3J81C

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j81C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81C02
4JI2I 1XMQE 4DV5E 2E5LE 3J81Q 4DR3E 4PRVA 4DUYE 1D6TA 4UTGA 1J5EE 4DV4E 1PIEA 4DPWA 4FWHA 4X62E 1IBME 4LF4E 4DV6I 4MYTA 1Z0WA 2HK3A 4P52A 5IWAI 5L3JA 3WU5A 3OTOE 3J7AG 4JI7E 4JYAE 1FJGE 2UU9E 4DPUA 2VF3A 2WW4A 2ZM6E 1XMQI 2E5LI 4JI0I 4DV7E 1IBKE 2UXDE 4B3RI 3K1JA 1A6FA 4DUYI 1BKNA 1FWKA 4EMDA 4AQYE 3QT5A 4X62I 1IBMI 4GKKE 4I3HA 1HR0E 4JI6E 1XNQI 1ZM3A 1IBLE 2DEJA 4XTJA 4FW9A 5A2QC 3ZKBA 3WU6A 4JI7I 4JYAI 2UU9I 4DR1E 2ZM6I 1I94E 4DR5I 4HYMA 4DV7I 4USMA 2F4VE 4JI8E 3ZM7A 4PU9A 1N32E 4MYUA 3F0NA 4JI4I 4HACA 1PKPA 1H72C 4JI2E 1HR0I 4JI3E 2EFGA 2X7IA 5A2QQ 4M1KA 1NHJA 2ZBKB 4KQVA 2UXCE 3T1YI 3M6AA 1IBLI 3D4JA 5GMDA 1S4EA 3PYGA 4B3TI 1N0UA 4JG4A 2A2DA 4HXZA 4WUBA 2UUAI 1N34I 4DXLA 1I94I 4YHHI 1HNXI 4LF8I 5IWAE 1ZXMA 5LMUI 2UUBI 4JI8I 1N32I 5IT9C 1Z5AA 3J80C 4ZVIA 1N33I 1ELOA 2XEXA 4JI3I 2Q2EB 4JI0E 1UEKA 2ZITA 2UXCI 4B3RE 1HNWI 2UXBE 1U2RA 2HFUA 4LF9E 1H7SA 4YY3I 1Z0VA 3PYFA 3B78A 1NHIA 4JI5I 1XNQE 3J80Q 1K47A 2AJ4A 1Z5BA 3JAMC 5FLXC 2X36A 1XNRE 4DR5E 4PRXA 2HKJA 4DV0I 1ZM4A 4WUCA 5LL6R 4NXNE 4DU8A 3ZKDA 2UXBI 4LF9I 4X64I 4DU7A 4JI4E 4X65I 4URLA 3J7AM 4FN5A 2R3VA 1RREA 3ZZTA 4DR7E 1XMOI 3JAMQ 3T1YE 5BR8I 4NXME 4B3TE 4DV1I 2UUAE 4K0KE 1B62A 4FWGA 1N34E 4B3MI 1XNRI 3QT8A 3PYDA 4UT4A 4YHHE 1HNXE 4LF8E 5LMUE 4GKJE 4JI1I 1MX0A 4LF5I 3K17A 4NXNI 2UUBE 1N33E 1MG7A 4RPFA 1H74A 2HK2A 4DR7I 2A2CA 1HNWE 2E1RA 5LMNE 4LFAI 1VISA 3LTOA 4P7AA 4NXMI 4OX9I 4YY3E 4K0KI 4DUZE 2DEIA 3WU4A 4JI5E 4GKJI 3QT6A 4HACB 2HFSA 4DPTA 1XHKA 3V2UC 4FWDA 2V2ZA 3J81C 2UUCI 3LPSA 1Z0TA 1B63A 1N36I 4DV0E 2BM1A 2VQEE 5LMNI 4X64E 4DR2I 1PVGA 1FWLA 4X65E 1H73A 3ZZ0A 4LFBE 4DV3I 4ED4A 3CWVA 1ZM2A 4LFCI 1KVKA 1MU5A 1FNMA 4WUDA 4JV5I 4DUZI 1XMOE 5IT9Q 1Z59A 5BR8E 3LNUA 3B82A 1NZ0A 4DR4I 2BM0A 4DR6E 4DV1E 2V8PA 4B3ME 4JI1E 4LF5E 3T1HE 1HNZE 2LJPA 4USKA 4DV2I 2VQEI 4B3SE 2VQFE 4LF7I 2HHHI 4X66E 4LFBI 1EA6A 4KHPI 4DV5I 2HKEA 2V2QA 5GMEA 1Z5CA 2V34A 4Z7CA 4LFAE 4DR3I 5FLXQ 4DR6I 4OX9E 2V2VA 1Z0EA 4HY1A 4DV4I 1J5EI 4LF4I 3ZZUA 1NHHA 1H7UA 1ZXNA 3T1HI 1HNZI 2R42A 1Z0CA 1FI4A 1Z0GA 4B3SI 3OTOI 2VQFI 2OI2A 2UUCE 1KKHA 3Q1QA 4X66I 1FJGI 1N36E 3GONA 1OJ4A 4LF6E 1KTVA 2J7KA 1IBKI 2UXDI 4DR2E 2NPFA 1KIJA 2GS8A 1DARA 4DV3E 4AQYI 4LFCE 4GKKI 1QZRA 3B8HA 4JV5E 4JI6I 1EI1A 1Z0BA 3PYEA 4DR4E 1ZM9A 1WUUA 3QT7A 4DV6E 3WU3A 1RR9A 4DR1I 4LF6I 2CZ9A 4Z7YA 1N0VC 3H4LA 4DPYA 4DV2E 3V5RA 2F4VI 4DPXA 2BV3A 4LF7E 2HHHE 1FKAE 3HULA 4R1FA 1S16A 4KHPE
chains in the Genus database with same CATH superfamily
2MC5A 4JI2I 1XMQE 4DV5E 2E5LE 2B7VA 5IXMB 1E3HA 3J81Q 3P06A 2NUGA 4L8NA 3UHMA 2N8XA 2JWOA 2RTXA 2D9HA 4DR3E 4PRVA 2EMHA 4FW7A 4DUYE 4IZJA 1UDNA 2IHR1 1D6TA 4UTGA 3C6MA 3C4BA 3VK6A 2LJHA 4DV4E 1J5EE 1PIEA 4X62E 1IBME 2BA0D 4FWHA 4LF4E 4DPWA 4DV6I 2NN6E 4MYTA 1Z0WA 2ENAA 2EPLX 2FTXB 2L2NA 4LTYA 4F9AB 4OO1C 3H09A 5A6KA 1XXEA 2HK3A 4IZKA 1X6EA 4P52A 2EPXA 4I8OA 2N3HA 5IWAI 2RSMA 3LMLA 5L3JA 2EMIA 3WU5A 3OTOE 2KHXA 4F9BB 1ZU1A 3J7AG 3BBGA 2EMCA 2EMWA 4JI7E 4JYAE 4R2EA 1FJGE 2V87A 4RH8A 2PO2B 1RQ0A 2UU9E 1YHCA 4DPUA 3PS1A 4IZJD 1TF6A 2VF3A 3K6QA 2WW4A 2ZM6E 1Y4UA 1AAYA 4ZYGA 1XMQI 2E5LI 2EORA 4JI0I 3U1KA 1STUA 4DV7E 2Z5EA 2PO0B 1IBKE 5JEAB 5C0XC 4X9JA 2UXDE 2Z5BB 3AUZA 4B3RI 2JT2A 3K1JA 1A6FA 1YYWA 1NCSA 4DUYI 1G2DC 1BKNA 4LOMA 1FWKA 4EMDA 3MSWA 4AIDA 4AQYE 3HTXA 3QT5A 2FV4B 1X47A 4X62I 1IBMI 4GKKE 4I3HA 2NN6D 3TQMA 4BA2B 5ELWA 2YWQA 2VQEI 5DRRA 1HR0E 3EPHA 2GO4A 2B7TA 3ECRA 3ADJA 1P42A 2EOHA 4JI6E 1EH7A 2J7JA 2NA2A 4OO1F 2RPCA 2V86A 1XNQI 1ZM3A 1IBLE 2L3CA 2DEJA 2R76A 2L2MA 3KWRA 4XTJA 1UBDC 1A1HA 4FW9A 5A2QC 4O4KA 4LPFA 4NBQA 3ZKBA 2JEAB 3WU6A 4JI7I 4JYAI 2C38A 4WXCA 1T38A 2L8TA 2UU9I 2JY9A 2BA1G 5C0XA 5F3WA 4DR1E 4BCAA 2ZM6I 3GMEA 2RS6A 2RSIA 1I94E 4IS9A 4DR5I 2LT7A 2YPNA 2PRTA 2EWLA 1Z1BA 4HYMA 4DV7I 4USMA 5C0XF 1QU6A 4Q28A 2BBGA 4JI8E 2F4VE 4BC7A 2V83A 4BMJA 1Y4SA 4PU9A 3ZM7A 1N32E 2JP9A 1F2IG 1USVA 4GQUA 2EJ4A 1T4NA 3F0NA 2EMFA 4MYUA 5K36E 1YSAC 4JI4I 4HACA 1PKPA 4QNKA 2R1FA 3DD6A 1H72C 3NZKA 2EPUA 