4DV6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv6E02
3B82A 2E5LI 4LFCI 4FWDA 3B78A 2DB2A 2ZITA 4DV7E 4KHPE 1Z0WA 2BV3A 2UUAE 1A6FA 2V2VA 4JI5I 3WU3A 1YYKA 1J5EE 4JI7I 3Q1QA 2E1RA 3WU6A 2N3GA 2L3CA 3P1XA 2F4VI 3ADGA 5BR8I 4B3TE 1VISA 4X62E 4JV5I 4X66I 4HYMA 4Z7CA 1H74A 1KTVA 4DV2I 4USKA 2HK3A 1IBKI 2DEJA 1XNQE 1XNRI 4DPWA 1XMOE 1ZXMA 3OTOE 1XMQE 1MG7A 1T4OA 2L2NA 1T4NA 4X64I 1UILA 3T1HI 1DARA 1N33E 1ZBTA 1Z0CA 2LRSA 1N32I 3ADIA 1Z0EA 5IWAI 3QT6A 2LJHA 2HHHE 3JAMQ 4JYAI 3JAMC 4LF8I 4DU7A 4DR2I 4GKJE 2AJ4A 3VYYA 1X48A 4NXNE 4WUDA 2OI2A 1EKZA 4JI8E 4JI1I 3J7Yp 3ZM7A 5LMUI 2GS8A 4LF5E 2NUGA 4UT4A 2VQEE 4DR1E 1XHKA 1N0UA 1S4EA 1D6TA 3ZKDA 4JI4E 1I94I 2UXCE 2HKJA 2BM0A 3K17A 4DV3I 4NXME 4JI6E 2UXDE 4LFBE 4KQVA 4P52A 4YHHE 4DUZE 4HY1A 4DV0E 2B7VA 2UUCI 2UXBE 1IBLE 3V5RA 4Z7YA 4DR7I 2R3VA 1HR0E 1Z0TA 4FWGA 2LUPB 4M1KA 2BM1A 4I3HA 2L2KB 1UHZA 4AQYI 4DV4I 1H73A 4B3MI 3ZKBA 1Z0GA 4GKKE 4FWHA 1ZM2A 1N36E 4DV6E 1PVGA 5GMDA 2KHXA 1K47A 1IBMI 4LF7I 1N0VC 4B3SI 1Z5AA 5IT9Q 2ZBKB 5IT9C 3D4JA 2V34A 2J7KA 4DR3E 1N34I 1PIEA 4JI0E 4DR6I 4PRXA 1KVKA 4MYUA 1Z59A 2UU9E 3HULA 4OX9I 4LFAI 2N3HA 3WU4A 4M30A 1FWLA 2V2QA 4HXZA 3T1YE 4DPXA 4DPUA 3M6AA 2VQFE 4DPYA 4LF9I 4X65E 1S16A 3ZZTA 1H7UA 4DV1E 4DV7I 2DMYA 4KHPI 2B3TB 1H7SA 2DEIA 2V2ZA 3F0NA 2UUAI 1HNZE 2X36A 3PYGA 2R42A 4PU9A 1J5EI 4JG4A 1BKNA 4FW9A 4B3TI 1QU6A 3LNUA 2UUBE 4ZVIA 3V2UC 4X62I 5IWAE 2NPFA 3QT7A 2HFUA 3CWVA 2NUFA 1NHHA 3LPSA 4EMDA 1HNWE 4DXLA 1XNQI 3H4LA 1NZ0A 3WU5A 1XMOI 3OTOI 1XMQI 4JI1E 3J81Q 4JI2E 3J80Q 1T4LB 3J81C 4X8WA 1ZM4A 3J80C 2L33A 2HK2A 2EZ6A 2DIXA 4B3RE 4K0KE 2EFGA 1YZ9A 2A2DA 3LLHA 4DR4E 5L3JA 2HHHI 5CFFE 4R1FA 1MU5A 4GKJI 3QT8A 2B7TA 2NUEA 1B63A 4NXNI 1RQ0A 2WW4A 3ZZUA 1B62A 1HNXE 4YY3E 1J26A 4DV5E 4LF5I 4M2ZA 2VQEI 4DR1I 4LF6E 4DU8A 5LMNE 2RSMA 4LF4E 3GONA 3B8HA 4JI4I 2ZM6E 4OOGC 4DUYE 1H72C 4NXMI 2MDRA 1WHQA 2V8PA 2CZ9A 3C4TA 5A2QQ 4HACB 4JI6I 2UXDI 4LFBI 4YHHI 5A2QC 1GQEA 4DUZI 1FJGI 4DV0I 1Z0BA 2LTSA 2UXBI 4WFTA 1IBLI 4DR5I 2E5LE 2CPNA 4LFCE 3J7AG 1Z5CA 1HR0I 1MX0A 1ZXNA 2IHR1 4JI5E 4JI3I 2LBSB 4JI7E 1ZM9A 2LJPA 3PYDA 4LFAE 1OJ4A 3C4BA 4GKKI 2F4VE 1KKHA 5BR8E 1N36I 4DV6I 2Q2EB 4LF9E 3ADJA 3ADLA 4JV5E 4X66E 1RC7A 1NHJA 2JVAA 4PRVA 4DV2E 2NA2A 3PYEA 1IBKE 5LL6R 4WUCA 1XNRE 4DR3I 1X47A 4JI0I 3J7AM 2UU9I 4X64E 3T1HE 4URLA 3VYXA 3T1YI 1QZRA 2RS6A 1FWKA 3PYFA 4DPTA 5FLXQ 2VQFI 2A2CA 1N32E 2XEXA 2YT4A 4X65I 5FLXC 4DV1I 4ED4A 1X49A 4JYAE 1HNZI 4LF8E 4RPFA 4DR2E 4MYTA 2X7IA 3LTOA 1EI1A 3K1JA 3HTXA 2L3JA 5LMUE 1ZM3A 1Z5BA 4HACA 1U2RA 2UUBI 2LTRA 1N33I 3ZZ0A 1I94E 2HFSA 4WYQB 1HNWI 4DV3E 1STUA 2L2MA 1YYWA 1RR9A 4JI2I 1YYOA 1WUUA 4JI8I 2UUCE 1FNMA 1RREA 1DI2A 1FKAE 1EA6A 4B3RI 4K0KI 4DR7E 4P7AA 2JY9A 4WUBA 4DR4I 1Z0VA 2UXCI 4AQYE 3QT5A 4DV4E 4B3ME 1FI4A 4XTJA 1WHNA 2RS7A 1FJGE 1NHIA 1HNXI 4YY3I 4DV5I 4UTGA 4DR5E 4DKKA 4USMA 1KIJA 4LF6I 1IBME 4FN5A 4LF7E 5LMNI 2LUQA 4B3SE 4LF4I 2RTXA 2ZM6I 4JI3E 1UEKA 5GMEA 1PKPA 4DUYI 1N34E 1O0WA 2HKEA 4DR6E 4OX9E 2VF3A 1ELOA
chains in the Genus database with same CATH superfamily
2CTDA 3B82A 2ODRC 2V88A 1Y5YA 2E5LI 2GQ0A 4LFCI 2Z5BB 4FWDA 4WSPA 2ODRD 3B78A 5C0XC 5AE1A 5LLQA 4R2DA 5K36E 2DB2A 2ZITA 4DV7E 4KHPE 1Z0WA 2BV3A 2EPNA 2UUAE 1A6FA 2JOBA 5C0XD 2V2VA 2O1WA 4JI5I 3WU3A 1YYKA 2PO1B 1UN6B 5FWKA 4O5GA 1J5EE 4JI7I 2E72A 3Q1QA 2EM3A 2E1RA 1YH8A 3WU6A 4BA2B 2N3GA 2L3CA 2EE8A 4GQUA 2EM5A 3P1XA 2F4VI 1EH6A 2YTOA 3ADGA 1WXRA 3P76A 5BR8I 4B3TE 5JEAF 4FW6A 2VE7C 3ECRA 1EH8A 1VISA 4X62E 4BMJA 1RHYA 1X6FA 4JV5I 4X66I 2EOYA 4HYMA 4Z7CA 2BR2A 1H74A 1KTVA 2HGHA 5KL5A 4DV2I 4USKA 2HK3A 2EPCA 2WP8A 5C0XB 1IBKI 1T39A 2DEJA 1XNQE 2NN6A 3EPJA 1XNRI 2EMFA 3P3GA 4DPWA 5AC5A 1N3GA 1XMOE 3L7ZB 1ZXMA 4MU3A 2HC5A 1USUA 3OTOE 1XMQE 1OYPA 1MG7A 2JT2A 1T4OA 2DSYA 2L2NA 4IFDF 1T4NA 4X64I 1UILA 4WXCA 1A1FA 2NN6C 3T1HI 2CVEA 4F9CB 1PDAA 3CDJA 4FW4A 2NN6D 2FV4B 1DARA 1N33E 1ZBTA 1Y6ZA 1Z0CA 2K4VA 2LRSA 2WBUA 1N32I 2LMZA 3ADIA 1TF6A 1Z0EA 5IWAI 2LE2A 4GZNC 3QT6A 2LJHA 4DMIA 2HHHE 3JAMQ 1YUJA 4JYAI 2E1MA 1OYRA 3JAMC 2JXPA 4LF8I 4DU7A 4DR2I 2N8XA 4GKJE 2EQ0A 3VYYA 2AJ4A 4FW3A 4KWYA 4U3DA 1X48A 5C0XF 2EN3A 4NXNE 4F9BB 4WUDA 3TQMA 2OI2A 3Q6NA 3C6KA 1EKZA 4JI8E 2R76A 3J7Yp 4JI1I 3ZM7A 2YWQA 5LMUI 2MDGA 2JP9A 2GS8A 4LF5E 3U1KA 3C6MA 