3J81C

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j81C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81C02
1Z5CA 2Q2EB 1Z5BA 1Z0TA 3H4LA 5A2QQ 1NHIA 5IWAI 1Z0EA 4HACA 5LL6R 1QZRA 3J7AG 2HKJA 4Z7CA 4DR2I 1XHKA 2OI2A 4JI4I 4MYTA 2VQEE 2VQFE 4LF5I 3OTOI 4B3MI 2ZITA 3LPSA 3QT7A 2UU9E 4LF4I 4M1KA 1IBLE 4LF6E 2UXCE 4DV0E 4X64I 1HNZI 1FWLA 4DV4I 4KQVA 4USKA 2V2QA 1Z0GA 4LF7E 4NXNE 2CZ9A 5BR8E 4JI2I 4I3HA 3LNUA 4KHPE 4DUZE 3QT8A 1KTVA 3T1HE 2V2VA 4P7AA 1H7UA 1FJGE 4JI7E 4DR4E 3WU6A 1KIJA 2XEXA 1NHHA 4DPXA 2F4VI 1H73A 2A2DA 5IWAE 5LMUE 4DV5I 1ZM4A 4YY3I 1H74A 4DR2E 1HR0E 1ZM9A 2E5LE 2HK3A 1DARA 3OTOE 4LF6I 3ZKBA 1Z0CA 4DV0I 4DU7A 4B3ME 1D6TA 1A6FA 4WUBA 4DV3I 4LFBI 4K0KE 4NXNI 1HNWE 1XNRI 4DPYA 4X64E 1HNZE 4PU9A 2BM0A 1U2RA 4P52A 4DV4E 1I94I 3B82A 4JI5I 3M6AA 2DEJA 4LFAE 2AJ4A 1NHJA 4X62I 2BV3A 3D4JA 4PRXA 4JI2E 1PVGA 4JI7I 4DR4I 4FWGA 4Z7YA 4GKJI 2DEIA 3J81C 1HNXE 5LMUI 3K17A 1PIEA 3PYEA 1XMQI 2F4VE 2UUBI 5IT9Q 4R1FA 2V34A 1HR0I 4LFCI 2E5LI 1B63A 4DV6I 1Z59A 4DV5E 1XMOI 4XTJA 4YY3E 1ZXMA 3ZZUA 4AQYI 1IBMI 3PYFA 4DPWA 4DR3I 2BM1A 4LF8I 4K0KI 2R3VA 1N34E 3B8HA 3QT6A 4UTGA 4DR5I 1HNWI 4EMDA 4DV1I 4DV3E 2V2ZA 3V2UC 4LFBE 1N36E 4JI6I 3JAMC 5GMDA 1ZM3A 4LFAI 1XNRE 4B3TI 1XNQI 4DR7I 4JI8I 1I94E 1S4EA 4FWHA 1N0UA 1FNMA 4B3SI 4JI5E 1OJ4A 1FWKA 1MX0A 1PKPA 1ZM2A 4X62E 1N33E 1HNXI 4JYAI 3J81Q 5LMNI 2X36A 1Z0WA 1N0VC 4GKJE 1N32I 1J5EI 5IT9C 4HYMA 1XMQE 2UUBE 2HK2A 4JI0I 4DUYI 3J7AM 4DR1I 4LFCE 4DV6E 1N34I 1XMOE 3HULA 4HXZA 2UUAE 4LF9I 3QT5A 4AQYE 5FLXQ 1IBME 4USMA 4DR3E 4JI1I 1N36I 4LF8E 4DPTA 1VISA 4DPUA 3ZM7A 4DR5E 1NZ0A 3JAMQ 2UXBE 4DV1E 1RR9A 2UXDI 3Q1QA 4OX9I 1MG7A 4JI6E 4B3RE 1N33I 4JI3I 1Z0VA 4B3TE 4DV7I 4ZVIA 1XNQE 4DR7E 4JI8E 2WW4A 4NXME 2UUCE 2ZBKB 4B3SE 3B78A 2HHHI 3WU4A 4JYAE 1IBKE 5LMNE 3PYGA 4DR6I 1S16A 3F0NA 5L3JA 1K47A 1MU5A 1N32E 1J5EE 3PYDA 2UUAI 3V5RA 4JV5I 1RREA 1ELOA 4JI0E 2HKEA 4DUYE 4DR1E 2GS8A 4DU8A 1Z5AA 3T1YI 5GMEA 4HY1A 5FLXC 2UXBI 4LF9E 4FWDA 4X66I 4FN5A 3J80Q 1EI1A 4RPFA 4JI1E 4B3RI 3GONA 4YHHI 2EFGA 2UXDE 4X65I 4NXMI 4OX9E 2UUCI 4DXLA 1H72C 4GKKI 2VF3A 3CWVA 1H7SA 2ZM6E 2R42A 4JI3E 4DV7E 4DV2I 1IBKI 3LTOA 4ED4A 2HHHE 4JG4A 1Z0BA 4DR6E 4UT4A 4WUCA 2J7KA 4URLA 5A2QC 1KKHA 2A2CA 3ZKDA 2NPFA 4JV5E 2VQEI 1WUUA 4HACB 3K1JA 2VQFI 1ZXNA 3T1YE 4FW9A 2UU9I 4JI4E 3J80C 1B62A 2HFSA 4WUDA 4X66E 1BKNA 1KVKA 4LF5E 1FI4A 1IBLI 4PRVA 2UXCI 1EA6A 3ZZ0A 2ZM6I 4LF4E 3WU3A 4YHHE 2V8PA 2X7IA 4X65E 4LF7I 3WU5A 2HFUA 5BR8I 4GKKE 1UEKA 4KHPI 4DUZI 4DV2E 4MYUA 1FKAE 3ZZTA 3T1HI 2LJPA 1FJGI 2E1RA
chains in the Genus database with same CATH superfamily
2EN1A 1Z5CA 4QNKA 1P42A 4HTGA 4MLQA 2Q2EB 1Z5BA 2BA0D 1Z0TA 3H4LA 5A6JA 5A2QQ 5K36C 2Q8UA 1NHIA 2J65A 1Z0EA 4OZEA 2GLIA 5IWAI 4Q35B 3TQMA 5JEAA 1Y60A 4KWYA 2LCEA 4HACA 5C0XD 5K36B 2DMIA 5LL6R 1QZRA 1GQEA 3J7AG 4WFTA 5DNYA 2EOXA 2HKJA 4IZJD 5AC4A 4Z7CA 4GQUA 1X49A 4DR2I 1IQSA 2EMAA 2V85A 1XHKA 3HQ1A 2OI2A 4JI4I 4MYTA 2VQEE 2EM2A 2B7TA 2LUPB 2YPNA 3U1YA 2YRMA 4O4KA 2VQFE 2WP8A 2BBGA 2L33A 1TF3A 1TF6A 3OTOI 2CT1A 2JEBB 4LF5I 4BC9A 4F6MA 2CPNA 2GHFA 2IHR1 3P76A 3PRYA 5C0XC 2KONA 4B3MI 2ZITA 3LPSA 3QT7A 2UU9E 2C38B 4LF4I 5C0XB 4R2RA 2YU8A 5KL7A 1G2DC 4FW7A 2V89A 1LLMC 1BB8A 3L7ZA 4M1KA 4IZJB 2DB2A 2N3HA 2NN6D 4OO1F 4F9BB 1IBLE 4LF6E 4ZYEA 4R2DA 2UXCE 4DV0E 2PO1B 4X64I 4FW4A 1HNZI 2EM5A 4FK5C 2F1DA 2IOQA 1FWLA 2HC5A 4DV4I 3KWRA 1NEIA 4WX9A 2ENHA 4KQVA 4USKA 2V2QA 2MDRA 3K85A 3B4TA 4LF7E 2EQ0A 4O5GA 1Z0GA 4NXNE 1Z1BA 1E3HA 2EPZA 2CZ9A 5BR8E 4JI2I 3THNA 1EKZA 1DI2A 4BC7A 1YH8A 2NN6C 2MKNA 3CDIA 4I3HA 2YTNA 3ZOQB 3LNUA 4KHPE 2YTOA 2EQ3A 4DUZE 4MU4A 2IERA 2NN6B 2EOYA 2EPRA 3QT8A 5AASA 2DGCA 1A1LA 2C39A 1KTVA 2O3ZA 3T1HE 4F9AB 1T38A 2V2VA 4P7AA 1FJGE 1H7UA 4JI7E 4DR4E 2EOEA 2NUEA 3WU6A 1KIJA 2WNRB 2EMHA 2EPPA 1NHHA 2XEXA 4DPXA 1YUIA 2F4VI 1H73A 4GEQB 2A2DA 2BR2B 2V88A 5IWAE 5TSEA 2EPMX 1Y6ZA 4I8OA 2HGHA 2V8QB 1T4OA 2YTPA 5LMUE 4DV5I 2KOUA 2LUQA 1YFHA 2JEBA 1ZM4A 4OO1E 1ZU1A 2MDGA 3EPLA 2D9HA 2PO2A 1H74A 2EJ4A 4YY3I 2JE6A 4DR2E 3DJWA 4M2ZA 1HR0E 5C0XA 2BA1D 3H09A 2CSHA 1ZM9A 4OKGA 3F6HA 2E5LE 2HK3A 4R03A 5A69A 