4DV6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv6E02
5A2QQ 4DV4I 2E1RA 1MU5A 4P7AA 2R3VA 1H73A 2AJ4A 2NPFA 1B62A 1Z5CA 3LPSA 1D6TA 4GKJE 3F0NA 3PYDA 3J80Q 1HNZE 4JYAE 4WUCA 4DV2E 4KHPE 4DV3I 2L3JA 1XMQI 4JI6I 5LMUI 2A2DA 4DR1E 2VF3A 2UU9I 1N33I 1ZXNA 4DV6I 1N32E 4JI2E 4JI7I 3M6AA 3PYGA 4B3ME 4LF8E 1H74A 4DV5I 2J7KA 3QT6A 3LLHA 4OX9I 3P1XA 4HACA 1YZ9A 4AQYI 1Z0TA 3ADGA 1HR0I 4DKKA 2UXCI 2E5LE 4M30A 1I94I 4B3RE 1H7SA 3VYYA 3OTOI 5CFFE 2BM0A 3PYEA 4JI0E 2UUCI 4PU9A 5GMDA 4LF9I 4DPTA 1NHHA 4HYMA 5BR8E 4USKA 5GMEA 3LTOA 1MX0A 2HK2A 4GKKI 3J81Q 4DR3E 1N36I 4X66E 4B3TI 1XNQI 2N3GA 2EZ6A 3B78A 3Q1QA 1IBKI 3ZKDA 4DV0I 1FI4A 4DR4E 4JI5I 4LF6I 5IT9Q 1XHKA 2Q2EB 4DR6E 4NXNE 2V2VA 2LTRA 1I94E 2EFGA 2V2QA 4K0KE 1ZXMA 1YYWA 1RQ0A 3J7Yp 4UT4A 4DV1I 5LMNI 4DV4E 3ZKBA 3V5RA 2B7TA 3ADJA 4JV5I 2X7IA 4NXMI 1ZM3A 3ADLA 4FWHA 1DARA 1ZM2A 1PIEA 4LF7I 4JI3I 4DR2I 1OJ4A 4URLA 5IWAI 1UEKA 4JI1I 2ZM6I 4DPWA 4DV3E 2XEXA 2UXBI 4JI6E 2MDRA 5LMUE 4YY3I 1YYKA 1IBLI 1XMOI 3J81C 2HHHI 2UU9E 3D4JA 2OI2A 1N33E 3C4BA 3GONA 4JI7E 1HNWI 2LUQA 2F4VI 4DUYI 2V2ZA 2CPNA 3J7AM 4WFTA 2NA2A 4DV5E 3T1YI 5IT9C 1N34E 4OX9E 4DV7I 2LRSA 4DR5I 1Z0WA 1EKZA 2LUPB 4AQYE 2L2KB 1X49A 2HKJA 1HR0E 4DXLA 4DR7I 2UXCE 1Z0VA 3OTOE 4HACB 2UXDI 1EI1A 1WUUA 4X64I 1X47A 4P52A 5A2QC 4Z7YA 1H72C 3K1JA 4LF9E 4JYAI 3WU5A 4LFAI 2V8PA 2YT4A 4LFBI 2NUFA 4GKKE 2RS6A 1N36E 2VQEE 5FLXQ 3PYFA 4B3TE 1XNQE 1RR9A 3J80C 1WHNA 2UUAI 3WU3A 2L2MA 2VQFI 1IBKE 2IHR1 4KQVA 3WU6A 1J26A 2UUBI 4JI8I 4R1FA 4DV0E 1GQEA 4FWDA 4LFCI 2LTSA 4FN5A 4MYTA 1U2RA 1XNRI 4DUZI 3QT8A 1DI2A 4DPYA 1BKNA 1PVGA 5LMNE 1H7UA 1S4EA 4JG4A 4WUBA 4LF5I 2RSMA 4Z7CA 4DPXA 2JY9A 3V2UC 3ZZTA 4JV5E 1Z59A 4MYUA 4NXME 1HNXI 1FNMA 2ZBKB 1ZM4A 1NZ0A 4DPUA 3J7AG 4K0KI 1T4OA 4LF7E 4HXZA 4JI3E 4LF4I 4DR2E 5IWAE 1KVKA 1N0VC 1Z5AA 4JI1E 4X65I 2ZM6E 4USMA 4DR3I 1T4NA 3HTXA 4YY3E 1UHZA 2HHHE 1XMOE 1X48A 1A6FA 4RPFA 5FLXC 2L2NA 5LL6R 1Z5BA 2JVAA 1FJGI 1HNWE 1EA6A 1ELOA 2GS8A 1IBMI 2F4VE 4DUYE 4X62I 1XMQE 3T1HI 4DV7E 4B3SI 4DR5E 4JI4I 4DV6E 4FW9A 1J5EI 3CWVA 1WHQA 4DU7A 2HFUA 2BV3A 3B8HA 4DR7E 4M2ZA 4WYQB 4YHHI 3H4LA 2UXDE 2DMYA 1UILA 4X64E 4HY1A 2LJHA 1NHIA 3ZZUA 3C4TA 4UTGA 3QT5A 1PKPA 4ZVIA 4I3HA 1KIJA 4LFAE 2DEJA 2A2CA 4WUDA 4GKJI 2BM1A 4PRVA 2UUCE 3QT7A 2R42A 2KHXA 4LFBE 2DEIA 1HNZI 2L3CA 4ED4A 1FWKA 1QZRA 4FWGA 4M1KA 1RREA 4DV2I 2UUAE 4KHPI 5L3JA 2V34A 2X36A 4X8WA 2VQFE 3JAMQ 2UUBE 1Z0CA 4JI8E 2HKEA 1KKHA 4DR1I 1N34I 4LFCE 1NHJA 2RTXA 1N32I 4DU8A 4JI2I 2WW4A 1XNRE 4DUZE 2LJPA 1STUA 1FWLA 2N3HA 3ZZ0A 4B3MI 4LF8I 1ZM9A 4XTJA 3K17A 2LBSB 2NUEA 2CZ9A 4LF5E 1Z0GA 2ZITA 4JI5E 4LF6E 2L33A 2DIXA 1Z0EA 3WU4A 4DV1E 2HK3A 4EMDA 1HNXE 2E5LI 4B3RI 4OOGC 4LF4E 4JI0I 1S16A 2DB2A 3VYXA 1K47A 4X65E 1KTVA 2VQEI 1O0WA 1B63A 2B7VA 2HFSA 5BR8I 1T4LB 3HULA 1FKAE 1FJGE 1QU6A 1IBME 1YYOA 3JAMC 4X66I 4X62E 2UXBE 1Z0BA 2RS7A 1IBLE 3T1HE 3ZM7A 3ADIA 4B3SE 2B3TB 4JI4E 2NUGA 1RC7A 1VISA 1ZBTA 1MG7A 1J5EE 4DR4I 4PRXA 4DR6I 4NXNI 1N0UA 3LNUA 4YHHE 3B82A 3T1YE
chains in the Genus database with same CATH superfamily
5A2QQ 3P3GA 1A1IA 3U1KA 4WSPA 4DV4I 2FTXB 1IQSA 5KL4A 2HJJA 3VK6A 2E1RA 1MU5A 5JEAD 5JEAE 4P7DA 4P7AA 2EPPA 2R3VA 3KRNA 3HPZA 2CGEA 5AC5A 4WXDA 1H73A 5AE3A 2AJ4A 2LJUA 2K4VA 3AV0A 4O4KA 2NPFA 5IV8B 1B62A 1Z5CA 5DRQA 3LPSA 2EPLX 5ADZA 2YTNA 1D6TA 2CTDA 3GCMA 4GKJE 1DGCA 3CDJA 2JP9A 2EMYA 1YSAC 1BB8A 2F1DA 3F0NA 3PYDA 5IXMB 3J80Q 2Z5EA 3FIGA 1HNZE 2M7QA 2F8BA 4JYAE 1B69A 4O24A 2EM9A 4WUCA 2KOUA 4DV2E 1E3PA 4WXCA 4KHPE 2O1UA 4DV3I 2A25A 2L3JA 1XMQI 4JI6I 2YWQA 3JTZA 5LMUI 2A2DA 1RHYA 2EJ4A 2N8XA 5A6JA 5A6BD 4R2PA 4DR1E 4F6NA 2VF3A 5ELWA 2UU9I 2EMIA 4IZJA 1N33I 1ZXNA 4DV6I 4MU4A 1N32E 1Z1BA 4FW4A 4FW3A 4JI2E 1LLMC 4JI7I 2EMGA 3HKMA 4FW7A 2VE7C 3M6AA 3K6QA 1ZAAC 3PYGA 2C39B 2EOHA 4B3ME 4LF8E 1H74A 4DV5I 2J7KA 4BCAA 3UK3C 3P3EA 3QT6A 1JK2A 3LLHA 4IFDB 2EMXA 4OX9I 4GQUA 3P1XA 1N3GA 1PJTA 4FW5A 1T39A 2BA1G 4HACA 1UDNA 1YZ9A 4BC9A 2EPAA 4AQYI 1Z0TA 3ADGA 1HR0I 2EPCA 2ENAA 4DKKA 3LMLA 2UXCI 5K36C 2E5LE 2I9IA 1WRJA 2EQ0A 2K7IA 4M30A 1I94I 4B3RE 1H7SA 3VYYA 3OTOI 5CFFE 4HEIA 2BM0A 3PYEA 4JI0E 2UUCI 2O1VA 3DF6A 5A6AA 1E3HA 4PU9A 2IOPA 2PO0B 1PJSA 2CSHA 2ADRA 2YTPA 5GMDA 2V87A 3Q6MA 2DRPA 4R2CA 3PRYA 2EM0A 2YRHA 5EL9A 4LF9I 4BHCA 2PNZA 