2PNZA

Crystal structure of the p. abyssi exosome rnase ph ring complexed with udp and gmp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 76
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2pnzA01
2PO1B 5K36C 4OO1E 4AIDA 2PNZB 2C37B 2NN6E 2WNRB 2C39A 3H1CA 4OO1D 3M7ND 3M85G 5C0XF 2BR2A 2NN6C 2BA0G 4IFDB 4AIMA 5C0XA 2JEAA 2PO1A 2JEBB 5C0XE 2PNZA 2C37A 1UDNA 4NBQA 5C0XD 4IFDF 4BA1B 2WP8B 4IFDA 2JEBA 4AM3A 4OO1C 3KRNA 1UDOA 5JEAB 3L7ZB 2C38B 4IFDD 5K36B 4BA1A 2WP8A 5JEAF 2BA1G 2WNRA 1R6LA 5C0XC 4OO1B 4BA2B 5JEAA 3GLLA 3L7ZA 5K36F 2NN6B 2C38A 1UDQA 3GMEA 5JEAE 3U1KA 2JE6B 4IFDE 5K36A 5JEAD 1E3HA 1OYRA 2PO0B 1OYSA 1E3PA 2NN6F 3CDJA 4IFDC 3M7NG 3M85D 1R6MA 3DD6A 5K36D 2PO2B 2NN6A 2BA0D 3HKMA 2JE6A 1UDSA 1OYPA 2PO0A 2NN6D 2BA1D 3GCMA 5C0XB 2C39B 4OO1F 3CDIA 2PO2A 5JEAC 2BR2B 5K36E 3B4TA 4OO1A 4BA2A 2JEAB
chains in the Genus database with same CATH superfamily
5DRRA 4DPXA 4AIDA 1N36E 2UUCI 3ZZTA 2C37B 4DPTA 5LMUE 5BR8I 4GKKI 1XNRE 2LJPA 2BR2A 2BM0A 1OJ4A 1RR9A 4Z7YA 3WU6A 5LMNE 4MYUA 2NN6C 1XMQE 2BA0G 5C0XA 1FKAE 3OTOE 2UU9I 1HNXI 4B3ME 4XTJA 4R1FA 4LCHA 3B82A 2ZM6I 1I94E 4LCGA 4DV7I 3J80C 4JI0I 1XNQI 1UDNA 3ZZ0A 1Z0GA 2VQFI 4IZKB 4FW5A 1ELOA 2V2VA 1Y4UA 4LFBI 2WP8B 4JI2E 3J81Q 4IFDA 1QZRA 2ZITA 4JI1I 2JEBA 4AM3A 4K0KI 2UUAI 1UDOA 5JEAB 1HNWI 4DR7I 4JYAE 2UXBE 4J3DA 2UUCE 3QT6A 4BA1A 5BR8E 4GKKE 1PVGA 4DV0I 5EKWA 5JEAF 4YY3I 1KKHA 1BKNA 4DU8A 4DR5I 2F1DA 4FW7A 4OO1B 3GLLA 4PRVA 2UU9E 2Z5BA 1HNXE 2C38A 5JEAE 3GONA 2ZM6E 4DV7E 2Q2EB 4JI0E 1XNQE 1MX0A 5K36A 4LCFA 3H4LA 2VQFE 3PYEA 4WUDA 3PYDA 1ZXNA 5JEAD 4OX9I 1OYSA 1EI1A 2O1VA 4FN5A 4HACA 1IBKI 3J80Q 4JI7I 4LFBE 1ZM4A 2O1WA 5FWKA 1Z0EA 1FI4A 2PO2B 2HHHI 4JI1E 2PNMA 4X62I 4K0KE 2UUAE 1HNWE 4DR7E 1FJGI 4IS9A 2BV3A 3WU5A 4M1KA 1NHIA 1P42A 1NZ0A 2BA1D 1Z0CA 4ZVIA 4GKJI 1PIEA 4JI3I 4DV0E 5DNXA 2X7IA 2GQ0A 4YY3E 4P52A 3CDIA 5JEAC 4DR5E 3V2UC 4JI4I 1KIJA 1VISA 2PO1B 2GS8A 2JT2A 3B78A 4MDTA 3P3EA 2IOQA 2PNZB 2GO3A 4X64I 2NN6E 2JEAB 2OI2A 1FNMA 1YH8A 4OX9E 4IZJB 3H1CA 2GO4A 1IBKE 4JI7E 1N33I 2HK2A 2R3VA 1FWKA 3K17A 2HHHE 4X62E 3U1YA 4LF5I 5DRPA 1USVA 2HFSA 3JAMQ 5ELWA 5A2QC 1ZM2A 1FJGE 