2PNZA

Crystal structure of the p. abyssi exosome rnase ph ring complexed with udp and gmp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
total genus 76
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2pnzA01
2C39B 2C38B 5K36C 2PO1B 2PO2B 1OYSA 5K36B 4OO1C 2WNRB 4OO1B 4AIMA 2JEBB 5C0XF 4BA2A 2PO0A 5C0XA 2C37A 1R6LA 5K36E 2NN6A 4IFDD 2BA0D 1UDOA 2JE6A 2WP8A 2BA1G 3M7NG 4IFDB 3GLLA 5JEAC 2BR2A 4BA1B 5JEAB 5C0XD 2NN6D 1E3PA 2PO0B 3M85G 2C37B 5JEAE 2NN6B 1E3HA 4OO1E 2JE6B 3U1KA 2C39A 2C38A 2WP8B 5K36F 3GCMA 5JEAF 2PO1A 2PO2A 4IFDC 5K36A 4AIDA 2JEAB 4OO1F 2WNRA 4OO1A 4NBQA 1OYRA 3M85D 3L7ZA 1UDSA 1UDQA 4IFDE 3CDIA 1R6MA 5C0XC 4BA2B 2PNZA 1OYPA 2NN6C 3B4TA 5C0XB 2BA1D 5K36D 3KRNA 4IFDF 3M7ND 4OO1D 3GMEA 4AM3A 3CDJA 1UDNA 4BA1A 5JEAA 5C0XE 2NN6E 2JEBA 3DD6A 2BR2B 3H1CA 3L7ZB 2NN6F 4IFDA 2PNZB 5JEAD 2JEAA 3HKMA 2BA0G
chains in the Genus database with same CATH superfamily
4KHPI 3PYEA 4MQYA 2AE8A 4FWHA 1OYSA 5K36B 4DR7E 4JV5E 4PU9A 4OO1B 1Z0WA 3PYDA 4LF6E 4DR6I 4LFAI 4LF7E 4BA2A 2IOQA 2XEXA 3K85A 1QZRA 5K36E 1Z0BA 4JI5E 3QT5A 1USUA 4IFDD 5FLXC 1NZ0A 1PKPA 4GKJI 4X62I 3M7NG 5IWAE 1KKHA 2V34A 1HNXE 1FJGI 2E1RA 4DR5E 4BA1B 5JEAB 1ELOA 4LCHA 4P52A 1N33I 2V2ZA 4JI0I 4B3RI 2Z5EA 4DUYE 4RPFA 4LF4I 5JEAE 4DV5E 2F4VE 1ZM2A 4JI1I 5LMUI 1MU5A 1N0UA 4DR1E 4X65E 4IZKB 3GCMA 2PO1A 2PO2A 3JAMC 4PRVA 4X66I 1H74A 4R1FA 2HHHE 4JI4I 1WUUA 5BR8I 3WU5A 2ZM6E 2UXDI 4DU8A 4JI6I 2E5LE 2R42A 1UDSA 5LMNE 4IFDE 1IBME 4WUCA 4KQVA 1EA6A 1OYPA 2JT2A 1KVKA 4DR3I 4DPWA 3KRNA 2A2DA 4LFCI 4X64E 1Y60A 3J81C 3CDJA 4WUBA 1D6TA 1UDNA 4USKA 4B3TI 4LF8I 4MU1A 4DXLA 3LTOA 4NXNE 2A2CA 3ZZ0A 4JV5I 4QNKA 1ZM4A 4YY3I 3OTOE 4GKKI 3DD6A 4LOMA 1EI1A 4HXZA 4DPYA 2NN6F 4JI7I 1HR0I 4OKGA 5FLXQ 4LCFA 4HYMA 3UHMA 4LF9I 2O3ZA 1ZM3A 2JEAA 4NXMI 4QNJA 3HKMA 2BA0G 1B62A 2ZBKB 4DV6I 1Z59A 2C39B 2C38B 1XMQI 3QT7A 1HNXI 2Z5CA 4HACA 4U3DA 4LCGA 4UT4A 4AIMA 1N32E 4Z7YA 4DV0E 1FNMA 2BM1A 1H72C 4MDTA 4DV5I 1XMOE 4DV7I 2F4VI 1VISA 3P76A 5A2QC 4P7AA 3JAMQ 4X65I 1Y4UA 5GMEA 1XHKA 4FWDA 2HHHI 4JYAE 3ZZTA 3H4LA 1XNQE 1OJ4A 2ZM6I 2Z5CB 1FKAE 5FWKA 2E5LI 1HNZI 2Z5BA 4LFBE 3WU6A 1S4EA 4B3SE 2DEJA 1IBMI 