3J81C

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
b'GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j81C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81C02
1FWKA 5FLXQ 4JI7I 2AJ4A 1N32E 4ZVIA 5A2QC 4USMA 3F0NA 1HR0E 2DEIA 4X62I 4HXZA 1UEKA 1Z0VA 4LF8E 4PRVA 1K47A 4JI8E 5GMEA 4LFBE 3V5RA 5A2QQ 3JAMC 1Z0CA 5IT9C 2XEXA 4JI1E 1XHKA 4DR1E 4K0KI 4DR4I 4DV3E 4DR2E 4DR5E 3PYEA 2UUBE 1Z0BA 4WUBA 4M1KA 5LMNE 4DUZI 1I94E 1Z5CA 4LFAI 1OJ4A 4DV0E 2CZ9A 3JAMQ 4GKKI 2HFUA 4DV2I 2E1RA 1H72C 1FI4A 2E5LI 1XNRE 1VISA 1ZM4A 1KTVA 2UUCI 2HFSA 3Q1QA 4RPFA 1ZXNA 1PKPA 2EFGA 4JV5E 1N34I 1RREA 2HHHE 4DR6E 3HULA 4LF9E 3T1YE 1FJGE 4LF4E 1N0VC 5LL6R 4DV4I 2F4VI 4NXME 1KIJA 4DV6I 1FWLA 4DV7I 2ZITA 2V2QA 5BR8I 4B3MI 4DU8A 1NHHA 4FN5A 4B3TI 3B78A 2UXBI 1B63A 1HNWE 3J7AM 4DPXA 1Z0WA 1RR9A 1N33E 4USKA 3QT5A 4JI0E 1IBKE 4EMDA 3M6AA 1PVGA 4R1FA 1XMQI 4JI6E 4LFCE 2A2DA 4Z7YA 4ED4A 2ZM6E 1XMOE 4DR7E 2HKEA 1EA6A 4AQYE 4DV5I 3T1HI 4JI4I 2OI2A 3ZM7A 3J80Q 1Z0TA 2VQEE 4YHHI 4YY3I 4NXNI 4LF7I 1MX0A 4OX9I 1ZM2A 1IBMI 2R3VA 2VQFI 4JI7E 1NHJA 3LTOA 1N36I 2UXDE 1KVKA 2DEJA 1ELOA 4LF5I 3PYGA 2X36A 4DR5I 2Q2EB 1ZM3A 3B8HA 1I94I 4KHPE 5IWAI 5LMUI 5IT9Q 1XNQI 4GKJI 3CWVA 2UUAI 4DU7A 1MU5A 3LPSA 4K0KE 4DR4E 2V34A 4JV5I 2A2CA 3ZZUA 1J5EI 4DR6I 4DUZE 4UT4A 4DV1I 4LFAE 4UTGA 4GKKE 4DV2E 1Z0EA 2UXCI 4WUCA 4I3HA 3GONA 4X64I 4DPWA 2UUCE 4JYAE 4B3SI 5L3JA 1HNXI 1N34E 2V8PA 3QT6A 2VF3A 4DPUA 4JI5I 3J81C 4LF6I 4JI3I 2WW4A 4B3RE 4P7AA 1KKHA 4DR3I 2ZBKB 4X65I 1IBLE 4X66I 2F4VE 2UU9I 1FKAE 1S16A 4DPYA 4DV6E 4JI2I 4JI0I 3J81Q 4DV7E 3QT8A 5BR8E 5GMDA 2BM1A 4DUYE 4B3ME 4JI6I 4HACA 4LFCI 1N32I 2GS8A 1Z0GA 2ZM6I 1XMOI 4FWHA 1HR0I 4P52A 2UXBE 1HNZE 4HY1A 3WU5A 2VQEI 4LF8I 1WUUA 3H4LA 3OTOE 4JI8I 1Z59A 4LFBI 3PYFA 2UXDI 2J7KA 1XMQE 4JI1I 3WU6A 1S4EA 4DR1I 3LNUA 2X7IA 4URLA 4DR2I 4DV3I 1NZ0A 1ZM9A 4XTJA 3WU4A 4DXLA 4DV5E 4X62E 3ZZ0A 3T1HE 4JI4E 2UUBI 1DARA 4FWGA 4KHPI 5LMNI 3D4JA 1N0UA 4JG4A 4YHHE 4YY3E 4LF7E 4NXNE 1Z5AA 4DV0I 2HKJA 4OX9E 1A6FA 1IBME 2VQFE 3B82A 1N36E 3J7AG 4FW9A 1B62A 4DPTA 1XNRI 1H7SA 4LF5E 1PIEA 3ZKDA 4WUDA 1QZRA 1D6TA 1BKNA 2HHHI 1U2RA 4LF9I 4Z7CA 3K17A 3T1YI 1FJGI 4LF4I 1MG7A 5IWAE 5LMUE 1XNQE 4GKJE 2UUAE 4FWDA 2BV3A 4JYAI 2E5LE 2BM0A 4NXMI 2HK2A 1EI1A 1J5EE 4KQVA 4DV1E 2NPFA 2V2ZA 4B3RI 1H74A 2UXCE 1Z5BA 1IBLI 1HNWI 2HK3A 4X64E 1ZXMA 4DV4E 1FNMA 1N33I 4PRXA 4B3SE 1H7UA 4HACB 1HNXE 3WU3A 1IBKI 4JI5E 2LJPA 4DUYI 2R42A 4PU9A 4LF6E 1H73A 4JI3E 5FLXC 4MYUA 2V2VA 3QT7A 4DR7I 4B3TE 1HNZI 3ZZTA 4DR3E 4AQYI 4X65E 1NHIA 4X66E 2UU9E 3J80C 4HYMA 3ZKBA 3PYDA 3V2UC 4JI2E 3K1JA 3OTOI 4MYTA
chains in the Genus database with same CATH superfamily
2EM8A 1FWKA 5FLXQ 4AM3A 2EMWA 2JOBA 2EMFA 2EOYA 2N8XA 1T4OA 4JI7I 2NN6A 1N32E 2AJ4A 4URLA 4ZVIA 1E3HA 4ISAA 3VK6A 5A2QC 2BA1G 5K36B 4WX9A 4USMA 3HQ1A 3F0NA 4MU1A 1EH6A 2YRMA 1UN6B 1HR0E 4OO1F 1Y60A 3Q6MA 2DEIA 5DRRA 1JK1A 4X62I 3ECRA 2VRDA 2YTIA 2EPXA 4HXZA 1UEKA 1A1GA 2JP9A 1Z0VA 3DD6A 2L3JA 1G2DC 4DV3I 2EM6A 5JEAE 3F6HA 2Z5BA 4LTYA 4LF8E 5K36F 2YPNA 1RHYA 3IWDA 3PRYA 4ZYHA 2EMCA 1K47A 3HKMA 4PRVA 4MQYA 2LE2A 4JI8E 5GMEA 3EPJA 2C39A 4LFBE 3V5RA 4WXCA 1YSAC 5A2QQ 4IFDA 1WHNA 3JAMC 1T38A 1Z0CA 2EMGA 4F54A 5IT9C 4JI1E 2JE6A 2XEXA 4NHRA 4IFDD 5F3WA 2NUEA 5DNYA 1XHKA 4DR1E 4K0KI 2JOXA 4X9JA 4DR4I 2B9DA 3VYYA 1YYKA 5AE3A 2JEBA 5AC4A 4DV3E 4DR2E 1A1JA 2EPNA 4DR5E 3BBGA 3PYEA 2UUBE 2EN7A 1IQOA 1XXEA 1Z0BA 4BA2A 4WUBA 4M1KA 4RHBB 4IFDC 5LMNE 4DUZI 1I94E 4IZJA 1Z5CA 4IZJD 4LFAI 1OJ4A 4DV0E 2EOOA 2MDGA 2CZ9A 1UBDC 2C37B 2EZ6A 3JAMQ 2AE8A 4BS9A 3PS1A 5C0XA 4GKKI 5IXMB 2HFUA 3KZYA 3DJWA 2O1WA 2E1RA 2YTNA 4DV2I 2YTJA 4GZNC 1IMUA 1H72C 1FI4A 2J65A 2E5LI 2EPAA 2L92A 5LLQA 1XNRE 1VISA 1ZM4A 2PNZB 2EM0A 1KTVA 2UUCI 2HFSA 3Q1QA 2V88A 3DF6A 4RPFA 3EPHA 1ZXNA 1PKPA 2B7VA 1N3GA 1BB8A 2EFGA 4JV5E 5KL5A 1QNTA 2BA1D 1RREA 1N34I 4IZKA 3IWCA 3NZKA 2RS7A 2WBSA 4FW4A 2HHHE 2EOMA 1KYQA 2PNLA 4DR6E 4LCGA 3L7ZB 4LF9E 3HULA 1BBOA 5JEAA 2DRPA 3T1YE 2C38A 1FJGE 2JPAA 2E1MA 4LF4E 2PO0B 1N0VC 2DB2A 2EPRA 4FW6A 1DGCA 3BF2A 2L6MA 1Y4SA 2BA0G 4FK5C 3GCMA 1MGTA 5LL6R 3P3CA 5DRQA 4DV4I 