4JI8I 1U2RA 3F0NA 1YHCA 2O1UA 3D4JA 5LL6R 1J5EE 4GKJE 1N32I 4JI3E 2UXDE 4X65E 3K85A 4LPFA 4IZJD 4JI4E 3KRNA 1Y4SA 1WUUA 5DROA 1HNZI 1XMOI 3PYGA 3Q1QA 4PU9A 3UHMA 4MU0A 2IERA 1Z0BA 4N3OA 4DPWA 4X64E 5IT9C 1ZXMA 2WNRA 1N33E 4DR4I 2Z5EA 3L7ZA 4DPYA 4LF5E 2CZ9A 1PKPA 3P76A 2E5LI 3Q6NA 4LF9E 1MU5A 1MG7A 2HK3A 4DXLA 4JI8E 1Y6ZA 1USUA 1ZM3A 4DU7A 4DR3E 4JI5I 1NHHA 3M6AA 1N32E 1KTVA 1Z59A 5A2QQ 3PS2A 2E1RA 3M7NG 3M85D 1Z5BA 2NN6A 4PRXA 2Z5CB 3P3CA 2JE6A 1NHJA 1HNZE 1XMOE 4DV6I 4NXMI 1VI7A 2PO0A 2O3ZA 4YHHI 2F4VI 3GCMA 5IWAI 2NPFA 4LFAI 4FW3A 2X36A 4OO1F 2BR2B 4FWDA 4DPUA 4P7AA 4DR4E 5IT9Q 5C0XB 2XEXA 4MYTA 1D6TA 2E5LE 4EMDA 4OO1E 3QT5A 4UT4A 1HK7A 2WNRB 2C39A 4HXZA 4DV3I 4JI5E 4OO1D 4DUYI 1Z5CA 5C0XF 3ZM7A 1J5EI 4JG4A 4NXNI 4IFDB 4USKA 2JEAA 2UXDI 2JEBB 1H74A 3PS3A 5C0XE 5EL9A 5FLXC 2C37A 1Z0VA 4DV6E 3CWVA 2A2DA 4NXME 5C0XD 1Z0WA 4IFDF 2ZBKB 4YHHE 2F4VE 4BA1B 4HYMA 2HKEA 1KVKA 1RREA 5IWAE 4LFAE 4DR2I 3T1YI 1ZM9A 4LF6I 3Q6MA 4OO1C 4MU3A 2Z5BB 2VESA 2V34A 2C38B 4DV5E 4IZKA 4IFDD 1UEKA 4U3BA 2WW4A 5K36B 4FWGA 4Z7CA 2WP8A 4DV3E 1XXEA 4DUYE 3LTOA 1Z0TA 1R6LA 4HACB 4LF7I 3LPSA 4DR3I 5C0XC 3WU3A 4FW6A 2AE8A 3PYFA 5JEAA 3HULA 4NXNE 3J81C 4USMA 1H73A 4DUZI 5K36F 1UDQA 4RPFA 5DNLA 3U1KA 1K47A 3WU4A 4MU1A 4DV1I 2V2ZA 1E3HA 4IFDC 5FLXQ 1A6FA 4DR2E 1R6MA 3T1YE 2HFUA 3DD6A 5K36D 4LF6E 2BA0D 3HKMA 4DR1I 1UDSA 4WUCA 2J7KA 3NZKA 3P06A 4DR6I 1B63A 1HR0I 3V5RA 4KQVA 4KHPI 2PO2A 4LF7E 3B4TA 4DV2I 1EA6A 4OKGA 1IBME 3P3GA 4BA2A 4DUZE 2VQEI 4AQYI 5K36C 3QT8A 2R42A 2A2CA 4FW4A 4U3DA 2V2QA 2PNLA 4DV1E 4LOMA 4B3TI 1N34I 4ISAA 1IBLI 2UUBI 2J65A 3M7ND 3M85G 4MQYA 4QNJA 1RHYA 4B3SI 4GQUA 3ZZUA 2IESA 3ZKDA 1B62A 4URLA 4B3RI 4AIMA 2IOPA 3K1JA 5L3JA 2PO1A 4UTGA 4DR1E 2PNZA 4OZEA 2DEIA 4JI6I 4IZJA 4NBQA 1FWLA 3PS1A 3B8HA 1S4EA 4DR6E 4DV5I 4JV5I 1HR0E 3T1HI 4KHPE 2CVEA 4LF4I 4DV2E 3L7ZB 4MU4A 2VQEE 4X66I 4AQYE 4HY1A 2UXCI 3JAMC 2CGEA 1H7SA 4B3TE 2BM1A 1N34E 1Y60A 1IBLE 2UUBE 2BA1G 1Z5AA 4B3SE 1N0UA 3HJCA 4LFCI 4BA2B 4QNKA 4LF8I 4B3RE 4X65I 4DV4I 1DARA 2NN6B 1XNRI 2HKJA 3GMEA 4FWHA 4LF9I 1N36I 2EFGA 2JE6B 4IFDE 2VF3A 2O1TA 5LMUI 4JI6E 5GMDA 2V8PA 1OYRA 4FW9A 2PO0B 5DRQA 3PRYA 4JV5E 1E3PA 2NN6F 3CDJA 5LMNI 4WUBA 1XMQI 5GMEA 3T1HE 2AJ4A 3OTOI 4B3MI 4LF4E 2DEJA 3LNUA 1I94I 1Y5YA 3J7AG 1H7UA 3QT7A 1OYPA 1IBMI 4I3HA 4X66E 1N0VC 2UXCE 2NN6D 3J7AM 2CG9A 1XHKA 2C39B 1H72C 4JI2I 5K36E 2Z5CA 4LFCE 4LF8E 2UXBI 4JYAI 4OO1A 3ZKBA 4DV4E 4ED4A 1S16A
