4DV6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv6E02
1ZXNA 3LPSA 4X8WA 1XNQE 1EA6A 3B8HA 4LFBI 1Z0EA 4URLA 4JI5E 2WW4A 1YYKA 4JI6I 2N3HA 1IBLE 2R3VA 1N34E 4DPYA 2LUQA 4X62I 3V2UC 4LF9I 4JI4E 3T1YE 4JI5I 4JI6E 1IBLI 2NUFA 5IWAE 2JY9A 1ELOA 1Z0WA 4USMA 3WU4A 3P1XA 2CZ9A 3VYXA 2E1RA 4HACB 3T1HE 4NXMI 2KHXA 1FKAE 3C4TA 2L3CA 3T1YI 4LF5E 1IBME 2L3JA 1STUA 1K47A 2EFGA 1FWKA 3VYYA 4PRXA 4B3RI 5A2QC 1IBKI 1IBMI 2V8PA 2UU9I 2GS8A 1RR9A 3PYDA 2NA2A 2LTSA 1N33E 2R42A 4LFCE 4B3RE 1KKHA 5IT9Q 2HFSA 4DR7E 2UU9E 3J7AG 2UUBE 1XNRE 1Z59A 1NZ0A 4LFCI 1FWLA 1X49A 4DR7I 4LF7I 4DV0I 2B7VA 2Q2EB 1ZM2A 2UUBI 2MDRA 4DR6I 1XNRI 3D4JA 4YHHI 2N3GA 4P7AA 4AQYI 4DV6E 1WUUA 4DV7I 3JAMC 2HFUA 4JI3I 1WHQA 1ZM9A 2UUCI 4WUBA 1XNQI 4DV1I 3J7AM 2NPFA 4HACA 4WUCA 1J5EE 1UHZA 4DV4I 1FJGE 3C4BA 1FI4A 1T4LB 2V2QA 1N34I 3K17A 4JI4I 5LMUI 5FLXC 2UUCE 1WHNA 1ZM4A 4DV1E 1J5EI 4DV4E 1FJGI 3QT5A 3OTOI 1N0VC 3F0NA 5LMUE 1YYWA 1Z0TA 4MYTA 3T1HI 4NXME 1RREA 3ZM7A 4FN5A 4ZVIA 4X65I 1KIJA 3ZKBA 3OTOE 4JI7E 3WU3A 1EI1A 2LBSB 3V5RA 2UXCE 1A6FA 2DIXA 1U2RA 3QT7A 4B3TE 4JI8E 4UTGA 2L2NA 3QT8A 3J80C 4PRVA 4DR4E 1N33I 4FWDA 5BR8E 2HHHE 4I3HA 4HXZA 1MX0A 4LF8E 4FWGA 3ZZTA 4JI2I 3K1JA 4M1KA 4DKKA 4LF4E 3HULA 4DR6E 3ADLA 4YHHE 5GMDA 2NUEA 1YZ9A 2RSMA 4AQYE 4LF8I 4PU9A 4JI2E 1OJ4A 1S4EA 2L33A 1RC7A 1B63A 4UT4A 4WUDA 4DXLA 3J80Q 1MG7A 4KQVA 1NHJA 4M30A 3J7Yp 2V2ZA 4LFAE 4JG4A 1ZBTA 2J7KA 3GONA 4FWHA 1N36I 4DR1I 2A2DA 3LLHA 1S16A 1H74A 1UEKA 4K0KI 2HK2A 3J81C 1GQEA 2F4VE 2UXDE 4OOGC 3PYEA 1X48A 5IT9C 2NUGA 4DR1E 1J26A 4KHPI 5L3JA 2LRSA 4K0KE 1H73A 3WU6A 4OX9E 4X65E 1KTVA 1HR0I 4JI7I 1MU5A 1NHIA 2UXCI 4X64E 4DR2I 4DPWA 4B3TI 4JI8I 1H7UA 2ZM6E 2X7IA 2L2MA 2BM0A 1QZRA 2DMYA 1O0WA 1UILA 4DR4I 5GMEA 2LJHA 2ZITA 4DR2E 4X64I 3ADIA 1Z5BA 4FW9A 1KVKA 1N32E 4JV5E 5BR8I 4JYAE 2LTRA 2HHHI 2IHR1 2X36A 1H7SA 1YYOA 1RQ0A 4R1FA 1N32I 4JV5I 4LF4I 3LNUA 4YY3E 2XEXA 4EMDA 1XHKA 2JVAA 4M2ZA 1PVGA 3B82A 2V2VA 3WU5A 4YY3I 3M6AA 3CWVA 1X47A 1H72C 4LFAI 4Z7CA 3PYGA 3B78A 4DR3E 4HY1A 1N36E 1NHHA 2OI2A 1T4OA 4B3MI 2LUPB 4DPUA 2HKEA 1EKZA 2UXBI 1DI2A 4RPFA 4GKKI 2LJPA 2F4VI 3QT6A 4WYQB 1Z0BA 2UXDI 2RTXA 1HNXE 4LF6E 4B3ME 3PYFA 4KHPE 3ADGA 2UXBE 1I94E 4DV2E 4GKKE 1HNZI 2E5LE 4JI0E 2VQEI 4MYUA 2BV3A 4OX9I 4DU8A 1HR0E 4HYMA 1D6TA 5A2QQ 4DPTA 2AJ4A 1I94I 1Z0VA 5FLXQ 2ZM6I 4DV2I 4XTJA 2VQEE 4JI0I 2E5LI 4B3SI 1N0UA 1XMOE 2B7TA 1Z5CA 2VF3A 4DV5I 2B3TB 4GKJE 4NXNI 4JYAI 5LL6R 3ZZUA 3ADJA 1BKNA 2HKJA 4DV5E 4X66I 4DR5I 4GKJI 4Z7YA 4NXNE 4DU7A 4DUZI 2DEIA 2CPNA 4JI1E 5IWAI 3H4LA 3J81Q 2RS6A 2A2CA 5CFFE 2VQFE 1ZXMA 4WFTA 4X66E 4DR5E 2L2KB 3ZKDA 2V34A 1Z0GA 3LTOA 4LF5I 4DUZE 1T4NA 4DV3I 4JI1I 2VQFI 3Q1QA 1VISA 1Z0CA 4P52A 4DUYE 2DEJA 1XMQI 2RS7A 1IBKE 4USKA 4DV3E 4DR3I 2DB2A 1PIEA 2UUAI 1XMQE 4DUYI 1FNMA 2HK3A 2ZBKB 2YT4A 1Z5AA 4DPXA 1HNXI 4LF6I 1DARA 2UUAE 1QU6A 1HNZE 3JAMQ 5LMNI 2BM1A 4LF7E 4DV0E 4ED4A 1ZM3A 1HNWE 3ZZ0A 2EZ6A 4DV6I 3HTXA 4LFBE 1PKPA 5LMNE 4B3SE 1B62A 1XMOI 4DV7E 1HNWI 4JI3E 4X62E 4LF9E
chains in the Genus database with same CATH superfamily
1ZXNA 1Y5YA 3LPSA 2EPAA 4X8WA 1XNQE 1EA6A 3B8HA 3K85A 2EN6A 2JEBA 4FW4A 2JYAA 4LFBI 5AE1A 1Z0EA 2JOXA 4URLA 4JI5E 3EPLA 1YYKA 2WW4A 4JI6I 2DGCA 2N3HA 2FV4B 1IBLE 2R3VA 1GZ6A 1N34E 4FW5A 4DPYA 2LUQA 4O24A 2WBTA 4X62I 3V2UC 4LF9I 4JI4E 4FW3A 5JEAD 1WRJA 1TF6A 4AM3A 5T6JA 3T1YE 4JI5I 4JI6E 2E72A 4WXCA 1IBLI 2I13A 2NUFA 3DJWA 2JY9A 5IWAE 2FTXB 2VF1A 2YTDA 3C6MA 4WX9A 1ELOA 1Z0WA 4I8OA 4USMA 3WU4A 3P1XA 3MHHC 2CZ9A 2YU8A 3VYXA 3PRYA 2E1RA 4HACB 2EM7A 4KZSA 3T1HE 2BA1G 4P78A 2EPUA 2KHXA 4NXMI 2YZTA 2KOUA 1FKAE 3C4TA 4IS1C 2EPPA 5F3WA 4IFDA 4F2JC 2L3CA 3T1YI 5KL2A 4LF5E 2EN8A 1IBME 1KJKA 2VRDA 4OO1B 3EPHA 2L3JA 2C37A 2K7IA 1STUA 2YTNA 4BHCA 1K47A 1R6LA 2EFGA 2Z5CA 1P47A 2EOZA 1L4SA 4OO1E 1KYQA 2RPCA 1PJTA 1IQSA 1FWKA 3VYYA 2LT7A 2WBSA 4PRXA 5IXMB 2EMZA 4R2EA 4B3RI 5A2QC 1IBKI 4DMIA 1IBMI 2YTFA 2V8PA 2BR2A 2UU9I 3DF6A 2NN6D 3OMLA 2YTQA 2PNZA 2EOEA 2GS8A 3MSWA 3AUZA 2EMBA 1RR9A 1Y4SA 4IFDC 2EWLA 3PYDA 2NA2A 2LTSA 3JU0A 3BGHA 1N33E 2R42A 5JEAC 4LFCE 5C0XA 3LMLA 4B3RE 1KKHA 5IT9Q 4MLQA 4R2QA 2HFSA 3Q6NA 4DR7E 2EPXA 2UU9E 3UHMA 3J7AG 2YTJA 2DMIA 3H09A 2FGGA 2UUBE 2V83A 1XNRE 1A1JA 2I9IA 4R8OA 1VI7A 1Z59A 1NZ0A 4IFDB 3IWBA 1TN9A 4LFCI 