2NPFA 5L3JA 1RHYA 4MYTA 3J81Q 4OO1E 3V2UC 4JI3E 3U1KA 1UEKA 4X64I 1Z0VA 5JEAF 4AQYI 4DV2E 2HKJA 4DR4E 4M1KA 4YHHI 2WNRA 3ZKDA 5DRQA 4MU0A 1USVA 3HULA 2VQEE 4NXNI 4NBQA 2VF3A 2UUCE 3OTOI 1OYRA 4JI8E 3M85D 3T1YE 1RR9A 2Z5BB 4DR2I 3NZKA 1FWKA 4BA2B 4FW5A 4MU4A 3B4TA 2BA1D 2UXBI 1IBKI 4IFDF 2UXCE 2HK2A 3B82A 3GMEA 1Z0EA 4DV1E 4FWGA 2V2QA 4JI2E 2UUAI 5IT9C 2ZITA 2O1TA 2JEBA 3T1HI 2OI2A 3H1CA 4ZVIA 1ZXNA 4OX9E 4OZEA 1ZXMA 2CG9A 5A2QQ 1XMOI 3Q1QA 1HNWE 4DV4I 3B78A 1I94E 1Y4SA 2PO1B 2PO2B 3ZZUA 3GONA 4FN5A 1P42A 3ZM7A 4DR7I 3PS1A 4HY1A 4LFAE 2JEBB 4K0KE 4LF6I 2J7KA 4XTJA 5C0XF 2PO0A 1B63A 4LF7I 5EL9A 1PIEA 5C0XA 2HFUA 4B3SI 2HKEA 2NN6A 2HK3A 1UDOA 4JI5I 3V5RA 1Y6ZA 4GKJE 2WP8A 4JI3I 4X62E 2O1VA 2DEIA 4LPFA 1N36E 2BA1G 2VQFE 4DV2I 3Q6MA 2IOPA 5IWAI 1FJGE 2R3VA 4IS9A 1IBLE 2BR2A 2V8PA 2UUCI 1N33E 4DR5I 1S16A 1HK7A 4MYUA 3T1YI 4JI0E 2Q2EB 4B3RE 4FW3A 1E3PA 3D4JA 1N0VC 1Z0GA 2PO0B 4LF4E 4DUYI 5DNLA 3K1JA 4B3ME 4JI1E 1FI4A 2NN6B 1E3HA 4DUZE 4FW7A 3Q6NA 2UXCI 2LJPA 3J80C 4DR1I 2WP8B 3QT6A 2X7IA 4FW9A 5K36F 4U3BA 4DV1I 5K36A 4I3HA 2JEAB 4OO1F 2UU9E 2GO3A 4FW4A 4OO1A 2BV3A 3PYFA 2BM0A 5LL6R 2VESA 1Z5BA 1NHJA 2CVEA 4HACB 3HJCA 2CZ9A 1UDQA 4PRXA 3K17A 5LMNI 5C0XC 1U2RA 2PNZA 4OX9I 2NN6C 4DR3E 4DV3E 4DPTA 4LFCE 1BKNA 1YH8A 2CGEA 5DNXA 1N34E 3P06A 5EKWA 1HNWI 3M6AA 4B3TE 4LF8E 1I94I 4BA1A 5JEAA 4FW6A 1VI7A 4LF5E 4IZJA 4YY3E 4GKKE 2GO4A 4GQUA 3P3EA 4K0KI 4JI7E 1HR0E 2UUBE 1XXEA 1ZM9A 4LF9E 2PNZB 4IZKA 4NXME 2O1WA 4DV6E 3LPSA 1N36I 4IFDA 4ED4A 2VQFI 1XMQE 5K36C 1J5EE 1A6FA 1DARA 1IBLI 4OO1C 2WNRB 4IZJB 1H73A 4Z7CA 4UTGA 1N32I 3QT8A 4JG4A 2C37A 1R6LA 1YHCA 4DV0I 1XNRE 4DV7E 2BA0D 4B3MI 3J80Q 2JE6A 2EFGA 4DUZI 4ISAA 3P3CA 1Z5AA 2O1UA 1Z5CA 3J7AM 3P3GA 4KHPE 4IFDB 1Y5YA 4DPUA 2UU9I 3GLLA 4JYAI 5JEAC 1XNQI 3PYGA 5DRRA 5C0XD 4DR6E 1HNZE 2NN6D 2GS8A 4LFBI 4DPXA 3M85G 4J3DA 1FWLA 2C37B 2X36A 4DV3I 2IERA 2JE6B 1N34I 2C39A 2C38A 4AQYE 2AJ4A 4IFDC 1MX0A 4YHHE 4AIDA 5ELWA 4URLA 3J7AG 4DU7A 4DR4I 4MU3A 1H7UA 3U1YA 1RREA 4LF5I 3WU4A 4USMA 2VQEI 1KIJA 1MG7A 2HFSA 3WU3A 4JI8I 3L7ZA 3PS3A 2UUBI 1H7SA 3B8HA 2V2VA 4DR2E 3CDIA 1R6MA 1Z0TA 2UXBE 5C0XB 1IBKE 5K36D 5GMDA 5LMUE 4N3OA 2J65A 3LNUA 4EMDA 3M7ND 4OO1D 2GQ0A 4AM3A 2PNMA 4X66E 1KTVA 1NHHA 1NHIA 1K47A 5DROA 1J5EI 3CWVA 2UUAE 4JI4E 5C0XE 5IT9Q 5BR8E 4JI2I 2NN6E 2F1DA 3T1HE 2UXDE 2WW4A 4JI6E 2BR2B 1PVGA 2PNLA 3L7ZB 5DRPA 1XNRI 2IESA 3PS2A 5JEAD 4WUDA 3ZKBA 1Z0CA 4IZJD 3PRYA 4DV4E 3F0NA