2FTXB 2JT2A 2EMYA 2F4VI 5AE1A 2V87A 4NXME 1KIJA 1Y5YA 4DV6I 1FWLA 2EWLA 5T6JA 4O4KA 3QG5C 4DV7I 5A6JA 2PO1B 2EQ0A 3VYXA 4TUGA 4IFDE 2ZITA 2V2QA 5BR8I 4BA1B 2JY9A 3C6KA 3C4TA 3GMEA 4B3MI 2EPZA 4U3DA 2CG9A 1JK2A 1O0WA 4WPYA 3Q6NA 3CDIA 2PNMA 2EMLA 4DU8A 5KL7A 2KOUA 2EMZA 4WSGA 4DMIA 1NHHA 2Z5CA 2HC5A 1UILA 4FN5A 1A1LA 4B3TI 2MC5A 2RTXA 3UK3C 3B78A 2UXBI 4ZYEA 1B63A 1HNWE 2EPKX 2YRKA 1MEYC 4DPXA 1Z0WA 3P3EA 3HPSA 2Z5EA 3J7AM 2ADRA 5DNLA 1RR9A 3H09A 1YUJA 4WYQB 4R2CA 1N33E 3J7Yp 4R2DA 2NN6B 3MHHC 1NCSA 2V8QB 1YYOA 2L8TA 3OMLA 1GTKA 2DLKA 3QT5A 4USKA 3M99B 2LMZA 2K4VA 4JI0E 1UDQA 2EL5A 3LLHA 1IBKE 2YU5A 2CGEA 4EMDA 4M2ZA 2PO2A 4OO1B 1T4NA 3M6AA 1PVGA 4LOMA 1T4LB 1ZBQA 2DSYA 1YZ9A 2CPNA 3FIGA 4R1FA 2M1SA 1XMQI 4JI6E 3M7NG 4L5NC 4LFCE 2EE8A 2R76A 2A2DA 4BA2B 4Z7YA 2NA2A 4ED4A 3HXLA 4WXDA 2NN6F 2LT7A 2ZM6E 1XMOE 2EPPA 2EPOA 4DR7E 4Q35B 2Z5BB 2HKEA 1EA6A 2G7HA 3M85D 5FWKA 4GEQB 2LTRA 4AQYE 4DV5I 3T1HI 1EH7A 4R2PA 5EL9A 1E3PA 4JI4I 3LMLA 2OI2A 3ZM7A 3J80Q 2C39B 4MLVA 4MU0A 1Z0TA 4ZYGA 2VQEE 1IQSA 4BCAA 5CFFE 4YHHI 4YY3I 1RMDA 2JE6B 4OZEA 2WZOA 4NXNI 4LF7I 1MX0A 2DIXA 4OX9I 1ZM2A 2R3VA 1IBMI 4U3BA 1YYWA 2JEBB 2VQFI 3EQ1A 4JI7E 2UXDE 1NHJA 3LTOA 1N36I 2EM9A 1L4SA 2JYAA 3GLLA 2J7JA 4J3DA 3RMPA 4IFDF 1KVKA 2DEJA 2V85A 1ELOA 4LF5I 3PYGA 2JEAA 2X36A 3PS2A 1WRJA 2NABA 2YSPA 4DR5I 1STUA 3P76A 2Q2EB 1ZM3A 2EL4A 2ENAA 5K36D 4MYTA 3ADGA 1TF3A 3B8HA 1I94I 2L2KB 4DXLA 4KHPE 2ENCA 2EOXA 2JVAA 1ZAAC 2JR1A 2JWOA 2IHR1 4KWYA 4RH8A 2MKNA 2ELYA 1P42A 4O24A 2EPUA 5IWAI 1GQEA 5LMUI 5IT9Q 5K36C 2L2MA 1XNQI 4GKJI 3CWVA 5ADZA 5C0XF 2I9IA 2UUAI 1WHQA 4J8ZA 1MU5A 4DU7A 2YTPA 3AV0A 4ZYDA 3LPSA 4K0KE 5KL6A 2CSHA 4DR4E 5AC5A 2V34A 5A6KA 2VF1A 2DMYA 2JXPA 3L00A 4JV5I 3THNA 2KONA 5JEAB 2C38B 4BC9A 4BC7A 2EPLX 1TN9A 2A2CA 5TSEA 3ZZUA 1J5EI 3C6MA 2EOFA 4DR6I 1PJSA 2GO4A 4DUZE 4R2EA 2EN4A 4LFAE 4UT4A 2EORA 4DV1I 2M4IA 1UDNA 4LCFA 4NBQA 2M9AA 2EM4A 4UTGA 4M0VA 4GKKE 1BBGA 2RSIA 4PRXA 5JEAF 4FW5A 4M30A 4DV2E 1PJTA 1P47A 4R2AA 3P1XA 4F9AB 1Z0EA 2BR2B 2HJJA 2VESA 4WUCA 4I3HA 2V83A 3ADLA 3GONA 1OYPA 4N3OA 4X64I 2MKDA 2M7QA 1SR9A 4DPWA 2UUCE 4JYAE 2FGGA 4B3SI 4BBYA 5L3JA 3TQMA 2EM7A 3K6QA 1F2IG 2EOEA 1N34E 1HNXI 2V8PA 4R8OA 3QT6A 2VF3A 2A25A 2Z5CB 4DPUA 4JI5I 3J81C 5AE2A 4LF6I 4OO1E 2YT4A 4HEIA 4JI3I 2WW4A 4IS1C 4I8OA 4B3RE 5KL3A 1T39A 2O1UA 3ADIA 4M9VC 5K36E 3IWBA 4P7AA 2LCEA 2EPCA 1KKHA 4DR3I 3K85A 5A6BD 2HGHA 2ZBKB 4X65I 1Y6ZA 1IBLE 4X66I 2F4VE 1X48A 2UU9I 1FKAE 1S16A 4BHBA 5KL2A 1WJPA 1X47A 2E72A 3KZZA 4DV6E 4DPYA 4JI2I 4DR2I 4JI0I 2YTEA 2GO3A 3J81Q 4DV7E 2LUQA 2K7IA 2LVHA 2YSOA 4O43A 4BMJA 3QT8A 4R2SA 5JEAC 2WP8A 5BR8E 5GMDA 2WBUA 4DUYE 1SFEA 4B3ME 2BM1A 4JI6I 4HACA 2ODRD 4LFCI 1N32I 4F6NA 2GS8A 1Z0GA 1GZ6A 2WNRA 2PO1A 5A6AA 2EOIA 1A1KA 2ZM6I 1XMOI 2LUPB 1USUA 4FWHA 4BA1A 1HR0I 2IOPA 4WSPA 4P52A 2UXBE 2UXCI 1HNZE 2EOHA 3HTXA 3BGHA 4X8WA 2F1DA 4NZVA 3KRNA 2LTSA 2ODRC 1DI2A 4HY1A 3WU5A 3MSWA 4LU9A 1Z1BA 1X6HA 2VQEI 4LF8I 2IERA 4IFDB 5EKWA 2DMIA 2BA0D 1WUUA 2R1FA 3H4LA 2B3TB 2EN8A 2YWQA 2RS6A 3OTOE 4JI8I 1Z59A 4LFBI 3PYFA 2UXDI 2JEAB 2J7KA 2EOSA 2YZTA 1XMQE 2NN6D 4JI1I 2LRSA 4OO1A 4FW3A 3WU6A 4OO1D 1S4EA 4DR1I 1RQ0A 4P7DA 3LNUA 2V89A 2X7IA 3C4BA 4IZJB 2CTDA 1X6FA 4DKKA 1NZ0A 4DV5E 3T1HE 1ZM9A 1EH8A 4X62E 2CVEA 4XTJA 4JI4E 5DROA 3WU4A 3ZZ0A 5K36A 2RQLA 1J26A 2EM2A 4P78A 3KWRA 1A1IA 2UUBI 2NN6C 1DARA 1X49A 4FWGA 4KHPI 5LMNI 1UHZA 3D4JA 5C0XB 1N0UA 4JG4A 4YHHE 4YY3E 4QNKA 4OO1C 4LF7E 4NXNE 4LCHA 1A1FA 4QNJA 1Z5AA 2GPIA 2PRTA 1X3CA 3P3GA 4DV0I 2BB8A 2HKJA 5ELWA 4OX9E 1A6FA 1IBME 4MU4A 2VQFE 2EP3A 2EN3A 1YPNA 2ELZA 3B82A 1N36E 2O1VA 1QU6A 2GQ0A 4FW7A 3CDJA 3J7AG 4FW9A 1B62A 4DPTA 1XNRI 3UHMA 4IZKB 3BIDA 2Q8UA 3HPZA 2O1TA 1KJKA 1H7SA 4LF5E 1OYSA 2EOJA 4F9CB 1PIEA 3ZKDA 4WUDA 4OOGC 2EM3A 1YUIA 3PS3A 1YHCA 3M7ND 1ZU1A 2ENHA 2GHFA 2WCC3 1QZRA 1BKNA 2HHHI 1D6TA 3H1CA 5AASA 2F8BA 1U2RA 4LF9I 1X5WA 3HJCA 2WBTA 4Z7CA 2D9HA 2EQ1A 3ZOQB 5A69A 3K17A 3T1YI 1FJGI 1R6LA 2EMKA 5KL4A 4LF4I 2EMXA 1MG7A 1USVA 5C0XD 5IWAE 2YTQA 5LMUE 4L8NA 1YH8A 1XNQE 4GKJE 2CT1A 2GLIA 3ADJA 2YTOA 2EMHA 2UUAE 4FWDA 2BV3A 4WFTA 2MC6A 4JYAI 