2PNZA

Crystal structure of the p. abyssi exosome rnase ph ring complexed with udp and gmp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
b'KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
total genus 76
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2pnzA01
2C38B 2PO1A 2WNRB 2WP8B 1R6MA 3DD6A 3GMEA 4BA2B 2C39B 2JEAB 4OO1D 2BR2B 3M7ND 3M85G 2C37A 4NBQA 5JEAB 4AIMA 1UDSA 2PNZA 1E3PA 2PO0A 3KRNA 2JEBB 5C0XC 3L7ZB 2JE6B 5C0XA 4AM3A 3GLLA 4IFDC 2NN6C 4OO1B 1OYRA 4BA1A 3M85D 4IFDD 2BA0G 2BA1G 4IFDA 4IFDE 2NN6A 5K36C 3CDIA 2PO2A 1UDQA 3B4TA 3U1KA 5K36A 4IFDF 2NN6F 2PO1B 5C0XD 1E3HA 5C0XE 2C38A 3HKMA 4IFDB 1OYPA 2C37B 2WNRA 4AIDA 2WP8A 2BA0D 2BA1D 2PNZB 5JEAC 5C0XF 2PO0B 2NN6D 4BA2A 2C39A 2JEAA 2NN6E 2BR2A 5JEAD 3GCMA 5JEAE 5JEAA 1UDNA 5K36D 5C0XB 5K36E 2JEBA 3L7ZA 1UDOA 1R6LA 5JEAF 2JE6A 4BA1B 4OO1C 3CDJA 5K36F 2NN6B 1OYSA 4OO1A 4OO1E 2PO2B 3M7NG 5K36B 3H1CA 4OO1F
chains in the Genus database with same CATH superfamily
2DEIA 2C38B 4IZJA 4R1FA 1IBKI 4DR1E 4X62E 2X36A 5FLXQ 2PO1A 4LF5E 1R6MA 3DD6A 3PYGA 4JI4E 5FWKA 2C39B 2O1WA 2JEAB 4IS9A 3K85A 2Z5BA 3Q6NA 4WUDA 2JT2A 4GKKI 3P76A 4DU7A 1H74A 3ZKDA 1E3PA 3PS2A 3L7ZB 4NXNE 1VI7A 3Q1QA 4DPXA 3JAMC 2BM1A 2UUAE 2E5LI 4DV5E 1BKNA 4MQYA 5LMNE 1KTVA 4LF8E 2O1VA 4JYAE 2NN6C 4OO1B 1MU5A 4DPWA 2A2CA 1H72C 2VQFE 3M85D 3K17A 2J65A 4K0KE 1Y6ZA 1XNQI 4IFDE 2NN6A 1I94E 3CWVA 1ZM3A 4Z7CA 4MU1A 2VQEE 5DRRA 2HHHI 3WU6A 2UU9I 2UXBE 4B3RI 4DV2E 4DR1I 1N34E 2NN6F 3OTOI 4DR5E 1IBMI 2F1DA 4JI7I 3HKMA 4LF9I 4WUCA 2O1TA 2WNRA 5L3JA 1N36I 3LPSA 4B3SI 4LFAI 5C0XF 4BA2A 4M1KA 3QT8A 2NN6E 4LOMA 2GO4A 3Q6MA 3B8HA 5JEAE 4DR6E 5LMUI 5C0XB 1N33I 2Z5CA 4DV3E 3QT7A 2JE6A 2UXCI 3ZZTA 4FW5A 4BA1B 4JI0I 1Y5YA 4LFBE 2UUCI 5K36F 1NHHA 4DUYI 1OYSA 4B3TE 4JI1I 1FWKA 4DV4I 1PIEA 4N3OA 1FWLA 5K36B 4FWHA 4LF4E 4U3DA 1J5EE 2VF3A 2V2ZA 4XTJA 2ZITA 4DV7E 4HYMA 2GO3A 4JI2I 4DV6E 1IBLI 2WP8B 5A2QC 4HACA 1EA6A 2ZBKB 1FJGI 2BR2B 4GKJE 3T1HE 2C37A 3M85G 4URLA 1USUA 1UDSA 4DV0I 1D6TA 5IT9C 4DPYA 5BR8I 1USVA 4LCHA 5LL6R 4DV3I 2ZM6I 1Z5AA 4FW4A 4DUZE 1HNWI 1A6FA 2HK2A 4AM3A 4GQUA 4IFDC 2PNLA 1ZXMA 4DR7E 1OYRA 4X66E 4NXMI 2V2VA 4IFDA 4LF7E 