chains in the Genus database with same CATH topology
2C39B 2C38B 5K36C 2PO1B 2PO2B 1OYSA 5K36B 4OO1C 2WNRB 4OO1B 4AIMA 2JEBB 5C0XF 4BA2A 2PO0A 5C0XA 2C37A 1R6LA 5K36E 2NN6A 4IFDD 2BA0D 1UDOA 2JE6A 2WP8A 2BA1G 3M7NG 4IFDB 3GLLA 5JEAC 2BR2A 4BA1B 5JEAB 5C0XD 2NN6D 1E3PA 2PO0B 3M85G 2C37B 5JEAE 2NN6B 1E3HA 4OO1E 2JE6B 3U1KA 2C39A 2C38A 2WP8B 5K36F 3GCMA 5JEAF 2PO1A 2PO2A 4IFDC 5K36A 4AIDA 2JEAB 4OO1F 2WNRA 4OO1A 4NBQA 1OYRA 3M85D 3L7ZA 1UDSA 1UDQA 4IFDE 3CDIA 1R6MA 5C0XC 4BA2B 2PNZA 1OYPA 2NN6C 3B4TA 5C0XB 2BA1D 5K36D 3KRNA 4IFDF 3M7ND 4OO1D 3GMEA 4AM3A 3CDJA 1UDNA 4BA1A 5JEAA 5C0XE 2NN6E 2JEBA 3DD6A 2BR2B 3H1CA 3L7ZB 2NN6F 4IFDA 2PNZB 5JEAD 2JEAA 3HKMA 2BA0G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C39 B;  2C38 B;  5K36 C;  2PO1 B;  2PO2 B;  1OYS A;  5K36 B;  4OO1 C;  2WNR B;  4OO1 B;  4AIM A;  2JEB B;  5C0X F;  4BA2 A;  2PO0 A;  5C0X A;  2C37 A;  1R6L A;  5K36 E;  2NN6 A;  4IFD D;  2BA0 D;  1UDO A;  2JE6 A;  2WP8 A;  2BA1 G;  3M7N G;  4IFD B;  3GLL A;  5JEA C;  2BR2 A;  4BA1 B;  5JEA B;  5C0X D;  2NN6 D;  1E3P A;  2PO0 B;  3M85 G;  2C37 B;  5JEA E;  2NN6 B;  1E3H A;  4OO1 E;  2JE6 B;  3U1K A;  2C39 A;  2C38 A;  2WP8 B;  5K36 F;  3GCM A;  5JEA F;  2PO1 A;  2PO2 A;  4IFD C;  5K36 A;  4AID A;  2JEA B;  4OO1 F;  2WNR A;  4OO1 A;  4NBQ A;  1OYR A;  3M85 D;  3L7Z A;  1UDS A;  1UDQ A;  4IFD E;  3CDI A;  1R6M A;  5C0X C;  4BA2 B;  2PNZ A;  1OYP A;  2NN6 C;  3B4T A;  5C0X B;  2BA1 D;  5K36 D;  3KRN A;  4IFD F;  3M7N D;  4OO1 D;  3GME A;  4AM3 A;  3CDJ A;  1UDN A;  4BA1 A;  5JEA A;  5C0X E;  2NN6 E;  2JEB A;  3DD6 A;  2BR2 B;  3H1C A;  3L7Z B;  2NN6 F;  4IFD A;  2PNZ B;  5JEA D;  2JEA A;  3HKM A;  2BA0 G; 
#chains in the Genus database with same CATH topology