4DPTA 1NHHA 2JWOA 2V85A 2GO4A 3CDIA 1KJKA 4AIDA 2EN7A 5K36E 4HYMA 2EM7A 2EPXA 5BR8E 4ZYGA 4USKA 5GMEA 5K36D 1PDAA 3LTOA 3RMPA 4ZYHA 2VRDA 3BF2A 5AE1A 1IMUA 2EL5A 1MX0A 2EN2A 3H1CA 3L7ZB 4U3BA 2HK2A 1X6EA 2EMFA 3J81Q 2JEAA 4GKKI 2EQ3A 4DR3E 1N36I 4X66E 3F6GA 3M85D 4F54A 4B3TI 2NABA 1XNQI 4BA2A 4KHPI 2N3GA 2NN6B 2EZ6A 3B78A 5JEAA 3Q1QA 1IBKI 3ZKDA 3NZKA 1UN6B 5C0XB 3DJWA 2EQ1A 4DV0I 4IZKB 2JEBA 5JEAF 1FI4A 4OO1C 2BB8A 2E1MA 2YTFA 4DR4E 4JI5I 2ENCA 2YPNA 3F6HA 4LF6I 5IT9Q 3THOB 2EN1A 1XHKA 2Q2EB 4DR6E 4NXNE 2V2VA 4OKGA 2LTRA 4IFDE 4IFDD 5TSEA 1I94E 2EFGA 2V2QA 4K0KE 1UDQA 1ZXMA 1YYWA 1RQ0A 3J7Yp 3ZOQB 3HJCA 4UT4A 4DV1I 3ECRA 5LMNI 1A1GA 4DV4E 2EMKA 4O43A 1UDSA 1EH8A 3EQ1A 3ZKBA 1WXRA 4WX9A 3V5RA 2B7TA 4OO1E 2EMAA 3ADJA 4JV5I 4OO1D 2EMBA 2EPKX 3GLLA 1R6MA 2X7IA 2V8QB 4NXMI 1ZM3A 2VESA 1PJQA 5A6BA 2EMLA 3ADLA 2HGHA 2EN4A 4FWHA 1OYPA 1P42A 5A6KA 1DARA 5KL3A 1ZM2A 1PIEA 2YTJA 3MHSC 1EH6A 4MU3A 2DGCA 4LF7I 1X6HA 4JI3I 4DR2I 1OJ4A 2ELYA 4URLA 5IWAI 2MC5A 4AIMA 2PO2A 1UEKA 2EE8A 4JI1I 2ZM6I 2JOXA 2M9AA 5DNYA 4DPWA 4DV3E 1OYRA 4BA1A 4KZSA 2XEXA 1YPNA 2UXBI 1RMDA 1QNTA 1X3CA 2ODRC 4JI6E 1KYQA 2MDRA 5LMUE 4I8OA 2IOQA 4YY3I 1YYKA 1YH8A 2EM3A 1VI7A 1XMOI 3J81C 1IBLI 3IWDA 2HHHI 2PO1A 2UU9E 3D4JA 2JE6A 2OI2A 1N33E 1G2FC 5FWKA 3C4BA 2Z5CA 2EPZA 4GEQB 4BBYA 4JI7E 2R76A 3GONA 1HNWI 3MHHC 2LUQA 1TN9A 2F4VI 3EPKA 2EORA 4IS1C 5KL7A 5C0XD 5C0XE 2V2ZA 4DUYI 2CPNA 3M99B 3J7AM 4WFTA 2NA2A 4DV5E 4N3OA 2EPNA 2EN3A 2EOOA 1MEYC 3T1YI 5IT9C 4IZJB 2ODRD 4LU9A 1N34E 4OX9E 2LRSA 4DV7I 4DR5I 1NCSA 4NBQA 1Z0WA 1EKZA 1JK1A 4J3DA 3C6MA 2LUPB 2PNMA 2EOJA 4M0VA 4Q28A 1AAYA 4AQYE 2L2KB 2C37A 1X49A 2HKJA 1HR0E 4DXLA 4DR7I 5DRRA 2YRKA 5K36A 2UXCE 2MDGA 3U1YA 4MLVA 2DLQA 4TUGA 5K36F 1Z0VA 3OTOE 4HACB 3QG5C 2UXDI 3HPSA 4M9VC 4F9AB 1EI1A 1WUUA 4X64I 4IS9A 2YTQA 4R2AA 1X47A 3K85A 5A2QC 2EMZA 4P52A 1Y60A 4R2SA 4QNKA 4Z7YA 2JXPA 1X5WA 1H72C 3K1JA 1P47A 3BBGA 4LF9E 4JYAI 3WU5A 4R2QA 2DLKA 4LFAI 2FV4B 3EPHA 2EOSA 2V8PA 4LOMA 3M7NG 2WNRA 5AASA 2WBSA 2Z5BA 1DQ3A 2B9DA 4HTGA 2FGGA 2YT4A 4LCGA 4LFBI 2E72A 2NUFA 2CVEA 4GKKE 3VHTB 2RS6A 2PNZB 1N36E 4IFDF 2G7HA 4LCFA 3IWBA 2VQEE 5FLXQ 4F9CB 2GLIA 3PYFA 4B3TE 1XNQE 3J80C 1RR9A 1GTKA 1WHNA 3WU3A 2UUAI 2L2MA 2D9HA 2VQFI 1IBKE 2IHR1 4FK5C 4KQVA 4O5GA 1J26A 4JI8I 3WU6A 2UUBI 4R1FA 4DV0E 2C38A 4OO1A 2YTIA 1GQEA 4FWDA 2AE8A 2YTEA 4LFCI 2JEAB 2H36X 2LTSA 3KWRA 4OO1F 4FN5A 4MYTA 4IFDC 2YTDA 1U2RA 1YFHA 1BBOA 1XNRI 4DUZI 4BA2B 3QT8A 1DI2A 4IZJD 3IWCA 2J7JA 5JEAB 2YRMA 4DPYA 1BKNA 2YSPA 4R8OA 1PVGA 1SFEA 2ENHA 5LMNE 1MGTA 2JEBB 1EH7A 1H7UA 1S4EA 4JG4A 4WUBA 4LF5I 2EPMX 2RSMA 4Z7CA 2DSYA 4DPXA 2JY9A 3V2UC 3ZZTA 4JV5E 1Z59A 4MYUA 2PNLA 4NXME 4R2EA 3AUZA 4DMIA 3L7ZA 2L92A 2BA0G 3EPJA 1HNXI 2EL4A 4YHHE 1FNMA 2JPAA 1GZ6A 2EN6A 2V83A 4N4RB 2ZBKB 1ZM4A 1NZ0A 3J7AG 4DPUA 4K0KI 1T4OA 4LF7E 4HXZA 4RH8A 4JI3E 4LF4I 2WZOA 1YUJA 2YTGA 3P06A 4DR2E 5IWAE 2EOFA 2LV2A 2WP8A 2LE2A 1AH5A 1KVKA 2YSOA 5C0XA 4L8NA 1UBDC 4IZKA 1N0VC 1Z5AA 4JI1E 5DNXA 2ZM6E 4X65I 4USMA 5C0XF 3JU0A 2WBTA 2EM2A 4NZVA 4DR3I 1T4NA 3HTXA 1L4SA 3OMLA 4LCHA 4FW6A 2EPUA 4YY3E 5KL6A 1UHZA 2MKNA 3M85G 2HHHE 1XMOE 1XXEA 1X48A 1A6FA 4RPFA 5FLXC 2L2NA 5LL6R 2PRTA 1Z5BA 2NN6C 2PO2B 2JVAA 3PS1A 1FJGI 1HNWE 2BR2A 3P76A 1A1JA 1EA6A 5C0XC 1ELOA 2GS8A 2RSIA 4BS9A 4BA1B 1IBMI 2F4VE 2GHFA 2BBGA 4DUYE 2EWLA 1ZU1A 4X62I 2PO1B 1XMQE 2JE6B 3HXLA 3T1HI 4DV7E 2EOEA 2GPIA 4B3SI 4DR5E 2Z5CB 2V89A 4JI4I 4DV6E 2LMZA 4FW9A 4WSGA 2O1TA 1A1FA 1J5EI 3BIDA 3CWVA 1WHQA 4DU7A 2NN6D 2EN8A 2NN6E 2M1SA 2BV3A 2HFUA 3B8HA 4R2DA 4QNJA 2EMHA 4DR7E 2R1FA 4M2ZA 2EOZA 4WYQB 4LTYA 1TF3A 5AC4A 4YHHI 1G2DC 1BBGA 1X6FA 2IERA 5T6JA 3H4LA 4ZYEA 2UXDE 2DMYA 2ELZA 1UILA 4X64E 4HY1A 2LJHA 2EOXA 1NHIA 2L8TA 4R03A 4U3DA 3ZZUA 2C37B 2YU5A 4RHBB 2M4IA 3C4TA 5K36B 2BA1D 4UTGA 3QT5A 1WJPA 1PKPA 3Q6NA 4ZVIA 4I3HA 1KIJA 4ZYDA 4LFAE 4BMJA 2DEJA 1NEIA 2RQLA 2A2CA 3MSWA 4WUDA 2LVHA 5LLQA 4MQYA 4GKJI 1SR9A 2BM1A 4PRVA 2UUCE 3QT7A 2CG9A 4KWYA 2EOIA 2R42A 2KHXA 4LFBE 4L5NC 4BC7A 2DEIA 4IJDA 2EM6A 2EM8A 1HNZI 2L3CA 4ISAA 4ED4A 5KL2A 1USVA 1FWKA 1HK7A 1QZRA 4FWGA 4M1KA 3HQ1A 2O1WA 1RREA 4BHBA 4DV2I 2UUAE 2LO3A 2WNRB 2Z5BB 2EP3A 2EL6A 1ZR9A 2EPRA 2V34A 4X8WA 2VQFE 2X36A 5L3JA 3JAMQ 2UUBE 4F9BB 4JI8E 1Z0CA 2C39A 2JR1A 