3J81C

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j81C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81C02
4JV5E 4Z7YA 3ZKBA 4B3TE 4HY1A 4X66I 1U2RA 2X7IA 4JI1E 4DPWA 4B3SE 4LF5E 3WU5A 1H7UA 4DV4I 3F0NA 5LL6R 4DV2I 1RR9A 4JG4A 2VQFE 4JI5I 1IBKE 2UUCE 4PU9A 2UUBE 4DR3I 3J7AM 1IBLE 1HNZE 1HNXI 2NPFA 3ZZTA 4DV4E 2DEIA 4I3HA 2VQEE 4LF9I 1IBME 3T1HE 2BM0A 4NXNE 1HNWI 1RREA 4X62E 4UTGA 2BV3A 1H74A 1Z0GA 4DXLA 4X65I 1Z0BA 1NHIA 1UEKA 3WU6A 2R42A 1Z59A 3V2UC 4DR1I 4B3ME 4GKKE 3JAMC 4FN5A 4DR5I 2UXDI 4DV5I 1NZ0A 3WU3A 1FI4A 4GKJI 4P52A 4LF7I 2HKJA 1N36E 1S16A 4JI7I 1KIJA 4JYAE 4JI8E 2UUBI 3OTOI 1PKPA 4DV1I 4AQYE 5L3JA 4K0KE 4WUDA 5A2QQ 3B82A 1FJGE 4FWDA 4XTJA 1H73A 4DR5E 4DU7A 4NXMI 4JI3I 1ZM9A 1N34I 1FWLA 2V2QA 3J81Q 4DR7E 4DV0I 1KTVA 5FLXC 4JI6E 2UXCE 1K47A 2UUCI 4NXME 4X64E 1N36I 2UXBE 1Z0VA 4FWHA 1Z5AA 1VISA 2UUAE 1N0UA 4LFAE 4HACA 4HACB 3QT6A 5FLXQ 2VF3A 1I94I 1IBKI 4P7AA 3GONA 3H4LA 4USMA 1NHJA 4MYTA 1XHKA 2HHHI 4X62I 1HR0E 4LFBI 5IWAE 4DPXA 2HK2A 1XNRI 4DV0E 4ZVIA 2E5LI 4YY3E 1Z0TA 2V8PA 1ZM3A 4DPTA 4JI3E 4JI8I 4DU8A 1XMOE 2F4VI 4JI5E 3J7AG 4DUYI 2HFSA 4LF7E 3T1HI 4GKJE 4HYMA 1PIEA 1FJGI 3B8HA 2DEJA 3PYGA 1I94E 2Q2EB 4JI6I 2HKEA 4B3RI 3ZZUA 4JYAI 4DV7I 2GS8A 4DR2E 1MG7A 4DV2E 4USKA 3K17A 3PYFA 4DR6I 4DPYA 3B78A 4FW9A 4JI0E 1KKHA 1N33E 4DUYE 2E1RA 2UXDE 1FNMA 4X66E 5IT9Q 4LF6E 5LMNI 1S4EA 5BR8E 4DR3E 3HULA 1ZM4A 3OTOE 4KQVA 1FWKA 4DV3E 5LMUI 1MX0A 2HHHE 4DUZI 4LFBE 4R1FA 1N0VC 2R3VA 4PRXA 1NHHA 4DV6E 4YHHI 4DV1E 3LTOA 4AQYI 2UXCI 4UT4A 3WU4A 4B3MI 4GKKI 3J80C 4YHHE 4LFAI 4DV6I 2VQFI 4HXZA 1ELOA 4WUBA 2V2ZA 4DPUA 1HR0I 4KHPE 4NXNI 3CWVA 4PRVA 4ED4A 4MYUA 3K1JA 2ZM6I 1BKNA 3QT8A 4YY3I 5BR8I 2ZM6E 4LF6I 4EMDA 1Z0WA 4LFCE 2V2VA 3J80Q 2UUAI 4Z7CA 2HK3A 1ZXMA 4LF9E 3Q1QA 4DR4I 1WUUA 1EI1A 4K0KI 3V5RA 4RPFA 4LFCI 1EA6A 5IT9C 4DR7I 2UU9I 1Z0CA 4DR1E 4FWGA 3ZM7A 4JV5I 4JI7E 3ZZ0A 3QT7A 2CZ9A 1B63A 1HNWE 1XNQE 4JI1I 1IBMI 2F4VE 1D6TA 2HFUA 1KVKA 4WUCA 4DV7E 4DR2I 1A6FA 3T1YI 1J5EE 1H72C 1N32I 1N33I 1H7SA 2EFGA 1Z5BA 4DR6E 2A2CA 4B3SI 4LF5I 1QZRA 3PYDA 4X64I 2X36A 1XMQE 1HNZI 1PVGA 1N32E 3J81C 4DV3I 2BM1A 4M1KA 4URLA 2WW4A 3D4JA 2AJ4A 1XMQI 5LMNE 3JAMQ 4JI2I 2OI2A 4DR4E 4OX9I 1XNQI 2UXBI 4JI0I 5IWAI 3LPSA 4DUZE 4KHPI 1Z0EA 1ZXNA 4DV5E 4LF4E 4JI2E 1DARA 4B3TI 2A2DA 1HNXE 1J5EI 2XEXA 3T1YE 4B3RE 3M6AA 2J7KA 5GMDA 1ZM2A 4JI4I 4LF8E 1B62A 1MU5A 4X65E 1FKAE 5A2QC 4OX9E 2ZBKB 3QT5A 1IBLI 4LF8I 4JI4E 2V34A 3LNUA 2UU9E 2E5LE 1OJ4A 1N34E 5GMEA 2ZITA 1XNRE 2LJPA 1Z5CA 3ZKDA 4LF4I 2VQEI 5LMUE 1XMOI 3PYEA
chains in the Genus database with same CATH superfamily
2FGGA 4JV5E 5A6BD 3U1KA 5AE2A 4Z7YA 3ZKBA 4M30A 2NUFA 5LLQA 2RSIA 3J7Yp 4B3TE 1O0WA 4HY1A 4IZKA 2EMKA 4X8WA 4X66I 4MDTA 1U2RA 1HK7A 1EKZA 2X7IA 4JI1E 1X3CA 3PS3A 4Q35B 4DPWA 4R2CA 1UDNA 5K36F 1QU6A 4B3SE 4LF5E 2DGCA 5JEAF 3UK3C 1H7UA 3WU5A 2EORA 3OMLA 3C6KA 4F2JC 2EZ6A 2C38A 4DV4I 3F0NA 2DLKA 5LL6R 4DV2I 1RR9A 1KJKA 4JG4A 2EPAA 2VQFE 3KZZA 4JI5I 1IBKE 3CDJA 1PJQA 1TN9A 2JEBA 4RH8A 2UUCE 2LTSA 5FWKA 3ECRA 2EJ4A 4PU9A 2PNZA 2YU8A 1L4SA 4WX9A 2UUBE 4OO1A 4IFDB 2DSYA 3ADIA 4DR3I 3J7AM 2GO4A 1IBLE 1HNZE 2V83A 4R2AA 1HNXI 2NPFA 3ZZTA 4N4RB 4M9VC 4F54A 1G2FC 2O3ZA 2GPIA 4DV4E 2KONA 2DEIA 4WPYA 2Z5EA 3P76A 4I3HA 2VQEE 4RHBB 2PO0B 2VF1A 1IBME 4FK5C 3T1HE 1USVA 2YTDA 3KWRA 4LF9I 2BM0A 4NXNE 4IFDF 1HNWI 1RREA 4X62E 4UTGA 5DNLA 2BV3A 1H74A 5A6KA 2EM5A 3VHTB 1Z0GA 4MU4A 4DXLA 1STUA 4DKKA 1OYRA 1Z0BA 5JEAB 2C38B 1NHIA 4X65I 3HTXA 5TSEA 2EPXA 1UEKA 3GMEA 3WU6A 2NUGA 3PS2A 2EM9A 2R42A 2EOYA 1Z59A 3V2UC 2EPZA 3HQ1A 4O43A 3HJCA 2JT2A 1PDAA 1ZBQA 2L8TA 4B3ME 5CFFE 4GKKE 4NBQA 4DR1I 5K36E 3JAMC 4HTGA 5AE1A 4TUGA 2YWQA 2C39B 4FN5A 4DR5I 2UXDI 3H09A 2YRKA 1RC7A 4WXDA 4DV5I 2CGEA 1NZ0A 3ADGA 3WU3A 2A25A 1Y4UA 1FI4A 2G7HA 4GKJI 4P52A 3AV0A 4LF7I 5ADZA 3CDIA 2HKJA 5C0XF 2EOZA 1AAYA 1N36E 2EN6A 2ADRA 4F6NA 1S16A 4IZJA 4JI7I 2EOSA 2EE8A 4JYAE 1KIJA 2B7TA 5IXMB 1VI7A 1A1GA 3Q6NA 3QG5C 1YZ9A 4JI8E 4QNJA 2UUBI 1X47A 3RMPA 1YSAC 2FV4B 3OTOI 3L7ZB 2O1VA 4IS9A 1PKPA 1SR9A 4AQYE 4DV1I 2DMYA 5EKWA 5L3JA 3ADJA 2WBSA 2RS7A 2EOXA 2ENCA 