5F3WA 3UHMA 1R6MA 5KL2A 3OTOE 1DARA 2EM4A 1A1HA 2E72A 1E3PA 4LF6I 2B9DA 1USVA 2WBTA 3ZKBA 1Z0CA 2EPLX 3M7ND 4DU7A 4DV0I 3BF2A 4B3ME 2EMGA 1D6TA 1BBOA 1A6FA 2YRHA 4IFDC 2PO0A 3BIDA 2ENAA 2N3GA 4WUBA 1KJKA 4DV3I 2K7IA 4ZYGA 3LMLA 4LFBI 2RTXA 4K0KE 2N8XA 4MU1A 2EOOA 2O1VA 3MHHC 1HNWE 4NXNI 1XNRI 4DPYA 2YTDA 4X64E 2JT2A 1HNZE 1YSAC 4PU9A 2BM0A 2JEAB 2C37A 4IS9A 2DLKA 2EOSA 4DV4E 1U2RA 4P52A 1I94I 4F9CB 2JXPA 1TN9A 4M30A 1ZBTA 1PJTA 4GZNC 2CTDA 3B82A 4JI5I 4F2JC 3M6AA 2DEJA 4LFAE 2EMLA 3AV0A 1NHJA 2AJ4A 4X62I 2EOMA 2V86A 2BV3A 3D4JA 4PRXA 4JI2E 2EN7A 1PVGA 4JI7I 4DR4I 1STUA 2PNZB 1A1IA 2WCC3 1A1JA 2RS6A 4FWGA 1A1KA 2YTGA 3JTZA 2JP9A 3M85G 5IXMB 4Z7YA 4GKJI 2DEIA 3J81C 1HNXE 1QNTA 1WXRA 1EH6A 5LMUI 4LCGA 2LTRA 2EM8A 2L6MA 1B69A 3K17A 3C6KA 2LE2A 1WJPA 4BHBA 2EOJA 1PIEA 2VESA 2F4VE 2EP3A 2MC6A 1OYSA 3PYEA 1XMQI 2UUBI 5IT9Q 1X5WA 4R1FA 3M85D 2V34A 3J7Yp 1HR0I 1X6EA 3HTXA 1IMUA 3IWBA 3PS3A 3EPHA 4LFCI 4RH8A 2E5LI 3KZZA 2YRKA 1B63A 4DV6I 1Y5YA 2L2NA 2BB8A 3BBGA 4DV5E 1Z59A 3GMEA 5JEAE 1XMOI 1WHQA 3P3GA 3F6GA 4XTJA 2YTQA 4YY3E 4QNJA 2LMZA 4OO1B 3P1XA 2RPCA 1ZXMA 3ZZUA 4AQYI 2EM0A 2EN2A 1IBMI 3PYFA 4BMJA 2EL6A 4ZYDA 2YSOA 4DPWA 2EMWA 2L2KB 4DR3I 2BM1A 4LF8I 4IFDA 4K0KI 2R3VA 1N34E 2LRSA 1O0WA 2EMKA 4WSPA 4M9VC 2Z5CA 2EMFA 3B8HA 2EM7A 3QT6A 4UTGA 4DR5I 1HNWI 5AE1A 1KYQA 5K36F 4R2AA 4KZSA 4EMDA 4BA2A 2YZTA 4DV1I 4DV3E 3BGHA 2LJHA 2V2ZA 2IESA 4LFBE 3V2UC 2YTIA 1N36E 4JI6I 2EZ6A 3JAMC 2FTXB 2M1SA 1ZM3A 2E1MA 5GMDA 4LFAI 3VHTB 1XNRE 2WBUA 1L4SA 4BA1B 2LV2A 4IZKB 1RQ0A 4B3TI 1RHYA 1XNQI 4DR7I 2LT7A 4JI8I 4M0VA 4NXMI 1I94E 1S4EA 4FWHA 1N0UA 2EN6A 4IS1C 4FW3A 3EPKA 1DQ3A 1FNMA 4B3SI 5C0XF 1MEYC 1YYOA 4JI5E 1OJ4A 2HJJA 1FWKA 1MX0A 1PKPA 1ZM2A 4X62E 1N33E 1HNXI 4JYAI 2RQLA 3L00A 5K36A 2J7JA 3GLLA 3J81Q 2GPIA 2CVEA 5LMNI 2F8BA 2X36A 1Z0WA 2L2MA 2L3JA 2GQ0A 2EM3A 3P06A 1WRJA 4MU0A 1N0VC 2FV4B 5JEAD 3P3CA 2Z5BB 4GKJE 1AAYA 4RHBB 1N32I 1J5EI 2EMYA 2ELZA 4FW6A 2A25A 5IT9C 4HYMA 2EORA 3MHSC 2JYAA 3IWDA 1XMQE 2YTFA 1UDSA 2GO4A 2V83A 1YUJA 2DRPA 2UUBE 4LOMA 2C38A 2HK2A 4JI0I 4DUYI 1NCSA 2EWLA 4DR1I 4LFCE 5KL6A 2EMIA 4MDTA 5T6JA 5JEAC 3J7AM 1FJGI 4DV6E 2LBSB 5AC5A 1N34I 1RC7A 1XMOE 3HULA 4IZJA 4HXZA 3P3EA 5JEAB 2JPAA 2UUAE 2NUGA 4LF9I 3QT5A 2FGGA 2JOXA 1UBDC 4AQYE 2NUFA 2PO1A 2RSMA 2PRTA 4F6NA 1IBME 5FLXQ 4LCFA 2EOZA 4U3BA 2PNLA 4USMA 1UILA 2NA2A 4DR3E 4LTYA 4JI1I 2PNMA 2JY9A 4LF8E 2JWOA 1N36I 3ADIA 3HJCA 4DPTA 4MLVA 1VISA 5C0XE 4N4RB 4DPUA 2G7HA 4DR5E 1NZ0A 3ZM7A 3JAMQ 2RS7A 2UXBE 2ODRD 3KZYA 2WBSA 3DF6A 2YSPA 4AM3A 2MC5A 4DV1E 5EL9A 1RR9A 1AH5A 3GCMA 3LLHA 4U3DA 2EMCA 3Q1QA 2UXDI 1G2FC 4OX9I 2DMYA 1MG7A 2NN6A 2JR1A 4JI6E 3EPJA 1T4NA 2I9IA 4B3RE 2EPCA 2M4IA 2EPAA 1N33I 4JI3I 2AE8A 1Z0VA 1PJQA 4B3TE 2VF1A 4DV7I 4ZVIA 4LU9A 1XNQE 4BHCA 4DR7E 1R6LA 4JI8E 1UDNA 3L7ZB 2WW4A 2ODRC 4NXME 1YZ9A 2WNRA 3HPZA 2UUCE 2O1TA 2ZBKB 4B3SE 5A6AA 2O1UA 3B78A 2BR2A 3C4TA 2EN3A 3WU4A 2HHHI 4OO1D 4IFDF 2YWQA 2EL5A 4OOGC 4JYAE 1DGCA 4TUIA 1IBKE 5LMNE 2M9AA 3ADGA 1T39A 2V87A 3PYGA 2EMXA 4DR6I 1UHZA 3PS1A 1VI7A 1S16A 3F0NA 1A1FA 3U1KA 5AE3A 2LTSA 4R2SA 1UDQA 3C6MA 5L3JA 2EOIA 4R8OA 3IWCA 1K47A 1MU5A 1N32E 1J5EE 4OO1C 3PYDA 4WXCA 4AIDA 5FWKA 2C39B 2RSIA 3VK6A 4F54A 3V5RA 2UUAI 4JV5I 4J3DA 4R2EA 4LPFA 1RREA 4JI0E 1MGTA 2JVAA 2EOHA 5KL4A 4R2PA 1ELOA 2HKEA 4DUYE 4DR1E 2JOBA 2CG9A 2GS8A 3NZKA 4DU8A 1SR9A 2EPUA 1Z5AA 3T1YI 2KHXA 5GMEA 4HY1A 1YPNA 1Y4UA 1HK7A 4TUGA 4WXDA 5A6BD 5FLXC 1J26A 5DRPA 2UXBI 4LF9E 4FWDA 5DNLA 3M99B 3UK3C 2EM9A 4X66I 2JEAA 4FN5A 1P47A 1EI1A 1EH7A 1USUA 3J80Q 3HKMA 4RPFA 5AE2A 4X8WA 3H1CA 4JI1E 2YU5A 2L3CA 2PO2B 4HEIA 4ZYHA 2JE6B 2EPXA 4BBYA 1X3CA 4B3RI 3HXLA 4IFDE 1N3GA 3GONA 2CGEA 4YHHI 1JK1A 1A1GA 2EFGA 4AIMA 2UXDE 2B7VA 4X65I 2R76A 1Y4SA 2PNZA 1QU6A 4IJDA 4OX9E 2EMBA 3DD6A 2UUCI 4DXLA 2GO3A 1H72C 4GKKI 5KL3A 2PO0B 2VF3A 3JU0A 4Q28A 2ZM6E 1JK2A 1H7SA 3CWVA 4JI3E 3C4BA 4R2QA 2R42A 1X6HA 2EN4A 2ELYA 4DV7E 4BCAA 4DV2I 1IBKI 4DKKA 3MSWA 4WSGA 1ZAAC 5DNXA 1IQOA 4NBQA 2L92A 3LTOA 3VYYA 4ED4A 2HHHE 2C37B 3ADJA 4R2CA 2LO3A 3CDJA 2R1FA 2K4VA 1PJSA 3ADLA 4JG4A 2WZOA 2EOQA 2B3TB 1Z0BA 