2Q8UA 4JI2E 5KL7A 2EM8A 4JI3E 2EFGA 2NUFA 2X7IA 1HR0I 2JE6B 5A2QQ 2JVAA 2YTNA 2O1WA 4M1KA 5C0XD 1NHJA 2ZBKB 4KQVA 2UXCE 3T1YI 3M6AA 1IBLI 3D4JA 5K36A 1BBOA 5GMDA 4F6MA 1R6LA 1DQ3A 2VRDA 2JPAA 1S4EA 4IFDE 2EQ3A 3PYGA 2WCC3 4B3TI 4TUIA 2LE2A 1N0UA 2JYAA 4JG4A 1YFHA 2A2DA 4HXZA 2PNZA 3HPZA 1Y60A 4WUBA 2UUAI 2EL6A 3RMPA 1N34I 4DXLA 4R2SA 1I94I 4O43A 4WFTA 4YHHI 1HNXI 4LF8I 5IWAE 1ZXMA 5LMUI 1YZ9A 1Y5YA 4LU9A 2CGEA 1YPNA 3BF2A 2MKNA 2KONA 4IS1C 2UUBI 2ADRA 4JI8I 1N32I 1T4OA 5IT9C 1Z5AA 3J80C 2C39A 4ZVIA 3BGHA 1N33I 2GHFA 5K36D 2EMYA 1ELOA 2GO3A 1ZBQA 2C37A 2NN6C 3C6KA 2HJJA 2XEXA 1UDSA 2EPRA 4JI3I 5KL4A 2Q2EB 4JI0E 2EZ6A 3ADIA 1UEKA 2EM9A 2ZITA 2EMLA 2EPPA 4M9VC 2ELYA 2UXCI 2EL4A 2EOXA 4B3RE 2KOUA 2NABA 4HTGA 2PO1B 1HNWI 3M99B 2JEBB 2EM2A 3U1YA 4GZNC 2CTDA 2UXBE 2YRKA 4LF9E 1U2RA 2HFUA 1UDOA 4MU0A 1H7SA 2YSPA 4F9CB 1N3GA 1AH5A 4BBYA 1BBGA 1PJQA 1JK1A 3PS2A 2YRHA 4YY3I 2ODRC 5A6JA 4J3DA 1Z0VA 1ZBTA 3PYFA 3B78A 5DNYA 4R2RA 5ADZA 2Z5CA 2EN8A 2JOBA 1NHIA 4R2QA 4AIMA 3M7NG 2BB8A 4JI5I 5JEAE 1XNQE 3J80Q 4MDTA 1K47A 3P1XA 2DLQA 2AJ4A 2EN3A 2EM7A 1IQOA 2AE8A 2YTDA 2IOQA 1Z5BA 2NN6A 2E72A 2WBSA 2IOPA 2WNRA 2LTSA 3THOB 3JAMC 4MLVA 2I13A 1PDAA 1EKZA 1TN9A 1GZ6A 2MDRA 2BR2B 1YUIA 5FLXC 2X36A 1XNRE 1KYQA 2EPZA 1YH8A 2NN6F 4FW3A 4DR5E 4PRXA 2LCEA 4MLQA 2HKJA 4DV0I 3J7Yp 1IQSA 4Q35B 2GLIA 1ZM4A 3H1CA 4NXNE 5LL6R 4WUCA 2LJUA 1Y6ZA 1EH8A 4DU8A 3ZKDA 2UXBI 4LF9I 4ZYDA 4X64I 3HPSA 4RHBB 4IZKB 4DU7A 2CVEA 4JI4E 2EMGA 4BA1A 4X65I 2L6MA 4URLA 2M7QA 2F8BA 3J7AM 4FN5A 2R3VA 2O1TA 3F6HA 1RREA 1J26A 3ZZTA 4DR7E 4ISAA 5KL6A 4WX9A 1R6MA 2F1DA 2YTOA 2EQ1A 3HXLA 3M85G 3JAMQ 1XMOI 3T1YE 5BR8I 1WHQA 3DJWA 4N3OA 4NZVA 2E1MA 3IWCA 2MC6A 2YZTA 2EOZA 2DB2A 2EOIA 2EN2A 2JOXA 4NXME 2EE8A 5K36C 4B3TE 2RS7A 4HEIA 4DV1I 2YTIA 2UUAE 4K0KE 2ODRD 1B62A 1A1GA 4FWGA 1N34E 4B3MI 1XNRI 1O0WA 3QT8A 1T4LB 4YHHE 1HNXE 4LF8E 2M1SA 3PYDA 4U3DA 4UT4A 2LRSA 4OO1B 5LMUE 4GKJE 2V8QB 4JI1I 2EMAA 2EM5A 1JK2A 2JR1A 1MX0A 4LF5I 2UUBE 3KZZA 5A6AA 4R2CA 3K17A 4NXNI 1SFEA 5A69A 2ENCA 1N33E 2EN7A 3Q6MA 4MU3A 3IWBA 3L7ZA 5DRPA 2L33A 2YTGA 1MEYC 1MG7A 2L3JA 3CDJA 4IFDC 1OYSA 3EQ1A 2K7IA 4RPFA 1H74A 2HK2A 2B3TB 4DR7I 2A2CA 1BB8A 1A1FA 5C0XB 2YTJA 1HNWE 2BA1D 2E1RA 2O1UA 1L4SA 2IESA 5LMNE 4LFAI 1VISA 1VI7A 3LTOA 2EMXA 1WXRA 1DGCA 4P7AA 4NXMI 4OX9I 3CDIA 4YY3E 1T39A 2PNLA 4K0KI 5K36F 3L00A 4R2PA 2EPMX 1PJSA 1X6FA 1YYKA 4DUZE 2DEIA 4OKGA 3THNA 2A25A 3BIDA 4BHCA 3WU4A 4JI5E 4MQYA 4GKJI 3QT6A 4HACB 2L92A 2HFSA 4IFDA 3KRNA 4DPTA 1X5WA 1XHKA 3V2UC 2GQ0A 2WP8A 4FWDA 2V2ZA 2EP3A 2VF1A 2WBTA 4ZYHA 3J81C 1SR9A 2UUCI 3LPSA 2JXPA 1Z0TA 3P3CA 5K36B 1B63A 4IFDF 2LVHA 1N36I 4DKKA 2V89A 4WYQB 4DV0E 5TSEA 2JEBA 4MU1A 2BA0G 5DROA 2YU8A 3UK3C 2EOQA 2PNZB 3B4TA 2EPAA 2BM1A 2VQEE 5LMNI 4X64E 2CSHA 1USUA 4DR2I 1PVGA 2EN6A 1FWLA 2EM0A 5FWKA 4IFDD 4X65E 1H73A 3ZZ0A 2EQ0A 4BHBA 4LFBE 4ED4A 4DV3I 1UHZA 3CWVA 1ZM2A 2B9DA 2MKDA 4LFCI 1KVKA 2YRMA 4WPYA 3HQ1A 1MU5A 2M9AA 3PRYA 1FNMA 4WUDA 4GEQB 5LLQA 1B69A 4JV5I 3DF6A 5AC4A 4DUZI 2C39B 2MDGA 2EPCA 1XMOE 1A1IA 5IT9Q 1Z59A 5BR8E 2EOSA 2C37B 5KL2A 3LNUA 3B82A 2ENHA 4X8WA 2PO2A 1NZ0A 4DR4I 2BR2A 2BM0A 2H36X 3P3EA 3FIGA 2DRPA 4DR6E 1ZR9A 3Q6NA 3HJCA 4DV1E 4AM3A 2LUQA 3EPJA 3OMLA 4J8ZA 1UDQA 2V8PA 2PO0A 4M0VA 4IZJB 5JEAA 1NEIA 4B3ME 2J65A 2Z5BA 5AE2A 2FGGA 3LLHA 1G2FC 4MU4A 3VHTB 3ADGA 2NUEA 2CPNA 4JI1E 1OYRA 3GLLA 4LF5E 3T1HE 1HNZE 1X48A 2YT4A 1A1KA 4FW5A 5JEAF 3ZOQB 2LJPA 1RHYA 4USKA 4DV2I 3AV0A 1WJPA 2L2KB 2DIXA 4B3SE 2O1VA 2DMYA 2VQFE 2Z5CB 4DMIA 3EPLA 2LBSB 3P76A 4U3BA 4LF7I 2HHHI 1P47A 3C4TA 2DMIA 4X66E 1GQEA 1DI2A 4LFBI 1EA6A 3P3GA 2YU5A 2CT1A 2LV2A 2WZOA 2EOYA 2G7HA 2V85A 4WSGA 5T6JA 5KL5A 2NN6B 2YTFA 1HK7A 2WNRB 4OZEA 2EN1A 4KHPI 3VYYA 4OO1E 2LO3A 2EMKA 2HKEA 4QNJA 5JEAD 4DV5I 2JEAA 2O3ZA 2EOEA 2V2QA 1X6HA 5GMEA 1Z5CA 2V34A 4LFAE 4Z7CA 4DR3I 5FLXQ 2EN4A 3MHHC 4M30A 4WXDA 4DR6I 2VE7C 4OX9E 3MHSC 2V2VA 5AE3A 1Z0EA 4HY1A 4DV4I 1J5EI 4OO1A 3F6GA 2EPOA 1E3PA 1UN6B 4L5NC 4LF4I 2HGHA 1A1LA 3ZZUA 4F6NA 2EM3A 2WBUA 3JTZA 4BA1B 1NHHA 1LLMC 1H7UA 5C0XE 2EOFA 1ZXNA 3T1HI 5DNLA 4F54A 1YYOA 1HNZI 1A1JA 