1XHKA 2O1UA 1HNXI 4PRVA 3CDIA 2GS8A 3P3EA 3J80C 2PO2A 2UUBI 3JAMQ 1HNZI 3J81C 5EKWA 1Z0VA 3H4LA 3B78A 4IZJB 4DV7I 1S4EA 4IFDF 3PRYA 2PO1B 1NZ0A 4YHHI 5IWAE 4JV5I 5ELWA 3V2UC 4YY3E 2Z5BB 4IFDB 3PYFA 1ZXNA 5DROA 5EL9A 2VESA 2BA0D 3T1HI 1PVGA 5JEAC 1Z5CA 4DR2E 2V8PA 4DV1E 1Z59A 4DU8A 1XMOI 4KHPE 3WU4A 4X65I 4DR3I 4LCFA 2IESA 5JEAA 1Z0CA 4UTGA 4B3ME 4OX9E 2IOPA 4LF6E 2X7IA 2JEBA 2Z5EA 3WU3A 4X62I 4LFCE 4QNKA 3PS3A 5JEAF 1OJ4A 4LF5I 4JI4I 1N0UA 1Z0BA 3V5RA 3K1JA 4AQYE 2NN6B 2HFUA 4OO1E 4USKA 4DR4E 4MYTA 4JI3E 4MU4A 4UT4A 3QT5A 4NXNI 1XNRE 3H1CA 2UXDE 2HK3A 5DNLA 2UUAI 3QT6A 1KIJA 4PU9A 4DV5I 3T1YE 5LMNI 2BM0A 4X64E 4LF8I 2WNRB 4YY3I 1XMQE 4JYAI 4LCGA 4FW3A 4HXZA 2HKJA 4BA2B 1K47A 2VQFI 3ZM7A 1FI4A 4JI8E 2F4VE 4K0KI 4OO1D 4U3BA 3M7ND 4LPFA 1I94I 4NBQA 1U2RA 1KKHA 1Z0WA 2PNZA 2VQEI 2PO0A 1Y60A 3KRNA 1HR0E 2BV3A 2UXBI 2Z5CB 2E1RA 4DV2I 1N34I 1ELOA 2AJ4A 4DR5I 1N32E 2JE6B 5A2QQ 4JI6E 4OZEA 2EFGA 3B82A 1IBKE 1MG7A 2HKEA 4DPUA 5DRQA 4P52A 3LNUA 1Z0TA 2HFSA 5IT9Q 2BA0G 3M6AA 1Z0GA 4P7AA 4Z7YA 4GKKE 3PYDA 4ISAA 2A2DA 2AE8A 2LJPA 1NHJA 4DR6I 1ZM4A 1UDQA 1P42A 3B4TA 3U1KA 1H7UA 5DNXA 5C0XD 2CG9A 3NZKA 3P06A 2E5LE 4HACB 2C38A 4FWDA 4LFBI 3ZZ0A 4AIDA 2C37B 2WW4A 2XEXA 4B3TI 3J7AM 1EI1A 2BA1D 1DARA 3J80Q 2C39A 3J81Q 2JEAA 1XNQE 1KVKA 1YH8A 3GCMA 4LF4I 2IOQA 1N0VC 2HHHE 1J5EI 2UU9E 5K36D 3PS1A 4ED4A 4B3RE 2GQ0A 3L7ZA 1UDOA 3GONA 3OTOE 3UHMA 4WUBA 4DV6I 1R6LA 1IBME 1S16A 4OO1C 4JI7E 4DPTA 4LF9E 5FLXC 2PNMA 3D4JA 4USMA 4FW6A 4GKJI 4MU3A 4OO1A 1N36E 2CGEA 3HULA 4B3SE 2PO2B 2V2QA 1B63A 1VISA 4FW7A 4LFAE 3M7NG 2CZ9A 4QNJA 1Y4UA 2OI2A 3J7AG 1Z0EA 4OO1F 5LMUE 1N33E 4MU0A 2V34A 4IZKA 4DUZI 1ZM9A 4MDTA 1YHCA 2UXCE 5DRPA 1PKPA 4DR7I 3LTOA 4X66I 4JI0E 3GMEA 2UUCE 4JI5E 2NPFA 4FN5A 4DUYE 4LF7I 2R42A 1RREA 3HJCA 4AIMA 5JEAB 4JI1E 4J3DA 4DV4E 1FNMA 2DEJA 2JEBB 5C0XC 4IZKB 1H7SA 4IZJD 5C0XA 5GMDA 5IWAI 3U1YA 2IERA 3GLLA 4JI2E 1IBLE 5GMEA 1ZM2A 4BA1A 3P3GA 4DR2I 4IFDD 4DV1I 1FJGE 1WUUA 2BA1G 3P3CA 1QZRA 4KHPI 2Q2EB 1Z5BA 5K36C 4DV0E 3ZKBA 4B3MI 5BR8E 4OX9I 3F0NA 4LF6I 4KQVA 5K36A 1FKAE 1E3HA 4LFCI 2ZM6E 5C0XE 2R3VA 1HNWE 4AQYI 1XXEA 4JI5I 4EMDA 1OYPA 3PYEA 2WP8A 4HY1A 2PNZB 