2HKEA 1A1HA 1KKHA 2EMCA 4DR1I 1Y4SA 5DNLA 3PS3A 1N34I 4LFCE 1NHJA 3KZYA 4IFDA 3M7ND 1OYSA 2RTXA 1N32I 2LT7A 4DU8A 4JI2I 4R2RA 2WW4A 1XNRE 4MU1A 4DUZE 2YZTA 2LJPA 2JT2A 1R6LA 2V88A 2L6MA 2V86A 5EKWA 1STUA 1FWLA 2N3HA 3ZZ0A 4B3MI 4X9JA 1ZM9A 2C38B 4XTJA 4LF8I 3K17A 2JOBA 2LBSB 4OO1B 2NUEA 2CZ9A 2KONA 2YTOA 3KZZA 2WCC3 4NHRA 4LF5E 2LCEA 1Z0GA 2ZITA 4JI5E 4LF6E 3B4TA 3PS2A 4MLQA 5A69A 2L33A 3L00A 2DIXA 1A1KA 1Z0EA 4OZEA 3WU4A 3UHMA 2PO0A 4J8ZA 4DV1E 2EOQA 4TUIA 2HK3A 4EMDA 1YHCA 1HNXE 2MKDA 2E5LI 2EM4A 3TQMA 2WBUA 4B3RI 2YU8A 1A1LA 4OOGC 4LF4E 4JI0I 4Q35B 4AM3A 2BA0D 1S16A 3GMEA 2DB2A 2Q8UA 2O3ZA 3VYXA 1K47A 4X65E 1KTVA 5DRPA 2IESA 2VQEI 1O0WA 5KL5A 4F6MA 1B63A 2B7VA 2HFSA 2EOMA 1ZBQA 4WPYA 5BR8I 5DROA 1Y5YA 2NN6A 1T4LB 2WP8B 3HULA 1F2IG 1FKAE 4MDTA 2JYAA 1FJGE 2NN6F 2EM5A 3THNA 4MU0A 2RPCA 1QU6A 3JAMC 1YYOA 1IBME 2HC5A 4X66I 4X62E 2UXBE 1Z0BA 3H09A 2RS7A 2MC6A 2I13A 1IBLE 3T1HE 2GQ0A 4P78A 4F2JC 2J65A 3ADIA 3ZM7A 4B3SE 2B3TB 4JI4E 2NUGA 1RC7A 1IQOA 1ZBTA 2CT1A 1MG7A 1USUA 1VISA 5JEAC 2BR2B 4GZNC 4LPFA 2EOYA 1YUIA 3DD6A 1J5EE 4DR4I 1Y6ZA 3BGHA 1TF6A 1UDOA 2DMIA 1Y4UA 1T38A 3P3CA 5AE2A 4PRXA 2VF1A 2EMWA 5F3WA 2GO3A 4NXNI 1N0UA 3LNUA 2EPOA 4DR6I 3C6KA 3B82A 3T1YE 3EPLA
chains in the Genus database with same CATH topology
5A2QQ 4WSPA 4DV4I 2FTXB 3VK6A 2E1RA 1MU5A 4P7DA 4P7AA 2R3VA 3HPZA 2CGEA 1H73A 5AE3A 2AJ4A 3AV0A 2K4VA 2NPFA 1B62A 1Z5CA 3LPSA 5ADZA 1D6TA 4GKJE 3F0NA 3PYDA 3J80Q 2Z5EA 3FIGA 1HNZE 2M7QA 2F8BA 4JYAE 4WUCA 2KOUA 4DV2E 2O1UA 4KHPE 4DV3I 2L3JA 1XMQI 4JI6I 3JTZA 5LMUI 2A2DA 4DR1E 2VF3A 2UU9I 4IZJA 1N33I 1ZXNA 4DV6I 1N32E 4JI2E 4JI7I 2VE7C 3M6AA 3K6QA 3PYGA 4B3ME 4LF8E 1H74A 4DV5I 2J7KA 4BCAA 3QT6A 3LLHA 4OX9I 3P1XA 4HACA 1YZ9A 4BC9A 4AQYI 1Z0TA 3ADGA 1HR0I 4DKKA 3LMLA 2UXCI 2E5LE 4M30A 1I94I 4B3RE 1H7SA 3VYYA 3OTOI 5CFFE 2BM0A 3PYEA 4JI0E 2UUCI 2O1VA 3DF6A 4PU9A 2IOPA 5GMDA 2V87A 3Q6MA 3PRYA 4LF9I 4DPTA 1NHHA 2JWOA 2V85A 4HYMA 5BR8E 4USKA 5GMEA 3LTOA 3RMPA 5AE1A 1MX0A 2HK2A 4GKKI 3J81Q 4DR3E 1N36I 4X66E 3F6GA 4F54A 4B3TI 1XNQI 2N3GA 2EZ6A 3B78A 3Q1QA 1IBKI 3ZKDA 3DJWA 4DV0I 4IZKB 1FI4A 2E1MA 4DR4E 4JI5I 4LF6I 3F6HA 5IT9Q 1XHKA 2Q2EB 4DR6E 4NXNE 2V2VA 2LTRA 1I94E 2EFGA 2V2QA 4K0KE 1ZXMA 3HJCA 1YYWA 1RQ0A 3J7Yp 3ZOQB 4UT4A 4DV1I 5LMNI 4DV4E 3ZKBA 1WXRA 3V5RA 2B7TA 3ADJA 4JV5I 2X7IA 2V8QB 4NXMI 1ZM3A 3ADLA 4FWHA 1DARA 1ZM2A 1PIEA 4LF7I 4JI3I 4DR2I 1OJ4A 4URLA 5IWAI 2MC5A 1UEKA 4JI1I 2ZM6I 2JOXA 5DNYA 4DPWA 4DV3E 4KZSA 2XEXA 2UXBI 2ODRC 4JI6E 2MDRA 5LMUE 2IOQA 4I8OA 4YY3I 1YYKA 1IBLI 1XMOI 3J81C 2HHHI 3IWDA 2UU9E 3D4JA 2OI2A 1N33E 5FWKA 3C4BA 2Z5CA 3GONA 4GEQB 4BBYA 4JI7E 1HNWI 2LUQA 2F4VI 4DUYI 2V2ZA 2CPNA 3J7AM 4WFTA 2NA2A 4DV5E 4N3OA 3T1YI 5IT9C 4IZJB 2ODRD 4LU9A 1N34E 4OX9E 2LRSA 4DV7I 4DR5I 1Z0WA 1EKZA 2LUPB 2PNMA 4M0VA 4Q28A 4AQYE 2L2KB 1X49A 2HKJA 1HR0E 4DXLA 4DR7I 2UXCE 4TUGA 1Z0VA 3OTOE 4HACB 2UXDI 3HPSA 4F9AB 1EI1A 1WUUA 4X64I 1X47A 3K85A 5A2QC 4P52A 4Z7YA 1H72C 3K1JA 4LF9E 4JYAI 3WU5A 4LFAI 2FV4B 2V8PA 2Z5BA 5AASA 1DQ3A 2B9DA 2FGGA 2YT4A 4LFBI 2NUFA 4GKKE 2RS6A 1N36E 2G7HA 3IWBA 2VQEE 5FLXQ 4F9CB 3PYFA 4B3TE 1XNQE 3J80C 1RR9A 1WHNA 2UUAI 3WU3A 2L2MA 2VQFI 1IBKE 2IHR1 4KQVA 3WU6A 1J26A 2UUBI 4JI8I 4R1FA 4DV0E 1GQEA 4FWDA 4LFCI 2H36X 2LTSA 3KWRA 4FN5A 4MYTA 1U2RA 1XNRI 4DUZI 3QT8A 1DI2A 4IZJD 3IWCA 4DPYA 1BKNA 4R8OA 1PVGA 5LMNE 1H7UA 1S4EA 4JG4A 4WUBA 4LF5I 2RSMA 4Z7CA 2DSYA 4DPXA 2JY9A 3V2UC 3ZZTA 4JV5E 1Z59A 4MYUA 2PNLA 4NXME 3AUZA 4DMIA 2L92A 1HNXI 1FNMA 1GZ6A 2V83A 2ZBKB 1ZM4A 1NZ0A 3J7AG 4DPUA 4K0KI 1T4OA 4LF7E 4HXZA 4JI3E 4LF4I 2WZOA 3P06A 4DR2E 5IWAE 2LE2A 1KVKA 4L8NA 4IZKA 1N0VC 1Z5AA 4JI1E 4X65I 2ZM6E 4USMA 3JU0A 4DR3I 1T4NA 3HTXA 3OMLA 4YY3E 1UHZA 2HHHE 1XMOE 1X48A 1A6FA 4RPFA 5FLXC 2L2NA 5LL6R 1Z5BA 2JVAA 1FJGI 1HNWE 1EA6A 1ELOA 2GS8A 4BS9A 1IBMI 2F4VE 4DUYE 4X62I 2EWLA 1XMQE 3HXLA 3T1HI 4DV7E 4B3SI 4DR5E 2Z5CB 2V89A 4JI4I 4DV6E 2LMZA 4FW9A 2O1TA 1J5EI 3CWVA 1WHQA 4DU7A 2M1SA 2BV3A 2HFUA 3B8HA 4DR7E 4M2ZA 4WYQB 4LTYA 4YHHI 5T6JA 3H4LA 2UXDE 2DMYA 1UILA 4X64E 4HY1A 2LJHA 1NHIA 2L8TA 4R03A 3ZZUA 2M4IA 3C4TA 4UTGA 3QT5A 3Q6NA 1PKPA 4ZVIA 4I3HA 1KIJA 4LFAE 4BMJA 2DEJA 2A2CA 3MSWA 4WUDA 4GKJI 1SR9A 2BM1A 4PRVA 2UUCE 3QT7A 2CG9A 2R42A 2KHXA 4LFBE 4L5NC 4BC7A 2DEIA 1HNZI 