2R42A 1Z0CA 1FI4A 2YTQA 1Z0GA 2GPIA 4WSPA 5AC5A 1ZAAC 3OTOI 2CG9A 2VQFI 4B3SI 2OI2A 2UUCE 4OOGC 1KKHA 4R8OA 2ELZA 3M85D 2JE6A 1PJTA 3Q1QA 4X66I 2YSOA 4O24A 1FJGI 2EOJA 2HC5A 4BC9A 1N36E 5A6BA 2DGCA 3JU0A 3GONA 1GTKA 4IJDA 1OJ4A 3QG5C 4LF6E 2LUPB 1KTVA 2C38B 2EMZA 4OO1D 2V88A 5EL9A 2J7KA 1IBKI 2EOOA 2UXDI 4DR2E 3HKMA 2NPFA 1OYPA 1KIJA 2GS8A 1DARA 2LMZA 5KL3A 4TUGA 3GCMA 4DV3E 1X49A 5DRQA 4AQYI 4LFCE 4FW6A 1WRJA 4GKKI 2EPKX 1KJKA 1QZRA 3B8HA 2DSYA 4JV5E 1YUJA 4LCHA 1X3CA 3L7ZB 4FK5C 4M2ZA 3M7ND 2M4IA 5A6BD 4JI6I 4BA2A 1EI1A 2LTRA 1Z0BA 3PYEA 5AE1A 4DR4E 1UILA 2DLKA 2N3GA 4NHRA 2EMBA 2YTEA 4P7DA 4R2AA 2IERA 5EKWA 1ZM9A 4F2JC 5IV8B 1WUUA 3QT7A 4KZSA 3EPKA 4DV6E 3WU3A 2EM6A 1EH6A 1RR9A 4FW4A 4DR1I 1RMDA 2PO1A 1WHNA 1RC7A 5CFFE 2CZ9A 4Z7YA 3KZYA 4LF6I 1N0VC 2YTPA 3H4LA 5JEAC 2EL5A 2VESA 4DPYA 4O5GA 4N4RB 4DV2E 2PNMA 4LCFA 2K4VA 3V5RA 2F4VI 1TF3A 4DPXA 4BS9A 4LF7E 4P78A 2BV3A 4R03A 4LCGA 2HHHE 2I9IA 5DNXA 1FKAE 3HULA 4IFDB 1IMUA 3IWDA 4KWYA 3ADLA 5AASA 3VYXA 4R2DA 1QNTA 2EOMA 2EPNA 4ZYEA 1MGTA 4R1FA 2WP8B 3K85A 1S16A 2EM4A 3PS3A 4KHPE 2RQLA
chains in the Genus database with same CATH topology
2MC5A 4JI2I 1XMQE 4DV5E 2E5LE 2B7VA 3J81Q 3P06A 2NUGA 4L8NA 2JWOA 2RTXA 4DR3E 4PRVA 4DUYE 4IZJA 2IHR1 1D6TA 4UTGA 1J5EE 3C4BA 3VK6A 2LJHA 4DV4E 1PIEA 4X62E 1IBME 4FWHA 4DPWA 4LF4E 4DV6I 4MYTA 1Z0WA 2FTXB 2L2NA 4LTYA 4F9AB 3H09A 2HK3A 4IZKA 4P52A 4I8OA 5IWAI 2N3HA 2RSMA 3LMLA 5L3JA 3WU5A 3OTOE 2KHXA 4F9BB 3J7AG 4JI7E 4JYAE 1FJGE 2V87A 1RQ0A 2UU9E 4DPUA 4IZJD 2VF3A 3K6QA 2WW4A 2ZM6E 1Y4UA 1XMQI 2E5LI 4JI0I 1STUA 4DV7E 2Z5EA 1IBKE 2UXDE 2Z5BB 3AUZA 4B3RI 3K1JA 1A6FA 1YYWA 4DUYI 1BKNA 1FWKA 4EMDA 3MSWA 4AQYE 3HTXA 3QT5A 2FV4B 1X47A 4X62I 1IBMI 4GKKE 4I3HA 1HR0E 2B7TA 3ADJA 4JI6E 2NA2A 2V86A 1XNQI 1ZM3A 1IBLE 2L3CA 2DEJA 2L2MA 3KWRA 4XTJA 4FW9A 5A2QC 3ZKBA 3WU6A 4JI7I 4JYAI 2L8TA 2UU9I 2JY9A 5F3WA 4DR1E 4BCAA 2ZM6I 2RS6A 1I94E 4DR5I 2EWLA 4HYMA 4DV7I 4USMA 1QU6A 4Q28A 2F4VE 4JI8E 4BC7A 2V83A 4BMJA 1Y4SA 4PU9A 3ZM7A 1N32E 1USVA 4MYUA 1T4NA 3F0NA 4JI4I 4HACA 1PKPA 1H72C 4JI2E 1HR0I 4JI3E 2EFGA 2X7IA 2NUFA 5A2QQ 2JVAA 2O1WA 4M1KA 1NHJA 2ZBKB 4KQVA 2UXCE 3T1YI 3M6AA 1IBLI 3D4JA 5GMDA 1DQ3A 1S4EA 3PYGA 4B3TI 4TUIA 2LE2A 1N0UA 4JG4A 2A2DA 4HXZA 4WUBA 3HPZA 2UUAI 3RMPA 1N34I 4DXLA 1I94I 4WFTA 4YHHI 1HNXI 4LF8I 5IWAE 1ZXMA 5LMUI 1YZ9A 4LU9A 2CGEA 2KONA 2UUBI 4JI8I 1N32I 1T4OA 5IT9C 1Z5AA 3J80C 4ZVIA 1N33I 1ELOA 1ZBQA 2XEXA 4JI3I 2Q2EB 4JI0E 2EZ6A 3ADIA 1UEKA 2ZITA 2UXCI 4B3RE 2KOUA 1HNWI 2UXBE 1U2RA 2HFUA 4LF9E 1H7SA 4F9CB 4BBYA 4YY3I 2ODRC 1Z0VA 1ZBTA 3PYFA 3B78A 5DNYA 5ADZA 2Z5CA 2JOBA 1NHIA 4JI5I 1XNQE 3J80Q 1K47A 3P1XA 2AJ4A 2IOQA 1Z5BA 2IOPA 2LTSA 3JAMC 1EKZA 1GZ6A 2MDRA 5FLXC 2X36A 1XNRE 4DR5E 4PRXA 2HKJA 4DV0I 3J7Yp 1ZM4A 4NXNE 5LL6R 4WUCA 1Y6ZA 4DU8A 3ZKDA 2UXBI 4LF9I 4X64I 3HPSA 4IZKB 4DU7A 4JI4E 4X65I 2L6MA 4URLA 2M7QA 2F8BA 3J7AM 4FN5A 2R3VA 2O1TA 3F6HA 1RREA 3ZZTA 4DR7E 3HXLA 1XMOI 3JAMQ 3T1YE 5BR8I 1WHQA 3DJWA 4N3OA 2E1MA 3IWCA 2MC6A 2YZTA 2DB2A 2JOXA 4NXME 4B3TE 2RS7A 4DV1I 2UUAE 4K0KE 2ODRD 1B62A 4FWGA 1N34E 4B3MI 1XNRI 1O0WA 3QT8A 1T4LB 4YHHE 1HNXE 4LF8E 2M1SA 3PYDA 4UT4A 2LRSA 5LMUE 4GKJE 2V8QB 4JI1I 1MX0A 4LF5I 2JR1A 2UUBE 3K17A 4NXNI 1N33E 3Q6MA 3IWBA 2L33A 1MG7A 4RPFA 1H74A 2HK2A 2B3TB 4DR7I 2A2CA 1HNWE 2E1RA 2O1UA 5LMNE 4LFAI 1VISA 3LTOA 4P7AA 1WXRA 4NXMI 4OX9I 4YY3E 2PNLA 4K0KI 1YYKA 4DUZE 2DEIA 3WU4A 4JI5E 4GKJI 3QT6A 4HACB 2L92A 2HFSA 4DPTA 1XHKA 3V2UC 2GQ0A 4FWDA 2V2ZA 2VF1A 3J81C 1SR9A 2UUCI 3LPSA 1Z0TA 1B63A 1N36I 4DKKA 2V89A 4WYQB 4DV0E 2BM1A 2VQEE 5LMNI 4X64E 1USUA 4DR2I 1PVGA 1FWLA 5FWKA 4X65E 1H73A 3ZZ0A 4LFBE 4DV3I 4ED4A 1UHZA 3CWVA 1ZM2A 2B9DA 4LFCI 1KVKA 4WPYA 3HQ1A 1MU5A 3PRYA 1FNMA 4WUDA 4GEQB 4JV5I 3DF6A 4DUZI 1XMOE 5IT9Q 1Z59A 5BR8E 3LNUA 3B82A 4X8WA 1NZ0A 4DR4I 2BM0A 2H36X 3FIGA 4DR6E 3Q6NA 3HJCA 4DV1E 2LUQA 3OMLA 4J8ZA 2V8PA 4M0VA 4IZJB 4B3ME 2Z5BA 5AE2A 2FGGA 3LLHA 3ADGA 2NUEA 2CPNA 4JI1E 4LF5E 3T1HE 1HNZE 1X48A 2YT4A 3ZOQB 2LJPA 4USKA 4DV2I 3AV0A 2L2KB 4B3SE 2DIXA 2O1VA 2Z5CB 2VQFE 2DMYA 2VQEI 4DMIA 2LBSB 4LF7I 2HHHI 3C4TA 4X66E 4LFBI 