3J81C

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j81C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81C02
1XNQE 4XTJA 4GKKI 2DEIA 4DV3E 1K47A 2VF3A 1H73A 3J7AM 4K0KI 4HY1A 3LTOA 2HHHI 4B3TE 4JI8I 5IT9Q 1Z0VA 1D6TA 4DPXA 4LF4E 2UXDE 2Q2EB 5L3JA 5LMNI 4PRVA 2E1RA 2AJ4A 4B3ME 4DR2E 4DV2I 4KHPI 4DR5I 4P7AA 3ZZTA 1FKAE 4JV5E 3Q1QA 2UU9E 4DR1E 1J5EI 2CZ9A 3B8HA 4PRXA 4DV1I 4LFCI 1XNRE 2HKJA 4JYAE 3JAMC 1S16A 4DUYE 5LL6R 1XMOI 1I94E 1Z59A 4URLA 3QT6A 1QZRA 4MYUA 1HNWE 4JI3E 4M1KA 2VQEI 3J81C 1N32I 2DEJA 1XMQE 2VQFE 3ZKBA 1IBLE 4NXMI 4DUZE 1WUUA 4LF5I 5BR8E 2UUCE 2J7KA 4EMDA 2UUAI 4JI1I 4JI6I 1MG7A 2X7IA 3PYDA 4X64E 2UXBI 5A2QQ 1Z0GA 3WU5A 3T1HE 2LJPA 1EA6A 4GKKE 4DV0I 2NPFA 2A2CA 3QT5A 4WUBA 4PU9A 4K0KE 5IT9C 4FWGA 2HHHE 4JI8E 4DPUA 2E5LI 2EFGA 5LMNE 1UEKA 1N36E 3B78A 4X66I 5FLXC 4DV2E 4KHPE 4DR5E 3T1YE 4DV5I 4LF6I 3J80Q 3J7AG 5GMDA 5LMUI 3WU4A 2V8PA 4RPFA 1N34I 1B63A 1Z0TA 2V2VA 1J5EE 4OX9I 3CWVA 4JI7E 4DV1E 4DR6E 1U2RA 4FN5A 3V5RA 1NHIA 1ELOA 1FJGE 4HACA 1PKPA 5IWAI 2VQEE 4JI5E 1FWKA 1N32E 3LPSA 1HNXI 1HR0E 2F4VI 1H7UA 4WUCA 2BV3A 3OTOE 1MX0A 4JI2E 3ZZUA 4NXME 4DPWA 3B82A 3QT8A 3H4LA 4DXLA 4YHHE 2UXCI 4GKJI 4JI1E 4JI6E 1Z0EA 1XNQI 4AQYI 4HXZA 2UXBE 4DV7I 4DV4I 1NHJA 2HK2A 4USKA 1IBKI 4DR7E 4DV0E 4FWHA 4YY3E 1H72C 1ZM9A 1Z0WA 1MU5A 4JI4I 1HNZE 2E5LE 3QT7A 2ZBKB 3PYFA 1Z5BA 4R1FA 1IBMI 4X62I 4X65I 2BM0A 4NXNI 2UU9I 4LF8I 1Z0BA 4LF7I 4LF9I 1N33E 3WU6A 4DV5E 4LF6E 1Z5CA 5LMUE 4JI0I 4B3RI 1XNRI 2ZITA 1N34E 4JYAI 1A6FA 4LFAI 4DUYI 4OX9E 1I94I 4UTGA 4B3SI 1DARA 2HK3A 1VISA 3K17A 1PVGA 1ZXMA 2V34A 2XEXA 2R3VA 4JI3I 4USMA 3PYGA 4DR3I 4UT4A 4DV6I 1XMQI 1N0UA 1H7SA 4DUZI 2UUBI 3WU3A 2UUCI 1Z5AA 1KTVA 2F4VE 4ED4A 1EI1A 2ZM6I 1KIJA 4Z7YA 4LFBI 4LFCE 2HKEA 2R42A 1BKNA 3F0NA 4DR4I 4FW9A 2UXCE 4GKJE 4ZVIA 1XMOE 4AQYE 1Z0CA 4DU7A 1ZM4A 4DV7E 4DV4E 1IBKE 3V2UC 3M6AA 2A2DA 3LNUA 1ZM2A 3GONA 4Z7CA 4JI4E 4LF5E 1N36I 1OJ4A 2UUAE 5FLXQ 3T1YI 1KKHA 4I3HA 1RR9A 1IBME 4KQVA 4X62E 1KVKA 3ZKDA 4X65E 4NXNE 1NHHA 5A2QC 4DV3I 1S4EA 4LF8E 4LF7E 4LF9E 1FI4A 4B3TI 4JI7I 4DR6I 4JI0E 4B3RE 4LFAE 1N0VC 1FJGI 2HFSA 4LF4I 2UXDI 5GMEA 4B3SE 4HYMA 4B3MI 4DR2I 4JI5I 1FWLA 3ZZ0A 1B62A 4JV5I 1PIEA 1ZM3A 3D4JA 1NZ0A 4DR3E 4DR1I 1HR0I 4WUDA 4X66E 1RREA 4DV6E 4MYTA 3PYEA 3OTOI 4HACB 4DU8A 4JI2I 3HULA 2UUBE 3J80C 2V2ZA 2WW4A 4YHHI 2OI2A 3JAMQ 1FNMA 2ZM6E 2GS8A 4LFBE 4DR4E 4DPTA 1HNWI 4FWDA 3J81Q 2HFUA 4DR7I 4YY3I 2X36A 2VQFI 5IWAE 1XHKA 1IBLI 1HNZI 5BR8I 1HNXE 1H74A 4P52A 4JG4A 1ZXNA 2BM1A 4X64I 3T1HI 4DPYA 3K1JA 2V2QA 1N33I 3ZM7A
chains in the Genus database with same CATH superfamily
4NBQA 1XNQE 4XTJA 4F9AB 2K7IA 2DEIA 4DV3E 4IZJB 4GKKI 1LLMC 1K47A 2EOQA 3ECRA 2VF3A 3MHHC 1H73A 2I9IA 5A6BD 5KL4A 3ADLA 2BR2B 3J7AM 2BA1G 2NUEA 2EWLA 4U3DA 4HY1A 4K0KI 2EOIA 3L7ZA 1WHNA 4Q35B 3LTOA 2YTQA 2HHHI 4B3TE 4JI8I 5IT9Q 4WX9A 2EPRA 1T4OA 2WBSA 1YSAC 1HK7A 1Z0VA 4HTGA 1D6TA 4R2DA 5AE3A 4IJDA 5C0XB 2IOPA 2VF1A 2G7HA 2HC5A 5F3WA 2KONA 4LF4E 2UXDE 2EMLA 1J26A 2Q2EB 4MU4A 3VYXA 4DPXA 4F54A 2FGGA 2WBUA 5JEAC 2CT1A 2NABA 2YTOA 2L2KB 2EJ4A 5IV8B 4PRVA 1G2DC 2E1RA 4B3ME 2AJ4A 3GLLA 4DR2E 1YHCA 3U1KA 4DV2I 4KHPI 1A1KA 4DR5I 4P7AA 4F2JC 1FKAE 3ZZTA 4GEQB 3ADIA 4JV5E 3CDJA 3Q1QA 2EP3A 2UU9E 4Q28A 2FTXB 1YPNA 4IFDF 1A1HA 5DRQA 1T39A 4DR1E 4ZYDA 1Z1BA 1J5EI 5DNYA 2CZ9A 4MDTA 2EOZA 4O43A 4LPFA 2EOJA 2LCEA 1X48A 2YTFA 5TSEA 2EMCA 3B8HA 4PRXA 4DV1I 2E72A 2LE2A 4J8ZA 2Z5BA 4LFCI 2H36X 2CPNA 3EQ1A 1XNRE 4JYAE 2HKJA 3JAMC 2LMZA 1A1FA 5AE2A 1S16A 1UHZA 4DUYE 1PJQA 5LL6R 2PNZA 1DGCA 2ELZA 2LUQA 5C0XF 1XMOI 4HEIA 1I94E 2LT7A 1Z59A 5C0XC 4M30A 2J65A 4URLA 2EM2A 2C39B 5EKWA 3ZOQB 2BA0G 5K36E 3QT6A 2L3CA 1QZRA 2YU8A 1HNWE 4MYUA 4O5GA 4JI3E 4M1KA 3J81C 4TUIA 4MU3A 5DROA 3Q6NA 2VQEI 1P47A 2HJJA 3F6GA 1N32I 1IQSA 2DEJA 5DRRA 1UILA 2RTXA 4L8NA 2YRKA 1X47A 1L4SA 2WNRB 1XMQE 1Y5YA 2VQFE 4FK5C 2LUPB 3ZKBA 1ZBQA 1IBLE 1YUJA 2NN6E 2MDRA 4DUZE 4NXMI 1NEIA 1WUUA 4LF5I 5BR8E 2YU5A 2UUCE 2CSHA 3L7ZB 4P78A 4TUGA 2EOYA 2J7KA 2O1VA 4GQUA 1GTKA 1IMUA 4EMDA 2UUAI 4JI1I 1JK2A 4JI6I 2EQ0A 1MG7A 2MC5A 5CFFE 4LCHA 2X7IA 2EN3A 3PYDA 4BA1A 