2YTFA 2NUGA 2CSHA 2EMXA 1YFHA 2O1VA 2BR2B 4UT4A 2VQEE 4DR1E 2JWOA 1N0UA 1S4EA 3LMLA 1XHKA 2MC6A 2PO0A 1D6TA 2EM0A 2M1SA 2NN6B 3THNA 3ZKDA 4LCGA 2EPMX 2D9HA 4JI4E 1I94I 1PJTA 2UXCE 2RPCA 2HKJA 3JU0A 2BM0A 2EM6A 3THOB 1TF3A 3K17A 4DV3I 2EN2A 1X3CA 2EMLA 4NXME 2F1DA 4MQYA 4JI6E 2UXDE 4LFBE 4KQVA 4P52A 4YHHE 4DUZE 4R2PA 4R8OA 4HY1A 4DV0E 2B7VA 2UUCI 2HJJA 1LLMC 2UXBE 5EL9A 1IBLE 4RHBB 5A6JA 2YTEA 2JE6A 5DRPA 3V5RA 4MU0A 2EMWA 4Z7YA 1E3PA 3L00A 2K7IA 4DR7I 2R3VA 1HR0E 2PNZA 1Z0TA 2EN6A 4FWGA 2LUPB 4M1KA 2BM1A 4I3HA 2L2KB 1UHZA 3RMPA 4AQYI 2PO2A 3Q6MA 4OO1E 4OO1A 1MEYC 4DV4I 4IZKA 1H73A 4B3MI 3ZKBA 1G2FC 1YUIA 2F8BA 4R2CA 2PO0B 3UHMA 2EM2A 1Z0GA 4GKKE 4FWHA 4F6NA 5A6KA 2CT1A 2BA1D 1ZM2A 1N36E 4DV6E 1PVGA 5GMDA 4OO1C 2WZOA 2KHXA 1K47A 1IBMI 4LF7I 1N0VC 3QG5C 3H1CA 2EMYA 4OO1D 1X6EA 4B3SI 5DRQA 1Z5AA 2EMBA 2IOPA 5IT9Q 5K36A 2ZBKB 4IS9A 4WX9A 5IT9C 3NZKA 3D4JA 2V34A 2L6MA 2J7KA 5A69A 4DR3E 5T6JA 1N34I 2JEBA 1PIEA 1SFEA 1UBDC 4JI0E 4DR6I 4PRXA 2DLQA 1KVKA 4LPFA 5K36C 4MYUA 1Z59A 2WBTA 3HPZA 2LVHA 4L8NA 2UU9E 2JE6B 3HULA 4P7DA 4OX9I 4Q28A 4LFAI 5K36D 2N3HA 1UDNA 4M30A 3WU4A 1FWLA 2V2QA 2LT7A 4HXZA 3T1YE 2EMCA 4I8OA 4DPXA 2PNZB 4DPUA 2IERA 1YSAC 3M6AA 2CG9A 2VQFE 2V85A 4DPYA 2EL5A 4R2EA 4LF9I 1YPNA 4X65E 1S16A 4QNJA 3ZZTA 5A6BA 1H7UA 4DV1E 2PO2B 3HXLA 2DMYA 4DV7I 1BB8A 2B3TB 1H7SA 2DEIA 2V2ZA 2EOOA 3F0NA 4FW7A 2M9AA 2EN1A 4IZKB 2UUAI 3F6GA 3VHTB 1HNZE 4F2JC 2BA1G 2C39A 2X36A 3HJCA 4BC7A 5KL7A 3PYGA 2R42A 4PU9A 1NCSA 1ZBQA 2I13A 2YTPA 1J5EI 4JG4A 3P3EA 1BKNA 5A6BD 2VRDA 5ELWA 3EQ1A 1DGCA 2GPIA 2BB8A 4BA1A 4F6MA 3DF6A 4FW9A 5K36B 2YRKA 4B3TI 1QU6A 5F3WA 3LNUA 2O1UA 2EWLA 2EPOA 4Q35B 2UUBE 2GO3A 4ZVIA 2YSPA 2EM7A 3V2UC 4X62I 5IWAE 1R6LA 2MC5A 5AE2A 1HK7A 2NPFA 4IZJA 3QT7A 2HFUA 4AIDA 2JEBB 2J7JA 2IESA 2DLKA 5IV8B 5AC4A 2EOHA 3CWVA 2NUFA 1NHHA 3LPSA 4EMDA 1HNWE 4DXLA 2GO4A 1XNQI 3H4LA 3FIGA 1NZ0A 3WU5A 1B69A 2MKDA 4M9VC 2I9IA 1XMOI 3H09A 4U3BA 3OTOI 2L8TA 1XMQI 4JI1E 2V83A 3J81Q 2EMIA 3B4TA 4JI2E 3PS3A 4MLQA 1T4LB 3J80Q 3J81C 2DRPA 2ENAA 4X8WA 2Q8UA 1ZM4A 3J80C 4IZJD 2B9DA 2FTXB 4MU4A 4P78A 3AUZA 2L33A 1WRJA 5KL6A 4IJDA 2HK2A 1RMDA 2EZ6A 2DIXA 4B3RE 4K0KE 2EPUA 2EFGA 1MGTA 1YZ9A 2A2DA 2C39B 4LOMA 2EQ1A 3ZOQB 3LLHA 5EKWA 2EOSA 2M4IA 4DR4E 5L3JA 2DMIA 2HHHI 4NBQA 3EPHA 4MLVA 2PNLA 2PNMA 1X6HA 5CFFE 4BCAA 4R1FA 1MU5A 2EM9A 4GKJI 5IXMB 3QT8A 2B7TA 4BA1B 2NUEA 4KZSA 4M0VA 1B63A 4NXNI 1G2DC 2MKNA 1RQ0A 1IMUA 3VK6A 4TUGA 2YTQA 2WW4A 3ZZUA 2EPXA 3BIDA 1F2IG 1B62A 4O4KA 2RSIA 1HNXE 4YY3E 1J26A 4DV5E 4LF5I 4BS9A 4IZJB 4M2ZA 2VQEI 4DR1I 5JEAE 4LF6E 4DU8A 1XXEA 5LMNE 2RSMA 1NEIA 3KWRA 1A1GA 1YHCA 4R2QA 4LF4E 1ZR9A 3GONA 3B8HA 2VF1A 4JI4I 2ZM6E 1PJQA 4F54A 4J8ZA 2EPPA 4OOGC 2NN6F 3P06A 4DUYE 5JEAC 1Z1BA 4N4RB 1H72C 3UK3C 4NXMI 3IWCA 2MDRA 2YU8A 1WHQA 2V8PA 2CZ9A 3C4TA 5A2QQ 4HACB 2ENCA 4JI6I 1EH7A 4LFBI 2UXDI 2YTNA 4YHHI 2RQLA 5A2QC 2JEAA 1GQEA 3BBGA 4DUZI 1FJGI 4IFDE 4DV0I 2EOZA 2LTSA 1Z0BA 5TSEA 2EOJA 3IWDA 1UDOA 1TN9A 3K85A 4MDTA 2UXBI 4WFTA 1IBLI 4DR5I 2E5LE 2CPNA 4LFCE 4ISAA 3J7AG 1Z5CA 4OZEA 2BA0D 1P42A 2V87A 1ZAAC 1HR0I 1IQOA 1MX0A 1ZXNA 4IFDC 2JR1A 2IHR1 4JI5E 2WNRA 4JI3I 5A6AA 1KYQA 3KZYA 4J3DA 4WSGA 2EN4A 2LBSB 1R6MA 2V86A 5C0XE 1IQSA 3DJWA 4JI7E 1ZM9A 2LJPA 2KONA 2YSOA 3PYDA 2PRTA 2ENHA 3EPKA 4LFAE 5JEAB 2ELZA 3C4BA 1OJ4A 1Y4SA 2EMGA 3P3CA 1A1KA 4GEQB 4GKKI 5DNYA 1ZU1A 2F4VE 1KKHA 1E3HA 2YTIA 5BR8E 1N36I 4DV6I 2Q2EB 4LF9E 1WJPA 2JOXA 2IOQA 3ADJA 3F6HA 3ADLA 4AIMA 4JV5E 4X66E 3HQ1A 5AASA 3BGHA 1RC7A 1NHJA 2JVAA 3M99B 4DV2E 1UDQA 3HPSA 4PRVA 2NA2A 3PYEA 1IBKE 4ZYDA 5LL6R 3GMEA 4WUCA 2JEAB 1XNRE 2EN7A 4WXDA 1X47A 2WBSA 4DR3I 2C38A 2C37A 1GTKA 4F9AB 4IFDB 3M7ND 4JI0I 2EOQA 2Z5CA 4N3OA 2BA0G 3KZZA 3MHSC 3J7AM 2UU9I 1AH5A 3PRYA 4TUIA 3PS1A 1X5WA 4X64E 3T1HE 5DNLA 4URLA 1A1JA 2EOEA 3VYXA 2G7HA 3T1YI 1QZRA 4NZVA 1JK1A 2RS6A 1FWKA 3PYFA 4DPTA 5FLXQ 2VQFI 2WNRB 2A2CA 1AAYA 1N32E 2XEXA 2YT4A 2YTJA 3KRNA 5FLXC 4QNKA 4ZYHA 4X65I 4DV1I 5KL3A 2L92A 2YPNA 4ED4A 1X49A 2KOUA 4BC9A 2NN6E 4ZYEA 2LV2A 4JYAE 4ZYGA 1SR9A 2EPRA 1HNZI 4LF8E 1OYSA 4RPFA 4DR2E 2H36X 1KJKA 4BHCA 2X7IA 3HKMA 4MYTA 3LTOA 4OO1F 1EI1A 4HTGA 3BF2A 3K1JA 5AE3A 2EP3A 3HTXA 2EM4A 2CGEA 2EOXA 2EMZA 1PJSA 5KL4A 2L3JA 1GZ6A 2EOFA 5LMUE 1ZM3A 4OO1B 1Z5BA 