2V86A 2C37A 2C37B 1YUIA 4ZYDA 4K0KE 1Z1BA 4WUDA 5A2QQ 3B82A 2JPAA 1WRJA 1FJGE 2PO1A 5JEAC 4R2EA 4FWDA 1E3PA 1A1KA 4XTJA 2JEAA 2RSMA 2YT4A 2LBSB 5EL9A 1JK2A 4FW6A 1H73A 2EN7A 2ENAA 1T4OA 5DRPA 3K85A 1RQ0A 2L92A 4DR5E 2YTJA 1A1IA 4DU7A 4NXMI 3VYXA 4O24A 4JI3I 2EM3A 3C4BA 2EN3A 4J8ZA 2VRDA 1ZM9A 1N34I 3NZKA 4BA2B 1FWLA 2LT7A 2V2QA 3J81Q 4DR7E 4DV0I 4JI6E 5FLXC 1KTVA 2UXCE 1K47A 4NXME 2UUCI 1ZU1A 2EQ1A 2WP8B 2PRTA 4X64E 4MLVA 1KYQA 2L6MA 1N36I 4BA1A 2UXBE 2WBUA 1Z0VA 1T39A 1EH6A 4P7DA 2EOOA 2MC6A 1YFHA 4P78A 4FWHA 2NABA 3U1YA 1Z5AA 1VISA 2UUAE 2EOQA 1N0UA 4LFAE 1QNTA 2GQ0A 4BC7A 1YH8A 4HACA 4HACB 3QT6A 5FLXQ 2LE2A 2EMFA 2M9AA 2NUEA 2O1WA 4U3BA 4IJDA 2JWOA 5A6BA 2VF3A 4ZYGA 1I94I 1IBKI 4P7AA 2EOFA 2JE6A 2CPNA 5C0XD 2WBTA 2MC5A 2YTEA 3GONA 3H4LA 4USMA 1NHJA 1UHZA 1MEYC 4MYTA 3M7NG 2PNZB 1A1FA 2YTIA 4KWYA 2KOUA 1XHKA 4F6MA 2K4VA 2HHHI 2RTXA 1DGCA 1HR0E 4X62I 5IWAE 4LFBI 4DPXA 2IERA 4N3OA 2HK2A 4GQUA 4WFTA 4R2DA 2EPKX 4LCGA 2PO0A 1XNRI 3ADLA 4L8NA 4DV0E 4BMJA 5AASA 4ZVIA 3P1XA 2E5LI 1MGTA 1A1LA 4OO1C 2EPRA 4YY3E 2BA0D 2JR1A 1NEIA 2H36X 2YTNA 1Z0TA 4WXCA 1ZM3A 2V8PA 4DPTA 4JI3E 4JI8I 2KHXA 4OO1D 2EMBA 1XMOE 2DRPA 4DU8A 2F4VI 4NHRA 4JI5E 1X6HA 3J7AG 4MLQA 4DUYI 5KL7A 3F6HA 2EMWA 1T4LB 2BA1D 2HFSA 2N8XA 3IWDA 4LF7E 1X5WA 1RMDA 3T1HI 5DNYA 2ELZA 4GKJE 3DD6A 4HYMA 4BHCA 1PIEA 1FJGI 3DJWA 2IESA 3B8HA 2DEJA 1YYOA 3P06A 1IQSA 2YTFA 1GZ6A 3PYGA 2N3HA 3MSWA 1UBDC 2R1FA 2JP9A 1I94E 3B4TA 2I9IA 4LTYA 2Q2EB 4JI6I 1UDOA 3THNA 4OKGA 4R2QA 2HKEA 4B3RI 1BBOA 2EN4A 2EPMX 3ZZUA 2K7IA 4DR2E 2GS8A 3BBGA 4DV7I 4JYAI 3EQ1A 1MG7A 2MDRA 3FIGA 4IFDA 4OO1B 4DV2E 1UDQA 4USKA 2YRMA 4BCAA 3K17A 4GEQB 3F6GA 3THOB 2EM6A 4DMIA 3PYFA 1GQEA 1IQOA 4ZYHA 4DR6I 5KL2A 2L2NA 2MKNA 4DPYA 3B78A 4J3DA 4FW9A 4JI0E 1KKHA 1N33E 2LMZA 4DUYE 4OO1F 5K36A 2E1RA 2UXDE 2DLQA 1FNMA 2JYAA 4X66E 4MU0A 2JEAB 5IT9Q 2EN8A 4LF6E 3HKMA 5LMNI 1S4EA 2LRSA 5BR8E 1X6FA 2M7QA 2V85A 4DR3E 2J7JA 2WCC3 2RPCA 2EWLA 2EN1A 4WSPA 3OTOE 3EPJA 1Y5YA 1ZM4A 3HULA 4KQVA 2Q8UA 2MKDA 4F9BB 4DV3E 2EOJA 3M99B 1FWKA 1R6LA 1USUA 2IOPA 5LMUI 4BC9A 3JTZA 3BF2A 2EMIA 2IOQA 1MX0A 4QNKA 2CT1A 3DF6A 4MU3A 3M85G 1ZR9A 3LLHA 4R2SA 2HHHE 4LFBE 4DUZI 2EMLA 2LV2A 2YU5A 2YTQA 4IFDE 4LOMA 4R1FA 4F9CB 2J65A 1G2DC 3VYYA 3GCMA 2EMAA 1N0VC 2R3VA 2RQLA 1NHHA 4DV6E 4PRXA 4BA1B 2EL6A 2ODRC 1YPNA 2Z5CA 5C0XA 4YHHI 4I8OA 4DV1E 3LTOA 1AH5A 1OYPA 4AQYI 1YYKA 2UXCI 4LPFA 4O4KA 2GO3A 2ODRD 4UT4A 3WU4A 4B3MI 4GKKI 2HC5A 2Z5BB 3J80C 1LLMC 5DROA 4YHHE 2JY9A 4LFAI 4DV6I 2VQFI 1Y4SA 2EPCA 2LUQA 2YSPA 3BIDA 2LO3A 3P3CA 4HXZA 2EPUA 2V8QB 1ELOA 1WHQA 2V2ZA 3P3EA 4WUBA 4DPUA 4LU9A 4BHBA 3AUZA 2Z5CB 5C0XB 1HR0I 4KHPE 2WNRA 3MHHC 4NXNI 5K36B 2NN6C 2NA2A 3CWVA 4PRVA 4ED4A 4KZSA 4MYUA 2O1UA 3K1JA 2EL5A 1N3GA 2BBGA 4R8OA 3UHMA 4WYQB 2ZM6I 1BKNA 3QT8A 1Y60A 3P3GA 3L00A 4YY3I 4X9JA 1R6MA 4NZVA 2AE8A 5BR8I 2EPLX 2EMHA 2ZM6E 2PNLA 2DIXA 4LF6I 1A1JA 4EMDA 1Z0WA 2ENHA 4LFCE 1YYWA 2YTOA 2V2VA 2BA0G 2BR2A 3J80Q 2UUAI 1T4NA 2EM2A 1EH7A 2EMCA 3PRYA 4Z7CA 4AM3A 2HJJA 2EP3A 2HK3A 2B9DA 2CSHA 1YHCA 3EPKA 1E3HA 1ZXMA 4LF9E 1B69A 3Q1QA 2EOHA 2BB8A 2WZOA 1UN6B 4DR4I 3M7ND 1WUUA 4FW4A 2L2KB 1A1HA 2BA1G 4MQYA 1EI1A 5JEAA 4K0KI 1RHYA 3V5RA 2YPNA 5C0XE 4OOGC 1TF3A 4RPFA 4LFCI 1EA6A 2V88A 5IT9C 2LJHA 5AC5A 4ZYEA 4DR7I 2UU9I 1Z0CA 1OYSA 2FTXB 4DR1E 4FWGA 4IS1C 2LCEA 3ZM7A 4JV5I 2LVHA 2E72A 3HPZA 4JI7E 3HPSA 2EN2A 3ZZ0A 4ISAA 5A6AA 2R76A 5C0XC 5ELWA 3QT7A 2L3CA 2I13A 2HGHA 2PO1B 2EM8A 2PO2B 2CZ9A 1B63A 2JVAA 1WHNA 4R2PA 4FW7A 5K36C 2EMGA 1BBGA 5A6JA 2E1MA 2CVEA 1HNWE 1XNQE 1UILA 2C39A 4JI1I 1IBMI 5DNXA 4TUIA 2F4VE 2PNMA 1D6TA 2HFUA 2ELYA 1WJPA 1KVKA 2JEBB 4WUCA 3PS1A 4DV7E 4GZNC 4DR2I 5KL3A 2RS6A 4FW3A 1A6FA 4O5GA 2EM0A 2NN6A 2JE6B 1T38A 2BR2B 3T1YI 4R03A 5KL5A 4Q28A 1J5EE 1H72C 2B7VA 1N32I 4IFDC 2F1DA 1P47A 4AIMA 1N33I 3EPLA 4IFDD 2EPOA 1H7SA 2EFGA 2PO2A 2F8BA 1Z5BA 4FW5A 2YRHA 3IWCA 2EQ3A 2EOEA 4DR6E 1P42A 2A2CA 4B3SI 2YSOA 4LF5I 1QZRA 3Q6MA 3PYDA 2LJUA 2EPNA 1DQ3A 2NN6B 4X64I 1UDSA 2YTPA 4WSGA 4R2RA 2WNRB 1X48A 1XMQE 2X36A 5DRQA 1HNZI 5K36D 3JU0A 1PVGA 1N32E 3J81C 3HXLA 4DV3I 3C4TA 2BM1A 