5DRRA 1YHCA 4DR6E 1YYWA 3EQ1A 5K36E 4P78A 2EM6A 4OO1A 1X47A 1ZR9A 2EQ1A 4UT4A 2EPKX 4WUCA 2NN6F 2J7KA 5ELWA 5KL5A 4URLA 1SFEA 2LJUA 3OMLA 4L5NC 5A2QC 1GZ6A 2YTJA 5A6KA 2ADRA 1KKHA 2A2CA 4J8ZA 4NZVA 1OYPA 3ZKDA 3HPSA 2EMZA 2H36X 4JV5E 2NPFA 2MKDA 1WUUA 2BA1G 4HACB 2VQEI 1GTKA 2VRDA 4NHRA 4WYQB 3RMPA 1PDAA 3K1JA 2VQFI 5DRQA 4O24A 1ZBQA 1X6FA 4IFDD 1YYKA 5LLQA 2I13A 3PS2A 4BS9A 2VE7C 3ECRA 1ZXNA 3M7NG 2EPOA 3T1YE 4P7DA 4FW9A 2UU9I 4O43A 2ENCA 4JI4E 5IV8B 4BA1A 3J80C 1B62A 2HFSA 2WP8B 4FW5A 2M7QA 2EL4A 2EN8A 3Q6MA 4IZKA 4WUDA 4X66E 1BKNA 1KVKA 2NABA 1X48A 4LF5E 4WPYA 1FI4A 1OYRA 3KRNA 1IBLI 1EH8A 3FIGA 4ISAA 4DMIA 4PRVA 2UXCI 3K6QA 1UN6B 5A6BA 1EA6A 3QG5C 4N3OA 3VYXA 3ZZ0A 1F2IG 2ZM6I 4LF4E 2YTEA 3WU3A 2L8TA 4YHHE 2LVHA 2DLQA 3THOB 2V8PA 2X7IA 4MQYA 4IFDB 2DIXA 2EOFA 2Z5CB 5JEAF 4X65E 1XXEA 4L8NA 4X9JA 5CFFE 4LF7I 3WU5A 2YT4A 3Q6NA 2Z5EA 2HFUA 5BR8I 4GKKE 4BA2B 1RMDA 5EKWA 2Z5BA 1UEKA 1UDOA 5K36D 4LCHA 2NN6E 4MU3A 4KHPI 2EPNA 2BA0G 4DUZI 4DV2E 3AUZA 4MYUA 2IOPA 1FKAE 5ADZA 5DROA 1BBGA 1T4LB 3ZZTA 3T1HI 1WHNA 2DSYA 2O1WA 2LJPA 2EE8A 2E1RA
chains in the Genus database with same CATH topology
1Z5CA 2Q2EB 1Z5BA 1Z0TA 3H4LA 5A2QQ 1NHIA 5IWAI 1Z0EA 4HACA 5LL6R 1QZRA 1GQEA 3J7AG 4WFTA 5DNYA 2HKJA 4IZJD 4Z7CA 1X49A 4DR2I 2V85A 1XHKA 3HQ1A 2OI2A 4JI4I 4MYTA 2VQEE 2B7TA 2LUPB 2VQFE 2L33A 4LF5I 3OTOI 4BC9A 2CPNA 2IHR1 3PRYA 2KONA 4B3MI 2ZITA 3LPSA 3QT7A 2UU9E 4LF4I 2V89A 4M1KA 4IZJB 2DB2A 2N3HA 4F9BB 1IBLE 4LF6E 2UXCE 4DV0E 4X64I 1HNZI 2IOQA 1FWLA 4DV4I 3KWRA 4KQVA 4USKA 2V2QA 2MDRA 3K85A 4LF7E 1Z0GA 4NXNE 2CZ9A 5BR8E 4JI2I 1EKZA 1DI2A 4BC7A 4I3HA 3ZOQB 3LNUA 4KHPE 4DUZE 3QT8A 5AASA 1KTVA 3T1HE 4F9AB 2V2VA 4P7AA 1FJGE 1H7UA 4JI7E 4DR4E 2NUEA 3WU6A 1KIJA 2XEXA 1NHHA 4DPXA 2F4VI 1H73A 4GEQB 2A2DA 2V88A 5IWAE 1Y6ZA 4I8OA 2V8QB 1T4OA 5LMUE 4DV5I 2KOUA 2LUQA 1ZM4A 4YY3I 1H74A 4DR2E 3DJWA 4M2ZA 1HR0E 3H09A 1ZM9A 3F6HA 2E5LE 2HK3A 4R03A 5F3WA 3OTOE 1DARA 4LF6I 2B9DA 1USVA 3ZKBA 1Z0CA 4DU7A 4DV0I 4B3ME 1D6TA 1A6FA 2N3GA 4WUBA 4DV3I 3LMLA 4LFBI 2RTXA 4K0KE 2O1VA 1HNWE 4NXNI 1XNRI 4DPYA 4X64E 1HNZE 4PU9A 2BM0A 4DV4E 1U2RA 4P52A 1I94I 4F9CB 4M30A 1ZBTA 3B82A 4JI5I 3M6AA 2DEJA 4LFAE 2AJ4A 3AV0A 1NHJA 4X62I 2V86A 2BV3A 3D4JA 4PRXA 4JI2E 1PVGA 4JI7I 4DR4I 1STUA 2RS6A 4FWGA 3JTZA 4Z7YA 4GKJI 2DEIA 3J81C 1HNXE 1WXRA 5LMUI 2LTRA 2L6MA 3K17A 2LE2A 1PIEA 3PYEA 2F4VE 2MC6A 1XMQI 2UUBI 5IT9Q 4R1FA 2V34A 3J7Yp 1HR0I 3HTXA 3IWBA 4LFCI 2E5LI 1B63A 4DV6I 1Z59A 2L2NA 4DV5E 1XMOI 1WHQA 3F6GA 4XTJA 4YY3E 2LMZA 3P1XA 1ZXMA 3ZZUA 4AQYI 1IBMI 3PYFA 4BMJA 4DPWA 2L2KB 4DR3I 2BM1A 4LF8I 4K0KI 2R3VA 1N34E 2LRSA 1O0WA 4WSPA 2Z5CA 3B8HA 3QT6A 4UTGA 4DR5I 1HNWI 5AE1A 4KZSA 4EMDA 2YZTA 4DV1I 4DV3E 2LJHA 2V2ZA 4LFBE 3V2UC 1N36E 4JI6I 2EZ6A 3JAMC 2FTXB 2M1SA 1ZM3A 2E1MA 5GMDA 4LFAI 1XNRE 4IZKB 1RQ0A 4B3TI 1XNQI 4DR7I 4JI8I 4M0VA 1I94E 1S4EA 4FWHA 1N0UA 1DQ3A 1FNMA 4B3SI 1YYOA 4JI5E 1OJ4A 1FWKA 1MX0A 1PKPA 1ZM2A 4X62E 1N33E 1HNXI 4JYAI 3J81Q 5LMNI 2F8BA 2X36A 1Z0WA 2L3JA 2L2MA 2GQ0A 3P06A 1N0VC 2FV4B 2Z5BB 4GKJE 1N32I 1J5EI 5IT9C 4HYMA 3IWDA 1XMQE 2V83A 2UUBE 2HK2A 4JI0I 4DUYI 3J7AM 2EWLA 4DR1I 4LFCE 5T6JA 4DV6E 2LBSB 1N34I 1RC7A 1XMOE 3HULA 4IZJA 4HXZA 2UUAE 2NUGA 4LF9I 3QT5A 2FGGA 2JOXA 2NUFA 4AQYE 2RSMA 1IBME 5FLXQ 2PNLA 4USMA 1UILA 2NA2A 4DR3E 4LTYA 4JI1I 2PNMA 2JY9A 4LF8E 2JWOA 1N36I 3ADIA 3HJCA 4DPTA 1VISA 4DPUA 2G7HA 4DR5E 1NZ0A 3ZM7A 3JAMQ 2RS7A 2UXBE 2ODRD 3DF6A 2MC5A 4DV1E 1RR9A 2UXDI 3Q1QA 3LLHA 4OX9I 2DMYA 1MG7A 2JR1A 4JI6E 1T4NA 4B3RE 2M4IA 1N33I 4JI3I 1Z0VA 4B3TE 2VF1A 4DV7I 4ZVIA 4LU9A 1XNQE 4DR7E 4JI8E 2WW4A 2ODRC 4NXME 1YZ9A 3HPZA 2UUCE 2O1TA 2ZBKB 4B3SE 2O1UA 3B78A 2HHHI 3C4TA 3WU4A 4OOGC 4JYAE 4TUIA 1IBKE 5LMNE 3ADGA 3PYGA 2V87A 4DR6I 1UHZA 1S16A 3F0NA 5AE3A 2LTSA 5L3JA 4R8OA 3IWCA 1K47A 1MU5A 1N32E 1J5EE 3PYDA 5FWKA 3VK6A 4F54A 3V5RA 2UUAI 4JV5I 1RREA 4JI0E 2JVAA 1ELOA 2HKEA 4DUYE 4DR1E 2JOBA 2CG9A 2GS8A 4DU8A 1SR9A 1Z5AA 3T1YI 2KHXA 5GMEA 4HY1A 1Y4UA 1HK7A 4TUGA 5FLXC 1J26A 2UXBI 4LF9E 4FWDA 4X66I 4FN5A 3J80Q 1EI1A 1USUA 4RPFA 5AE2A 4X8WA 4JI1E 2L3CA 4BBYA 4B3RI 3HXLA 3GONA 2CGEA 