1GQEA 1DI2A 1EA6A 2WZOA 2L3JA 2G7HA 2V85A 5T6JA 1HK7A 4KHPI 3VYYA 4DV5I 2HKEA 2V2QA 5GMEA 1Z5CA 2V34A 4LFAE 4Z7CA 4DR3I 5FLXQ 4M30A 4DR6I 2VE7C 4OX9E 2V2VA 5AE3A 1Z0EA 4HY1A 4DV4I 1J5EI 3F6GA 4LF4I 4L5NC 3ZZUA 3JTZA 1NHHA 1H7UA 1ZXNA 3T1HI 1HNZI 4F54A 1YYOA 2R42A 1Z0CA 1FI4A 1Z0GA 4WSPA 4B3SI 3OTOI 2CG9A 2VQFI 2OI2A 2UUCE 4OOGC 1KKHA 4R8OA 3Q1QA 4X66I 1FJGI 4BC9A 1N36E 3JU0A 3GONA 1OJ4A 4LF6E 2LUPB 1KTVA 2V88A 2J7KA 1IBKI 2UXDI 4DR2E 2NPFA 1KIJA 2GS8A 1DARA 2LMZA 4TUGA 4DV3E 1X49A 4AQYI 4LFCE 4GKKI 1QZRA 3B8HA 2DSYA 4JV5E 4M2ZA 2M4IA 4JI6I 1EI1A 2LTRA 1Z0BA 3PYEA 5AE1A 4DR4E 1UILA 2N3GA 4P7DA 1ZM9A 1WUUA 3QT7A 4KZSA 4DV6E 3WU3A 1RR9A 4DR1I 1WHNA 1RC7A 5CFFE 2CZ9A 4Z7YA 4LF6I 1N0VC 3H4LA 4DPYA 4DV2E 2PNMA 2K4VA 3V5RA 2F4VI 4DPXA 4BS9A 4LF7E 4P78A 2BV3A 4R03A 2HHHE 1FKAE 3HULA 3IWDA 3ADLA 5AASA 3VYXA 4R1FA 3K85A 1S16A 1J26A 4KHPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 I;  1XMQ E;  4DV5 E;  2E5L E;  3J81 Q;  4DR3 E;  4PRV A;  4DUY E;  1D6T A;  4UTG A;  1J5E E;  4DV4 E;  1PIE A;  4DPW A;  4FWH A;  4X62 E;  1IBM E;  4LF4 E;  4DV6 I;  4MYT A;  1Z0W A;  2HK3 A;  4P52 A;  5IWA I;  5L3J A;  3WU5 A;  3OTO E;  3J7A G;  4JI7 E;  4JYA E;  1FJG E;  2UU9 E;  4DPU A;  2VF3 A;  2WW4 A;  2ZM6 E;  1XMQ I;  2E5L I;  4JI0 I;  4DV7 E;  1IBK E;  2UXD E;  4B3R I;  3K1J A;  1A6F A;  4DUY I;  1BKN A;  1FWK A;  4EMD A;  4AQY E;  3QT5 A;  4X62 I;  1IBM I;  4GKK E;  4I3H A;  1HR0 E;  4JI6 E;  1XNQ I;  1ZM3 A;  1IBL E;  2DEJ A;  4XTJ A;  4FW9 A;  5A2Q C;  3ZKB A;  3WU6 A;  4JI7 I;  4JYA I;  2UU9 I;  4DR1 E;  2ZM6 I;  1I94 E;  4DR5 I;  4HYM A;  4DV7 I;  4USM A;  2F4V E;  4JI8 E;  3ZM7 A;  4PU9 A;  1N32 E;  4MYU A;  3F0N A;  4JI4 I;  4HAC A;  1PKP A;  1H72 C;  4JI2 E;  1HR0 I;  4JI3 E;  2EFG A;  2X7I A;  5A2Q Q;  4M1K A;  1NHJ A;  2ZBK B;  4KQV A;  2UXC E;  3T1Y I;  3M6A A;  1IBL I;  3D4J A;  5GMD A;  1S4E A;  3PYG A;  4B3T I;  1N0U A;  4JG4 A;  2A2D A;  4HXZ A;  4WUB A;  2UUA I;  1N34 I;  4DXL A;  1I94 I;  4YHH I;  1HNX I;  4LF8 I;  5IWA E;  1ZXM A;  5LMU I;  2UUB I;  4JI8 I;  1N32 I;  5IT9 C;  1Z5A A;  3J80 C;  4ZVI A;  1N33 I;  1ELO A;  2XEX A;  4JI3 I;  2Q2E B;  4JI0 E;  1UEK A;  2ZIT A;  2UXC I;  4B3R E;  1HNW I;  2UXB E;  1U2R A;  2HFU A;  4LF9 E;  1H7S A;  4YY3 I;  1Z0V A;  3PYF A;  3B78 A;  1NHI A;  4JI5 I;  1XNQ E;  3J80 Q;  1K47 A;  2AJ4 A;  1Z5B A;  3JAM C;  5FLX C;  2X36 A;  1XNR E;  4DR5 E;  4PRX A;  2HKJ A;  4DV0 I;  1ZM4 A;  4WUC A;  5LL6 R;  4NXN E;  4DU8 A;  3ZKD A;  2UXB I;  4LF9 I;  4X64 I;  4DU7 A;  4JI4 E;  4X65 I;  4URL A;  3J7A M;  4FN5 A;  2R3V A;  1RRE A;  3ZZT A;  4DR7 E;  1XMO I;  3JAM Q;  3T1Y E;  5BR8 I;  4NXM E;  4B3T E;  4DV1 I;  2UUA E;  4K0K E;  1B62 A;  4FWG A;  1N34 E;  4B3M I;  1XNR I;  3QT8 A;  3PYD A;  4UT4 A;  4YHH E;  1HNX E;  4LF8 E;  5LMU E;  4GKJ E;  4JI1 I;  1MX0 A;  4LF5 I;  3K17 A;  4NXN I;  2UUB E;  1N33 E;  1MG7 A;  4RPF A;  1H74 A;  2HK2 A;  4DR7 I;  2A2C A;  1HNW E;  2E1R A;  5LMN E;  4LFA I;  1VIS A;  3LTO A;  4P7A A;  4NXM I;  4OX9 I;  4YY3 E;  4K0K I;  4DUZ E;  2DEI A;  3WU4 A;  4JI5 E;  4GKJ I;  3QT6 A;  4HAC B;  2HFS A;  4DPT A;  1XHK A;  3V2U C;  4FWD A;  2V2Z A;  3J81 C;  2UUC I;  3LPS A;  1Z0T A;  1B63 A;  1N36 I;  4DV0 E;  2BM1 A;  2VQE E;  5LMN I;  4X64 E;  4DR2 I;  1PVG A;  1FWL A;  4X65 E;  1H73 A;  3ZZ0 A;  4LFB E;  4DV3 I;  4ED4 A;  3CWV A;  1ZM2 A;  4LFC I;  1KVK A;  1MU5 A;  1FNM A;  4WUD A;  4JV5 I;  4DUZ I;  1XMO E;  5IT9 Q;  1Z59 A;  5BR8 E;  3LNU A;  3B82 A;  1NZ0 A;  4DR4 I;  2BM0 A;  4DR6 E;  4DV1 E;  2V8P A;  4B3M E;  4JI1 E;  4LF5 E;  3T1H E;  1HNZ E;  2LJP A;  4USK A;  4DV2 I;  2VQE I;  4B3S E;  2VQF E;  4LF7 I;  2HHH I;  4X66 E;  4LFB I;  1EA6 A;  4KHP I;  4DV5 I;  2HKE A;  2V2Q A;  5GME A;  1Z5C A;  2V34 A;  4Z7C A;  4LFA E;  4DR3 I;  5FLX Q;  4DR6 I;  4OX9 E;  2V2V A;  1Z0E A;  4HY1 A;  4DV4 I;  1J5E I;  4LF4 I;  3ZZU A;  1NHH A;  1H7U A;  1ZXN A;  3T1H I;  1HNZ I;  2R42 A;  1Z0C A;  1FI4 A;  1Z0G A;  4B3S I;  3OTO I;  2VQF I;  2OI2 A;  2UUC E;  1KKH A;  3Q1Q A;  4X66 I;  1FJG I;  1N36 E;  3GON A;  1OJ4 A;  4LF6 E;  1KTV A;  2J7K A;  1IBK I;  2UXD I;  4DR2 E;  2NPF A;  1KIJ A;  2GS8 A;  1DAR A;  4DV3 E;  4AQY I;  4LFC E;  4GKK I;  1QZR A;  3B8H A;  4JV5 E;  4JI6 I;  1EI1 A;  1Z0B A;  3PYE A;  4DR4 E;  1ZM9 A;  1WUU A;  3QT7 A;  4DV6 E;  3WU3 A;  1RR9 A;  4DR1 I;  4LF6 I;  2CZ9 A;  4Z7Y A;  1N0V C;  3H4L A;  4DPY A;  4DV2 E;  3V5R A;  2F4V I;  4DPX A;  2BV3 A;  4LF7 E;  2HHH E;  1FKA E;  3HUL A;  4R1F A;  1S16 A;  4KHP E; 