4X64E 4LCGA 2PO1A 2JEAA 4F6MA 2UXBI 2KHXA 5A2QQ 4GZNC 1Z0GA 3WU5A 3T1HE 2YWQA 2DIXA 4BMJA 2EPZA 2LO3A 2EN1A 3LMLA 2I13A 2EL5A 2LJPA 3BBGA 2YRHA 4FW7A 1EA6A 2EMGA 2IHR1 4GKKE 3M85D 4DV0I 2YSPA 4BHBA 4N3OA 2EMAA 2PRTA 2NPFA 2WBTA 5K36B 2A2CA 2EMZA 4NHRA 3QT5A 3P3GA 4PU9A 4WUBA 2EPAA 4K0KE 4FW6A 5IXMB 4LU9A 4ZYGA 2PO2A 5IT9C 2HHHE 4FWGA 4JI8E 4DPUA 3C4BA 2ENAA 1BBOA 2E5LI 2DMIA 4R2QA 2JE6A 4R8OA 4QNKA 2EPCA 5DRPA 1PDAA 3MSWA 2R76A 5KL3A 1X3CA 2ELYA 3HPSA 2F8BA 2EFGA 2Z5BB 3JTZA 5KL6A 1ZR9A 1A1IA 4MLVA 3PRYA 2NN6B 3C6MA 5LMNE 2DLKA 2PNZB 2M9AA 2GPIA 1OYSA 3KWRA 1UEKA 1N36E 3B78A 4WYQB 1RQ0A 1A1GA 4X66I 3P1XA 5FLXC 4DV2E 4KHPE 2C37A 4DR5E 3T1YE 2EM0A 4DKKA 1F2IG 1KYQA 2ODRC 4DV5I 4LF6I 3J80Q 2EPPA 1X49A 3J7AG 2WP8A 1USVA 5GMDA 2LBSB 5LMUI 3WU4A 2V8PA 4RPFA 1N34I 5K36F 1B63A 1Z0TA 1P42A 1J5EE 2V2VA 4OX9I 4IFDD 5K36C 3EPKA 2YPNA 5FWKA 1NCSA 3EPJA 1BBGA 1E3PA 2EPLX 3CWVA 2YTEA 4OO1A 4JI7E 1O0WA 4DV1E 1BB8A 4DR6E 4DMIA 4WXDA 1U2RA 5AC4A 4FN5A 5KL5A 3V5RA 1NHIA 3K6QA 2EM4A 4X8WA 2EM7A 2JXPA 2JY9A 1FJGE 1ELOA 4RHBB 2RPCA 2Z5CA 5KL7A 4IS1C 2YTGA 2NN6F 2NN6C 2RQLA 3UHMA 4HACA 4IS9A 5LMNI 1PKPA 1UDQA 5IWAI 2V89A 2VQEE 4JI5E 1FWKA 2JYAA 3KRNA 2O3ZA 1GZ6A 2N8XA 1N32E 2DMYA 3LPSA 1YYWA 1HNXI 1HR0E 3KZZA 2F4VI 1H7UA 3BF2A 2YT4A 2FV4B 3H09A 1OYPA 4WUCA 2BV3A 4L5NC 3OTOE 1E3HA 1MX0A 1ZAAC 5DNXA 3M7ND 4JI2E 2LV2A 4NXME 1DQ3A 3LLHA 3ZZUA 2L2MA 2MC6A 2V85A 2JEBB 3B82A 2B7VA 3H4LA 3QT8A 4DPWA 2MDGA 2AE8A 3HTXA 3IWBA 2EQ3A 3PS3A 3C6KA 1QU6A 4YHHE 4DXLA 2UXCI 4GKJI 4JI1E 2JE6B 4JI6E 2VESA 5AASA 3ADGA 1Z0EA 1QNTA 1XNQI 4AQYI 3FIGA 3L00A 2JOXA 4HXZA 2UXBE 4IZKB 2EL6A 3THOB 2EMHA 1KJKA 4DV7I 4DV4I 2RSIA 1Y6ZA 2EPXA 1NHJA 2HK2A 2Z5EA 2YTJA 2EM5A 4OO1D 2CTDA 2EPOA 4USKA 1IBKI 2EOMA 3M99B 4DR7E 4DV0E 1RMDA 2EN2A 4MLQA 1ZBTA 3DF6A 5EL9A 4AM3A 4YY3E 4FWHA 4R2AA 1H72C 5JEAA 2NUGA 1ZM9A 4WFTA 3HPZA 4WPYA 1Z0WA 1T4LB 3J7Yp 3P76A 2RS7A 2R1FA 1MU5A 4JI4I 3BIDA 1HNZE 1AAYA 2E5LE 2LJHA 2B7TA 2JOBA 1A1JA 2ZBKB 1Z5BA 3PYFA 2LJUA 2V86A 3QT7A 2BA1D 2DSYA 4R1FA 3VK6A 1IBMI 4IFDA 1T4NA 4X62I 1X6EA 1STUA 2YRMA 4X65I 2BM0A 4I8OA 4NXNI 2BR2A 2UU9I 3UK3C 2EORA 2V87A 2EMFA 2B3TB 2E1MA 2D9HA 2Z5CB 3PS1A 1OYRA 4LF8I 5KL2A 4R03A 1Z0BA 1Y4UA 4N4RB 4LF7I 4LF9I 5DNLA 3AUZA 1UBDC 3THNA 4BHCA 2EQ1A 1N33E 4OZEA 2EMIA 3WU6A 4DV5E 4ZYHA 1T38A 4LF6E 1Z5CA 3KZYA 2JWOA 5LMUE 2EOSA 4JI0I 4B3RI 1XNRI 2ZITA 1N34E 5C0XA 1A6FA 4JYAI 4LFAI 4DUYI 4MU1A 4OX9E 2L33A 2WCC3 2DGCA 2O1UA 3CDIA 3HJCA 3HXLA 1I94I 4IFDE 4UTGA 4B3SI 1DARA 2HK3A 2J7JA 3HKMA 4P7DA 1VISA 1WJPA 3K17A 2M7QA 3IWDA 1PVGA 1RHYA 2EM6A 4KWYA 1YFHA 1ZXMA 2V34A 2XEXA 3PS2A 2R3VA 2EOHA 4JI3I 4USMA 2CGEA 3TQMA 2EN7A 2MKNA 3PYGA 2ADRA 2EMBA 1WRJA 2EPUA 4DR3I 4UT4A 5JEAD 1YZ9A 4DV6I 1XMQI 2L6MA 1N0UA 4R2CA 1N3GA 4BCAA 1H7SA 5LLQA 4DUZI 4X9JA 2EOXA 2UUBI 2B9DA 3WU3A 2EE8A 2UUCI 1Z5AA 1KTVA 2BA0D 2JVAA 2CG9A 2JT2A 4F9BB 2GO4A 1AH5A 5A6AA 2F4VE 2GO3A 3VHTB 1WXRA 1USUA 2EOOA 4ED4A 4R2EA 2C39A 2DLQA 2L3JA 1GQEA 2IOQA 5JEAF 2LTRA 5ADZA 1EI1A 2ZM6I 2N3GA 1KIJA 4Z7YA 4LFBI 4LFCE 2HKEA 2R42A 1BKNA 3F0NA 2V8QB 3F6HA 2EOEA 4FW9A 4DR4I 2UXCE 4GKJE 1EH7A 1XMOE 2EN4A 4ZVIA 4LOMA 2KOUA 4AQYE 2JPAA 2WNRA 4M9VC 2EPKX 1Z0CA 2PNLA 1YH8A 1ZM4A 4DU7A 2EN8A 5C0XD 4IFDB 4BA1B 3JU0A 2PO1B 2JEAB 4DV7E 4DV4E 4WSGA 3P3CA 4J3DA 2GLIA 2A25A 2MKDA 2M4IA 4FW5A 1MGTA 1IBKE 3V2UC 3M6AA 2A2DA 4OO1E 4O4KA 1RC7A 3LNUA 3OMLA 4ZYEA 2V88A 2O1TA 2VRDA 5AC5A 1Y60A 1ZM2A 3GONA 2EM8A 4Z7CA 4WXCA 1SFEA 4JI4E 4BA2A 2RS6A 2JP9A 4LF5E 2C38A 4KZSA 2JR1A 3M85G 4BS9A 2PO2B 1N36I 1OJ4A 2V83A 2N3HA 2L8TA 2YTNA 1JK1A 2IESA 2VE7C 2UUAE 5L3JA 5FLXQ 2EL4A 3T1YI 1KKHA 4I3HA 1IBME 1RR9A 4KQVA 4X62E 1WHQA 1KVKA 4FW3A 3ZKDA 1DI2A 4X65E 4NXNE 1NHHA 5A2QC 2EMKA 2O1WA 4DV3I 5K36A 1S4EA 4U3BA 2EMXA 4IFDC 3RMPA 4F9CB 4LF8E 5T6JA 4QNJA 4R2RA 4LF7E 4LF9E 1SR9A 1FI4A 4NZVA 1A1LA 1ZU1A 4RH8A 1Y4SA 3P06A 2PO0A 1TN9A 4B3TI 2C37B 1XXEA 4AIDA 4JI7I 4DR6I 5A69A 3DD6A 2EM3A 2NA2A 1TF3A 3GCMA 4JI0E 2BBGA 4B3RE 4LFAE 2YTIA 1N0VC 2NN6A 4BC7A 2WP8B 1FJGI 4MQYA 1MEYC 2HFSA 4LF4I 2UXDI 5GMEA 4B3SE 5A6JA 4HYMA 4BBYA 4OKGA 3Q6MA 2DB2A 