2C38A 1XXEA 1FWLA 3U1KA 1X49A 4RHBB 2JR1A 2MC6A 3GMEA 4DV0I 4LF7I 2EMKA 2B7VA 4DR7I 5K36E 4GZNC 2Q2EB 1ZM2A 2UUBI 2MDRA 4DR6I 1XNRI 3D4JA 4YHHI 4AIDA 2N3GA 5C0XF 4P7AA 2IESA 2O1UA 1G2DC 4AQYI 4DV6E 5KL5A 1WUUA 2LE2A 2JP9A 2NN6C 5A6JA 2ELZA 4M0VA 3ZOQB 4BA2B 2EP3A 4DV7I 2C39B 3JAMC 4TUGA 1YUJA 2HFUA 4BMJA 1OYPA 2O1WA 4JI3I 3TQMA 4OZEA 1WHQA 3C6KA 4F9BB 2EMFA 1ZM9A 4OKGA 2LVHA 4ZYDA 3KWRA 4F54A 4WUBA 2Q8UA 4AIMA 2UUCI 1XNQI 4N3OA 4DV1I 3J7AM 3KRNA 1J5EE 4HACA 4WUCA 2NPFA 1UHZA 1A1FA 4DV4I 1FJGE 3C4BA 1FI4A 3P3GA 4L8NA 1T4LB 2V2QA 1N34I 2LCEA 4BC9A 4IZJB 5DRPA 3RMPA 4J3DA 3HXLA 5TSEA 2BA0G 2J65A 3K17A 4JI4I 2EMAA 5LMUI 5FLXC 2V89A 1WHNA 2UUCE 1ZM4A 4DV1E 4R2CA 1J5EI 1EH7A 4DV4E 1FJGI 3QT5A 1R6MA 5FWKA 3OTOI 2LV2A 5DNLA 1N0VC 2BR2B 1BB8A 1EH8A 3F0NA 5LMUE 1YYWA 1Z0TA 4MYTA 3T1HI 3EQ1A 4NXME 1RREA 2WP8B 1T38A 2IERA 4FN5A 3ZM7A 3THOB 4LCHA 4U3DA 3HJCA 3QG5C 4ZVIA 4X65I 3DD6A 4FW7A 1KIJA 2ENHA 3ZKBA 3OTOE 4JI7E 3WU3A 4MU0A 4BA1A 2O1VA 1EI1A 2LBSB 2EQ3A 4IS9A 2GLIA 3V5RA 2UXCE 1A6FA 2EMIA 1A1KA 2DIXA 4R2SA 1U2RA 3QT7A 4F9AB 4JI8E 4B3TE 1JK1A 4UTGA 1T39A 1B69A 2L2NA 3J80C 2CSHA 3QT8A 1A1GA 4PRVA 1A1HA 5KL6A 4DR4E 1N33I 2EPZA 4FWDA 1SR9A 2EOFA 2YRHA 2MKNA 4LPFA 4QNKA 2F1DA 4BBYA 5BR8E 2BA1D 5ELWA 4U3BA 2DRPA 2V8QB 2HHHE 2LMZA 1DQ3A 1LLMC 4GQUA 4MU1A 4HXZA 4I3HA 2PO1A 1GTKA 5A6BD 2PNZB 1MX0A 4LF8E 4FWGA 3ZZTA 2DSYA 2EPMX 4JI2I 3L7ZB 5DRQA 3K1JA 2EJ4A 3FIGA 4M1KA 4MU4A 4DKKA 4LF4E 3HULA 3PS3A 1NCSA 4DR6E 3ADLA 2PO0B 4YHHE 4MDTA 5GMDA 2NUEA 2BB8A 1YZ9A 2RSMA 4AQYE 4L5NC 4OO1A 4LF8I 4OO1D 4PU9A 1WJPA 1X5WA 2VESA 4JI2E 1OJ4A 3AV0A 2EPKX 1S4EA 2V87A 3MHSC 2L33A 1RC7A 1B63A 1ZU1A 1UDNA 4UT4A 4WUDA 2PNMA 5C0XC 4IFDD 2NN6A 4DXLA 3J80Q 4BS9A 3ECRA 1MG7A 4KQVA 1NHJA 2WNRA 4M30A 3J7Yp 2V2ZA 2YTEA 4LFAE 2MKDA 3THNA 2EPNA 4JG4A 1ZBTA 2J7KA 3GONA 3NZKA 4FWHA 1N36I 4DR1I 2A2DA 3BIDA 3LLHA 1S16A 1H74A 2YRKA 1UDOA 2WBUA 2EPOA 1USVA 1YFHA 1UEKA 4K0KI 2HK2A 4IZJA 5K36F 2IOPA 2JXPA 3J81C 1E3HA 1GQEA 3HQ1A 2EOYA 2F4VE 4X9JA 2UXDE 4OOGC 2G7HA 3PYEA 1X48A 5IT9C 2CTDA 4DR1E 2NUGA 4IZKB 4NZVA 1J26A 2Z5BA 2J7JA 2ENCA 4BHBA 4KHPI 4IZJD 5L3JA 2YPNA 2RSIA 4R2RA 2LRSA 4K0KE 2YRMA 2EM2A 1H73A 4R03A 3WU6A 2JWOA 4OX9E 2EM0A 4X65E 1KTVA 2EOXA 1HR0I 4JI7I 1X6FA 5A69A 1MU5A 1NHIA 5AASA 5KL3A 2UXCI 4X64E 4DR2I 4DPWA 2EL6A 4B3TI 2C39A 1H7UA 4JI8I 2ZM6E 2EQ1A 2X7IA 2K4VA 2L2MA 2BM0A 1QZRA 2WP8A 3CDJA 2DMYA 2EPRA 1O0WA 3VHTB 4OO1F 2BA0D 1UILA 1USUA 4DR4I 5GMEA 2LJHA 2ZITA 4HTGA 4DR2E 2PO2B 4X64I 2ENAA 3ADIA 1Z5BA 4FW6A 4BA1B 4FW9A 4IZKA 1KVKA 3HPZA 1AH5A 2JEAB 4FK5C 1N32E 4JV5E 5BR8I 4JYAE 2LTRA 3HPSA 2HHHI 2IHR1 2X36A 4F6MA 2L92A 2C37B 1H7SA 2EOJA 4LU9A 1YYOA 1G2FC 2HGHA 2ADRA 1RQ0A 4MQYA 4R1FA 4Q35B 1N32I 4JV5I 3EPJA 4LF4I 1MEYC 3LNUA 4YY3E 5C0XE 3BBGA 2V85A 3IWCA 2XEXA 2CVEA 3P3EA 3JTZA 1XHKA 5A6BA 4MU3A 2VE7C 4EMDA 2JVAA 4M2ZA 4O43A 1IMUA 2YTIA 1PVGA 1JK2A 3B82A 1N3GA 3F6HA 2V2VA 3F6GA 1Y60A 4RH8A 3WU5A 2JEBB 1E3PA 4YY3I 3M6AA 5EL9A 2L6MA 2CG9A 5KL7A 1MGTA 2GQ0A 3CWVA 1IQOA 2DLKA 4NBQA 4J8ZA 1X47A 3M7ND 1QNTA 1H72C 5JEAF 4LFAI 3GLLA 2JT2A 2EM9A 2YTPA 1SFEA 4Z7CA 3PYGA 3B78A 4IFDF 4DR3E 4P7DA 1YHCA 4HY1A 1YUIA 1OYSA 2C38B 2F8BA 1YPNA 1N36E 3P06A 1NHHA 2OI2A 1T4OA 3IWDA 4B3MI 2LUPB 5IV8B 4DPUA 5K36C 2HKEA 2YSOA 1EKZA 2UXBI 1DI2A 4RPFA 4BC7A 1PJQA 4GKKI 2EL5A 2LJPA 2ODRC 1BBOA 2Z5BB 2F4VI 1ZBQA 5AC5A 4WYQB 1Z0BA 2Z5EA 3QT6A 2UXDI 2RTXA 1HNXE 4LF6E 1F2IG 2EOHA 4WXDA 2R1FA 4B3ME 2A25A 2KONA 4KHPE 3PYFA 2EMLA 3ADGA 1UN6B 2JE6B 2EM3A 2UXBE 2NN6B 1I94E 2BBGA 4DV2E 1Y6ZA 4QNJA 2EM5A 4GKKE 1HNZI 2E5LE 4JI0E 2VQEI 2PO0A 4MYUA 2BV3A 4OX9I 5K36B 2EORA 2GPIA 4O5GA 2NN6F 4GEQB 4DU8A 2YSPA 5A6AA 1HR0E 4IJDA 1UDQA 4HYMA 2M9AA 5C0XD 1D6TA 1YH8A 5A2QQ 1OYRA 1WXRA 1P42A 4DPTA 4OO1C 2AJ4A 2GHFA 5ADZA 2WCC3 1I94I 4IFDE 1Z0VA 3UK3C 5FLXQ 2ZM6I 4DV2I 4XTJA 2VQEE 4JI0I 4LCFA 2E5LI 4B3SI 1N0UA 1XMOE 1EH6A 5KL4A 2B7TA 1PDAA 1PJSA 2EM8A 4LTYA 1Z5CA 1BBGA 5EKWA 2EPCA 2CGEA 1RMDA 3M85G 2VF3A 4DV5I 2B3TB 2YU5A 4ZYHA 5AC4A 4GKJE 2IOQA 2JPAA 2NN6E 2EOSA 2ELYA 1AAYA 2V88A 2Z5CB 3KZYA 4NXNI 2YTOA 1DGCA 5JEAB 4ISAA 4JYAI 5LL6R 2EM6A 5DNXA 3ZZUA 2JOBA 1Y4UA 3ADJA 4WSPA 2DLQA 1BKNA 2HKJA 2EPLX 3CDIA 2EOMA 1TF3A 4DV5E 5JEAA 1YSAC 4X66I 4DR5I 2HC5A 4GKJI 4Z7YA 3P3CA 2RQLA 