#chains in the Genus database with same CATH topology
 2MC5 A;  4JI2 I;  1XMQ E;  4DV5 E;  2E5L E;  2B7V A;  5IXM B;  1E3H A;  3J81 Q;  3P06 A;  2NUG A;  4L8N A;  3UHM A;  2N8X A;  2JWO A;  2RTX A;  2D9H A;  4DR3 E;  4PRV A;  2EMH A;  4FW7 A;  4DUY E;  4IZJ A;  1UDN A;  2IHR 1;  1D6T A;  4UTG A;  3C6M A;  3C4B A;  3VK6 A;  2LJH A;  4DV4 E;  1J5E E;  1PIE A;  4X62 E;  1IBM E;  2BA0 D;  4FWH A;  4LF4 E;  4DPW A;  4DV6 I;  2NN6 E;  4MYT A;  1Z0W A;  2ENA A;  2EPL X;  2FTX B;  2L2N A;  4LTY A;  4F9A B;  4OO1 C;  3H09 A;  5A6K A;  1XXE A;  2HK3 A;  4IZK A;  1X6E A;  4P52 A;  2EPX A;  4I8O A;  2N3H A;  5IWA I;  2RSM A;  3LML A;  5L3J A;  2EMI A;  3WU5 A;  3OTO E;  2KHX A;  4F9B B;  1ZU1 A;  3J7A G;  3BBG A;  2EMC A;  2EMW A;  4JI7 E;  4JYA E;  4R2E A;  1FJG E;  2V87 A;  4RH8 A;  2PO2 B;  1RQ0 A;  2UU9 E;  1YHC A;  4DPU A;  3PS1 A;  4IZJ D;  1TF6 A;  2VF3 A;  3K6Q A;  2WW4 A;  2ZM6 E;  1Y4U A;  1AAY A;  4ZYG A;  1XMQ I;  2E5L I;  2EOR A;  4JI0 I;  3U1K A;  1STU A;  4DV7 E;  2Z5E A;  2PO0 B;  1IBK E;  5JEA B;  5C0X C;  4X9J A;  2UXD E;  2Z5B B;  3AUZ A;  4B3R I;  2JT2 A;  3K1J A;  1A6F A;  1YYW A;  1NCS A;  4DUY I;  1G2D C;  1BKN A;  4LOM A;  1FWK A;  4EMD A;  3MSW A;  4AID A;  4AQY E;  3HTX A;  3QT5 A;  2FV4 B;  1X47 A;  4X62 I;  1IBM I;  4GKK E;  4I3H A;  2NN6 D;  3TQM A;  4BA2 B;  5ELW A;  2YWQ A;  2VQE I;  5DRR A;  1HR0 E;  3EPH A;  2GO4 A;  2B7T A;  3ECR A;  3ADJ A;  1P42 A;  2EOH A;  4JI6 E;  1EH7 A;  2J7J A;  2NA2 A;  4OO1 F;  2RPC A;  2V86 A;  1XNQ I;  1ZM3 A;  1IBL E;  2L3C A;  2DEJ A;  2R76 A;  2L2M A;  3KWR A;  4XTJ A;  1UBD C;  1A1H A;  4FW9 A;  5A2Q C;  4O4K A;  4LPF A;  4NBQ A;  3ZKB A;  2JEA B;  3WU6 A;  4JI7 I;  4JYA I;  2C38 A;  4WXC A;  1T38 A;  2L8T A;  2UU9 I;  2JY9 A;  2BA1 G;  5C0X A;  5F3W A;  4DR1 E;  4BCA A;  2ZM6 I;  3GME A;  2RS6 A;  2RSI A;  1I94 E;  4IS9 A;  4DR5 I;  2LT7 A;  2YPN A;  2PRT A;  2EWL A;  1Z1B A;  4HYM A;  4DV7 I;  4USM A;  5C0X F;  1QU6 A;  4Q28 A;  2BBG A;  4JI8 E;  2F4V E;  4BC7 A;  2V83 A;  4BMJ A;  1Y4S A;  4PU9 A;  3ZM7 A;  1N32 E;  2JP9 A;  1F2I G;  1USV A;  4GQU A;  2EJ4 A;  1T4N A;  3F0N A;  2EMF A;  4MYU A;  5K36 E;  1YSA C;  4JI4 I;  4HAC A;  1PKP A;  4QNK A;  2R1F A;  3DD6 A;  1H72 C;  3NZK A;  2EPU A;  2Q8U A;  4JI2 E;  5KL7 A;  2EM8 A;  4JI3 E;  2EFG A;  2NUF A;  2X7I A;  1HR0 I;  2JE6 B;  5A2Q Q;  2JVA A;  2YTN A;  2O1W A;  4M1K A;  5C0X D;  1NHJ A;  2ZBK B;  4KQV A;  2UXC E;  3T1Y I;  3M6A A;  1IBL I;  3D4J A;  5K36 A;  1BBO A;  5GMD A;  4F6M A;  1R6L A;  1DQ3 A;  2VRD A;  2JPA A;  1S4E A;  4IFD E;  2EQ3 A;  3PYG A;  2WCC 3;  4B3T I;  4TUI A;  2LE2 A;  1N0U A;  2JYA A;  4JG4 A;  1YFH A;  2A2D A;  4HXZ A;  2PNZ A;  3HPZ A;  1Y60 A;  4WUB A;  2UUA I;  2EL6 A;  3RMP A;  1N34 I;  4DXL A;  4R2S A;  1I94 I;  4O43 A;  4WFT A;  4YHH I;  1HNX I;  4LF8 I;  5IWA E;  1ZXM A;  5LMU I;  1YZ9 A;  1Y5Y A;  4LU9 A;  2CGE A;  1YPN A;  3BF2 A;  2MKN A;  2KON A;  4IS1 C;  2UUB I;  2ADR A;  4JI8 I;  1N32 I;  1T4O A;  5IT9 C;  1Z5A A;  3J80 C;  2C39 A;  4ZVI A;  3BGH A;  1N33 I;  2GHF A;  5K36 D;  2EMY A;  1ELO A;  2GO3 A;  1ZBQ A;  2C37 A;  2NN6 C;  3C6K A;  2HJJ A;  2XEX A;  1UDS A;  2EPR A;  4JI3 I;  5KL4 A;  2Q2E B;  4JI0 E;  2EZ6 A;  3ADI A;  1UEK A;  2EM9 A;  2ZIT A;  2EML A;  2EPP A;  4M9V C;  2ELY A;  2UXC I;  2EL4 A;  2EOX A;  4B3R E;  2KOU A;  2NAB A;  4HTG A;  2PO1 B;  1HNW I;  3M99 B;  2JEB B;  2EM2 A;  3U1Y A;  4GZN C;  2CTD A;  2UXB E;  2YRK A;  4LF9 E;  1U2R A;  2HFU A;  1UDO A;  4MU0 A;  1H7S A;  2YSP A;  4F9C B;  1N3G A;  1AH5 A;  4BBY A;  1BBG A;  1PJQ A;  1JK1 