4OO1B 4B3MI 4DR2I 1G2FC 2CVEA 4IZJA 1VI7A 4JI5I 4OOGC 1FWLA 3HQ1A 2EM9A 1B62A 3ZZ0A 2M1SA 4JV5I 1X6FA 5AE1A 1PIEA 1ZM3A 3D4JA 2BB8A 2L92A 4DR3E 1NZ0A 4DR1I 1HR0I 4WUDA 2EOFA 2YTPA 3EPLA 4X66E 2EPMX 2Q8UA 4DV6E 1R6LA 1RREA 2IERA 4AIMA 1UDNA 4MYTA 1PJTA 3PYEA 3OTOI 1UDOA 4HACB 2YTDA 1EH6A 2EZ6A 4DU8A 5JEAE 4JI2I 3HULA 2UUBE 3J80C 2ENHA 2YZTA 2V2ZA 4MU0A 2ODRD 2EMYA 2GHFA 2LVHA 2DRPA 2EMWA 1TF6A 2WW4A 4YHHI 2RSMA 4R2PA 2OI2A 5A6BA 3JAMQ 3P3EA 4M0VA 1EH8A 3DJWA 1YYOA 1FNMA 5K36D 2ZM6E 2GS8A 3BGHA 4LFBE 4BA2B 2C38B 4OO1F 4WSPA 4DR4E 4DPTA 4OO1C 3IWCA 1HNWI 4FWDA 1IQOA 3EPHA 3M7NG 1UN6B 2PNMA 3J81Q 3ADJA 1PJSA 3K85A 2HFUA 4DR7I 2ENCA 2NN6D 3MHSC 2NUFA 4YY3I 2X36A 2VQFI 2JEBA 3H1CA 5C0XE 3C4TA 2EPNA 2LTSA 3GMEA 5IWAE 3AV0A 2K4VA 1XHKA 1IBLI 3B4TA 2LRSA 3QG5C 1HNZI 1R6MA 5BR8I 5ELWA 4M2ZA 3U1YA 2EN6A 1HNXE 1H74A 4ISAA 2PO0B 4FW4A 2HGHA 4P52A 4IZJD 4JG4A 1ZXNA 2GQ0A 3VYYA 4IZKA 4LTYA 2YSOA 4F6NA 2BM1A 2WZOA 5JEAB 1UDSA 4X64I 2L2NA 4O24A 1B69A 4BC9A 1EKZA 1X6HA 3T1HI 4LCFA 4DPYA 3K1JA 5A6KA 2V2QA 4R2SA 2F1DA 1YYKA 1YUIA 1N33I 3NZKA 1X5WA 3ZM7A
chains in the Genus database with same CATH topology
1XNQE 4XTJA 4F9AB 4IZJB 2DEIA 4DV3E 4GKKI 1K47A 2VF3A 1H73A 3ADLA 3J7AM 2NUEA 2EWLA 4K0KI 4HY1A 1WHNA 3LTOA 2HHHI 4B3TE 4JI8I 5IT9Q 1T4OA 1HK7A 1Z0VA 1D6TA 5AE3A 2IOPA 2VF1A 2G7HA 5F3WA 1J26A 2KONA 4LF4E 2UXDE 4DPXA 2Q2EB 5L3JA 3VYXA 5LMNI 4F54A 2FGGA 2L2KB 4PRVA 2E1RA 4B3ME 2AJ4A 4DR2E 4DV2I 4KHPI 4DR5I 4P7AA 3ZZTA 1FKAE 4GEQB 3ADIA 4JV5E 3Q1QA 2UU9E 4Q28A 2FTXB 4DR1E 1J5EI 5DNYA 2CZ9A 1X48A 3B8HA 4PRXA 4DV1I 2LE2A 4J8ZA 2Z5BA 4LFCI 2H36X 2CPNA 1XNRE 2HKJA 4JYAE 3JAMC 2LMZA 1S16A 5AE2A 1UHZA 4DUYE 5LL6R 2LUQA 1XMOI 1I94E 1Z59A 4M30A 4URLA 3ZOQB 3QT6A 2L3CA 1QZRA 4MYUA 1HNWE 4JI3E 4M1KA 2VQEI 3J81C 4TUIA 3Q6NA 3F6GA 1N32I 2DEJA 1UILA 2RTXA 4L8NA 1X47A 1XMQE 2VQFE 2LUPB 3ZKBA 1ZBQA 1IBLE 4NXMI 2MDRA 4DUZE 1WUUA 4LF5I 5BR8E 2UUCE 4P78A 4TUGA 2J7KA 2O1VA 4EMDA 2UUAI 4JI1I 4JI6I 1MG7A 2MC5A 5CFFE 2X7IA 3PYDA 4X64E 2UXBI 2KHXA 5A2QQ 1Z0GA 3WU5A 3T1HE 2DIXA 4BMJA 3LMLA 2LJPA 1EA6A 2IHR1 4GKKE 4DV0I 4N3OA 2NPFA 2A2CA 3QT5A 4WUBA 4PU9A 4K0KE 4LU9A 5IT9C 2HHHE 4FWGA 4JI8E 4DPUA 3C4BA 2E5LI 4R8OA 3MSWA 2EFGA 3HPSA 2F8BA 2Z5BB 3JTZA 3PRYA 5LMNE 3KWRA 1UEKA 1N36E 3B78A 4WYQB 1RQ0A 4X66I 3P1XA 5FLXC 4DV2E 4KHPE 4DR5E 3T1YE 4DKKA 2ODRC 4DV5I 4LF6I 3J80Q 3J7AG 1X49A 5GMDA 1USVA 5LMUI 2LBSB 3WU4A 2V8PA 4RPFA 1N34I 1B63A 1Z0TA 2V2VA 1J5EE 4OX9I 5FWKA 3CWVA 4JI7E 1O0WA 4DV1E 4DR6E 4DMIA 1U2RA 4FN5A 3V5RA 1NHIA 3K6QA 4X8WA 2JY9A 1FJGE 1ELOA 2Z5CA 4HACA 1PKPA 5IWAI 2V89A 2VQEE 4JI5E 1FWKA 1GZ6A 1N32E 2DMYA 3LPSA 1YYWA 1HNXI 1HR0E 2F4VI 1H7UA 2YT4A 2FV4B 3H09A 4WUCA 2BV3A 4L5NC 3OTOE 1MX0A 4JI2E 4NXME 1DQ3A 3LLHA 3ZZUA 2L2MA 2MC6A 2V85A 3B82A 3QT8A 2B7VA 3H4LA 4DPWA 3HTXA 3IWBA 1QU6A 4YHHE 4DXLA 2UXCI 4GKJI 4JI1E 4JI6E 5AASA 3ADGA 1Z0EA 1XNQI 4AQYI 3FIGA 2JOXA 4HXZA 2UXBE 4IZKB 4DV7I 4DV4I 1Y6ZA 2Z5EA 1NHJA 2HK2A 4USKA 1IBKI 4DR7E 4DV0E 1ZBTA 3DF6A 4YY3E 4FWHA 1H72C 2NUGA 1ZM9A 4WFTA 3HPZA 4WPYA 1Z0WA 1T4LB 3J7Yp 2RS7A 1MU5A 4JI4I 1HNZE 2E5LE 2LJHA 2B7TA 2JOBA 2ZBKB 3PYFA 1Z5BA 3QT7A 2V86A 2DSYA 4R1FA 3VK6A 1IBMI 1T4NA 4X62I 1STUA 4X65I 2BM0A 4I8OA 4NXNI 2UU9I 2V87A 2B3TB 2E1MA 2Z5CB 4LF8I 4R03A 1Z0BA 1Y4UA 4LF7I 4LF9I 3AUZA 1N33E 3WU6A 4DV5E 4LF6E 1Z5CA 2JWOA 5LMUE 4JI0I 4B3RI 1XNRI 2ZITA 1N34E 4JYAI 1A6FA 4LFAI 4DUYI 4OX9E 2L33A 2O1UA 3HJCA 1I94I 3HXLA 4UTGA 4B3SI 1DARA 2HK3A 4P7DA 1VISA 3K17A 2M7QA 3IWDA 1PVGA 1ZXMA 2V34A 2XEXA 2R3VA 4JI3I 4USMA 2CGEA 3PYGA 4DR3I 4UT4A 1YZ9A 4DV6I 1XMQI 2L6MA 1N0UA 4BCAA 1H7SA 4DUZI 2UUBI 2B9DA 3WU3A 2UUCI 1Z5AA 1KTVA 2CG9A 2JVAA 4F9BB 2F4VE 1WXRA 1USUA 4ED4A 2L3JA 1GQEA 2IOQA 2LTRA 5ADZA 1EI1A 2ZM6I 2N3GA 1KIJA 4Z7YA 4LFBI 4LFCE 2HKEA 2R42A 1BKNA 3F0NA 2V8QB 3F6HA 4DR4I 4FW9A 2UXCE 4GKJE 1XMOE 4ZVIA 2KOUA 4AQYE 1Z0CA 2PNLA 4DU7A 1ZM4A 3JU0A 4DV7E 4DV4E 2M4IA 1IBKE 3V2UC 3M6AA 2A2DA 1RC7A 3LNUA 3OMLA 2V88A 2O1TA 1ZM2A 3GONA 4Z7CA 4JI4E 2RS6A 4LF5E 4KZSA 2JR1A 4BS9A 1N36I 1OJ4A 2V83A 2N3HA 2L8TA 2VE7C 2UUAE 5FLXQ 3T1YI 1KKHA 4I3HA 1IBME 1RR9A 4KQVA 