2E5LE 5DNXA 2BM0A 2EMIA 4NXMI 2C37A 2EM5A 2EPMX 4F2JC 2KHXA 3VHTB 5IV8B 2HK2A 4MLQA 1DQ3A 1N33I 4GQUA 3P06A 4MDTA 4R03A 2EQ3A 5C0XC 3U1YA 4N4RB 1EI1A 1J5EE 3B4TA 2NN6E 4KQVA 1AAYA 2PNZA 1ZBTA 2H36X 3M85G 4IS9A 4TUIA 1NEIA 4DV1E 2LJHA 2YTDA 5JEAD 2NPFA 2V2ZA 4B3RI 2N3GA 1H74A 1PDAA 2EN2A 1RC7A 2NUFA 4O5GA 2IESA 1R6MA 1EKZA 2YU8A 2LJUA 1HK7A 2UXCE 1PJQA 3L7ZA 5A6BA 1G2FC 1Z5BA 3EPLA 4AIMA 1IBLI 4BHCA 1B69A 1HNWI 1A1HA 2RSMA 2HK3A 2O3ZA 4X64E 2NUGA 1ZXMA 4DV4E 1FNMA 1LLMC 2PO0A 2PO2B 3JU0A 2WP8B 3F6GA 4F9BB 2EJ4A 4B3SE 4MU3A 1H7UA 2YRHA 3MHSC 4KZSA 1OYRA 2BR2A 4HACB 2B7TA 2I13A 4AIDA 2EN6A 3EPKA 1ZR9A 1HNXE 2WNRB 2IOQA 4OKGA 3WU3A 1YFHA 4JI5E 1IBKI 2V86A 3U1KA 2LJPA 4DUYI 1UDOA 2R42A 4PU9A 2YTGA 4LF6E 3THOB 2LV2A 1H73A 2RPCA 4JI3E 2EMBA 3JTZA 4LPFA 2LO3A 5FLXC 4R2RA 3AUZA 2EOQA 2L33A 4Q28A 2DLQA 5DRPA 4MYUA 2V2VA 4IJDA 3QT7A 2YTFA 4DR7I 4B3TE 2L2NA 1X6EA 2N3HA 1HNZI 1UDSA 4DR3E 3ZZTA 2LBSB 4AQYI 4X65E 2EOZA 1NHIA 2MDRA 2L3CA 4F6MA 2EL6A 4X66E 4HTGA 2UU9E 2FV4B 2EN1A 1WXRA 3J80C 4HYMA 3ZKBA 2EMAA 2VE7C 4JI2E 1AH5A 3PYDA 1TF6A 1VI7A 3V2UC 2BBGA 3K1JA 1Y4UA 5C0XE 3OTOI 4R2QA 2DGCA
chains in the Genus database with same CATH topology
1FWKA 5FLXQ 2JOBA 1T4OA 4JI7I 1N32E 2AJ4A 4ZVIA 3VK6A 5A2QC 4USMA 3HQ1A 3F0NA 1HR0E 3Q6MA 2DEIA 4X62I 4HXZA 1UEKA 1Z0VA 2L3JA 4DV3I 3F6HA 2Z5BA 4LTYA 4LF8E 3IWDA 3PRYA 4PRVA 1K47A 2LE2A 4JI8E 5GMEA 4LFBE 3V5RA 5A2QQ 1WHNA 3JAMC 1Z0CA 4F54A 5IT9C 2XEXA 4JI1E 5F3WA 2NUEA 5DNYA 1XHKA 4DR1E 4K0KI 2JOXA 4DR4I 2B9DA 3VYYA 1YYKA 5AE3A 4DV3E 4DR2E 4DR5E 3PYEA 2UUBE 1Z0BA 4WUBA 4M1KA 5LMNE 4DUZI 1I94E 4IZJA 1Z5CA 4IZJD 4LFAI 1OJ4A 4DV0E 2CZ9A 2EZ6A 3JAMQ 4BS9A 4GKKI 2HFUA 3DJWA 2O1WA 2E1RA 4DV2I 1H72C 1FI4A 2E5LI 1XNRE 2L92A 1VISA 1ZM4A 1KTVA 2UUCI 2HFSA 3Q1QA 2V88A 3DF6A 4RPFA 1ZXNA 1PKPA 2B7VA 2EFGA 4JV5E 1N34I 1RREA 4IZKA 3IWCA 2RS7A 2HHHE 2PNLA 4DR6E 4LF9E 3HULA 3T1YE 1FJGE 2E1MA 4LF4E 1N0VC 2DB2A 2L6MA 1Y4SA 5LL6R 4DV4I 2FTXB 2F4VI 5AE1A 4NXME 2V87A 1KIJA 4DV6I 1FWLA 2EWLA 5T6JA 4DV7I 3VYXA 4TUGA 2ZITA 2V2QA 5BR8I 2JY9A 3C4TA 4B3MI 2CG9A 1O0WA 4WPYA 3Q6NA 2PNMA 4DU8A 2KOUA 4DMIA 1NHHA 2Z5CA 1UILA 4FN5A 4B3TI 2MC5A 2RTXA 3B78A 2UXBI 1B63A 1HNWE 3J7AM 4DPXA 1Z0WA 3HPSA 2Z5EA 1RR9A 3H09A 4WYQB 1N33E 3J7Yp 2V8QB 1YYOA 2L8TA 3OMLA 3QT5A 4USKA 2CGEA 2LMZA 2K4VA 4JI0E 3LLHA 1IBKE 4EMDA 4M2ZA 1T4NA 3M6AA 1PVGA 1T4LB 1ZBQA 2DSYA 1YZ9A 2CPNA 3FIGA 4R1FA 2M1SA 1XMQI 4JI6E 4L5NC 4LFCE 2A2DA 4Z7YA 2NA2A 4ED4A 3HXLA 2ZM6E 1XMOE 4DR7E 2Z5BB 2HKEA 1EA6A 2G7HA 5FWKA 4GEQB 2LTRA 4AQYE 4DV5I 3T1HI 4JI4I 3LMLA 2OI2A 3ZM7A 3J80Q 1Z0TA 2VQEE 4BCAA 5CFFE 4YHHI 4YY3I 2WZOA 4NXNI 4LF7I 1MX0A 2DIXA 4OX9I 1ZM2A 2R3VA 1IBMI 2VQFI 1YYWA 4JI7E 1NHJA 2UXDE 3LTOA 1N36I 3RMPA 1KVKA 2DEJA 2V85A 1ELOA 4LF5I 3PYGA 2X36A 4DR5I 1STUA 2Q2EB 1ZM3A 3ADGA 3B8HA 1I94I 2L2KB 4KHPE 2JVAA 2JR1A 2JWOA 2IHR1 5IWAI 1GQEA 5LMUI 5IT9Q 2L2MA 1XNQI 4GKJI 3CWVA 5ADZA 2UUAI 1WHQA 4J8ZA 1MU5A 4DU7A 3AV0A 3LPSA 4K0KE 4DR4E 2V34A 2VF1A 2DMYA 4JV5I 2KONA 4BC9A 4BC7A 2A2CA 3ZZUA 1J5EI 4DR6I 4DUZE 4LFAE 4UT4A 4DV1I 2M4IA 4UTGA 4M0VA 4GKKE 4M30A 4DV2E 1Z0EA 2UXCI 3P1XA 4F9AB 4WUCA 4I3HA 2V83A 3ADLA 3GONA 4N3OA 4X64I 2M7QA 1SR9A 4DPWA 2UUCE 4JYAE 2FGGA 4B3SI 4BBYA 5L3JA 3K6QA 1HNXI 1N34E 2V8PA 4R8OA 3QT6A 2VF3A 4DPUA 2Z5CB 4JI5I 3J81C 5AE2A 4LF6I 2YT4A 4JI3I 2WW4A 4I8OA 4B3RE 2O1UA 3ADIA 3IWBA 4P7AA 1KKHA 4DR3I 3K85A 2ZBKB 4X65I 1Y6ZA 1IBLE 4X66I 2F4VE 1X48A 2UU9I 1FKAE 1S16A 4DPYA 1X47A 4DV6E 4JI2I 4DR2I 4JI0I 3J81Q 4DV7E 2LUQA 4BMJA 3QT8A 5BR8E 5GMDA 4DUYE 4B3ME 2BM1A 4JI6I 4HACA 2ODRD 4LFCI 1N32I 2GS8A 1Z0GA 1GZ6A 2ZM6I 1XMOI 2LUPB 1USUA 4FWHA 1HR0I 2IOPA 4WSPA 4P52A 2UXBE 1HNZE 3HTXA 4X8WA 2LTSA 2ODRC 1DI2A 4HY1A 3WU5A 3MSWA 4LU9A 2VQEI 4LF8I 1WUUA 3H4LA 2B3TB 3OTOE 4JI8I 2RS6A 1Z59A 4LFBI 3PYFA 2UXDI 2J7KA 2YZTA 1XMQE 4JI1I 2LRSA 3WU6A 1S4EA 4DR1I 1RQ0A 4P7DA 3LNUA 2V89A 2X7IA 3C4BA 4IZJB 4URLA 1NZ0A 4DKKA 1ZM9A 4DV5E 3T1HE 4XTJA 4X62E 3WU4A 3ZZ0A 4DXLA 4JI4E 1J26A 4P78A 2UUBI 3KWRA 1DARA 1X49A 4FWGA 4KHPI 5LMNI 1UHZA 3D4JA 1N0UA 4JG4A 4YHHE 4YY3E 4NXNE 4LF7E 1Z5AA 4DV0I 2HKJA 4OX9E 1A6FA 