A;  3PS2 A;  2YRH A;  4YY3 I;  2ODR C;  5A6J A;  4J3D A;  1Z0V A;  1ZBT A;  3PYF A;  3B78 A;  5DNY A;  4R2R A;  5ADZ A;  2Z5C A;  2EN8 A;  2JOB A;  1NHI A;  4R2Q A;  4AIM A;  3M7N G;  2BB8 A;  4JI5 I;  5JEA E;  1XNQ E;  3J80 Q;  4MDT A;  1K47 A;  3P1X A;  2DLQ A;  2AJ4 A;  2EN3 A;  2EM7 A;  1IQO A;  2AE8 A;  2YTD A;  2IOQ A;  1Z5B A;  2NN6 A;  2E72 A;  2WBS A;  2IOP A;  2WNR A;  2LTS A;  3THO B;  3JAM C;  4MLV A;  2I13 A;  1PDA A;  1EKZ A;  1TN9 A;  1GZ6 A;  2MDR A;  2BR2 B;  1YUI A;  5FLX C;  2X36 A;  1XNR E;  1KYQ A;  2EPZ A;  1YH8 A;  2NN6 F;  4FW3 A;  4DR5 E;  4PRX A;  2LCE A;  4MLQ A;  2HKJ A;  4DV0 I;  3J7Y p;  1IQS A;  4Q35 B;  2GLI A;  1ZM4 A;  3H1C A;  4NXN E;  5LL6 R;  4WUC A;  2LJU A;  1Y6Z A;  1EH8 A;  4DU8 A;  3ZKD A;  2UXB I;  4LF9 I;  4ZYD A;  4X64 I;  3HPS A;  4RHB B;  4IZK B;  4DU7 A;  2CVE A;  4JI4 E;  2EMG A;  4BA1 A;  4X65 I;  2L6M A;  4URL A;  2M7Q A;  2F8B A;  3J7A M;  4FN5 A;  2R3V A;  2O1T A;  3F6H A;  1RRE A;  1J26 A;  3ZZT A;  4DR7 E;  4ISA A;  5KL6 A;  4WX9 A;  1R6M A;  2F1D A;  2YTO A;  2EQ1 A;  3HXL A;  3M85 G;  3JAM Q;  1XMO I;  3T1Y E;  5BR8 I;  1WHQ A;  3DJW A;  4N3O A;  4NZV A;  2E1M A;  3IWC A;  2MC6 A;  2YZT A;  2EOZ A;  2DB2 A;  2EOI A;  2EN2 A;  2JOX A;  4NXM E;  2EE8 A;  5K36 C;  4B3T E;  2RS7 A;  4HEI A;  4DV1 I;  2YTI A;  2UUA E;  4K0K E;  2ODR D;  1B62 A;  1A1G A;  4FWG A;  1N34 E;  4B3M I;  1XNR I;  1O0W A;  3QT8 A;  1T4L B;  4YHH E;  1HNX E;  4LF8 E;  2M1S A;  3PYD A;  4U3D A;  4UT4 A;  2LRS A;  4OO1 B;  5LMU E;  4GKJ E;  2V8Q B;  4JI1 I;  2EMA A;  2EM5 A;  1JK2 A;  2JR1 A;  1MX0 A;  4LF5 I;  2UUB E;  3KZZ A;  5A6A A;  4R2C A;  3K17 A;  4NXN I;  1SFE A;  5A69 A;  2ENC A;  1N33 E;  2EN7 A;  3Q6M A;  4MU3 A;  3IWB A;  3L7Z A;  5DRP A;  2L33 A;  2YTG A;  1MEY C;  1MG7 A;  2L3J A;  3CDJ A;  4IFD C;  1OYS A;  3EQ1 A;  2K7I A;  4RPF A;  1H74 A;  2HK2 A;  2B3T B;  4DR7 I;  2A2C A;  1BB8 A;  1A1F A;  5C0X B;  2YTJ A;  1HNW E;  2BA1 D;  2E1R A;  2O1U A;  1L4S A;  2IES A;  5LMN E;  4LFA I;  1VIS A;  1VI7 A;  3LTO A;  2EMX A;  1WXR A;  1DGC A;  4P7A A;  4NXM I;  4OX9 I;  3CDI A;  4YY3 E;  1T39 A;  2PNL A;  4K0K I;  5K36 F;  3L00 A;  4R2P A;  2EPM X;  1PJS A;  1X6F A;  1YYK A;  4DUZ E;  2DEI A;  4OKG A;  3THN A;  2A25 A;  3BID A;  4BHC A;  3WU4 A;  4JI5 E;  4MQY A;  4GKJ I;  3QT6 A;  4HAC B;  2L92 A;  2HFS A;  4IFD A;  3KRN A;  4DPT A;  1X5W A;  1XHK A;  3V2U C;  2GQ0 A;  2WP8 A;  4FWD A;  2V2Z A;  2EP3 A;  2VF1 A;  2WBT A;  4ZYH A;  3J81 C;  1SR9 A;  2UUC I;  3LPS A;  2JXP A;  1Z0T A;  3P3C A;  5K36 B;  1B63 A;  4IFD F;  2LVH A;  1N36 I;  4DKK A;  2V89 A;  4WYQ B;  4DV0 E;  5TSE A;  2JEB A;  4MU1 A;  2BA0 G;  5DRO A;  2YU8 A;  3UK3 C;  2EOQ A;  2PNZ B;  3B4T A;  2EPA A;  2BM1 A;  2VQE E;  5LMN I;  4X64 E;  2CSH A;  1USU A;  4DR2 I;  1PVG A;  2EN6 A;  1FWL A;  2EM0 A;  5FWK A;  4IFD D;  4X65 E;  1H73 A;  3ZZ0 A;  2EQ0 A;  4BHB A;  4LFB E;  4ED4 A;  4DV3 I;  1UHZ A;  3CWV A;  1ZM2 A;  2B9D A;  2MKD A;  4LFC I;  1KVK A;  2YRM A;  4WPY A;  3HQ1 A;  1MU5 A;  2M9A A;  3PRY A;  1FNM A;  4WUD A;  4GEQ B;  5LLQ A;  1B69 A;  4JV5 I;  3DF6 A;  5AC4 A;  4DUZ I;  2C39 B;  2MDG A;  2EPC A;  1XMO E;  1A1I A;  5IT9 Q;  1Z59 A;  5BR8 E;  2EOS A;  2C37 B;  5KL2 A;  3LNU A;  3B82 A;  2ENH A;  4X8W A;  2PO2 A;  1NZ0 A;  4DR4 I;  2BR2 A;  2BM0 A;  2H36 X;  3P3E A;  3FIG A;  2DRP A;  4DR6 E;  1ZR9 A;  3Q6N A;  3HJC A;  4DV1 E;  4AM3 A;  2LUQ A;  3EPJ A;  3OML A;  4J8Z A;  1UDQ A;  2V8P A;  2PO0 A;  4M0V A;  4IZJ B;  5JEA A;  1NEI A;  4B3M E;  2J65 A;  2Z5B A;  5AE2 A;  2FGG A;  3LLH A;  1G2F C;  4MU4 A;  3VHT B;  3ADG A;  2NUE A;  2CPN A;  4JI1 E;  1OYR A;  3GLL A;  4LF5 E;  3T1H E;  1HNZ E;  1X48 A;  2YT4 A;  1A1K A;  4FW5 A;  5JEA F;  3ZOQ B;  2LJP A;  1RHY A;  4USK A;  4DV2 I;  3AV0 A;  1WJP A;  2L2K B;  2DIX A;  4B3S E;  2O1V A;  2DMY A;  2VQF E;  2Z5C B;  4DMI A;  3EPL A;  2LBS B;  3P76 A;  4U3B A;  4LF7 I;  2HHH I;  1P47 A;  3C4T A;  2DMI A;  4X66 E;  1GQE A;  1DI2 A;  4LFB I;  1EA6 A;  3P3G A;  2YU5 A;  2CT1 A;  2LV2 A;  2WZO