2PNZA

Crystal structure of the p. abyssi exosome rnase ph ring complexed with udp and gmp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
total genus 76
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2pnzA01
2NN6E 3M7NG 2PO1B 2BA1D 2WNRA 4IFDE 2JEAB 4AIDA 2C39B 2C37B 5JEAA 5K36B 3CDIA 2PO0A 5C0XB 3H1CA 5JEAF 2PO2A 4OO1B 3HKMA 2BA1G 2NN6C 3M85D 3DD6A 2C38A 1E3PA 2NN6D 1OYSA 3KRNA 5K36E 2BA0G 4BA1B 2PO0B 4IFDA 4IFDD 5C0XE 1OYPA 4OO1E 4IFDF 2BR2A 2WP8A 3M85G 2JEBA 1R6LA 2JE6A 2WNRB 4AM3A 3L7ZA 5K36C 5C0XC 5K36D 2NN6A 4OO1C 5JEAB 1R6MA 1UDOA 4AIMA 5C0XD 2NN6F 4OO1D 2PO2B 1OYRA 2C38B 4BA2A 5JEAE 1UDNA 2PNZA 4IFDB 2JEAA 2BR2B 1UDSA 2WP8B 2C39A 4BA2B 3GMEA 5K36A 2JEBB 5C0XA 3CDJA 2PNZB 5K36F 4OO1A 4NBQA 1UDQA 5C0XF 2JE6B 3GCMA 4OO1F 3L7ZB 5JEAC 2BA0D 3M7ND 3U1KA 5JEAD 2NN6B 4BA1A 1E3HA 3GLLA 3B4TA 2PO1A 4IFDC 2C37A
chains in the Genus database with same CATH superfamily
3PS3A 4FW5A 4DV4E 1KVKA 3WU4A 1J5EI 2PO1B 2CVEA 1Z59A 4FWDA 5IT9Q 4IFDE 1Z0GA 4DPYA 4PU9A 2CZ9A 4DV6E 2JEAB 1HNXI 4AIDA 2V2ZA 2Q2EB 2C37B 2O1TA 1HK7A 5K36B 2PO0A 5C0XB 3H1CA 5JEAF 2PO2A 4IZKA 4NXMI 3ZZ0A 2XEXA 1I94I 4LCHA 4DUZI 2UUCE 4DR5I 2J7KA 4MYTA 1S4EA 2NN6D 3J81C 1ELOA 5BR8E 3WU3A 5K36E 2BA0G 4DV0E 1NHIA 4JV5E 5C0XE 1OYPA 4LFBI 3U1YA 5LMNE 4LFCE 4IFDF 3PS1A 2EFGA 1VISA 5FLXC 4DR7E 1ZM9A 4B3RI 4R1FA 1Y6ZA 1Z5BA 2IERA 2VQEE 4DR4E 1N0UA 3M6AA 5DRPA 4DXLA 3B82A 4EMDA 2BM0A 4IS9A 1YHCA 4OO1C 3J80C 2VQFI 2NN6F 2Z5CB 4HACA 3V5RA 1B63A 3LNUA 4DUYI 2E5LE 4JI5I 4LF5I 3WU6A 4MDTA 2JT2A 4M1KA 4X66E 1EI1A 1EA6A 4MQYA 1XMQE 4DR3I 1USVA 4UT4A 4DR2I 4GKKE 2F4VI 2J65A 1IBKI 3H4LA 4B3ME 1QZRA 2JEAA 1S16A 3CWVA 2UU9E 1YH8A 3GMEA 3OTOI 5K36A 4DV2E 4ED4A 4LF4E 2JEBB 2AE8A 5C0XA 4GQUA 5DNLA 2PNZB 4X65I 2CGEA 4NBQA 4JI3I 1UDQA 4JI0E 5DROA 4JI8E 5JEAC 4LPFA 4JI1I 1Z0VA 5EL9A 2UXCI 3GONA 1E3HA 1ZM4A 1FNMA 3HJCA 4DPXA 5FWKA 2E1RA 2AJ4A 3PYDA 4JI2E 4OZEA 1RR9A 4IFDC 3QT6A 2V8PA 4YY3I 2IESA 5GMDA 1NHHA 2O1UA 4MU4A 3QT8A 5FLXQ 3Q6MA 4KHPI 2OI2A 2LJPA 1XMOE 1HR0I 4USMA 5DNXA 4NXNI 4MU1A 1HNWE 4DR1I 4DPWA 2Z5CA 4DR6I 3K17A 5A2QC 4DV3E 2NN6C 3M85D 4LF7I 1Z0TA 3J80Q 1XNRE 3KRNA 1N34E 