2L3CA 4ED4A 1USVA 1FWKA 1HK7A 1QZRA 4FWGA 4M1KA 3HQ1A 2O1WA 1RREA 4DV2I 2UUAE 2Z5BB 4KHPI 5L3JA 2V34A 2X36A 4X8WA 2VQFE 3JAMQ 2UUBE 4F9BB 4JI8E 1Z0CA 2JR1A 2HKEA 1KKHA 4DR1I 1Y4SA 1N34I 4LFCE 1NHJA 2RTXA 1N32I 4DU8A 4JI2I 2WW4A 1XNRE 4DUZE 2YZTA 2LJPA 2V88A 2L6MA 2V86A 1STUA 1FWLA 2N3HA 3ZZ0A 4B3MI 4LF8I 1ZM9A 4XTJA 3K17A 2JOBA 2LBSB 2NUEA 2CZ9A 2KONA 4LF5E 1Z0GA 2ZITA 4JI5E 4LF6E 2L33A 2DIXA 1Z0EA 3WU4A 4J8ZA 4DV1E 4TUIA 2HK3A 4EMDA 1HNXE 2E5LI 4B3RI 4OOGC 4LF4E 4JI0I 1S16A 2DB2A 3VYXA 1K47A 4X65E 1KTVA 2VQEI 1O0WA 1B63A 2B7VA 2HFSA 1ZBQA 4WPYA 5BR8I 1T4LB 3HULA 1FKAE 1FJGE 1QU6A 3JAMC 1YYOA 1IBME 4X66I 4X62E 2UXBE 1Z0BA 3H09A 2RS7A 2MC6A 2GQ0A 1IBLE 3T1HE 4P78A 3ZM7A 3ADIA 4B3SE 2B3TB 4JI4E 2NUGA 1RC7A 1USUA 1ZBTA 1MG7A 1VISA 1J5EE 4DR4I 1Y6ZA 1Y4UA 5AE2A 4PRXA 2VF1A 5F3WA 4NXNI 4DR6I 1N0UA 3LNUA 4YHHE 3B82A 3T1YE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q Q;  4DV4 I;  2E1R A;  1MU5 A;  4P7A A;  2R3V A;  1H73 A;  2AJ4 A;  2NPF A;  1B62 A;  1Z5C A;  3LPS A;  1D6T A;  4GKJ E;  3F0N A;  3PYD A;  3J80 Q;  1HNZ E;  4JYA E;  4WUC A;  4DV2 E;  4KHP E;  4DV3 I;  2L3J A;  1XMQ I;  4JI6 I;  5LMU I;  2A2D A;  4DR1 E;  2VF3 A;  2UU9 I;  1N33 I;  1ZXN A;  4DV6 I;  1N32 E;  4JI2 E;  4JI7 I;  3M6A A;  3PYG A;  4B3M E;  4LF8 E;  1H74 A;  4DV5 I;  2J7K A;  3QT6 A;  3LLH A;  4OX9 I;  3P1X A;  4HAC A;  1YZ9 A;  4AQY I;  1Z0T A;  3ADG A;  1HR0 I;  4DKK A;  2UXC I;  2E5L E;  4M30 A;  1I94 I;  4B3R E;  1H7S A;  3VYY A;  3OTO I;  5CFF E;  2BM0 A;  3PYE A;  4JI0 E;  2UUC I;  4PU9 A;  5GMD A;  4LF9 I;  4DPT A;  1NHH A;  4HYM A;  5BR8 E;  4USK A;  5GME A;  3LTO A;  1MX0 A;  2HK2 A;  4GKK I;  3J81 Q;  4DR3 E;  1N36 I;  4X66 E;  4B3T I;  1XNQ I;  2N3G A;  2EZ6 A;  3B78 A;  3Q1Q A;  1IBK I;  3ZKD A;  4DV0 I;  1FI4 A;  4DR4 E;  4JI5 I;  4LF6 I;  5IT9 Q;  1XHK A;  2Q2E B;  4DR6 E;  4NXN E;  2V2V A;  2LTR A;  1I94 E;  2EFG A;  2V2Q A;  4K0K E;  1ZXM A;  1YYW A;  1RQ0 A;  3J7Y p;  4UT4 A;  4DV1 I;  5LMN I;  4DV4 E;  3ZKB A;  3V5R A;  2B7T A;  3ADJ A;  4JV5 I;  2X7I A;  4NXM I;  1ZM3 A;  3ADL A;  4FWH A;  1DAR A;  1ZM2 A;  1PIE A;  4LF7 I;  4JI3 I;  4DR2 I;  1OJ4 A;  4URL A;  5IWA I;  1UEK A;  4JI1 I;  2ZM6 I;  4DPW A;  4DV3 E;  2XEX A;  2UXB I;  4JI6 E;  2MDR A;  5LMU E;  4YY3 I;  1YYK A;  1IBL I;  1XMO I;  3J81 C;  2HHH I;  2UU9 E;  3D4J A;  2OI2 A;  1N33 E;  3C4B A;  3GON A;  4JI7 E;  1HNW I;  2LUQ A;  2F4V I;  4DUY I;  2V2Z A;  2CPN A;  3J7A M;  4WFT A;  2NA2 A;  4DV5 E;  3T1Y I;  5IT9 C;  1N34 E;  4OX9 E;  4DV7 I;  2LRS A;  4DR5 I;  1Z0W A;  1EKZ A;  2LUP B;  4AQY E;  2L2K B;  1X49 A;  2HKJ A;  1HR0 E;  4DXL A;  4DR7 I;  2UXC E;  1Z0V A;  3OTO E;  4HAC B;  2UXD I;  1EI1 A;  1WUU A;  4X64 I;  1X47 A;  4P52 A;  5A2Q C;  4Z7Y A;  1H72 C;  3K1J A;  4LF9 E;  4JYA I;  3WU5 A;  4LFA I;  2V8P A;  2YT4 A;  4LFB I;  2NUF A;  4GKK E;  2RS6 A;  1N36 E;  2VQE E;  5FLX Q;  3PYF A;  4B3T E;  1XNQ E;  1RR9 A;  3J80 C;  1WHN A;  2UUA I;  3WU3 A;  2L2M A;  2VQF I;  1IBK E;  2IHR 1;  4KQV A;  3WU6 A;  1J26 A;  2UUB I;  4JI8 I;  4R1F A;  4DV0 E;  1GQE A;  4FWD A;  4LFC I;  2LTS A;  4FN5 A;  4MYT A;  1U2R A;  1XNR I;  4DUZ I;  3QT8 A;  1DI2 A;  4DPY A;  1BKN A;  1PVG A;  5LMN E;  1H7U A;  1S4E A;  4JG4 A;  4WUB A;  4LF5 I;  2RSM A;  4Z7C A;  4DPX A;  2JY9 A;  3V2U C;  3ZZT A;  4JV5 E;  1Z59 A;  4MYU A;  4NXM E;  1HNX I;  1FNM A;  2ZBK B;  1ZM4 A;  1NZ0 A;  4DPU A;  3J7A G;  4K0K I;  1T4O A;  4LF7 E;  4HXZ A;  4JI3 E;  4LF4 I;  4DR2 E;  5IWA E;  1KVK A;  1N0V C;  1Z5A A;  4JI1 E;  4X65 I;  2ZM6 E;  4USM A;  4DR3 I;  1T4N A;  3HTX A;  4YY3 E;  1UHZ A;  2HHH E;  1XMO E;  1X48 A;  1A6F A;  4RPF A;  5FLX C;  2L2N A;  5LL6 R;  1Z5B A;  2JVA A;  1FJG I;  1HNW E;  1EA6 A;  1ELO A;  2GS8 A;  1IBM I;  2F4V E;  4DUY E;  4X62 I;  1XMQ E;  3T1H I;  4DV7 E;  4B3S I;  4DR5 E;  4JI4 I;  4DV6 E;  4FW9 A;  1J5E I;  3CWV A;  1WHQ A;  4DU7 A;  2HFU A;  2BV3 A;  3B8H A;  4DR7 E;  4M2Z A;  4WYQ B;  4YHH I;  3H4L A;  2UXD E;  2DMY A;  1UIL A;  4X64 E;  4HY1 A;  2LJH A;  1NHI A;  3ZZU A;  3C4T A;  4UTG A;  3QT5 A;  1PKP A;  4ZVI A;  4I3H A;  1KIJ A;  4LFA E;  2DEJ A;  2A2C A;  4WUD A;  4GKJ I;  2BM1 A;  4PRV A;  2UUC E;  3QT7 A;  2R42 A;  2KHX