1ZBTA 4M1KA 4URLA 2GLIA 2M4IA 3ZOQB 2WW4A 3D4JA 5DRRA 3BGHA 2AJ4A 1XMQI 2EM7A 2EQ0A 4BS9A 5LMNE 3JAMQ 4BBYA 2JOBA 2VE7C 5AC4A 4JI2I 4DR4E 2OI2A 4OX9I 3GLLA 2B3TB 1XNQI 1IMUA 2UXBI 4LCHA 4JI0I 4DUZE 3LPSA 5IWAI 4KHPI 3EPHA 1XXEA 2L3JA 1Z0EA 2V89A 4DV5E 3LMLA 2CTDA 1ZXNA 4IZKB 4LF4E 4LCFA 2EPPA 4JI2E 1BB8A 1X49A 4AIDA 1DARA 4B3TI 2A2DA 1HNXE 1J5EI 1GTKA 2XEXA 2D9HA 3T1YE 3H1CA 4B3RE 2WP8A 2J7KA 1NCSA 3M6AA 1ZM2A 5GMDA 1F2IG 1EH8A 5AE3A 1WXRA 4LF8E 4MU1A 4F9AB 3L7ZA 1B62A 2VESA 4JI4I 4HEIA 2EMXA 1MU5A 4L5NC 5A69A 1TF6A 4X65E 2N3GA 4BA2A 2YTGA 2EMYA 1FKAE 4IZJB 2IHR1 5T6JA 3C6MA 4M0VA 4U3DA 3TQMA 5A2QC 3MHSC 5KL4A 4OX9E 1YUJA 2L33A 2V87A 1ZAAC 1DI2A 2ZBKB 3K6QA 2GHFA 2M1SA 1J26A 4OO1E 3QT5A 5IV8B 1Y6ZA 1IBLI 3IWBA 1X6EA 4JI4E 4LF8I 2EL4A 2V34A 3LNUA 2UU9E 5JEAE 2JOXA 2E5LE 2EMZA 2EM4A 1N34E 1OJ4A 2O1TA 2CG9A 4IZJD 5GMEA 2ZITA 3M85D 4OZEA 2DB2A 1XNRE 2LJPA 2L2MA 3KZYA 1Z5CA 2NN6E 3ZKDA 3KRNA 4LF4I 2LUPB 1JK1A 1PJSA 2MDGA 1SFEA 1PJTA 2EOMA 2EOIA 5F3WA 3VK6A 2NN6F 2NN6D 2VQEI 2Z5BA 2LTRA 2DMIA 5LMUE 2JXPA 1XMOI 4M2ZA 5JEAD 3PYEA 5KL6A 2YZTA
chains in the Genus database with same CATH topology
2FGGA 4JV5E 5AE2A 4Z7YA 3ZKBA 4M30A 2NUFA 3J7Yp 4B3TE 1O0WA 4HY1A 4IZKA 4X8WA 4X66I 1U2RA 1HK7A 1EKZA 2X7IA 4JI1E 4DPWA 1QU6A 4B3SE 4LF5E 3WU5A 1H7UA 3OMLA 2EZ6A 4DV4I 3F0NA 5LL6R 4DV2I 1RR9A 4JG4A 2VQFE 4JI5I 1IBKE 2UUCE 2LTSA 5FWKA 4PU9A 2UUBE 2DSYA 3ADIA 4DR3I 3J7AM 1IBLE 1HNZE 2V83A 1HNXI 2NPFA 3ZZTA 4F54A 4DV4E 2KONA 2DEIA 4WPYA 2Z5EA 4I3HA 2VQEE 4LF9I 2VF1A 1IBME 3T1HE 1USVA 3KWRA 2BM0A 4NXNE 1HNWI 1RREA 4X62E 4UTGA 2BV3A 1H74A 1Z0GA 4DXLA 1STUA 4DKKA 4X65I 1Z0BA 1NHIA 3HTXA 1UEKA 3WU6A 2NUGA 2R42A 1Z59A 3V2UC 3HQ1A 3HJCA 1ZBQA 2L8TA 4B3ME 5CFFE 4GKKE 4DR1I 3JAMC 5AE1A 4TUGA 4FN5A 4DR5I 2UXDI 3H09A 1RC7A 4DV5I 2CGEA 1NZ0A 3ADGA 3WU3A 1Y4UA 1FI4A 2G7HA 4GKJI 4P52A 3AV0A 4LF7I 5ADZA 2HKJA 1N36E 1S16A 4IZJA 4JI7I 1KIJA 4JYAE 2B7TA 3Q6NA 1YZ9A 4JI8E 2UUBI 1X47A 3RMPA 2FV4B 3OTOI 2O1VA 1PKPA 1SR9A 4AQYE 4DV1I 2DMYA 5L3JA 3ADJA 2RS7A 2V86A 4K0KE 4WUDA 5A2QQ 3B82A 1FJGE 4FWDA 4XTJA 2RSMA 2YT4A 2LBSB 1H73A 1T4OA 3K85A 1RQ0A 2L92A 4DR5E 4DU7A 4NXMI 3VYXA 4JI3I 3C4BA 4J8ZA 1ZM9A 1N34I 1FWLA 2V2QA 3J81Q 4DR7E 4DV0I 4JI6E 5FLXC 1KTVA 2UXCE 1K47A 4NXME 2UUCI 4X64E 2L6MA 1N36I 2UXBE 1Z0VA 4P7DA 2MC6A 4FWHA 4P78A 1Z5AA 1VISA 2UUAE 2GQ0A 1N0UA 4LFAE 4HACA 4HACB 3QT6A 5FLXQ 2LE2A 2NUEA 2O1WA 2JWOA 2VF3A 1I94I 1IBKI 4P7AA 2CPNA 2MC5A 3GONA 3H4LA 4USMA 1NHJA 1UHZA 4MYTA 2KOUA 1XHKA 2K4VA 2HHHI 2RTXA 1HR0E 4X62I 4LFBI 5IWAE 4DPXA 4N3OA 2HK2A 4WFTA 1XNRI 3ADLA 4L8NA 4DV0E 4BMJA 5AASA 4ZVIA 3P1XA 2E5LI 4YY3E 2JR1A 2H36X 1Z0TA 2V8PA 1ZM3A 4DPTA 4JI3E 4JI8I 2KHXA 1XMOE 4DU8A 2F4VI 4JI5E 3J7AG 4DUYI 3F6HA 1T4LB 2HFSA 3IWDA 4LF7E 3T1HI 5DNYA 4GKJE 4HYMA 1PIEA 1FJGI 3DJWA 3B8HA 2DEJA 1YYOA 3P06A 1GZ6A 3PYGA 2N3HA 3MSWA 1I94E 4LTYA 2Q2EB 4JI6I 2HKEA 4B3RI 3ZZUA 4JYAI 4DR2E 2GS8A 4DV7I 1MG7A 2MDRA 3FIGA 4DV2E 4USKA 4BCAA 3K17A 4GEQB 3F6GA 4DMIA 3PYFA 1GQEA 4DR6I 2L2NA 4DPYA 3B78A 4FW9A 4JI0E 1KKHA 1N33E 2LMZA 4DUYE 2E1RA 2UXDE 1FNMA 4X66E 5IT9Q 4LF6E 5LMNI 1S4EA 2LRSA 5BR8E 2M7QA 2V85A 4DR3E 2EWLA 4WSPA 3OTOE 1ZM4A 3HULA 4KQVA 4F9BB 4DV3E 1FWKA 1USUA 2IOPA 5LMUI 4BC9A 3JTZA 2IOQA 1MX0A 3DF6A 3LLHA 2HHHE 4LFBE 4DUZI 4R1FA 4F9CB 3VYYA 1N0VC 2R3VA 4PRXA 1NHHA 4DV6E 2ODRC 2Z5CA 4YHHI 4I8OA 4DV1E 3LTOA 4AQYI 2UXCI 1YYKA 2ODRD 4UT4A 3WU4A 4B3MI 4GKKI 2Z5BB 3J80C 4YHHE 2JY9A 4LFAI 4DV6I 2VQFI 1Y4SA 2LUQA 4HXZA 2V8QB 1ELOA 4WUBA 1WHQA 2V2ZA 4DPUA 4LU9A 3AUZA 2Z5CB 1HR0I 4KHPE 4NXNI 2NA2A 3CWVA 4PRVA 4ED4A 4KZSA 4MYUA 2O1UA 3K1JA 4R8OA 4WYQB 2ZM6I 1BKNA 3QT8A 4YY3I 5BR8I 2ZM6E 2PNLA 2DIXA 4LF6I 4EMDA 1Z0WA 4LFCE 1YYWA 2V2VA 3J80Q 2UUAI 1T4NA 3PRYA 4Z7CA 2HK3A 2B9DA 1ZXMA 4LF9E 3Q1QA 2WZOA 4DR4I 1WUUA 2L2KB 1EI1A 4K0KI 3V5RA 4OOGC 4RPFA 4LFCI 1EA6A 2V88A 5IT9C 2LJHA 4DR7I 2UU9I 1Z0CA 2FTXB 4DR1E 4FWGA 3ZM7A 4JV5I 3HPZA 3HPSA 4JI7E 3ZZ0A 3QT7A 2L3CA 2CZ9A 1B63A 2JVAA 1WHNA 2E1MA 1HNWE 1XNQE 1UILA 4JI1I 1IBMI 4TUIA 2F4VE 2PNMA 1D6TA 2HFUA 1KVKA 4WUCA 4DV7E 4DR2I 2RS6A 1A6FA 3T1YI 4R03A 1J5EE 4Q28A 