5IWAE 4LF8I 1IBLI 4LF6I 4IZJB 3P3CA 4IFDD 2DEJA 4U3DA 1J5EE 2DEIA 4DPTA 4K0KE 4RPFA 4JYAI 3P76A 1ZM2A 4DPUA 4OX9I 3M85G 4P7AA 2JEBA 4DV5E 1HNXE 2HHHI 1R6LA 1Z5AA 4WUBA 4N3OA 1Z0BA 3B8HA 2BM1A 4AM3A 1FI4A 1DARA 4YHHI 2UUBI 4LFAI 5GMEA 4FWGA 3V2UC 4NXME 2Z5BB 2ZM6I 1PKPA 1I94E 4DUZE 5K36D 4DR5E 4USKA 4MU0A 5C0XD 2HFSA 1MX0A 5DRRA 4LFBE 1OYRA 1N32I 3T1HE 4BA2A 1ZXMA 4X62I 4B3RE 2PNMA 2GQ0A 2GO3A 4LF9I 4Z7CA 1UDSA 2X7IA 4B3TE 1FJGI 3P3EA 4JI7I 5K36F 2UUAI 2VQFE 4DR7I 5C0XF 1XXEA 3PS2A 3GCMA 3L7ZB 2V34A 3M7ND 4DUYE 4JI4I 4JI5E 4LF5E 3PRYA 4FW6A 4B3SI 3F0NA 2HK2A 4IZJA 3JAMC 3B4TA 2PO1A 5A2QQ 4DR3E 1MU5A 1Y4SA 4DR2E 2F4VE 3J7AG 1D6TA 1IBKE 4QNJA 2UXBI 2C37A 1KIJA 3M7NG 3OTOE 4GKJI 2BA1D 4AQYI 5IT9C 4X65E 2UXDI 5DRQA 4JI3E 2GS8A 2Z5BA 4GKKI 2C39B 3PYFA 4JI1E 4DV7I 3ZZUA 2UXCE 3ZKDA 4OO1B 3HKMA 1KTVA 2NPFA 4UTGA 2BA1G 1FKAE 2ZBKB 4LOMA 3J81Q 1IBMI 2VESA 5ELWA 2HKEA 4BA1B 2PO0B 1N36I 4YY3E 4P52A 4IZKB 4OO1E 1Z0CA 3J7AM 1XNQI 3LTOA 1N33I 4KHPE 3QT7A 4MU3A 1H7SA 4FN5A 4DV1I 1HR0E 4JI2I 2HKJA 4NXNE 4DR1E 5EKWA 1Y5YA 3Q1QA 4DR6E 2WNRB 4URLA 1HNZE 3L7ZA 3T1YI 5K36C 1N0VC 1PVGA 5C0XC 4ZVIA 4LF7E 4FWHA 5JEAB 1R6MA 3ZM7A 4AIMA 5LMUI 2PNLA 4LF8E 1ZM3A 1IBLE 4LF6E 1Y4UA 5LL6R 1XMOI 3PYEA 4XTJA 2C38B 3LPSA 3WU5A 3JAMQ 4OX9E 4IZJD 5JEAE 1UDNA 2PNZA 3QT5A 3P3GA 4IFDB 2HHHE 4JI6I 4X64I 2BR2B 2WP8B 2C39A 2F1DA 4YHHE 4DV4I 2UUBE 4LFAE 2ZM6E 4K0KI 4U3BA 4OO1A 1FWKA 3P06A 2A2CA 4Z7YA 2JE6B 4DV6I 1Z0WA 3ZKBA 2BA0D 4DV5I 3U1KA 1N32E 2NN6B 4BA1A 3GLLA 3NZKA 1ZXNA 1NZ0A 2V2QA 1K47A 2R3VA 4HY1A 2ZITA 2UUCI 4X62E 1OJ4A 4LF9E 5BR8I 4DV0I 4JV5I 2NN6E 1VI7A 5LMNI 1FJGE 4LFCI 4WUCA 3T1HI 4JI7E 2WNRA 1WUUA 2UUAE 4PRXA 5JEAA 2VQEI 4JI4E 4DR4I 4JG4A 3CDIA 4B3SE 1NHJA 1H74A 3D4JA 4B3TI 2Z5EA 3DD6A 2C38A 2V2VA 1E3PA 1OYSA 4OKGA 2IOPA 4J3DA 2UXBE 1Z0EA 1BKNA 4FW3A 4IFDA 4PRVA 4ISAA 2E5LI 2O3ZA 1PIEA 4GKJE 1A6FA 2BR2A 2WP8A 4KQVA 4QNKA 1FWLA 4DU8A 4X66I 4LCGA 5L3JA 4AQYE 1XMQI 2UXDE 2O1WA 1MG7A 2HFUA 3UHMA 4FW4A 4B3MI 4DV7E 2JE6A 2HK3A 2UU9I 4DU7A 4DV2I 3PYGA 4LF4I 3HULA 4I3HA 2NN6A 4LCFA 1RHYA 1UDOA 1IBME 4OO1D 4JI0I 2A2DA 1H73A 4JI8I 2PO2B 2CG9A 3ZZTA 1N36E 2BV3A 2O1VA 4WUDA 1XNQE 1N33E 4DV1E 4HXZA 2R42A 1B62A 4BA2B 3T1YE 1USUA 1RREA 1H72C 2WW4A 2X36A 3CDJA 1Z5CA 5LMUE 1UEKA 4FW9A 4OO1F 1Y60A 1U2RA 1HNWI 3Q6NA 1H7UA 5JEAD 2GO4A 3K85A 4JYAE 2VF3A 1KKHA 1P42A 1HNZI 4DV3I 3B78A 4HACB 2IOQA 3K1JA 4HYMA 4JI6E 1XNRI 4X64E 1XHKA 1N34I 4FW7A 5IWAI 4MYUA