A;  4LFB E;  2DEI A;  1HNZ I;  2L3C A;  4ED4 A;  1FWK A;  1QZR A;  4FWG A;  4M1K A;  1RRE A;  4DV2 I;  2UUA E;  4KHP I;  5L3J A;  2V34 A;  2X36 A;  4X8W A;  2VQF E;  3JAM Q;  2UUB E;  1Z0C A;  4JI8 E;  2HKE A;  1KKH A;  4DR1 I;  1N34 I;  4LFC E;  1NHJ A;  2RTX A;  1N32 I;  4DU8 A;  4JI2 I;  2WW4 A;  1XNR E;  4DUZ E;  2LJP A;  1STU A;  1FWL A;  2N3H A;  3ZZ0 A;  4B3M I;  4LF8 I;  1ZM9 A;  4XTJ A;  3K17 A;  2LBS B;  2NUE A;  2CZ9 A;  4LF5 E;  1Z0G A;  2ZIT A;  4JI5 E;  4LF6 E;  2L33 A;  2DIX A;  1Z0E A;  3WU4 A;  4DV1 E;  2HK3 A;  4EMD A;  1HNX E;  2E5L I;  4B3R I;  4OOG C;  4LF4 E;  4JI0 I;  1S16 A;  2DB2 A;  3VYX A;  1K47 A;  4X65 E;  1KTV A;  2VQE I;  1O0W A;  1B63 A;  2B7V A;  2HFS A;  5BR8 I;  1T4L B;  3HUL A;  1FKA E;  1FJG E;  1QU6 A;  1IBM E;  1YYO A;  3JAM C;  4X66 I;  4X62 E;  2UXB E;  1Z0B A;  2RS7 A;  1IBL E;  3T1H E;  3ZM7 A;  3ADI A;  4B3S E;  2B3T B;  4JI4 E;  2NUG A;  1RC7 A;  1VIS A;  1ZBT A;  1MG7 A;  1J5E E;  4DR4 I;  4PRX A;  4DR6 I;  4NXN I;  1N0U A;  3LNU A;  4YHH E;  3B82 A;  3T1Y E; 
#chains in the Genus database with same CATH topology
 5A2Q Q;  3P3G A;  1A1I A;  3U1K A;  4WSP A;  4DV4 I;  2FTX B;  1IQS A;  5KL4 A;  2HJJ A;  3VK6 A;  2E1R A;  1MU5 A;  5JEA D;  5JEA E;  4P7D A;  4P7A A;  2EPP A;  2R3V A;  3KRN A;  3HPZ A;  2CGE A;  5AC5 A;  4WXD A;  1H73 A;  5AE3 A;  2AJ4 A;  2LJU A;  2K4V A;  3AV0 A;  4O4K A;  2NPF A;  5IV8 B;  1B62 A;  1Z5C A;  5DRQ A;  3LPS A;  2EPL X;  5ADZ A;  2YTN A;  1D6T A;  2CTD A;  3GCM A;  4GKJ E;  1DGC A;  3CDJ A;  2JP9 A;  2EMY A;  1YSA C;  1BB8 A;  2F1D A;  3F0N A;  3PYD A;  5IXM B;  3J80 Q;  2Z5E A;  3FIG A;  1HNZ E;  2M7Q A;  2F8B A;  4JYA E;  1B69 A;  4O24 A;  2EM9 A;  4WUC A;  2KOU A;  4DV2 E;  1E3P A;  4WXC A;  4KHP E;  2O1U A;  4DV3 I;  2A25 A;  2L3J A;  1XMQ I;  4JI6 I;  2YWQ A;  3JTZ A;  5LMU I;  2A2D A;  1RHY A;  2EJ4 A;  2N8X A;  5A6J A;  5A6B D;  4R2P A;  4DR1 E;  4F6N A;  2VF3 A;  5ELW A;  2UU9 I;  2EMI A;  4IZJ A;  1N33 I;  1ZXN A;  4DV6 I;  4MU4 A;  1N32 E;  1Z1B A;  4FW4 A;  4FW3 A;  4JI2 E;  1LLM C;  4JI7 I;  2EMG A;  3HKM A;  4FW7 A;  2VE7 C;  3M6A A;  3K6Q A;  1ZAA C;  3PYG A;  2C39 B;  2EOH A;  4B3M E;  4LF8 E;  1H74 A;  4DV5 I;  2J7K A;  4BCA A;  3UK3 C;  3P3E A;  3QT6 A;  1JK2 A;  3LLH A;  4IFD B;  2EMX A;  4OX9 I;  4GQU A;  3P1X A;  1N3G A;  1PJT A;  4FW5 A;  1T39 A;  2BA1 G;  4HAC A;  1UDN A;  1YZ9 A;  4BC9 A;  2EPA A;  4AQY I;  1Z0T A;  3ADG A;  1HR0 I;  2EPC A;  2ENA A;  4DKK A;  3LML A;  2UXC I;  5K36 C;  2E5L E;  2I9I A;  1WRJ A;  2EQ0 A;  2K7I A;  4M30 A;  1I94 I;  4B3R E;  1H7S A;  3VYY A;  3OTO I;  5CFF E;  4HEI A;  2BM0 A;  3PYE A;  4JI0 E;  2UUC I;  2O1V A;  3DF6 A;  5A6A A;  1E3H A;  4PU9 A;  2IOP A;  2PO0 B;  1PJS A;  2CSH A;  2ADR A;  2YTP A;  5GMD A;  2V87 A;  3Q6M A;  2DRP A;  4R2C A;  3PRY A;  2EM0 A;  2YRH A;  5EL9 A;  4LF9 I;  4BHC A;  2PNZ A;  4DPT A;  1NHH A;  2JWO A;  2V85 A;  2GO4 A;  3CDI A;  1KJK A;  4AID A;  2EN7 A;  5K36 E;  4HYM A;  2EM7 A;  2EPX A;  5BR8 E;  4ZYG A;  4USK A;  5GME A;  5K36 D;  1PDA A;  3LTO A;  3RMP A;  4ZYH A;  2VRD A;  3BF2 A;  5AE1 A;  1IMU A;  2EL5 A;  1MX0 A;  2EN2 A;  3H1C A;  3L7Z B;  4U3B A;  2HK2 A;  1X6E A;  2EMF A;  3J81 Q;  2JEA A;  4GKK I;  2EQ3 A;  4DR3 E;  1N36 I;  4X66 E;  3F6G A;  3M85 D;  4F54 A;  4B3T I;  2NAB A;  1XNQ I;  4BA2 A;  4KHP I;  2N3G A;  2NN6 B;  2EZ6 A;  3B78 A;  5JEA A;  3Q1Q A;  1IBK I;  3ZKD A;  3NZK A;  1UN6 B;  5C0X B;  3DJW A;  2EQ1 A;  4DV0 I;  4IZK B;  2JEB A;  5JEA F;  1FI4 A;  4OO1 C;  2BB8 A;  2E1M A;  2YTF A;  4DR4 E;  4JI5 I;  2ENC A;  2YPN A;  3F6H A;  4LF6 I;  5IT9 Q;  3THO B;  2EN1 A;  1XHK A;  2Q2E B;  4DR6 E;  4NXN E;  2V2V A;  4OKG A;  2LTR A;  4IFD E;  4IFD D;  5TSE A;  1I94 E;  2EFG A;  2V2Q A;  4K0K E;  1UDQ A;  1ZXM A;  1YYW A;  1RQ0 A;  3J7Y p;  3ZOQ B;  3HJC A;  4UT4 A;  4DV1 I;  3ECR A;  5LMN I;  1A1G A;  4DV4 E;  2EMK A;  4O43 A;  1UDS A;  1EH8 A;  3EQ1 A;  3ZKB A;  1WXR A;  4WX9 A;  3V5R A;  2B7T A;  4OO1 E;  2EMA A;  3ADJ A;  4JV5 I;  4OO1 D;  2EMB A;  2EPK X;  3GLL A;  1R6M A;  2X7I A;  2V8Q B;  4NXM I;  1ZM3 A;  2VES A;  1PJQ A;  5A6B A;  2EML A;  3ADL A;  2HGH A;  2EN4 A;  4FWH A;  1OYP A;  1P42 A;  5A6K