3ZZUA 4DR4I 4JG4A 4NXME 2J7KA 2NN6D 4FWGA 2PO0B 4FW9A 4JI3I 2BR2A 5JEAD 1HNXE 3WU5A 4ZVIA 1UDNA 2UUBE 1XNRI 1HNZE 1B62A 2UXDI 1H73A 5K36E 3T1YI 1NHIA 4X64I 1XMQI 4MYUA 1Y4SA 4YHHE 4JV5E 3CDJA 4JI8I 2O3ZA 4DXLA 2F4VI 1HK7A 4RPFA 1HR0I 1XMOE 4I3HA 1RR9A 1RHYA 1UEKA 4OKGA 4X65E 4DR3E 4PRXA 2CVEA 1MX0A 1N32I 4JI6I
chains in the Genus database with same CATH topology
2C38B 2PO1A 2WNRB 2WP8B 1R6MA 3DD6A 3GMEA 4BA2B 2C39B 2JEAB 4OO1D 2BR2B 3M7ND 3M85G 2C37A 4NBQA 5JEAB 4AIMA 1UDSA 2PNZA 1E3PA 2PO0A 3KRNA 2JEBB 5C0XC 3L7ZB 2JE6B 5C0XA 4AM3A 3GLLA 4IFDC 2NN6C 4OO1B 1OYRA 4BA1A 3M85D 4IFDD 2BA0G 2BA1G 4IFDA 4IFDE 2NN6A 5K36C 3CDIA 2PO2A 1UDQA 3B4TA 3U1KA 5K36A 4IFDF 2NN6F 2PO1B 5C0XD 1E3HA 5C0XE 2C38A 3HKMA 4IFDB 1OYPA 2C37B 2WNRA 4AIDA 2WP8A 2BA0D 2BA1D 2PNZB 5JEAC 5C0XF 2PO0B 2NN6D 4BA2A 2C39A 2JEAA 2NN6E 2BR2A 5JEAD 3GCMA 5JEAE 5JEAA 1UDNA 5K36D 5C0XB 5K36E 2JEBA 3L7ZA 1UDOA 1R6LA 5JEAF 2JE6A 4BA1B 4OO1C 3CDJA 5K36F 2NN6B 1OYSA 4OO1A 4OO1E 2PO2B 3M7NG 5K36B 3H1CA 4OO1F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C38 B;  2PO1 A;  2WNR B;  2WP8 B;  1R6M A;  3DD6 A;  3GME A;  4BA2 B;  2C39 B;  2JEA B;  4OO1 D;  2BR2 B;  3M7N D;  3M85 G;  2C37 A;  4NBQ A;  5JEA B;  4AIM A;  1UDS A;  2PNZ A;  1E3P A;  2PO0 A;  3KRN A;  2JEB B;  5C0X C;  3L7Z B;  2JE6 B;  5C0X A;  4AM3 A;  3GLL A;  4IFD C;  2NN6 C;  4OO1 B;  1OYR A;  4BA1 A;  3M85 D;  4IFD D;  2BA0 G;  2BA1 G;  4IFD A;  4IFD E;  2NN6 A;  5K36 C;  3CDI A;  2PO2 A;  1UDQ A;  3B4T A;  3U1K A;  5K36 A;  4IFD F;  2NN6 F;  2PO1 B;  5C0X D;  1E3H A;  5C0X E;  2C38 A;  3HKM A;  4IFD B;  1OYP A;  2C37 B;  2WNR A;  4AID A;  2WP8 A;  2BA0 D;  2BA1 D;  2PNZ B;  5JEA C;  5C0X F;  2PO0 B;  2NN6 D;  4BA2 A;  2C39 A;  2JEA A;  2NN6 E;  2BR2 A;  5JEA D;  3GCM A;  5JEA E;  5JEA A;  1UDN A;  5K36 D;  5C0X B;  5K36 E;  2JEB A;  3L7Z A;  1UDO A;  1R6L A;  5JEA F;  2JE6 A;  4BA1 B;  4OO1 C;  3CDJ A;  5K36 F;  2NN6 B;  1OYS A;  4OO1 A;  4OO1 E;  2PO2 B;  3M7N G;  5K36 B;  3H1C A;  4OO1 F; 
#chains in the Genus database with same CATH topology