4YHHI 2EFGA 2UXDE 2B7VA 4X65I 4NXMI 1Y4SA 1QU6A 4OX9E 2UUCI 4DXLA 1H72C 4GKKI 2VF3A 3JU0A 4Q28A 1H7SA 2ZM6E 3CWVA 4JI3E 3C4BA 2R42A 4DV7E 4BCAA 4DV2I 1IBKI 4DKKA 3MSWA 2L92A 3LTOA 3VYYA 4ED4A 2HHHE 3ADJA 2K4VA 3ADLA 4JG4A 2WZOA 2B3TB 1Z0BA 4DR6E 1YYWA 4P78A 1X47A 4UT4A 4WUCA 2J7KA 4URLA 5A2QC 3OMLA 4L5NC 1GZ6A 1KKHA 2A2CA 4J8ZA 3ZKDA 3HPSA 2H36X 4JV5E 2NPFA 1WUUA 4HACB 2VQEI 4WYQB 3RMPA 3K1JA 2VQFI 1ZBQA 1YYKA 4BS9A 2VE7C 1ZXNA 3T1YE 4P7DA 4FW9A 2UU9I 4JI4E 3J80C 1B62A 2HFSA 4IZKA 4WUDA 2M7QA 3Q6MA 4X66E 1BKNA 1KVKA 1X48A 4LF5E 4WPYA 1FI4A 1IBLI 3FIGA 4DMIA 4PRVA 2UXCI 3K6QA 1EA6A 3ZZ0A 4N3OA 3VYXA 2ZM6I 4LF4E 3WU3A 2L8TA 4YHHE 2V8PA 2X7IA 2DIXA 2Z5CB 4X65E 4L8NA 5CFFE 4LF7I 3WU5A 2YT4A 3Q6NA 2Z5EA 2HFUA 5BR8I 4GKKE 2Z5BA 1UEKA 4KHPI 4DUZI 4DV2E 3AUZA 4MYUA 2IOPA 1FKAE 5ADZA 1T4LB 3ZZTA 3T1HI 1WHNA 2DSYA 2O1WA 2LJPA 1FJGI 2E1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5C A;  2Q2E B;  1Z5B A;  1Z0T A;  3H4L A;  5A2Q Q;  1NHI A;  5IWA I;  1Z0E A;  4HAC A;  5LL6 R;  1QZR A;  3J7A G;  2HKJ A;  4Z7C A;  4DR2 I;  1XHK A;  2OI2 A;  4JI4 I;  4MYT A;  2VQE E;  2VQF E;  4LF5 I;  3OTO I;  4B3M I;  2ZIT A;  3LPS A;  3QT7 A;  2UU9 E;  4LF4 I;  4M1K A;  1IBL E;  4LF6 E;  2UXC E;  4DV0 E;  4X64 I;  1HNZ I;  1FWL A;  4DV4 I;  4KQV A;  4USK A;  2V2Q A;  1Z0G A;  4LF7 E;  4NXN E;  2CZ9 A;  5BR8 E;  4JI2 I;  4I3H A;  3LNU A;  4KHP E;  4DUZ E;  3QT8 A;  1KTV A;  3T1H E;  2V2V A;  4P7A A;  1H7U A;  1FJG E;  4JI7 E;  4DR4 E;  3WU6 A;  1KIJ A;  2XEX A;  1NHH A;  4DPX A;  2F4V I;  1H73 A;  2A2D A;  5IWA E;  5LMU E;  4DV5 I;  1ZM4 A;  4YY3 I;  1H74 A;  4DR2 E;  1HR0 E;  1ZM9 A;  2E5L E;  2HK3 A;  1DAR A;  3OTO E;  4LF6 I;  3ZKB A;  1Z0C A;  4DV0 I;  4DU7 A;  4B3M E;  1D6T A;  1A6F A;  4WUB A;  4DV3 I;  4LFB I;  4K0K E;  4NXN I;  1HNW E;  1XNR I;  4DPY A;  4X64 E;  1HNZ E;  4PU9 A;  2BM0 A;  1U2R A;  4P52 A;  4DV4 E;  1I94 I;  3B82 A;  4JI5 I;  3M6A A;  2DEJ A;  4LFA E;  2AJ4 A;  1NHJ A;  4X62 I;  2BV3 A;  3D4J A;  4PRX A;  4JI2 E;  1PVG A;  4JI7 I;  4DR4 I;  4FWG A;  4Z7Y A;  4GKJ I;  2DEI A;  3J81 C;  1HNX E;  5LMU I;  3K17 A;  1PIE A;  3PYE A;  1XMQ I;  2F4V E;  2UUB I;  5IT9 Q;  4R1F A;  2V34 A;  1HR0 I;  4LFC I;  2E5L I;  1B63 A;  4DV6 I;  1Z59 A;  4DV5 E;  1XMO I;  4XTJ A;  4YY3 E;  1ZXM A;  3ZZU A;  4AQY I;  1IBM I;  3PYF A;  4DPW A;  4DR3 I;  2BM1 A;  4LF8 I;  4K0K I;  2R3V A;  1N34 E;  3B8H A;  3QT6 A;  4UTG A;  4DR5 I;  1HNW I;  4EMD A;  4DV1 I;  4DV3 E;  2V2Z A;  3V2U C;  4LFB E;  1N36 E;  4JI6 I;  3JAM C;  5GMD A;  1ZM3 A;  4LFA I;  1XNR E;  4B3T I;  1XNQ I;  4DR7 I;  4JI8 I;  1I94 E;  1S4E A;  4FWH A;  1N0U A;  1FNM A;  4B3S I;  4JI5 E;  1OJ4 A;  1FWK A;  1MX0 A;  1PKP A;  1ZM2 A;  4X62 E;  1N33 E;  1HNX I;  4JYA I;  3J81 Q;  5LMN I;  2X36 A;  1Z0W A;  1N0V C;  4GKJ E;  1N32 I;  1J5E I;  5IT9 C;  4HYM A;  1XMQ E;  2UUB E;  2HK2 A;  4JI0 I;  4DUY I;  3J7A M;  4DR1 I;  4LFC E;  4DV6 E;  1N34 I;  1XMO E;  3HUL A;  4HXZ A;  2UUA E;  4LF9 I;  3QT5 A;  4AQY E;  5FLX Q;  1IBM E;  4USM A;  4DR3 E;  4JI1 I;  1N36 I;  4LF8 E;  4DPT A;  1VIS A;  4DPU A;  3ZM7 A;  4DR5 E;  1NZ0 A;  3JAM Q;  2UXB E;  4DV1 E;  1RR9 A;  2UXD I;  3Q1Q A;  4OX9 I;  1MG7 A;  4JI6 E;  4B3R E;  1N33 I;  4JI3 I;  1Z0V A;  4B3T E;  4DV7 I;  4ZVI A;  1XNQ E;  4DR7 E;  4JI8 E;  2WW4 A;  4NXM E;  2UUC E;  2ZBK B;  4B3S E;  3B78 A;  2HHH I;  3WU4 A;  4JYA E;  1IBK E;  5LMN E;  3PYG A;  4DR6 I;  1S16 A;  3F0N A;  5L3J A;  1K47 A;  1MU5 A;  1N32 E;  1J5E E;  3PYD A;  2UUA I;  3V5R A;  4JV5 I;  1RRE A;  1ELO A;  4JI0 E;  2HKE A;  4DUY E;  4DR1 E;  2GS8 A;  4DU8 A;  1Z5A A;  3T1Y I;  5GME A;  4HY1 A;  5FLX C;  2UXB I;  4LF9 E;  4FWD A;  4X66 I;  4FN5 A;  3J80 Q;  1EI1 A;  4RPF A;  4JI1 E;  4B3R I;  3GON A;  4YHH I;  2EFG A;  2UXD E;  4X65 I;  4NXM I;  4OX9 E;  2UUC I;  4DXL A;  1H72 C;  4GKK I;  2VF3 A;  3CWV A;  1H7S A;  2ZM6 E;  2R42 A;  4JI3 E;  4DV7 E;  4DV2 I;  1IBK I;  3LTO A;  4ED4 A;  2HHH E;  4JG4 A;  1Z0B A;  4DR6 E;  4UT4 A;  4WUC A;  2J7K A;  4URL A;  5A2Q C;  1KKH A;  2A2C A;  3ZKD A;  2NPF A;  4JV5 E;  2VQE I;  1WUU A;  4HAC B;  3K1J A;  2VQF I;  1ZXN A;  3T1Y E;  4FW9 A;  2UU9 I;  4JI4 E;  3J80 C;  1B62 A;  2HFS A;  4WUD A;  4X66 E;  1BKN A;  1KVK A;  4LF5 E;  1FI4 A;  1IBL I;  4PRV A;  2UXC I;  1EA6 A;  3ZZ0 A;  2ZM6 I;  4LF4 E;  3WU3 A;  4YHH E;  2V8P A;  2X7I A;  4X65 E;  4LF7 I;  3WU5 A;  2HFU A;  5BR8 I;  4GKK E;  1UEK A;  4KHP I;  4DUZ I;  4DV2 E;  4MYU A;  1FKA E;  3ZZT A;  3T1H I;  2LJP A;  1FJG I;  2E1R A; 