 4KHP I;  3PYE A;  4MQY A;  2AE8 A;  4FWH A;  1OYS A;  5K36 B;  4DR7 E;  4JV5 E;  4PU9 A;  4OO1 B;  1Z0W A;  3PYD A;  4LF6 E;  4DR6 I;  4LFA I;  4LF7 E;  4BA2 A;  2IOQ A;  2XEX A;  3K85 A;  1QZR A;  5K36 E;  1Z0B A;  4JI5 E;  3QT5 A;  1USU A;  4IFD D;  5FLX C;  1NZ0 A;  1PKP A;  4GKJ I;  4X62 I;  3M7N G;  5IWA E;  1KKH A;  2V34 A;  1HNX E;  1FJG I;  2E1R A;  4DR5 E;  4BA1 B;  5JEA B;  1ELO A;  4LCH A;  4P52 A;  1N33 I;  2V2Z A;  4JI0 I;  4B3R I;  2Z5E A;  4DUY E;  4RPF A;  4LF4 I;  5JEA E;  4DV5 E;  2F4V E;  1ZM2 A;  4JI1 I;  5LMU I;  1MU5 A;  1N0U A;  4DR1 E;  4X65 E;  4IZK B;  3GCM A;  2PO1 A;  2PO2 A;  3JAM C;  4PRV A;  4X66 I;  1H74 A;  4R1F A;  2HHH E;  4JI4 I;  1WUU A;  5BR8 I;  3WU5 A;  2ZM6 E;  2UXD I;  4DU8 A;  4JI6 I;  2E5L E;  2R42 A;  1UDS A;  5LMN E;  4IFD E;  1IBM E;  4WUC A;  4KQV A;  1EA6 A;  1OYP A;  2JT2 A;  1KVK A;  4DR3 I;  4DPW A;  3KRN A;  2A2D A;  4LFC I;  4X64 E;  1Y60 A;  3J81 C;  3CDJ A;  4WUB A;  1D6T A;  1UDN A;  4USK A;  4B3T I;  4LF8 I;  4MU1 A;  4DXL A;  3LTO A;  4NXN E;  2A2C A;  3ZZ0 A;  4JV5 I;  4QNK A;  1ZM4 A;  4YY3 I;  3OTO E;  4GKK I;  3DD6 A;  4LOM A;  1EI1 A;  4HXZ A;  4DPY A;  2NN6 F;  4JI7 I;  1HR0 I;  4OKG A;  5FLX Q;  4LCF A;  4HYM A;  3UHM A;  4LF9 I;  2O3Z A;  1ZM3 A;  2JEA A;  4NXM I;  4QNJ A;  3HKM A;  2BA0 G;  1B62 A;  2ZBK B;  4DV6 I;  1Z59 A;  2C39 B;  2C38 B;  1XMQ I;  3QT7 A;  1HNX I;  2Z5C A;  4HAC A;  4U3D A;  4LCG A;  4UT4 A;  4AIM A;  1N32 E;  4Z7Y A;  4DV0 E;  1FNM A;  2BM1 A;  1H72 C;  4MDT A;  4DV5 I;  1XMO E;  4DV7 I;  2F4V I;  1VIS A;  3P76 A;  5A2Q C;  4P7A A;  3JAM Q;  4X65 I;  1Y4U A;  5GME A;  1XHK A;  4FWD A;  2HHH I;  4JYA E;  3ZZT A;  3H4L A;  1XNQ E;  1OJ4 A;  2ZM6 I;  2Z5C B;  1FKA E;  5FWK A;  2E5L I;  1HNZ I;  2Z5B A;  4LFB E;  3WU6 A;  1S4E A;  4B3S E;  2DEJ A;  1IBM I;  2NPF A;  5L3J A;  1RHY A;  4MYT A;  3J81 Q;  4OO1 E;  3V2U C;  4JI3 E;  3U1K A;  1UEK A;  4X64 I;  1Z0V A;  5JEA F;  4AQY I;  4DV2 E;  2HKJ A;  4DR4 E;  4M1K A;  4YHH I;  2WNR A;  3ZKD A;  5DRQ A;  4MU0 A;  1USV A;  3HUL A;  2VQE E;  4NXN I;  4NBQ A;  2VF3 A;  2UUC E;  3OTO I;  1OYR A;  4JI8 E;  3M85 D;  3T1Y E;  1RR9 A;  2Z5B B;  4DR2 I;  3NZK A;  1FWK A;  4BA2 B;  4FW5 A;  4MU4 A;  3B4T A;  2BA1 