 2DEI A;  2C38 B;  4IZJ A;  4R1F A;  1IBK I;  4DR1 E;  4X62 E;  2X36 A;  5FLX Q;  2PO1 A;  4LF5 E;  1R6M A;  3DD6 A;  3PYG A;  4JI4 E;  5FWK A;  2C39 B;  2O1W A;  2JEA B;  4IS9 A;  3K85 A;  2Z5B A;  3Q6N A;  4WUD A;  2JT2 A;  4GKK I;  3P76 A;  4DU7 A;  1H74 A;  3ZKD A;  1E3P A;  3PS2 A;  3L7Z B;  4NXN E;  1VI7 A;  3Q1Q A;  4DPX A;  3JAM C;  2BM1 A;  2UUA E;  2E5L I;  4DV5 E;  1BKN A;  4MQY A;  5LMN E;  1KTV A;  4LF8 E;  2O1V A;  4JYA E;  2NN6 C;  4OO1 B;  1MU5 A;  4DPW A;  2A2C A;  1H72 C;  2VQF E;  3M85 D;  3K17 A;  2J65 A;  4K0K E;  1Y6Z A;  1XNQ I;  4IFD E;  2NN6 A;  1I94 E;  3CWV A;  1ZM3 A;  4Z7C A;  4MU1 A;  2VQE E;  5DRR A;  2HHH I;  3WU6 A;  2UU9 I;  2UXB E;  4B3R I;  4DV2 E;  4DR1 I;  1N34 E;  2NN6 F;  3OTO I;  4DR5 E;  1IBM I;  2F1D A;  4JI7 I;  3HKM A;  4LF9 I;  4WUC A;  2O1T A;  2WNR A;  5L3J A;  1N36 I;  3LPS A;  4B3S I;  4LFA I;  5C0X F;  4BA2 A;  4M1K A;  3QT8 A;  2NN6 E;  4LOM A;  2GO4 A;  3Q6M A;  3B8H A;  5JEA E;  4DR6 E;  5LMU I;  5C0X B;  1N33 I;  2Z5C A;  4DV3 E;  3QT7 A;  2JE6 A;  2UXC I;  3ZZT A;  4FW5 A;  4BA1 B;  4JI0 I;  1Y5Y A;  4LFB E;  2UUC I;  5K36 F;  1NHH A;  4DUY I;  1OYS A;  4B3T E;  4JI1 I;  1FWK A;  4DV4 I;  1PIE A;  4N3O A;  1FWL A;  5K36 B;  4FWH A;  4LF4 E;  4U3D A;  1J5E E;  2VF3 A;  2V2Z A;  4XTJ A;  2ZIT A;  4DV7 E;  4HYM A;  2GO3 A;  4JI2 I;  4DV6 E;  1IBL I;  2WP8 B;  5A2Q C;  4HAC A;  1EA6 A;  2ZBK B;  1FJG I;  2BR2 B;  4GKJ E;  3T1H E;  2C37 A;  3M85 G;  4URL A;  1USU A;  1UDS A;  4DV0 I;  1D6T A;  5IT9 C;  4DPY A;  5BR8 I;  1USV A;  4LCH A;  5LL6 R;  4DV3 I;  2ZM6 I;  1Z5A A;  4FW4 A;  4DUZ E;  1HNW I;  1A6F A;  2HK2 A;  4AM3 A;  4GQU A;  4IFD C;  2PNL A;  1ZXM A;  4DR7 E;  1OYR A;  4X66 E;  4NXM I;  2V2V A;  4IFD A;  4LF7 E;  1XHK A;  2O1U A;  1HNX I;  4PRV A;  3CDI A;  2GS8 A;  3P3E A;  3J80 C;  2PO2 A;  2UUB I;  3JAM Q;  1HNZ I;  3J81 C;  5EKW A;  1Z0V A;  3H4L A;  3B78 A;  4IZJ B;  4DV7 I;  1S4E A;  4IFD F;  3PRY A;  2PO1 B;  1NZ0 A;  4YHH I;  5IWA E;  4JV5 I;  5ELW A;  3V2U C;  4YY3 E;  2Z5B B;  4IFD B;  3PYF A;  1ZXN A;  5DRO A;  5EL9 A;  2VES A;  2BA0 D;  3T1H I;  1PVG A;  5JEA C;  1Z5C A;  4DR2 E;  2V8P A;  4DV1 E;  1Z59 A;  4DU8 A;  1XMO I;  4KHP E;  3WU4 A;  