1H7SA 5LMNI 4JI0E 3LLHA 4GKKE 1I94I 1U2RA 4DR5I 4JI3I 4DR7E 2E5LE 4LF8E 4USMA 1XNRE 2N3HA 4DU8A 2NUFA 2B7VA 2ZM6E 1YYWA 4UTGA 2HFUA 4B3SI 1DARA 4FWDA 2R42A 3JAMC 2A2DA 4GKJI 4LFBE 4P52A 1N36I 4JI1E 2LTSA 4DR6E 4HACA 4JI7I 4FWGA 1GQEA 1Z0GA 2UUBE 4X64I 3LPSA 1RREA 2VQEI 1FJGE 4DV0I 4KHPE 4B3RI 3QT5A 1H72C 4HYMA 2HHHI 4JI8I 3ADGA 4DKKA 2V2QA 1Z0CA 2X7IA 4X66I 4MYUA 4B3ME 1D6TA 4PRXA 1J5EE 1EA6A 2V34A 1STUA 2VF3A 3J7Yp 3LNUA 4EMDA 5LMUE 2NUGA 2NUEA 4X8WA 2YT4A 2L3CA 1ZM3A 1EI1A 3J7AM 1XHKA 4HACB 3V5RA 4DV1I 4ZVIA 4WUCA 5L3JA 1N32I 5GMDA 4JI6E 4DPTA 1H73A 1YZ9A 3V2UC 4DV6I 1HNWI 1T4NA 4WUDA 2IHR1 4OX9E 2DEJA 4LFAE 4DUZE 4DR4E 3D4JA 5GMEA 1FWLA 2HK2A 3B78A 3ZM7A 5IT9Q 3K1JA 5IWAE 4JYAE 4AQYI 1IBKE 4X65E 3J7AG 5A2QC 1HNZI 4DPXA 3M6AA 4PRVA 5BR8I 2UXBI 4FWHA 2HKEA 1T4OA 3T1YE 1YYOA 3K17A 4I3HA 4JI0I 2KHXA 1N33E 4WUBA 4USKA 4GKKI 2B7TA 3QT6A 1ZM4A 2F4VE 2HKJA 2E5LI 4DR7I 1FNMA 1XNRI 1IBLE 3WU5A 1KVKA 2RTXA 1Z0BA 4NXME 4LFCE 2ZM6I 4DPWA 4DR1E 4B3TE 2Q2EB 2V8PA 2A2CA 4FW9A 1PIEA 2UU9E 4LFBI 2CPNA 4KQVA 2BM0A 4DV3E 4DUYE 2UXDE 4DR6I 1S16A 1WHQA 1NHIA 3OTOE 4DV2E 2UUBI 1FJGI 4HXZA 4KHPI 1XNQE 3ADJA 3C4TA 2BM1A 2N3GA 4LF6E 4B3MI 1IBME 1J5EI 3C4BA 5FLXC 1H7UA 4JI4E 3J81Q 4K0KE 1T4LB 1UEKA 5LMUI 1XMQE 1MX0A 4DXLA 3HULA 4NXNE 4YY3E 2ZITA 4JI5E 2ZBKB 3J80C 1KTVA 2L2KB 5CFFE 1N36E 1WUUA 2L2NA 2L3JA 4JI2E 1ZXMA 4RPFA 2NPFA 4JI6I 4WYQB 4JI7E 2BV3A 4OX9I 4LF7E 1Z5CA 3ZKBA 2UUAE 1DI2A 1A6FA 2DIXA 4DUZI 1BKNA 4DR4I 4DV4E 4JG4A 2LBSB 2J7KA 4R1FA 3T1HE 4DR3E 1Z0VA 1UHZA 1Z5AA 5IWAI 3GONA 3ADIA 4JYAI 2LJHA 2RS7A 1VISA 3ZZTA 1H74A 4X65I 4LF9E 2RSMA 1ZM2A 4DV7E 1B62A 4DR2E 1HR0I 4X62E 2UXCE 4M1KA 3ZZ0A 1N33I 4YHHI 4JV5E 1RR9A 4DV5I 1FWKA 2F4VI 3WU6A 1N34E 1IBLI 1OJ4A 2VQFE 4NXMI 4LFCI 1S4EA 1ZBTA 4DR1I 4B3TI 1EKZA 2B3TB 1FI4A 3ZKDA 2DEIA 2LUQA 4LF4E 2LUPB 1B63A 1MU5A 1Z59A 4LF8I 4LF5E 2RS6A 3ZZUA 2CZ9A 3B82A 2XEXA 4DUYI 4DV3I 2UXDI 1X47A 4XTJA 2V2VA 3OTOI 4DV2I 1N0VC 4JI1I 1NHJA 1HNXE 1XNQI 3QT8A 4LF6I 2LJPA 2JY9A 1XMOE 1NHHA 2UUCE 1IBMI 1N0UA 2V2ZA 2L33A 4HY1A 3PYGA 1ZXNA 4JI4I 1X48A 4WFTA 4K0KI 1ZM9A 4PU9A 1XMQI 4FN5A 5LMNE 3WU3A 3PYEA 1UILA 1I94E 3CWVA 1J26A 5A2QQ 4DR5E 3LTOA 4JI3E 4NXNI 4YY3I 4OOGC 2HK3A 4JI5I 2MDRA 2LRSA 4JI2I 2AJ4A 4B3SE 5IT9C 4GKJE 4LF7I 2JVAA 2UUAI 4URLA 3B8HA 1NZ0A 3PYDA 4DV4I 1ELOA 2WW4A 2NA2A 4DPUA 4ED4A 3ADLA 1PKPA 1KKHA 3T1HI 4DR3I 1QZRA 4X64E 2VQEE 2HFSA 4DV0E 4LFAI 4B3RE 1Z5BA 1K47A 4M2ZA 4MYTA 2DB2A 3QT7A 4LF9I 4Z7CA 2DMYA 2HHHE 4JI8E 5LL6R 4DV7I 4M30A 2GS8A 4X66E 3PYFA 1QU6A 1KIJA 3JAMQ 1Z0TA 4DR2I 4Z7YA 3VYXA 4X62I 1IBKI 1Z0WA 2UXCI 1RC7A 4JV5I 4UT4A 1Z0EA 1MG7A 2EZ6A 1N34I 3WU4A 3T1YI 2VQFI 1RQ0A 1WHNA 4DV1E 3H4LA 5FLXQ 3Q1QA 4LF4I
chains in the Genus database with same CATH superfamily
1N32E 1E3HA 4LF5I 4L5NC 3JTZA 1YYKA 1ZBQA 4DV6E 1HNWE 2X36A 2E1RA 2CVEA 3L7ZB 3M85G 2V88A 3HTXA 2HGHA 4P7AA 5JEAE 1X49A 3J80Q 1ZU1A 2PO2B 4BHBA 3F0NA 2R3VA 1SFEA 1O0WA 2EQ0A 2JXPA 1PJSA 2L2MA 2BR2B 2EPPA 2O1UA 2KONA 2IOQA 2NN6B 5DRQA 2UU9I 4IFDD 4ZYGA 2R76A 2YPNA 4DU7A 3VK6A 2C38A 1HNXI 1USVA 2I9IA 3J81C 4LPFA 3HJCA 2EQ1A 5AC4A 1BBGA 4MU0A 1FKAE 5K36C 2JR1A 3P1XA 5A6JA 2EFGA 2IESA 4M0VA 4DPYA 1HR0E 2L8TA 3BIDA 3QG5C 2PNLA 4AQYE 2JWOA 1XMOI 2NABA 2JOXA 4NBQA 2MDGA 2LTRA 4YHHE 2PNZB 4BA1A 2UUCI 1PVGA 4OO1B 1HNZE 4DV5E 2CG9A 3VYYA 5BR8E 2BBGA 2UXBE 2G7HA 4MLVA 5KL5A 3H1CA 2WBTA 2OI2A 2PRTA 2EPZA 2JYAA 2BA1G 3HXLA 1H7SA 5LMNI 3OMLA 4JI0E 3LLHA 2PNMA 2LVHA 2YTDA 4GKKE 1U2RA 1I94I 4DR5I 1XXEA 4JI3I 2L6MA 4DR7E 2YTGA 2E5LE 2ENHA 4LF8E 2IERA 1YPNA 1XNRE 4USMA 2N3HA 4DU8A 3EPLA 5A69A 2C38B 2GO3A 2NUFA 2B7VA 3THNA 2M4IA 2ZM6E 2EOSA 4L8NA 2DSYA 1YYWA 3HKMA 1GTKA 2HFUA 4UTGA 4B3SI 2DLKA 1DARA 5JEAA 2D9HA 3M85D 4FWDA 2R42A 3GMEA 3JAMC 2A2DA 2YTOA 4GKJI 2F8BA 4IZKA 4LFBE 3P76A 4P52A 4BA1B 1ZR9A 4DV7I 1N36I 2O1TA 4BC7A 2EJ4A 5AE3A 4JI1E 2JP9A 1E3PA 2LTSA 3CDJA 4R2PA 5JEAF 4DR6E 2EPRA 2V83A 1SR9A 4HACA 4JI7I 2KOUA 4FWGA 2YTIA 3P3EA 2V87A 1GQEA 1Z0GA 2UUBE 4X9JA 4X64I 3LPSA 1RREA 2VQEI 1FJGE 3UHMA 4DV0I 4OO1E 4KHPE 4B3RI 3QT5A 5KL2A 4F54A 1H72C 3RMPA 2DLQA 4HYMA 1N33I 1MEYC 2JE6A 1EH8A 2HHHI 4WXDA 4JI8I 3ADGA 4DKKA 2V2QA 3EPKA 2EN2A 1QNTA 1Z0CA 2CGEA 2X7IA 4MYUA 4X66I 4B3ME 2RSIA 