1H72C 2B7VA 1N32I 1N33I 1H7SA 2EFGA 2F8BA 1Z5BA 4DR6E 3IWCA 2A2CA 4B3SI 4LF5I 1QZRA 3Q6MA 3PYDA 1DQ3A 4X64I 1X48A 1XMQE 2X36A 1HNZI 3JU0A 1PVGA 1N32E 3J81C 3HXLA 4DV3I 3C4TA 2BM1A 1ZBTA 4M1KA 4URLA 2M4IA 3ZOQB 2WW4A 3D4JA 2AJ4A 1XMQI 4BS9A 5LMNE 3JAMQ 4BBYA 2JOBA 2VE7C 4JI2I 4DR4E 2OI2A 4OX9I 2B3TB 1XNQI 2UXBI 4JI0I 5IWAI 4DUZE 3LPSA 4KHPI 1Z0EA 2L3JA 1ZXNA 2V89A 4DV5E 3LMLA 4IZKB 4LF4E 4JI2E 1X49A 1DARA 4B3TI 2A2DA 1HNXE 1J5EI 2YZTA 2XEXA 3T1YE 4B3RE 3M6AA 2J7KA 5GMDA 1ZM2A 5AE3A 1WXRA 4LF8E 4JI4I 4F9AB 1B62A 1MU5A 4L5NC 4X65E 2N3GA 1FKAE 4IZJB 2IHR1 5T6JA 4M0VA 5A2QC 4OX9E 2L33A 2V87A 1DI2A 2ZBKB 3K6QA 2M1SA 1J26A 3QT5A 1Y6ZA 1IBLI 3IWBA 4JI4E 4LF8I 2V34A 3LNUA 2UU9E 2JOXA 2E5LE 1OJ4A 1N34E 2O1TA 4IZJD 5GMEA 2CG9A 2ZITA 2DB2A 1XNRE 2LJPA 2L2MA 1Z5CA 3ZKDA 4LF4I 2LUPB 5F3WA 3VK6A 2VQEI 2Z5BA 2LTRA 5LMUE 1XMOI 4M2ZA 3PYEA 4BC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 E;  4Z7Y A;  3ZKB A;  4B3T E;  4HY1 A;  4X66 I;  1U2R A;  2X7I A;  4JI1 E;  4DPW A;  4B3S E;  4LF5 E;  3WU5 A;  1H7U A;  4DV4 I;  3F0N A;  5LL6 R;  4DV2 I;  1RR9 A;  4JG4 A;  2VQF E;  4JI5 I;  1IBK E;  2UUC E;  4PU9 A;  2UUB E;  4DR3 I;  3J7A M;  1IBL E;  1HNZ E;  1HNX I;  2NPF A;  3ZZT A;  4DV4 E;  2DEI A;  4I3H A;  2VQE E;  4LF9 I;  1IBM E;  3T1H E;  2BM0 A;  4NXN E;  1HNW I;  1RRE A;  4X62 E;  4UTG A;  2BV3 A;  1H74 A;  1Z0G A;  4DXL A;  4X65 I;  1Z0B A;  1NHI A;  1UEK A;  3WU6 A;  2R42 A;  1Z59 A;  3V2U C;  4DR1 I;  4B3M E;  4GKK E;  3JAM C;  4FN5 A;  4DR5 I;  2UXD I;  4DV5 I;  1NZ0 A;  3WU3 A;  1FI4 A;  4GKJ I;  4P52 A;  4LF7 I;  2HKJ A;  1N36 E;  1S16 A;  4JI7 I;  1KIJ A;  4JYA E;  4JI8 E;  2UUB I;  3OTO I;  1PKP A;  4DV1 I;  4AQY E;  5L3J A;  4K0K E;  4WUD A;  5A2Q Q;  3B82 A;  1FJG E;  4FWD A;  4XTJ A;  1H73 A;  4DR5 E;  4DU7 A;  4NXM I;  4JI3 I;  1ZM9 A;  1N34 I;  1FWL A;  2V2Q A;  3J81 Q;  4DR7 E;  4DV0 I;  1KTV A;  5FLX C;  4JI6 E;  2UXC E;  1K47 A;  2UUC I;  4NXM E;  4X64 E;  1N36 I;  2UXB E;  1Z0V A;  4FWH A;  1Z5A A;  1VIS A;  2UUA E;  1N0U A;  4LFA E;  4HAC A;  4HAC B;  3QT6 A;  5FLX Q;  2VF3 A;  1I94 I;  1IBK I;  4P7A A;  3GON A;  3H4L A;  4USM A;  1NHJ A;  4MYT A;  1XHK A;  2HHH I;  4X62 I;  1HR0 E;  4LFB I;  5IWA E;  4DPX A;  2HK2 A;  1XNR I;  4DV0 E;  4ZVI A;  2E5L I;  4YY3 E;  1Z0T A;  2V8P A;  1ZM3 A;  4DPT A;  4JI3 E;  4JI8 I;  4DU8 A;  1XMO E;  2F4V I;  4JI5 E;  3J7A G;  4DUY I;  2HFS A;  4LF7 E;  3T1H I;  4GKJ E;  4HYM A;  1PIE A;  1FJG I;  3B8H A;  2DEJ A;  3PYG A;  1I94 E;  2Q2E B;  4JI6 I;  2HKE A;  4B3R I;  3ZZU A;  4JYA I;  4DV7 I;  2GS8 A;  4DR2 E;  1MG7 A;  4DV2 E;  4USK A;  3K17 A;  3PYF A;  4DR6 I;  4DPY A;  3B78 A;  4FW9 A;  4JI0 E;  1KKH A;  1N33 E;  4DUY E;  2E1R A;  2UXD E;  1FNM A;  4X66 E;  5IT9 Q;  4LF6 E;  5LMN I;  1S4E A;  5BR8 E;  4DR3 E;  3HUL A;  1ZM4 A;  3OTO E;  4KQV A;  1FWK A;  4DV3 E;  5LMU I;  1MX0 A;  2HHH E;  4DUZ I;  4LFB E;  4R1F A;  1N0V C;  2R3V A;  4PRX A;  1NHH A;  4DV6 E;  4YHH I;  4DV1 E;  3LTO A;  4AQY I;  2UXC I;  4UT4 A;  3WU4 A;  4B3M I;  4GKK I;  3J80 C;  4YHH E;  4LFA I;  4DV6 I;  2VQF I;  4HXZ A;  1ELO A;  4WUB A;  2V2Z A;  4DPU A;  1HR0 I;  4KHP E;  4NXN I;  3CWV A;  4PRV A;  4ED4 A;  4MYU A;  3K1J A;  2ZM6 I;  1BKN A;  3QT8 A;  4YY3 I;  5BR8 I;  2ZM6 E;  4LF6 I;  4EMD A;  1Z0W A;  4LFC E;  2V2V A;  3J80 Q;  2UUA I;  4Z7C A;  2HK3 A;  1ZXM A;  4LF9 E;  3Q1Q A;  4DR4 I;  1WUU A;  1EI1 A;  4K0K I;  3V5R A;  4RPF A;  4LFC I;  1EA6 A;  5IT9 C;  4DR7 I;  2UU9 I;  1Z0C A;  4DR1 E;  4FWG A;  3ZM7 A;  4JV5 I;  4JI7 E;  3ZZ0 A;  3QT7 A;  2CZ9 A;  1B63 A;  1HNW E;  1XNQ E;  4JI1 I;  1IBM I;  2F4V E;  1D6T A;  2HFU A;  1KVK A;  4WUC A;  4DV7 E;  4DR2 I;  1A6F A;  3T1Y I;  1J5E E;  1H72 C;  1N32 I;  1N33 I;  1H7S A;  2EFG A;  1Z5B A;  4DR6 E;  2A2C A;  4B3S I;  4LF5 I;  1QZR A;  3PYD A;  4X64 I;  2X36 A;  1XMQ E;  1HNZ I;  1PVG A;  1N32 E;  3J81 C;  4DV3 I;  2BM1 A;  4M1K A;  4URL A;  2WW4 A;  3D4J A;  2AJ4 A;  1XMQ I;  5LMN E;  3JAM Q;  4JI2 I;  2OI2 A;  4DR4 E;  4OX9 I;  1XNQ I;  2UXB I;  4JI0 I;  5IWA I;  3LPS A;  4DUZ E;  4KHP I;  1Z0E A;  1ZXN A;  4DV5 E;  4LF4 E;  4JI2 E;  1DAR A;  4B3T I;  2A2D A;  1HNX E;  1J5E I;  2XEX A;  3T1Y E;  4B3R E;  3M6A A;  2J7K A;  5GMD A;  1ZM2 A;  4JI4 I;  4LF8 E;  1B62 A;  1MU5 A;  4X65 E;  1FKA E;  5A2Q C;  4OX9 E;  2ZBK B;  3QT5 A;  1IBL I;  4LF8 I;  4JI4 E;  2V34 A;  3LNU A;  2UU9 E;  2E5L E;  1OJ4 A;  1N34 E;  5GME A;  2ZIT A;  1XNR E;  2LJP A;  1Z5C A;  3ZKD A;  4LF4 I;  2VQE I;  5LMU E;  1XMO I;  3PYE A; 