1JK2A 2EMKA 5KL2A 3JTZA 4LCHA 3DD6A 4WPYA 1BBOA 2R1FA 4HACA 1U2RA 2EJ4A 3M7NG 2YZTA 2UUBI 1DQ3A 4RH8A 2LTRA 2YTGA 1N33I 2NABA 5K36F 2EPKX 2GLIA 1I94E 2O1TA 3MSWA 2C37B 2C38B 3ZZ0A 2LCEA 2EQ3A 2GHFA 2Z5CB 3M85D 2EMAA 2HFSA 2V89A 4WYQB 1HNWI 4DV3E 1STUA 2L2MA 4FW5A 4NHRA 1YYWA 1RR9A 4JI2I 1YYOA 2YRMA 4R2RA 2EL4A 1WUUA 3CDIA 4JI8I 2VESA 2ELYA 2UUCE 1FNMA 1RREA 1DI2A 4LCFA 1FKAE 1EA6A 4LU9A 2WP8B 1Y60A 4HEIA 5JEAA 4B3RI 4K0KI 4DR7E 2JYAA 3K6QA 4R2AA 4P7AA 2M7QA 2JY9A 4WUBA 4DR4I 2EL6A 1Z0VA 1USVA 4R2SA 2Z5EA 2Z5BA 2UXCI 2J65A 1T38A 3GLLA 4MU1A 4BBYA 2EORA 4AQYE 5DROA 2A25A 3QT5A 4DV4E 1Y4UA 4B3ME 1FI4A 4XTJA 5JEAD 2ADRA 2BBGA 1WHNA 2LJUA 3OMLA 2RS7A 1FJGE 1A1IA 2DGCA 4O24A 2PO1A 4X9JA 3M85G 1NHIA 4AM3A 1HNXI 4YY3I 1P47A 4R03A 4UTGA 3GCMA 4DR5E 4DV5I 4DKKA 4IFDA 5DRRA 4USMA 2LO3A 1KIJA 4LF6I 1IBME 4FN5A 2EPLX 4BA2A 4LF7E 3EPLA 5LMNI 2LUQA 1A1LA 4B3SE 1VI7A 4L5NC 4LF4I 2EPAA 2RTXA 3IWBA 2YTDA 2EOIA 3U1YA 2ZM6I 2EN8A 4JI3E 1UEKA 4KHPI 4BHBA 5GMEA 2YRHA 1PKPA 2V8QB 3AV0A 4DUYI 2WCC3 4IFDD 2EOMA 1N34E 1UDSA 1O0WA 2HKEA 5DNXA 4LTYA 2EMHA 1QNTA 2YU5A 4DR6E 2AE8A 5C0XA 2FGGA 4OX9E 5ADZA 3MHHC 2EPZA 4IS1C 3PS2A 1L4SA 4OKGA 4O43A 4FK5C 2O3ZA 1A1HA 2EM8A 2VF3A 3L7ZA 1BBGA 2JPAA 1ELOA
chains in the Genus database with same CATH topology
3B82A 2ODRC 2V88A 2E5LI 2GQ0A 4LFCI 2Z5BB 4FWDA 4WSPA 2ODRD 3B78A 5AE1A 2DB2A 2ZITA 4DV7E 4KHPE 1Z0WA 2BV3A 2UUAE 1A6FA 2JOBA 2V2VA 2O1WA 4JI5I 3WU3A 1YYKA 5FWKA 1J5EE 4JI7I 3Q1QA 2E1RA 3WU6A 2N3GA 2L3CA 3P1XA 2F4VI 3ADGA 1WXRA 5BR8I 4B3TE 2VE7C 1VISA 4X62E 4BMJA 4JV5I 4X66I 4HYMA 4Z7CA 1H74A 1KTVA 4DV2I 4USKA 2HK3A 1IBKI 2DEJA 1XNQE 1XNRI 4DPWA 1XMOE 1ZXMA 1USUA 3OTOE 1XMQE 1MG7A 1T4OA 2DSYA 2L2NA 1T4NA 4X64I 1UILA 3T1HI 4F9CB 2FV4B 1DARA 1N33E 1ZBTA 1Y6ZA 1Z0CA 2K4VA 2LRSA 1N32I 2LMZA 3ADIA 1Z0EA 5IWAI 2LE2A 3QT6A 2LJHA 4DMIA 2HHHE 3JAMQ 4JYAI 2E1MA 3JAMC 4LF8I 4DU7A 4DR2I 4GKJE 2AJ4A 3VYYA 1X48A 4NXNE 4F9BB 4WUDA 2OI2A 3Q6NA 1EKZA 4JI8E 4JI1I 3J7Yp 3ZM7A 5LMUI 2GS8A 4LF5E 2NUGA 2O1VA 4UT4A 2VQEE 4DR1E 2JWOA 1N0UA 1S4EA 3LMLA 1XHKA 2MC6A 1D6TA 2M1SA 3ZKDA 4JI4E 1I94I 2UXCE 2HKJA 3JU0A 2BM0A 3K17A 4DV3I 4NXME 4JI6E 2UXDE 4LFBE 4KQVA 4P52A 4YHHE 4DUZE 4R8OA 4HY1A 4DV0E 2B7VA 2UUCI 2UXBE 1IBLE 3V5RA 4Z7YA 4DR7I 2R3VA 1HR0E 1Z0TA 4FWGA 2LUPB 4M1KA 2BM1A 4I3HA 2L2KB 1UHZA 3RMPA 4AQYI 3Q6MA 4DV4I 4IZKA 1H73A 4B3MI 3ZKBA 2F8BA 1Z0GA 4GKKE 4FWHA 1ZM2A 1N36E 4DV6E 1PVGA 5GMDA 2WZOA 2KHXA 1K47A 1IBMI 4LF7I 1N0VC 4B3SI 1Z5AA 5IT9Q 2IOPA 2ZBKB 5IT9C 3D4JA 2V34A 2L6MA 2J7KA 4DR3E 5T6JA 1N34I 1PIEA 4JI0E 4DR6I 4PRXA 1KVKA 4MYUA 1Z59A 3HPZA 2UU9E 4L8NA 3HULA 4OX9I 4P7DA 4Q28A 4LFAI 2N3HA 3WU4A 4M30A 1FWLA 2V2QA 4HXZA 3T1YE 4I8OA 4DPXA 4DPUA 3M6AA 2CG9A 2VQFE 2V85A 4DPYA 4LF9I 4X65E 1S16A 3ZZTA 1H7UA 4DV1E 3HXLA 2DMYA 4DV7I 4KHPI 2B3TB 1H7SA 2DEIA 2V2ZA 3F0NA 4IZKB 2UUAI 3F6GA 1HNZE 3HJCA 2X36A 4BC7A 3PYGA 2R42A 4PU9A 1ZBQA 1J5EI 4JG4A 1BKNA 3DF6A 4FW9A 4B3TI 1QU6A 5F3WA 3LNUA 2O1UA 2EWLA 2UUBE 4ZVIA 3V2UC 4X62I 5IWAE 2MC5A 5AE2A 1HK7A 2NPFA 4IZJA 3QT7A 2HFUA 3CWVA 2NUFA 1NHHA 3LPSA 4EMDA 1HNWE 4DXLA 1XNQI 3H4LA 3FIGA 1NZ0A 3WU5A 1XMOI 3H09A 3OTOI 2L8TA 1XMQI 4JI1E 2V83A 3J81Q 4JI2E 3J80Q 1T4LB 3J81C 4IZJD 4X8WA 1ZM4A 3J80C 2B9DA 2FTXB 4P78A 3AUZA 2L33A 2HK2A 2EZ6A 2DIXA 4B3RE 4K0KE 2EFGA 1YZ9A 2A2DA 3ZOQB 3LLHA 2M4IA 4DR4E 5L3JA 2HHHI 2PNLA 2PNMA 5CFFE 4BCAA 4R1FA 1MU5A 4GKJI 3QT8A 2B7TA 2NUEA 4KZSA 4M0VA 1B63A 4NXNI 1RQ0A 3VK6A 4TUGA 2WW4A 3ZZUA 1B62A 1HNXE 4YY3E 1J26A 4DV5E 4LF5I 4BS9A 4IZJB 4M2ZA 2VQEI 4DR1I 4LF6E 4DU8A 5LMNE 2RSMA 3KWRA 4LF4E 3GONA 3B8HA 2VF1A 4JI4I 2ZM6E 4F54A 4J8ZA 4OOGC 3P06A 4DUYE 1H72C 4NXMI 3IWCA 2MDRA 1WHQA 2V8PA 2CZ9A 3C4TA 5A2QQ 4HACB 4JI6I 2UXDI 4LFBI 4YHHI 5A2QC 1GQEA 4DUZI 1FJGI 4DV0I 1Z0BA 2LTSA 3IWDA 3K85A 2UXBI 4WFTA 1IBLI 4DR5I 2E5LE 2CPNA 4LFCE 3J7AG 1Z5CA 2V87A 1HR0I 1MX0A 1ZXNA 2JR1A 2IHR1 4JI5E 4JI3I 2LBSB 2V86A 3DJWA 4JI7E 1ZM9A 2LJPA 2KONA 3PYDA 4LFAE 1OJ4A 3C4BA 1Y4SA 4GKKI 4GEQB 5DNYA 2F4VE 1KKHA 5BR8E 1N36I 4DV6I 2Q2EB 4LF9E 2JOXA 2IOQA 3ADJA 3F6HA 3ADLA 4JV5E 4X66E 3HQ1A 5AASA 1RC7A 1NHJA 2JVAA 4PRVA 4DV2E 3HPSA 2NA2A 3PYEA 1IBKE 5LL6R 4WUCA 1XNRE 4DR3I 1X47A 4F9AB 4JI0I 2Z5CA 4N3OA 3J7AM 2UU9I 3PRYA 4TUIA 4X64E 3T1HE 4URLA 3VYXA 2G7HA 