2EN8A 2BA1D 5JEAB 4PRXA 1J5EE 1D6TA 4J8ZA 2M9AA 2ADRA 2EMIA 3MHHC 1EA6A 2V34A 1L4SA 4FW7A 4IZKB 1STUA 2VF3A 3J7Yp 3LNUA 1HK7A 5C0XA 4EMDA 4ZYEA 3EPJA 5LMUE 2E1MA 2NUGA 4MU3A 4X8WA 2NUEA 2YT4A 2L3CA 5EL9A 4WXCA 1ZM3A 1EI1A 3J7AM 1XHKA 4HACB 3V5RA 4DV1I 4ZVIA 4WUCA 2Z5BA 3THOB 5JEAD 2VF1A 5IXMB 2GQ0A 5L3JA 2IOPA 1TF3A 4MU1A 5KL4A 2EMWA 3H09A 3M99B 1R6LA 2RQLA 1JK1A 2PO0A 4ISAA 4JI6E 4U3BA 5DNXA 2JE6B 5GMDA 1N32I 2EM5A 3ECRA 1H73A 1WXRA 4DPTA 4IJDA 1YZ9A 1A1LA 3V2UC 4DV6I 1HNWI 1T4NA 1RHYA 4WUDA 4FW4A 2IHR1 4OX9E 2DEJA 4IS9A 2V86A 3Q6NA 5A6KA 5AASA 4LFAE 2HC5A 4R2SA 4Q35B 4DUZE 4FW5A 2EOHA 4DR4E 3PS2A 4AIMA 3D4JA 2MKDA 5GMEA 2YWQA 4QNKA 5C0XB 1FWLA 2HK2A 4F9AB 3B78A 3Q6MA 3ZM7A 4GQUA 3K1JA 5IT9Q 2NN6C 2UXBI 3PS1A 5IWAE 3C6MA 4HTGA 3M7NG 4JYAE 4OO1F 1WJPA 2EMLA 3CDIA 4ZYDA 4AQYI 2Z5BB 1IBKE 4X65E 3J7AG 3GLLA 4R8OA 5A2QC 2JT2A 2EM9A 1HNZI 2LT7A 5K36A 2EOYA 4DPXA 5DNLA 2EMGA 2FV4B 1YH8A 3M6AA 4PRVA 2WCC3 5BR8I 2B9DA 4F6MA 5KL3A 2M7QA 5A6BA 4FWHA 2LJUA 4N3OA 2HKEA 2PO0B 4R2DA 1T4OA 4IZJA 3T1YE 1YYOA 1OYRA 3K17A 2EM3A 4R2QA 4I3HA 4JI0I 4F9CB 2KHXA 1N3GA 2VRDA 1N33E 1EH7A 4WUBA 4USKA 2MKNA 4GKKI 2B7TA 4MQYA 4LU9A 4TUIA 2YRKA 2DRPA 3QT6A 1ZM4A 5KL7A 2F4VE 4BMJA 2HKJA 2NN6D 2E5LI 1FNMA 4DR7I 1WRJA 1XNRI 1NEIA 1X5WA 1IBLE 3WU5A 1P42A 2WNRA 2EOJA 2EOMA 2RTXA 1KVKA 1Z0BA 4NXME 4LFCE 2ZM6I 4DPWA 3TQMA 4DR1E 4B3TE 2YTJA 3HPSA 2BB8A 2Q2EB 4BBYA 2V8PA 3FIGA 2V89A 2EL4A 2A2CA 5A6AA 2EMKA 2YTEA 3L00A 4GEQB 4FW9A 1PIEA 2UU9E 2LV2A 4TUGA 4LFBI 5C0XE 2LMZA 2CPNA 4KQVA 4OO1D 4AIDA 5K36B 4MU4A 4J3DA 3GCMA 4QNJA 3PRYA 2EM2A 2BM0A 4DV3E 4DUYE 2CTDA 2UXDE 4FW6A 2EQ3A 2ELZA 4DR6I 4IZJB 1S16A 1WHQA 3LMLA 4I8OA 1NHIA 5F3WA 1AH5A 2EN7A 3OTOE 2HJJA 3M7ND 1YUJA 4DV2E 2UUBI 1FJGI 2EE8A 2EMCA 4HXZA 2K7IA 1RMDA 4KHPI 2EOFA 2EPMX 4O43A 3IWBA 1LLMC 1XNQE 3EQ1A 3ZOQB 3ADJA 5AE1A 2WNRB 3C4TA 2ODRD 2BM1A 2N3GA 5A6BD 4LF6E 4ZYHA 4B3MI 3IWCA 2O1VA 1IBME 2EOXA 3C4BA 1J5EI 5FLXC 2JOBA 3PS3A 2Q8UA 2EPUA 2CSHA 3F6HA 3C6KA 3AV0A 1H7UA 1NCSA 2EL5A 4R2CA 1GZ6A 4JI4E 4K0KE 2EM8A 5JEAC 3J81Q 2LE2A 1T4LB 2BA0G 1UEKA 5LMUI 1XMQE 1MX0A 2EOIA 1F2IG 1A1GA 4DXLA 3HULA 2FGGA 1OYPA 4NHRA 4O4KA 4NXNE 4YY3E 5FWKA 2EN4A 1KYQA 3J80C 4JI5E 1Y6ZA 1KTVA 2GO4A 2ZBKB 3MHSC 2L2KB 2EPCA 4N4RB 5CFFE 5K36E 1X6HA 1N36E 3EPHA 2EWLA 2RPCA 5DNYA 2L2NA 2L3JA 4JI2E 1TN9A 1WUUA 1ZXMA 4RPFA 2NPFA 4JI6I 4WYQB 4BA2A 2GPIA 3KZYA 3K6QA 2EN1A 4JI7E 1JK2A 2BV3A 4OX9I 2EOEA 4LF7E 2JEAA 4IFDA 1IQSA 4F6NA 1Z5CA 3ZKBA 4NZVA 2YZTA 2UUAE 5C0XF 2WP8A 2YU8A 1DI2A 1YSAC 3JU0A 2DIXA 1A6FA 4DUZI 1BKNA 4DR4I 4DV4E 2JEBA 2LBSB 4JG4A 3AUZA 2DMIA 4R2EA 2J7KA 4R1FA 1Y4UA 3T1HE 4DR3E 3P06A 1Z0VA 2CT1A 1UHZA 1Z5AA 5IWAI 3GONA 3ADIA 3DD6A 1OYSA 5C0XC 4JYAI 2EPNA 2MC5A 2LJHA 2RS7A 3UK3C 2EMBA 1VISA 2E72A 3ZZTA 2GHFA 2YRHA 2J7JA 1H74A 4MDTA 4X65I 1X6FA 2VE7C 4LF9E 2RSMA 4OZEA 2YTPA 1MGTA 1ZM2A 2C37A 4DV7E 2EPXA 4R03A 1B62A 4BA2B 4M9VC 2BA0D 4DR2E 1HR0I 4WPYA 4X62E 2JEAB 2UXCE 4M1KA 3ZZ0A 4IFDB 4WX9A 1UDSA 1T39A 4YHHI 2L92A 4JV5E 2WP8B 1RR9A 4DV5I 1FWKA 3KWRA 2ELYA 1PDAA 2EMFA 2EPOA 2JEBB 3WU6A 2F4VI 1A1IA 2YRMA 4O24A 1N34E 5ELWA 5C0XD 1IBLI 1OJ4A 4OO1C 2V85A 2VQFE 4NXMI 4LFCI 1S4EA 1IMUA 1R6MA 1ZBTA 4DR1I 4B3TI 4RH8A 4AM3A 1EKZA 2B3TB 1FI4A 3ZKDA 5K36F 2DEIA 2EN3A 2LUQA 4LF4E 2LUPB 1YFHA 1B63A 1MU5A 1Z59A 4LF8I 4LF5E 2RS6A 4U3DA 1PJQA 3KRNA 3ZZUA 2CZ9A 4R2RA 2C37B 3KZZA 4OKGA 1Y5YA 3B82A 2EM4A 2XEXA 4DUYI 4DV3I 1X47A 4MLQA 4XTJA 2C39B 2UXDI 2ZITA 2YU5A 3BBGA 2ODRC 1VI7A 2A25A 4GZNC 2V2VA 3OTOI 4BHCA 4P7DA 4DV2I 5LLQA 4BCAA 1N0VC 2PO1A 1UDQA 2YTNA 3F6GA 4LTYA 2V8QB 1NHJA 4JI1I 2EMZA 1HNXE 4LCHA 1XNQI 2YSPA 4DMIA 3QT8A 3IWDA 5AE2A 1A1JA 1X3CA 4HEIA 4LF6I 2LJPA 4IFDE 2JY9A 1XMOE 1NHHA 2UUCE 1IBMI 2EMYA 4F9BB 5AC5A 1N0UA 2I13A 2ENAA 2EORA 2L33A 1IQOA 2V2ZA 3PYGA 3BGHA 4HY1A 1ZXNA 4JI4I 3P3GA 1X48A 4WFTA 4K0KI 2Z5EA 1ZM9A 5K36D 1YHCA 4PU9A 1XMQI 4FN5A 5LMNE 3WU3A 3PYEA 2WZOA 2EP3A 1UILA 2EPLX 5KL6A 4IZJD 4WSPA 3U1KA 1I94E 3CWVA 1J26A 5A2QQ 5IV8B 4DR5E 4JI3E 1X6EA 3HPZA 2JPAA 3LTOA 4NXNI 4YY3I 2NN6E 4OOGC 2HK3A 3B4TA 4JI5I 2PO1B 1DGCA 4FW3A 2WBSA 1Y4SA 5T6JA 2O3ZA 3HQ1A 2GLIA 2MDRA 2EMHA 2LRSA 4JI2I 1A1KA 2DGCA 1UDNA 2AJ4A 4B3SE 2N8XA 2YTQA 2LO3A 5IT9C 1PJTA 