4X62E 1WHQA 1KVKA 3ZKDA 1DI2A 4X65E 4NXNE 1NHHA 5A2QC 2O1WA 4DV3I 1S4EA 3RMPA 4F9CB 4LF8E 5T6JA 4LF7E 4LF9E 1SR9A 1FI4A 1Y4SA 3P06A 4B3TI 4JI7I 4DR6I 2NA2A 4JI0E 4B3RE 4LFAE 1N0VC 4BC7A 1FJGI 2HFSA 4LF4I 2UXDI 5GMEA 4B3SE 4HYMA 4BBYA 3Q6MA 2DB2A 4B3MI 4DR2I 4IZJA 4JI5I 4OOGC 1FWLA 3HQ1A 3ZZ0A 1B62A 4JV5I 2M1SA 5AE1A 1PIEA 1ZM3A 3D4JA 2L92A 4DR3E 1NZ0A 4DR1I 1HR0I 4WUDA 4X66E 4DV6E 1RREA 4MYTA 3PYEA 3OTOI 4HACB 2EZ6A 4DU8A 4JI2I 3HULA 2UUBE 3J80C 2YZTA 2V2ZA 2ODRD 2WW4A 4YHHI 2RSMA 2OI2A 3JAMQ 4M0VA 1YYOA 3DJWA 1FNMA 2ZM6E 2GS8A 4LFBE 4WSPA 4DR4E 4DPTA 1HNWI 3IWCA 4FWDA 2PNMA 3J81Q 3ADJA 3K85A 2HFUA 4DR7I 4YY3I 2NUFA 2X36A 2VQFI 3C4TA 2LTSA 5IWAE 3AV0A 2K4VA 1XHKA 1IBLI 2LRSA 1HNZI 5BR8I 4M2ZA 1HNXE 1H74A 4P52A 4IZJD 4JG4A 1ZXNA 2GQ0A 3VYYA 4IZKA 4LTYA 2BM1A 2WZOA 4X64I 2L2NA 4BC9A 1EKZA 3T1HI 4DPYA 3K1JA 2V2QA 1YYKA 1N33I 3ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ E;  4XTJ A;  4GKK I;  2DEI A;  4DV3 E;  1K47 A;  2VF3 A;  1H73 A;  3J7A M;  4K0K I;  4HY1 A;  3LTO A;  2HHH I;  4B3T E;  4JI8 I;  5IT9 Q;  1Z0V A;  1D6T A;  4DPX A;  4LF4 E;  2UXD E;  2Q2E B;  5L3J A;  5LMN I;  4PRV A;  2E1R A;  2AJ4 A;  4B3M E;  4DR2 E;  4DV2 I;  4KHP I;  4DR5 I;  4P7A A;  3ZZT A;  1FKA E;  4JV5 E;  3Q1Q A;  2UU9 E;  4DR1 E;  1J5E I;  2CZ9 A;  3B8H A;  4PRX A;  4DV1 I;  4LFC I;  1XNR E;  2HKJ A;  4JYA E;  3JAM C;  1S16 A;  4DUY E;  5LL6 R;  1XMO I;  1I94 E;  1Z59 A;  4URL A;  3QT6 A;  1QZR A;  4MYU A;  1HNW E;  4JI3 E;  4M1K A;  2VQE I;  3J81 C;  1N32 I;  2DEJ A;  1XMQ E;  2VQF E;  3ZKB A;  1IBL E;  4NXM I;  4DUZ E;  1WUU A;  4LF5 I;  5BR8 E;  2UUC E;  2J7K A;  4EMD A;  2UUA I;  4JI1 I;  4JI6 I;  1MG7 A;  2X7I A;  3PYD A;  4X64 E;  2UXB I;  5A2Q Q;  1Z0G A;  3WU5 A;  3T1H E;  2LJP A;  1EA6 A;  4GKK E;  4DV0 I;  2NPF A;  2A2C A;  3QT5 A;  4WUB A;  4PU9 A;  4K0K E;  5IT9 C;  4FWG A;  2HHH E;  4JI8 E;  4DPU A;  2E5L I;  2EFG A;  5LMN E;  1UEK A;  1N36 E;  3B78 A;  4X66 I;  5FLX C;  4DV2 E;  4KHP E;  4DR5 E;  3T1Y E;  4DV5 I;  4LF6 I;  3J80 Q;  3J7A G;  5GMD A;  5LMU I;  3WU4 A;  2V8P A;  4RPF A;  1N34 I;  1B63 A;  1Z0T A;  2V2V A;  1J5E E;  4OX9 I;  3CWV A;  4JI7 E;  4DV1 E;  4DR6 E;  1U2R A;  4FN5 A;  3V5R A;  1NHI A;  1ELO A;  1FJG E;  4HAC A;  1PKP A;  5IWA I;  2VQE E;  4JI5 E;  1FWK A;  1N32 E;  3LPS A;  1HNX I;  1HR0 E;  2F4V I;  1H7U A;  4WUC A;  2BV3 A;  3OTO E;  1MX0 A;  4JI2 E;  3ZZU A;  4NXM E;  4DPW A;  3B82 A;  3QT8 A;  3H4L A;  4DXL A;  4YHH E;  2UXC I;  4GKJ I;  4JI1 E;  4JI6 E;  1Z0E A;  1XNQ I;  4AQY I;  4HXZ A;  2UXB E;  4DV7 I;  4DV4 I;  1NHJ A;  2HK2 A;  4USK A;  1IBK I;  4DR7 E;  4DV0 E;  4FWH A;  4YY3 E;  1H72 C;  1ZM9 A;  1Z0W A;  1MU5 A;  4JI4 I;  1HNZ E;  2E5L E;  3QT7 A;  2ZBK B;  3PYF A;  1Z5B A;  4R1F A;  1IBM I;  4X62 I;  4X65 I;  2BM0 A;  4NXN I;  2UU9 I;  4LF8 I;  1Z0B A;  4LF7 I;  4LF9 I;  1N33 E;  3WU6 A;  4DV5 E;  4LF6 E;  1Z5C A;  5LMU E;  4JI0 I;  4B3R I;  1XNR I;  2ZIT A;  1N34 E;  4JYA I;  1A6F A;  4LFA I;  4DUY I;  4OX9 E;  1I94 I;  4UTG A;  4B3S I;  1DAR A;  2HK3 A;  1VIS A;  3K17 A;  1PVG A;  1ZXM A;  2V34 A;  2XEX A;  2R3V A;  4JI3 I;  4USM A;  3PYG A;  4DR3 I;  4UT4 A;  4DV6 I;  1XMQ I;  1N0U A;  1H7S A;  4DUZ I;  2UUB I;  3WU3 A;  2UUC I;  1Z5A A;  1KTV A;  2F4V E;  4ED4 A;  1EI1 A;  2ZM6 I;  1KIJ A;  4Z7Y A;  4LFB I;  4LFC E;  2HKE A;  2R42 A;  1BKN A;  3F0N A;  4DR4 I;  4FW9 A;  2UXC E;  4GKJ E;  4ZVI A;  1XMO E;  4AQY E;  1Z0C A;  4DU7 A;  1ZM4 A;  4DV7 E;  4DV4 E;  1IBK E;  3V2U C;  3M6A A;  2A2D A;  3LNU A;  1ZM2 A;  3GON A;  4Z7C A;  4JI4 E;  4LF5 E;  1N36 I;  1OJ4 A;  2UUA E;  5FLX Q;  3T1Y I;  1KKH A;  4I3H A;  1RR9 A;  1IBM E;  4KQV A;  4X62 E;  1KVK A;  3ZKD A;  4X65 E;  4NXN E;  1NHH A;  5A2Q C;  4DV3 I;  1S4E A;  4LF8 E;  4LF7 E;  4LF9 E;  1FI4 A;  4B3T I;  4JI7 I;  4DR6 I;  4JI0 E;  4B3R E;  4LFA E;  1N0V C;  1FJG I;  2HFS A;  4LF4 I;  2UXD I;  5GME A;  4B3S E;  4HYM A;  4B3M I;  4DR2 I;  4JI5 I;  1FWL A;  3ZZ0 A;  1B62 A;  4JV5 I;  1PIE A;  1ZM3 A;  3D4J A;  1NZ0 A;  4DR3 E;  4DR1 I;  1HR0 I;  4WUD A;  4X66 E;  1RRE A;  4DV6 E;  4MYT A;  3PYE A;  3OTO I;  4HAC B;  4DU8 A;  4JI2 I;  3HUL A;  2UUB E;  3J80 C;  2V2Z A;  2WW4 A;  4YHH I;  2OI2 A;  3JAM Q;  1FNM A;  2ZM6 E;  2GS8 A;  4LFB E;  4DR4 E;  4DPT A;  1HNW I;  4FWD A;  3J81 Q;  2HFU A;  4DR7 I;  4YY3 I;  2X36 A;  2VQF I;  5IWA E;  1XHK A;  1IBL I;  1HNZ I;  5BR8 I;  1HNX E;  1H74 A;  4P52 A;  4JG4 A;  1ZXN A;  2BM1 A;  4X64 I;  3T1H I;  4DPY A;  3K1J A;  2V2Q A;  1N33 I;  3ZM7 A; 