4NXNE 4DU7A 4WPYA 4DUZI 2DEIA 2R76A 2O3ZA 2CPNA 4JI1E 2EMHA 5IWAI 3PS1A 4F6NA 2EL4A 3H4LA 3J81Q 2GO3A 3BF2A 2RS6A 2A2CA 2LJUA 2M1SA 5CFFE 1HK7A 2VQFE 5C0XB 1ZXMA 1X6HA 1X6EA 4WFTA 4KWYA 4R2PA 4X66E 4DR5E 5K36D 2L2KB 2EN3A 5AE3A 4LOMA 3ZKDA 2WZOA 2V34A 1Z0GA 3LTOA 4LF5I 4DUZE 1ZAAC 1T4NA 4DV3I 3P76A 2EM4A 2JE6A 4JI1I 5JEAE 2H36X 2CT1A 2ODRD 3PS2A 2AE8A 4F9CB 2L8TA 1UDSA 4N4RB 3EPKA 1RHYA 2VQFI 2EN1A 5K36A 3Q1QA 2EOIA 1VISA 1Z0CA 4P52A 4DUYE 2DEJA 2MC5A 2RS7A 2PRTA 1UBDC 1IBKE 1XMQI 3HKMA 4USKA 2V86A 4DV3E 4NHRA 3L00A 2DB2A 4DR3I 2EMYA 4HEIA 2YWQA 1PIEA 2UUAI 5A6KA 4O4KA 2EMGA 2EN2A 4BCAA 2O1TA 5LLQA 1XMQE 2YTGA 4DUYI 2M7QA 2PO1B 1FNMA 3M99B 2EMXA 1Z1BA 2HK3A 2YT4A 2ZBKB 1Z5AA 5DRRA 5DROA 2PO2A 5DNYA 3VK6A 4DPXA 2EN7A 1A1LA 1HNXI 4LF6I 3K6QA 4WSGA 1DARA 2UUAE 3M85D 2EOQA 2NABA 4R2AA 2JEAA 2LO3A 4MLVA 5AE2A 4R2DA 2GO4A 1QU6A 1HNZE 3JAMQ 2D9HA 2BM1A 2MDGA 5LMNI 4LF7E 3KZZA 2EN4A 2N8XA 4DV0E 3Q6MA 2PNLA 4ED4A 4M9VC 1HNWE 1ZM3A 3ZZ0A 2EZ6A 4ZYEA 3GCMA 2E1MA 4Q28A 3B4TA 2EE8A 1A1IA 4BA2A 2B9DA 3L7ZA 1NEIA 4DV6I 3HTXA 2M4IA 4LFBE 2EMCA 2EOOA 1PKPA 1ZR9A 5LMNE 4B3SE 2EQ0A 2WNRB 1B62A 2HJJA 1XMOI 2EMWA 4DV7E 1X3CA 3H1CA 1HNWI 3M7NG 4TUIA 4JI3E 4ZYGA 4LCGA 3U1YA 4X62E 4LF9E
chains in the Genus database with same CATH topology
1ZXNA 3LPSA 4X8WA 1XNQE 1EA6A 3B8HA 3K85A 4LFBI 5AE1A 1Z0EA 2JOXA 4URLA 4JI5E 2WW4A 1YYKA 4JI6I 2N3HA 2FV4B 1IBLE 2R3VA 1GZ6A 1N34E 4DPYA 2LUQA 4X62I 3V2UC 4LF9I 4JI4E 5T6JA 3T1YE 4JI5I 4JI6E 1IBLI 2NUFA 3DJWA 2JY9A 5IWAE 2FTXB 2VF1A 1ELOA 1Z0WA 4I8OA 4USMA 3WU4A 3P1XA 2CZ9A 3VYXA 3PRYA 2E1RA 4HACB 4KZSA 3T1HE 4P78A 4NXMI 2KHXA 2YZTA 2KOUA 1FKAE 3C4TA 5F3WA 2L3CA 3T1YI 4LF5E 1IBME 2L3JA 1STUA 1K47A 2EFGA 2Z5CA 1FWKA 3VYYA 4PRXA 4B3RI 5A2QC 1IBKI 4DMIA 1IBMI 2V8PA 2UU9I 3DF6A 3OMLA 2GS8A 3MSWA 3AUZA 1RR9A 1Y4SA 2EWLA 3PYDA 2NA2A 2LTSA 3JU0A 1N33E 2R42A 4LFCE 3LMLA 4B3RE 1KKHA 5IT9Q 2HFSA 3Q6NA 4DR7E 2UU9E 3J7AG 3H09A 2FGGA 2UUBE 2V83A 1XNRE 4R8OA 1Z59A 1NZ0A 3IWBA 4LFCI 1FWLA 1X49A 2JR1A 2MC6A 4LF7I 4DV0I 4DR7I 2B7VA 2Q2EB 1ZM2A 2UUBI 2MDRA 4DR6I 1XNRI 3D4JA 4YHHI 2N3GA 4P7AA 4AQYI 2O1UA 4DV6E 1WUUA 2LE2A 4M0VA 3ZOQB 4DV7I 3JAMC 4TUGA 2HFUA 4BMJA 2O1WA 4JI3I 1WHQA 4F9BB 1ZM9A 3KWRA 4F54A 4WUBA 2UUCI 1XNQI 4N3OA 4DV1I 3J7AM 2NPFA 1J5EE 4HACA 4WUCA 1UHZA 4DV4I 1FJGE 3C4BA 1FI4A 4L8NA 1T4LB 2V2QA 1N34I 4BC9A 4IZJB 3RMPA 3HXLA 3K17A 4JI4I 5LMUI 5FLXC 2V89A 1WHNA 2UUCE 1ZM4A 4DV1E 1J5EI 4DV4E 1FJGI 3QT5A 5FWKA 3OTOI 1N0VC 3F0NA 5LMUE 1YYWA 1Z0TA 4MYTA 3T1HI 4NXME 1RREA 3ZM7A 4FN5A 3HJCA 4ZVIA 4X65I 1KIJA 3ZKBA 3OTOE 4JI7E 3WU3A 2O1VA 1EI1A 2LBSB 3V5RA 2UXCE 1A6FA 2DIXA 1U2RA 3QT7A 4F9AB 4JI8E 4B3TE 4UTGA 2L2NA 3J80C 3QT8A 4PRVA 4DR4E 1N33I 4FWDA 1SR9A 4BBYA 5BR8E 2HHHE 2V8QB 2LMZA 1DQ3A 4I3HA 4HXZA 1MX0A 4LF8E 4FWGA 3ZZTA 2DSYA 4JI2I 3K1JA 4M1KA 3FIGA 4DKKA 4LF4E 3HULA 4DR6E 3ADLA 4YHHE 5GMDA 2NUEA 1YZ9A 2RSMA 4AQYE 4L5NC 4LF8I 4PU9A 4JI2E 1OJ4A 3AV0A 1S4EA 2V87A 2L33A 1RC7A 1B63A 4UT4A 4WUDA 2PNMA 4DXLA 3J80Q 4BS9A 1MG7A 4KQVA 1NHJA 4M30A 3J7Yp 2V2ZA 4LFAE 4JG4A 1ZBTA 2J7KA 3GONA 4FWHA 1N36I 4DR1I 2A2DA 3LLHA 1S16A 1H74A 1USVA 1UEKA 4K0KI 2HK2A 4IZJA 2IOPA 3J81C 1GQEA 3HQ1A 2F4VE 2UXDE 4OOGC 2G7HA 3PYEA 1X48A 5IT9C 2NUGA 4DR1E 4IZKB 1J26A 2Z5BA 4KHPI 4IZJD 5L3JA 2LRSA 4K0KE 1H73A 4R03A 3WU6A 2JWOA 4OX9E 4X65E 1KTVA 1HR0I 4JI7I 1MU5A 1NHIA 5AASA 2UXCI 4X64E 4DR2I 4DPWA 4B3TI 4JI8I 1H7UA 2ZM6E 2X7IA 2K4VA 2L2MA 2BM0A 1QZRA 2DMYA 1O0WA 1UILA 1USUA 4DR4I 5GMEA 2LJHA 2ZITA 4DR2E 4X64I 3ADIA 1Z5BA 4FW9A 4IZKA 1KVKA 3HPZA 1N32E 4JV5E 5BR8I 4JYAE 2LTRA 3HPSA 2HHHI 2IHR1 2X36A 2L92A 1H7SA 4LU9A 1YYOA 1RQ0A 4R1FA 1N32I 4JV5I 4LF4I 3LNUA 4YY3E 2V85A 3IWCA 2XEXA 3JTZA 1XHKA 4EMDA 2VE7C 2JVAA 4M2ZA 1PVGA 3B82A 3F6HA 2V2VA 3F6GA 3WU5A 4YY3I 3M6AA 2L6MA 2CG9A 2GQ0A 3CWVA 4J8ZA 1X47A 1H72C 4LFAI 4Z7CA 3PYGA 3B78A 4DR3E 4P7DA 4HY1A 2F8BA 1N36E 3P06A 1NHHA 2OI2A 1T4OA 3IWDA 4B3MI 2LUPB 4DPUA 2HKEA 1EKZA 2UXBI 1DI2A 4RPFA 4BC7A 4GKKI 2LJPA 2ODRC 2Z5BB 2F4VI 1ZBQA 2Z5EA 4WYQB 1Z0BA 3QT6A 2UXDI 2RTXA 1HNXE 4LF6E 4B3ME 3PYFA 2KONA 4KHPE 3ADGA 2UXBE 1I94E 1Y6ZA 4DV2E 4GKKE 1HNZI 2E5LE 4JI0E 2VQEI 4MYUA 2BV3A 4OX9I 4GEQB 4DU8A 1HR0E 4HYMA 1D6TA 5A2QQ 1WXRA 4DPTA 2AJ4A 5ADZA 1I94I 1Z0VA 5FLXQ 2ZM6I 