4FK5C 2F1DA 4GKJE 4P78A 4LF7I 2JVAA 4LCGA 2UUAI 5DRRA 4URLA 3B8HA 3VHTB 2M1SA 1NZ0A 3PYDA 4LCFA 5DROA 4KWYA 2EM6A 4DV4I 3MSWA 1ELOA 1USUA 2WW4A 2NA2A 4DPUA 4ED4A 3ADLA 1PKPA 1KKHA 3NZKA 2MC6A 1T38A 3T1HI 2Z5CA 4DR3I 1UN6B 1AAYA 1QZRA 2EMXA 4X64E 2O1WA 2VQEE 3DF6A 2AE8A 2VESA 2HFSA 4DV0E 4IS1C 4LFAI 2YSOA 4B3RE 1Z5BA 1K47A 4M2ZA 2EM0A 1BBOA 4MYTA 2DB2A 2EOZA 3QT7A 4Q28A 3K85A 4LOMA 2DMYA 4Z7CA 4LF9I 4WSGA 1B69A 5DRPA 1ZAAC 2HHHE 4JI8E 5LL6R 1G2FC 2ENCA 1DQ3A 4M30A 2GS8A 4O5GA 4F2JC 2EL6A 1P47A 1Y60A 4X66E 2LCEA 3PYFA 3L7ZA 4IFDF 1BB8A 1QU6A 2R1FA 1KIJA 3JAMQ 1Z0TA 4DR2I 4Z7YA 2PO2A 3DJWA 5TSEA 4BS9A 3VYXA 2J65A 5EKWA 4X62I 2BR2A 3P3CA 1IBKI 1Z0WA 2UXCI 2NN6A 4R2AA 1RC7A 1KJKA 4JV5I 3U1YA 2EM7A 1UBDC 2EOOA 1Z0EA 2EMAA 1MG7A 4UT4A 2YTFA 2EZ6A 2K4VA 4IFDC 4RHBB 1EH6A 1N34I 2C39A 2EN6A 2H36X 3WU4A 3BF2A 3T1YI 1A1FA 2VQFI 1RQ0A 1WHNA 2WBUA 2EPAA 4DV1E 1Z1BA 4KZSA 2EPKX 2Z5CB 3H4LA 5FLXQ 2FTXB 2NN6F 1UDOA 5ADZA 4BC9A 1A1HA 1YUIA 1G2DC 2PNZA 4OO1A 3Q1QA 2EOQA 4LF4I 1TF6A
chains in the Genus database with same CATH topology
1N32E 4LF5I 4L5NC 3JTZA 1YYKA 1ZBQA 4DV6E 1HNWE 2X36A 2E1RA 2V88A 3HTXA 4P7AA 1X49A 3J80Q 3F0NA 2R3VA 1O0WA 2L2MA 2O1UA 2KONA 2IOQA 2UU9I 4DU7A 3VK6A 1HNXI 1USVA 3J81C 3HJCA 1FKAE 2JR1A 3P1XA 2EFGA 4M0VA 4DPYA 1HR0E 2L8TA 2PNLA 4AQYE 2JWOA 1XMOI 2JOXA 4YHHE 2LTRA 2UUCI 1PVGA 1HNZE 4DV5E 2CG9A 3VYYA 5BR8E 2UXBE 2G7HA 2OI2A 3HXLA 1H7SA 5LMNI 3OMLA 4JI0E 3LLHA 2PNMA 4GKKE 1I94I 1U2RA 4DR5I 4JI3I 2L6MA 4DR7E 2E5LE 4LF8E 4USMA 1XNRE 2N3HA 4DU8A 2NUFA 2B7VA 2M4IA 2ZM6E 4L8NA 2DSYA 1YYWA 4UTGA 2HFUA 4B3SI 1DARA 4FWDA 2R42A 3JAMC 2A2DA 4GKJI 2F8BA 4IZKA 4LFBE 4P52A 1N36I 2O1TA 4BC7A 5AE3A 4JI1E 2LTSA 4DR6E 2V83A 1SR9A 4HACA 4JI7I 2KOUA 4FWGA 2V87A 1GQEA 1Z0GA 2UUBE 4X64I 3LPSA 1RREA 2VQEI 1FJGE 4DV0I 4KHPE 4B3RI 3QT5A 4F54A 1H72C 3RMPA 4HYMA 2HHHI 4JI8I 3ADGA 4DKKA 2V2QA 1Z0CA 2CGEA 2X7IA 4X66I 4MYUA 4B3ME 1D6TA 4PRXA 1J5EE 4J8ZA 1EA6A 2V34A 4IZKB 1STUA 2VF3A 3J7Yp 3LNUA 1HK7A 4EMDA 5LMUE 2E1MA 2NUGA 2NUEA 4X8WA 2YT4A 2L3CA 1ZM3A 1EI1A 3J7AM 1XHKA 4HACB 3V5RA 4DV1I 4ZVIA 4WUCA 2Z5BA 2VF1A 2GQ0A 5L3JA 2IOPA 3H09A 1N32I 5GMDA 4JI6E 4DPTA 1H73A 1WXRA 1YZ9A 3V2UC 4DV6I 1HNWI 1T4NA 4WUDA 2IHR1 4OX9E 2DEJA 2V86A 3Q6NA 5AASA 4LFAE 4DUZE 4DR4E 3D4JA 5GMEA 1FWLA 2HK2A 4F9AB 3B78A 3Q6MA 3ZM7A 5IT9Q 3K1JA 5IWAE 4JYAE 4AQYI 2Z5BB 1IBKE 4X65E 3J7AG 4R8OA 5A2QC 1HNZI 4DPXA 3M6AA 2FV4B 4PRVA 5BR8I 2UXBI 2B9DA 2M7QA 4FWHA 4N3OA 2HKEA 1T4OA 4IZJA 3T1YE 1YYOA 3K17A 4I3HA 4JI0I 4F9CB 2KHXA 1N33E 4WUBA 4USKA 4GKKI 2B7TA 4LU9A 4TUIA 3QT6A 1ZM4A 2F4VE 4BMJA 2HKJA 2E5LI 4DR7I 1FNMA 1XNRI 1IBLE 3WU5A 1KVKA 2RTXA 1Z0BA 4NXME 4LFCE 2ZM6I 4DPWA 4DR1E 4B3TE 3HPSA 2Q2EB 4BBYA 2V8PA 3FIGA 2V89A 2A2CA 4FW9A 4GEQB 1PIEA 2UU9E 4LFBI 4TUGA 2LMZA 2CPNA 4KQVA 3PRYA 2BM0A 4DV3E 4DUYE 2UXDE 4DR6I 4IZJB 1S16A 1WHQA 3LMLA 4I8OA 1NHIA 5F3WA 3OTOE 4DV2E 2UUBI 1FJGI 4HXZA 4KHPI 3IWBA 1XNQE 3ZOQB 3ADJA 5AE1A 3C4TA 2ODRD 2BM1A 2N3GA 4LF6E 4B3MI 3IWCA 2O1VA 1IBME 1J5EI 3C4BA 5FLXC 2JOBA 3F6HA 3AV0A 1H7UA 4JI4E 1GZ6A 4K0KE 3J81Q 2LE2A 1T4LB 1UEKA 5LMUI 1XMQE 1MX0A 4DXLA 3HULA 2FGGA 4NXNE 4YY3E 5FWKA 2ZITA 3J80C 4JI5E 1Y6ZA 1KTVA 2ZBKB 2L2KB 5CFFE 1N36E 2EWLA 5DNYA 2L2NA 2L3JA 4JI2E 1WUUA 1ZXMA 4RPFA 2NPFA 4JI6I 4WYQB 3K6QA 4JI7E 2BV3A 4OX9I 4LF7E 1Z5CA 3ZKBA 2UUAE 2YZTA 1DI2A 3JU0A 2DIXA 1A6FA 4DUZI 1BKNA 4DR4I 4DV4E 4JG4A 2LBSB 3AUZA 2J7KA 4R1FA 1Y4UA 3T1HE 4DR3E 3P06A 1Z0VA 1UHZA 1Z5AA 5IWAI 3GONA 3ADIA 4JYAI 2MC5A 2LJHA 2RS7A 1VISA 3ZZTA 1H74A 4X65I 2VE7C 4LF9E 2RSMA 1ZM2A 4DV7E 4R03A 1B62A 4DR2E 1HR0I 4WPYA 4X62E 2UXCE 4M1KA 3ZZ0A 1N33I 4YHHI 2L92A 4JV5E 1RR9A 4DV5I 1FWKA 3KWRA 2F4VI 3WU6A 1N34E 1IBLI 1OJ4A 2V85A 2VQFE 4NXMI 4LFCI 1S4EA 1ZBTA 4DR1I 4B3TI 1EKZA 2B3TB 1FI4A 3ZKDA 2DEIA 2LUQA 4LF4E 2LUPB 1B63A 1MU5A 1Z59A 4LF8I 4LF5E 2RS6A 3ZZUA 2CZ9A 3B82A 2XEXA 4DUYI 4DV3I 2UXDI 1X47A 4XTJA 2ODRC 2V2VA 3OTOI 4P7DA 4DV2I 4BCAA 1N0VC 3F6GA 4LTYA 2V8QB 1NHJA 4JI1I 1HNXE 1XNQI 4DMIA 3QT8A 3IWDA 5AE2A 4LF6I 2LJPA 2JY9A 1XMOE 1NHHA 2UUCE 1IBMI 4F9BB 1N0UA 2V2ZA 2L33A 4HY1A 3PYGA 1ZXNA 4JI4I 1X48A 4WFTA 4K0KI 2Z5EA 1ZM9A 4PU9A 1XMQI 4FN5A 5LMNE 3WU3A 3PYEA 2WZOA 4IZJD 1UILA 4WSPA 1I94E 3CWVA 1J26A 5A2QQ 4DR5E 3LTOA 4JI3E 3HPZA 4NXNI 4YY3I 4OOGC 2HK3A 4JI5I 1Y4SA 5T6JA 3HQ1A 2MDRA 2LRSA 4JI2I 2AJ4A 4B3SE 5IT9C 4GKJE 4P78A 4LF7I 2JVAA 2UUAI 4URLA 3B8HA 1NZ0A 2M1SA 3PYDA 4DV4I 3MSWA 1ELOA 1USUA 2WW4A 2NA2A 4DPUA 4ED4A 3ADLA 1PKPA 1KKHA 2MC6A 3T1HI 2Z5CA 4DR3I 1QZRA 4X64E 2VQEE 3DF6A 2HFSA 4DV0E 4LFAI 4B3RE 1Z5BA 1K47A 4M2ZA 4MYTA 2DB2A 3QT7A 4Q28A 3K85A 4Z7CA 2DMYA 4LF9I 2HHHE 4JI8E 5LL6R 2O1WA 4DV7I 1DQ3A 4M30A 2GS8A 4X66E 3PYFA 1QU6A 1KIJA 3JAMQ 1Z0TA 4DR2I 4Z7YA 3DJWA 4BS9A 3VYXA 4X62I 1IBKI 1Z0WA 2UXCI 1RC7A 4JV5I 4UT4A 1Z0EA 1MG7A 2EZ6A 2K4VA 1N34I 2H36X 3WU4A 3T1YI 2VQFI 1RQ0A 1WHNA 4DV1E 2Z5CB 3H4LA 4KZSA 5FLXQ 2FTXB 5ADZA 4BC9A 3Q1QA 4LF4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 E;  4LF5 I;  1YYK A;  4DV6 E;  1HNW E;  2X36 A;  2E1R A;  3HTX A;  4P7A A;  1X49 A;  3J80 Q;  3F0N A;  2R3V A;  1O0W A;  2L2M A;  2UU9 I;  4DU7 A;  1HNX I;  3J81 C;  1FKA E;  3P1X A;  2EFG A;  4DPY A;  1HR0 E;  4AQY E;  1XMO I;  4YHH E;  2LTR A;  2UUC I;  1PVG A;  1HNZ E;  4DV5 E;  3VYY A;  5BR8 E;  2UXB E;  2OI2 A;  1H7S A;  5LMN I;  4JI0 E;  3LLH A;  4GKK E;  1I94 I;  1U2R A;  4DR5 I;  4JI3 I;  4DR7 E;  2E5L E;  4LF8 E;  4USM A;  1XNR E;  2N3H A;  4DU8 A;  2NUF A;  2B7V A;  2ZM6 E;  1YYW A;  4UTG A;  2HFU A;  4B3S I;  1DAR A;  4FWD A;  2R42 A;  3JAM C;  2A2D A;  4GKJ I;  4LFB E;  4P52 A;  1N36 I;  4JI1 E;  2LTS A;  4DR6 E;  4HAC A;  4JI7 I;  4FWG A;  1GQE A;  1Z0G A;  2UUB E;  4X64 I;  3LPS A;  1RRE A;  2VQE I;  1FJG E;  4DV0 I;  4KHP E;  4B3R I;  3QT5 A;  1H72 C;  4HYM A;  2HHH I;  4JI8 I;  3ADG A;  4DKK A;  2V2Q A;  1Z0C A;  2X7I A;  4X66 I;  4MYU A;  4B3M E;  1D6T A;  4PRX A;  1J5E E;  1EA6 A;  2V34 A;  1STU A;  2VF3 A;  3J7Y p;  3LNU A;  4EMD A;  5LMU E;  2NUG A;  2NUE A;  4X8W A;  2YT4 A;  2L3C A;  1ZM3 A;  1EI1 A;  3J7A M;  1XHK A;  4HAC B;  3V5R A;  4DV1 I;  4ZVI A;  4WUC A;  5L3J A;  1N32 I;  5GMD A;  4JI6 E;  4DPT A;  1H73 A;  1YZ9 A;  3V2U C;  4DV6 I;  1HNW I;  1T4N A;  4WUD A;  2IHR 1;  4OX9 E;  2DEJ A;  4LFA E;  4DUZ E;  4DR4 E;  3D4J A;  5GME A;  1FWL A;  2HK2 A;  3B78 A;  3ZM7 A;  5IT9 Q;  3K1J A;  5IWA E;  4JYA E;  4AQY I;  1IBK E;  4X65 E;  3J7A G;  5A2Q C;  1HNZ I;  4DPX A;  3M6A A;  4PRV A;  5BR8 I;  2UXB I;  4FWH A;  2HKE A;  1T4O A;  3T1Y E;  1YYO A;  3K17 A;  4I3H A;  4JI0 I;  2KHX A;  1N33 E;  4WUB A;  4USK A;  4GKK I;  2B7T A;  3QT6 A;  1ZM4 A;  2F4V E;  2HKJ A;  2E5L I;  4DR7 I;  1FNM A;  1XNR I;  1IBL E;  3WU5 A;  1KVK A;  2RTX A;  1Z0B A;  4NXM E;  4LFC E;  2ZM6 I;  4DPW A;  4DR1 E;  4B3T E;  2Q2E B;  2V8P A;  2A2C A;  4FW9 A;  1PIE A;  2UU9 E;  4LFB I;  2CPN A;  4KQV A;  2BM0 A;  4DV3 E;  4DUY E;  2UXD E;  4DR6 I;  1S16 A;  1WHQ A;  1NHI A;  3OTO E;  4DV2 E;  2UUB I;  1FJG I;  4HXZ A;  4KHP I;  1XNQ E;  3ADJ A;  3C4T A;  2BM1 A;  2N3G A;  4LF6 E;  4B3M I;  1IBM E;  1J5E I;  3C4B A;  5FLX C;  1H7U A;  4JI4 E;  3J81 Q;  4K0K E;  1T4L B;  1UEK A;  5LMU I;  1XMQ E;  1MX0 A;  4DXL A;  3HUL A;  4NXN E;  4YY3 E;  2ZIT A;  4JI5 E;  2ZBK B;  3J80 C;  1KTV A;  2L2K B;  5CFF E;  1N36 E;  1WUU A;  2L2N A;  2L3J A;  4JI2 E;  1ZXM A;  4RPF A;  2NPF A;  4JI6 I;  4WYQ B;  4JI7 E;  2BV3 A;  4OX9 I;  4LF7 E;  1Z5C A;  3ZKB A;  2UUA E;  1DI2 A;  1A6F A;  2DIX A;  4DUZ I;  1BKN A;  4DR4 I;  4DV4 E;  4JG4 A;  2LBS B;  2J7K A;  4R1F A;  3T1H E;  4DR3 E;  1Z0V A;  1UHZ A;  1Z5A A;  5IWA I;  3GON A;  3ADI A;  4JYA I;  2LJH A;  2RS7 A;  1VIS A;  3ZZT A;  1H74 A;  4X65 I;  4LF9 E;  2RSM A;  1ZM2 A;  4DV7 E;  1B62 A;  4DR2 E;  1HR0 I;  4X62 E;  2UXC E;  4M1K A;  3ZZ0 A;  1N33 I;  4YHH I;  4JV5 E;  1RR9 A;  4DV5 I;  1FWK A;  2F4V I;  3WU6 A;  1N34 E;  1IBL I;  1OJ4 A;  2VQF E;  4NXM I;  4LFC I;  1S4E A;  1ZBT A;  4DR1 I;  4B3T I;  1EKZ A;  2B3T B;  1FI4 A;  3ZKD A;  2DEI A;  2LUQ A;  4LF4 E;  2LUP B;  1B63 A;  1MU5 A;  1Z59 A;  4LF8 I;  4LF5 E;  2RS6 A;  3ZZU A;  2CZ9 A;  3B82 A;  2XEX A;  4DUY I;  4DV3 I;  2UXD I;  1X47 A;  4XTJ A;  2V2V A;  3OTO I;  4DV2 I;  1N0V C;  4JI1 I;  1NHJ A;  1HNX E;  1XNQ I;  3QT8 A;  4LF6 I;  2LJP A;  2JY9 A;  1XMO E;  1NHH A;  2UUC E;  1IBM I;  1N0U A;  2V2Z A;  2L33 A;  4HY1 A;  3PYG A;  1ZXN A;  4JI4 I;  1X48 A;  4WFT A;  