#chains in the Genus database with same CATH topology
 4NBQ A;  1XNQ E;  4XTJ A;  4F9A B;  2K7I A;  2DEI A;  4DV3 E;  4IZJ B;  4GKK I;  1LLM C;  1K47 A;  2EOQ A;  3ECR A;  2VF3 A;  3MHH C;  1H73 A;  2I9I A;  5A6B D;  5KL4 A;  3ADL A;  2BR2 B;  3J7A M;  2BA1 G;  2NUE A;  2EWL A;  4U3D A;  4HY1 A;  4K0K I;  2EOI A;  3L7Z A;  1WHN A;  4Q35 B;  3LTO A;  2YTQ A;  2HHH I;  4B3T E;  4JI8 I;  5IT9 Q;  4WX9 A;  2EPR A;  1T4O A;  2WBS A;  1YSA C;  1HK7 A;  1Z0V A;  4HTG A;  1D6T A;  4R2D A;  5AE3 A;  4IJD A;  5C0X B;  2IOP A;  2VF1 A;  2G7H A;  2HC5 A;  5F3W A;  2KON A;  4LF4 E;  2UXD E;  2EML A;  1J26 A;  2Q2E B;  4MU4 A;  3VYX A;  4DPX A;  4F54 A;  2FGG A;  2WBU A;  5JEA C;  2CT1 A;  2NAB A;  2YTO A;  2L2K B;  2EJ4 A;  5IV8 B;  4PRV A;  1G2D C;  2E1R A;  4B3M E;  2AJ4 A;  3GLL A;  4DR2 E;  1YHC A;  3U1K A;  4DV2 I;  4KHP I;  1A1K A;  4DR5 I;  4P7A A;  4F2J C;  1FKA E;  3ZZT A;  4GEQ B;  3ADI A;  4JV5 E;  3CDJ A;  3Q1Q A;  2EP3 A;  2UU9 E;  4Q28 A;  2FTX B;  1YPN A;  4IFD F;  1A1H A;  5DRQ A;  1T39 A;  4DR1 E;  4ZYD A;  1Z1B A;  1J5E I;  5DNY A;  2CZ9 A;  4MDT A;  2EOZ A;  4O43 A;  4LPF A;  2EOJ A;  2LCE A;  1X48 A;  2YTF A;  5TSE A;  2EMC A;  3B8H A;  4PRX A;  4DV1 I;  2E72 A;  2LE2 A;  4J8Z A;  2Z5B A;  4LFC I;  2H36 X;  2CPN A;  3EQ1 A;  1XNR E;  4JYA E;  2HKJ A;  3JAM C;  2LMZ A;  1A1F A;  5AE2 A;  1S16 A;  1UHZ A;  4DUY E;  1PJQ A;  5LL6 R;  2PNZ A;  1DGC A;  2ELZ A;  2LUQ A;  5C0X F;  1XMO I;  4HEI A;  1I94 E;  2LT7 A;  1Z59 A;  5C0X C;  4M30 A;  2J65 A;  4URL A;  2EM2 A;  2C39 B;  5EKW A;  3ZOQ B;  2BA0 G;  5K36 E;  3QT6 A;  2L3C A;  1QZR A;  2YU8 A;  1HNW E;  4MYU A;  4O5G A;  4JI3 E;  4M1K A;  3J81 C;  4TUI A;  4MU3 A;  5DRO A;  3Q6N A;  2VQE I;  1P47 A;  2HJJ A;  3F6G A;  1N32 I;  1IQS A;  2DEJ A;  5DRR A;  1UIL A;  2RTX A;  4L8N A;  2YRK A;  1X47 A;  1L4S A;  2WNR B;  1XMQ E;  1Y5Y A;  2VQF E;  4FK5 C;  2LUP B;  3ZKB A;  1ZBQ A;  1IBL E;  1YUJ A;  2NN6 E;  2MDR A;  4DUZ E;  4NXM I;  1NEI A;  1WUU A;  4LF5 I;  5BR8 E;  2YU5 A;  2UUC E;  2CSH A;  3L7Z B;  4P78 A;  4TUG A;  2EOY A;  2J7K A;  2O1V A;  4GQU A;  1GTK A;  1IMU A;  4EMD A;  2UUA I;  4JI1 I;  1JK2 A;  4JI6 I;  2EQ0 A;  1MG7 A;  2MC5 A;  5CFF E;  4LCH A;  2X7I A;  2EN3 A;  3PYD A;  4BA1 A;  4X64 E;  4LCG A;  2PO1 A;  2JEA A;  4F6M A;  2UXB I;  2KHX A;  5A2Q Q;  4GZN C;  1Z0G A;  3WU5 A;  3T1H E;  2YWQ A;  2DIX A;  4BMJ A;  2EPZ A;  2LO3 A;  2EN1 A;  3LML A;  2I13 A;  2EL5 A;  2LJP A;  3BBG A;  2YRH A;  4FW7 A;  1EA6 A;  2EMG A;  2IHR 1;  4GKK E;  3M85 D;  4DV0 I;  2YSP A;  4BHB A;  4N3O A;  2EMA A;  2PRT A;  2NPF A;  2WBT A;  5K36 B;  2A2C A;  2EMZ A;  4NHR A;  3QT5 A;  3P3G A;  4PU9 A;  4WUB A;  2EPA A;  4K0K E;  4FW6 A;  5IXM B;  4LU9 A;  4ZYG A;  2PO2 A;  5IT9 C;  2HHH E;  4FWG A;  4JI8 E;  4DPU A;  3C4B A;  2ENA A;  1BBO A;  2E5L I;  2DMI A;  4R2Q A;  2JE6 A;  4R8O A;  4QNK A;  2EPC A;  5DRP A;  1PDA A;  3MSW A;  2R76 A;  5KL3 A;  1X3C A;  2ELY A;  3HPS A;  2F8B A;  2EFG A;  2Z5B B;  3JTZ A;  5KL6 A;  1ZR9 A;  1A1I A;  4MLV A;  3PRY A;  2NN6 B;  3C6M A;  5LMN E;  2DLK A;  2PNZ B;  2M9A A;  2GPI A;  1OYS A;  3KWR A;  1UEK A;  1N36 E;  3B78 A;  4WYQ B;  1RQ0 A;  1A1G A;  4X66 I;  3P1X A;  5FLX C;  4DV2 E;  4KHP E;  2C37 A;  4DR5 E;  3T1Y E;  2EM0 A;  4DKK A;  1F2I G;  1KYQ A;  2ODR C;  4DV5 I;  4LF6 I;  3J80 Q;  2EPP A;  1X49 A;  3J7A G;  2WP8 A;  1USV A;  5GMD A;  2LBS B;  5LMU I;  3WU4 A;  2V8P A;  4RPF A;  1N34 I;  5K36 F;  1B63 A;  1Z0T A;  1P42 A;  1J5E E;  2V2V A;  4OX9 I;  4IFD D;  5K36 C;  3EPK A;  2YPN A;  5FWK A;  1NCS A;  3EPJ A;  1BBG