#chains in the Genus database with same CATH topology
 2EN1 A;  1Z5C A;  4QNK A;  1P42 A;  4HTG A;  4MLQ A;  2Q2E B;  1Z5B A;  2BA0 D;  1Z0T A;  3H4L A;  5A6J A;  5A2Q Q;  5K36 C;  2Q8U A;  1NHI A;  2J65 A;  1Z0E A;  4OZE A;  2GLI A;  5IWA I;  4Q35 B;  3TQM A;  5JEA A;  1Y60 A;  4KWY A;  2LCE A;  4HAC A;  5C0X D;  5K36 B;  2DMI A;  5LL6 R;  1QZR A;  1GQE A;  3J7A G;  4WFT A;  5DNY A;  2EOX A;  2HKJ A;  4IZJ D;  5AC4 A;  4Z7C A;  4GQU A;  1X49 A;  4DR2 I;  1IQS A;  2EMA A;  2V85 A;  1XHK A;  3HQ1 A;  2OI2 A;  4JI4 I;  4MYT A;  2VQE E;  2EM2 A;  2B7T A;  2LUP B;  2YPN A;  3U1Y A;  2YRM A;  4O4K A;  2VQF E;  2WP8 A;  2BBG A;  2L33 A;  1TF3 A;  1TF6 A;  3OTO I;  2CT1 A;  2JEB B;  4LF5 I;  4BC9 A;  4F6M A;  2CPN A;  2GHF A;  2IHR 1;  3P76 A;  3PRY A;  5C0X C;  2KON A;  4B3M I;  2ZIT A;  3LPS A;  3QT7 A;  2UU9 E;  2C38 B;  4LF4 I;  5C0X B;  4R2R A;  2YU8 A;  5KL7 A;  1G2D C;  4FW7 A;  2V89 A;  1LLM C;  1BB8 A;  3L7Z A;  4M1K A;  4IZJ B;  2DB2 A;  2N3H A;  2NN6 D;  4OO1 F;  4F9B B;  1IBL E;  4LF6 E;  4ZYE A;  4R2D A;  2UXC E;  4DV0 E;  2PO1 B;  4X64 I;  4FW4 A;  1HNZ I;  2EM5 A;  4FK5 C;  2F1D A;  2IOQ A;  1FWL A;  2HC5 A;  4DV4 I;  3KWR A;  1NEI A;  4WX9 A;  2ENH A;  4KQV A;  4USK A;  2V2Q A;  2MDR A;  3K85 A;  3B4T A;  4LF7 E;  2EQ0 A;  4O5G A;  1Z0G A;  4NXN E;  1Z1B A;  1E3H A;  2EPZ A;  2CZ9 A;  5BR8 E;  4JI2 I;  3THN A;  1EKZ A;  1DI2 A;  4BC7 A;  1YH8 A;  2NN6 C;  2MKN A;  3CDI A;  4I3H A;  2YTN A;  3ZOQ B;  3LNU A;  4KHP E;  2YTO A;  2EQ3 A;  4DUZ E;  4MU4 A;  2IER A;  2NN6 B;  2EOY A;  2EPR A;  3QT8 A;  5AAS A;  2DGC A;  1A1L A;  2C39 A;  1KTV A;  2O3Z A;  3T1H E;  4F9A B;  1T38 A;  2V2V A;  4P7A A;  1FJG E;  1H7U A;  4JI7 E;  4DR4 E;  2EOE A;  2NUE A;  3WU6 A;  1KIJ A;  2WNR B;  2EMH A;  2EPP A;  1NHH A;  2XEX A;  4DPX A;  1YUI A;  2F4V I;  1H73 A;  4GEQ B;  2A2D A;  2BR2 B;  2V88 A;  5IWA E;  5TSE A;  2EPM X;  1Y6Z A;  4I8O A;  2HGH A;  2V8Q B;  1T4O A;  2YTP A;  5LMU E;  4DV5 I;  2KOU A;  2LUQ A;  1YFH A;  2JEB A;  1ZM4 A;  4OO1 E;  1ZU1 A;  2MDG A;  3EPL A;  2D9H A;  2PO2 A;  1H74 A;  2EJ4 A;  4YY3 I;  2JE6 A;  4DR2 E;  3DJW A;  4M2Z A;  1HR0 E;  5C0X A;  2BA1 D;  3H09 A;  2CSH A;  1ZM9 A;  4OKG A;  3F6H A;  2E5L E;  2HK3 A;  4R03 A;  5A69 A;  5F3W A;  3UHM A;  1R6M A;  5KL2 A;  3OTO E;  1DAR A;  2EM4 A;  1A1H A;  2E72 A;  1E3P A;  4LF6 I;  2B9D A;  1USV A;  2WBT A;  3ZKB A;  1Z0C A;  2EPL X;  3M7N D;  4DU7 A;  4DV0 I;  3BF2 A;  4B3M E;  2EMG A;  1D6T A;  1BBO A;  1A6F A;  2YRH A;  4IFD C;  2PO0 A;  3BID A;  2ENA A;  2N3G A;  4WUB A;  1KJK A;  4DV3 I;  2K7I A;  4ZYG A;  3LML A;  4LFB I;  2RTX A;  4K0K E;  2N8X A;  4MU1 A;  2EOO A;  2O1V A;  3MHH C;  1HNW E;  4NXN I;  1XNR I;  4DPY A;  2YTD A;  4X64 E;  2JT2 A;  1HNZ E;  1YSA C;  4PU9 A;  2BM0 A;  2JEA B;  2C37 A;  4IS9 A;  2DLK A;  2EOS A;  4DV4 E;  1U2R A;  4P52 A;  1I94 I;  4F9C B;  2JXP A;  1TN9 A;  4M30 A;  1ZBT A;  1PJT A;  4GZN C;  2CTD A;  3B82 A;  4JI5 I;  4F2J C;  3M6A A;  2DEJ A;  4LFA E;  2EML A;  3AV0 A;  1NHJ A;  2AJ4 A;  4X62 I;  2EOM A;  2V86 A;  2BV3 A;  3D4J A;  4PRX A;  4JI2 E;  2EN7 A;  1PVG A;  4JI7 I;  4DR4 I;  1STU A;  2PNZ B;  1A1I A;  2WCC 3;  1A1J A;  2RS6 A;  4FWG A;  1A1K A;  2YTG A;  3JTZ A;  2JP9 A;  3M85 G;  5IXM B;  4Z7Y A;  4GKJ I;  2DEI A;  3J81 C;  1HNX E;  1QNT A;  1WXR A;  1EH6 A;  5LMU I;  4LCG A;  2LTR A;  2EM8 A;  2L6M A;  1B69 A;  3K17 A;  3C6K A;  2LE2 A;  1WJP A;  4BHB A;  2EOJ A;  1PIE A;  2VES A;  2F4V E;  2EP3 A;  2MC6 A;  1OYS A;  3PYE A;  1XMQ I;  2UUB I;  5IT9 Q;  1X5W A;  4R1F A;  3M85 D;  2V34 A;  3J7Y