3T1YI 1QZRA 2RS6A 1FWKA 3PYFA 4DPTA 5FLXQ 2VQFI 2A2CA 1N32E 2XEXA 2YT4A 4X65I 5FLXC 4DV1I 2L92A 4ED4A 1X49A 2KOUA 4BC9A 4JYAE 1SR9A 1HNZI 4LF8E 4RPFA 4DR2E 2H36X 4MYTA 2X7IA 3LTOA 1EI1A 3K1JA 5AE3A 3HTXA 2CGEA 2L3JA 1GZ6A 5LMUE 1ZM3A 1Z5BA 3JTZA 4WPYA 4HACA 1U2RA 2YZTA 2UUBI 1DQ3A 2LTRA 1N33I 3ZZ0A 1I94E 2O1TA 3MSWA 2Z5CB 2HFSA 2V89A 4WYQB 1HNWI 4DV3E 1STUA 2L2MA 1YYWA 1RR9A 4JI2I 1YYOA 1WUUA 4JI8I 2UUCE 1FNMA 1RREA 1DI2A 1FKAE 1EA6A 4LU9A 4B3RI 4K0KI 4DR7E 3K6QA 4P7AA 2M7QA 2JY9A 4WUBA 4DR4I 1Z0VA 1USVA 2Z5EA 2Z5BA 2UXCI 4BBYA 4AQYE 3QT5A 4DV4E 1Y4UA 4B3ME 1FI4A 4XTJA 1WHNA 2RS7A 3OMLA 1FJGE 1NHIA 1HNXI 4YY3I 4DV5I 4R03A 4UTGA 4DR5E 4DKKA 4USMA 1KIJA 4LF6I 1IBME 4FN5A 4LF7E 5LMNI 2LUQA 4B3SE 4L5NC 4LF4I 3IWBA 2RTXA 2ZM6I 4JI3E 1UEKA 5GMEA 1PKPA 2V8QB 3AV0A 4DUYI 1N34E 1O0WA 2HKEA 4LTYA 4DR6E 2FGGA 4OX9E 5ADZA 2VF3A 1ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B82 A;  2E5L I;  4LFC I;  4FWD A;  3B78 A;  2DB2 A;  2ZIT A;  4DV7 E;  4KHP E;  1Z0W A;  2BV3 A;  2UUA E;  1A6F A;  2V2V A;  4JI5 I;  3WU3 A;  1YYK A;  1J5E E;  4JI7 I;  3Q1Q A;  2E1R A;  3WU6 A;  2N3G A;  2L3C A;  3P1X A;  2F4V I;  3ADG A;  5BR8 I;  4B3T E;  1VIS A;  4X62 E;  4JV5 I;  4X66 I;  4HYM A;  4Z7C A;  1H74 A;  1KTV A;  4DV2 I;  4USK A;  2HK3 A;  1IBK I;  2DEJ A;  1XNQ E;  1XNR I;  4DPW A;  1XMO E;  1ZXM A;  3OTO E;  1XMQ E;  1MG7 A;  1T4O A;  2L2N A;  1T4N A;  4X64 I;  1UIL A;  3T1H I;  1DAR A;  1N33 E;  1ZBT A;  1Z0C A;  2LRS A;  1N32 I;  3ADI A;  1Z0E A;  5IWA I;  3QT6 A;  2LJH A;  2HHH E;  3JAM Q;  4JYA I;  3JAM C;  4LF8 I;  4DU7 A;  4DR2 I;  4GKJ E;  2AJ4 A;  3VYY A;  1X48 A;  4NXN E;  4WUD A;  2OI2 A;  1EKZ A;  4JI8 E;  4JI1 I;  3J7Y p;  3ZM7 A;  5LMU I;  2GS8 A;  4LF5 E;  2NUG A;  4UT4 A;  2VQE E;  4DR1 E;  1XHK A;  1N0U A;  1S4E A;  1D6T A;  3ZKD A;  4JI4 E;  1I94 I;  2UXC E;  2HKJ A;  2BM0 A;  3K17 A;  4DV3 I;  4NXM E;  4JI6 E;  2UXD E;  4LFB E;  4KQV A;  4P52 A;  4YHH E;  4DUZ E;  4HY1 A;  4DV0 E;  2B7V A;  2UUC I;  2UXB E;  1IBL E;  3V5R A;  4Z7Y A;  4DR7 I;  2R3V A;  1HR0 E;  1Z0T A;  4FWG A;  2LUP B;  4M1K A;  2BM1 A;  4I3H A;  2L2K B;  1UHZ A;  4AQY I;  4DV4 I;  1H73 A;  4B3M I;  3ZKB A;  1Z0G A;  4GKK E;  4FWH A;  1ZM2 A;  1N36 E;  4DV6 E;  1PVG A;  5GMD A;  2KHX A;  1K47 A;  1IBM I;  4LF7 I;  1N0V C;  4B3S I;  1Z5A A;  5IT9 Q;  2ZBK B;  5IT9 C;  3D4J A;  2V34 A;  2J7K A;  4DR3 E;  1N34 I;  1PIE A;  4JI0 E;  4DR6 I;  4PRX A;  1KVK A;  4MYU A;  1Z59 A;  2UU9 E;  3HUL A;  4OX9 I;  4LFA I;  2N3H A;  3WU4 A;  4M30 A;  1FWL A;  2V2Q A;  4HXZ A;  3T1Y E;  4DPX A;  4DPU A;  3M6A A;  2VQF E;  4DPY A;  4LF9 I;  4X65 E;  1S16 A;  3ZZT A;  1H7U A;  4DV1 E;  4DV7 I;  2DMY A;  4KHP I;  2B3T B;  1H7S A;  2DEI A;  2V2Z A;  3F0N A;  2UUA I;  1HNZ E;  2X36 A;  3PYG A;  2R42 A;  4PU9 A;  1J5E I;  4JG4 A;  1BKN A;  4FW9 A;  4B3T I;  1QU6 A;  3LNU A;  2UUB E;  4ZVI A;  3V2U C;  4X62 I;  5IWA E;  2NPF A;  3QT7 A;  2HFU A;  3CWV A;  2NUF A;  1NHH A;  3LPS A;  4EMD A;  1HNW E;  4DXL A;  1XNQ I;  3H4L A;  1NZ0 A;  3WU5 A;  1XMO I;  3OTO I;  1XMQ I;  4JI1 E;  3J81 Q;  4JI2 E;  3J80 Q;  1T4L B;  3J81 C;  4X8W A;  1ZM4 A;  3J80 C;  2L33 A;  2HK2 A;  2EZ6 A;  2DIX A;  4B3R E;  4K0K E;  2EFG A;  1YZ9 A;  2A2D A;  3LLH A;  4DR4 E;  5L3J A;  2HHH I;  5CFF E;  4R1F A;  1MU5 A;  4GKJ I;  3QT8 A;  2B7T A;  2NUE A;  1B63 A;  4NXN I;  1RQ0 A;  2WW4 A;  3ZZU A;  1B62 A;  1HNX E;  4YY3 E;  1J26 A;  4DV5 E;  4LF5 I;  4M2Z A;  2VQE I;  4DR1 I;  4LF6 E;  4DU8 A;  5LMN E;  2RSM A;  4LF4 E;  3GON A;  3B8H A;  4JI4 I;  2ZM6 E;  4OOG C;  4DUY E;  1H72 C;  4NXM I;  2MDR A;  1WHQ A;  2V8P A;  2CZ9 A;  3C4T A;  5A2Q Q;  4HAC B;  4JI6 I;  2UXD I;  4LFB I;  4YHH I;  5A2Q C;  1GQE A;  4DUZ I;  1FJG I;  4DV0 I;  1Z0B A;  2LTS A;  2UXB I;  4WFT A;  1IBL I;  4DR5 I;  2E5L E;  2CPN A;  4LFC E;  3J7A G;  1Z5C A;  1HR0 I;  1MX0 A;  1ZXN A;  2IHR 1;  4JI5 E;  4JI3 I;  2LBS B;  4JI7 E;  1ZM9 A;  2LJP A;  3PYD A;  4LFA E;  1OJ4 A;  3C4B A;  4GKK I;  2F4V E;  1KKH A;  5BR8 E;  1N36 I;  4DV6 I;  2Q2E B;  4LF9 E;  3ADJ A;  3ADL A;  4JV5 E;  4X66 E;  1RC7 A;  1NHJ A;  2JVA A;  4PRV A;  4DV2 E;  2NA2 A;  3PYE A;  1IBK E;  5LL6 R;  4WUC A;  1XNR E;  4DR3 I;  