4K0K I;  1ZM9 A;  4PU9 A;  1XMQ I;  4FN5 A;  5LMN E;  3WU3 A;  3PYE A;  1UIL A;  1I94 E;  3CWV A;  1J26 A;  5A2Q Q;  4DR5 E;  3LTO A;  4JI3 E;  4NXN I;  4YY3 I;  4OOG C;  2HK3 A;  4JI5 I;  2MDR A;  2LRS A;  4JI2 I;  2AJ4 A;  4B3S E;  5IT9 C;  4GKJ E;  4LF7 I;  2JVA A;  2UUA I;  4URL A;  3B8H A;  1NZ0 A;  3PYD A;  4DV4 I;  1ELO A;  2WW4 A;  2NA2 A;  4DPU A;  4ED4 A;  3ADL A;  1PKP A;  1KKH A;  3T1H I;  4DR3 I;  1QZR A;  4X64 E;  2VQE E;  2HFS A;  4DV0 E;  4LFA I;  4B3R E;  1Z5B A;  1K47 A;  4M2Z A;  4MYT A;  2DB2 A;  3QT7 A;  4LF9 I;  4Z7C A;  2DMY A;  2HHH E;  4JI8 E;  5LL6 R;  4DV7 I;  4M30 A;  2GS8 A;  4X66 E;  3PYF A;  1QU6 A;  1KIJ A;  3JAM Q;  1Z0T A;  4DR2 I;  4Z7Y A;  3VYX A;  4X62 I;  1IBK I;  1Z0W A;  2UXC I;  1RC7 A;  4JV5 I;  4UT4 A;  1Z0E A;  1MG7 A;  2EZ6 A;  1N34 I;  3WU4 A;  3T1Y I;  2VQF I;  1RQ0 A;  1WHN A;  4DV1 E;  3H4L A;  5FLX Q;  3Q1Q A;  4LF4 I; 
#chains in the Genus database with same CATH topology
 1N32 E;  1E3H A;  4LF5 I;  4L5N C;  3JTZ A;  1YYK A;  1ZBQ A;  4DV6 E;  1HNW E;  2X36 A;  2E1R A;  2CVE A;  3L7Z B;  3M85 G;  2V88 A;  3HTX A;  2HGH A;  4P7A A;  5JEA E;  1X49 A;  3J80 Q;  1ZU1 A;  2PO2 B;  4BHB A;  3F0N A;  2R3V A;  1SFE A;  1O0W A;  2EQ0 A;  2JXP A;  1PJS A;  2L2M A;  2BR2 B;  2EPP A;  2O1U A;  2KON A;  2IOQ A;  2NN6 B;  5DRQ A;  2UU9 I;  4IFD D;  4ZYG A;  2R76 A;  2YPN A;  4DU7 A;  3VK6 A;  2C38 A;  1HNX I;  1USV A;  2I9I A;  3J81 C;  4LPF A;  3HJC A;  2EQ1 A;  5AC4 A;  1BBG A;  4MU0 A;  1FKA E;  5K36 C;  2JR1 A;  3P1X A;  5A6J A;  2EFG A;  2IES A;  4M0V A;  4DPY A;  1HR0 E;  2L8T A;  3BID A;  3QG5 C;  2PNL A;  4AQY E;  2JWO A;  1XMO I;  2NAB A;  2JOX A;  4NBQ A;  2MDG A;  2LTR A;  4YHH E;  2PNZ B;  4BA1 A;  2UUC I;  1PVG A;  4OO1 B;  1HNZ E;  4DV5 E;  2CG9 A;  3VYY A;  5BR8 E;  2BBG A;  2UXB E;  2G7H A;  4MLV A;  5KL5 A;  3H1C A;  2WBT A;  2OI2 A;  2PRT A;  2EPZ A;  2JYA A;  2BA1 G;  3HXL A;  1H7S A;  5LMN I;  3OML A;  4JI0 E;  3LLH A;  2PNM A;  2LVH A;  2YTD A;  4GKK E;  1U2R A;  1I94 I;  4DR5 I;  1XXE A;  4JI3 I;  2L6M A;  4DR7 E;  2YTG A;  2E5L E;  2ENH A;  4LF8 E;  2IER A;  1YPN A;  1XNR E;  4USM A;  2N3H A;  4DU8 A;  3EPL A;  5A69 A;  2C38 B;  2GO3 A;  2NUF A;  2B7V A;  3THN A;  2M4I A;  2ZM6 E;  2EOS A;  4L8N A;  2DSY A;  1YYW A;  3HKM A;  1GTK A;  2HFU A;  4UTG A;  4B3S I;  2DLK A;  1DAR A;  5JEA A;  2D9H A;  3M85 D;  4FWD A;  2R42 A;  3GME A;  3JAM C;  2A2D A;  2YTO A;  4GKJ I;  2F8B A;  4IZK A;  4LFB E;  3P76 A;  4P52 A;  4BA1 B;  1ZR9 A;  4DV7 I;  1N36 I;  2O1T A;  4BC7 A;  2EJ4 A;  5AE3 A;  4JI1 E;  2JP9 A;  1E3P A;  2LTS A;  3CDJ A;  4R2P A;  5JEA F;  4DR6 E;  2EPR A;  2V83 A;  1SR9 A;  4HAC A;  4JI7 I;  2KOU A;  4FWG A;  2YTI A;  3P3E A;  2V87 A;  1GQE A;  1Z0G A;  2UUB E;  4X9J A;  4X64 I;  3LPS A;  1RRE A;  2VQE I;  1FJG E;  3UHM A;  4DV0 I;  4OO1 E;  4KHP E;  4B3R I;  3QT5 A;  5KL2 A;  4F54 A;  1H72 C;  3RMP A;  2DLQ A;  4HYM A;  1N33 I;  1MEY C;  2JE6 A;  1EH8 A;  2HHH I;  4WXD A;  4JI8 I;  3ADG A;  4DKK A;  2V2Q A;  3EPK A;  2EN2 A;  1QNT A;  1Z0C A;  2CGE A;  2X7I A;  4MYU A;  4X66 I;  4B3M E;  2RSI A;  2EN8 A;  2BA1 D;  5JEA B;  4PRX A;  1J5E E;  1D6T A;  4J8Z A;  2M9A A;  2ADR A;  2EMI A;  3MHH C;  1EA6 A;  2V34 A;  1L4S A;  4FW7 A;  4IZK B;  1STU A;  2VF3 A;  3J7Y p;  3LNU A;  1HK7 A;  5C0X A;  4EMD A;  4ZYE A;  3EPJ A;  5LMU E;  2E1M A;  2NUG A;  4MU3 A;  4X8W A;  2NUE A;  2YT4 A;  2L3C A;  5EL9 A;  4WXC A;  1ZM3 A;  1EI1 A;  3J7A M;  1XHK A;  4HAC B;  3V5R A;  4DV1 I;  4ZVI A;  4WUC A;  2Z5B A;  3THO B;  5JEA D;  2VF1 A;  5IXM B;  2GQ0 A;  5L3J A;  2IOP A;  1TF3 A;  4MU1 A;  5KL4 A;  2EMW A;  3H09 A;  3M99 B;  1R6L A;  2RQL A;  1JK1 A;  2PO0 A;  4ISA A;  4JI6 E;  4U3B A;  5DNX A;  2JE6 B;  5GMD A;  1N32 I;  2EM5 A;  3ECR A;  1H73 A;  1WXR A;  4DPT A;  4IJD A;  1YZ9 A;  1A1L A;  3V2U C;  4DV6 I;  1HNW I;  1T4N A;  1RHY A;  4WUD A;  4FW4 A;  2IHR 1;  4OX9 E;  2DEJ A;  4IS9 A;  2V86 A;  3Q6N A;  5A6K A;  5AAS A;  4LFA E;  2HC5 A;  4R2S A;  4Q35 B;  4DUZ E;  4FW5 A;  2EOH A;  4DR4 E;  3PS2 A;  4AIM A;  3D4J A;  2MKD A;  5GME A;  2YWQ A;  4QNK A;  5C0X B;  1FWL A;  2HK2 A;  4F9A B;  3B78 A;  