4DV2I 4XTJA 2VQEE 4JI0I 2E5LI 4B3SI 1N0UA 1XMOE 2B7TA 1Z5CA 4LTYA 2CGEA 2VF3A 4DV5I 2B3TB 4GKJE 2IOQA 2V88A 2Z5CB 4NXNI 4JYAI 5LL6R 3ZZUA 2JOBA 1Y4UA 3ADJA 4WSPA 1BKNA 2HKJA 4DV5E 4X66I 4DR5I 4GKJI 4Z7YA 4NXNE 4DU7A 4WPYA 4DUZI 2DEIA 2CPNA 4JI1E 5IWAI 3H4LA 3J81Q 2RS6A 2A2CA 2M1SA 5CFFE 1HK7A 2VQFE 1ZXMA 4WFTA 4X66E 4DR5E 2L2KB 5AE3A 3ZKDA 2WZOA 2V34A 1Z0GA 3LTOA 4LF5I 4DUZE 1T4NA 4DV3I 4JI1I 2H36X 2ODRD 4F9CB 2L8TA 2VQFI 3Q1QA 1VISA 1Z0CA 4P52A 4DUYE 2DEJA 2MC5A 2RS7A 1XMQI 1IBKE 4USKA 2V86A 4DV3E 4DR3I 2DB2A 1PIEA 2UUAI 4BCAA 2O1TA 1XMQE 4DUYI 2M7QA 1FNMA 2HK3A 2ZBKB 2YT4A 1Z5AA 5DNYA 3VK6A 4DPXA 1HNXI 4LF6I 3K6QA 1DARA 2UUAE 5AE2A 1QU6A 1HNZE 3JAMQ 5LMNI 2BM1A 4LF7E 4DV0E 3Q6MA 4ED4A 2PNLA 1ZM3A 1HNWE 3ZZ0A 2EZ6A 2E1MA 4Q28A 2B9DA 4DV6I 3HTXA 2M4IA 4LFBE 1PKPA 5LMNE 4B3SE 1B62A 1XMOI 4DV7E 1HNWI 4TUIA 4JI3E 4X62E 4LF9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXN A;  3LPS A;  4X8W A;  1XNQ E;  1EA6 A;  3B8H A;  4LFB I;  1Z0E A;  4URL A;  4JI5 E;  2WW4 A;  1YYK A;  4JI6 I;  2N3H A;  1IBL E;  2R3V A;  1N34 E;  4DPY A;  2LUQ A;  4X62 I;  3V2U C;  4LF9 I;  4JI4 E;  3T1Y E;  4JI5 I;  4JI6 E;  1IBL I;  2NUF A;  5IWA E;  2JY9 A;  1ELO A;  1Z0W A;  4USM A;  3WU4 A;  3P1X A;  2CZ9 A;  3VYX A;  2E1R A;  4HAC B;  3T1H E;  4NXM I;  2KHX A;  1FKA E;  3C4T A;  2L3C A;  3T1Y I;  4LF5 E;  1IBM E;  2L3J A;  1STU A;  1K47 A;  2EFG A;  1FWK A;  3VYY A;  4PRX A;  4B3R I;  5A2Q C;  1IBK I;  1IBM I;  2V8P A;  2UU9 I;  2GS8 A;  1RR9 A;  3PYD A;  2NA2 A;  2LTS A;  1N33 E;  2R42 A;  4LFC E;  4B3R E;  1KKH A;  5IT9 Q;  2HFS A;  4DR7 E;  2UU9 E;  3J7A G;  2UUB E;  1XNR E;  1Z59 A;  1NZ0 A;  4LFC I;  1FWL A;  1X49 A;  4DR7 I;  4LF7 I;  4DV0 I;  2B7V A;  2Q2E B;  1ZM2 A;  2UUB I;  2MDR A;  4DR6 I;  1XNR I;  3D4J A;  4YHH I;  2N3G A;  4P7A A;  4AQY I;  4DV6 E;  1WUU A;  4DV7 I;  3JAM C;  2HFU A;  4JI3 I;  1WHQ A;  1ZM9 A;  2UUC I;  4WUB A;  1XNQ I;  4DV1 I;  3J7A M;  2NPF A;  4HAC A;  4WUC A;  1J5E E;  1UHZ A;  4DV4 I;  1FJG E;  3C4B A;  1FI4 A;  1T4L B;  2V2Q A;  1N34 I;  3K17 A;  4JI4 I;  5LMU I;  5FLX C;  2UUC E;  1WHN A;  1ZM4 A;  4DV1 E;  1J5E I;  4DV4 E;  1FJG I;  3QT5 A;  3OTO I;  1N0V C;  3F0N A;  5LMU E;  1YYW A;  1Z0T A;  4MYT A;  3T1H I;  4NXM E;  1RRE A;  3ZM7 A;  4FN5 A;  4ZVI A;  4X65 I;  1KIJ A;  3ZKB A;  3OTO E;  4JI7 E;  3WU3 A;  1EI1 A;  2LBS B;  3V5R A;  2UXC E;  1A6F A;  2DIX A;  1U2R A;  3QT7 A;  4B3T E;  4JI8 E;  4UTG A;  2L2N A;  3QT8 A;  3J80 C;  4PRV A;  4DR4 E;  1N33 I;  4FWD A;  5BR8 E;  2HHH E;  4I3H A;  4HXZ A;  1MX0 A;  4LF8 E;  4FWG A;  3ZZT A;  4JI2 I;  3K1J A;  4M1K A;  4DKK A;  4LF4 E;  3HUL A;  4DR6 E;  3ADL A;  4YHH E;  5GMD A;  2NUE A;  1YZ9 A;  2RSM A;  4AQY E;  4LF8 I;  4PU9 A;  4JI2 E;  1OJ4 A;  1S4E A;  2L33 A;  1RC7 A;  1B63 A;  4UT4 A;  4WUD A;  4DXL A;  3J80 Q;  1MG7 A;  4KQV A;  1NHJ A;  4M30 A;  3J7Y p;  2V2Z A;  4LFA E;  4JG4 A;  1ZBT A;  2J7K A;  3GON A;  4FWH A;  1N36 I;  4DR1 I;  2A2D A;  3LLH A;  1S16 A;  1H74 A;  1UEK A;  4K0K I;  2HK2 A;  3J81 C;  1GQE A;  2F4V E;  2UXD E;  4OOG C;  3PYE A;  1X48 A;  5IT9 C;  2NUG A;  4DR1 E;  1J26 A;  4KHP I;  5L3J A;  2LRS A;  4K0K E;  1H73 A;  3WU6 A;  4OX9 E;  4X65 E;  1KTV A;  1HR0 I;  4JI7 I;  1MU5 A;  1NHI A;  2UXC I;  4X64 E;  4DR2 I;  4DPW A;  4B3T I;  4JI8 I;  1H7U A;  2ZM6 E;  2X7I A;  2L2M A;  2BM0 A;  1QZR A;  2DMY A;  1O0W A;  1UIL A;  4DR4 I;  5GME A;  2LJH A;  2ZIT A;  4DR2 E;  4X64 I;  3ADI A;  1Z5B A;  4FW9 A;  1KVK A;  1N32 E;  4JV5 E;  5BR8 I;  4JYA E;  2LTR A;  2HHH I;  2IHR 1;  2X36 A;  1H7S A;  1YYO A;  1RQ0 A;  4R1F A;  1N32 I;  4JV5 I;  4LF4 I;  3LNU A;  4YY3 E;  2XEX A;  4EMD A;  1XHK A;  2JVA A;  4M2Z A;  1PVG A;  3B82 A;  2V2V A;  3WU5 A;  4YY3 I;  3M6A A;  3CWV A;  1X47 A;  1H72 C;  4LFA I;  4Z7C A;  3PYG A;  3B78 A;  4DR3 E;  4HY1 A;  1N36 E;  1NHH A;  2OI2 A;  1T4O A;  4B3M I;  2LUP B;  4DPU A;  2HKE A;  1EKZ A;  2UXB I;  1DI2 A;  4RPF A;  4GKK I;  2LJP A;  2F4V I;  3QT6 A;  4WYQ B;  1Z0B A;  2UXD I;  2RTX A;  1HNX E;  4LF6 E;  4B3M E;  3PYF A;  4KHP E;  3ADG A;  2UXB E;  1I94 E;  4DV2 E;  4GKK E;  1HNZ I;  2E5L E;  4JI0 E;  2VQE I;  4MYU A;  2BV3 A;  4OX9 I;  4DU8 A;  1HR0 E;  4HYM A;  1D6T