#chains in the Genus database with same CATH topology
 2FGG A;  4JV5 E;  5A6B D;  3U1K A;  5AE2 A;  4Z7Y A;  3ZKB A;  4M30 A;  2NUF A;  5LLQ A;  2RSI A;  3J7Y p;  4B3T E;  1O0W A;  4HY1 A;  4IZK A;  2EMK A;  4X8W A;  4X66 I;  4MDT A;  1U2R A;  1HK7 A;  1EKZ A;  2X7I A;  4JI1 E;  1X3C A;  3PS3 A;  4Q35 B;  4DPW A;  4R2C A;  1UDN A;  5K36 F;  1QU6 A;  4B3S E;  4LF5 E;  2DGC A;  5JEA F;  3UK3 C;  1H7U A;  3WU5 A;  2EOR A;  3OML A;  3C6K A;  4F2J C;  2EZ6 A;  2C38 A;  4DV4 I;  3F0N A;  2DLK A;  5LL6 R;  4DV2 I;  1RR9 A;  1KJK A;  4JG4 A;  2EPA A;  2VQF E;  3KZZ A;  4JI5 I;  1IBK E;  3CDJ A;  1PJQ A;  1TN9 A;  2JEB A;  4RH8 A;  2UUC E;  2LTS A;  5FWK A;  3ECR A;  2EJ4 A;  4PU9 A;  2PNZ A;  2YU8 A;  1L4S A;  4WX9 A;  2UUB E;  4OO1 A;  4IFD B;  2DSY A;  3ADI A;  4DR3 I;  3J7A M;  2GO4 A;  1IBL E;  1HNZ E;  2V83 A;  4R2A A;  1HNX I;  2NPF A;  3ZZT A;  4N4R B;  4M9V C;  4F54 A;  1G2F C;  2O3Z A;  2GPI A;  4DV4 E;  2KON A;  2DEI A;  4WPY A;  2Z5E A;  3P76 A;  4I3H A;  2VQE E;  4RHB B;  2PO0 B;  2VF1 A;  1IBM E;  4FK5 C;  3T1H E;  1USV A;  2YTD A;  3KWR A;  4LF9 I;  2BM0 A;  4NXN E;  4IFD F;  1HNW I;  1RRE A;  4X62 E;  4UTG A;  5DNL A;  2BV3 A;  1H74 A;  5A6K A;  2EM5 A;  3VHT B;  1Z0G A;  4MU4 A;  4DXL A;  1STU A;  4DKK A;  1OYR A;  1Z0B A;  5JEA B;  2C38 B;  1NHI A;  4X65 I;  3HTX A;  5TSE A;  2EPX A;  1UEK A;  3GME A;  3WU6 A;  2NUG A;  3PS2 A;  2EM9 A;  2R42 A;  2EOY A;  1Z59 A;  3V2U C;  2EPZ A;  3HQ1 A;  4O43 A;  3HJC A;  2JT2 A;  1PDA A;  1ZBQ A;  2L8T A;  4B3M E;  5CFF E;  4GKK E;  4NBQ A;  4DR1 I;  5K36 E;  3JAM C;  4HTG A;  5AE1 A;  4TUG A;  2YWQ A;  2C39 B;  4FN5 A;  4DR5 I;  2UXD I;  3H09 A;  2YRK A;  1RC7 A;  4WXD A;  4DV5 I;  2CGE A;  1NZ0 A;  3ADG A;  3WU3 A;  2A25 A;  1Y4U A;  1FI4 A;  2G7H A;  4GKJ I;  4P52 A;  3AV0 A;  4LF7 I;  5ADZ A;  3CDI A;  2HKJ A;  5C0X F;  2EOZ A;  1AAY A;  1N36 E;  2EN6 A;  2ADR A;  4F6N A;  1S16 A;  4IZJ A;  4JI7 I;  2EOS A;  2EE8 A;  4JYA E;  1KIJ A;  2B7T A;  5IXM B;  1VI7 A;  1A1G A;  3Q6N A;  3QG5 C;  1YZ9 A;  4JI8 E;  4QNJ A;  2UUB I;  1X47 A;  3RMP A;  1YSA C;  2FV4 B;  3OTO I;  3L7Z B;  2O1V A;  4IS9 A;  1PKP A;  1SR9 A;  4AQY E;  4DV1 I;  2DMY A;  5EKW A;  5L3J A;  3ADJ A;  2WBS A;  2RS7 A;  2EOX A;  2ENC A;  2V86 A;  2C37 A;  2C37 B;  1YUI A;  4ZYD A;  4K0K E;  1Z1B A;  4WUD A;  5A2Q Q;  3B82 A;  2JPA A;  1WRJ A;  1FJG E;  2PO1 A;  5JEA C;  4R2E A;  4FWD A;  1E3P A;  1A1K A;  4XTJ A;  2JEA A;  2RSM A;  2YT4 A;  2LBS B;  5EL9 A;  1JK2 A;  4FW6 A;  1H73 A;  2EN7 A;  2ENA A;  1T4O A;  5DRP A;  3K85 A;  1RQ0 A;  2L92 A;  4DR5 E;  2YTJ A;  1A1I A;  4DU7 A;  4NXM I;  3VYX A;  4O24 A;  4JI3 I;  2EM3 A;  3C4B A;  2EN3 A;  4J8Z A;  2VRD A;  1ZM9 A;  1N34 I;  3NZK A;  4BA2 B;  1FWL A;  2LT7 A;  2V2Q A;  3J81 Q;  4DR7 E;  4DV0 I;  4JI6 E;  5FLX C;  1KTV A;  2UXC E;  1K47 A;  4NXM E;  2UUC I;  1ZU1 A;  2EQ1 A;  2WP8 B;  2PRT A;  4X64 E;  4MLV A;  1KYQ A;  2L6M A;  1N36 I;  4BA1 A;  2UXB E;  2WBU A;  1Z0V A;  1T39 A;  1EH6 A;  4P7D A;  2EOO A;  2MC6 A;  1YFH A;  4P78 A;  4FWH A;  2NAB A;  3U1Y A;  1Z5A A;  1VIS A;  2UUA E;  2EOQ A;  1N0U A;  4LFA E;  1QNT A;  2GQ0 A;  4BC7 A;  1YH8 A;  4HAC A;  4HAC B;  3QT6 A;  5FLX Q;  2LE2 A;  2EMF A;  2M9A A;  2NUE A;  2O1W A;  4U3B A;  4IJD A;  2JWO A;  5A6B A;  2VF3 A;  4ZYG A;  1I94 I;  1IBK I;  4P7A A;  2EOF A;  2JE6 A;  2CPN A;  5C0X D;  2WBT A;  2MC5 A;  2YTE A;  3GON A;  3H4L A;  4USM A;  1NHJ A;  1UHZ A;  1MEY C;  4MYT A;  3M7N G;  2PNZ B;  1A1F A;  2YTI A;  4KWY A;  2KOU A;  1XHK A;  4F6M A;  2K4V A;  2HHH I;  2RTX A;  1DGC A;  1HR0 