3Q6M A;  3ZM7 A;  4GQU A;  3K1J A;  5IT9 Q;  2NN6 C;  2UXB I;  3PS1 A;  5IWA E;  3C6M A;  4HTG A;  3M7N G;  4JYA E;  4OO1 F;  1WJP A;  2EML A;  3CDI A;  4ZYD A;  4AQY I;  2Z5B B;  1IBK E;  4X65 E;  3J7A G;  3GLL A;  4R8O A;  5A2Q C;  2JT2 A;  2EM9 A;  1HNZ I;  2LT7 A;  5K36 A;  2EOY A;  4DPX A;  5DNL A;  2EMG A;  2FV4 B;  1YH8 A;  3M6A A;  4PRV A;  2WCC 3;  5BR8 I;  2B9D A;  4F6M A;  5KL3 A;  2M7Q A;  5A6B A;  4FWH A;  2LJU A;  4N3O A;  2HKE A;  2PO0 B;  4R2D A;  1T4O A;  4IZJ A;  3T1Y E;  1YYO A;  1OYR A;  3K17 A;  2EM3 A;  4R2Q A;  4I3H A;  4JI0 I;  4F9C B;  2KHX A;  1N3G A;  2VRD A;  1N33 E;  1EH7 A;  4WUB A;  4USK A;  2MKN A;  4GKK I;  2B7T A;  4MQY A;  4LU9 A;  4TUI A;  2YRK A;  2DRP A;  3QT6 A;  1ZM4 A;  5KL7 A;  2F4V E;  4BMJ A;  2HKJ A;  2NN6 D;  2E5L I;  1FNM A;  4DR7 I;  1WRJ A;  1XNR I;  1NEI A;  1X5W A;  1IBL E;  3WU5 A;  1P42 A;  2WNR A;  2EOJ A;  2EOM A;  2RTX A;  1KVK A;  1Z0B A;  4NXM E;  4LFC E;  2ZM6 I;  4DPW A;  3TQM A;  4DR1 E;  4B3T E;  2YTJ A;  3HPS A;  2BB8 A;  2Q2E B;  4BBY A;  2V8P A;  3FIG A;  2V89 A;  2EL4 A;  2A2C A;  5A6A A;  2EMK A;  2YTE A;  3L00 A;  4GEQ B;  4FW9 A;  1PIE A;  2UU9 E;  2LV2 A;  4TUG A;  4LFB I;  5C0X E;  2LMZ A;  2CPN A;  4KQV A;  4OO1 D;  4AID A;  5K36 B;  4MU4 A;  4J3D A;  3GCM A;  4QNJ A;  3PRY A;  2EM2 A;  2BM0 A;  4DV3 E;  4DUY E;  2CTD A;  2UXD E;  4FW6 A;  2EQ3 A;  2ELZ A;  4DR6 I;  4IZJ B;  1S16 A;  1WHQ A;  3LML A;  4I8O A;  1NHI A;  5F3W A;  1AH5 A;  2EN7 A;  3OTO E;  2HJJ A;  3M7N D;  1YUJ A;  4DV2 E;  2UUB I;  1FJG I;  2EE8 A;  2EMC A;  4HXZ A;  2K7I A;  1RMD A;  4KHP I;  2EOF A;  2EPM X;  4O43 A;  3IWB A;  1LLM C;  1XNQ E;  3EQ1 A;  3ZOQ B;  3ADJ A;  5AE1 A;  2WNR B;  3C4T A;  2ODR D;  2BM1 A;  2N3G A;  5A6B D;  4LF6 E;  4ZYH A;  4B3M I;  3IWC A;  2O1V A;  1IBM E;  2EOX A;  3C4B A;  1J5E I;  5FLX C;  2JOB A;  3PS3 A;  2Q8U A;  2EPU A;  2CSH A;  3F6H A;  3C6K A;  3AV0 A;  1H7U A;  1NCS A;  2EL5 A;  4R2C A;  1GZ6 A;  4JI4 E;  4K0K E;  2EM8 A;  5JEA C;  3J81 Q;  2LE2 A;  1T4L B;  2BA0 G;  1UEK A;  5LMU I;  1XMQ E;  1MX0 A;  2EOI A;  1F2I G;  1A1G A;  4DXL A;  3HUL A;  2FGG A;  1OYP A;  4NHR A;  4O4K A;  4NXN E;  4YY3 E;  5FWK A;  2EN4 A;  1KYQ A;  3J80 C;  4JI5 E;  1Y6Z A;  1KTV A;  2GO4 A;  2ZBK B;  3MHS C;  2L2K B;  2EPC A;  4N4R B;  5CFF E;  5K36 E;  1X6H A;  1N36 E;  3EPH A;  2EWL A;  2RPC A;  5DNY A;  2L2N A;  2L3J A;  4JI2 E;  1TN9 A;  1WUU A;  1ZXM A;  4RPF A;  2NPF A;  4JI6 I;  4WYQ B;  4BA2 A;  2GPI A;  3KZY A;  3K6Q A;  2EN1 A;  4JI7 E;  1JK2 A;  2BV3 A;  4OX9 I;  2EOE A;  4LF7 E;  2JEA A;  4IFD A;  1IQS A;  4F6N A;  1Z5C A;  3ZKB A;  4NZV A;  2YZT A;  2UUA E;  5C0X F;  2WP8 A;  2YU8 A;  1DI2 A;  1YSA C;  3JU0 A;  2DIX A;  1A6F A;  4DUZ I;  1BKN A;  4DR4 I;  4DV4 E;  2JEB A;  2LBS B;  4JG4 A;  3AUZ A;  2DMI A;  4R2E A;  2J7K A;  4R1F A;  1Y4U A;  3T1H E;  4DR3 E;  3P06 A;  1Z0V A;  2CT1 A;  1UHZ A;  1Z5A A;  5IWA I;  3GON A;  3ADI A;  3DD6 A;  1OYS A;  5C0X C;  4JYA I;  2EPN A;  2MC5 A;  2LJH A;  2RS7 A;  3UK3 C;  2EMB A;  1VIS A;  2E72 A;  3ZZT A;  2GHF A;  2YRH A;  2J7J A;  1H74 A;  4MDT A;  4X65 I;  1X6F A;  2VE7 C;  4LF9 E;  2RSM A;  4OZE A;  2YTP A;  1MGT A;  1ZM2 A;  2C37 A;  4DV7 E;  2EPX A;  4R03 A;  1B62 A;  4BA2 B;  4M9V C;  2BA0 D;  4DR2 E;  1HR0 I;  4WPY A;  4X62 E;  2JEA B;  2UXC E;  4M1K A;  3ZZ0 A;  4IFD B;  4WX9 A;  1UDS A;  1T39 A;  4YHH I;  2L92 A;  4JV5 E;  2WP8 B;  1RR9 A;  4DV5 I;  1FWK A;  3KWR A;  2ELY A;  1PDA A;  2EMF A;  2EPO A;  2JEB B;  3WU6 A;  2F4V I;  1A1I A;  2YRM A;  4O24 A;  1N34 E;  5ELW A;  5C0X D;  1IBL I;  1OJ4 A;  4OO1 C;  2V85 A;  2VQF E;  4NXM I;  4LFC I;  1S4E A;  1IMU A;  1R6M A;  1ZBT A;  4DR1 I;  4B3T I;  4RH8 A;  4AM3 A;  1EKZ A;  2B3T B;  1FI4 A;  3ZKD A;  5K36 F;  2DEI A;  2EN3 A;  2LUQ A;  4LF4 E;  2LUP B;  1YFH A;  1B63 A;  1MU5 A;  1Z59 A;  4LF8 I;  4LF5 E;  2RS6 A;  4U3D A;  1PJQ A;  3KRN A;  3ZZU A;  2CZ9 A;  4R2R A;  2C37 B;  3KZZ A;  4OKG A;  1Y5Y A;  3B82 A;  2EM4 A;  2XEX A;  4DUY I;  4DV3 I;  1X47 A;  4MLQ A;  4XTJ A;  2C39 B;  2UXD I;  2ZIT A;  2YU5 A;  3BBG A;  2ODR C;  1VI7 A;  2A25 A;  4GZN C;  2V2V A;  3OTO I;  4BHC A;  4P7D