A;  5A2Q Q;  4DPT A;  2AJ4 A;  1I94 I;  1Z0V A;  5FLX Q;  2ZM6 I;  4DV2 I;  4XTJ A;  2VQE E;  4JI0 I;  2E5L I;  4B3S I;  1N0U A;  1XMO E;  2B7T A;  1Z5C A;  2VF3 A;  4DV5 I;  2B3T B;  4GKJ E;  4NXN I;  4JYA I;  5LL6 R;  3ZZU A;  3ADJ A;  1BKN A;  2HKJ A;  4DV5 E;  4X66 I;  4DR5 I;  4GKJ I;  4Z7Y A;  4NXN E;  4DU7 A;  4DUZ I;  2DEI A;  2CPN A;  4JI1 E;  5IWA I;  3H4L A;  3J81 Q;  2RS6 A;  2A2C A;  5CFF E;  2VQF E;  1ZXM A;  4WFT A;  4X66 E;  4DR5 E;  2L2K B;  3ZKD A;  2V34 A;  1Z0G A;  3LTO A;  4LF5 I;  4DUZ E;  1T4N A;  4DV3 I;  4JI1 I;  2VQF I;  3Q1Q A;  1VIS A;  1Z0C A;  4P52 A;  4DUY E;  2DEJ A;  1XMQ I;  2RS7 A;  1IBK E;  4USK A;  4DV3 E;  4DR3 I;  2DB2 A;  1PIE A;  2UUA I;  1XMQ E;  4DUY I;  1FNM A;  2HK3 A;  2ZBK B;  2YT4 A;  1Z5A A;  4DPX A;  1HNX I;  4LF6 I;  1DAR A;  2UUA E;  1QU6 A;  1HNZ E;  3JAM Q;  5LMN I;  2BM1 A;  4LF7 E;  4DV0 E;  4ED4 A;  1ZM3 A;  1HNW E;  3ZZ0 A;  2EZ6 A;  4DV6 I;  3HTX A;  4LFB E;  1PKP A;  5LMN E;  4B3S E;  1B62 A;  1XMO I;  4DV7 E;  1HNW I;  4JI3 E;  4X62 E;  4LF9 E; 
#chains in the Genus database with same CATH topology
 1ZXN A;  1Y5Y A;  3LPS A;  2EPA A;  4X8W A;  1XNQ E;  1EA6 A;  3B8H A;  3K85 A;  2EN6 A;  2JEB A;  4FW4 A;  2JYA A;  4LFB I;  5AE1 A;  1Z0E A;  2JOX A;  4URL A;  4JI5 E;  3EPL A;  1YYK A;  2WW4 A;  4JI6 I;  2DGC A;  2N3H A;  2FV4 B;  1IBL E;  2R3V A;  1GZ6 A;  1N34 E;  4FW5 A;  4DPY A;  2LUQ A;  4O24 A;  2WBT A;  4X62 I;  3V2U C;  4LF9 I;  4JI4 E;  4FW3 A;  5JEA D;  1WRJ A;  1TF6 A;  4AM3 A;  5T6J A;  3T1Y E;  4JI5 I;  4JI6 E;  2E72 A;  4WXC A;  1IBL I;  2I13 A;  2NUF A;  3DJW A;  2JY9 A;  5IWA E;  2FTX B;  2VF1 A;  2YTD A;  3C6M A;  4WX9 A;  1ELO A;  1Z0W A;  4I8O A;  4USM A;  3WU4 A;  3P1X A;  3MHH C;  2CZ9 A;  2YU8 A;  3VYX A;  3PRY A;  2E1R A;  4HAC B;  2EM7 A;  4KZS A;  3T1H E;  2BA1 G;  4P78 A;  2EPU A;  2KHX A;  4NXM I;  2YZT A;  2KOU A;  1FKA E;  3C4T A;  4IS1 C;  2EPP A;  5F3W A;  4IFD A;  4F2J C;  2L3C A;  3T1Y I;  5KL2 A;  4LF5 E;  2EN8 A;  1IBM E;  1KJK A;  2VRD A;  4OO1 B;  3EPH A;  2L3J A;  2C37 A;  2K7I A;  1STU A;  2YTN A;  4BHC A;  1K47 A;  1R6L A;  2EFG A;  2Z5C A;  1P47 A;  2EOZ A;  1L4S A;  4OO1 E;  1KYQ A;  2RPC A;  1PJT A;  1IQS A;  1FWK A;  3VYY A;  2LT7 A;  2WBS A;  4PRX A;  5IXM B;  2EMZ A;  4R2E A;  4B3R I;  5A2Q C;  1IBK I;  4DMI A;  1IBM I;  2YTF A;  2V8P A;  2BR2 A;  2UU9 I;  3DF6 A;  2NN6 D;  3OML A;  2YTQ A;  2PNZ A;  2EOE A;  2GS8 A;  3MSW A;  3AUZ A;  2EMB A;  1RR9 A;  1Y4S A;  4IFD C;  2EWL A;  3PYD A;  2NA2 A;  2LTS A;  3JU0 A;  3BGH A;  1N33 E;  2R42 A;  5JEA C;  4LFC E;  5C0X A;  3LML A;  4B3R E;  1KKH A;  5IT9 Q;  4MLQ A;  4R2Q A;  2HFS A;  3Q6N A;  4DR7 E;  2EPX A;  2UU9 E;  3UHM A;  3J7A G;  2YTJ A;  2DMI A;  3H09 A;  2FGG A;  2UUB E;  2V83 A;  1XNR E;  1A1J A;  2I9I A;  4R8O A;  1VI7 A;  1Z59 A;  1NZ0 A;  4IFD B;  3IWB A;  1TN9 A;  4LFC I;  2C38 A;  1XXE A;  1FWL A;  3U1K A;  1X49 A;  4RHB B;  2JR1 A;  2MC6 A;  3GME A;  4DV0 I;  4LF7 I;  2EMK A;  2B7V A;  4DR7 I;  5K36 E;  4GZN C;  2Q2E B;  1ZM2 A;  2UUB I;  2MDR A;  4DR6 I;  1XNR I;  3D4J A;  4YHH I;  4AID A;  2N3G A;  5C0X F;  4P7A A;  2IES A;  2O1U A;  1G2D C;  4AQY I;  4DV6 E;  5KL5 A;  1WUU A;  2LE2 A;  2JP9 A;  2NN6 C;  5A6J A;  2ELZ A;  4M0V A;  3ZOQ B;  4BA2 B;  2EP3 A;  4DV7 I;  2C39 B;  3JAM C;  4TUG A;  1YUJ A;  2HFU A;  4BMJ A;  1OYP A;  2O1W A;  4JI3 I;  3TQM A;  4OZE A;  1WHQ A;  3C6K A;  4F9B B;  2EMF A;  1ZM9 A;  4OKG A;  2LVH A;  4ZYD A;  3KWR A;  4F54 A;  4WUB A;  2Q8U A;  4AIM A;  2UUC I;  1XNQ I;  4N3O A;  4DV1 I;  3J7A M;  3KRN A;  1J5E E;  4HAC A;  4WUC A;  2NPF A;  1UHZ A;  1A1F A;  4DV4 I;  1FJG E;  3C4B A;  1FI4 A;  3P3G A;  4L8N A;  1T4L B;  2V2Q A;  1N34 I;  2LCE A;  4BC9 A;  4IZJ B;  5DRP A;  3RMP A;  4J3D A;  3HXL A;  5TSE A;  2BA0 G;  2J65 A;  3K17 A;  4JI4 I;  2EMA A;  5LMU I;  5FLX C;  2V89 A;  1WHN A;  2UUC E;  1ZM4 A;  4DV1 E;  4R2C A;  1J5E I;  1EH7 A;  4DV4 E;  1FJG I;  3QT5 A;  1R6M A;  5FWK A;  3OTO I;  2LV2 A;  5DNL A;  1N0V C;  2BR2 B;  1BB8 A;  1EH8 A;  3F0N A;  5LMU E;  1YYW A;  1Z0T A;  4MYT A;  3T1H I;  3EQ1 A;  4NXM E;  1RRE A;  2WP8 B;  1T38 A;  2IER A;  4FN5 A;  3ZM7 A;  3THO B;  4LCH A;  4U3D