chains in the Genus database with same CATH topology
2PO1B 5K36C 4OO1E 4AIDA 2PNZB 2C37B 2NN6E 2WNRB 2C39A 3H1CA 4OO1D 3M7ND 3M85G 5C0XF 2BR2A 2NN6C 2BA0G 4IFDB 4AIMA 5C0XA 2JEAA 2PO1A 2JEBB 5C0XE 2PNZA 2C37A 1UDNA 4NBQA 5C0XD 4IFDF 4BA1B 2WP8B 4IFDA 2JEBA 4AM3A 4OO1C 3KRNA 1UDOA 5JEAB 3L7ZB 2C38B 4IFDD 5K36B 4BA1A 2WP8A 5JEAF 2BA1G 2WNRA 1R6LA 5C0XC 4OO1B 4BA2B 5JEAA 3GLLA 3L7ZA 5K36F 2NN6B 2C38A 1UDQA 3GMEA 5JEAE 3U1KA 2JE6B 4IFDE 5K36A 5JEAD 1E3HA 1OYRA 2PO0B 1OYSA 1E3PA 2NN6F 3CDJA 4IFDC 3M7NG 3M85D 1R6MA 3DD6A 5K36D 2PO2B 2NN6A 2BA0D 3HKMA 2JE6A 1UDSA 1OYPA 2PO0A 2NN6D 2BA1D 3GCMA 5C0XB 2C39B 4OO1F 3CDIA 2PO2A 5JEAC 2BR2B 5K36E 3B4TA 4OO1A 4BA2A 2JEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PO1 B;  5K36 C;  4OO1 E;  4AID A;  2PNZ B;  2C37 B;  2NN6 E;  2WNR B;  2C39 A;  3H1C A;  4OO1 D;  3M7N D;  3M85 G;  5C0X F;  2BR2 A;  2NN6 C;  2BA0 G;  4IFD B;  4AIM A;  5C0X A;  2JEA A;  2PO1 A;  2JEB B;  5C0X E;  2PNZ A;  2C37 A;  1UDN A;  4NBQ A;  5C0X D;  4IFD F;  4BA1 B;  2WP8 B;  4IFD A;  2JEB A;  4AM3 A;  4OO1 C;  3KRN A;  1UDO A;  5JEA B;  3L7Z B;  2C38 B;  4IFD D;  5K36 B;  4BA1 A;  2WP8 A;  5JEA F;  2BA1 G;  2WNR A;  1R6L A;  5C0X C;  4OO1 B;  4BA2 B;  5JEA A;  3GLL A;  3L7Z A;  5K36 F;  2NN6 B;  2C38 A;  1UDQ A;  3GME A;  5JEA E;  3U1K A;  2JE6 B;  4IFD E;  5K36 A;  5JEA D;  1E3H A;  1OYR A;  2PO0 B;  1OYS A;  1E3P A;  2NN6 F;  3CDJ A;  4IFD C;  3M7N G;  3M85 D;  1R6M A;  3DD6 A;  5K36 D;  2PO2 B;  2NN6 A;  2BA0 D;  3HKM A;  2JE6 A;  1UDS A;  1OYP A;  2PO0 A;  2NN6 D;  2BA1 D;  3GCM A;  5C0X B;  2C39 B;  4OO1 F;  3CDI A;  2PO2 A;  5JEA C;  2BR2 B;  5K36 E;  3B4T A;  4OO1 A;  4BA2 A;  2JEA B; 
#chains in the Genus database with same CATH topology