1X47 A;  4JI0 I;  3J7A M;  2UU9 I;  4X64 E;  3T1H E;  4URL A;  3VYX A;  3T1Y I;  1QZR A;  2RS6 A;  1FWK A;  3PYF A;  4DPT A;  5FLX Q;  2VQF I;  2A2C A;  1N32 E;  2XEX A;  2YT4 A;  4X65 I;  5FLX C;  4DV1 I;  4ED4 A;  1X49 A;  4JYA E;  1HNZ I;  4LF8 E;  4RPF A;  4DR2 E;  4MYT A;  2X7I A;  3LTO A;  1EI1 A;  3K1J A;  3HTX A;  2L3J A;  5LMU E;  1ZM3 A;  1Z5B A;  4HAC A;  1U2R A;  2UUB I;  2LTR A;  1N33 I;  3ZZ0 A;  1I94 E;  2HFS A;  4WYQ B;  1HNW I;  4DV3 E;  1STU A;  2L2M A;  1YYW A;  1RR9 A;  4JI2 I;  1YYO A;  1WUU A;  4JI8 I;  2UUC E;  1FNM A;  1RRE A;  1DI2 A;  1FKA E;  1EA6 A;  4B3R I;  4K0K I;  4DR7 E;  4P7A A;  2JY9 A;  4WUB A;  4DR4 I;  1Z0V A;  2UXC I;  4AQY E;  3QT5 A;  4DV4 E;  4B3M E;  1FI4 A;  4XTJ A;  1WHN A;  2RS7 A;  1FJG E;  1NHI A;  1HNX I;  4YY3 I;  4DV5 I;  4UTG A;  4DR5 E;  4DKK A;  4USM A;  1KIJ A;  4LF6 I;  1IBM E;  4FN5 A;  4LF7 E;  5LMN I;  2LUQ A;  4B3S E;  4LF4 I;  2RTX A;  2ZM6 I;  4JI3 E;  1UEK A;  5GME A;  1PKP A;  4DUY I;  1N34 E;  1O0W A;  2HKE A;  4DR6 E;  4OX9 E;  2VF3 A;  1ELO A; 
#chains in the Genus database with same CATH topology
 2CTD A;  3B82 A;  2ODR C;  2V88 A;  1Y5Y A;  2E5L I;  2GQ0 A;  4LFC I;  2Z5B B;  4FWD A;  4WSP A;  2ODR D;  3B78 A;  5C0X C;  5AE1 A;  5LLQ A;  4R2D A;  5K36 E;  2DB2 A;  2ZIT A;  4DV7 E;  4KHP E;  1Z0W A;  2BV3 A;  2EPN A;  2UUA E;  1A6F A;  2JOB A;  5C0X D;  2V2V A;  2O1W A;  4JI5 I;  3WU3 A;  1YYK A;  2PO1 B;  1UN6 B;  5FWK A;  4O5G A;  1J5E E;  4JI7 I;  2E72 A;  3Q1Q A;  2EM3 A;  2E1R A;  1YH8 A;  3WU6 A;  4BA2 B;  2N3G A;  2L3C A;  2EE8 A;  4GQU A;  2EM5 A;  3P1X A;  2F4V I;  1EH6 A;  2YTO A;  3ADG A;  1WXR A;  3P76 A;  5BR8 I;  4B3T E;  5JEA F;  4FW6 A;  2VE7 C;  3ECR A;  1EH8 A;  1VIS A;  4X62 E;  4BMJ A;  1RHY A;  1X6F A;  4JV5 I;  4X66 I;  2EOY A;  4HYM A;  4Z7C A;  2BR2 A;  1H74 A;  1KTV A;  2HGH A;  5KL5 A;  4DV2 I;  4USK A;  2HK3 A;  2EPC A;  2WP8 A;  5C0X B;  1IBK I;  1T39 A;  2DEJ A;  1XNQ E;  2NN6 A;  3EPJ A;  1XNR I;  2EMF A;  3P3G A;  4DPW A;  5AC5 A;  1N3G A;  1XMO E;  3L7Z B;  1ZXM A;  4MU3 A;  2HC5 A;  1USU A;  3OTO E;  1XMQ E;  1OYP A;  1MG7 A;  2JT2 A;  1T4O A;  2DSY A;  2L2N A;  4IFD F;  1T4N A;  4X64 I;  1UIL A;  4WXC A;  1A1F A;  2NN6 C;  3T1H I;  2CVE A;  4F9C B;  1PDA A;  3CDJ A;  4FW4 A;  2NN6 D;  2FV4 B;  1DAR A;  1N33 E;  1ZBT A;  1Y6Z A;  1Z0C A;  2K4V A;  2LRS A;  2WBU A;  1N32 I;  2LMZ A;  3ADI A;  1TF6 A;  1Z0E A;  5IWA I;  2LE2 A;  4GZN C;  3QT6 A;  2LJH A;  4DMI A;  2HHH E;  3JAM Q;  1YUJ A;  4JYA I;  2E1M A;  1OYR A;  3JAM C;  2JXP A;  4LF8 I;  4DU7 A;  4DR2 I;  2N8X A;  4GKJ E;  2EQ0 A;  3VYY A;  2AJ4 A;  4FW3 A;  4KWY A;  4U3D A;  1X48 A;  5C0X F;  2EN3 A;  4NXN E;  4F9B B;  4WUD A;  3TQM A;  2OI2 A;  3Q6N A;  3C6K A;  1EKZ A;  4JI8 E;  2R76 A;  3J7Y p;  4JI1 I;  3ZM7 A;  2YWQ A;  5LMU I;  2MDG A;  2JP9 A;  2GS8 A;  4LF5 E;  3U1K A;  3C6M A;  2YTF A;  2NUG A;  2CSH A;  2EMX A;  1YFH A;  2O1V A;  2BR2 B;  4UT4 A;  2VQE E;  4DR1 E;  2JWO A;  1N0U A;  1S4E A;  3LML A;  1XHK A;  2MC6 A;  2PO0 A;  1D6T A;  2EM0 A;  2M1S A;  2NN6 B;  3THN A;  3ZKD A;  4LCG A;  2EPM X;  2D9H A;  4JI4 E;  1I94 I;  1PJT A;  2UXC E;  2RPC A;  2HKJ A;  3JU0 A;  2BM0 A;  2EM6 A;  3THO B;  1TF3 A;  3K17 A;  4DV3 I;  2EN2 A;  1X3C A;  2EML A;  4NXM E;  2F1D A;  4MQY A;  4JI6 E;  2UXD E;  4LFB E;  4KQV A;  4P52 A;  4YHH E;  4DUZ E;  4R2P A;  4R8O A;  4HY1 A;  4DV0 E;  2B7V A;  2UUC I;  2HJJ A;  1LLM C;  2UXB E;  5EL9 A;  1IBL E;  4RHB B;  5A6J A;  2YTE A;  2JE6 A;  5DRP A;  3V5R A;  4MU0 A;  2EMW A;  4Z7Y A;  1E3P A;  3L00 A;  2K7I A;  4DR7 I;  2R3V A;  1HR0 E;  2PNZ A;  1Z0T A;  2EN6 A;  4FWG A;  2LUP B;  4M1K A;  2BM1 A;  4I3H A;  2L2K B;  1UHZ A;  3RMP A;  4AQY I;  2PO2 A;  3Q6M A;  4OO1 E;  4OO1 A;  1MEY C;  4DV4 I;  4IZK A;  1H73 A;  4B3M I;  3ZKB A;  1G2F C;  1YUI A;  2F8B A;  4R2C A;  2PO0 B;  3UHM A;  2EM2 A;  1Z0G A;  4GKK E;  4FWH A;  4F6N A;  5A6K A;  2CT1 A;  2BA1 D;  1ZM2 A;  1N36 E;  4DV6 E;  1PVG A;  5GMD A;  4OO1 C;  2WZO A;  2KHX A;  1K47 A;  1IBM I;  4LF7 I;  1N0V C;  3QG5 C;  3H1C A;  2EMY A;  4OO1 D;  1X6E A;  4B3S I;  5DRQ A;  1Z5A A;  2EMB A;  2IOP A;  5IT9 Q;  5K36 A;  2ZBK B;  4IS9 A;  4WX9 A;  