E;  4X62 I;  5IWA E;  4LFB I;  4DPX A;  2IER A;  4N3O A;  2HK2 A;  4GQU A;  4WFT A;  4R2D A;  2EPK X;  4LCG A;  2PO0 A;  1XNR I;  3ADL A;  4L8N A;  4DV0 E;  4BMJ A;  5AAS A;  4ZVI A;  3P1X A;  2E5L I;  1MGT A;  1A1L A;  4OO1 C;  2EPR A;  4YY3 E;  2BA0 D;  2JR1 A;  1NEI A;  2H36 X;  2YTN A;  1Z0T A;  4WXC A;  1ZM3 A;  2V8P A;  4DPT A;  4JI3 E;  4JI8 I;  2KHX A;  4OO1 D;  2EMB A;  1XMO E;  2DRP A;  4DU8 A;  2F4V I;  4NHR A;  4JI5 E;  1X6H A;  3J7A G;  4MLQ A;  4DUY I;  5KL7 A;  3F6H A;  2EMW A;  1T4L B;  2BA1 D;  2HFS A;  2N8X A;  3IWD A;  4LF7 E;  1X5W A;  1RMD A;  3T1H I;  5DNY A;  2ELZ A;  4GKJ E;  3DD6 A;  4HYM A;  4BHC A;  1PIE A;  1FJG I;  3DJW A;  2IES A;  3B8H A;  2DEJ A;  1YYO A;  3P06 A;  1IQS A;  2YTF A;  1GZ6 A;  3PYG A;  2N3H A;  3MSW A;  1UBD C;  2R1F A;  2JP9 A;  1I94 E;  3B4T A;  2I9I A;  4LTY A;  2Q2E B;  4JI6 I;  1UDO A;  3THN A;  4OKG A;  4R2Q A;  2HKE A;  4B3R I;  1BBO A;  2EN4 A;  2EPM X;  3ZZU A;  2K7I A;  4DR2 E;  2GS8 A;  3BBG A;  4DV7 I;  4JYA I;  3EQ1 A;  1MG7 A;  2MDR A;  3FIG A;  4IFD A;  4OO1 B;  4DV2 E;  1UDQ A;  4USK A;  2YRM A;  4BCA A;  3K17 A;  4GEQ B;  3F6G A;  3THO B;  2EM6 A;  4DMI A;  3PYF A;  1GQE A;  1IQO A;  4ZYH A;  4DR6 I;  5KL2 A;  2L2N A;  2MKN A;  4DPY A;  3B78 A;  4J3D A;  4FW9 A;  4JI0 E;  1KKH A;  1N33 E;  2LMZ A;  4DUY E;  4OO1 F;  5K36 A;  2E1R A;  2UXD E;  2DLQ A;  1FNM A;  2JYA A;  4X66 E;  4MU0 A;  2JEA B;  5IT9 Q;  2EN8 A;  4LF6 E;  3HKM A;  5LMN I;  1S4E A;  2LRS A;  5BR8 E;  1X6F A;  2M7Q A;  2V85 A;  4DR3 E;  2J7J A;  2WCC 3;  2RPC A;  2EWL A;  2EN1 A;  4WSP A;  3OTO E;  3EPJ A;  1Y5Y A;  1ZM4 A;  3HUL A;  4KQV A;  2Q8U A;  2MKD A;  4F9B B;  4DV3 E;  2EOJ A;  3M99 B;  1FWK A;  1R6L A;  1USU A;  2IOP A;  5LMU I;  4BC9 A;  3JTZ A;  3BF2 A;  2EMI A;  2IOQ A;  1MX0 A;  4QNK A;  2CT1 A;  3DF6 A;  4MU3 A;  3M85 G;  1ZR9 A;  3LLH A;  4R2S A;  2HHH E;  4LFB E;  4DUZ I;  2EML A;  2LV2 A;  2YU5 A;  2YTQ A;  4IFD E;  4LOM A;  4R1F A;  4F9C B;  2J65 A;  1G2D C;  3VYY A;  3GCM A;  2EMA A;  1N0V C;  2R3V A;  2RQL A;  1NHH A;  4DV6 E;  4PRX A;  4BA1 B;  2EL6 A;  2ODR C;  1YPN A;  2Z5C A;  5C0X A;  4YHH I;  4I8O A;  4DV1 E;  3LTO A;  1AH5 A;  1OYP A;  4AQY I;  1YYK A;  2UXC I;  4LPF A;  4O4K A;  2GO3 A;  2ODR D;  4UT4 A;  3WU4 A;  4B3M I;  4GKK I;  2HC5 A;  2Z5B B;  3J80 C;  1LLM C;  5DRO A;  4YHH E;  2JY9 A;  4LFA I;  4DV6 I;  2VQF I;  1Y4S A;  2EPC A;  2LUQ A;  2YSP A;  3BID A;  2LO3 A;  3P3C A;  4HXZ A;  2EPU A;  2V8Q B;  1ELO A;  1WHQ A;  2V2Z A;  3P3E A;  4WUB A;  4DPU A;  4LU9 A;  4BHB A;  3AUZ A;  2Z5C B;  5C0X B;  1HR0 I;  4KHP E;  2WNR A;  3MHH C;  4NXN I;  5K36 B;  2NN6 C;  2NA2 A;  3CWV A;  4PRV A;  4ED4 A;  4KZS A;  4MYU A;  2O1U A;  3K1J A;  2EL5 A;  1N3G A;  2BBG A;  4R8O A;  3UHM A;  4WYQ B;  2ZM6 I;  1BKN A;  3QT8 A;  1Y60 A;  3P3G A;  3L00 A;  4YY3 I;  4X9J A;  1R6M A;  4NZV A;  2AE8 A;  5BR8 I;  2EPL X;  2EMH A;  2ZM6 E;  2PNL A;  2DIX A;  4LF6 I;  1A1J A;  4EMD A;  1Z0W A;  2ENH A;  4LFC E;  1YYW A;  2YTO A;  2V2V A;  2BA0 G;  2BR2 A;  3J80 Q;  2UUA I;  1T4N A;  2EM2 A;  1EH7 A;  2EMC A;  3PRY A;  4Z7C A;  4AM3 A;  2HJJ A;  2EP3 A;  2HK3 A;  2B9D A;  2CSH A;  1YHC A;  3EPK A;  1E3H A;  1ZXM A;  4LF9 E;  1B69 A;  3Q1Q A;  2EOH A;  2BB8 A;  2WZO A;  1UN6 B;  4DR4 I;  3M7N D;  1WUU A;  4FW4 A;  2L2K B;  1A1H A;  2BA1 G;  4MQY A;  1EI1 A;  5JEA A;  4K0K I;  1RHY A;  3V5R A;  2YPN A;  5C0X E;  4OOG C;  1TF3 A;  4RPF A;  4LFC I;  1EA6 A;  2V88 A;  5IT9 C;  2LJH A;  5AC5 A;  4ZYE A;  4DR7 I;  2UU9 I;  1Z0C A;  1OYS A;  2FTX B;  4DR1 E;  4FWG A;  4IS1 C;  2LCE A;  3ZM7 A;  4JV5 I;  2LVH A;  2E72 A;  3HPZ A;  4JI7 E;  3HPS A;  2EN2 A;  3ZZ0 A;  4ISA A;  5A6A A;  2R76 A;  5C0X C;  5ELW A;  3QT7 A;  2L3C A;  2I13 A;  2HGH A;  2PO1 B;  2EM8 A;  2PO2 B;  2CZ9 A;  1B63 A;  2JVA A;  1WHN A;  4R2P A;  4FW7 A;  5K36 C;  2EMG A;  1BBG A;  5A6J A;  2E1M A;  2CVE A;  1HNW E;  1XNQ E;  1UIL A;  2C39 A;  4JI1 I;  1IBM I;  5DNX A;  4TUI A;  2F4V E;  2PNM A;  1D6T A;  2HFU A;  2ELY A;  1WJP A;  1KVK A;  2JEB