4DR2I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr2I00
4DR6I 4X66I 3PYDA 4HYMA 4X62E 1EI1A 2HKJA 3H4LA 4DV7E 1KIJA 4JI3I 4DR3E 3HULA 4USKA 4YY3I 1HR0E 1RR9A 1N32I 4HACB 4P52A 4MYUA 2EFGA 5IT9C 2VF3A 4R1FA 2UXDE 3J80Q 3WU4A 3QT8A 3ZKDA 4LFCE 2V8PA 4UTGA 1ELOA 5LMNI 3ZKBA 4M1KA 4LF5E 1I94I 2E1RA 3ZZ0A 2UXCI 2DEIA 1KKHA 4FWHA 4DV2E 4YHHI 2CZ9A 3JAMC 4DUZE 1K47A 4KHPE 1HNXI 2UUAI 4DPUA 1XNRI 5GMDA 1ZXMA 3OTOI 4DV0E 4JI8I 3B82A 1VISA 4DV5I 5LMUI 2UUCE 4JV5I 1FNMA 4LF9I 4X65I 3PYFA 1ZM3A 4B3SE 4PRVA 1Z0BA 1DARA 4OX9I 1HNWE 4DV6I 1J5EE 4JYAI 1N34E 4HACA 2V34A 4USMA 5BR8E 4LF7I 2XEXA 3WU3A 4JI6I 1IBLE 1PVGA 1N0VC 2E5LE 2J7KA 1NHHA 5LL6R 2UUBE 1IBKI 1D6TA 1ZM9A 3ZZUA 1XMOE 4B3MI 4JI1I 1FI4A 4ZVIA 1NHIA 4PU9A 4DU8A 4LF6I 1H7SA 1KVKA 1FJGI 2ZM6I 1FWKA 2VQFE 4AQYE 4X64E 1XHKA 1UEKA 4NXME 4FW9A 2BV3A 3B78A 5IT9Q 4DR1I 4DV4E 4K0KE 2UXBI 4KQVA 1N36E 2HHHE 3LPSA 4LFAI 5L3JA 3T1HI 3WU5A 4GKJI 1MX0A 3J7AM 3T1YE 2F4VE 1WUUA 1Z5BA 4DXLA 1U2RA 5FLXC 1XNQI 4JI7E 3M6AA 4DV3E 1XMQE 4X62I 5IWAE 4LFBE 4JG4A 4DV7I 3JAMQ 4DU7A 4DR3I 1FWLA 1Z0CA 4WUCA 4NXNE 3ZM7A 1MG7A 1HR0I 4JI0E 1Z59A 1HNZE 3Q1QA 1H7UA 3CWVA 2UXDI 2V2ZA 3LTOA 3J80C 2HK3A 4DV1E 3PYEA 2NPFA 4LFCI 1S16A 4I3HA 4B3TE 4DPTA 4Z7YA 4LF8E 4DR7E 4JI5E 2Q2EB 4DPXA 4LF5I 4JI2E 4DR5E 2VQEE 4DV2I 5A2QC 1IBME 3QT6A 3ZZTA 4DPWA 1ZM4A 4DUZI 4KHPI 4WUDA 2UU9E 1H74A 4LF4E 4DV0I 2X7IA 4DR2E 1Z5AA 1A6FA 2HK2A 1OJ4A 4JI4E 4DUYE 1H73A 4DR4E 3K1JA 1B63A 4GKKE 2UUCI 4B3RE 2BM1A 1N33E 4WUBA 2ZITA 4FWGA 2R42A 4DR6E 4B3SI 4X66E 3F0NA 4HY1A 3B8HA 4EMDA 1HNWI 1MU5A 4JI3E 1J5EI 1N34I 4YY3E 3K17A 2OI2A 5BR8I 1N32E 3J7AG 1IBLI 1Z0TA 4PRXA 1BKNA 3QT5A 4RPFA 1ZXNA 2R3VA 2E5LI 5GMEA 3V2UC 3WU6A 4UT4A 4URLA 2BM0A 2UUBI 1FKAE 5FLXQ 2LJPA 1XMOI 3J81C 1H72C 1PKPA 5LMNE 1Z0VA 2HFUA 3V5RA 2X36A 1I94E 2VQFI 4AQYI 2UXCE 4X64I 4Z7CA 4YHHE 4NXMI 1ZM2A 2V2VA 1HNXE 4DV4I 2UUAE 2WW4A 4K0KI 1XNRE 4P7AA 2V2QA 2A2DA 3OTOE 1N36I 2HHHI 4JI8E 4DV5E 5LMUE 3T1YI 4JV5E 4LF9E 1Z5CA 2F4VI 4X65E 1Z0EA 3LNUA 4JI7I 4OX9E 4DV6E 4MYTA 4DV3I 1XMQI 4JYAE 5IWAI 2HKEA 5A2QQ 4ED4A 4LFBI 4LF7E 2A2CA 1QZRA 2GS8A 4FWDA 4JI6E 4NXNI 