5IT9 C;  3NZK A;  3D4J A;  2V34 A;  2L6M A;  2J7K A;  5A69 A;  4DR3 E;  5T6J A;  1N34 I;  2JEB A;  1PIE A;  1SFE A;  1UBD C;  4JI0 E;  4DR6 I;  4PRX A;  2DLQ A;  1KVK A;  4LPF A;  5K36 C;  4MYU A;  1Z59 A;  2WBT A;  3HPZ A;  2LVH A;  4L8N A;  2UU9 E;  2JE6 B;  3HUL A;  4P7D A;  4OX9 I;  4Q28 A;  4LFA I;  5K36 D;  2N3H A;  1UDN A;  4M30 A;  3WU4 A;  1FWL A;  2V2Q A;  2LT7 A;  4HXZ A;  3T1Y E;  2EMC A;  4I8O A;  4DPX A;  2PNZ B;  4DPU A;  2IER A;  1YSA C;  3M6A A;  2CG9 A;  2VQF E;  2V85 A;  4DPY A;  2EL5 A;  4R2E A;  4LF9 I;  1YPN A;  4X65 E;  1S16 A;  4QNJ A;  3ZZT A;  5A6B A;  1H7U A;  4DV1 E;  2PO2 B;  3HXL A;  2DMY A;  4DV7 I;  1BB8 A;  2B3T B;  1H7S A;  2DEI A;  2V2Z A;  2EOO A;  3F0N A;  4FW7 A;  2M9A A;  2EN1 A;  4IZK B;  2UUA I;  3F6G A;  3VHT B;  1HNZ E;  4F2J C;  2BA1 G;  2C39 A;  2X36 A;  3HJC A;  4BC7 A;  5KL7 A;  3PYG A;  2R42 A;  4PU9 A;  1NCS A;  1ZBQ A;  2I13 A;  2YTP A;  1J5E I;  4JG4 A;  3P3E A;  1BKN A;  5A6B D;  2VRD A;  5ELW A;  3EQ1 A;  1DGC A;  2GPI A;  2BB8 A;  4BA1 A;  4F6M A;  3DF6 A;  4FW9 A;  5K36 B;  2YRK A;  4B3T I;  1QU6 A;  5F3W A;  3LNU A;  2O1U A;  2EWL A;  2EPO A;  4Q35 B;  2UUB E;  2GO3 A;  4ZVI A;  2YSP A;  2EM7 A;  3V2U C;  4X62 I;  5IWA E;  1R6L A;  2MC5 A;  5AE2 A;  1HK7 A;  2NPF A;  4IZJ A;  3QT7 A;  2HFU A;  4AID A;  2JEB B;  2J7J A;  2IES A;  2DLK A;  5IV8 B;  5AC4 A;  2EOH A;  3CWV A;  2NUF A;  1NHH A;  3LPS A;  4EMD A;  1HNW E;  4DXL A;  2GO4 A;  1XNQ I;  3H4L A;  3FIG A;  1NZ0 A;  3WU5 A;  1B69 A;  2MKD A;  4M9V C;  2I9I A;  1XMO I;  3H09 A;  4U3B A;  3OTO I;  2L8T A;  1XMQ I;  4JI1 E;  2V83 A;  3J81 Q;  2EMI A;  3B4T A;  4JI2 E;  3PS3 A;  4MLQ A;  1T4L B;  3J80 Q;  3J81 C;  2DRP A;  2ENA A;  4X8W A;  2Q8U A;  1ZM4 A;  3J80 C;  4IZJ D;  2B9D A;  2FTX B;  4MU4 A;  4P78 A;  3AUZ A;  2L33 A;  1WRJ A;  5KL6 A;  4IJD A;  2HK2 A;  1RMD A;  2EZ6 A;  2DIX A;  4B3R E;  4K0K E;  2EPU A;  2EFG A;  1MGT A;  1YZ9 A;  2A2D A;  2C39 B;  4LOM A;  2EQ1 A;  3ZOQ B;  3LLH A;  5EKW A;  2EOS A;  2M4I A;  4DR4 E;  5L3J A;  2DMI A;  2HHH I;  4NBQ A;  3EPH A;  4MLV A;  2PNL A;  2PNM A;  1X6H A;  5CFF E;  4BCA A;  4R1F A;  1MU5 A;  2EM9 A;  4GKJ I;  5IXM B;  3QT8 A;  2B7T A;  4BA1 B;  2NUE A;  4KZS A;  4M0V A;  1B63 A;  4NXN I;  1G2D C;  2MKN A;  1RQ0 A;  1IMU A;  3VK6 A;  4TUG A;  2YTQ A;  2WW4 A;  3ZZU A;  2EPX A;  3BID A;  1F2I G;  1B62 A;  4O4K A;  2RSI A;  1HNX E;  4YY3 E;  1J26 A;  4DV5 E;  4LF5 I;  4BS9 A;  4IZJ B;  4M2Z A;  2VQE I;  4DR1 I;  5JEA E;  4LF6 E;  4DU8 A;  1XXE A;  5LMN E;  2RSM A;  1NEI A;  3KWR A;  1A1G A;  1YHC A;  4R2Q A;  4LF4 E;  1ZR9 A;  3GON A;  3B8H A;  2VF1 A;  4JI4 I;  2ZM6 E;  1PJQ A;  4F54 A;  4J8Z A;  2EPP A;  4OOG C;  2NN6 F;  3P06 A;  4DUY E;  5JEA C;  1Z1B A;  4N4R B;  1H72 C;  3UK3 C;  4NXM I;  3IWC A;  2MDR A;  2YU8 A;  1WHQ A;  2V8P A;  2CZ9 A;  3C4T A;  5A2Q Q;  4HAC B;  2ENC A;  4JI6 I;  1EH7 A;  4LFB I;  2UXD I;  2YTN A;  4YHH I;  2RQL A;  5A2Q C;  2JEA A;  1GQE A;  3BBG A;  4DUZ I;  1FJG I;  4IFD E;  4DV0 I;  2EOZ A;  2LTS A;  1Z0B A;  5TSE A;  2EOJ A;  3IWD A;  1UDO A;  1TN9 A;  3K85 A;  4MDT A;  2UXB I;  4WFT A;  1IBL I;  4DR5 I;  2E5L E;  2CPN A;  4LFC E;  4ISA A;  3J7A G;  1Z5C A;  4OZE A;  2BA0 D;  1P42 A;  2V87 A;  1ZAA C;  1HR0 I;  1IQO A;  1MX0 A;  1ZXN A;  4IFD C;  2JR1 A;  2IHR 1;  4JI5 E;  2WNR A;  4JI3 I;  5A6A A;  1KYQ A;  3KZY A;  4J3D A;  4WSG A;  2EN4 A;  2LBS B;  1R6M A;  2V86 A;  5C0X E;  1IQS A;  3DJW A;  4JI7 E;  1ZM9 A;  2LJP A;  2KON A;  2YSO A;  3PYD A;  2PRT A;  2ENH A;  3EPK A;  4LFA E;  5JEA B;  2ELZ A;  3C4B A;  1OJ4 A;  1Y4S A;  2EMG A;  3P3C A;  1A1K A;  4GEQ B;  4GKK I;  5DNY A;  1ZU1 A;  2F4V E;  1KKH A;  1E3H A;  2YTI A;  5BR8 E;  1N36 I;  4DV6 I;  2Q2E B;  4LF9 E;  1WJP A;  2JOX A;  2IOQ A;  3ADJ A;  3F6H A;  3ADL A;  4AIM A;  4JV5 E;  4X66 E;  3HQ1 A;  5AAS A;  3BGH A;  1RC7 A;  1NHJ A;  2JVA A;  3M99 B;  4DV2 E;  1UDQ A;  3HPS A;  4PRV A;  2NA2 A;  3PYE A;  1IBK E;  4ZYD A;  5LL6 R;  3GME A;  4WUC A;  2JEA B;  1XNR E;  2EN7 A;  4WXD A;  1X47 A;  2WBS A;  4DR3 I;  2C38 A;  2C37 A;  1GTK A;  4F9A B;  4IFD B;  3M7N D;  4JI0 I;  2EOQ A;  2Z5C A;  4N3O A;  2BA0 G;  3KZZ A;  3MHS C;  3J7A M;  2UU9 