A;  1DAR A;  5KL3 A;  1ZM2 A;  1PIE A;  2YTJ A;  3MHS C;  1EH6 A;  4MU3 A;  2DGC A;  4LF7 I;  1X6H A;  4JI3 I;  4DR2 I;  1OJ4 A;  2ELY A;  4URL A;  5IWA I;  2MC5 A;  4AIM A;  2PO2 A;  1UEK A;  2EE8 A;  4JI1 I;  2ZM6 I;  2JOX A;  2M9A A;  5DNY A;  4DPW A;  4DV3 E;  1OYR A;  4BA1 A;  4KZS A;  2XEX A;  1YPN A;  2UXB I;  1RMD A;  1QNT A;  1X3C A;  2ODR C;  4JI6 E;  1KYQ A;  2MDR A;  5LMU E;  4I8O A;  2IOQ A;  4YY3 I;  1YYK A;  1YH8 A;  2EM3 A;  1VI7 A;  1XMO I;  3J81 C;  1IBL I;  3IWD A;  2HHH I;  2PO1 A;  2UU9 E;  3D4J A;  2JE6 A;  2OI2 A;  1N33 E;  1G2F C;  5FWK A;  3C4B A;  2Z5C A;  2EPZ A;  4GEQ B;  4BBY A;  4JI7 E;  2R76 A;  3GON A;  1HNW I;  3MHH C;  2LUQ A;  1TN9 A;  2F4V I;  3EPK A;  2EOR A;  4IS1 C;  5KL7 A;  5C0X D;  5C0X E;  2V2Z A;  4DUY I;  2CPN A;  3M99 B;  3J7A M;  4WFT A;  2NA2 A;  4DV5 E;  4N3O A;  2EPN A;  2EN3 A;  2EOO A;  1MEY C;  3T1Y I;  5IT9 C;  4IZJ B;  2ODR D;  4LU9 A;  1N34 E;  4OX9 E;  2LRS A;  4DV7 I;  4DR5 I;  1NCS A;  4NBQ A;  1Z0W A;  1EKZ A;  1JK1 A;  4J3D A;  3C6M A;  2LUP B;  2PNM A;  2EOJ A;  4M0V A;  4Q28 A;  1AAY A;  4AQY E;  2L2K B;  2C37 A;  1X49 A;  2HKJ A;  1HR0 E;  4DXL A;  4DR7 I;  5DRR A;  2YRK A;  5K36 A;  2UXC E;  2MDG A;  3U1Y A;  4MLV A;  2DLQ A;  4TUG A;  5K36 F;  1Z0V A;  3OTO E;  4HAC B;  3QG5 C;  2UXD I;  3HPS A;  4M9V C;  4F9A B;  1EI1 A;  1WUU A;  4X64 I;  4IS9 A;  2YTQ A;  4R2A A;  1X47 A;  3K85 A;  5A2Q C;  2EMZ A;  4P52 A;  1Y60 A;  4R2S A;  4QNK A;  4Z7Y A;  2JXP A;  1X5W A;  1H72 C;  3K1J A;  1P47 A;  3BBG A;  4LF9 E;  4JYA I;  3WU5 A;  4R2Q A;  2DLK A;  4LFA I;  2FV4 B;  3EPH A;  2EOS A;  2V8P A;  4LOM A;  3M7N G;  2WNR A;  5AAS A;  2WBS A;  2Z5B A;  1DQ3 A;  2B9D A;  4HTG A;  2FGG A;  2YT4 A;  4LCG A;  4LFB I;  2E72 A;  2NUF A;  2CVE A;  4GKK E;  3VHT B;  2RS6 A;  2PNZ B;  1N36 E;  4IFD F;  2G7H A;  4LCF A;  3IWB A;  2VQE E;  5FLX Q;  4F9C B;  2GLI A;  3PYF A;  4B3T E;  1XNQ E;  3J80 C;  1RR9 A;  1GTK A;  1WHN A;  3WU3 A;  2UUA I;  2L2M A;  2D9H A;  2VQF I;  1IBK E;  2IHR 1;  4FK5 C;  4KQV A;  4O5G A;  1J26 A;  4JI8 I;  3WU6 A;  2UUB I;  4R1F A;  4DV0 E;  2C38 A;  4OO1 A;  2YTI A;  1GQE A;  4FWD A;  2AE8 A;  2YTE A;  4LFC I;  2JEA B;  2H36 X;  2LTS A;  3KWR A;  4OO1 F;  4FN5 A;  4MYT A;  4IFD C;  2YTD A;  1U2R A;  1YFH A;  1BBO A;  1XNR I;  4DUZ I;  4BA2 B;  3QT8 A;  1DI2 A;  4IZJ D;  3IWC A;  2J7J A;  5JEA B;  2YRM A;  4DPY A;  1BKN A;  2YSP A;  4R8O A;  1PVG A;  1SFE A;  2ENH A;  5LMN E;  1MGT A;  2JEB B;  1EH7 A;  1H7U A;  1S4E A;  4JG4 A;  4WUB A;  4LF5 I;  2EPM X;  2RSM A;  4Z7C A;  2DSY A;  4DPX A;  2JY9 A;  3V2U C;  3ZZT A;  4JV5 E;  1Z59 A;  4MYU A;  2PNL A;  4NXM E;  4R2E A;  3AUZ A;  4DMI A;  3L7Z A;  2L92 A;  2BA0 G;  3EPJ A;  1HNX I;  2EL4 A;  4YHH E;  1FNM A;  2JPA A;  1GZ6 A;  2EN6 A;  2V83 A;  4N4R B;  2ZBK B;  1ZM4 A;  1NZ0 A;  3J7A G;  4DPU A;  4K0K I;  1T4O A;  4LF7 E;  4HXZ A;  4RH8 A;  4JI3 E;  4LF4 I;  2WZO A;  1YUJ A;  2YTG A;  3P06 A;  4DR2 E;  5IWA E;  2EOF A;  2LV2 A;  2WP8 A;  2LE2 A;  1AH5 A;  1KVK A;  2YSO A;  5C0X A;  4L8N A;  1UBD C;  4IZK A;  1N0V C;  1Z5A A;  4JI1 E;  5DNX A;  2ZM6 E;  4X65 I;  4USM A;  5C0X F;  3JU0 A;  2WBT A;  2EM2 A;  4NZV A;  4DR3 I;  1T4N A;  3HTX A;  1L4S A;  3OML A;  4LCH A;  4FW6 A;  2EPU A;  4YY3 E;  5KL6 A;  1UHZ A;  2MKN A;  3M85 G;  2HHH E;  1XMO E;  1XXE A;  1X48 A;  1A6F A;  4RPF A;  5FLX C;  2L2N A;  5LL6 R;  2PRT A;  1Z5B A;  2NN6 C;  2PO2 B;  2JVA A;  3PS1 A;  1FJG I;  1HNW E;  2BR2 A;  3P76 A;  1A1J A;  1EA6 A;  5C0X C;  1ELO A;  2GS8 A;  2RSI A;  4BS9 A;  4BA1 B;  1IBM I;  2F4V E;  2GHF A;  2BBG A;  4DUY E;  2EWL A;  1ZU1 A;  4X62 I;  2PO1 B;  1XMQ E;  2JE6 B;  3HXL A;  3T1H I;  4DV7 E;  2EOE A;  2GPI A;  4B3S I;  4DR5 E;  2Z5C B;  2V89 A;  4JI4 I;  4DV6 E;  2LMZ A;  4FW9 A;  4WSG A;  2O1T A;  1A1F A;  1J5E I;  3BID A;  3CWV A;  1WHQ A;  4DU7 A;  2NN6 D;  2EN8 A;  2NN6 E;  2M1S A;  2BV3 A;  2HFU A;  3B8H A;  4R2D A;  4QNJ A;  2EMH A;  4DR7 E;  2R1F A;  4M2Z A;  2EOZ A;  4WYQ B;  4LTY A;  1TF3 A;  5AC4 A;  4YHH I;  1G2D C;  1BBG A;  1X6F A;  2IER A;  5T6J A;  3H4L A;  4ZYE A;  2UXD E;  2DMY A;  2ELZ A;  1UIL A;  4X64 E;  4HY1 A;  2LJH A;  2EOX A;  1NHI A;  2L8T