A;  1E3P A;  2EPL X;  3CWV A;  2YTE A;  4OO1 A;  4JI7 E;  1O0W A;  4DV1 E;  1BB8 A;  4DR6 E;  4DMI A;  4WXD A;  1U2R A;  5AC4 A;  4FN5 A;  5KL5 A;  3V5R A;  1NHI A;  3K6Q A;  2EM4 A;  4X8W A;  2EM7 A;  2JXP A;  2JY9 A;  1FJG E;  1ELO A;  4RHB B;  2RPC A;  2Z5C A;  5KL7 A;  4IS1 C;  2YTG A;  2NN6 F;  2NN6 C;  2RQL A;  3UHM A;  4HAC A;  4IS9 A;  5LMN I;  1PKP A;  1UDQ A;  5IWA I;  2V89 A;  2VQE E;  4JI5 E;  1FWK A;  2JYA A;  3KRN A;  2O3Z A;  1GZ6 A;  2N8X A;  1N32 E;  2DMY A;  3LPS A;  1YYW A;  1HNX I;  1HR0 E;  3KZZ A;  2F4V I;  1H7U A;  3BF2 A;  2YT4 A;  2FV4 B;  3H09 A;  1OYP A;  4WUC A;  2BV3 A;  4L5N C;  3OTO E;  1E3H A;  1MX0 A;  1ZAA C;  5DNX A;  3M7N D;  4JI2 E;  2LV2 A;  4NXM E;  1DQ3 A;  3LLH A;  3ZZU A;  2L2M A;  2MC6 A;  2V85 A;  2JEB B;  3B82 A;  2B7V A;  3H4L A;  3QT8 A;  4DPW A;  2MDG A;  2AE8 A;  3HTX A;  3IWB A;  2EQ3 A;  3PS3 A;  3C6K A;  1QU6 A;  4YHH E;  4DXL A;  2UXC I;  4GKJ I;  4JI1 E;  2JE6 B;  4JI6 E;  2VES A;  5AAS A;  3ADG A;  1Z0E A;  1QNT A;  1XNQ I;  4AQY I;  3FIG A;  3L00 A;  2JOX A;  4HXZ A;  2UXB E;  4IZK B;  2EL6 A;  3THO B;  2EMH A;  1KJK A;  4DV7 I;  4DV4 I;  2RSI A;  1Y6Z A;  2EPX A;  1NHJ A;  2HK2 A;  2Z5E A;  2YTJ A;  2EM5 A;  4OO1 D;  2CTD A;  2EPO A;  4USK A;  1IBK I;  2EOM A;  3M99 B;  4DR7 E;  4DV0 E;  1RMD A;  2EN2 A;  4MLQ A;  1ZBT A;  3DF6 A;  5EL9 A;  4AM3 A;  4YY3 E;  4FWH A;  4R2A A;  1H72 C;  5JEA A;  2NUG A;  1ZM9 A;  4WFT A;  3HPZ A;  4WPY A;  1Z0W A;  1T4L B;  3J7Y p;  3P76 A;  2RS7 A;  2R1F A;  1MU5 A;  4JI4 I;  3BID A;  1HNZ E;  1AAY A;  2E5L E;  2LJH A;  2B7T A;  2JOB A;  1A1J A;  2ZBK B;  1Z5B A;  3PYF A;  2LJU A;  2V86 A;  3QT7 A;  2BA1 D;  2DSY A;  4R1F A;  3VK6 A;  1IBM I;  4IFD A;  1T4N A;  4X62 I;  1X6E A;  1STU A;  2YRM A;  4X65 I;  2BM0 A;  4I8O A;  4NXN I;  2BR2 A;  2UU9 I;  3UK3 C;  2EOR A;  2V87 A;  2EMF A;  2B3T B;  2E1M A;  2D9H A;  2Z5C B;  3PS1 A;  1OYR A;  4LF8 I;  5KL2 A;  4R03 A;  1Z0B A;  1Y4U A;  4N4R B;  4LF7 I;  4LF9 I;  5DNL A;  3AUZ A;  1UBD C;  3THN A;  4BHC A;  2EQ1 A;  1N33 E;  4OZE A;  2EMI A;  3WU6 A;  4DV5 E;  4ZYH A;  1T38 A;  4LF6 E;  1Z5C A;  3KZY A;  2JWO A;  5LMU E;  2EOS A;  4JI0 I;  4B3R I;  1XNR I;  2ZIT A;  1N34 E;  5C0X A;  1A6F A;  4JYA I;  4LFA I;  4DUY I;  4MU1 A;  4OX9 E;  2L33 A;  2WCC 3;  2DGC A;  2O1U A;  3CDI A;  3HJC A;  3HXL A;  1I94 I;  4IFD E;  4UTG A;  4B3S I;  1DAR A;  2HK3 A;  2J7J A;  3HKM A;  4P7D A;  1VIS A;  1WJP A;  3K17 A;  2M7Q A;  3IWD A;  1PVG A;  1RHY A;  2EM6 A;  4KWY A;  1YFH A;  1ZXM A;  2V34 A;  2XEX A;  3PS2 A;  2R3V A;  2EOH A;  4JI3 I;  4USM A;  2CGE A;  3TQM A;  2EN7 A;  2MKN A;  3PYG A;  2ADR A;  2EMB A;  1WRJ A;  2EPU A;  4DR3 I;  4UT4 A;  5JEA D;  1YZ9 A;  4DV6 I;  1XMQ I;  2L6M A;  1N0U A;  4R2C A;  1N3G A;  4BCA A;  1H7S A;  5LLQ A;  4DUZ I;  4X9J A;  2EOX A;  2UUB I;  2B9D A;  3WU3 A;  2EE8 A;  2UUC I;  1Z5A A;  1KTV A;  2BA0 D;  2JVA A;  2CG9 A;  2JT2 A;  4F9B B;  2GO4 A;  1AH5 A;  5A6A A;  2F4V E;  2GO3 A;  3VHT B;  1WXR A;  1USU A;  2EOO A;  4ED4 A;  4R2E A;  2C39 A;  2DLQ A;  2L3J A;  1GQE A;  2IOQ A;  5JEA F;  2LTR A;  5ADZ A;  1EI1 A;  2ZM6 I;  2N3G A;  1KIJ A;  4Z7Y A;  4LFB I;  4LFC E;  2HKE A;  2R42 A;  1BKN A;  3F0N A;  2V8Q B;  3F6H A;  2EOE A;  4FW9 A;  4DR4 I;  2UXC E;  4GKJ E;  1EH7 A;  1XMO E;  2EN4 A;  4ZVI A;  4LOM A;  2KOU A;  4AQY E;  2JPA A;  2WNR A;  4M9V C;  2EPK X;  1Z0C A;  2PNL A;  1YH8 A;  1ZM4 A;  4DU7 A;  2EN8 A;  5C0X D;  4IFD B;  4BA1 B;  3JU0 A;  2PO1 B;  2JEA B;  4DV7 E;  4DV4 E;  4WSG A;  3P3C A;  4J3D A;  2GLI A;  2A25 A;  2MKD A;  2M4I A;  4FW5 A;  1MGT A;  1IBK E;  3V2U C;  3M6A A;  2A2D A;  4OO1 E;  4O4K A;  1RC7 A;  3LNU A;  3OML A;  4ZYE A;  2V88 A;  2O1T A;  2VRD A;  5AC5 A;  1Y60 A;  1ZM2 A;  3GON A;  2EM8 A;  4Z7C A;  4WXC A;  1SFE A;  4JI4 E;  4BA2 A;  2RS6 A;  2JP9 A;  4LF5 E;  2C38 A;  4KZS A;  2JR1 A;  3M85 G;  4BS9 A;  2PO2 B;  1N36 I;  1OJ4 A;  2V83 A;  2N3H A;  2L8T A;  2YTN A;  1JK1 A;  2IES A;  2VE7 C;  2UUA E;  5L3J A;  5FLX Q;  2EL4 A;  3T1Y I;  1KKH A;  4I3H