p;  1HR0 I;  1X6E A;  3HTX A;  1IMU A;  3IWB A;  3PS3 A;  3EPH A;  4LFC I;  4RH8 A;  2E5L I;  3KZZ A;  2YRK A;  1B63 A;  4DV6 I;  1Y5Y A;  2L2N A;  2BB8 A;  3BBG A;  4DV5 E;  1Z59 A;  3GME A;  5JEA E;  1XMO I;  1WHQ A;  3P3G A;  3F6G A;  4XTJ A;  2YTQ A;  4YY3 E;  4QNJ A;  2LMZ A;  4OO1 B;  3P1X A;  2RPC A;  1ZXM A;  3ZZU A;  4AQY I;  2EM0 A;  2EN2 A;  1IBM I;  3PYF A;  4BMJ A;  2EL6 A;  4ZYD A;  2YSO A;  4DPW A;  2EMW A;  2L2K B;  4DR3 I;  2BM1 A;  4LF8 I;  4IFD A;  4K0K I;  2R3V A;  1N34 E;  2LRS A;  1O0W A;  2EMK A;  4WSP A;  4M9V C;  2Z5C A;  2EMF A;  3B8H A;  2EM7 A;  3QT6 A;  4UTG A;  4DR5 I;  1HNW I;  5AE1 A;  1KYQ A;  5K36 F;  4R2A A;  4KZS A;  4EMD A;  4BA2 A;  2YZT A;  4DV1 I;  4DV3 E;  3BGH A;  2LJH A;  2V2Z A;  2IES A;  4LFB E;  3V2U C;  2YTI A;  1N36 E;  4JI6 I;  2EZ6 A;  3JAM C;  2FTX B;  2M1S A;  1ZM3 A;  2E1M A;  5GMD A;  4LFA I;  3VHT B;  1XNR E;  2WBU A;  1L4S A;  4BA1 B;  2LV2 A;  4IZK B;  1RQ0 A;  4B3T I;  1RHY A;  1XNQ I;  4DR7 I;  2LT7 A;  4JI8 I;  4M0V A;  4NXM I;  1I94 E;  1S4E A;  4FWH A;  1N0U A;  2EN6 A;  4IS1 C;  4FW3 A;  3EPK A;  1DQ3 A;  1FNM A;  4B3S I;  5C0X F;  1MEY C;  1YYO A;  4JI5 E;  1OJ4 A;  2HJJ A;  1FWK A;  1MX0 A;  1PKP A;  1ZM2 A;  4X62 E;  1N33 E;  1HNX I;  4JYA I;  2RQL A;  3L00 A;  5K36 A;  2J7J A;  3GLL A;  3J81 Q;  2GPI A;  2CVE A;  5LMN I;  2F8B A;  2X36 A;  1Z0W A;  2L2M A;  2L3J A;  2GQ0 A;  2EM3 A;  3P06 A;  1WRJ A;  4MU0 A;  1N0V C;  2FV4 B;  5JEA D;  3P3C A;  2Z5B B;  4GKJ E;  1AAY A;  4RHB B;  1N32 I;  1J5E I;  2EMY A;  2ELZ A;  4FW6 A;  2A25 A;  5IT9 C;  4HYM A;  2EOR A;  3MHS C;  2JYA A;  3IWD A;  1XMQ E;  2YTF A;  1UDS A;  2GO4 A;  2V83 A;  1YUJ A;  2DRP A;  2UUB E;  4LOM A;  2C38 A;  2HK2 A;  4JI0 I;  4DUY I;  1NCS A;  2EWL A;  4DR1 I;  4LFC E;  5KL6 A;  2EMI A;  4MDT A;  5T6J A;  5JEA C;  3J7A M;  1FJG I;  4DV6 E;  2LBS B;  5AC5 A;  1N34 I;  1RC7 A;  1XMO E;  3HUL A;  4IZJ A;  4HXZ A;  3P3E A;  5JEA B;  2JPA A;  2UUA E;  2NUG A;  4LF9 I;  3QT5 A;  2FGG A;  2JOX A;  1UBD C;  4AQY E;  2NUF A;  2PO1 A;  2RSM A;  2PRT A;  4F6N A;  1IBM E;  5FLX Q;  4LCF A;  2EOZ A;  4U3B A;  2PNL A;  4USM A;  1UIL A;  2NA2 A;  4DR3 E;  4LTY A;  4JI1 I;  2PNM A;  2JY9 A;  4LF8 E;  2JWO A;  1N36 I;  3ADI A;  3HJC A;  4DPT A;  4MLV A;  1VIS A;  5C0X E;  4N4R B;  4DPU A;  2G7H A;  4DR5 E;  1NZ0 A;  3ZM7 A;  3JAM Q;  2RS7 A;  2UXB E;  2ODR D;  3KZY A;  2WBS A;  3DF6 A;  2YSP A;  4AM3 A;  2MC5 A;  4DV1 E;  5EL9 A;  1RR9 A;  1AH5 A;  3GCM A;  3LLH A;  4U3D A;  2EMC A;  3Q1Q A;  2UXD I;  1G2F C;  4OX9 I;  2DMY A;  1MG7 A;  2NN6 A;  2JR1 A;  4JI6 E;  3EPJ A;  1T4N A;  2I9I A;  4B3R E;  2EPC A;  2M4I A;  2EPA A;  1N33 I;  4JI3 I;  2AE8 A;  1Z0V A;  1PJQ A;  4B3T E;  2VF1 A;  4DV7 I;  4ZVI A;  4LU9 A;  1XNQ E;  4BHC A;  4DR7 E;  1R6L A;  4JI8 E;  1UDN A;  3L7Z B;  2WW4 A;  2ODR C;  4NXM E;  1YZ9 A;  2WNR A;  3HPZ A;  2UUC E;  2O1T A;  2ZBK B;  4B3S E;  5A6A A;  2O1U A;  3B78 A;  2BR2 A;  3C4T A;  2EN3 A;  3WU4 A;  2HHH I;  4OO1 D;  4IFD F;  2YWQ A;  2EL5 A;  4OOG C;  4JYA E;  1DGC A;  4TUI A;  1IBK E;  5LMN E;  2M9A A;  3ADG A;  1T39 A;  2V87 A;  3PYG A;  2EMX A;  4DR6 I;  1UHZ A;  3PS1 A;  1VI7 A;  1S16 A;  3F0N A;  1A1F A;  3U1K A;  5AE3 A;  2LTS A;  4R2S A;  1UDQ A;  3C6M A;  5L3J A;  2EOI A;  4R8O A;  3IWC A;  1K47 A;  1MU5 A;  1N32 E;  1J5E E;  4OO1 C;  3PYD A;  4WXC A;  4AID A;  5FWK A;  2C39 B;  2RSI A;  3VK6 A;  4F54 A;  3V5R A;  2UUA I;  4JV5 I;  4J3D A;  4R2E A;  4LPF A;  1RRE A;  4JI0 E;  1MGT A;  2JVA A;  2EOH A;  5KL4 A;  4R2P A;  1ELO A;  2HKE A;  4DUY E;  4DR1 E;  2JOB A;  2CG9 A;  2GS8 A;  3NZK A;  4DU8 A;  1SR9 A;  2EPU A;  1Z5A A;  3T1Y I;  2KHX A;  5GME A;  4HY1 A;  1YPN A;  1Y4U A;  1HK7 A;  4TUG A;  4WXD A;  5A6B D;  5FLX C;  1J26 A;  5DRP A;  2UXB I;  4LF9 E;  4FWD A;  5DNL A;  3M99 B;  3UK3 C;  2EM9 A;  4X66 I;  2JEA A;  4FN5 A;  1P47 A;  1EI1 A;  1EH7 A;  1USU A;  3J80 Q;  3HKM A;  4RPF A;  5AE2 A;  4X8W A;  3H1C A;  4JI1 E;  2YU5 A;  2L3C A;  2PO2 B;  4HEI A;  4ZYH A;  2JE6 B;  2EPX A;  4BBY