A;  4R03 A;  4U3D A;  3ZZU A;  2C37 B;  2YU5 A;  4RHB B;  2M4I A;  3C4T A;  5K36 B;  2BA1 D;  4UTG A;  3QT5 A;  1WJP A;  1PKP A;  3Q6N A;  4ZVI A;  4I3H A;  1KIJ A;  4ZYD A;  4LFA E;  4BMJ A;  2DEJ A;  1NEI A;  2RQL A;  2A2C A;  3MSW A;  4WUD A;  2LVH A;  5LLQ A;  4MQY A;  4GKJ I;  1SR9 A;  2BM1 A;  4PRV A;  2UUC E;  3QT7 A;  2CG9 A;  4KWY A;  2EOI A;  2R42 A;  2KHX A;  4LFB E;  4L5N C;  4BC7 A;  2DEI A;  4IJD A;  2EM6 A;  2EM8 A;  1HNZ I;  2L3C A;  4ISA A;  4ED4 A;  5KL2 A;  1USV A;  1FWK A;  1HK7 A;  1QZR A;  4FWG A;  4M1K A;  3HQ1 A;  2O1W A;  1RRE A;  4BHB A;  4DV2 I;  2UUA E;  2LO3 A;  2WNR B;  2Z5B B;  2EP3 A;  2EL6 A;  1ZR9 A;  2EPR A;  2V34 A;  4X8W A;  2VQF E;  2X36 A;  5L3J A;  3JAM Q;  2UUB E;  4F9B B;  4JI8 E;  1Z0C A;  2C39 A;  2JR1 A;  2HKE A;  1A1H A;  1KKH A;  2EMC A;  4DR1 I;  1Y4S A;  5DNL A;  3PS3 A;  1N34 I;  4LFC E;  1NHJ A;  3KZY A;  4IFD A;  3M7N D;  1OYS A;  2RTX A;  1N32 I;  2LT7 A;  4DU8 A;  4JI2 I;  4R2R A;  2WW4 A;  1XNR E;  4MU1 A;  4DUZ E;  2YZT A;  2LJP A;  2JT2 A;  1R6L A;  2V88 A;  2L6M A;  2V86 A;  5EKW A;  1STU A;  1FWL A;  2N3H A;  3ZZ0 A;  4B3M I;  4X9J A;  1ZM9 A;  2C38 B;  4XTJ A;  4LF8 I;  3K17 A;  2JOB A;  2LBS B;  4OO1 B;  2NUE A;  2CZ9 A;  2KON A;  2YTO A;  3KZZ A;  2WCC 3;  4NHR A;  4LF5 E;  2LCE A;  1Z0G A;  2ZIT A;  4JI5 E;  4LF6 E;  3B4T A;  3PS2 A;  4MLQ A;  5A69 A;  2L33 A;  3L00 A;  2DIX A;  1A1K A;  1Z0E A;  4OZE A;  3WU4 A;  3UHM A;  2PO0 A;  4J8Z A;  4DV1 E;  2EOQ A;  4TUI A;  2HK3 A;  4EMD A;  1YHC A;  1HNX E;  2MKD A;  2E5L I;  2EM4 A;  3TQM A;  2WBU A;  4B3R I;  2YU8 A;  1A1L A;  4OOG C;  4LF4 E;  4JI0 I;  4Q35 B;  4AM3 A;  2BA0 D;  1S16 A;  3GME A;  2DB2 A;  2Q8U A;  2O3Z A;  3VYX A;  1K47 A;  4X65 E;  1KTV A;  5DRP A;  2IES A;  2VQE I;  1O0W A;  5KL5 A;  4F6M A;  1B63 A;  2B7V A;  2HFS A;  2EOM A;  1ZBQ A;  4WPY A;  5BR8 I;  5DRO A;  1Y5Y A;  2NN6 A;  1T4L B;  2WP8 B;  3HUL A;  1F2I G;  1FKA E;  4MDT A;  2JYA A;  1FJG E;  2NN6 F;  2EM5 A;  3THN A;  4MU0 A;  2RPC A;  1QU6 A;  3JAM C;  1YYO A;  1IBM E;  2HC5 A;  4X66 I;  4X62 E;  2UXB E;  1Z0B A;  3H09 A;  2RS7 A;  2MC6 A;  2I13 A;  1IBL E;  3T1H E;  2GQ0 A;  4P78 A;  4F2J C;  2J65 A;  3ADI A;  3ZM7 A;  4B3S E;  2B3T B;  4JI4 E;  2NUG A;  1RC7 A;  1IQO A;  1ZBT A;  2CT1 A;  1MG7 A;  1USU A;  1VIS A;  5JEA C;  2BR2 B;  4GZN C;  4LPF A;  2EOY A;  1YUI A;  3DD6 A;  1J5E E;  4DR4 I;  1Y6Z A;  3BGH A;  1TF6 A;  1UDO A;  2DMI A;  1Y4U A;  1T38 A;  3P3C A;  5AE2 A;  4PRX A;  2VF1 A;  2EMW A;  5F3W A;  2GO3 A;  4NXN I;  1N0U A;  3LNU A;  2EPO A;  4DR6 I;  3C6K A;  3B82 A;  3T1Y E;  3EPL A; 
#chains in the Genus database with same CATH homology
 5A2Q Q;  4WSP A;  4DV4 I;  2FTX B;  3VK6 A;  2E1R A;  1MU5 A;  4P7D A;  4P7A A;  2R3V A;  3HPZ A;  2CGE A;  1H73 A;  5AE3 A;  2AJ4 A;  3AV0 A;  2K4V A;  2NPF A;  1B62 A;  1Z5C A;  3LPS A;  5ADZ A;  1D6T A;  4GKJ E;  3F0N A;  3PYD A;  3J80 Q;  2Z5E A;  3FIG A;  1HNZ E;  2M7Q A;  2F8B A;  4JYA E;  4WUC A;  2KOU A;  4DV2 E;  2O1U A;  4KHP E;  4DV3 I;  2L3J A;  1XMQ I;  4JI6 I;  3JTZ A;  5LMU I;  2A2D A;  4DR1 E;  2VF3 A;  2UU9 I;  4IZJ A;  1N33 I;  1ZXN A;  4DV6 I;  1N32 E;  4JI2 E;  4JI7 I;  2VE7 C;  3M6A A;  3K6Q A;  3PYG A;  4B3M E;  4LF8 E;  1H74 A;  4DV5 I;  2J7K A;  4BCA A;  3QT6 A;  3LLH A;  4OX9 I;  3P1X A;  4HAC A;  1YZ9 A;  4BC9 A;  4AQY I;  1Z0T A;  3ADG A;  1HR0 I;  4DKK A;  3LML A;  2UXC I;  2E5L E;  4M30 A;  1I94 I;  4B3R E;  1H7S A;  3VYY A;  3OTO I;  5CFF E;  2BM0 A;  3PYE A;  4JI0 E;  2UUC I;  2O1V A;  3DF6 A;  4PU9 A;  2IOP A;  5GMD A;  2V87 A;  3Q6M A;  3PRY A;  4LF9 I;  4DPT A;  1NHH A;  2JWO A;  2V85 A;  4HYM A;  5BR8 E;  4USK A;  5GME A;  3LTO A;  3RMP A;  5AE1 A;  1MX0 A;  2HK2 A;  4GKK I;  3J81 Q;  4DR3 E;  1N36 I;  4X66 E;  3F6G A;  4F54 A;  4B3T I;  1XNQ I;  2N3G A;  2EZ6 A;  3B78 A;  3Q1Q A;  1IBK I;  3ZKD A;  3DJW A;  4DV0 I;  4IZK B;  1FI4 A;  2E1M A;  4DR4 E;  4JI5 I;  4LF6 I;  3F6H A;  5IT9 Q;  1XHK A;  2Q2E B;  4DR6 E;  4NXN E;  2V2V A;  2LTR A;  1I94 E;  2EFG A;  2V2Q A;  4K0K E;  1ZXM A;  3HJC A;  1YYW A;  1RQ0 A;  3J7Y p;  3ZOQ B;  4UT4 A;  4DV1 I;  5LMN I;  4DV4 E;  3ZKB A;  1WXR A;  3V5R A;  2B7T A;  3ADJ A;  4JV5 