I;  1AH5 A;  3PRY A;  4TUI A;  3PS1 A;  1X5W A;  4X64 E;  3T1H E;  5DNL A;  4URL A;  1A1J A;  2EOE A;  3VYX A;  2G7H A;  3T1Y I;  1QZR A;  4NZV A;  1JK1 A;  2RS6 A;  1FWK A;  3PYF A;  4DPT A;  5FLX Q;  2VQF I;  2WNR B;  2A2C A;  1AAY A;  1N32 E;  2XEX A;  2YT4 A;  2YTJ A;  3KRN A;  5FLX C;  4QNK A;  4ZYH A;  4X65 I;  4DV1 I;  5KL3 A;  2L92 A;  2YPN A;  4ED4 A;  1X49 A;  2KOU A;  4BC9 A;  2NN6 E;  4ZYE A;  2LV2 A;  4JYA E;  4ZYG A;  1SR9 A;  2EPR A;  1HNZ I;  4LF8 E;  1OYS A;  4RPF A;  4DR2 E;  2H36 X;  1KJK A;  4BHC A;  2X7I A;  3HKM A;  4MYT A;  3LTO A;  4OO1 F;  1EI1 A;  4HTG A;  3BF2 A;  3K1J A;  5AE3 A;  2EP3 A;  3HTX A;  2EM4 A;  2CGE A;  2EOX A;  2EMZ A;  1PJS A;  5KL4 A;  2L3J A;  1GZ6 A;  2EOF A;  5LMU E;  1ZM3 A;  4OO1 B;  1Z5B A;  1JK2 A;  2EMK A;  5KL2 A;  3JTZ A;  4LCH A;  3DD6 A;  4WPY A;  1BBO A;  2R1F A;  4HAC A;  1U2R A;  2EJ4 A;  3M7N G;  2YZT A;  2UUB I;  1DQ3 A;  4RH8 A;  2LTR A;  2YTG A;  1N33 I;  2NAB A;  5K36 F;  2EPK X;  2GLI A;  1I94 E;  2O1T A;  3MSW A;  2C37 B;  2C38 B;  3ZZ0 A;  2LCE A;  2EQ3 A;  2GHF A;  2Z5C B;  3M85 D;  2EMA A;  2HFS A;  2V89 A;  4WYQ B;  1HNW I;  4DV3 E;  1STU A;  2L2M A;  4FW5 A;  4NHR A;  1YYW A;  1RR9 A;  4JI2 I;  1YYO A;  2YRM A;  4R2R A;  2EL4 A;  1WUU A;  3CDI A;  4JI8 I;  2VES A;  2ELY A;  2UUC E;  1FNM A;  1RRE A;  1DI2 A;  4LCF A;  1FKA E;  1EA6 A;  4LU9 A;  2WP8 B;  1Y60 A;  4HEI A;  5JEA A;  4B3R I;  4K0K I;  4DR7 E;  2JYA A;  3K6Q A;  4R2A A;  4P7A A;  2M7Q A;  2JY9 A;  4WUB A;  4DR4 I;  2EL6 A;  1Z0V A;  1USV A;  4R2S A;  2Z5E A;  2Z5B A;  2UXC I;  2J65 A;  1T38 A;  3GLL A;  4MU1 A;  4BBY A;  2EOR A;  4AQY E;  5DRO A;  2A25 A;  3QT5 A;  4DV4 E;  1Y4U A;  4B3M E;  1FI4 A;  4XTJ A;  5JEA D;  2ADR A;  2BBG A;  1WHN A;  2LJU A;  3OML A;  2RS7 A;  1FJG E;  1A1I A;  2DGC A;  4O24 A;  2PO1 A;  4X9J A;  3M85 G;  1NHI A;  4AM3 A;  1HNX I;  4YY3 I;  1P47 A;  4R03 A;  4UTG A;  3GCM A;  4DR5 E;  4DV5 I;  4DKK A;  4IFD A;  5DRR A;  4USM A;  2LO3 A;  1KIJ A;  4LF6 I;  1IBM E;  4FN5 A;  2EPL X;  4BA2 A;  4LF7 E;  3EPL A;  5LMN I;  2LUQ A;  1A1L A;  4B3S E;  1VI7 A;  4L5N C;  4LF4 I;  2EPA A;  2RTX A;  3IWB A;  2YTD A;  2EOI A;  3U1Y A;  2ZM6 I;  2EN8 A;  4JI3 E;  1UEK A;  4KHP I;  4BHB A;  5GME A;  2YRH A;  1PKP A;  2V8Q B;  3AV0 A;  4DUY I;  2WCC 3;  4IFD D;  2EOM A;  1N34 E;  1UDS A;  1O0W A;  2HKE A;  5DNX A;  4LTY A;  2EMH A;  1QNT A;  2YU5 A;  4DR6 E;  2AE8 A;  5C0X A;  2FGG A;  4OX9 E;  5ADZ A;  3MHH C;  2EPZ A;  4IS1 C;  3PS2 A;  1L4S A;  4OKG A;  4O43 A;  4FK5 C;  2O3Z A;  1A1H A;  2EM8 A;  2VF3 A;  3L7Z A;  1BBG A;  2JPA A;  1ELO A; 
#chains in the Genus database with same CATH homology
 3B82 A;  2ODR C;  2V88 A;  2E5L I;  2GQ0 A;  4LFC I;  2Z5B B;  4FWD A;  4WSP A;  2ODR D;  3B78 A;  5AE1 A;  2DB2 A;  2ZIT A;  4DV7 E;  4KHP E;  1Z0W A;  2BV3 A;  2UUA E;  1A6F A;  2JOB A;  2V2V A;  2O1W A;  4JI5 I;  3WU3 A;  1YYK A;  5FWK A;  1J5E E;  4JI7 I;  3Q1Q A;  2E1R A;  3WU6 A;  2N3G A;  2L3C A;  3P1X A;  2F4V I;  3ADG A;  1WXR A;  5BR8 I;  4B3T E;  2VE7 C;  1VIS A;  4X62 E;  4BMJ A;  4JV5 I;  4X66 I;  4HYM A;  4Z7C A;  1H74 A;  1KTV A;  4DV2 I;  4USK A;  2HK3 A;  1IBK I;  2DEJ A;  1XNQ E;  1XNR I;  4DPW A;  1XMO E;  1ZXM A;  1USU A;  3OTO E;  1XMQ E;  1MG7 A;  1T4O A;  2DSY A;  2L2N A;  1T4N A;  4X64 I;  1UIL A;  3T1H I;  4F9C B;  2FV4 B;  1DAR A;  1N33 E;  1ZBT A;  1Y6Z A;  1Z0C A;  2K4V A;  2LRS A;  1N32 I;  2LMZ A;  3ADI A;  1Z0E A;  5IWA I;  2LE2 A;  3QT6 A;  2LJH A;  4DMI A;  2HHH E;  3JAM Q;  4JYA I;  2E1M A;  3JAM C;  4LF8 I;  4DU7 A;  4DR2 I;  4GKJ E;  2AJ4 A;  3VYY A;  1X48 A;  4NXN E;  4F9B B;  4WUD A;  2OI2 A;  3Q6N A;  1EKZ A;  4JI8 E;  4JI1 I;  3J7Y p;  3ZM7 A;  5LMU I;  2GS8 A;  4LF5 E;  2NUG A;  2O1V A;  4UT4 A;  2VQE E;  4DR1 E;  2JWO A;  1N0U A;  1S4E A;  3LML A;  1XHK A;  2MC6 A;  1D6T A;  2M1S A;  3ZKD A;  4JI4 E;  1I94 I;  2UXC E;  2HKJ A;  3JU0 A;  2BM0 A;  3K17 A;  4DV3 I;  4NXM E;  4JI6 E;  2UXD E;  4LFB E;  4KQV A;  4P52 A;  4YHH E;  4DUZ E;  4R8O A;  4HY1 A;  4DV0 E;  2B7V A;  2UUC I;  2UXB E;  1IBL E;  3V5R A;  4Z7Y A;  4DR7 I;  2R3V A;  1HR0 E;  1Z0T A;  4FWG A;  2LUP B;  4M1K A;  2BM1 A;  4I3H A;  2L2K B;  