 5DRR A;  4DPX A;  4AID A;  1N36 E;  2UUC I;  3ZZT A;  2C37 B;  4DPT A;  5LMU E;  5BR8 I;  4GKK I;  1XNR E;  2LJP A;  2BR2 A;  2BM0 A;  1OJ4 A;  1RR9 A;  4Z7Y A;  3WU6 A;  5LMN E;  4MYU A;  2NN6 C;  1XMQ E;  2BA0 G;  5C0X A;  1FKA E;  3OTO E;  2UU9 I;  1HNX I;  4B3M E;  4XTJ A;  4R1F A;  4LCH A;  3B82 A;  2ZM6 I;  1I94 E;  4LCG A;  4DV7 I;  3J80 C;  4JI0 I;  1XNQ I;  1UDN A;  3ZZ0 A;  1Z0G A;  2VQF I;  4IZK B;  4FW5 A;  1ELO A;  2V2V A;  1Y4U A;  4LFB I;  2WP8 B;  4JI2 E;  3J81 Q;  4IFD A;  1QZR A;  2ZIT A;  4JI1 I;  2JEB A;  4AM3 A;  4K0K I;  2UUA I;  1UDO A;  5JEA B;  1HNW I;  4DR7 I;  4JYA E;  2UXB E;  4J3D A;  2UUC E;  3QT6 A;  4BA1 A;  5BR8 E;  4GKK E;  1PVG A;  4DV0 I;  5EKW A;  5JEA F;  4YY3 I;  1KKH A;  1BKN A;  4DU8 A;  4DR5 I;  2F1D A;  4FW7 A;  4OO1 B;  3GLL A;  4PRV A;  2UU9 E;  2Z5B A;  1HNX E;  2C38 A;  5JEA E;  3GON A;  2ZM6 E;  4DV7 E;  2Q2E B;  4JI0 E;  1XNQ E;  1MX0 A;  5K36 A;  4LCF A;  3H4L A;  2VQF E;  3PYE A;  4WUD A;  3PYD A;  1ZXN A;  5JEA D;  4OX9 I;  1OYS A;  1EI1 A;  2O1V A;  4FN5 A;  4HAC A;  1IBK I;  3J80 Q;  4JI7 I;  4LFB E;  1ZM4 A;  2O1W A;  5FWK A;  1Z0E A;  1FI4 A;  2PO2 B;  2HHH I;  4JI1 E;  2PNM A;  4X62 I;  4K0K E;  2UUA E;  1HNW E;  4DR7 E;  1FJG I;  4IS9 A;  2BV3 A;  3WU5 A;  4M1K A;  1NHI A;  1P42 A;  1NZ0 A;  2BA1 D;  1Z0C A;  4ZVI A;  4GKJ I;  1PIE A;  4JI3 I;  4DV0 E;  5DNX A;  2X7I A;  2GQ0 A;  4YY3 E;  4P52 A;  3CDI A;  5JEA C;  4DR5 E;  3V2U C;  4JI4 I;  1KIJ A;  1VIS A;  2PO1 B;  2GS8 A;  2JT2 A;  3B78 A;  4MDT A;  3P3E A;  2IOQ A;  2PNZ B;  2GO3 A;  4X64 I;  2NN6 E;  2JEA B;  2OI2 A;  1FNM A;  1YH8 A;  4OX9 E;  4IZJ B;  3H1C A;  2GO4 A;  1IBK E;  4JI7 E;  1N33 I;  2HK2 A;  2R3V A;  1FWK A;  3K17 A;  2HHH E;  4X62 E;  3U1Y A;  4LF5 I;  5DRP A;  1USV A;  2HFS A;  3JAM Q;  5ELW A;  5A2Q C;  1ZM2 A;  1FJG E;  4JI8 I;  1U2R A;  3F0N A;  1YHC A;  2O1U A;  3D4J A;  5LL6 R;  1J5E E;  4GKJ E;  1N32 I;  4JI3 E;  2UXD E;  4X65 E;  3K85 A;  4LPF A;  4IZJ D;  4JI4 E;  3KRN A;  1Y4S A;  1WUU A;  5DRO A;  1HNZ I;  1XMO I;  3PYG A;  3Q1Q A;  4PU9 A;  3UHM A;  4MU0 A;  2IER A;  1Z0B A;  4N3O A;  4DPW A;  4X64 E;  5IT9 C;  1ZXM A;  2WNR A;  1N33 E;  4DR4 I;  2Z5E A;  3L7Z A;  4DPY A;  4LF5 E;  2CZ9 A;  1PKP