A;  3HJC A;  3QG5 C;  4ZVI A;  4X65 I;  3DD6 A;  4FW7 A;  1KIJ A;  2ENH A;  3ZKB A;  3OTO E;  4JI7 E;  3WU3 A;  4MU0 A;  4BA1 A;  2O1V A;  1EI1 A;  2LBS B;  2EQ3 A;  4IS9 A;  2GLI A;  3V5R A;  2UXC E;  1A6F A;  2EMI A;  1A1K A;  2DIX A;  4R2S A;  1U2R A;  3QT7 A;  4F9A B;  4JI8 E;  4B3T E;  1JK1 A;  4UTG A;  1T39 A;  1B69 A;  2L2N A;  3J80 C;  2CSH A;  3QT8 A;  1A1G A;  4PRV A;  1A1H A;  5KL6 A;  4DR4 E;  1N33 I;  2EPZ A;  4FWD A;  1SR9 A;  2EOF A;  2YRH A;  2MKN A;  4LPF A;  4QNK A;  2F1D A;  4BBY A;  5BR8 E;  2BA1 D;  5ELW A;  4U3B A;  2DRP A;  2V8Q B;  2HHH E;  2LMZ A;  1DQ3 A;  1LLM C;  4GQU A;  4MU1 A;  4HXZ A;  4I3H A;  2PO1 A;  1GTK A;  5A6B D;  2PNZ B;  1MX0 A;  4LF8 E;  4FWG A;  3ZZT A;  2DSY A;  2EPM X;  4JI2 I;  3L7Z B;  5DRQ A;  3K1J A;  2EJ4 A;  3FIG A;  4M1K A;  4MU4 A;  4DKK A;  4LF4 E;  3HUL A;  3PS3 A;  1NCS A;  4DR6 E;  3ADL A;  2PO0 B;  4YHH E;  4MDT A;  5GMD A;  2NUE A;  2BB8 A;  1YZ9 A;  2RSM A;  4AQY E;  4L5N C;  4OO1 A;  4LF8 I;  4OO1 D;  4PU9 A;  1WJP A;  1X5W A;  2VES A;  4JI2 E;  1OJ4 A;  3AV0 A;  2EPK X;  1S4E A;  2V87 A;  3MHS C;  2L33 A;  1RC7 A;  1B63 A;  1ZU1 A;  1UDN A;  4UT4 A;  4WUD A;  2PNM A;  5C0X C;  4IFD D;  2NN6 A;  4DXL A;  3J80 Q;  4BS9 A;  3ECR A;  1MG7 A;  4KQV A;  1NHJ A;  2WNR A;  4M30 A;  3J7Y p;  2V2Z A;  2YTE A;  4LFA E;  2MKD A;  3THN A;  2EPN A;  4JG4 A;  1ZBT A;  2J7K A;  3GON A;  3NZK A;  4FWH A;  1N36 I;  4DR1 I;  2A2D A;  3BID A;  3LLH A;  1S16 A;  1H74 A;  2YRK A;  1UDO A;  2WBU A;  2EPO A;  1USV A;  1YFH A;  1UEK A;  4K0K I;  2HK2 A;  4IZJ A;  5K36 F;  2IOP A;  2JXP A;  3J81 C;  1E3H A;  1GQE A;  3HQ1 A;  2EOY A;  2F4V E;  4X9J A;  2UXD E;  4OOG C;  2G7H A;  3PYE A;  1X48 A;  5IT9 C;  2CTD A;  4DR1 E;  2NUG A;  4IZK B;  4NZV A;  1J26 A;  2Z5B A;  2J7J A;  2ENC A;  4BHB A;  4KHP I;  4IZJ D;  5L3J A;  2YPN A;  2RSI A;  4R2R A;  2LRS A;  4K0K E;  2YRM A;  2EM2 A;  1H73 A;  4R03 A;  3WU6 A;  2JWO A;  4OX9 E;  2EM0 A;  4X65 E;  1KTV A;  2EOX A;  1HR0 I;  4JI7 I;  1X6F A;  5A69 A;  1MU5 A;  1NHI A;  5AAS A;  5KL3 A;  2UXC I;  4X64 E;  4DR2 I;  4DPW A;  2EL6 A;  4B3T I;  2C39 A;  1H7U A;  4JI8 I;  2ZM6 E;  2EQ1 A;  2X7I A;  2K4V A;  2L2M A;  2BM0 A;  1QZR A;  2WP8 A;  3CDJ A;  2DMY A;  2EPR A;  1O0W A;  3VHT B;  4OO1 F;  2BA0 D;  1UIL A;  1USU A;  4DR4 I;  5GME A;  2LJH A;  2ZIT A;  4HTG A;  4DR2 E;  2PO2 B;  4X64 I;  2ENA A;  3ADI A;  1Z5B A;  4FW6 A;  4BA1 B;  4FW9 A;  4IZK A;  1KVK A;  3HPZ A;  1AH5 A;  2JEA B;  4FK5 C;  1N32 E;  4JV5 E;  5BR8 I;  4JYA E;  2LTR A;  3HPS A;  2HHH I;  2IHR 1;  2X36 A;  4F6M A;  2L92 A;  2C37 B;  1H7S A;  2EOJ A;  4LU9 A;  1YYO A;  1G2F C;  2HGH A;  2ADR A;  1RQ0 A;  4MQY A;  4R1F A;  4Q35 B;  1N32 I;  4JV5 I;  3EPJ A;  4LF4 I;  1MEY C;  3LNU A;  4YY3 E;  5C0X E;  3BBG A;  2V85 A;  3IWC A;  2XEX A;  2CVE A;  3P3E A;  3JTZ A;  1XHK A;  5A6B A;  4MU3 A;  2VE7 C;  4EMD A;  2JVA A;  4M2Z A;  4O43 A;  1IMU A;  2YTI A;  1PVG A;  1JK2 A;  3B82 A;  1N3G A;  3F6H A;  2V2V A;  3F6G A;  1Y60 A;  4RH8 A;  3WU5 A;  2JEB B;  1E3P A;  4YY3 I;  3M6A A;  5EL9 A;  2L6M A;  2CG9 A;  5KL7 A;  1MGT A;  2GQ0 A;  3CWV A;  1IQO A;  2DLK A;  4NBQ A;  4J8Z A;  1X47 A;  3M7N D;  1QNT A;  1H72 C;  5JEA F;  4LFA I;  3GLL A;  2JT2 A;  2EM9 A;  2YTP A;  1SFE A;  4Z7C A;  3PYG A;  3B78 A;  4IFD F;  4DR3 E;  4P7D A;  1YHC A;  4HY1 A;  1YUI A;  1OYS A;  2C38 B;  2F8B A;  1YPN A;  1N36 E;  3P06 A;  1NHH A;  2OI2 A;  1T4O A;  3IWD A;  4B3M I;  2LUP B;  5IV8 B;  4DPU A;  5K36 C;  2HKE A;  2YSO A;  1EKZ A;  2UXB I;  1DI2 A;  4RPF A;  4BC7 A;  1PJQ A;  4GKK I;  2EL5 A;  2LJP A;  2ODR C;  1BBO A;  2Z5B B;  2F4V I;  1ZBQ A;  5AC5 A;  4WYQ B;  1Z0B A;  2Z5E A;  3QT6 A;  2UXD I;  2RTX A;  1HNX E;  4LF6 E;  1F2I G;  2EOH A;  4WXD A;  2R1F A;  4B3M E;  2A25 A;  2KON A;  4KHP E;  3PYF A;  2EML A;  3ADG A;  1UN6 B;  2JE6 B;  2EM3 A;  2UXB E;  2NN6 B;  1I94 E;  2BBG A;  4DV2 E;  1Y6Z A;  4QNJ A;  2EM5 A;  4GKK E;  1HNZ I;  2E5L E;  4JI0 E;  2VQE I;  2PO0 A;  4MYU A;  2BV3 A;  4OX9 I;  5K36 B;  2EOR A;  2GPI A;  4O5G A;  2NN6 F;  4GEQ B;  4DU8 A;  2YSP A;  5A6A A;  1HR0 E;  4IJD A;  1UDQ A;  4HYM A;  2M9A A;  5C0X D;  1D6T A;  1YH8 A;  5A2Q Q;  1OYR