1UHZ A;  3RMP A;  4AQY I;  3Q6M A;  4DV4 I;  4IZK A;  1H73 A;  4B3M I;  3ZKB A;  2F8B A;  1Z0G A;  4GKK E;  4FWH A;  1ZM2 A;  1N36 E;  4DV6 E;  1PVG A;  5GMD A;  2WZO A;  2KHX A;  1K47 A;  1IBM I;  4LF7 I;  1N0V C;  4B3S I;  1Z5A A;  5IT9 Q;  2IOP A;  2ZBK B;  5IT9 C;  3D4J A;  2V34 A;  2L6M A;  2J7K A;  4DR3 E;  5T6J A;  1N34 I;  1PIE A;  4JI0 E;  4DR6 I;  4PRX A;  1KVK A;  4MYU A;  1Z59 A;  3HPZ A;  2UU9 E;  4L8N A;  3HUL A;  4OX9 I;  4P7D A;  4Q28 A;  4LFA I;  2N3H A;  3WU4 A;  4M30 A;  1FWL A;  2V2Q A;  4HXZ A;  3T1Y E;  4I8O A;  4DPX A;  4DPU A;  3M6A A;  2CG9 A;  2VQF E;  2V85 A;  4DPY A;  4LF9 I;  4X65 E;  1S16 A;  3ZZT A;  1H7U A;  4DV1 E;  3HXL A;  2DMY A;  4DV7 I;  4KHP I;  2B3T B;  1H7S A;  2DEI A;  2V2Z A;  3F0N A;  4IZK B;  2UUA I;  3F6G A;  1HNZ E;  3HJC A;  2X36 A;  4BC7 A;  3PYG A;  2R42 A;  4PU9 A;  1ZBQ A;  1J5E I;  4JG4 A;  1BKN A;  3DF6 A;  4FW9 A;  4B3T I;  1QU6 A;  5F3W A;  3LNU A;  2O1U A;  2EWL A;  2UUB E;  4ZVI A;  3V2U C;  4X62 I;  5IWA E;  2MC5 A;  5AE2 A;  1HK7 A;  2NPF A;  4IZJ A;  3QT7 A;  2HFU A;  3CWV A;  2NUF A;  1NHH A;  3LPS A;  4EMD A;  1HNW E;  4DXL A;  1XNQ I;  3H4L A;  3FIG A;  1NZ0 A;  3WU5 A;  1XMO I;  3H09 A;  3OTO I;  2L8T A;  1XMQ I;  4JI1 E;  2V83 A;  3J81 Q;  4JI2 E;  3J80 Q;  1T4L B;  3J81 C;  4IZJ D;  4X8W A;  1ZM4 A;  3J80 C;  2B9D A;  2FTX B;  4P78 A;  3AUZ A;  2L33 A;  2HK2 A;  2EZ6 A;  2DIX A;  4B3R E;  4K0K E;  2EFG A;  1YZ9 A;  2A2D A;  3ZOQ B;  3LLH A;  2M4I A;  4DR4 E;  5L3J A;  2HHH I;  2PNL A;  2PNM A;  5CFF E;  4BCA A;  4R1F A;  1MU5 A;  4GKJ I;  3QT8 A;  2B7T A;  2NUE A;  4KZS A;  4M0V A;  1B63 A;  4NXN I;  1RQ0 A;  3VK6 A;  4TUG A;  2WW4 A;  3ZZU A;  1B62 A;  1HNX E;  4YY3 E;  1J26 A;  4DV5 E;  4LF5 I;  4BS9 A;  4IZJ B;  4M2Z A;  2VQE I;  4DR1 I;  4LF6 E;  4DU8 A;  5LMN E;  2RSM A;  3KWR A;  4LF4 E;  3GON A;  3B8H A;  2VF1 A;  4JI4 I;  2ZM6 E;  4F54 A;  4J8Z A;  4OOG C;  3P06 A;  4DUY E;  1H72 C;  4NXM I;  3IWC A;  2MDR A;  1WHQ A;  2V8P A;  2CZ9 A;  3C4T A;  5A2Q Q;  4HAC B;  4JI6 I;  2UXD I;  4LFB I;  4YHH I;  5A2Q C;  1GQE A;  4DUZ I;  1FJG I;  4DV0 I;  1Z0B A;  2LTS A;  3IWD A;  3K85 A;  2UXB I;  4WFT A;  1IBL I;  4DR5 I;  2E5L E;  2CPN A;  4LFC E;  3J7A G;  1Z5C A;  2V87 A;  1HR0 I;  1MX0 A;  1ZXN A;  2JR1 A;  2IHR 1;  4JI5 E;  4JI3 I;  2LBS B;  2V86 A;  3DJW A;  4JI7 E;  1ZM9 A;  2LJP A;  2KON A;  3PYD A;  4LFA E;  1OJ4 A;  3C4B A;  1Y4S A;  4GKK I;  4GEQ B;  5DNY A;  2F4V E;  1KKH A;  5BR8 E;  1N36 I;  4DV6 I;  2Q2E B;  4LF9 E;  2JOX A;  2IOQ A;  3ADJ A;  3F6H A;  3ADL A;  4JV5 E;  4X66 E;  3HQ1 A;  5AAS A;  1RC7 A;  1NHJ A;  2JVA A;  4PRV A;  4DV2 E;  3HPS A;  2NA2 A;  3PYE A;  1IBK E;  5LL6 R;  4WUC A;  1XNR E;  4DR3 I;  1X47 A;  4F9A B;  4JI0 I;  2Z5C A;  4N3O A;  3J7A M;  2UU9 I;  3PRY A;  4TUI A;  4X64 E;  3T1H E;  4URL A;  3VYX A;  2G7H A;  3T1Y I;  1QZR A;  2RS6 A;  1FWK A;  3PYF A;  4DPT A;  5FLX Q;  2VQF I;  2A2C A;  1N32 E;  2XEX A;  2YT4 A;  4X65 I;  5FLX C;  4DV1 I;  2L92 A;  4ED4 A;  1X49 A;  2KOU A;  4BC9 A;  4JYA E;  1SR9 A;  1HNZ I;  4LF8 E;  4RPF A;  4DR2 E;  2H36 X;  4MYT A;  2X7I A;  3LTO A;  1EI1 A;  3K1J A;  5AE3 A;  3HTX A;  2CGE A;  2L3J A;  1GZ6 A;  5LMU E;  1ZM3 A;  1Z5B A;  3JTZ A;  4WPY A;  4HAC A;  1U2R A;  2YZT A;  2UUB I;  1DQ3 A;  2LTR A;  1N33 I;  3ZZ0 A;  1I94 E;  2O1T A;  3MSW A;  2Z5C B;  2HFS A;  2V89 A;  4WYQ B;  1HNW I;  4DV3 E;  1STU A;  2L2M A;  1YYW A;  1RR9 A;  4JI2 I;  1YYO A;  1WUU A;  4JI8 I;  2UUC E;  1FNM A;  1RRE A;  1DI2 A;  1FKA E;  1EA6 A;  4LU9 A;  4B3R I;  4K0K I;  4DR7 E;  3K6Q A;  4P7A A;  2M7Q A;  2JY9 A;  4WUB A;  4DR4 I;  1Z0V A;  1USV A;  2Z5E A;  2Z5B A;  2UXC I;  4BBY A;  4AQY E;  3QT5 A;  4DV4 E;  1Y4U A;  4B3M E;  1FI4 A;  4XTJ A;  1WHN A;  2RS7 A;  3OML A;  1FJG E;  1NHI A;  1HNX I;  4YY3 I;  4DV5 I;  4R03 A;  4UTG A;  4DR5 E;  4DKK A;  4USM A;  1KIJ A;  4LF6 I;  1IBM E;  4FN5 A;  4LF7 E;  5LMN I;  2LUQ A;  4B3S E;  4L5N C;  4LF4 I;  3IWB A;  2RTX A;  2ZM6 I;  4JI3 E;  1UEK A;  5GME A;  1PKP A;  2V8Q B;  3AV0 A;  4DUY I;  1N34 E;  1O0W A;  2HKE A;  4LTY A;  4DR6 E;  2FGG A;  4OX9 E;  5ADZ A;  2VF3 A;  1ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...