4HXZA 2DEJA 1S4EA 4JI0I 1HNZI 4DPYA 4FN5A 1KTVA 1Z0GA 3D4JA 4XTJA 1NHJA 1IBKE 4DV1I 3QT7A 4B3ME 4JI1E 4B3TI 4LF6E 2ZBKB 3PYGA 1FJGE 1N0UA 4LF8I 4DR7I 2ZM6E 4JI5I 1B62A 1PIEA 4JI2I 4DR5I 1EA6A 2VQEI 4DR1E 1IBMI 2UXBE 2UU9I 2HFSA 4LFAE 1RREA 4LF4I 3T1HE 4GKJE 4DR2I 3J81Q 3GONA 4JI4I 4DUYI 4DR4I 4GKKI 4B3RI 1N33I 2AJ4A 1Z0WA 1XNQE 1NZ0A
chains in the Genus database with same CATH superfamily
4DR6I 4X66I 3PYDA 4HYMA 4X62E 1EI1A 2HKJA 3Q6NA 3H4LA 4DV7E 1KIJA 4JI3I 2IERA 4DR3E 3HULA 4USKA 4YY3I 1XXEA 1HR0E 1RR9A 1N32I 2F1DA 4HACB 4P52A 4MYUA 4BA1B 2EFGA 5IT9C 2VF3A 4R1FA 2JEBA 2UXDE 3J80Q 2GO3A 2JE6A 3QT8A 3WU4A 2NN6D 3H1CA 3CDJA 3ZKDA 1Y6ZA 5C0XA 4LFCE 2V8PA 1HK7A 5DROA 4UTGA 4AIMA 4FW3A 1ELOA 5LMNI 2O1UA 3ZKBA 4M1KA 4LF5E 1VI7A 1Y4UA 1I94I 2E1RA 3ZZ0A 2UXCI 4NBQA 2DEIA 5K36D 1KKHA 4FWHA 4DV2E 2WNRA 3GMEA 4YHHI 2CZ9A 3CDIA 3JAMC 4DUZE 1K47A 4KHPE 1HNXI 3B4TA 4BA2A 2UUAI 4DPUA 1XNRI 4OO1D 5GMDA 1ZXMA 2NN6E 3OTOI 4DV0E 2JEAB 4JI8I 1YH8A 2CGEA 3B82A 1VISA 4DV5I 5LMUI 2UUCE 2JEBB 4JV5I 1UDOA 1FNMA 4LF9I 5EL9A 2O1WA 2BA0G 4X65I 3PYFA 4LCFA 1ZM3A 4B3SE 2O3ZA 4PRVA 1Z0BA 1DARA 4LCHA 4OX9I 1HNWE 4DV6I 2PO2B 1J5EE 4JYAI 1N34E 5K36A 4HACA 1UDSA 2V34A 4USMA 5BR8E 1R6LA 4LF7I 2XEXA 3WU3A 4IFDF 4JI6I 1IBLE 2WP8B 2Z5EA 3L7ZA 3Q6MA 2GO4A 4OO1A 1PVGA 1N0VC 2C38B 2E5LE 2J7KA 1NHHA 2WNRB 4OZEA 5JEAF 3GCMA 5C0XF 5LL6R 1P42A 2UUBE 4BA2B 1IBKI 2Z5BA 1D6TA 1ZM9A 3M85D 3ZZUA 1XMOE 4J3DA 4B3MI 4JI1I 1FI4A 4ZVIA 1NHIA 4PU9A 4DU8A 2BA1D 4LF6I 1H7SA 4LPFA 1KVKA 2NN6B 1FJGI 2ZM6I 1FWKA 2VQFE 4AQYE 5ELWA 4X64E 1XHKA 1UEKA 5DRQA 4NXME 3HKMA 4FW9A 2BV3A 3B78A 4MU1A 5IT9Q 4DR1I 4DV4E 4K0KE 4OKGA 2JEAA 2UXBI 4MU0A 4KQVA 5K36B 3M7ND 1N36E 2HHHE 3LPSA 4LFAI 3NZKA 5L3JA 3T1HI 2JT2A 2PO0A 3WU5A 4GKJI 3L7ZB 1MX0A 3J7AM 4OO1B 3T1YE 2F4VE 1WUUA 1Z5BA 4DXLA 2PO2A 2PNLA 1U2RA 5FLXC 1E3HA 1XNQI 4JI7E 3M6AA 4DV3E 1XMQE 4X62I 5IWAE 2Z5BB 2O1TA 4LFBE 2WP8A 4JG4A 4DV7I 3JAMQ 4DU7A 4DR3I 1FWLA 1Z0CA 5DNXA 4WUCA 4NXNE 2PNZA 3ZM7A 1MG7A 2C38A 1HR0I 4JI0E 1Z59A 1HNZE 5DRPA 3Q1QA 1H7UA 3CWVA 2UXDI 1UDQA 2V2ZA 4MU3A 3LTOA 3J80C 2HK3A 4DV1E 5FWKA 3PYEA 2NPFA 