A;  1WXR A;  1P42 A;  4DPT A;  4OO1 C;  2AJ4 A;  2GHF A;  5ADZ A;  2WCC 3;  1I94 I;  4IFD E;  1Z0V A;  3UK3 C;  5FLX Q;  2ZM6 I;  4DV2 I;  4XTJ A;  2VQE E;  4JI0 I;  4LCF A;  2E5L I;  4B3S I;  1N0U A;  1XMO E;  1EH6 A;  5KL4 A;  2B7T A;  1PDA A;  1PJS A;  2EM8 A;  4LTY A;  1Z5C A;  1BBG A;  5EKW A;  2EPC A;  2CGE A;  1RMD A;  3M85 G;  2VF3 A;  4DV5 I;  2B3T B;  2YU5 A;  4ZYH A;  5AC4 A;  4GKJ E;  2IOQ A;  2JPA A;  2NN6 E;  2EOS A;  2ELY A;  1AAY A;  2V88 A;  2Z5C B;  3KZY A;  4NXN I;  2YTO A;  1DGC A;  5JEA B;  4ISA A;  4JYA I;  5LL6 R;  2EM6 A;  5DNX A;  3ZZU A;  2JOB A;  1Y4U A;  3ADJ A;  4WSP A;  2DLQ A;  1BKN A;  2HKJ A;  2EPL X;  3CDI A;  2EOM A;  1TF3 A;  4DV5 E;  5JEA A;  1YSA C;  4X66 I;  4DR5 I;  2HC5 A;  4GKJ I;  4Z7Y A;  3P3C A;  2RQL A;  4NXN E;  4DU7 A;  4WPY A;  4DUZ I;  2DEI A;  2R76 A;  2O3Z A;  2CPN A;  4JI1 E;  2EMH A;  5IWA I;  3PS1 A;  4F6N A;  2EL4 A;  3H4L A;  3J81 Q;  2GO3 A;  3BF2 A;  2RS6 A;  2A2C A;  2LJU A;  2M1S A;  5CFF E;  1HK7 A;  2VQF E;  5C0X B;  1ZXM A;  1X6H A;  1X6E A;  4WFT A;  4KWY A;  4R2P A;  4X66 E;  4DR5 E;  5K36 D;  2L2K B;  2EN3 A;  5AE3 A;  4LOM A;  3ZKD A;  2WZO A;  2V34 A;  1Z0G A;  3LTO A;  4LF5 I;  4DUZ E;  1ZAA C;  1T4N A;  4DV3 I;  3P76 A;  2EM4 A;  2JE6 A;  4JI1 I;  5JEA E;  2H36 X;  2CT1 A;  2ODR D;  3PS2 A;  2AE8 A;  4F9C B;  2L8T A;  1UDS A;  4N4R B;  3EPK A;  1RHY A;  2VQF I;  2EN1 A;  5K36 A;  3Q1Q A;  2EOI A;  1VIS A;  1Z0C A;  4P52 A;  4DUY E;  2DEJ A;  2MC5 A;  2RS7 A;  2PRT A;  1UBD C;  1IBK E;  1XMQ I;  3HKM A;  4USK A;  2V86 A;  4DV3 E;  4NHR A;  3L00 A;  2DB2 A;  4DR3 I;  2EMY A;  4HEI A;  2YWQ A;  1PIE A;  2UUA I;  5A6K A;  4O4K A;  2EMG A;  2EN2 A;  4BCA A;  2O1T A;  5LLQ A;  1XMQ E;  2YTG A;  4DUY I;  2M7Q A;  2PO1 B;  1FNM A;  3M99 B;  2EMX A;  1Z1B A;  2HK3 A;  2YT4 A;  2ZBK B;  1Z5A A;  5DRR A;  5DRO A;  2PO2 A;  5DNY A;  3VK6 A;  4DPX A;  2EN7 A;  1A1L A;  1HNX I;  4LF6 I;  3K6Q A;  4WSG A;  1DAR A;  2UUA E;  3M85 D;  2EOQ A;  2NAB A;  4R2A A;  2JEA A;  2LO3 A;  4MLV A;  5AE2 A;  4R2D A;  2GO4 A;  1QU6 A;  1HNZ E;  3JAM Q;  2D9H A;  2BM1 A;  2MDG A;  5LMN I;  4LF7 E;  3KZZ A;  2EN4 A;  2N8X A;  4DV0 E;  3Q6M A;  2PNL A;  4ED4 A;  4M9V C;  1HNW E;  1ZM3 A;  3ZZ0 A;  2EZ6 A;  4ZYE A;  3GCM A;  2E1M A;  4Q28 A;  3B4T A;  2EE8 A;  1A1I A;  4BA2 A;  2B9D A;  3L7Z A;  1NEI A;  4DV6 I;  3HTX A;  2M4I A;  4LFB E;  2EMC A;  2EOO A;  1PKP A;  1ZR9 A;  5LMN E;  4B3S E;  2EQ0 A;  2WNR B;  1B62 A;  2HJJ A;  1XMO I;  2EMW A;  4DV7 E;  1X3C A;  3H1C A;  1HNW I;  3M7N G;  4TUI A;  4JI3 E;  4ZYG A;  4LCG A;  3U1Y A;  4X62 E;  4LF9 E; 
#chains in the Genus database with same CATH homology
 1ZXN A;  3LPS A;  4X8W A;  1XNQ E;  1EA6 A;  3B8H A;  3K85 A;  4LFB I;  5AE1 A;  1Z0E A;  2JOX A;  4URL A;  4JI5 E;  2WW4 A;  1YYK A;  4JI6 I;  2N3H A;  2FV4 B;  1IBL E;  2R3V A;  1GZ6 A;  1N34 E;  4DPY A;  2LUQ A;  4X62 I;  3V2U C;  4LF9 I;  4JI4 E;  5T6J A;  3T1Y E;  4JI5 I;  4JI6 E;  1IBL I;  2NUF A;  3DJW A;  2JY9 A;  5IWA E;  2FTX B;  2VF1 A;  1ELO A;  1Z0W A;  4I8O A;  4USM A;  3WU4 A;  3P1X A;  2CZ9 A;  3VYX A;  3PRY A;  2E1R A;  4HAC B;  4KZS A;  3T1H E;  4P78 A;  4NXM I;  2KHX A;  2YZT A;  2KOU A;  1FKA E;  3C4T A;  5F3W A;  2L3C A;  3T1Y I;  4LF5 E;  1IBM E;  2L3J A;  1STU A;  1K47 A;  2EFG A;  2Z5C A;  1FWK A;  3VYY A;  4PRX A;  4B3R I;  5A2Q C;  1IBK I;  4DMI A;  1IBM I;  2V8P A;  2UU9 I;  3DF6 A;  3OML A;  2GS8 A;  3MSW A;  3AUZ A;  1RR9 A;  1Y4S A;  2EWL A;  3PYD A;  2NA2 A;  2LTS A;  3JU0 A;  1N33 E;  2R42 A;  4LFC E;  3LML A;  4B3R E;  1KKH A;  5IT9 Q;  2HFS A;  3Q6N A;  4DR7 E;  2UU9 E;  3J7A G;  3H09 A;  2FGG A;  2UUB E;  2V83 A;  1XNR E;  4R8O A;  1Z59 A;  1NZ0 A;  3IWB A;  4LFC I;  1FWL A;  1X49 A;  2JR1 A;  2MC6 A;  4LF7 I;  4DV0 I;  4DR7 I;  2B7V A;  2Q2E B;  1ZM2 A;  2UUB I;  2MDR A;  4DR6 I;  1XNR I;  3D4J A;  4YHH I;  2N3G A;  4P7A A;  4AQY I;  2O1U A;  4DV6 E;  1WUU A;  2LE2 A;  4M0V A;  3ZOQ B;  4DV7 I;  3JAM C;  4TUG A;  2HFU A;  4BMJ A;  2O1W A;  4JI3 I;  1WHQ A;  4F9B B;  1ZM9 A;  3KWR A;  4F54 A;  4WUB A;  2UUC I;  1XNQ I;  4N3O A;  4DV1 I;  3J7A M;  2NPF A;  1J5E E;  4HAC A;  4WUC A;  1UHZ A;  4DV4 I;  1FJG E;  3C4B