A;  4DV2 I;  5LLQ A;  4BCA A;  1N0V C;  2PO1 A;  1UDQ A;  2YTN A;  3F6G A;  4LTY A;  2V8Q B;  1NHJ A;  4JI1 I;  2EMZ A;  1HNX E;  4LCH A;  1XNQ I;  2YSP A;  4DMI A;  3QT8 A;  3IWD A;  5AE2 A;  1A1J A;  1X3C A;  4HEI A;  4LF6 I;  2LJP A;  4IFD E;  2JY9 A;  1XMO E;  1NHH A;  2UUC E;  1IBM I;  2EMY A;  4F9B B;  5AC5 A;  1N0U A;  2I13 A;  2ENA A;  2EOR A;  2L33 A;  1IQO A;  2V2Z A;  3PYG A;  3BGH A;  4HY1 A;  1ZXN A;  4JI4 I;  3P3G A;  1X48 A;  4WFT A;  4K0K I;  2Z5E A;  1ZM9 A;  5K36 D;  1YHC A;  4PU9 A;  1XMQ I;  4FN5 A;  5LMN E;  3WU3 A;  3PYE A;  2WZO A;  2EP3 A;  1UIL A;  2EPL X;  5KL6 A;  4IZJ D;  4WSP A;  3U1K A;  1I94 E;  3CWV A;  1J26 A;  5A2Q Q;  5IV8 B;  4DR5 E;  4JI3 E;  1X6E A;  3HPZ A;  2JPA A;  3LTO A;  4NXN I;  4YY3 I;  2NN6 E;  4OOG C;  2HK3 A;  3B4T A;  4JI5 I;  2PO1 B;  1DGC A;  4FW3 A;  2WBS A;  1Y4S A;  5T6J A;  2O3Z A;  3HQ1 A;  2GLI A;  2MDR A;  2EMH A;  2LRS A;  4JI2 I;  1A1K A;  2DGC A;  1UDN A;  2AJ4 A;  4B3S E;  2N8X A;  2YTQ A;  2LO3 A;  5IT9 C;  1PJT A;  4FK5 C;  2F1D A;  4GKJ E;  4P78 A;  4LF7 I;  2JVA A;  4LCG A;  2UUA I;  5DRR A;  4URL A;  3B8H A;  3VHT B;  2M1S A;  1NZ0 A;  3PYD A;  4LCF A;  5DRO A;  4KWY A;  2EM6 A;  4DV4 I;  3MSW A;  1ELO A;  1USU A;  2WW4 A;  2NA2 A;  4DPU A;  4ED4 A;  3ADL A;  1PKP A;  1KKH A;  3NZK A;  2MC6 A;  1T38 A;  3T1H I;  2Z5C A;  4DR3 I;  1UN6 B;  1AAY A;  1QZR A;  2EMX A;  4X64 E;  2O1W A;  2VQE E;  3DF6 A;  2AE8 A;  2VES A;  2HFS A;  4DV0 E;  4IS1 C;  4LFA I;  2YSO A;  4B3R E;  1Z5B A;  1K47 A;  4M2Z A;  2EM0 A;  1BBO A;  4MYT A;  2DB2 A;  2EOZ A;  3QT7 A;  4Q28 A;  3K85 A;  4LOM A;  2DMY A;  4Z7C A;  4LF9 I;  4WSG A;  1B69 A;  5DRP A;  1ZAA C;  2HHH E;  4JI8 E;  5LL6 R;  1G2F C;  2ENC A;  1DQ3 A;  4M30 A;  2GS8 A;  4O5G A;  4F2J C;  2EL6 A;  1P47 A;  1Y60 A;  4X66 E;  2LCE A;  3PYF A;  3L7Z A;  4IFD F;  1BB8 A;  1QU6 A;  2R1F A;  1KIJ A;  3JAM Q;  1Z0T A;  4DR2 I;  4Z7Y A;  2PO2 A;  3DJW A;  5TSE A;  4BS9 A;  3VYX A;  2J65 A;  5EKW A;  4X62 I;  2BR2 A;  3P3C A;  1IBK I;  1Z0W A;  2UXC I;  2NN6 A;  4R2A A;  1RC7 A;  1KJK A;  4JV5 I;  3U1Y A;  2EM7 A;  1UBD C;  2EOO A;  1Z0E A;  2EMA A;  1MG7 A;  4UT4 A;  2YTF A;  2EZ6 A;  2K4V A;  4IFD C;  4RHB B;  1EH6 A;  1N34 I;  2C39 A;  2EN6 A;  2H36 X;  3WU4 A;  3BF2 A;  3T1Y I;  1A1F A;  2VQF I;  1RQ0 A;  1WHN A;  2WBU A;  2EPA A;  4DV1 E;  1Z1B A;  4KZS A;  2EPK X;  2Z5C B;  3H4L A;  5FLX Q;  2FTX B;  2NN6 F;  1UDO A;  5ADZ A;  4BC9 A;  1A1H A;  1YUI A;  1G2D C;  2PNZ A;  4OO1 A;  3Q1Q A;  2EOQ A;  4LF4 I;  1TF6 A; 
#chains in the Genus database with same CATH homology
 1N32 E;  4LF5 I;  4L5N C;  3JTZ A;  1YYK A;  1ZBQ A;  4DV6 E;  1HNW E;  2X36 A;  2E1R A;  2V88 A;  3HTX A;  4P7A A;  1X49 A;  3J80 Q;  3F0N A;  2R3V A;  1O0W A;  2L2M A;  2O1U A;  2KON A;  2IOQ A;  2UU9 I;  4DU7 A;  3VK6 A;  1HNX I;  1USV A;  3J81 C;  3HJC A;  1FKA E;  2JR1 A;  3P1X A;  2EFG A;  4M0V A;  4DPY A;  1HR0 E;  2L8T A;  2PNL A;  4AQY E;  2JWO A;  1XMO I;  2JOX A;  4YHH E;  2LTR A;  2UUC I;  1PVG A;  1HNZ E;  4DV5 E;  2CG9 A;  3VYY A;  5BR8 E;  2UXB E;  2G7H A;  2OI2 A;  3HXL A;  1H7S A;  5LMN I;  3OML A;  4JI0 E;  3LLH A;  2PNM A;  4GKK E;  1I94 I;  1U2R A;  4DR5 I;  4JI3 I;  2L6M A;  4DR7 E;  2E5L E;  4LF8 E;  4USM A;  1XNR E;  2N3H A;  4DU8 A;  2NUF A;  2B7V A;  2M4I A;  2ZM6 E;  4L8N A;  2DSY A;  1YYW A;  4UTG A;  2HFU A;  4B3S I;  1DAR A;  4FWD A;  2R42 A;  3JAM C;  2A2D A;  4GKJ I;  2F8B A;  4IZK A;  4LFB E;  4P52 A;  1N36 I;  2O1T A;  4BC7 A;  5AE3 A;  4JI1 E;  2LTS A;  4DR6 E;  2V83 A;  1SR9 A;  4HAC A;  4JI7 I;  2KOU A;  4FWG A;  2V87 A;  1GQE A;  1Z0G A;  2UUB E;  4X64 I;  3LPS A;  1RRE A;  2VQE I;  1FJG E;  4DV0 I;  4KHP E;  4B3R I;  3QT5 A;  4F54 A;  1H72 C;  3RMP A;  4HYM A;  2HHH I;  4JI8 I;  3ADG A;  4DKK A;  2V2Q A;  1Z0C A;  2CGE A;  2X7I A;  4X66 I;  4MYU A;  4B3M E;  1D6T A;  4PRX A;  1J5E E;  4J8Z A;  1EA6 A;  2V34 A;  4IZK B;  1STU A;  2VF3 A;  3J7Y p;  3LNU A;  1HK7 A;  4EMD A;  5LMU E;  2E1M A;  2NUG A;  2NUE A;  4X8W A;  2YT4 A;  2L3C A;  1ZM3 A;  1EI1 A;  3J7A M;  1XHK A;  4HAC B;  3V5R A;  4DV1 I;  4ZVI A;  4WUC A;  2Z5B A;  2VF1 A;  2GQ0 A;  5L3J