1IBME 2VQFE 3B82A 1N36E 2O1VA 1QU6A 2GQ0A 3J7AG 4FW9A 1B62A 4DPTA 1XNRI 4IZKB 3HPZA 2O1TA 1H7SA 4LF5E 4F9CB 1PIEA 3ZKDA 4WUDA 4OOGC 1QZRA 1D6TA 1BKNA 2HHHI 5AASA 2F8BA 1U2RA 4LF9I 3HJCA 4Z7CA 3ZOQB 3K17A 3T1YI 1FJGI 4LF4I 1MG7A 1USVA 5IWAE 5LMUE 4L8NA 1XNQE 4GKJE 3ADJA 2UUAE 4FWDA 2BV3A 4WFTA 2MC6A 4JYAI 2E5LE 2BM0A 4NXMI 2KHXA 2HK2A 1DQ3A 3P06A 4R03A 1EI1A 1J5EE 4KQVA 1ZBTA 2H36X 4TUIA 4DV1E 2LJHA 2NPFA 2V2ZA 4B3RI 2N3GA 1H74A 1RC7A 2NUFA 1EKZA 1HK7A 2UXCE 1Z5BA 1IBLI 1HNWI 2RSMA 2HK3A 4X64E 2NUGA 1ZXMA 4DV4E 1FNMA 1N33I 3JU0A 4PRXA 3F6GA 4F9BB 4B3SE 1H7UA 4KZSA 4HACB 2B7TA 1HNXE 3WU3A 2IOQA 4JI5E 1IBKI 2V86A 2LJPA 4DUYI 2R42A 4PU9A 4LF6E 1H73A 4JI3E 3JTZA 5FLXC 3AUZA 2L33A 4Q28A 4MYUA 2V2VA 3QT7A 4DR7I 4B3TE 2L2NA 2N3HA 1HNZI 4DR3E 3ZZTA 2LBSB 4AQYI 4X65E 1NHIA 2MDRA 2L3CA 4X66E 2UU9E 2FV4B 1WXRA 3J80C 4HYMA 3ZKBA 2VE7C 4JI2E 3PYDA 3V2UC 3K1JA 1Y4UA 3OTOI 4MYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWK A;  5FLX Q;  4JI7 I;  2AJ4 A;  1N32 E;  4ZVI A;  5A2Q C;  4USM A;  3F0N A;  1HR0 E;  2DEI A;  4X62 I;  4HXZ A;  1UEK A;  1Z0V A;  4LF8 E;  4PRV A;  1K47 A;  4JI8 E;  5GME A;  4LFB E;  3V5R A;  5A2Q Q;  3JAM C;  1Z0C A;  5IT9 C;  2XEX A;  4JI1 E;  1XHK A;  4DR1 E;  4K0K I;  4DR4 I;  4DV3 E;  4DR2 E;  4DR5 E;  3PYE A;  2UUB E;  1Z0B A;  4WUB A;  4M1K A;  5LMN E;  4DUZ I;  1I94 E;  1Z5C A;  4LFA I;  1OJ4 A;  4DV0 E;  2CZ9 A;  3JAM Q;  4GKK I;  2HFU A;  4DV2 I;  2E1R A;  1H72 C;  1FI4 A;  2E5L I;  1XNR E;  1VIS A;  1ZM4 A;  1KTV A;  2UUC I;  2HFS A;  3Q1Q A;  4RPF A;  1ZXN A;  1PKP A;  2EFG A;  4JV5 E;  1N34 I;  1RRE A;  2HHH E;  4DR6 E;  3HUL A;  4LF9 E;  3T1Y E;  1FJG E;  4LF4 E;  1N0V C;  5LL6 R;  4DV4 I;  2F4V I;  4NXM E;  1KIJ A;  4DV6 I;  1FWL A;  4DV7 I;  2ZIT A;  2V2Q A;  5BR8 I;  4B3M I;  4DU8 A;  1NHH A;  4FN5 A;  4B3T I;  3B78 A;  2UXB I;  1B63 A;  1HNW E;  3J7A M;  4DPX A;  1Z0W A;  1RR9 A;  1N33 E;  4USK A;  3QT5 A;  4JI0 E;  1IBK E;  4EMD A;  3M6A A;  1PVG A;  4R1F A;  1XMQ I;  4JI6 E;  4LFC E;  2A2D A;  4Z7Y A;  4ED4 A;  2ZM6 E;  1XMO E;  4DR7 E;  2HKE A;  1EA6 A;  4AQY E;  4DV5 I;  3T1H I;  4JI4 I;  2OI2 A;  3ZM7 A;  3J80 Q;  1Z0T A;  2VQE E;  4YHH I;  4YY3 I;  4NXN I;  4LF7 I;  1MX0 A;  4OX9 I;  1ZM2 A;  1IBM I;  2R3V A;  2VQF I;  4JI7 E;  1NHJ A;  3LTO A;  1N36 I;  2UXD E;  1KVK A;  2DEJ A;  1ELO A;  4LF5 I;  3PYG A;  2X36 A;  4DR5 I;  2Q2E B;  1ZM3 A;  3B8H A;  1I94 I;  4KHP E;  5IWA I;  5LMU I;  5IT9 Q;  1XNQ I;  4GKJ I;  3CWV A;  2UUA I;  4DU7 A;  1MU5 A;  3LPS A;  4K0K E;  4DR4 E;  2V34 A;  4JV5 I;  2A2C A;  3ZZU A;  1J5E I;  4DR6 I;  4DUZ E;  4UT4 A;  4DV1 I;  4LFA E;  4UTG A;  4GKK E;  4DV2 E;  1Z0E A;  2UXC I;  4WUC A;  4I3H A;  3GON A;  4X64 I;  4DPW A;  2UUC E;  4JYA E;  4B3S I;  5L3J A;  1HNX I;  1N34 E;  2V8P A;  3QT6 A;  2VF3 A;  4DPU A;  4JI5 I;  3J81 C;  4LF6 I;  4JI3 I;  2WW4 A;  4B3R E;  4P7A A;  1KKH A;  4DR3 I;  2ZBK B;  4X65 I;  1IBL E;  4X66 I;  2F4V E;  2UU9 I;  1FKA E;  1S16 A;  4DPY A;  4DV6 E;  4JI2 I;  4JI0 I;  3J81 Q;  4DV7 E;  3QT8 A;  5BR8 E;  5GMD A;  2BM1 A;  4DUY E;  4B3M E;  4JI6 I;  4HAC A;  4LFC I;  1N32 I;  2GS8 A;  1Z0G A;  2ZM6 I;  1XMO I;  4FWH A;  1HR0 I;  4P52 A;  2UXB E;  1HNZ E;  4HY1 A;  3WU5 A;  2VQE I;  4LF8 I;  1WUU A;  3H4L A;  3OTO E;  4JI8 I;  1Z59 A;  4LFB I;  3PYF A;  2UXD I;  2J7K A;  1XMQ E;  4JI1 I;  3WU6 A;  1S4E A;  4DR1 I;  3LNU A;  2X7I A;  4URL A;  4DR2 I;  4DV3 I;  1NZ0 A;  1ZM9 A;  4XTJ A;  3WU4 A;  4DXL A;  4DV5 E;  4X62 E;  3ZZ0 A;  3T1H E;  4JI4 E;  2UUB I;  1DAR A;  4FWG A;  4KHP I;  5LMN I;  3D4J A;  1N0U A;  4JG4 A;  4YHH E;  4YY3 E;  4LF7 E;  4NXN E;  1Z5A A;  4DV0 I;  2HKJ A;  4OX9 E;  1A6F A;  1IBM E;  2VQF E;  3B82 A;  1N36 E;  3J7A G;  4FW9 A;  1B62 A;  4DPT A;  1XNR I;  1H7S A;  4LF5 E;  1PIE A;  3ZKD A;  4WUD A;  1QZR A;  1D6T A;  1BKN A;  2HHH I;  1U2R A;  4LF9 I;  4Z7C A;  3K17 A;  3T1Y I;  1FJG I;  4LF4 I;  1MG7 A;  5IWA E;  5LMU E;  1XNQ E;  4GKJ E;  2UUA E;  4FWD A;  2BV3 A;  4JYA I;  2E5L E;  2BM0 A;  4NXM I;  2HK2 A;  1EI1 A;  1J5E E;  4KQV A;  4DV1 E;  2NPF A;  2V2Z A;  4B3R I;  1H74 A;  2UXC E;  1Z5B A;  1IBL I;  1HNW I;  2HK3 A;  4X64 E;  1ZXM A;  4DV4 E;  1FNM A;  1N33 I;  4PRX A;  4B3S E;  1H7U A;  4HAC B;  1HNX E;  3WU3 A;  1IBK I;  4JI5 E;  2LJP A;  4DUY I;  2R42 A;  4PU9 A;  4LF6 E;  1H73 A;  4JI3 E;  5FLX C;  4MYU A;  2V2V A;  3QT7 A;  4DR7 I;  4B3T E;  1HNZ I;  3ZZT A;  4DR3 E;  4AQY I;  4X65 E;  1NHI A;  4X66 E;  2UU9 E;  3J80 C;  4HYM A;  3ZKB A;  3PYD A;  3V2U C;  4JI2 E;  3K1J A;  3OTO I;  4MYT A; 