B;  4WUC A;  3PS1 A;  4DV7 E;  4GZN C;  4DR2 I;  5KL3 A;  2RS6 A;  4FW3 A;  1A6F A;  4O5G A;  2EM0 A;  2NN6 A;  2JE6 B;  1T38 A;  2BR2 B;  3T1Y I;  4R03 A;  5KL5 A;  4Q28 A;  1J5E E;  1H72 C;  2B7V A;  1N32 I;  4IFD C;  2F1D A;  1P47 A;  4AIM A;  1N33 I;  3EPL A;  4IFD D;  2EPO A;  1H7S A;  2EFG A;  2PO2 A;  2F8B A;  1Z5B A;  4FW5 A;  2YRH A;  3IWC A;  2EQ3 A;  2EOE A;  4DR6 E;  1P42 A;  2A2C A;  4B3S I;  2YSO A;  4LF5 I;  1QZR A;  3Q6M A;  3PYD A;  2LJU A;  2EPN A;  1DQ3 A;  2NN6 B;  4X64 I;  1UDS A;  2YTP A;  4WSG A;  4R2R A;  2WNR B;  1X48 A;  1XMQ E;  2X36 A;  5DRQ A;  1HNZ I;  5K36 D;  3JU0 A;  1PVG A;  1N32 E;  3J81 C;  3HXL A;  4DV3 I;  3C4T A;  2BM1 A;  1ZBT A;  4M1K A;  4URL A;  2GLI A;  2M4I A;  3ZOQ B;  2WW4 A;  3D4J A;  5DRR A;  3BGH A;  2AJ4 A;  1XMQ I;  2EM7 A;  2EQ0 A;  4BS9 A;  5LMN E;  3JAM Q;  4BBY A;  2JOB A;  2VE7 C;  5AC4 A;  4JI2 I;  4DR4 E;  2OI2 A;  4OX9 I;  3GLL A;  2B3T B;  1XNQ I;  1IMU A;  2UXB I;  4LCH A;  4JI0 I;  4DUZ E;  3LPS A;  5IWA I;  4KHP I;  3EPH A;  1XXE A;  2L3J A;  1Z0E A;  2V89 A;  4DV5 E;  3LML A;  2CTD A;  1ZXN A;  4IZK B;  4LF4 E;  4LCF A;  2EPP A;  4JI2 E;  1BB8 A;  1X49 A;  4AID A;  1DAR A;  4B3T I;  2A2D A;  1HNX E;  1J5E I;  1GTK A;  2XEX A;  2D9H A;  3T1Y E;  3H1C A;  4B3R E;  2WP8 A;  2J7K A;  1NCS A;  3M6A A;  1ZM2 A;  5GMD A;  1F2I G;  1EH8 A;  5AE3 A;  1WXR A;  4LF8 E;  4MU1 A;  4F9A B;  3L7Z A;  1B62 A;  2VES A;  4JI4 I;  4HEI A;  2EMX A;  1MU5 A;  4L5N C;  5A69 A;  1TF6 A;  4X65 E;  2N3G A;  4BA2 A;  2YTG A;  2EMY A;  1FKA E;  4IZJ B;  2IHR 1;  5T6J A;  3C6M A;  4M0V A;  4U3D A;  3TQM A;  5A2Q C;  3MHS C;  5KL4 A;  4OX9 E;  1YUJ A;  2L33 A;  2V87 A;  1ZAA C;  1DI2 A;  2ZBK B;  3K6Q A;  2GHF A;  2M1S A;  1J26 A;  4OO1 E;  3QT5 A;  5IV8 B;  1Y6Z A;  1IBL I;  3IWB A;  1X6E A;  4JI4 E;  4LF8 I;  2EL4 A;  2V34 A;  3LNU A;  2UU9 E;  5JEA E;  2JOX A;  2E5L E;  2EMZ A;  2EM4 A;  1N34 E;  1OJ4 A;  2O1T A;  2CG9 A;  4IZJ D;  5GME A;  2ZIT A;  3M85 D;  4OZE A;  2DB2 A;  1XNR E;  2LJP A;  2L2M A;  3KZY A;  1Z5C A;  2NN6 E;  3ZKD A;  3KRN A;  4LF4 I;  2LUP B;  1JK1 A;  1PJS A;  2MDG A;  1SFE A;  1PJT A;  2EOM A;  2EOI A;  5F3W A;  3VK6 A;  2NN6 F;  2NN6 D;  2VQE I;  2Z5B A;  2LTR A;  2DMI A;  5LMU E;  2JXP A;  1XMO I;  4M2Z A;  5JEA D;  3PYE A;  5KL6 A;  2YZT A; 
#chains in the Genus database with same CATH homology
 2FGG A;  4JV5 E;  5AE2 A;  4Z7Y A;  3ZKB A;  4M30 A;  2NUF A;  3J7Y p;  4B3T E;  1O0W A;  4HY1 A;  4IZK A;  4X8W A;  4X66 I;  1U2R A;  1HK7 A;  1EKZ A;  2X7I A;  4JI1 E;  4DPW A;  1QU6 A;  4B3S E;  4LF5 E;  3WU5 A;  1H7U A;  3OML A;  2EZ6 A;  4DV4 I;  3F0N A;  5LL6 R;  4DV2 I;  1RR9 A;  4JG4 A;  2VQF E;  4JI5 I;  1IBK E;  2UUC E;  2LTS A;  5FWK A;  4PU9 A;  2UUB E;  2DSY A;  3ADI A;  4DR3 I;  3J7A M;  1IBL E;  1HNZ E;  2V83 A;  1HNX I;  2NPF A;  3ZZT A;  4F54 A;  4DV4 E;  2KON A;  2DEI A;  4WPY A;  2Z5E A;  4I3H A;  2VQE E;  4LF9 I;  2VF1 A;  1IBM E;  3T1H E;  1USV A;  3KWR A;  2BM0 A;  4NXN E;  1HNW I;  1RRE A;  4X62 E;  4UTG A;  2BV3 A;  1H74 A;  1Z0G A;  4DXL A;  1STU A;  4DKK A;  4X65 I;  1Z0B A;  1NHI A;  3HTX A;  1UEK A;  3WU6 A;  2NUG A;  2R42 A;  1Z59 A;  3V2U C;  3HQ1 A;  3HJC A;  1ZBQ A;  2L8T A;  4B3M E;  5CFF E;  4GKK E;  4DR1 I;  3JAM C;  5AE1 A;  4TUG A;  4FN5 A;  4DR5 I;  2UXD I;  3H09 A;  1RC7 A;  4DV5 I;  2CGE A;  1NZ0 A;  3ADG A;  3WU3 A;  1Y4U A;  1FI4 A;  2G7H A;  4GKJ I;  4P52 A;  3AV0 A;  4LF7 I;  5ADZ A;  2HKJ A;  1N36 E;  1S16 A;  4IZJ A;  4JI7 I;  1KIJ A;  4JYA E;  2B7T A;  3Q6N A;  1YZ9 A;  4JI8 E;  2UUB I;  1X47 A;  3RMP A;  2FV4 B;  3OTO I;  2O1V A;  1PKP A;  1SR9 A;  4AQY E;  4DV1 I;  2DMY A;  5L3J A;  3ADJ A;  2RS7 A;  2V86 A;  4K0K E;  4WUD A;  5A2Q Q;  3B82 A;  1FJG E;  4FWD A;  4XTJ A;  2RSM A;  2YT4 A;  2LBS B;  1H73 A;  1T4O A;  3K85 A;  1RQ0 A;  2L92 A;  4DR5 E;  4DU7 A;  4NXM I;  3VYX A;  4JI3 I;  3C4B A;  4J8Z A;  1ZM9 A;  1N34 I;  1FWL A;  2V2Q A;  3J81 Q;  4DR7 E;  4DV0 I;  4JI6 E;  5FLX C;  1KTV A;  2UXC E;  1K47 A;  4NXM E;  2UUC I;  4X64 E;  2L6M