A;  1IBM E;  1RR9 A;  4KQV A;  4X62 E;  1WHQ A;  1KVK A;  4FW3 A;  3ZKD A;  1DI2 A;  4X65 E;  4NXN E;  1NHH A;  5A2Q C;  2EMK A;  2O1W A;  4DV3 I;  5K36 A;  1S4E A;  4U3B A;  2EMX A;  4IFD C;  3RMP A;  4F9C B;  4LF8 E;  5T6J A;  4QNJ A;  4R2R A;  4LF7 E;  4LF9 E;  1SR9 A;  1FI4 A;  4NZV A;  1A1L A;  1ZU1 A;  4RH8 A;  1Y4S A;  3P06 A;  2PO0 A;  1TN9 A;  4B3T I;  2C37 B;  1XXE A;  4AID A;  4JI7 I;  4DR6 I;  5A69 A;  3DD6 A;  2EM3 A;  2NA2 A;  1TF3 A;  3GCM A;  4JI0 E;  2BBG A;  4B3R E;  4LFA E;  2YTI A;  1N0V C;  2NN6 A;  4BC7 A;  2WP8 B;  1FJG I;  4MQY A;  1MEY C;  2HFS A;  4LF4 I;  2UXD I;  5GME A;  4B3S E;  5A6J A;  4HYM A;  4BBY A;  4OKG A;  3Q6M A;  2DB2 A;  4OO1 B;  4B3M I;  4DR2 I;  1G2F C;  2CVE A;  4IZJ A;  1VI7 A;  4JI5 I;  4OOG C;  1FWL A;  3HQ1 A;  2EM9 A;  1B62 A;  3ZZ0 A;  2M1S A;  4JV5 I;  1X6F A;  5AE1 A;  1PIE A;  1ZM3 A;  3D4J A;  2BB8 A;  2L92 A;  4DR3 E;  1NZ0 A;  4DR1 I;  1HR0 I;  4WUD A;  2EOF A;  2YTP A;  3EPL A;  4X66 E;  2EPM X;  2Q8U A;  4DV6 E;  1R6L A;  1RRE A;  2IER A;  4AIM A;  1UDN A;  4MYT A;  1PJT A;  3PYE A;  3OTO I;  1UDO A;  4HAC B;  2YTD A;  1EH6 A;  2EZ6 A;  4DU8 A;  5JEA E;  4JI2 I;  3HUL A;  2UUB E;  3J80 C;  2ENH A;  2YZT A;  2V2Z A;  4MU0 A;  2ODR D;  2EMY A;  2GHF A;  2LVH A;  2DRP A;  2EMW A;  1TF6 A;  2WW4 A;  4YHH I;  2RSM A;  4R2P A;  2OI2 A;  5A6B A;  3JAM Q;  3P3E A;  4M0V A;  1EH8 A;  3DJW A;  1YYO A;  1FNM A;  5K36 D;  2ZM6 E;  2GS8 A;  3BGH A;  4LFB E;  4BA2 B;  2C38 B;  4OO1 F;  4WSP A;  4DR4 E;  4DPT A;  4OO1 C;  3IWC A;  1HNW I;  4FWD A;  1IQO A;  3EPH A;  3M7N G;  1UN6 B;  2PNM A;  3J81 Q;  3ADJ A;  1PJS A;  3K85 A;  2HFU A;  4DR7 I;  2ENC A;  2NN6 D;  3MHS C;  2NUF A;  4YY3 I;  2X36 A;  2VQF I;  2JEB A;  3H1C A;  5C0X E;  3C4T A;  2EPN A;  2LTS A;  3GME A;  5IWA E;  3AV0 A;  2K4V A;  1XHK A;  1IBL I;  3B4T A;  2LRS A;  3QG5 C;  1HNZ I;  1R6M A;  5BR8 I;  5ELW A;  4M2Z A;  3U1Y A;  2EN6 A;  1HNX E;  1H74 A;  4ISA A;  2PO0 B;  4FW4 A;  2HGH A;  4P52 A;  4IZJ D;  4JG4 A;  1ZXN A;  2GQ0 A;  3VYY A;  4IZK A;  4LTY A;  2YSO A;  4F6N A;  2BM1 A;  2WZO A;  5JEA B;  1UDS A;  4X64 I;  2L2N A;  4O24 A;  1B69 A;  4BC9 A;  1EKZ A;  1X6H A;  3T1H I;  4LCF A;  4DPY A;  3K1J A;  5A6K A;  2V2Q A;  4R2S A;  2F1D A;  1YYK A;  1YUI A;  1N33 I;  3NZK A;  1X5W A;  3ZM7 A; 
#chains in the Genus database with same CATH homology
 1XNQ E;  4XTJ A;  4F9A B;  4IZJ B;  2DEI A;  4DV3 E;  4GKK I;  1K47 A;  2VF3 A;  1H73 A;  3ADL A;  3J7A M;  2NUE A;  2EWL A;  4K0K I;  4HY1 A;  1WHN A;  3LTO A;  2HHH I;  4B3T E;  4JI8 I;  5IT9 Q;  1T4O A;  1HK7 A;  1Z0V A;  1D6T A;  5AE3 A;  2IOP A;  2VF1 A;  2G7H A;  5F3W A;  1J26 A;  2KON A;  4LF4 E;  2UXD E;  4DPX A;  2Q2E B;  5L3J A;  3VYX A;  5LMN I;  4F54 A;  2FGG A;  2L2K B;  4PRV A;  2E1R A;  4B3M E;  2AJ4 A;  4DR2 E;  4DV2 I;  4KHP I;  4DR5 I;  4P7A A;  3ZZT A;  1FKA E;  4GEQ B;  3ADI A;  4JV5 E;  3Q1Q A;  2UU9 E;  4Q28 A;  2FTX B;  4DR1 E;  1J5E I;  5DNY A;  2CZ9 A;  1X48 A;  3B8H A;  4PRX A;  4DV1 I;  2LE2 A;  4J8Z A;  2Z5B A;  4LFC I;  2H36 X;  2CPN A;  1XNR E;  2HKJ A;  4JYA E;  3JAM C;  2LMZ A;  1S16 A;  5AE2 A;  1UHZ A;  4DUY E;  5LL6 R;  2LUQ A;  1XMO I;  1I94 E;  1Z59 A;  4M30 A;  4URL A;  3ZOQ B;  3QT6 A;  2L3C A;  1QZR A;  4MYU A;  1HNW E;  4JI3 E;  4M1K A;  2VQE I;  3J81 C;  4TUI A;  3Q6N A;  3F6G A;  1N32 I;  2DEJ A;  1UIL A;  2RTX A;  4L8N A;  1X47 A;  1XMQ E;  2VQF E;  2LUP B;  3ZKB A;  1ZBQ A;  1IBL E;  4NXM I;  2MDR A;  4DUZ E;  1WUU A;  4LF5 I;  5BR8 E;  2UUC E;  4P78 A;  4TUG A;  2J7K A;  2O1V A;  4EMD A;  2UUA I;  4JI1 I;  4JI6 I;  1MG7 A;  2MC5 A;  5CFF E;  2X7I A;  3PYD A;  4X64 E;  2UXB I;  2KHX A;  5A2Q Q;  1Z0G A;  3WU5 A;  3T1H E;  2DIX A;  4BMJ A;  3LML A;  2LJP A;  1EA6 A;  2IHR 1;  4GKK E;  4DV0 I;  4N3O A;  2NPF A;  2A2C A;  3QT5 A;  4WUB A;  4PU9 A;  4K0K E;  4LU9 A;  5IT9 C;  2HHH E;  4FWG A;  4JI8 E;  4DPU A;  3C4B A;  2E5L I;  4R8O A;  3MSW A;  2EFG A;  3HPS A;  2F8B A;  2Z5B B;  3JTZ A;  3PRY A;  5LMN E;  3KWR A;  1UEK A;  1N36 E;  3B78 A;  4WYQ B;  1RQ0 A;  4X66 I;  3P1X A;  5FLX C;  4DV2 E;  4KHP E;  4DR5 E;  3T1Y E;  4DKK A;  2ODR C;  4DV5 I;  4LF6 I;  3J80 Q;  3J7A G;  1X49 A;  5GMD A;  1USV A;  5LMU I;  2LBS B;  3WU4 A;  2V8P A;  4RPF A;  1N34 I;  1B63 A;  1Z0T A;  2V2V A;  1J5E E;  4OX9 I;  5FWK A;  3CWV A;  4JI7 E;  1O0W A;  4DV1 E;  4DR6 E;  4DMI A;  1U2R A;  4FN5 A;  3V5R A;  1NHI A;  3K6Q A;  4X8W A;  2JY9 A;  1FJG E;  1ELO A;  2Z5C A;  4HAC A;  1PKP A;  5IWA I;  2V89 A;  2VQE E;  4JI5 E;  1FWK A;  1GZ6 A;  1N32 E;  2DMY A;  3LPS A;  1YYW A;  1HNX I;  1HR0 E;  2F4V I;  1H7U A;  2YT4 A;  2FV4 B;  3H09 A;  4WUC A;  2BV3 A;  4L5N C;  3OTO E;  1MX0 A;  4JI2 E;  4NXM E;  1DQ3 A;  3LLH A;  3ZZU A;  2L2M A;  2MC6 A;  2V85 A;  3B82 A;  3QT8 A;  2B7V A;  3H4L A;  4DPW A;  3HTX A;  3IWB A;  1QU6 A;  4YHH E;  4DXL A;  2UXC I;  4GKJ I;  4JI1 E;  4JI6 E;  5AAS A;  3ADG A;  1Z0E A;  1XNQ I;  4AQY I;  3FIG A;  2JOX A;  4HXZ A;  2UXB E;  4IZK B;  4DV7 I;  4DV4 I;  1Y6Z A;  2Z5E A;  1NHJ A;  2HK2 A;  4USK A;  1IBK I;  4DR7 E;  4DV0 E;  1ZBT A;  3DF6 A;  4YY3 E;  4FWH A;  1H72 C;  2NUG A;  1ZM9 A;  4WFT A;  3HPZ A;  4WPY A;  1Z0W A;  1T4L B;  3J7Y p;  2RS7 A;  1MU5 A;  4JI4 I;  1HNZ E;  2E5L E;  2LJH A;  2B7T A;  2JOB A;  2ZBK B;  3PYF A;  1Z5B A;  3QT7 A;  2V86 A;  2DSY A;  4R1F A;  3VK6 A;  1IBM I;  1T4N A;  4X62 I;  1STU A;  4X65 I;  2BM0 A;  4I8O A;  4NXN I;  2UU9 I;  2V87 A;  2B3T B;  2E1M A;  2Z5C B;  4LF8 I;  4R03 A;  1Z0B A;  1Y4U A;  4LF7 I;  4LF9 I;  3AUZ A;  1N33 E;  3WU6 A;  4DV5 E;  4LF6 E;  1Z5C A;  2JWO A;  5LMU E;  4JI0 I;  4B3R I;  1XNR I;  2ZIT A;  1N34 E;  4JYA I;  1A6F A;  4LFA I;  4DUY I;  4OX9 E;  2L33 A;  2O1U A;  3HJC A;  1I94 I;  3HXL A;  4UTG A;  4B3S I;  1DAR A;  2HK3 A;  4P7D A;  1VIS A;  3K17 A;  2M7Q A;  3IWD A;  1PVG A;  1ZXM A;  2V34 A;  2XEX A;  2R3V A;  4JI3 I;  4USM A;  2CGE A;  3PYG A;  4DR3 I;  4UT4 A;  1YZ9 A;  4DV6 I;  1XMQ I;  2L6M A;  1N0U A;  4BCA A;  1H7S A;  4DUZ I;  2UUB I;  2B9D A;  3WU3 A;  2UUC I;  1Z5A A;  1KTV A;  2CG9 A;  2JVA A;  4F9B B;  2F4V E;  1WXR A;  1USU A;  4ED4 A;  2L3J A;  1GQE A;  2IOQ A;  2LTR A;  5ADZ A;  1EI1 A;  2ZM6 I;  2N3G A;  1KIJ A;  4Z7Y A;  4LFB I;  4LFC E;  2HKE A;  2R42 A;  1BKN A;  3F0N A;  2V8Q B;  3F6H A;  4DR4 I;  4FW9 A;  2UXC E;  4GKJ E;  1XMO E;  4ZVI A;  2KOU A;  4AQY E;  1Z0C A;  2PNL A;  4DU7 A;  1ZM4 A;  3JU0 A;  4DV7 E;  4DV4 E;  2M4I A;  1IBK E;  3V2U C;  3M6A A;  2A2D A;  1RC7 A;  3LNU A;  3OML A;  2V88 A;  2O1T A;  1ZM2 A;  3GON A;  4Z7C A;  4JI4 E;  2RS6 A;  4LF5 E;  4KZS A;  2JR1 A;  4BS9 A;  1N36 I;  1OJ4 A;  2V83 A;  2N3H A;  2L8T A;  2VE7 C;  2UUA E;  5FLX Q;  3T1Y I;  1KKH A;  4I3H A;  1IBM E;  1RR9 A;  4KQV A;  4X62 E;  1WHQ A;  1KVK A;  3ZKD A;  1DI2 A;  4X65 E;  4NXN E;  1NHH A;  5A2Q C;  2O1W A;  4DV3 I;  1S4E A;  3RMP A;  4F9C B;  4LF8 E;  5T6J A;  4LF7 E;  4LF9 E;  1SR9 A;  1FI4 A;  1Y4S A;  3P06 A;  4B3T I;  4JI7 I;  4DR6 I;  2NA2 A;  4JI0 E;  4B3R E;  4LFA E;  1N0V C;  4BC7 A;  1FJG I;  2HFS A;  4LF4 I;  2UXD I;  5GME A;  4B3S E;  4HYM A;  4BBY A;  3Q6M A;  2DB2 A;  4B3M I;  4DR2 I;  4IZJ A;  4JI5 I;  4OOG C;  1FWL A;  3HQ1 A;  3ZZ0 A;  1B62 A;  4JV5 I;  2M1S A;  5AE1 A;  1PIE A;  1ZM3 A;  3D4J A;  2L92 A;  4DR3 E;  1NZ0 A;  4DR1 I;  1HR0 I;  4WUD A;  4X66 E;  4DV6 E;  1RRE A;  4MYT A;  3PYE A;  3OTO I;  4HAC B;  2EZ6 A;  4DU8 A;  4JI2 I;  3HUL A;  2UUB E;  3J80 C;  2YZT A;  2V2Z A;  2ODR D;  2WW4 A;  4YHH I;  2RSM A;  2OI2 A;  3JAM Q;  4M0V A;  1YYO A;  3DJW A;  1FNM A;  2ZM6 E;  2GS8 A;  4LFB E;  4WSP A;  4DR4 E;  4DPT A;  1HNW I;  3IWC A;  4FWD A;  2PNM A;  3J81 Q;  3ADJ A;  3K85 A;  2HFU A;  4DR7 I;  4YY3 I;  2NUF A;  2X36 A;  2VQF I;  3C4T A;  2LTS A;  5IWA E;  3AV0 A;  2K4V A;  1XHK A;  1IBL I;  2LRS A;  1HNZ I;  5BR8 I;  4M2Z A;  1HNX E;  1H74 A;  4P52 A;  4IZJ D;  4JG4 A;  1ZXN A;  2GQ0 A;  3VYY A;  4IZK A;  4LTY A;  2BM1 A;  2WZO A;  4X64 I;  2L2N A;  4BC9 A;  1EKZ A;  3T1H I;  4DPY A;  3K1J A;  2V2Q A;  1YYK A;  1N33 I;  3ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...