#chains in the Genus database with same CATH topology
 2EM8 A;  1FWK A;  5FLX Q;  4AM3 A;  2EMW A;  2JOB A;  2EMF A;  2EOY A;  2N8X A;  1T4O A;  4JI7 I;  2NN6 A;  1N32 E;  2AJ4 A;  4URL A;  4ZVI A;  1E3H A;  4ISA A;  3VK6 A;  5A2Q C;  2BA1 G;  5K36 B;  4WX9 A;  4USM A;  3HQ1 A;  3F0N A;  4MU1 A;  1EH6 A;  2YRM A;  1UN6 B;  1HR0 E;  4OO1 F;  1Y60 A;  3Q6M A;  2DEI A;  5DRR A;  1JK1 A;  4X62 I;  3ECR A;  2VRD A;  2YTI A;  2EPX A;  4HXZ A;  1UEK A;  1A1G A;  2JP9 A;  1Z0V A;  3DD6 A;  2L3J A;  1G2D C;  4DV3 I;  2EM6 A;  5JEA E;  3F6H A;  2Z5B A;  4LTY A;  4LF8 E;  5K36 F;  2YPN A;  1RHY A;  3IWD A;  3PRY A;  4ZYH A;  2EMC A;  1K47 A;  3HKM A;  4PRV A;  4MQY A;  2LE2 A;  4JI8 E;  5GME A;  3EPJ A;  2C39 A;  4LFB E;  3V5R A;  4WXC A;  1YSA C;  5A2Q Q;  4IFD A;  1WHN A;  3JAM C;  1T38 A;  1Z0C A;  2EMG A;  4F54 A;  5IT9 C;  4JI1 E;  2JE6 A;  2XEX A;  4NHR A;  4IFD D;  5F3W A;  2NUE A;  5DNY A;  1XHK A;  4DR1 E;  4K0K I;  2JOX A;  4X9J A;  4DR4 I;  2B9D A;  3VYY A;  1YYK A;  5AE3 A;  2JEB A;  5AC4 A;  4DV3 E;  4DR2 E;  1A1J A;  2EPN A;  4DR5 E;  3BBG A;  3PYE A;  2UUB E;  2EN7 A;  1IQO A;  1XXE A;  1Z0B A;  4BA2 A;  4WUB A;  4M1K A;  4RHB B;  4IFD C;  5LMN E;  4DUZ I;  1I94 E;  4IZJ A;  1Z5C A;  4IZJ D;  4LFA I;  1OJ4 A;  4DV0 E;  2EOO A;  2MDG A;  2CZ9 A;  1UBD C;  2C37 B;  2EZ6 A;  3JAM Q;  2AE8 A;  4BS9 A;  3PS1 A;  5C0X A;  4GKK I;  5IXM B;  2HFU A;  3KZY A;  3DJW A;  2O1W A;  2E1R A;  2YTN A;  4DV2 I;  2YTJ A;  4GZN C;  1IMU A;  1H72 C;  1FI4 A;  2J65 A;  2E5L I;  2EPA A;  2L92 A;  5LLQ A;  1XNR E;  1VIS A;  1ZM4 A;  2PNZ B;  2EM0 A;  1KTV A;  2UUC I;  2HFS A;  3Q1Q A;  2V88 A;  3DF6 A;  4RPF A;  3EPH A;  1ZXN A;  1PKP A;  2B7V A;  1N3G A;  1BB8 A;  2EFG A;  4JV5 E;  5KL5 A;  1QNT A;  2BA1 D;  1RRE A;  1N34 I;  4IZK A;  3IWC A;  3NZK A;  2RS7 A;  2WBS A;  4FW4 A;  2HHH E;  2EOM A;  1KYQ A;  2PNL A;  4DR6 E;  4LCG A;  3L7Z B;  4LF9 E;  3HUL A;  1BBO A;  5JEA A;  2DRP A;  3T1Y E;  2C38 A;  1FJG E;  2JPA A;  2E1M A;  4LF4 E;  2PO0 B;  1N0V C;  2DB2 A;  2EPR A;  4FW6 A;  1DGC A;  3BF2 A;  2L6M A;  1Y4S A;  2BA0 G;  4FK5 C;  3GCM A;  1MGT A;  5LL6 R;  3P3C A;  5DRQ A;  4DV4 I;  2FTX B;  2JT2 A;  2EMY A;  2F4V I;  5AE1 A;  2V87 A;  4NXM E;  1KIJ A;  1Y5Y A;  4DV6 I;  1FWL A;  2EWL A;  5T6J A;  4O4K A;  3QG5 C;  4DV7 I;  5A6J A;  2PO1 B;  2EQ0 A;  3VYX A;  4TUG A;  4IFD E;  2ZIT A;  2V2Q A;  5BR8 I;  4BA1 B;  2JY9 A;  3C6K A;  3C4T A;  3GME A;  4B3M I;  2EPZ A;  4U3D A;  2CG9 A;  1JK2 A;  1O0W A;  4WPY A;  3Q6N A;  3CDI A;  2PNM A;  2EML A;  4DU8 A;  5KL7 A;  2KOU A;  2EMZ A;  4WSG A;  4DMI A;  1NHH A;  2Z5C A;  2HC5 A;  1UIL A;  4FN5 A;  1A1L A;  4B3T I;  2MC5 A;  2RTX A;  3UK3 C;  3B78 A;  2UXB I;  4ZYE A;  1B63 A;  1HNW E;  2EPK X;  2YRK A;  1MEY C;  4DPX A;  1Z0W A;  3P3E A;  3HPS A;  2Z5E A;  3J7A M;  2ADR A;  5DNL A;  1RR9 A;  3H09 A;  1YUJ A;  4WYQ B;  4R2C A;  1N33 E;  3J7Y p;  4R2D A;  2NN6 B;  3MHH C;  1NCS A;  2V8Q B;  1YYO A;  2L8T A;  3OML A;  1GTK A;  2DLK A;  3QT5 A;  4USK A;  3M99 B;  2LMZ A;  2K4V A;  4JI0 E;  1UDQ A;  2EL5 A;  3LLH A;  1IBK E;  2YU5 A;  2CGE A;  4EMD A;  4M2Z A;  2PO2 A;  4OO1 B;  1T4N A;  3M6A A;  1PVG A;  4LOM A;  1T4L B;  1ZBQ A;  2DSY A;  1YZ9 A;  2CPN A;  3FIG A;  4R1F A;  2M1S A;  1XMQ I;  4JI6 E;  3M7N G;  4L5N C;  4LFC E;  2EE8 A;  2R76 A;  2A2D A;  4BA2 B;  4Z7Y A;  2NA2 A;  4ED4 A;  3HXL A;  4WXD A;  2NN6 F;  2LT7 A;  2ZM6 E;  1XMO E;  2EPP A;  2EPO A;  4DR7 E;  4Q35 B;  2Z5B B;  2HKE A;  1EA6 A;  2G7H A;  3M85 D;  5FWK A;  4GEQ B;  2LTR A;  4AQY E;  