A;  1X3C A;  4B3R I;  3HXL A;  4IFD E;  1N3G A;  3GON A;  2CGE A;  4YHH I;  1JK1 A;  1A1G A;  2EFG A;  4AIM A;  2UXD E;  2B7V A;  4X65 I;  2R76 A;  1Y4S A;  2PNZ A;  1QU6 A;  4IJD A;  4OX9 E;  2EMB A;  3DD6 A;  2UUC I;  4DXL A;  2GO3 A;  1H72 C;  4GKK I;  5KL3 A;  2PO0 B;  2VF3 A;  3JU0 A;  4Q28 A;  2ZM6 E;  1JK2 A;  1H7S A;  3CWV A;  4JI3 E;  3C4B A;  4R2Q A;  2R42 A;  1X6H A;  2EN4 A;  2ELY A;  4DV7 E;  4BCA A;  4DV2 I;  1IBK I;  4DKK A;  3MSW A;  4WSG A;  1ZAA C;  5DNX A;  1IQO A;  4NBQ A;  2L92 A;  3LTO A;  3VYY A;  4ED4 A;  2HHH E;  2C37 B;  3ADJ A;  4R2C A;  2LO3 A;  3CDJ A;  2R1F A;  2K4V A;  1PJS A;  3ADL A;  4JG4 A;  2WZO A;  2EOQ A;  2B3T B;  1Z0B A;  5DRR A;  1YHC A;  4DR6 E;  1YYW A;  3EQ1 A;  5K36 E;  4P78 A;  2EM6 A;  4OO1 A;  1X47 A;  1ZR9 A;  2EQ1 A;  4UT4 A;  2EPK X;  4WUC A;  2NN6 F;  2J7K A;  5ELW A;  5KL5 A;  4URL A;  1SFE A;  2LJU A;  3OML A;  4L5N C;  5A2Q C;  1GZ6 A;  2YTJ A;  5A6K A;  2ADR A;  1KKH A;  2A2C A;  4J8Z A;  4NZV A;  1OYP A;  3ZKD A;  3HPS A;  2EMZ A;  2H36 X;  4JV5 E;  2NPF A;  2MKD A;  1WUU A;  2BA1 G;  4HAC B;  2VQE I;  1GTK A;  2VRD A;  4NHR A;  4WYQ B;  3RMP A;  1PDA A;  3K1J A;  2VQF I;  5DRQ A;  4O24 A;  1ZBQ A;  1X6F A;  4IFD D;  1YYK A;  5LLQ A;  2I13 A;  3PS2 A;  4BS9 A;  2VE7 C;  3ECR A;  1ZXN A;  3M7N G;  2EPO A;  3T1Y E;  4P7D A;  4FW9 A;  2UU9 I;  4O43 A;  2ENC A;  4JI4 E;  5IV8 B;  4BA1 A;  3J80 C;  1B62 A;  2HFS A;  2WP8 B;  4FW5 A;  2M7Q A;  2EL4 A;  2EN8 A;  3Q6M A;  4IZK A;  4WUD A;  4X66 E;  1BKN A;  1KVK A;  2NAB A;  1X48 A;  4LF5 E;  4WPY A;  1FI4 A;  1OYR A;  3KRN A;  1IBL I;  1EH8 A;  3FIG A;  4ISA A;  4DMI A;  4PRV A;  2UXC I;  3K6Q A;  1UN6 B;  5A6B A;  1EA6 A;  3QG5 C;  4N3O A;  3VYX A;  3ZZ0 A;  1F2I G;  2ZM6 I;  4LF4 E;  2YTE A;  3WU3 A;  2L8T A;  4YHH E;  2LVH A;  2DLQ A;  3THO B;  2V8P A;  2X7I A;  4MQY A;  4IFD B;  2DIX A;  2EOF A;  2Z5C B;  5JEA F;  4X65 E;  1XXE A;  4L8N A;  4X9J A;  5CFF E;  4LF7 I;  3WU5 A;  2YT4 A;  3Q6N A;  2Z5E A;  2HFU A;  5BR8 I;  4GKK E;  4BA2 B;  1RMD A;  5EKW A;  2Z5B A;  1UEK A;  1UDO A;  5K36 D;  4LCH A;  2NN6 E;  4MU3 A;  4KHP I;  2EPN A;  2BA0 G;  4DUZ I;  4DV2 E;  3AUZ A;  4MYU A;  2IOP A;  1FKA E;  5ADZ A;  5DRO A;  1BBG A;  1T4L B;  3ZZT A;  3T1H I;  1WHN A;  2DSY A;  2O1W A;  2LJP A;  2EE8 A;  2E1R A; 
#chains in the Genus database with same CATH homology
 1Z5C A;  2Q2E B;  1Z5B A;  1Z0T A;  3H4L A;  5A2Q Q;  1NHI A;  5IWA I;  1Z0E A;  4HAC A;  5LL6 R;  1QZR A;  1GQE A;  3J7A G;  4WFT A;  5DNY A;  2HKJ A;  4IZJ D;  4Z7C A;  1X49 A;  4DR2 I;  2V85 A;  1XHK A;  3HQ1 A;  2OI2 A;  4JI4 I;  4MYT A;  2VQE E;  2B7T A;  2LUP B;  2VQF E;  2L33 A;  4LF5 I;  3OTO I;  4BC9 A;  2CPN A;  2IHR 1;  3PRY A;  2KON A;  4B3M I;  2ZIT A;  3LPS A;  3QT7 A;  2UU9 E;  4LF4 I;  2V89 A;  4M1K A;  4IZJ B;  2DB2 A;  2N3H A;  4F9B B;  1IBL E;  4LF6 E;  2UXC E;  4DV0 E;  4X64 I;  1HNZ I;  2IOQ A;  1FWL A;  4DV4 I;  3KWR A;  4KQV A;  4USK A;  2V2Q A;  2MDR A;  3K85 A;  4LF7 E;  1Z0G A;  4NXN E;  2CZ9 A;  5BR8 E;  4JI2 I;  1EKZ A;  1DI2 A;  4BC7 A;  4I3H A;  3ZOQ B;  3LNU A;  4KHP E;  4DUZ E;  3QT8 A;  5AAS A;  1KTV A;  3T1H E;  4F9A B;  2V2V A;  4P7A A;  1FJG E;  1H7U A;  4JI7 E;  4DR4 E;  2NUE A;  3WU6 A;  1KIJ A;  2XEX A;  1NHH A;  4DPX A;  2F4V I;  1H73 A;  4GEQ B;  2A2D A;  2V88 A;  5IWA E;  1Y6Z A;  4I8O A;  2V8Q B;  1T4O A;  5LMU E;  4DV5 I;  2KOU A;  2LUQ A;  1ZM4 A;  4YY3 I;  1H74 A;  4DR2 E;  3DJW A;  4M2Z A;  1HR0 E;  3H09 A;  1ZM9 A;  3F6H A;  2E5L E;  2HK3 A;  4R03 A;  5F3W A;  3OTO E;  1DAR A;  4LF6 I;  2B9D A;  1USV A;  3ZKB A;  1Z0C A;  4DU7 A;  4DV0 I;  4B3M E;  1D6T A;  1A6F A;  2N3G A;  4WUB A;  4DV3 I;  3LML A;  4LFB I;  2RTX A;  4K0K E;  2O1V A;  1HNW E;  4NXN I;  1XNR I;  4DPY A;  4X64 E;  1HNZ E;  4PU9 A;  2BM0 A;  4DV4 E;  1U2R A;  4P52 A;  1I94 I;  4F9C B;  4M30 A;  1ZBT A;  3B82 A;  4JI5 I;  3M6A A;  2DEJ A;  4LFA E;  2AJ4 A;  3AV0 A;  1NHJ A;  4X62 I;  2V86 A;  2BV3 A;  3D4J A;  4PRX A;  4JI2 E;  1PVG A;  4JI7 I;  4DR4 I;  1STU A;  2RS6 A;  4FWG