D;  2UXB I;  1IBK I;  4IFD F;  2UXC E;  2HK2 A;  3B82 A;  3GME A;  1Z0E A;  4DV1 E;  4FWG A;  2V2Q A;  4JI2 E;  2UUA I;  5IT9 C;  2ZIT A;  2O1T A;  2JEB A;  3T1H I;  2OI2 A;  3H1C A;  4ZVI A;  1ZXN A;  4OX9 E;  4OZE A;  1ZXM A;  2CG9 A;  5A2Q Q;  1XMO I;  3Q1Q A;  1HNW E;  4DV4 I;  3B78 A;  1I94 E;  1Y4S A;  2PO1 B;  2PO2 B;  3ZZU A;  3GON A;  4FN5 A;  1P42 A;  3ZM7 A;  4DR7 I;  3PS1 A;  4HY1 A;  4LFA E;  2JEB B;  4K0K E;  4LF6 I;  2J7K A;  4XTJ A;  5C0X F;  2PO0 A;  1B63 A;  4LF7 I;  5EL9 A;  1PIE A;  5C0X A;  2HFU A;  4B3S I;  2HKE A;  2NN6 A;  2HK3 A;  1UDO A;  4JI5 I;  3V5R A;  1Y6Z A;  4GKJ E;  2WP8 A;  4JI3 I;  4X62 E;  2O1V A;  2DEI A;  4LPF A;  1N36 E;  2BA1 G;  2VQF E;  4DV2 I;  3Q6M A;  2IOP A;  5IWA I;  1FJG E;  2R3V A;  4IS9 A;  1IBL E;  2BR2 A;  2V8P A;  2UUC I;  1N33 E;  4DR5 I;  1S16 A;  1HK7 A;  4MYU A;  3T1Y I;  4JI0 E;  2Q2E B;  4B3R E;  4FW3 A;  1E3P A;  3D4J A;  1N0V C;  1Z0G A;  2PO0 B;  4LF4 E;  4DUY I;  5DNL A;  3K1J A;  4B3M E;  4JI1 E;  1FI4 A;  2NN6 B;  1E3H A;  4DUZ E;  4FW7 A;  3Q6N A;  2UXC I;  2LJP A;  3J80 C;  4DR1 I;  2WP8 B;  3QT6 A;  2X7I A;  4FW9 A;  5K36 F;  4U3B A;  4DV1 I;  5K36 A;  4I3H A;  2JEA B;  4OO1 F;  2UU9 E;  2GO3 A;  4FW4 A;  4OO1 A;  2BV3 A;  3PYF A;  2BM0 A;  5LL6 R;  2VES A;  1Z5B A;  1NHJ A;  2CVE A;  4HAC B;  3HJC A;  2CZ9 A;  1UDQ A;  4PRX A;  3K17 A;  5LMN I;  5C0X C;  1U2R A;  2PNZ A;  4OX9 I;  2NN6 C;  4DR3 E;  4DV3 E;  4DPT A;  4LFC E;  1BKN A;  1YH8 A;  2CGE A;  5DNX A;  1N34 E;  3P06 A;  5EKW A;  1HNW I;  3M6A A;  4B3T E;  4LF8 E;  1I94 I;  4BA1 A;  5JEA A;  4FW6 A;  1VI7 A;  4LF5 E;  4IZJ A;  4YY3 E;  4GKK E;  2GO4 A;  4GQU A;  3P3E A;  4K0K I;  4JI7 E;  1HR0 E;  2UUB E;  1XXE A;  1ZM9 A;  4LF9 E;  2PNZ B;  4IZK A;  4NXM E;  2O1W A;  4DV6 E;  3LPS A;  1N36 I;  4IFD A;  4ED4 A;  2VQF I;  1XMQ E;  5K36 C;  1J5E E;  1A6F A;  1DAR A;  1IBL I;  4OO1 C;  2WNR B;  4IZJ B;  1H73 A;  4Z7C A;  4UTG A;  1N32 I;  3QT8 A;  4JG4 A;  2C37 A;  1R6L A;  1YHC A;  4DV0 I;  1XNR E;  4DV7 E;  2BA0 D;  4B3M I;  3J80 Q;  2JE6 A;  2EFG A;  4DUZ I;  4ISA A;  3P3C A;  1Z5A A;  2O1U A;  1Z5C A;  