4DV5 I;  3T1H I;  1EH7 A;  4R2P A;  5EL9 A;  1E3P A;  4JI4 I;  3LML A;  2OI2 A;  3ZM7 A;  3J80 Q;  2C39 B;  4MLV A;  4MU0 A;  1Z0T A;  4ZYG A;  2VQE E;  1IQS A;  4BCA A;  5CFF E;  4YHH I;  4YY3 I;  1RMD A;  2JE6 B;  4OZE A;  2WZO A;  4NXN I;  4LF7 I;  1MX0 A;  2DIX A;  4OX9 I;  1ZM2 A;  2R3V A;  1IBM I;  4U3B A;  1YYW A;  2JEB B;  2VQF I;  3EQ1 A;  4JI7 E;  2UXD E;  1NHJ A;  3LTO A;  1N36 I;  2EM9 A;  1L4S A;  2JYA A;  3GLL A;  2J7J A;  4J3D A;  3RMP A;  4IFD F;  1KVK A;  2DEJ A;  2V85 A;  1ELO A;  4LF5 I;  3PYG A;  2JEA A;  2X36 A;  3PS2 A;  1WRJ A;  2NAB A;  2YSP A;  4DR5 I;  1STU A;  3P76 A;  2Q2E B;  1ZM3 A;  2EL4 A;  2ENA A;  5K36 D;  4MYT A;  3ADG A;  1TF3 A;  3B8H A;  1I94 I;  2L2K B;  4DXL A;  4KHP E;  2ENC A;  2EOX A;  2JVA A;  1ZAA C;  2JR1 A;  2JWO A;  2IHR 1;  4KWY A;  4RH8 A;  2MKN A;  2ELY A;  1P42 A;  4O24 A;  2EPU A;  5IWA I;  1GQE A;  5LMU I;  5IT9 Q;  5K36 C;  2L2M A;  1XNQ I;  4GKJ I;  3CWV A;  5ADZ A;  5C0X F;  2I9I A;  2UUA I;  1WHQ A;  4J8Z A;  1MU5 A;  4DU7 A;  2YTP A;  3AV0 A;  4ZYD A;  3LPS A;  4K0K E;  5KL6 A;  2CSH A;  4DR4 E;  5AC5 A;  2V34 A;  5A6K A;  2VF1 A;  2DMY A;  2JXP A;  3L00 A;  4JV5 I;  3THN A;  2KON A;  5JEA B;  2C38 B;  4BC9 A;  4BC7 A;  2EPL X;  1TN9 A;  2A2C A;  5TSE A;  3ZZU A;  1J5E I;  3C6M A;  2EOF A;  4DR6 I;  1PJS A;  2GO4 A;  4DUZ E;  4R2E A;  2EN4 A;  4LFA E;  4UT4 A;  2EOR A;  4DV1 I;  2M4I A;  1UDN A;  4LCF A;  4NBQ A;  2M9A A;  2EM4 A;  4UTG A;  4M0V A;  4GKK E;  1BBG A;  2RSI A;  4PRX A;  5JEA F;  4FW5 A;  4M30 A;  4DV2 E;  1PJT A;  1P47 A;  4R2A A;  3P1X A;  4F9A B;  1Z0E A;  2BR2 B;  2HJJ A;  2VES A;  4WUC A;  4I3H A;  2V83 A;  3ADL A;  3GON A;  1OYP A;  4N3O A;  4X64 I;  2MKD A;  2M7Q A;  1SR9 A;  4DPW A;  2UUC E;  4JYA E;  2FGG A;  4B3S I;  4BBY A;  5L3J A;  3TQM A;  2EM7 A;  3K6Q A;  1F2I G;  2EOE A;  1N34 E;  1HNX I;  2V8P A;  4R8O A;  3QT6 A;  2VF3 A;  2A25 A;  2Z5C B;  4DPU A;  4JI5 I;  3J81 C;  5AE2 A;  4LF6 I;  4OO1 E;  2YT4 A;  4HEI A;  4JI3 I;  2WW4 A;  4IS1 C;  4I8O A;  4B3R E;  5KL3 A;  1T39 A;  2O1U A;  3ADI A;  4M9V C;  5K36 E;  3IWB A;  4P7A A;  2LCE A;  2EPC A;  1KKH A;  4DR3 I;  3K85 A;  5A6B D;  2HGH A;  2ZBK B;  4X65 I;  1Y6Z A;  1IBL E;  4X66 I;  2F4V E;  1X48 A;  2UU9 I;  1FKA E;  1S16 A;  4BHB A;  5KL2 A;  1WJP A;  1X47 A;  2E72 A;  3KZZ A;  4DV6 E;  4DPY A;  4JI2 I;  4DR2 I;  4JI0 I;  2YTE A;  2GO3 A;  3J81 Q;  4DV7 E;  2LUQ A;  2K7I A;  2LVH A;  2YSO A;  4O43 A;  4BMJ A;  3QT8 A;  4R2S A;  5JEA C;  2WP8 A;  5BR8 E;  5GMD A;  2WBU A;  4DUY E;  1SFE A;  4B3M E;  2BM1 A;  4JI6 I;  4HAC A;  2ODR D;  4LFC I;  1N32 I;  4F6N A;  2GS8 A;  1Z0G A;  1GZ6 A;  2WNR A;  2PO1 A;  5A6A A;  2EOI A;  1A1K A;  2ZM6 I;  1XMO I;  2LUP B;  1USU A;  4FWH A;  4BA1 A;  1HR0 I;  2IOP A;  4WSP A;  4P52 A;  2UXB E;  2UXC I;  1HNZ E;  2EOH A;  3HTX A;  3BGH A;  4X8W A;  2F1D A;  4NZV A;  3KRN A;  2LTS A;  2ODR C;  1DI2 A;  4HY1 A;  3WU5 A;  3MSW A;  4LU9 A;  1Z1B A;  1X6H A;  2VQE I;  4LF8 I;  2IER A;  4IFD B;  5EKW A;  2DMI A;  2BA0 D;  1WUU A;  2R1F A;  3H4L A;  2B3T B;  2EN8 A;  2YWQ A;  2RS6 A;  3OTO E;  4JI8 I;  1Z59 A;  4LFB I;  3PYF A;  2UXD I;  2JEA B;  2J7K A;  2EOS A;  2YZT A;  1XMQ E;  2NN6 D;  4JI1 I;  2LRS A;  4OO1 A;  4FW3 A;  3WU6 A;  4OO1 D;  1S4E A;  4DR1 I;  1RQ0 A;  4P7D A;  3LNU A;  2V89 A;  2X7I A;  3C4B A;  4IZJ B;  2CTD A;  1X6F A;  4DKK A;  1NZ0 A;  4DV5 E;  3T1H E;  1ZM9 A;  1EH8 A;  4X62 E;  2CVE A;  4XTJ A;  4JI4 E;  5DRO A;  3WU4 A;  3ZZ0 A;  5K36 A;  2RQL A;  1J26 A;  2EM2 A;  4P78 A;  3KWR A;  1A1I A;  2UUB I;  2NN6 C;  1DAR A;  1X49 A;  4FWG A;  4KHP I;  5LMN I;  1UHZ A;  3D4J A;  5C0X B;  1N0U A;  4JG4 A;  4YHH E;  4YY3 E;  4QNK A;  4OO1 C;  4LF7 E;  4NXN E;  4LCH A;  1A1F A;  4QNJ A;  1Z5A A;  2GPI A;  2PRT A;  1X3C A;  3P3G A;  4DV0 I;  2BB8 A;  2HKJ A;  5ELW A;  4OX9 E;  1A6F A;  1IBM E;  4MU4 A;  2VQF E;  2EP3 A;  2EN3 A;  1YPN A;  2ELZ A;  3B82 A;  1N36 E;  2O1V A;  1QU6 A;  2GQ0 A;  4FW7 A;  3CDJ A;  3J7A G;  4FW9 A;  1B62 A;  4DPT A;  1XNR I;  3UHM A;  4IZK B;  