4X65 I;  4DR3 I;  4LCF A;  2IES A;  5JEA A;  1Z0C A;  4UTG A;  4B3M E;  4OX9 E;  2IOP A;  4LF6 E;  2X7I A;  2JEB A;  2Z5E A;  3WU3 A;  4X62 I;  4LFC E;  4QNK A;  3PS3 A;  5JEA F;  1OJ4 A;  4LF5 I;  4JI4 I;  1N0U A;  1Z0B A;  3V5R A;  3K1J A;  4AQY E;  2NN6 B;  2HFU A;  4OO1 E;  4USK A;  4DR4 E;  4MYT A;  4JI3 E;  4MU4 A;  4UT4 A;  3QT5 A;  4NXN I;  1XNR E;  3H1C A;  2UXD E;  2HK3 A;  5DNL A;  2UUA I;  3QT6 A;  1KIJ A;  4PU9 A;  4DV5 I;  3T1Y E;  5LMN I;  2BM0 A;  4X64 E;  4LF8 I;  2WNR B;  4YY3 I;  1XMQ E;  4JYA I;  4LCG A;  4FW3 A;  4HXZ A;  2HKJ A;  4BA2 B;  1K47 A;  2VQF I;  3ZM7 A;  1FI4 A;  4JI8 E;  2F4V E;  4K0K I;  4OO1 D;  4U3B A;  3M7N D;  4LPF A;  1I94 I;  4NBQ A;  1U2R A;  1KKH A;  1Z0W A;  2PNZ A;  2VQE I;  2PO0 A;  1Y60 A;  3KRN A;  1HR0 E;  2BV3 A;  2UXB I;  2Z5C B;  2E1R A;  4DV2 I;  1N34 I;  1ELO A;  2AJ4 A;  4DR5 I;  1N32 E;  2JE6 B;  5A2Q Q;  4JI6 E;  4OZE A;  2EFG A;  3B82 A;  1IBK E;  1MG7 A;  2HKE A;  4DPU A;  5DRQ A;  4P52 A;  3LNU A;  1Z0T A;  2HFS A;  5IT9 Q;  2BA0 G;  3M6A A;  1Z0G A;  4P7A A;  4Z7Y A;  4GKK E;  3PYD A;  4ISA A;  2A2D A;  2AE8 A;  2LJP A;  1NHJ A;  4DR6 I;  1ZM4 A;  1UDQ A;  1P42 A;  3B4T A;  3U1K A;  1H7U A;  5DNX A;  5C0X D;  2CG9 A;  3NZK A;  3P06 A;  2E5L E;  4HAC B;  2C38 A;  4FWD A;  4LFB I;  3ZZ0 A;  4AID A;  2C37 B;  2WW4 A;  2XEX A;  4B3T I;  3J7A M;  1EI1 A;  2BA1 D;  1DAR A;  3J80 Q;  2C39 A;  3J81 Q;  2JEA A;  1XNQ E;  1KVK A;  1YH8 A;  3GCM A;  4LF4 I;  2IOQ A;  1N0V C;  2HHH E;  1J5E I;  2UU9 E;  5K36 D;  3PS1 A;  4ED4 A;  4B3R E;  2GQ0 A;  3L7Z A;  1UDO A;  3GON A;  3OTO E;  3UHM A;  4WUB A;  4DV6 I;  1R6L A;  1IBM E;  1S16 A;  4OO1 C;  4JI7 E;  4DPT A;  4LF9 E;  5FLX C;  2PNM A;  3D4J A;  4USM A;  4FW6 A;  4GKJ I;  4MU3 A;  4OO1 A;  1N36 E;  2CGE A;  3HUL A;  4B3S E;  2PO2 B;  2V2Q A;  1B63 A;  1VIS A;  4FW7 A;  4LFA E;  3M7N G;  2CZ9 A;  4QNJ A;  1Y4U A;  2OI2 A;  3J7A G;  1Z0E A;  4OO1 F;  5LMU E;  1N33 E;  4MU0 A;  2V34 A;  4IZK A;  4DUZ I;  1ZM9 A;  4MDT A;  1YHC A;  2UXC E;  5DRP A;  1PKP A;  4DR7 I;  3LTO A;  4X66 I;  4JI0 E;  3GME A;  2UUC E;  4JI5 E;  2NPF A;  4FN5 A;  4DUY E;  