A;  1N36 I;  2UXB E;  1Z0V A;  4P7D A;  2MC6 A;  4FWH A;  4P78 A;  1Z5A A;  1VIS A;  2UUA E;  2GQ0 A;  1N0U A;  4LFA E;  4HAC A;  4HAC B;  3QT6 A;  5FLX Q;  2LE2 A;  2NUE A;  2O1W A;  2JWO A;  2VF3 A;  1I94 I;  1IBK I;  4P7A A;  2CPN A;  2MC5 A;  3GON A;  3H4L A;  4USM A;  1NHJ A;  1UHZ A;  4MYT A;  2KOU A;  1XHK A;  2K4V A;  2HHH I;  2RTX A;  1HR0 E;  4X62 I;  4LFB I;  5IWA E;  4DPX A;  4N3O A;  2HK2 A;  4WFT A;  1XNR I;  3ADL A;  4L8N A;  4DV0 E;  4BMJ A;  5AAS A;  4ZVI A;  3P1X A;  2E5L I;  4YY3 E;  2JR1 A;  2H36 X;  1Z0T A;  2V8P A;  1ZM3 A;  4DPT A;  4JI3 E;  4JI8 I;  2KHX A;  1XMO E;  4DU8 A;  2F4V I;  4JI5 E;  3J7A G;  4DUY I;  3F6H A;  1T4L B;  2HFS A;  3IWD A;  4LF7 E;  3T1H I;  5DNY A;  4GKJ E;  4HYM A;  1PIE A;  1FJG I;  3DJW A;  3B8H A;  2DEJ A;  1YYO A;  3P06 A;  1GZ6 A;  3PYG A;  2N3H A;  3MSW A;  1I94 E;  4LTY A;  2Q2E B;  4JI6 I;  2HKE A;  4B3R I;  3ZZU A;  4JYA I;  4DR2 E;  2GS8 A;  4DV7 I;  1MG7 A;  2MDR A;  3FIG A;  4DV2 E;  4USK A;  4BCA A;  3K17 A;  4GEQ B;  3F6G A;  4DMI A;  3PYF A;  1GQE A;  4DR6 I;  2L2N A;  4DPY A;  3B78 A;  4FW9 A;  4JI0 E;  1KKH A;  1N33 E;  2LMZ A;  4DUY E;  2E1R A;  2UXD E;  1FNM A;  4X66 E;  5IT9 Q;  4LF6 E;  5LMN I;  1S4E A;  2LRS A;  5BR8 E;  2M7Q A;  2V85 A;  4DR3 E;  2EWL A;  4WSP A;  3OTO E;  1ZM4 A;  3HUL A;  4KQV A;  4F9B B;  4DV3 E;  1FWK A;  1USU A;  2IOP A;  5LMU I;  4BC9 A;  3JTZ A;  2IOQ A;  1MX0 A;  3DF6 A;  3LLH A;  2HHH E;  4LFB E;  4DUZ I;  4R1F A;  4F9C B;  3VYY A;  1N0V C;  2R3V A;  4PRX A;  1NHH A;  4DV6 E;  2ODR C;  2Z5C A;  4YHH I;  4I8O A;  4DV1 E;  3LTO A;  4AQY I;  2UXC I;  1YYK A;  2ODR D;  4UT4 A;  3WU4 A;  4B3M I;  4GKK I;  2Z5B B;  3J80 C;  4YHH E;  2JY9 A;  4LFA I;  4DV6 I;  2VQF I;  1Y4S A;  2LUQ A;  4HXZ A;  2V8Q B;  1ELO A;  4WUB A;  1WHQ A;  2V2Z A;  4DPU A;  4LU9 A;  3AUZ A;  2Z5C B;  1HR0 I;  4KHP E;  4NXN I;  2NA2 A;  3CWV A;  4PRV A;  4ED4 A;  4KZS A;  4MYU A;  2O1U A;  3K1J A;  4R8O A;  4WYQ B;  2ZM6 I;  1BKN A;  3QT8 A;  4YY3 I;  5BR8 I;  2ZM6 E;  2PNL A;  2DIX A;  4LF6 I;  4EMD A;  1Z0W A;  4LFC E;  1YYW A;  2V2V A;  3J80 Q;  2UUA I;  1T4N A;  3PRY A;  4Z7C A;  2HK3 A;  2B9D A;  1ZXM A;  4LF9 E;  3Q1Q A;  2WZO A;  4DR4 I;  1WUU A;  2L2K B;  1EI1 A;  4K0K I;  3V5R A;  4OOG C;  4RPF A;  4LFC I;  1EA6 A;  2V88 A;  5IT9 C;  2LJH A;  4DR7 I;  2UU9 I;  1Z0C A;  2FTX B;  4DR1 E;  4FWG A;  3ZM7 A;  4JV5 I;  3HPZ A;  3HPS A;  4JI7 E;  3ZZ0 A;  3QT7 A;  2L3C A;  2CZ9 A;  1B63 A;  2JVA A;  1WHN A;  2E1M A;  1HNW E;  1XNQ E;  1UIL A;  4JI1 I;  1IBM I;  4TUI A;  2F4V E;  2PNM A;  1D6T A;  2HFU A;  1KVK A;  4WUC A;  4DV7 E;  4DR2 I;  2RS6 A;  1A6F A;  3T1Y I;  4R03 A;  1J5E E;  4Q28 A;  1H72 C;  2B7V A;  1N32 I;  1N33 I;  1H7S A;  2EFG A;  2F8B A;  1Z5B A;  4DR6 E;  3IWC A;  2A2C A;  4B3S I;  4LF5 I;  1QZR A;  3Q6M A;  3PYD A;  1DQ3 A;  4X64 I;  1X48 A;  1XMQ E;  2X36 A;  1HNZ I;  3JU0 A;  1PVG A;  1N32 E;  3J81 C;  3HXL A;  4DV3 I;  3C4T A;  2BM1 A;  1ZBT A;  4M1K A;  4URL A;  2M4I A;  3ZOQ B;  2WW4 A;  3D4J A;  2AJ4 A;  1XMQ I;  4BS9 A;  5LMN E;  3JAM Q;  4BBY A;  2JOB A;  2VE7 C;  4JI2 I;  4DR4 E;  2OI2 A;  4OX9 I;  2B3T B;  1XNQ I;  2UXB I;  4JI0 I;  5IWA I;  4DUZ E;  3LPS A;  4KHP I;  1Z0E A;  2L3J A;  1ZXN A;  2V89 A;  4DV5 E;  3LML A;  4IZK B;  4LF4 E;  4JI2 E;  1X49 A;  1DAR A;  4B3T I;  2A2D A;  1HNX E;  1J5E I;  2YZT A;  2XEX A;  3T1Y E;  4B3R E;  3M6A A;  2J7K A;  5GMD A;  1ZM2 A;  5AE3 A;  1WXR A;  4LF8 E;  4JI4 I;  4F9A B;  1B62 A;  1MU5 A;  4L5N C;  4X65 E;  2N3G A;  1FKA E;  4IZJ B;  2IHR 1;  5T6J A;  4M0V A;  5A2Q C;  4OX9 E;  2L33 A;  2V87 A;  1DI2 A;  2ZBK B;  3K6Q A;  2M1S A;  1J26 A;  3QT5 A;  1Y6Z A;  1IBL I;  3IWB A;  4JI4 E;  4LF8 I;  2V34 A;  3LNU A;  2UU9 E;  2JOX A;  2E5L E;  1OJ4 A;  1N34 E;  2O1T A;  4IZJ D;  5GME A;  2CG9 A;  2ZIT A;  2DB2 A;  1XNR E;  2LJP A;  2L2M A;  1Z5C A;  3ZKD A;  4LF4 I;  2LUP B;  5F3W A;  3VK6 A;  2VQE I;  2Z5B A;  2LTR A;  5LMU E;  1XMO I;  4M2Z A;  3PYE A;  4BC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...