3BID A;  2Q8U A;  3HPZ A;  2O1T A;  1KJK A;  1H7S A;  4LF5 E;  1OYS A;  2EOJ A;  4F9C B;  1PIE A;  3ZKD A;  4WUD A;  4OOG C;  2EM3 A;  1YUI A;  3PS3 A;  1YHC A;  3M7N D;  1ZU1 A;  2ENH A;  2GHF A;  2WCC 3;  1QZR A;  1BKN A;  2HHH I;  1D6T A;  3H1C A;  5AAS A;  2F8B A;  1U2R A;  4LF9 I;  1X5W A;  3HJC A;  2WBT A;  4Z7C A;  2D9H A;  2EQ1 A;  3ZOQ B;  5A69 A;  3K17 A;  3T1Y I;  1FJG I;  1R6L A;  2EMK A;  5KL4 A;  4LF4 I;  2EMX A;  1MG7 A;  1USV A;  5C0X D;  5IWA E;  2YTQ A;  5LMU E;  4L8N A;  1YH8 A;  1XNQ E;  4GKJ E;  2CT1 A;  2GLI A;  3ADJ A;  2YTO A;  2EMH A;  2UUA E;  4FWD A;  2BV3 A;  4WFT A;  2MC6 A;  4JYA I;  2E5L E;  5DNX A;  2BM0 A;  2EMI A;  4NXM I;  2C37 A;  2EM5 A;  2EPM X;  4F2J C;  2KHX A;  3VHT B;  5IV8 B;  2HK2 A;  4MLQ A;  1DQ3 A;  1N33 I;  4GQU A;  3P06 A;  4MDT A;  4R03 A;  2EQ3 A;  5C0X C;  3U1Y A;  4N4R B;  1EI1 A;  1J5E E;  3B4T A;  2NN6 E;  4KQV A;  1AAY A;  2PNZ A;  1ZBT A;  2H36 X;  3M85 G;  4IS9 A;  4TUI A;  1NEI A;  4DV1 E;  2LJH A;  2YTD A;  5JEA D;  2NPF A;  2V2Z A;  4B3R I;  2N3G A;  1H74 A;  1PDA A;  2EN2 A;  1RC7 A;  2NUF A;  4O5G A;  2IES A;  1R6M A;  1EKZ A;  2YU8 A;  2LJU A;  1HK7 A;  2UXC E;  1PJQ A;  3L7Z A;  5A6B A;  1G2F C;  1Z5B A;  3EPL A;  4AIM A;  1IBL I;  4BHC A;  1B69 A;  1HNW I;  1A1H A;  2RSM A;  2HK3 A;  2O3Z A;  4X64 E;  2NUG A;  1ZXM A;  4DV4 E;  1FNM A;  1LLM C;  2PO0 A;  2PO2 B;  3JU0 A;  2WP8 B;  3F6G A;  4F9B B;  2EJ4 A;  4B3S E;  4MU3 A;  1H7U A;  2YRH A;  3MHS C;  4KZS A;  1OYR A;  2BR2 A;  4HAC B;  2B7T A;  2I13 A;  4AID A;  2EN6 A;  3EPK A;  1ZR9 A;  1HNX E;  2WNR B;  2IOQ A;  4OKG A;  3WU3 A;  1YFH A;  4JI5 E;  1IBK I;  2V86 A;  3U1K A;  2LJP A;  4DUY I;  1UDO A;  2R42 A;  4PU9 A;  2YTG A;  4LF6 E;  3THO B;  2LV2 A;  1H73 A;  2RPC A;  4JI3 E;  2EMB A;  3JTZ A;  4LPF A;  2LO3 A;  5FLX C;  4R2R A;  3AUZ A;  2EOQ A;  2L33 A;  4Q28 A;  2DLQ A;  5DRP A;  4MYU A;  2V2V A;  4IJD A;  3QT7 A;  2YTF A;  4DR7 I;  4B3T E;  2L2N A;  1X6E A;  2N3H A;  1HNZ I;  1UDS A;  4DR3 E;  3ZZT A;  2LBS B;  4AQY I;  4X65 E;  2EOZ A;  1NHI A;  2MDR A;  2L3C A;  4F6M A;  2EL6 A;  4X66 E;  4HTG A;  2UU9 E;  2FV4 B;  2EN1 A;  1WXR A;  3J80 C;  4HYM A;  3ZKB A;  2EMA A;  2VE7 C;  4JI2 E;  1AH5 A;  3PYD A;  1TF6 A;  1VI7 A;  3V2U C;  2BBG A;  3K1J A;  1Y4U A;  5C0X E;  3OTO I;  4R2Q A;  2DGC A; 
#chains in the Genus database with same CATH homology
 1FWK A;  5FLX Q;  2JOB A;  1T4O A;  4JI7 I;  1N32 E;  2AJ4 A;  4ZVI A;  3VK6 A;  5A2Q C;  4USM A;  3HQ1 A;  3F0N A;  1HR0 E;  3Q6M A;  2DEI A;  4X62 I;  4HXZ A;  1UEK A;  1Z0V A;  2L3J A;  4DV3 I;  3F6H A;  2Z5B A;  4LTY A;  4LF8 E;  3IWD A;  3PRY A;  4PRV A;  1K47 A;  2LE2 A;  4JI8 E;  5GME A;  4LFB E;  3V5R A;  5A2Q Q;  1WHN A;  3JAM C;  1Z0C A;  4F54 A;  5IT9 C;  2XEX A;  4JI1 E;  5F3W A;  2NUE A;  5DNY A;  1XHK A;  4DR1 E;  4K0K I;  2JOX A;  4DR4 I;  2B9D A;  3VYY A;  1YYK A;  5AE3 A;  4DV3 E;  4DR2 E;  4DR5 E;  3PYE A;  2UUB E;  1Z0B A;  4WUB A;  4M1K A;  5LMN E;  4DUZ I;  1I94 E;  4IZJ A;  1Z5C A;  4IZJ D;  4LFA I;  1OJ4 A;  4DV0 E;  2CZ9 A;  2EZ6 A;  3JAM Q;  4BS9 A;  4GKK I;  2HFU A;  3DJW A;  2O1W A;  2E1R A;  4DV2 I;  1H72 C;  1FI4 A;  2E5L I;  1XNR E;  2L92 A;  1VIS A;  1ZM4 A;  1KTV A;  2UUC I;  2HFS A;  3Q1Q A;  2V88 A;  3DF6 A;  4RPF A;  1ZXN A;  1PKP A;  2B7V A;  2EFG A;  4JV5 E;  1N34 I;  1RRE A;  4IZK A;  3IWC A;  2RS7 A;  2HHH E;  2PNL A;  4DR6 E;  4LF9 E;  3HUL A;  3T1Y E;  1FJG E;  2E1M A;  4LF4 E;  1N0V C;  2DB2 A;  2L6M A;  1Y4S A;  5LL6 R;  4DV4 I;  2FTX B;  2F4V I;  5AE1 A;  4NXM E;  2V87 A;  1KIJ A;  4DV6 I;  1FWL A;  2EWL A;  5T6J A;  4DV7 I;  3VYX A;  4TUG A;  2ZIT A;  2V2Q A;  5BR8 I;  2JY9 A;  3C4T A;  4B3M I;  2CG9 A;  1O0W A;  4WPY A;  3Q6N A;  2PNM A;  4DU8 A;  2KOU A;  4DMI A;  1NHH A;  2Z5C A;  1UIL A;  4FN5 A;  4B3T I;  2MC5 A;  2RTX A;  3B78 A;  2UXB I;  1B63 A;  1HNW E;  3J7A M;  4DPX A;  1Z0W A;  3HPS A;  2Z5E A;  1RR9 A;  3H09 A;  4WYQ B;  1N33 E;  3J7Y p;  2V8Q B;  1YYO A;  2L8T A;  3OML A;  3QT5 A;  4USK A;  2CGE A;  2LMZ A;  2K4V A;  4JI0 