I;  2X7I A;  2V8Q B;  4NXM I;  1ZM3 A;  3ADL A;  4FWH A;  1DAR A;  1ZM2 A;  1PIE A;  4LF7 I;  4JI3 I;  4DR2 I;  1OJ4 A;  4URL A;  5IWA I;  2MC5 A;  1UEK A;  4JI1 I;  2ZM6 I;  2JOX A;  5DNY A;  4DPW A;  4DV3 E;  4KZS A;  2XEX A;  2UXB I;  2ODR C;  4JI6 E;  2MDR A;  5LMU E;  2IOQ A;  4I8O A;  4YY3 I;  1YYK A;  1IBL I;  1XMO I;  3J81 C;  2HHH I;  3IWD A;  2UU9 E;  3D4J A;  2OI2 A;  1N33 E;  5FWK A;  3C4B A;  2Z5C A;  3GON A;  4GEQ B;  4BBY A;  4JI7 E;  1HNW I;  2LUQ A;  2F4V I;  4DUY I;  2V2Z A;  2CPN A;  3J7A M;  4WFT A;  2NA2 A;  4DV5 E;  4N3O A;  3T1Y I;  5IT9 C;  4IZJ B;  2ODR D;  4LU9 A;  1N34 E;  4OX9 E;  2LRS A;  4DV7 I;  4DR5 I;  1Z0W A;  1EKZ A;  2LUP B;  2PNM A;  4M0V A;  4Q28 A;  4AQY E;  2L2K B;  1X49 A;  2HKJ A;  1HR0 E;  4DXL A;  4DR7 I;  2UXC E;  4TUG A;  1Z0V A;  3OTO E;  4HAC B;  2UXD I;  3HPS A;  4F9A B;  1EI1 A;  1WUU A;  4X64 I;  1X47 A;  3K85 A;  5A2Q C;  4P52 A;  4Z7Y A;  1H72 C;  3K1J A;  4LF9 E;  4JYA I;  3WU5 A;  4LFA I;  2FV4 B;  2V8P A;  2Z5B A;  5AAS A;  1DQ3 A;  2B9D A;  2FGG A;  2YT4 A;  4LFB I;  2NUF A;  4GKK E;  2RS6 A;  1N36 E;  2G7H A;  3IWB A;  2VQE E;  5FLX Q;  4F9C B;  3PYF A;  4B3T E;  1XNQ E;  3J80 C;  1RR9 A;  1WHN A;  2UUA I;  3WU3 A;  2L2M A;  2VQF I;  1IBK E;  2IHR 1;  4KQV A;  3WU6 A;  1J26 A;  2UUB I;  4JI8 I;  4R1F A;  4DV0 E;  1GQE A;  4FWD A;  4LFC I;  2H36 X;  2LTS A;  3KWR A;  4FN5 A;  4MYT A;  1U2R A;  1XNR I;  4DUZ I;  3QT8 A;  1DI2 A;  4IZJ D;  3IWC A;  4DPY A;  1BKN A;  4R8O A;  1PVG A;  5LMN E;  1H7U A;  1S4E A;  4JG4 A;  4WUB A;  4LF5 I;  2RSM A;  4Z7C A;  2DSY A;  4DPX A;  2JY9 A;  3V2U C;  3ZZT A;  4JV5 E;  1Z59 A;  4MYU A;  2PNL A;  4NXM E;  3AUZ A;  4DMI A;  2L92 A;  1HNX I;  1FNM A;  1GZ6 A;  2V83 A;  2ZBK B;  1ZM4 A;  1NZ0 A;  3J7A G;  4DPU A;  4K0K I;  1T4O A;  4LF7 E;  4HXZ A;  4JI3 E;  4LF4 I;  2WZO A;  3P06 A;  4DR2 E;  5IWA E;  2LE2 A;  1KVK A;  4L8N A;  4IZK A;  1N0V C;  1Z5A A;  4JI1 E;  4X65 I;  2ZM6 E;  4USM A;  3JU0 A;  4DR3 I;  1T4N A;  3HTX A;  3OML A;  4YY3 E;  1UHZ A;  2HHH E;  1XMO E;  1X48 A;  1A6F A;  4RPF A;  5FLX C;  2L2N A;  5LL6 R;  1Z5B A;  2JVA A;  1FJG I;  1HNW E;  1EA6 A;  1ELO A;  2GS8 A;  4BS9 A;  1IBM I;  2F4V E;  4DUY E;  4X62 I;  2EWL A;  1XMQ E;  3HXL A;  3T1H I;  4DV7 E;  4B3S I;  4DR5 E;  2Z5C B;  2V89 A;  4JI4 I;  4DV6 E;  2LMZ A;  4FW9 A;  2O1T A;  1J5E I;  3CWV A;  1WHQ A;  4DU7 A;  2M1S A;  2BV3 A;  2HFU A;  3B8H A;  4DR7 E;  4M2Z A;  4WYQ B;  4LTY A;  4YHH I;  5T6J A;  3H4L A;  2UXD E;  2DMY A;  1UIL A;  4X64 E;  4HY1 A;  2LJH A;  1NHI A;  2L8T A;  4R03 A;  3ZZU A;  2M4I A;  3C4T A;  4UTG A;  3QT5 A;  3Q6N A;  1PKP A;  4ZVI A;  4I3H A;  1KIJ A;  4LFA E;  4BMJ A;  2DEJ A;  2A2C A;  3MSW A;  4WUD A;  4GKJ I;  1SR9 A;  2BM1 A;  4PRV A;  2UUC E;  3QT7 A;  2CG9 A;  2R42 A;  2KHX A;  4LFB E;  4L5N C;  4BC7 A;  2DEI A;  1HNZ I;  2L3C A;  4ED4 A;  1USV A;  1FWK A;  1HK7 A;  1QZR A;  4FWG A;  4M1K A;  3HQ1 A;  2O1W A;  1RRE A;  4DV2 I;  2UUA E;  2Z5B B;  4KHP I;  5L3J A;  2V34 A;  2X36 A;  4X8W A;  2VQF E;  3JAM Q;  2UUB E;  4F9B B;  4JI8 E;  1Z0C A;  2JR1 A;  2HKE A;  1KKH A;  4DR1 I;  1Y4S A;  1N34 I;  4LFC E;  1NHJ A;  2RTX A;  1N32 I;  4DU8 A;  4JI2 I;  2WW4 A;  1XNR E;  4DUZ E;  2YZT A;  2LJP A;  2V88 A;  2L6M A;  2V86 A;  1STU A;  1FWL A;  2N3H A;  3ZZ0 A;  4B3M I;  4LF8 I;  1ZM9 A;  4XTJ A;  3K17 A;  2JOB A;  2LBS B;  2NUE A;  2CZ9 A;  2KON A;  4LF5 E;  1Z0G A;  2ZIT A;  4JI5 E;  4LF6 E;  2L33 A;  2DIX A;  1Z0E A;  3WU4 A;  4J8Z A;  4DV1 E;  4TUI A;  2HK3 A;  4EMD A;  1HNX E;  2E5L I;  4B3R I;  4OOG C;  4LF4 E;  4JI0 I;  1S16 A;  2DB2 A;  3VYX A;  1K47 A;  4X65 E;  1KTV A;  2VQE I;  1O0W A;  1B63 A;  2B7V A;  2HFS A;  1ZBQ A;  4WPY A;  5BR8 I;  1T4L B;  3HUL A;  1FKA E;  1FJG E;  1QU6 A;  3JAM C;  1YYO A;  1IBM E;  4X66 I;  4X62 E;  2UXB E;  1Z0B A;  3H09 A;  2RS7 A;  2MC6 A;  2GQ0 A;  1IBL E;  3T1H E;  4P78 A;  3ZM7 A;  3ADI A;  4B3S E;  2B3T B;  4JI4 E;  2NUG A;  1RC7 A;  1USU A;  1ZBT A;  1MG7 A;  1VIS A;  1J5E E;  4DR4 I;  1Y6Z A;  1Y4U A;  5AE2 A;  4PRX A;  2VF1 A;  5F3W A;  4NXN I;  4DR6 I;  1N0U A;  3LNU A;  4YHH E;  3B82 A;  3T1Y E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...