3J7A M;  3P3G A;  4KHP E;  4IFD B;  1Y5Y A;  4DPU A;  2UU9 I;  3GLL A;  4JYA I;  5JEA C;  1XNQ I;  3PYG A;  5DRR A;  5C0X D;  4DR6 E;  1HNZ E;  2NN6 D;  2GS8 A;  4LFB I;  4DPX A;  3M85 G;  4J3D A;  1FWL A;  2C37 B;  2X36 A;  4DV3 I;  2IER A;  2JE6 B;  1N34 I;  2C39 A;  2C38 A;  4AQY E;  2AJ4 A;  4IFD C;  1MX0 A;  4YHH E;  4AID A;  5ELW A;  4URL A;  3J7A G;  4DU7 A;  4DR4 I;  4MU3 A;  1H7U A;  3U1Y A;  1RRE A;  4LF5 I;  3WU4 A;  4USM A;  2VQE I;  1KIJ A;  1MG7 A;  2HFS A;  3WU3 A;  4JI8 I;  3L7Z A;  3PS3 A;  2UUB I;  1H7S A;  3B8H A;  2V2V A;  4DR2 E;  3CDI A;  1R6M A;  1Z0T A;  2UXB E;  5C0X B;  1IBK E;  5K36 D;  5GMD A;  5LMU E;  4N3O A;  2J65 A;  3LNU A;  4EMD A;  3M7N D;  4OO1 D;  2GQ0 A;  4AM3 A;  2PNM A;  4X66 E;  1KTV A;  1NHH A;  1NHI A;  1K47 A;  5DRO A;  1J5E I;  3CWV A;  2UUA E;  4JI4 E;  5C0X E;  5IT9 Q;  5BR8 E;  4JI2 I;  2NN6 E;  2F1D A;  3T1H E;  2UXD E;  2WW4 A;  4JI6 E;  2BR2 B;  1PVG A;  2PNL A;  3L7Z B;  5DRP A;  1XNR I;  2IES A;  3PS2 A;  5JEA D;  4WUD A;  3ZKB A;  1Z0C A;  4IZJ D;  3PRY A;  4DV4 E;  3F0N A; 
#chains in the Genus database with same CATH homology
 2C39 B;  2C38 B;  5K36 C;  2PO1 B;  2PO2 B;  1OYS A;  5K36 B;  4OO1 C;  2WNR B;  4OO1 B;  4AIM A;  2JEB B;  5C0X F;  4BA2 A;  2PO0 A;  5C0X A;  2C37 A;  1R6L A;  5K36 E;  2NN6 A;  4IFD D;  2BA0 D;  1UDO A;  2JE6 A;  2WP8 A;  2BA1 G;  3M7N G;  4IFD B;  3GLL A;  5JEA C;  2BR2 A;  4BA1 B;  5JEA B;  5C0X D;  2NN6 D;  1E3P A;  2PO0 B;  3M85 G;  2C37 B;  5JEA E;  2NN6 B;  1E3H A;  4OO1 E;  2JE6 B;  3U1K A;  2C39 A;  2C38 A;  2WP8 B;  5K36 F;  3GCM A;  5JEA F;  2PO1 A;  2PO2 A;  4IFD C;  5K36 A;  4AID A;  2JEA B;  4OO1 F;  2WNR A;  4OO1 A;  4NBQ A;  1OYR A;  3M85 D;  3L7Z A;  1UDS A;  1UDQ A;  4IFD E;  3CDI A;  1R6M A;  5C0X C;  4BA2 B;  2PNZ A;  1OYP A;  2NN6 C;  3B4T A;  5C0X B;  2BA1 D;  5K36 D;  3KRN A;  4IFD F;  3M7N D;  4OO1 D;  3GME A;  4AM3 A;  3CDJ A;  1UDN A;  4BA1 A;  5JEA A;  5C0X E;  2NN6 E;  2JEB A;  3DD6 A;  2BR2 B;  3H1C A;  3L7Z B;  2NN6 F;  4IFD A;  2PNZ B;  5JEA D;  2JEA A;  3HKM A;  2BA0 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...