E;  3LLH A;  1IBK E;  4EMD A;  4M2Z A;  1T4N A;  3M6A A;  1PVG A;  1T4L B;  1ZBQ A;  2DSY A;  1YZ9 A;  2CPN A;  3FIG A;  4R1F A;  2M1S A;  1XMQ I;  4JI6 E;  4L5N C;  4LFC E;  2A2D A;  4Z7Y A;  2NA2 A;  4ED4 A;  3HXL A;  2ZM6 E;  1XMO E;  4DR7 E;  2Z5B B;  2HKE A;  1EA6 A;  2G7H A;  5FWK A;  4GEQ B;  2LTR A;  4AQY E;  4DV5 I;  3T1H I;  4JI4 I;  3LML A;  2OI2 A;  3ZM7 A;  3J80 Q;  1Z0T A;  2VQE E;  4BCA A;  5CFF E;  4YHH I;  4YY3 I;  2WZO A;  4NXN I;  4LF7 I;  1MX0 A;  2DIX A;  4OX9 I;  1ZM2 A;  2R3V A;  1IBM I;  2VQF I;  1YYW A;  4JI7 E;  1NHJ A;  2UXD E;  3LTO A;  1N36 I;  3RMP A;  1KVK A;  2DEJ A;  2V85 A;  1ELO A;  4LF5 I;  3PYG A;  2X36 A;  4DR5 I;  1STU A;  2Q2E B;  1ZM3 A;  3ADG A;  3B8H A;  1I94 I;  2L2K B;  4KHP E;  2JVA A;  2JR1 A;  2JWO A;  2IHR 1;  5IWA I;  1GQE A;  5LMU I;  5IT9 Q;  2L2M A;  1XNQ I;  4GKJ I;  3CWV A;  5ADZ A;  2UUA I;  1WHQ A;  4J8Z A;  1MU5 A;  4DU7 A;  3AV0 A;  3LPS A;  4K0K E;  4DR4 E;  2V34 A;  2VF1 A;  2DMY A;  4JV5 I;  2KON A;  4BC9 A;  4BC7 A;  2A2C A;  3ZZU A;  1J5E I;  4DR6 I;  4DUZ E;  4LFA E;  4UT4 A;  4DV1 I;  2M4I A;  4UTG A;  4M0V A;  4GKK E;  4M30 A;  4DV2 E;  1Z0E A;  2UXC I;  3P1X A;  4F9A B;  4WUC A;  4I3H A;  2V83 A;  3ADL A;  3GON A;  4N3O A;  4X64 I;  2M7Q A;  1SR9 A;  4DPW A;  2UUC E;  4JYA E;  2FGG A;  4B3S I;  4BBY A;  5L3J A;  3K6Q A;  1HNX I;  1N34 E;  2V8P A;  4R8O A;  3QT6 A;  2VF3 A;  4DPU A;  2Z5C B;  4JI5 I;  3J81 C;  5AE2 A;  4LF6 I;  2YT4 A;  4JI3 I;  2WW4 A;  4I8O A;  4B3R E;  2O1U A;  3ADI A;  3IWB A;  4P7A A;  1KKH A;  4DR3 I;  3K85 A;  2ZBK B;  4X65 I;  1Y6Z A;  1IBL E;  4X66 I;  2F4V E;  1X48 A;  2UU9 I;  1FKA E;  1S16 A;  4DPY A;  1X47 A;  4DV6 E;  4JI2 I;  4DR2 I;  4JI0 I;  3J81 Q;  4DV7 E;  2LUQ A;  4BMJ A;  3QT8 A;  5BR8 E;  5GMD A;  4DUY E;  4B3M E;  2BM1 A;  4JI6 I;  4HAC A;  2ODR D;  4LFC I;  1N32 I;  2GS8 A;  1Z0G A;  1GZ6 A;  2ZM6 I;  1XMO I;  2LUP B;  1USU A;  4FWH A;  1HR0 I;  2IOP A;  4WSP A;  4P52 A;  2UXB E;  1HNZ E;  3HTX A;  4X8W A;  2LTS A;  2ODR C;  1DI2 A;  4HY1 A;  3WU5 A;  3MSW A;  4LU9 A;  2VQE I;  4LF8 I;  1WUU A;  3H4L A;  2B3T B;  3OTO E;  4JI8 I;  2RS6 A;  1Z59 A;  4LFB I;  3PYF A;  2UXD I;  2J7K A;  2YZT A;  1XMQ E;  4JI1 I;  2LRS A;  3WU6 A;  1S4E A;  4DR1 I;  1RQ0 A;  4P7D A;  3LNU A;  2V89 A;  2X7I A;  3C4B A;  4IZJ B;  4URL A;  1NZ0 A;  4DKK A;  1ZM9 A;  4DV5 E;  3T1H E;  4XTJ A;  4X62 E;  3WU4 A;  3ZZ0 A;  4DXL A;  4JI4 E;  1J26 A;  4P78 A;  2UUB I;  3KWR A;  1DAR A;  1X49 A;  4FWG A;  4KHP I;  5LMN I;  1UHZ A;  3D4J A;  1N0U A;  4JG4 A;  4YHH E;  4YY3 E;  4NXN E;  4LF7 E;  1Z5A A;  4DV0 I;  2HKJ A;  4OX9 E;  1A6F A;  1IBM E;  2VQF E;  3B82 A;  1N36 E;  2O1V A;  1QU6 A;  2GQ0 A;  3J7A G;  4FW9 A;  1B62 A;  4DPT A;  1XNR I;  4IZK B;  3HPZ A;  2O1T A;  1H7S A;  4LF5 E;  4F9C B;  1PIE A;  3ZKD A;  4WUD A;  4OOG C;  1QZR A;  1D6T A;  1BKN A;  2HHH I;  5AAS A;  2F8B A;  1U2R A;  4LF9 I;  3HJC A;  4Z7C A;  3ZOQ B;  3K17 A;  3T1Y I;  1FJG I;  4LF4 I;  1MG7 A;  1USV A;  5IWA E;  5LMU E;  4L8N A;  1XNQ E;  4GKJ E;  3ADJ A;  2UUA E;  4FWD A;  2BV3 A;  4WFT A;  2MC6 A;  4JYA I;  2E5L E;  2BM0 A;  4NXM I;  2KHX A;  2HK2 A;  1DQ3 A;  3P06 A;  4R03 A;  1EI1 A;  1J5E E;  4KQV A;  1ZBT A;  2H36 X;  4TUI A;  4DV1 E;  2LJH A;  2NPF A;  2V2Z A;  4B3R I;  2N3G A;  1H74 A;  1RC7 A;  2NUF A;  1EKZ A;  1HK7 A;  2UXC E;  1Z5B A;  1IBL I;  1HNW I;  2RSM A;  2HK3 A;  4X64 E;  2NUG A;  1ZXM A;  4DV4 E;  1FNM A;  1N33 I;  3JU0 A;  4PRX A;  3F6G A;  4F9B B;  4B3S E;  1H7U A;  4KZS A;  4HAC B;  2B7T A;  1HNX E;  3WU3 A;  2IOQ A;  4JI5 E;  1IBK I;  2V86 A;  2LJP A;  4DUY I;  2R42 A;  4PU9 A;  4LF6 E;  1H73 A;  4JI3 E;  3JTZ A;  5FLX C;  3AUZ A;  2L33 A;  4Q28 A;  4MYU A;  2V2V A;  3QT7 A;  4DR7 I;  4B3T E;  2L2N A;  2N3H A;  1HNZ I;  4DR3 E;  3ZZT A;  2LBS B;  4AQY I;  4X65 E;  1NHI A;  2MDR A;  2L3C A;  4X66 E;  2UU9 E;  2FV4 B;  1WXR A;  3J80 C;  4HYM A;  3ZKB A;  2VE7 C;  4JI2 E;  3PYD A;  3V2U C;  3K1J A;  1Y4U A;  3OTO I;  4MYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...