chains in the Genus database with same CATH topology
2NN6E 3M7NG 2PO1B 2BA1D 2WNRA 4IFDE 2JEAB 4AIDA 2C39B 2C37B 5JEAA 5K36B 3CDIA 2PO0A 5C0XB 3H1CA 5JEAF 2PO2A 4OO1B 3HKMA 2BA1G 2NN6C 3M85D 3DD6A 2C38A 1E3PA 2NN6D 1OYSA 3KRNA 5K36E 2BA0G 4BA1B 2PO0B 4IFDA 4IFDD 5C0XE 1OYPA 4OO1E 4IFDF 2BR2A 2WP8A 3M85G 2JEBA 1R6LA 2JE6A 2WNRB 4AM3A 3L7ZA 5K36C 5C0XC 5K36D 2NN6A 4OO1C 5JEAB 1R6MA 1UDOA 4AIMA 5C0XD 2NN6F 4OO1D 2PO2B 1OYRA 2C38B 4BA2A 5JEAE 1UDNA 2PNZA 4IFDB 2JEAA 2BR2B 1UDSA 2WP8B 2C39A 4BA2B 3GMEA 5K36A 2JEBB 5C0XA 3CDJA 2PNZB 5K36F 4OO1A 4NBQA 1UDQA 5C0XF 2JE6B 3GCMA 4OO1F 3L7ZB 5JEAC 2BA0D 3M7ND 3U1KA 5JEAD 2NN6B 4BA1A 1E3HA 3GLLA 3B4TA 2PO1A 4IFDC 2C37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 E;  3M7N G;  2PO1 B;  2BA1 D;  2WNR A;  4IFD E;  2JEA B;  4AID A;  2C39 B;  2C37 B;  5JEA A;  5K36 B;  3CDI A;  2PO0 A;  5C0X B;  3H1C A;  5JEA F;  2PO2 A;  4OO1 B;  3HKM A;  2BA1 G;  2NN6 C;  3M85 D;  3DD6 A;  2C38 A;  1E3P A;  2NN6 D;  1OYS A;  3KRN A;  5K36 E;  2BA0 G;  4BA1 B;  2PO0 B;  4IFD A;  4IFD D;  5C0X E;  1OYP A;  4OO1 E;  4IFD F;  2BR2 A;  2WP8 A;  3M85 G;  2JEB A;  1R6L A;  2JE6 A;  2WNR B;  4AM3 A;  3L7Z A;  5K36 C;  5C0X C;  5K36 D;  2NN6 A;  4OO1 C;  5JEA B;  1R6M A;  1UDO A;  4AIM A;  5C0X D;  2NN6 F;  4OO1 D;  2PO2 B;  1OYR A;  2C38 B;  4BA2 A;  5JEA E;  1UDN A;  2PNZ A;  4IFD B;  2JEA A;  2BR2 B;  1UDS A;  2WP8 B;  2C39 A;  4BA2 B;  3GME A;  5K36 A;  2JEB B;  5C0X A;  3CDJ A;  2PNZ B;  5K36 F;  4OO1 A;  4NBQ A;  1UDQ A;  5C0X F;  2JE6 B;  3GCM A;  4OO1 F;  3L7Z B;  5JEA C;  2BA0 D;  3M7N D;  3U1K A;  5JEA D;  2NN6 B;  4BA1 A;  1E3H A;  3GLL A;  3B4T A;  2PO1 A;  4IFD C;  2C37 A; 
#chains in the Genus database with same CATH topology