A;  1FI4 A;  4L8N A;  1T4L B;  2V2Q A;  1N34 I;  4BC9 A;  4IZJ B;  3RMP A;  3HXL A;  3K17 A;  4JI4 I;  5LMU I;  5FLX C;  2V89 A;  1WHN A;  2UUC E;  1ZM4 A;  4DV1 E;  1J5E I;  4DV4 E;  1FJG I;  3QT5 A;  5FWK A;  3OTO I;  1N0V C;  3F0N A;  5LMU E;  1YYW A;  1Z0T A;  4MYT A;  3T1H I;  4NXM E;  1RRE A;  3ZM7 A;  4FN5 A;  3HJC A;  4ZVI A;  4X65 I;  1KIJ A;  3ZKB A;  3OTO E;  4JI7 E;  3WU3 A;  2O1V A;  1EI1 A;  2LBS B;  3V5R A;  2UXC E;  1A6F A;  2DIX A;  1U2R A;  3QT7 A;  4F9A B;  4JI8 E;  4B3T E;  4UTG A;  2L2N A;  3J80 C;  3QT8 A;  4PRV A;  4DR4 E;  1N33 I;  4FWD A;  1SR9 A;  4BBY A;  5BR8 E;  2HHH E;  2V8Q B;  2LMZ A;  1DQ3 A;  4I3H A;  4HXZ A;  1MX0 A;  4LF8 E;  4FWG A;  3ZZT A;  2DSY A;  4JI2 I;  3K1J A;  4M1K A;  3FIG A;  4DKK A;  4LF4 E;  3HUL A;  4DR6 E;  3ADL A;  4YHH E;  5GMD A;  2NUE A;  1YZ9 A;  2RSM A;  4AQY E;  4L5N C;  4LF8 I;  4PU9 A;  4JI2 E;  1OJ4 A;  3AV0 A;  1S4E A;  2V87 A;  2L33 A;  1RC7 A;  1B63 A;  4UT4 A;  4WUD A;  2PNM A;  4DXL A;  3J80 Q;  4BS9 A;  1MG7 A;  4KQV A;  1NHJ A;  4M30 A;  3J7Y p;  2V2Z A;  4LFA E;  4JG4 A;  1ZBT A;  2J7K A;  3GON A;  4FWH A;  1N36 I;  4DR1 I;  2A2D A;  3LLH A;  1S16 A;  1H74 A;  1USV A;  1UEK A;  4K0K I;  2HK2 A;  4IZJ A;  2IOP A;  3J81 C;  1GQE A;  3HQ1 A;  2F4V E;  2UXD E;  4OOG C;  2G7H A;  3PYE A;  1X48 A;  5IT9 C;  2NUG A;  4DR1 E;  4IZK B;  1J26 A;  2Z5B A;  4KHP I;  4IZJ D;  5L3J A;  2LRS A;  4K0K E;  1H73 A;  4R03 A;  3WU6 A;  2JWO A;  4OX9 E;  4X65 E;  1KTV A;  1HR0 I;  4JI7 I;  1MU5 A;  1NHI A;  5AAS A;  2UXC I;  4X64 E;  4DR2 I;  4DPW A;  4B3T I;  4JI8 I;  1H7U A;  2ZM6 E;  2X7I A;  2K4V A;  2L2M A;  2BM0 A;  1QZR A;  2DMY A;  1O0W A;  1UIL A;  1USU A;  4DR4 I;  5GME A;  2LJH A;  2ZIT A;  4DR2 E;  4X64 I;  3ADI A;  1Z5B A;  4FW9 A;  4IZK A;  1KVK A;  3HPZ A;  1N32 E;  4JV5 E;  5BR8 I;  4JYA E;  2LTR A;  3HPS A;  2HHH I;  2IHR 1;  2X36 A;  2L92 A;  1H7S A;  4LU9 A;  1YYO A;  1RQ0 A;  4R1F A;  1N32 I;  4JV5 I;  4LF4 I;  3LNU A;  4YY3 E;  2V85 A;  3IWC A;  2XEX A;  3JTZ A;  1XHK A;  4EMD A;  2VE7 C;  2JVA A;  4M2Z A;  1PVG A;  3B82 A;  3F6H A;  2V2V A;  3F6G A;  3WU5 A;  4YY3 I;  3M6A A;  2L6M A;  2CG9 A;  2GQ0 A;  3CWV A;  4J8Z A;  1X47 A;  1H72 C;  4LFA I;  4Z7C A;  3PYG A;  3B78 A;  4DR3 E;  4P7D A;  4HY1 A;  2F8B A;  1N36 E;  3P06 A;  1NHH A;  2OI2 A;  1T4O A;  3IWD A;  4B3M I;  2LUP B;  4DPU A;  2HKE A;  1EKZ A;  2UXB I;  1DI2 A;  4RPF A;  4BC7 A;  4GKK I;  2LJP A;  2ODR C;  2Z5B B;  2F4V I;  1ZBQ A;  2Z5E A;  4WYQ B;  1Z0B A;  3QT6 A;  2UXD I;  2RTX A;  1HNX E;  4LF6 E;  4B3M E;  3PYF A;  2KON A;  4KHP E;  3ADG A;  2UXB E;  1I94 E;  1Y6Z A;  4DV2 E;  4GKK E;  1HNZ I;  2E5L E;  4JI0 E;  2VQE I;  4MYU A;  2BV3 A;  4OX9 I;  4GEQ B;  4DU8 A;  1HR0 E;  4HYM A;  1D6T A;  5A2Q Q;  1WXR A;  4DPT A;  2AJ4 A;  5ADZ A;  1I94 I;  1Z0V A;  5FLX Q;  2ZM6 I;  4DV2 I;  4XTJ A;  2VQE E;  4JI0 I;  2E5L I;  4B3S I;  1N0U A;  1XMO E;  2B7T A;  1Z5C A;  4LTY A;  2CGE A;  2VF3 A;  4DV5 I;  2B3T B;  4GKJ E;  2IOQ A;  2V88 A;  2Z5C B;  4NXN I;  4JYA I;  5LL6 R;  3ZZU A;  2JOB A;  1Y4U A;  3ADJ A;  4WSP A;  1BKN A;  2HKJ A;  4DV5 E;  4X66 I;  4DR5 I;  4GKJ I;  4Z7Y A;  4NXN E;  4DU7 A;  4WPY A;  4DUZ I;  2DEI A;  2CPN A;  4JI1 E;  5IWA I;  3H4L A;  3J81 Q;  2RS6 A;  2A2C A;  2M1S A;  5CFF E;  1HK7 A;  2VQF E;  1ZXM A;  4WFT A;  4X66 E;  4DR5 E;  2L2K B;  5AE3 A;  3ZKD A;  2WZO A;  2V34 A;  1Z0G A;  3LTO A;  4LF5 I;  4DUZ E;  1T4N A;  4DV3 I;  4JI1 I;  2H36 X;  2ODR D;  4F9C B;  2L8T A;  2VQF I;  3Q1Q A;  1VIS A;  1Z0C A;  4P52 A;  4DUY E;  2DEJ A;  2MC5 A;  2RS7 A;  1XMQ I;  1IBK E;  4USK A;  2V86 A;  4DV3 E;  4DR3 I;  2DB2 A;  1PIE A;  2UUA I;  4BCA A;  2O1T A;  1XMQ E;  4DUY I;  2M7Q A;  1FNM A;  2HK3 A;  2ZBK B;  2YT4 A;  1Z5A A;  5DNY A;  3VK6 A;  4DPX A;  1HNX I;  4LF6 I;  3K6Q A;  1DAR A;  2UUA E;  5AE2 A;  1QU6 A;  1HNZ E;  3JAM Q;  5LMN I;  2BM1 A;  4LF7 E;  4DV0 E;  3Q6M A;  4ED4 A;  2PNL A;  1ZM3 A;  1HNW E;  3ZZ0 A;  2EZ6 A;  2E1M A;  4Q28 A;  2B9D A;  4DV6 I;  3HTX A;  2M4I A;  4LFB E;  1PKP A;  5LMN E;  4B3S E;  1B62 A;  1XMO I;  4DV7 E;  1HNW I;  4TUI A;  4JI3 E;  4X62 E;  4LF9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...