A;  2EOY A;  2G7H A;  2V85 A;  4WSG A;  5T6J A;  5KL5 A;  2NN6 B;  2YTF A;  1HK7 A;  2WNR B;  4OZE A;  2EN1 A;  4KHP I;  3VYY A;  4OO1 E;  2LO3 A;  2EMK A;  2HKE A;  4QNJ A;  5JEA D;  4DV5 I;  2JEA A;  2O3Z A;  2EOE A;  2V2Q A;  1X6H A;  5GME A;  1Z5C A;  2V34 A;  4LFA E;  4Z7C A;  4DR3 I;  5FLX Q;  2EN4 A;  3MHH C;  4M30 A;  4WXD A;  4DR6 I;  2VE7 C;  4OX9 E;  3MHS C;  2V2V A;  5AE3 A;  1Z0E A;  4HY1 A;  4DV4 I;  1J5E I;  4OO1 A;  3F6G A;  2EPO A;  1E3P A;  1UN6 B;  4L5N C;  4LF4 I;  2HGH A;  1A1L A;  3ZZU A;  4F6N A;  2EM3 A;  2WBU A;  3JTZ A;  4BA1 B;  1NHH A;  1LLM C;  1H7U A;  5C0X E;  2EOF A;  1ZXN A;  3T1H I;  5DNL A;  4F54 A;  1YYO A;  1HNZ I;  1A1J A;  2R42 A;  1Z0C A;  1FI4 A;  2YTQ A;  1Z0G A;  2GPI A;  4WSP A;  5AC5 A;  1ZAA C;  3OTO I;  2CG9 A;  2VQF I;  4B3S I;  2OI2 A;  2UUC E;  4OOG C;  1KKH A;  4R8O A;  2ELZ A;  3M85 D;  2JE6 A;  1PJT A;  3Q1Q A;  4X66 I;  2YSO A;  4O24 A;  1FJG I;  2EOJ A;  2HC5 A;  4BC9 A;  1N36 E;  5A6B A;  2DGC A;  3JU0 A;  3GON A;  1GTK A;  4IJD A;  1OJ4 A;  3QG5 C;  4LF6 E;  2LUP B;  1KTV A;  2C38 B;  2EMZ A;  4OO1 D;  2V88 A;  5EL9 A;  2J7K A;  1IBK I;  2EOO A;  2UXD I;  4DR2 E;  3HKM A;  2NPF A;  1OYP A;  1KIJ A;  2GS8 A;  1DAR A;  2LMZ A;  5KL3 A;  4TUG A;  3GCM A;  4DV3 E;  1X49 A;  5DRQ A;  4AQY I;  4LFC E;  4FW6 A;  1WRJ A;  4GKK I;  2EPK X;  1KJK A;  1QZR A;  3B8H A;  2DSY A;  4JV5 E;  1YUJ A;  4LCH A;  1X3C A;  3L7Z B;  4FK5 C;  4M2Z A;  3M7N D;  2M4I A;  5A6B D;  4JI6 I;  4BA2 A;  1EI1 A;  2LTR A;  1Z0B A;  3PYE A;  5AE1 A;  4DR4 E;  1UIL A;  2DLK A;  2N3G A;  4NHR A;  2EMB A;  2YTE A;  4P7D A;  4R2A A;  2IER A;  5EKW A;  1ZM9 A;  4F2J C;  5IV8 B;  1WUU A;  3QT7 A;  4KZS A;  3EPK A;  4DV6 E;  3WU3 A;  2EM6 A;  1EH6 A;  1RR9 A;  4FW4 A;  4DR1 I;  1RMD A;  2PO1 A;  1WHN A;  1RC7 A;  5CFF E;  2CZ9 A;  4Z7Y A;  3KZY A;  4LF6 I;  1N0V C;  2YTP A;  3H4L A;  5JEA C;  2EL5 A;  2VES A;  4DPY A;  4O5G A;  4N4R B;  4DV2 E;  2PNM A;  4LCF A;  2K4V A;  3V5R A;  2F4V I;  1TF3 A;  4DPX A;  4BS9 A;  4LF7 E;  4P78 A;  2BV3 A;  4R03 A;  4LCG A;  2HHH E;  2I9I A;  5DNX A;  1FKA E;  3HUL A;  4IFD B;  1IMU A;  3IWD A;  4KWY A;  3ADL A;  5AAS A;  3VYX A;  4R2D A;  1QNT A;  2EOM A;  2EPN A;  4ZYE A;  1MGT A;  4R1F A;  2WP8 B;  3K85 A;  1S16 A;  2EM4 A;  3PS3 A;  4KHP E;  2RQL A; 
#chains in the Genus database with same CATH homology
 2MC5 A;  4JI2 I;  1XMQ E;  4DV5 E;  2E5L E;  2B7V A;  3J81 Q;  3P06 A;  2NUG A;  4L8N A;  2JWO A;  2RTX A;  4DR3 E;  4PRV A;  4DUY E;  4IZJ A;  2IHR 1;  1D6T A;  4UTG A;  1J5E E;  3C4B A;  3VK6 A;  2LJH A;  4DV4 E;  1PIE A;  4X62 E;  1IBM E;  4FWH A;  4DPW A;  4LF4 E;  4DV6 I;  4MYT A;  1Z0W A;  2FTX B;  2L2N A;  4LTY A;  4F9A B;  3H09 A;  2HK3 A;  4IZK A;  4P52 A;  4I8O A;  5IWA I;  2N3H A;  2RSM A;  3LML A;  5L3J A;  3WU5 A;  3OTO E;  2KHX A;  4F9B B;  3J7A G;  4JI7 E;  4JYA E;  1FJG E;  2V87 A;  1RQ0 A;  2UU9 E;  4DPU A;  4IZJ D;  2VF3 A;  3K6Q A;  2WW4 A;  2ZM6 E;  1Y4U A;  1XMQ I;  2E5L I;  4JI0 I;  1STU A;  4DV7 E;  2Z5E A;  1IBK E;  2UXD E;  2Z5B B;  3AUZ A;  4B3R I;  3K1J A;  1A6F A;  1YYW A;  4DUY I;  1BKN A;  1FWK A;  4EMD A;  3MSW A;  4AQY E;  3HTX A;  3QT5 A;  2FV4 B;  1X47 A;  4X62 I;  1IBM I;  4GKK E;  4I3H A;  1HR0 E;  2B7T A;  3ADJ A;  4JI6 E;  2NA2 A;  2V86 A;  1XNQ I;  1ZM3 A;  1IBL E;  2L3C A;  2DEJ A;  2L2M A;  3KWR A;  4XTJ A;  4FW9 A;  5A2Q C;  3ZKB A;  3WU6 A;  4JI7 I;  4JYA I;  2L8T A;  2UU9 I;  2JY9 A;  5F3W A;  4DR1 E;  4BCA A;  2ZM6 I;  2RS6 A;  1I94 E;  4DR5 I;  2EWL A;  4HYM A;  4DV7 I;  4USM A;  1QU6 A;  4Q28 A;  2F4V E;  4JI8 E;  4BC7 A;  2V83 A;  4BMJ A;  1Y4S A;  4PU9 A;  3ZM7 A;  1N32 E;  1USV A;  4MYU A;  1T4N A;  3F0N A;  4JI4 I;  4HAC A;  1PKP A;  1H72 C;  4JI2 E;  1HR0 I;  4JI3 E;  2EFG A;  2X7I A;  2NUF A;  5A2Q Q;  2JVA A;  2O1W A;  4M1K A;  1NHJ A;  2ZBK B;  4KQV A;  2UXC E;  3T1Y I;  3M6A A;  1IBL I;  3D4J A;  5GMD A;  1DQ3 A;  1S4E A;  3PYG A;  4B3T I;  4TUI A;  2LE2 A;  1N0U A;  4JG4 A;  2A2D A;  4HXZ A;  4WUB A;  3HPZ A;  2UUA I;  3RMP A;  1N34 