 3PS3 A;  4FW5 A;  4DV4 E;  1KVK A;  3WU4 A;  1J5E I;  2PO1 B;  2CVE A;  1Z59 A;  4FWD A;  5IT9 Q;  4IFD E;  1Z0G A;  4DPY A;  4PU9 A;  2CZ9 A;  4DV6 E;  2JEA B;  1HNX I;  4AID A;  2V2Z A;  2Q2E B;  2C37 B;  2O1T A;  1HK7 A;  5K36 B;  2PO0 A;  5C0X B;  3H1C A;  5JEA F;  2PO2 A;  4IZK A;  4NXM I;  3ZZ0 A;  2XEX A;  1I94 I;  4LCH A;  4DUZ I;  2UUC E;  4DR5 I;  2J7K A;  4MYT A;  1S4E A;  2NN6 D;  3J81 C;  1ELO A;  5BR8 E;  3WU3 A;  5K36 E;  2BA0 G;  4DV0 E;  1NHI A;  4JV5 E;  5C0X E;  1OYP A;  4LFB I;  3U1Y A;  5LMN E;  4LFC E;  4IFD F;  3PS1 A;  2EFG A;  1VIS A;  5FLX C;  4DR7 E;  1ZM9 A;  4B3R I;  4R1F A;  1Y6Z A;  1Z5B A;  2IER A;  2VQE E;  4DR4 E;  1N0U A;  3M6A A;  5DRP A;  4DXL A;  3B82 A;  4EMD A;  2BM0 A;  4IS9 A;  1YHC A;  4OO1 C;  3J80 C;  2VQF I;  2NN6 F;  2Z5C B;  4HAC A;  3V5R A;  1B63 A;  3LNU A;  4DUY I;  2E5L E;  4JI5 I;  4LF5 I;  3WU6 A;  4MDT A;  2JT2 A;  4M1K A;  4X66 E;  1EI1 A;  1EA6 A;  4MQY A;  1XMQ E;  4DR3 I;  1USV A;  4UT4 A;  4DR2 I;  4GKK E;  2F4V I;  2J65 A;  1IBK I;  3H4L A;  4B3M E;  1QZR A;  2JEA A;  1S16 A;  3CWV A;  2UU9 E;  1YH8 A;  3GME A;  3OTO I;  5K36 A;  4DV2 E;  4ED4 A;  4LF4 E;  2JEB B;  2AE8 A;  5C0X A;  4GQU A;  5DNL A;  2PNZ B;  4X65 I;  2CGE A;  4NBQ A;  4JI3 I;  1UDQ A;  4JI0 E;  5DRO A;  4JI8 E;  5JEA C;  4LPF A;  4JI1 I;  1Z0V A;  5EL9 A;  2UXC I;  3GON A;  1E3H A;  1ZM4 A;  1FNM A;  3HJC A;  4DPX A;  5FWK A;  2E1R A;  2AJ4 A;  3PYD A;  4JI2 E;  4OZE A;  1RR9 A;  4IFD C;  3QT6 A;  2V8P A;  4YY3 I;  2IES A;  5GMD A;  1NHH A;  2O1U A;  4MU4 A;  3QT8 A;  5FLX Q;  3Q6M A;  4KHP I;  2OI2 A;  2LJP A;  1XMO E;  1HR0 I;  4USM A;  5DNX A;  4NXN I;  4MU1 A;  1HNW E;  4DR1 I;  4DPW A;  2Z5C A;  4DR6 I;  3K17 A;  5A2Q C;  4DV3 E;  2NN6 C;  3M85 D;  4LF7 I;  1Z0T A;  3J80 Q;  1XNR E;  3KRN A;  1N34 E;  5IWA E;  4LF8 I;  1IBL I;  4LF6 I;  4IZJ B;  3P3C A;  4IFD D;  2DEJ A;  4U3D A;  1J5E E;  2DEI A;  4DPT A;  4K0K E;  4RPF A;  4JYA I;  3P76 A;  1ZM2 A;  4DPU A;  4OX9 I;  3M85 G;  4P7A A;  2JEB A;  4DV5 E;  1HNX E;  2HHH I;  1R6L A;  1Z5A A;  4WUB A;  4N3O A;  1Z0B A;  3B8H A;  2BM1 A;  4AM3 A;  1FI4 A;  1DAR A;  4YHH I;  2UUB I;  4LFA I;  5GME A;  4FWG A;  3V2U C;  4NXM E;  2Z5B B;  2ZM6 I;  1PKP A;  1I94 