4LF7 I;  2R42 A;  1RRE A;  3HJC A;  4AIM A;  5JEA B;  4JI1 E;  4J3D A;  4DV4 E;  1FNM A;  2DEJ A;  2JEB B;  5C0X C;  4IZK B;  1H7S A;  4IZJ D;  5C0X A;  5GMD A;  5IWA I;  3U1Y A;  2IER A;  3GLL A;  4JI2 E;  1IBL E;  5GME A;  1ZM2 A;  4BA1 A;  3P3G A;  4DR2 I;  4IFD D;  4DV1 I;  1FJG E;  1WUU A;  2BA1 G;  3P3C A;  1QZR A;  4KHP I;  2Q2E B;  1Z5B A;  5K36 C;  4DV0 E;  3ZKB A;  4B3M I;  5BR8 E;  4OX9 I;  3F0N A;  4LF6 I;  4KQV A;  5K36 A;  1FKA E;  1E3H A;  4LFC I;  2ZM6 E;  5C0X E;  2R3V A;  1HNW E;  4AQY I;  1XXE A;  4JI5 I;  4EMD A;  1OYP A;  3PYE A;  2WP8 A;  4HY1 A;  2PNZ B;  3ZZU A;  4DR4 I;  4JG4 A;  4NXM E;  2J7K A;  2NN6 D;  4FWG A;  2PO0 B;  4FW9 A;  4JI3 I;  2BR2 A;  5JEA D;  1HNX E;  3WU5 A;  4ZVI A;  1UDN A;  2UUB E;  1XNR I;  1HNZ E;  1B62 A;  2UXD I;  1H73 A;  5K36 E;  3T1Y I;  1NHI A;  4X64 I;  1XMQ I;  4MYU A;  1Y4S A;  4YHH E;  4JV5 E;  3CDJ A;  4JI8 I;  2O3Z A;  4DXL A;  2F4V I;  1HK7 A;  4RPF A;  1HR0 I;  1XMO E;  4I3H A;  1RR9 A;  1RHY A;  1UEK A;  4OKG A;  4X65 E;  4DR3 E;  4PRX A;  2CVE A;  1MX0 A;  1N32 I;  4JI6 I; 
#chains in the Genus database with same CATH homology
 2C38 B;  2PO1 A;  2WNR B;  2WP8 B;  1R6M A;  3DD6 A;  3GME A;  4BA2 B;  2C39 B;  2JEA B;  4OO1 D;  2BR2 B;  3M7N D;  3M85 G;  2C37 A;  4NBQ A;  5JEA B;  4AIM A;  1UDS A;  2PNZ A;  1E3P A;  2PO0 A;  3KRN A;  2JEB B;  5C0X C;  3L7Z B;  2JE6 B;  5C0X A;  4AM3 A;  3GLL A;  4IFD C;  2NN6 C;  4OO1 B;  1OYR A;  4BA1 A;  3M85 D;  4IFD D;  2BA0 G;  2BA1 G;  4IFD A;  4IFD E;  2NN6 A;  5K36 C;  3CDI A;  2PO2 A;  1UDQ A;  3B4T A;  3U1K A;  5K36 A;  4IFD F;  2NN6 F;  2PO1 B;  5C0X D;  1E3H A;  5C0X E;  2C38 A;  3HKM A;  4IFD B;  1OYP A;  2C37 B;  2WNR A;  4AID A;  2WP8 A;  2BA0 D;  2BA1 D;  2PNZ B;  5JEA C;  5C0X F;  2PO0 B;  2NN6 D;  4BA2 A;  2C39 A;  2JEA A;  2NN6 E;  2BR2 A;  5JEA D;  3GCM A;  5JEA E;  5JEA A;  1UDN A;  5K36 D;  5C0X B;  5K36 E;  2JEB A;  3L7Z A;  1UDO A;  1R6L A;  5JEA F;  2JE6 A;  4BA1 B;  4OO1 C;  3CDJ A;  5K36 F;  2NN6 B;  1OYS A;  4OO1 A;  4OO1 E;  2PO2 B;  3M7N G;  5K36 B;  3H1C A;  4OO1 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...