I;  4DXL A;  1I94 I;  4WFT A;  4YHH I;  1HNX I;  4LF8 I;  5IWA E;  1ZXM A;  5LMU I;  1YZ9 A;  4LU9 A;  2CGE A;  2KON A;  2UUB I;  4JI8 I;  1N32 I;  1T4O A;  5IT9 C;  1Z5A A;  3J80 C;  4ZVI A;  1N33 I;  1ELO A;  1ZBQ A;  2XEX A;  4JI3 I;  2Q2E B;  4JI0 E;  2EZ6 A;  3ADI A;  1UEK A;  2ZIT A;  2UXC I;  4B3R E;  2KOU A;  1HNW I;  2UXB E;  1U2R A;  2HFU A;  4LF9 E;  1H7S A;  4F9C B;  4BBY A;  4YY3 I;  2ODR C;  1Z0V A;  1ZBT A;  3PYF A;  3B78 A;  5DNY A;  5ADZ A;  2Z5C A;  2JOB A;  1NHI A;  4JI5 I;  1XNQ E;  3J80 Q;  1K47 A;  3P1X A;  2AJ4 A;  2IOQ A;  1Z5B A;  2IOP A;  2LTS A;  3JAM C;  1EKZ A;  1GZ6 A;  2MDR A;  5FLX C;  2X36 A;  1XNR E;  4DR5 E;  4PRX A;  2HKJ A;  4DV0 I;  3J7Y p;  1ZM4 A;  4NXN E;  5LL6 R;  4WUC A;  1Y6Z A;  4DU8 A;  3ZKD A;  2UXB I;  4LF9 I;  4X64 I;  3HPS A;  4IZK B;  4DU7 A;  4JI4 E;  4X65 I;  2L6M A;  4URL A;  2M7Q A;  2F8B A;  3J7A M;  4FN5 A;  2R3V A;  2O1T A;  3F6H A;  1RRE A;  3ZZT A;  4DR7 E;  3HXL A;  1XMO I;  3JAM Q;  3T1Y E;  5BR8 I;  1WHQ A;  3DJW A;  4N3O A;  2E1M A;  3IWC A;  2MC6 A;  2YZT A;  2DB2 A;  2JOX A;  4NXM E;  4B3T E;  2RS7 A;  4DV1 I;  2UUA E;  4K0K E;  2ODR D;  1B62 A;  4FWG A;  1N34 E;  4B3M I;  1XNR I;  1O0W A;  3QT8 A;  1T4L B;  4YHH E;  1HNX E;  4LF8 E;  2M1S A;  3PYD A;  4UT4 A;  2LRS A;  5LMU E;  4GKJ E;  2V8Q B;  4JI1 I;  1MX0 A;  4LF5 I;  2JR1 A;  2UUB E;  3K17 A;  4NXN I;  1N33 E;  3Q6M A;  3IWB A;  2L33 A;  1MG7 A;  4RPF A;  1H74 A;  2HK2 A;  2B3T B;  4DR7 I;  2A2C A;  1HNW E;  2E1R A;  2O1U A;  5LMN E;  4LFA I;  1VIS A;  3LTO A;  4P7A A;  1WXR A;  4NXM I;  4OX9 I;  4YY3 E;  2PNL A;  4K0K I;  1YYK A;  4DUZ E;  2DEI A;  3WU4 A;  4JI5 E;  4GKJ I;  3QT6 A;  4HAC B;  2L92 A;  2HFS A;  4DPT A;  1XHK A;  3V2U C;  2GQ0 A;  4FWD A;  2V2Z A;  2VF1 A;  3J81 C;  1SR9 A;  2UUC I;  3LPS A;  1Z0T A;  1B63 A;  1N36 I;  4DKK A;  2V89 A;  4WYQ B;  4DV0 E;  2BM1 A;  2VQE E;  5LMN I;  4X64 E;  1USU A;  4DR2 I;  1PVG A;  1FWL A;  5FWK A;  4X65 E;  1H73 A;  3ZZ0 A;  4LFB E;  4DV3 I;  4ED4 A;  1UHZ A;  3CWV A;  1ZM2 A;  2B9D A;  4LFC I;  1KVK A;  4WPY A;  3HQ1 A;  1MU5 A;  3PRY A;  1FNM A;  4WUD A;  4GEQ B;  4JV5 I;  3DF6 A;  4DUZ I;  1XMO E;  5IT9 Q;  1Z59 A;  5BR8 E;  3LNU A;  3B82 A;  4X8W A;  1NZ0 A;  4DR4 I;  2BM0 A;  2H36 X;  3FIG A;  4DR6 E;  3Q6N A;  3HJC A;  4DV1 E;  2LUQ A;  3OML A;  4J8Z A;  2V8P A;  4M0V A;  4IZJ B;  4B3M E;  2Z5B A;  5AE2 A;  2FGG A;  3LLH A;  3ADG A;  2NUE A;  2CPN A;  4JI1 E;  4LF5 E;  3T1H E;  1HNZ E;  1X48 A;  2YT4 A;  3ZOQ B;  2LJP A;  4USK A;  4DV2 I;  3AV0 A;  2L2K B;  4B3S E;  2DIX A;  2O1V A;  2Z5C B;  2VQF E;  2DMY A;  2VQE I;  4DMI A;  2LBS B;  4LF7 I;  2HHH I;  3C4T A;  4X66 E;  4LFB I;  1GQE A;  1DI2 A;  1EA6 A;  2WZO A;  2L3J A;  2G7H A;  2V85 A;  5T6J A;  1HK7 A;  4KHP I;  3VYY A;  4DV5 I;  2HKE A;  2V2Q A;  5GME A;  1Z5C A;  2V34 A;  4LFA E;  4Z7C A;  4DR3 I;  5FLX Q;  4M30 A;  4DR6 I;  2VE7 C;  4OX9 E;  2V2V A;  5AE3 A;  1Z0E A;  4HY1 A;  4DV4 I;  1J5E I;  3F6G A;  4LF4 I;  4L5N C;  3ZZU A;  3JTZ A;  1NHH A;  1H7U A;  1ZXN A;  3T1H I;  1HNZ I;  4F54 A;  1YYO A;  2R42 A;  1Z0C A;  1FI4 A;  1Z0G A;  4WSP A;  4B3S I;  3OTO I;  2CG9 A;  2VQF I;  2OI2 A;  2UUC E;  4OOG C;  1KKH A;  4R8O A;  3Q1Q A;  4X66 I;  1FJG I;  4BC9 A;  1N36 E;  3JU0 A;  3GON A;  1OJ4 A;  4LF6 E;  2LUP B;  1KTV A;  2V88 A;  2J7K A;  1IBK I;  2UXD I;  4DR2 E;  2NPF A;  1KIJ A;  2GS8 A;  1DAR A;  2LMZ A;  4TUG A;  4DV3 E;  1X49 A;  4AQY I;  4LFC E;  4GKK I;  1QZR A;  3B8H A;  2DSY A;  4JV5 E;  4M2Z A;  2M4I A;  4JI6 I;  1EI1 A;  2LTR A;  1Z0B A;  3PYE A;  5AE1 A;  4DR4 E;  1UIL A;  2N3G A;  4P7D A;  1ZM9 A;  1WUU A;  3QT7 A;  4KZS A;  4DV6 E;  3WU3 A;  1RR9 A;  4DR1 I;  1WHN A;  1RC7 A;  5CFF E;  2CZ9 A;  4Z7Y A;  4LF6 I;  1N0V C;  3H4L A;  4DPY A;  4DV2 E;  2PNM A;  2K4V A;  3V5R A;  2F4V I;  4DPX A;  4BS9 A;  4LF7 E;  4P78 A;  2BV3 A;  4R03 A;  2HHH E;  1FKA E;  3HUL A;  3IWD A;  3ADL A;  5AAS A;  3VYX A;  4R1F A;  3K85 A;  1S16 A;  1J26 A;  4KHP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...