A;  3JTZ A;  4Z7Y A;  4GKJ I;  2DEI A;  3J81 C;  1HNX E;  1WXR A;  5LMU I;  2LTR A;  2L6M A;  3K17 A;  2LE2 A;  1PIE A;  3PYE A;  2F4V E;  2MC6 A;  1XMQ I;  2UUB I;  5IT9 Q;  4R1F A;  2V34 A;  3J7Y p;  1HR0 I;  3HTX A;  3IWB A;  4LFC I;  2E5L I;  1B63 A;  4DV6 I;  1Z59 A;  2L2N A;  4DV5 E;  1XMO I;  1WHQ A;  3F6G A;  4XTJ A;  4YY3 E;  2LMZ A;  3P1X A;  1ZXM A;  3ZZU A;  4AQY I;  1IBM I;  3PYF A;  4BMJ A;  4DPW A;  2L2K B;  4DR3 I;  2BM1 A;  4LF8 I;  4K0K I;  2R3V A;  1N34 E;  2LRS A;  1O0W A;  4WSP A;  2Z5C A;  3B8H A;  3QT6 A;  4UTG A;  4DR5 I;  1HNW I;  5AE1 A;  4KZS A;  4EMD A;  2YZT A;  4DV1 I;  4DV3 E;  2LJH A;  2V2Z A;  4LFB E;  3V2U C;  1N36 E;  4JI6 I;  2EZ6 A;  3JAM C;  2FTX B;  2M1S A;  1ZM3 A;  2E1M A;  5GMD A;  4LFA I;  1XNR E;  4IZK B;  1RQ0 A;  4B3T I;  1XNQ I;  4DR7 I;  4JI8 I;  4M0V A;  1I94 E;  1S4E A;  4FWH A;  1N0U A;  1DQ3 A;  1FNM A;  4B3S I;  1YYO A;  4JI5 E;  1OJ4 A;  1FWK A;  1MX0 A;  1PKP A;  1ZM2 A;  4X62 E;  1N33 E;  1HNX I;  4JYA I;  3J81 Q;  5LMN I;  2F8B A;  2X36 A;  1Z0W A;  2L3J A;  2L2M A;  2GQ0 A;  3P06 A;  1N0V C;  2FV4 B;  2Z5B B;  4GKJ E;  1N32 I;  1J5E I;  5IT9 C;  4HYM A;  3IWD A;  1XMQ E;  2V83 A;  2UUB E;  2HK2 A;  4JI0 I;  4DUY I;  3J7A M;  2EWL A;  4DR1 I;  4LFC E;  5T6J A;  4DV6 E;  2LBS B;  1N34 I;  1RC7 A;  1XMO E;  3HUL A;  4IZJ A;  4HXZ A;  2UUA E;  2NUG A;  4LF9 I;  3QT5 A;  2FGG A;  2JOX A;  2NUF A;  4AQY E;  2RSM A;  1IBM E;  5FLX Q;  2PNL A;  4USM A;  1UIL A;  2NA2 A;  4DR3 E;  4LTY A;  4JI1 I;  2PNM A;  2JY9 A;  4LF8 E;  2JWO A;  1N36 I;  3ADI A;  3HJC A;  4DPT A;  1VIS A;  4DPU A;  2G7H A;  4DR5 E;  1NZ0 A;  3ZM7 A;  3JAM Q;  2RS7 A;  2UXB E;  2ODR D;  3DF6 A;  2MC5 A;  4DV1 E;  1RR9 A;  2UXD I;  3Q1Q A;  3LLH A;  4OX9 I;  2DMY A;  1MG7 A;  2JR1 A;  4JI6 E;  1T4N A;  4B3R E;  2M4I A;  1N33 I;  4JI3 I;  1Z0V A;  4B3T E;  2VF1 A;  4DV7 I;  4ZVI A;  4LU9 A;  1XNQ E;  4DR7 E;  4JI8 E;  2WW4 A;  2ODR C;  4NXM E;  1YZ9 A;  3HPZ A;  2UUC E;  2O1T A;  2ZBK B;  4B3S E;  2O1U A;  3B78 A;  2HHH I;  3C4T A;  3WU4 A;  4OOG C;  4JYA E;  4TUI A;  1IBK E;  5LMN E;  3ADG A;  3PYG A;  2V87 A;  4DR6 I;  1UHZ A;  1S16 A;  3F0N A;  5AE3 A;  2LTS A;  5L3J A;  4R8O A;  3IWC A;  1K47 A;  1MU5 A;  1N32 E;  1J5E E;  3PYD A;  5FWK A;  3VK6 A;  4F54 A;  3V5R A;  2UUA I;  4JV5 I;  1RRE A;  4JI0 E;  2JVA A;  1ELO A;  2HKE A;  4DUY E;  4DR1 E;  2JOB A;  2CG9 A;  2GS8 A;  4DU8 A;  1SR9 A;  1Z5A A;  3T1Y I;  2KHX A;  5GME A;  4HY1 A;  1Y4U A;  1HK7 A;  4TUG A;  5FLX C;  1J26 A;  2UXB I;  4LF9 E;  4FWD A;  4X66 I;  4FN5 A;  3J80 Q;  1EI1 A;  1USU A;  4RPF A;  5AE2 A;  4X8W A;  4JI1 E;  2L3C A;  4BBY A;  4B3R I;  3HXL A;  3GON A;  2CGE A;  4YHH I;  2EFG A;  2UXD E;  2B7V A;  4X65 I;  4NXM I;  1Y4S A;  1QU6 A;  4OX9 E;  2UUC I;  4DXL A;  1H72 C;  4GKK I;  2VF3 A;  3JU0 A;  4Q28 A;  1H7S A;  2ZM6 E;  3CWV A;  4JI3 E;  3C4B A;  2R42 A;  4DV7 E;  4BCA A;  4DV2 I;  1IBK I;  4DKK A;  3MSW A;  2L92 A;  3LTO A;  3VYY A;  4ED4 A;  2HHH E;  3ADJ A;  2K4V A;  3ADL A;  4JG4 A;  2WZO A;  2B3T B;  1Z0B A;  4DR6 E;  1YYW A;  4P78 A;  1X47 A;  4UT4 A;  4WUC A;  2J7K A;  4URL A;  5A2Q C;  3OML A;  4L5N C;  1GZ6 A;  1KKH A;  2A2C A;  4J8Z A;  3ZKD A;  3HPS A;  2H36 X;  4JV5 E;  2NPF A;  1WUU A;  4HAC B;  2VQE I;  4WYQ B;  3RMP A;  3K1J A;  2VQF I;  1ZBQ A;  1YYK A;  4BS9 A;  2VE7 C;  1ZXN A;  3T1Y E;  4P7D A;  4FW9 A;  2UU9 I;  4JI4 E;  3J80 C;  1B62 A;  2HFS A;  4IZK A;  4WUD A;  2M7Q A;  3Q6M A;  4X66 E;  1BKN A;  1KVK A;  1X48 A;  4LF5 E;  4WPY A;  1FI4 A;  1IBL I;  3FIG A;  4DMI A;  4PRV A;  2UXC I;  3K6Q A;  1EA6 A;  3ZZ0 A;  4N3O A;  3VYX A;  2ZM6 I;  4LF4 E;  3WU3 A;  2L8T A;  4YHH E;  2V8P A;  2X7I A;  2DIX A;  2Z5C B;  4X65 E;  4L8N A;  5CFF E;  4LF7 I;  3WU5 A;  2YT4 A;  3Q6N A;  2Z5E A;  2HFU A;  5BR8 I;  4GKK E;  2Z5B A;  1UEK A;  4KHP I;  4DUZ I;  4DV2 E;  3AUZ A;  4MYU A;  2IOP A;  1FKA E;  5ADZ A;  1T4L B;  3ZZT A;  3T1H I;  1WHN A;  2DSY A;  2O1W A;  2LJP A;  1FJG I;  2E1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...