E;  4DUZ E;  5K36 D;  4DR5 E;  4USK A;  4MU0 A;  5C0X D;  2HFS A;  1MX0 A;  5DRR A;  4LFB E;  1OYR A;  1N32 I;  3T1H E;  4BA2 A;  1ZXM A;  4X62 I;  4B3R E;  2PNM A;  2GQ0 A;  2GO3 A;  4LF9 I;  4Z7C A;  1UDS A;  2X7I A;  4B3T E;  1FJG I;  3P3E A;  4JI7 I;  5K36 F;  2UUA I;  2VQF E;  4DR7 I;  5C0X F;  1XXE A;  3PS2 A;  3GCM A;  3L7Z B;  2V34 A;  3M7N D;  4DUY E;  4JI4 I;  4JI5 E;  4LF5 E;  3PRY A;  4FW6 A;  4B3S I;  3F0N A;  2HK2 A;  4IZJ A;  3JAM C;  3B4T A;  2PO1 A;  5A2Q Q;  4DR3 E;  1MU5 A;  1Y4S A;  4DR2 E;  2F4V E;  3J7A G;  1D6T A;  1IBK E;  4QNJ A;  2UXB I;  2C37 A;  1KIJ A;  3M7N G;  3OTO E;  4GKJ I;  2BA1 D;  4AQY I;  5IT9 C;  4X65 E;  2UXD I;  5DRQ A;  4JI3 E;  2GS8 A;  2Z5B A;  4GKK I;  2C39 B;  3PYF A;  4JI1 E;  4DV7 I;  3ZZU A;  2UXC E;  3ZKD A;  4OO1 B;  3HKM A;  1KTV A;  2NPF A;  4UTG A;  2BA1 G;  1FKA E;  2ZBK B;  4LOM A;  3J81 Q;  1IBM I;  2VES A;  5ELW A;  2HKE A;  4BA1 B;  2PO0 B;  1N36 I;  4YY3 E;  4P52 A;  4IZK B;  4OO1 E;  1Z0C A;  3J7A M;  1XNQ I;  3LTO A;  1N33 I;  4KHP E;  3QT7 A;  4MU3 A;  1H7S A;  4FN5 A;  4DV1 I;  1HR0 E;  4JI2 I;  2HKJ A;  4NXN E;  4DR1 E;  5EKW A;  1Y5Y A;  3Q1Q A;  4DR6 E;  2WNR B;  4URL A;  1HNZ E;  3L7Z A;  3T1Y I;  5K36 C;  1N0V C;  1PVG A;  5C0X C;  4ZVI A;  4LF7 E;  4FWH A;  5JEA B;  1R6M A;  3ZM7 A;  4AIM A;  5LMU I;  2PNL A;  4LF8 E;  1ZM3 A;  1IBL E;  4LF6 E;  1Y4U A;  5LL6 R;  1XMO I;  3PYE A;  4XTJ A;  2C38 B;  3LPS A;  3WU5 A;  3JAM Q;  4OX9 E;  4IZJ D;  5JEA E;  1UDN A;  2PNZ A;  3QT5 A;  3P3G A;  4IFD B;  2HHH E;  4JI6 I;  4X64 I;  2BR2 B;  2WP8 B;  2C39 A;  2F1D A;  4YHH E;  4DV4 I;  2UUB E;  4LFA E;  2ZM6 E;  4K0K I;  4U3B A;  4OO1 A;  1FWK A;  3P06 A;  2A2C A;  4Z7Y A;  2JE6 B;  4DV6 I;  1Z0W A;  3ZKB A;  2BA0 D;  4DV5 I;  3U1K A;  1N32 E;  2NN6 B;  4BA1 A;  3GLL A;  3NZK A;  1ZXN A;  1NZ0 A;  2V2Q A;  1K47 A;  2R3V A;  4HY1 A;  2ZIT A;  2UUC I;  4X62 E;  1OJ4 A;  4LF9 E;  5BR8 I;  4DV0 I;  4JV5 I;  2NN6 E;  1VI7 A;  5LMN I;  1FJG E;  4LFC I;  4WUC A;  3T1H I;  4JI7 E;  2WNR A;  1WUU A;  2UUA E;  4PRX A;  5JEA A;  2VQE I;  4JI4 E;  4DR4 I;  4JG4 A;  3CDI A;  4B3S E;  