A;  3P76 A;  2E5L I;  3Q6N A;  4LF9 E;  1MU5 A;  1MG7 A;  2HK3 A;  4DXL A;  4JI8 E;  1Y6Z A;  1USU A;  1ZM3 A;  4DU7 A;  4DR3 E;  4JI5 I;  1NHH A;  3M6A A;  1N32 E;  1KTV A;  1Z59 A;  5A2Q Q;  3PS2 A;  2E1R A;  3M7N G;  3M85 D;  1Z5B A;  2NN6 A;  4PRX A;  2Z5C B;  3P3C A;  2JE6 A;  1NHJ A;  1HNZ E;  1XMO E;  4DV6 I;  4NXM I;  1VI7 A;  2PO0 A;  2O3Z A;  4YHH I;  2F4V I;  3GCM A;  5IWA I;  2NPF A;  4LFA I;  4FW3 A;  2X36 A;  4OO1 F;  2BR2 B;  4FWD A;  4DPU A;  4P7A A;  4DR4 E;  5IT9 Q;  5C0X B;  2XEX A;  4MYT A;  1D6T A;  2E5L E;  4EMD A;  4OO1 E;  3QT5 A;  4UT4 A;  1HK7 A;  2WNR B;  2C39 A;  4HXZ A;  4DV3 I;  4JI5 E;  4OO1 D;  4DUY I;  1Z5C A;  5C0X F;  3ZM7 A;  1J5E I;  4JG4 A;  4NXN I;  4IFD B;  4USK A;  2JEA A;  2UXD I;  2JEB B;  1H74 A;  3PS3 A;  5C0X E;  5EL9 A;  5FLX C;  2C37 A;  1Z0V A;  4DV6 E;  3CWV A;  2A2D A;  4NXM E;  5C0X D;  1Z0W A;  4IFD F;  2ZBK B;  4YHH E;  2F4V E;  4BA1 B;  4HYM A;  2HKE A;  1KVK A;  1RRE A;  5IWA E;  4LFA E;  4DR2 I;  3T1Y I;  1ZM9 A;  4LF6 I;  3Q6M A;  4OO1 C;  4MU3 A;  2Z5B B;  2VES A;  2V34 A;  2C38 B;  4DV5 E;  4IZK A;  4IFD D;  1UEK A;  4U3B A;  2WW4 A;  5K36 B;  4FWG A;  4Z7C A;  2WP8 A;  4DV3 E;  1XXE A;  4DUY E;  3LTO A;  1Z0T A;  1R6L A;  4HAC B;  4LF7 I;  3LPS A;  4DR3 I;  5C0X C;  3WU3 A;  4FW6 A;  2AE8 A;  3PYF A;  5JEA A;  3HUL A;  4NXN E;  3J81 C;  4USM A;  1H73 A;  4DUZ I;  5K36 F;  1UDQ A;  4RPF A;  5DNL A;  3U1K A;  1K47 A;  3WU4 A;  4MU1 A;  4DV1 I;  2V2Z A;  1E3H A;  4IFD C;  5FLX Q;  1A6F A;  4DR2 E;  1R6M A;  3T1Y E;  2HFU A;  3DD6 A;  5K36 D;  4LF6 E;  2BA0 D;  3HKM A;  4DR1 I;  1UDS A;  4WUC A;  2J7K A;  3NZK A;  3P06 A;  4DR6 I;  1B63 A;  1HR0 I;  3V5R A;  4KQV A;  4KHP I;  2PO2 A;  4LF7 E;  3B4T A;  4DV2 I;  1EA6 A;  4OKG A;  1IBM E;  3P3G A;  4BA2 A;  4DUZ E;  2VQE I;  4AQY I;  5K36 C;  3QT8 A;  2R42 A;  2A2C A;  4FW4 A;  4U3D A;  2V2Q A;  2PNL A;  4DV1 E;  4LOM A;  4B3T I;  1N34 I;  4ISA A;  1IBL I;  2UUB I;  2J65 A;  3M7N D;  3M85 G;  4MQY A;  4QNJ A;  1RHY A;  4B3S I;  4GQU A;  3ZZU A;  2IES A;  3ZKD A;  1B62 A;  4URL A;  4B3R I;  4AIM A;  2IOP A;  3K1J A;  5L3J A;  