A;  2IOP A;  3H09 A;  1N32 I;  5GMD A;  4JI6 E;  4DPT A;  1H73 A;  1WXR A;  1YZ9 A;  3V2U C;  4DV6 I;  1HNW I;  1T4N A;  4WUD A;  2IHR 1;  4OX9 E;  2DEJ A;  2V86 A;  3Q6N A;  5AAS A;  4LFA E;  4DUZ E;  4DR4 E;  3D4J A;  5GME A;  1FWL A;  2HK2 A;  4F9A B;  3B78 A;  3Q6M A;  3ZM7 A;  5IT9 Q;  3K1J A;  5IWA E;  4JYA E;  4AQY I;  2Z5B B;  1IBK E;  4X65 E;  3J7A G;  4R8O A;  5A2Q C;  1HNZ I;  4DPX A;  3M6A A;  2FV4 B;  4PRV A;  5BR8 I;  2UXB I;  2B9D A;  2M7Q A;  4FWH A;  4N3O A;  2HKE A;  1T4O A;  4IZJ A;  3T1Y E;  1YYO A;  3K17 A;  4I3H A;  4JI0 I;  4F9C B;  2KHX A;  1N33 E;  4WUB A;  4USK A;  4GKK I;  2B7T A;  4LU9 A;  4TUI A;  3QT6 A;  1ZM4 A;  2F4V E;  4BMJ A;  2HKJ A;  2E5L I;  4DR7 I;  1FNM A;  1XNR I;  1IBL E;  3WU5 A;  1KVK A;  2RTX A;  1Z0B A;  4NXM E;  4LFC E;  2ZM6 I;  4DPW A;  4DR1 E;  4B3T E;  3HPS A;  2Q2E B;  4BBY A;  2V8P A;  3FIG A;  2V89 A;  2A2C A;  4FW9 A;  4GEQ B;  1PIE A;  2UU9 E;  4LFB I;  4TUG A;  2LMZ A;  2CPN A;  4KQV A;  3PRY A;  2BM0 A;  4DV3 E;  4DUY E;  2UXD E;  4DR6 I;  4IZJ B;  1S16 A;  1WHQ A;  3LML A;  4I8O A;  1NHI A;  5F3W A;  3OTO E;  4DV2 E;  2UUB I;  1FJG I;  4HXZ A;  4KHP I;  3IWB A;  1XNQ E;  3ZOQ B;  3ADJ A;  5AE1 A;  3C4T A;  2ODR D;  2BM1 A;  2N3G A;  4LF6 E;  4B3M I;  3IWC A;  2O1V A;  1IBM E;  1J5E I;  3C4B A;  5FLX C;  2JOB A;  3F6H A;  3AV0 A;  1H7U A;  4JI4 E;  1GZ6 A;  4K0K E;  3J81 Q;  2LE2 A;  1T4L B;  1UEK A;  5LMU I;  1XMQ E;  1MX0 A;  4DXL A;  3HUL A;  2FGG A;  4NXN E;  4YY3 E;  5FWK A;  2ZIT A;  3J80 C;  4JI5 E;  1Y6Z A;  1KTV A;  2ZBK B;  2L2K B;  5CFF E;  1N36 E;  2EWL A;  5DNY A;  2L2N A;  2L3J A;  4JI2 E;  1WUU A;  1ZXM A;  4RPF A;  2NPF A;  4JI6 I;  4WYQ B;  3K6Q A;  4JI7 E;  2BV3 A;  4OX9 I;  4LF7 E;  1Z5C A;  3ZKB A;  2UUA E;  2YZT A;  1DI2 A;  3JU0 A;  2DIX A;  1A6F A;  4DUZ I;  1BKN A;  4DR4 I;  4DV4 E;  4JG4 A;  2LBS B;  3AUZ A;  2J7K A;  4R1F A;  1Y4U A;  3T1H E;  4DR3 E;  3P06 A;  1Z0V A;  1UHZ A;  1Z5A A;  5IWA I;  3GON A;  3ADI A;  4JYA I;  2MC5 A;  2LJH A;  2RS7 A;  1VIS A;  3ZZT A;  1H74 A;  4X65 I;  2VE7 C;  4LF9 E;  2RSM A;  1ZM2 A;  4DV7 E;  4R03 A;  1B62 A;  4DR2 E;  1HR0 I;  4WPY A;  4X62 E;  2UXC E;  4M1K A;  3ZZ0 A;  1N33 I;  4YHH I;  2L92 A;  4JV5 E;  1RR9 A;  4DV5 I;  1FWK A;  3KWR A;  2F4V I;  3WU6 A;  1N34 E;  1IBL I;  1OJ4 A;  2V85 A;  2VQF E;  4NXM I;  4LFC I;  1S4E A;  1ZBT A;  4DR1 I;  4B3T I;  1EKZ A;  2B3T B;  1FI4 A;  3ZKD A;  2DEI A;  2LUQ A;  4LF4 E;  2LUP B;  1B63 A;  1MU5 A;  1Z59 A;  4LF8 I;  4LF5 E;  2RS6 A;  3ZZU A;  2CZ9 A;  3B82 A;  2XEX A;  4DUY I;  4DV3 I;  2UXD I;  1X47 A;  4XTJ A;  2ODR C;  2V2V A;  3OTO I;  4P7D A;  4DV2 I;  4BCA A;  1N0V C;  3F6G A;  4LTY A;  2V8Q B;  1NHJ A;  4JI1 I;  1HNX E;  1XNQ I;  4DMI A;  3QT8 A;  3IWD A;  5AE2 A;  4LF6 I;  2LJP A;  2JY9 A;  1XMO E;  1NHH A;  2UUC E;  1IBM I;  4F9B B;  1N0U A;  2V2Z A;  2L33 A;  4HY1 A;  3PYG A;  1ZXN A;  4JI4 I;  1X48 A;  4WFT A;  4K0K I;  2Z5E A;  1ZM9 A;  4PU9 A;  1XMQ I;  4FN5 A;  5LMN E;  3WU3 A;  3PYE A;  2WZO A;  4IZJ D;  1UIL A;  4WSP A;  1I94 E;  3CWV A;  1J26 A;  5A2Q Q;  4DR5 E;  3LTO A;  4JI3 E;  3HPZ A;  4NXN I;  4YY3 I;  4OOG C;  2HK3 A;  4JI5 I;  1Y4S A;  5T6J A;  3HQ1 A;  2MDR A;  2LRS A;  4JI2 I;  2AJ4 A;  4B3S E;  5IT9 C;  4GKJ E;  4P78 A;  4LF7 I;  2JVA A;  2UUA I;  4URL A;  3B8H A;  1NZ0 A;  2M1S A;  3PYD A;  4DV4 I;  3MSW A;  1ELO A;  1USU A;  2WW4 A;  2NA2 A;  4DPU A;  4ED4 A;  3ADL A;  1PKP A;  1KKH A;  2MC6 A;  3T1H I;  2Z5C A;  4DR3 I;  1QZR A;  4X64 E;  2VQE E;  3DF6 A;  2HFS A;  4DV0 E;  4LFA I;  4B3R E;  1Z5B A;  1K47 A;  4M2Z A;  4MYT A;  2DB2 A;  3QT7 A;  4Q28 A;  3K85 A;  4Z7C A;  2DMY A;  4LF9 I;  2HHH E;  4JI8 E;  5LL6 R;  2O1W A;  4DV7 I;  1DQ3 A;  4M30 A;  2GS8 A;  4X66 E;  3PYF A;  1QU6 A;  1KIJ A;  3JAM Q;  1Z0T A;  4DR2 I;  4Z7Y A;  3DJW A;  4BS9 A;  3VYX A;  4X62 I;  1IBK I;  1Z0W A;  2UXC I;  1RC7 A;  4JV5 I;  4UT4 A;  1Z0E A;  1MG7 A;  2EZ6 A;  2K4V A;  1N34 I;  2H36 X;  3WU4 A;  3T1Y I;  2VQF I;  1RQ0 A;  1WHN A;  4DV1 E;  2Z5C B;  3H4L A;  4KZS A;  5FLX Q;  2FTX B;  5ADZ A;  4BC9 A;  3Q1Q A;  4LF4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...