1NHJ A;  1H74 A;  3D4J A;  4B3T I;  2Z5E A;  3DD6 A;  2C38 A;  2V2V A;  1E3P A;  1OYS A;  4OKG A;  2IOP A;  4J3D A;  2UXB E;  1Z0E A;  1BKN A;  4FW3 A;  4IFD A;  4PRV A;  4ISA A;  2E5L I;  2O3Z A;  1PIE A;  4GKJ E;  1A6F A;  2BR2 A;  2WP8 A;  4KQV A;  4QNK A;  1FWL A;  4DU8 A;  4X66 I;  4LCG A;  5L3J A;  4AQY E;  1XMQ I;  2UXD E;  2O1W A;  1MG7 A;  2HFU A;  3UHM A;  4FW4 A;  4B3M I;  4DV7 E;  2JE6 A;  2HK3 A;  2UU9 I;  4DU7 A;  4DV2 I;  3PYG A;  4LF4 I;  3HUL A;  4I3H A;  2NN6 A;  4LCF A;  1RHY A;  1UDO A;  1IBM E;  4OO1 D;  4JI0 I;  2A2D A;  1H73 A;  4JI8 I;  2PO2 B;  2CG9 A;  3ZZT A;  1N36 E;  2BV3 A;  2O1V A;  4WUD A;  1XNQ E;  1N33 E;  4DV1 E;  4HXZ A;  2R42 A;  1B62 A;  4BA2 B;  3T1Y E;  1USU A;  1RRE A;  1H72 C;  2WW4 A;  2X36 A;  3CDJ A;  1Z5C A;  5LMU E;  1UEK A;  4FW9 A;  4OO1 F;  1Y60 A;  1U2R A;  1HNW I;  3Q6N A;  1H7U A;  5JEA D;  2GO4 A;  3K85 A;  4JYA E;  2VF3 A;  1KKH A;  1P42 A;  1HNZ I;  4DV3 I;  3B78 A;  4HAC B;  2IOQ A;  3K1J A;  4HYM A;  4JI6 E;  1XNR I;  4X64 E;  1XHK A;  1N34 I;  4FW7 A;  5IWA I;  4MYU A; 
#chains in the Genus database with same CATH homology
 2NN6 E;  3M7N G;  2PO1 B;  2BA1 D;  2WNR A;  4IFD E;  2JEA B;  4AID A;  2C39 B;  2C37 B;  5JEA A;  5K36 B;  3CDI A;  2PO0 A;  5C0X B;  3H1C A;  5JEA F;  2PO2 A;  4OO1 B;  3HKM A;  2BA1 G;  2NN6 C;  3M85 D;  3DD6 A;  2C38 A;  1E3P A;  2NN6 D;  1OYS A;  3KRN A;  5K36 E;  2BA0 G;  4BA1 B;  2PO0 B;  4IFD A;  4IFD D;  5C0X E;  1OYP A;  4OO1 E;  4IFD F;  2BR2 A;  2WP8 A;  3M85 G;  2JEB A;  1R6L A;  2JE6 A;  2WNR B;  4AM3 A;  3L7Z A;  5K36 C;  5C0X C;  5K36 D;  2NN6 A;  4OO1 C;  5JEA B;  1R6M A;  1UDO A;  4AIM A;  5C0X D;  2NN6 F;  4OO1 D;  2PO2 B;  1OYR A;  2C38 B;  4BA2 A;  5JEA E;  1UDN A;  2PNZ A;  4IFD B;  2JEA A;  2BR2 B;  1UDS A;  2WP8 B;  2C39 A;  4BA2 B;  3GME A;  5K36 A;  2JEB B;  5C0X A;  3CDJ A;  2PNZ B;  5K36 F;  4OO1 A;  4NBQ A;  1UDQ A;  5C0X F;  2JE6 B;  3GCM A;  4OO1 F;  3L7Z B;  5JEA C;  2BA0 D;  3M7N D;  3U1K A;  5JEA D;  2NN6 B;  4BA1 A;  1E3H A;  3GLL A;  3B4T A;  2PO1 A;  4IFD C;  2C37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...