2PO1 A;  4UTG A;  4DR1 E;  2PNZ A;  4OZE A;  2DEI A;  4JI6 I;  4IZJ A;  4NBQ A;  1FWL A;  3PS1 A;  3B8H A;  1S4E A;  4DR6 E;  4DV5 I;  4JV5 I;  1HR0 E;  3T1H I;  4KHP E;  2CVE A;  4LF4 I;  4DV2 E;  3L7Z B;  4MU4 A;  2VQE E;  4X66 I;  4AQY E;  4HY1 A;  2UXC I;  3JAM C;  2CGE A;  1H7S A;  4B3T E;  2BM1 A;  1N34 E;  1Y60 A;  1IBL E;  2UUB E;  2BA1 G;  1Z5A A;  4B3S E;  1N0U A;  3HJC A;  4LFC I;  4BA2 B;  4QNK A;  4LF8 I;  4B3R E;  4X65 I;  4DV4 I;  1DAR A;  2NN6 B;  1XNR I;  2HKJ A;  3GME A;  4FWH A;  4LF9 I;  1N36 I;  2EFG A;  2JE6 B;  4IFD E;  2VF3 A;  2O1T A;  5LMU I;  4JI6 E;  5GMD A;  2V8P A;  1OYR A;  4FW9 A;  2PO0 B;  5DRQ A;  3PRY A;  4JV5 E;  1E3P A;  2NN6 F;  3CDJ A;  5LMN I;  4WUB A;  1XMQ I;  5GME A;  3T1H E;  2AJ4 A;  3OTO I;  4B3M I;  4LF4 E;  2DEJ A;  3LNU A;  1I94 I;  1Y5Y A;  3J7A G;  1H7U A;  3QT7 A;  1OYP A;  1IBM I;  4I3H A;  4X66 E;  1N0V C;  2UXC E;  2NN6 D;  3J7A M;  2CG9 A;  1XHK A;  2C39 B;  1H72 C;  4JI2 I;  5K36 E;  2Z5C A;  4LFC E;  4LF8 E;  2UXB I;  4JYA I;  4OO1 A;  3ZKB A;  4DV4 E;  4ED4 A;  1S16 A; 
#chains in the Genus database with same CATH homology
 2PO1 B;  5K36 C;  4OO1 E;  4AID A;  2PNZ B;  2C37 B;  2NN6 E;  2WNR B;  2C39 A;  3H1C A;  4OO1 D;  3M7N D;  3M85 G;  5C0X F;  2BR2 A;  2NN6 C;  2BA0 G;  4IFD B;  4AIM A;  5C0X A;  2JEA A;  2PO1 A;  2JEB B;  5C0X E;  2PNZ A;  2C37 A;  1UDN A;  4NBQ A;  5C0X D;  4IFD F;  4BA1 B;  2WP8 B;  4IFD A;  2JEB A;  4AM3 A;  4OO1 C;  3KRN A;  1UDO A;  5JEA B;  3L7Z B;  2C38 B;  4IFD D;  5K36 B;  4BA1 A;  2WP8 A;  5JEA F;  2BA1 G;  2WNR A;  1R6L A;  5C0X C;  4OO1 B;  4BA2 B;  5JEA A;  3GLL A;  3L7Z A;  5K36 F;  2NN6 B;  2C38 A;  1UDQ A;  3GME A;  5JEA E;  3U1K A;  2JE6 B;  4IFD E;  5K36 A;  5JEA D;  1E3H A;  1OYR A;  2PO0 B;  1OYS A;  1E3P A;  2NN6 F;  3CDJ A;  4IFD C;  3M7N G;  3M85 D;  1R6M A;  3DD6 A;  5K36 D;  2PO2 B;  2NN6 A;  2BA0 D;  3HKM A;  2JE6 A;  1UDS A;  1OYP A;  2PO0 A;  2NN6 D;  2BA1 D;  3GCM A;  5C0X B;  2C39 B;  4OO1 F;  3CDI A;  2PO2 A;  5JEA C;  2BR2 B;  5K36 E;  3B4T A;  4OO1 A;  4BA2 A;  2JEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...