2NN6A 1S16A 4LFCI 2O1VA 4I3HA 4B3TE 4DPTA 1R6MA 4Z7YA 4LF8E 3PS3A 4DR7E 2PO0B 4JI5E 2Q2EB 5EKWA 4DPXA 4LF5I 3P76A 4JI2E 4DR5E 2J65A 4FW6A 2VQEE 4U3DA 4DV2I 5A2QC 1IBME 3QT6A 3ZZTA 4DPWA 1ZM4A 4DUZI 4KHPI 4WUDA 2UU9E 4FW4A 1OYPA 1H74A 2Z5CA 4IFDC 4LF4E 2IOQA 4QNJA 4DV0I 3P06A 2X7IA 2PNZB 1RHYA 4DR2E 3PS2A 1Z5AA 4ISAA 1A6FA 2HK2A 1OJ4A 4JI4E 4DUYE 1H73A 1OYSA 4DR4E 3K1JA 1B63A 1Y5YA 5JEAC 4GKKE 2UUCI 4B3RE 3P3EA 5C0XC 2BM1A 1N33E 3P3GA 4WUBA 2ZITA 4FWGA 1UDNA 2R42A 4DR6E 4B3SI 4X66E 2IESA 3F0NA 3DD6A 3B8HA 4HY1A 4EMDA 4AM3A 2C37B 1HNWI 1MU5A 5DRRA 4JI3E 3P3CA 1J5EI 1N34I 4YY3E 1USVA 3K17A 2C39A 2OI2A 4FW5A 5BR8I 1N32E 3J7AG 4IFDD 1IBLI 1Z0TA 4PRXA 1BKNA 3QT5A 4RPFA 1ZXNA 4FW7A 2R3VA 5JEAD 2E5LI 5C0XD 5GMEA 3V2UC 3WU6A 2VESA 4URLA 4UT4A 3HJCA 2NN6F 2BM0A 2UUBI 1FKAE 2IOPA 4LCGA 2LJPA 1YHCA 5FLXQ 2Z5CB 4QNKA 3U1YA 4AIDA 3J81C 1XMOI 1H72C 1PKPA 5LMNE 1Z0VA 2HFUA 2BA0D 3V5RA 2X36A 1I94E 2VQFI 4AQYI 3PRYA 2UXCE 4X64I 3PS1A 4IFDE 4Z7CA 4LOMA 4YHHE 5K36F 4IFDA 4NXMI 5K36C 3U1KA 1ZM2A 2V2VA 1HNXE 4DV4I 2UUAE 5DNLA 2WW4A 4K0KI 1XNRE 4P7AA 5JEAE 2V2QA 2A2DA 4OO1F 2BR2B 5JEAA 5C0XE 4OO1C 3OTOE 3K85A 1N36I 2HHHI 2PO1A 4IZJD 2C39B 4JI8E 4DV5E 5LMUE 3M85G 4U3BA 3T1YI 4JV5E 4IS9A 4LF9E 2BA1G 1Z5CA 3UHMA 2F4VI 2C37A 4X65E 1Z0EA 2AE8A 4MU4A 3LNUA 4JI7I 4OX9E 4DV6E 4MYTA 4DV3I 1XMQI 4JYAE 1USUA 5IWAI 2HKEA 5A2QQ 4ED4A 4LFBI 4MDTA 4LF7E 2A2CA 1QZRA 2GS8A 4FWDA 2CVEA 4JI6E 4NXNI 4HXZA 2DEJA 1S4EA 4JI0I 3M7NG 4IZKA 1Y4SA 4MQYA 1HNZI 4DPYA 4IZJA 4FN5A 1KTVA 1Z0GA 3D4JA 4IFDB 2CG9A 4XTJA 1NHJA 1IBKE 4DV1I 3QT7A 3GLLA 4B3ME 2JE6B 4JI1E 4B3TI 1E3PA 5JEAB 4GQUA 4LF6E 2PO1B 5K36E 2ZBKB 3PYGA 3KRNA 5C0XB 1FJGE 1N0UA 4LF8I 4DR7I 2ZM6E 4JI5I 1B62A 1PIEA 4BA1A 4JI2I 4DR5I 4OO1E 1EA6A 2VQEI 4DR1E 1IBMI 2BR2A 2UXBE 2UU9I 2HFSA 4LFAE 1RREA 4LF4I 1Y60A 3T1HE 4GKJE 4DR2I 3J81Q 3GONA 4JI4I 4IZKB 2PNMA 4DUYI 4N3OA 4DR4I 4GKKI 4IZJB 4B3RI 2NN6C 2GQ0A 2AJ4A 1N33I 1Z0WA 1XNQE 1OYRA 1NZ0A
chains in the Genus database with same CATH topology
4DR6I 4X66I 3PYDA 4HYMA 4X62E 1EI1A 2HKJA 3Q6NA 3H4LA 4DV7E 1KIJA 4JI3I 4DR3E 3HULA 4USKA 4YY3I 1HR0E 1RR9A 1N32I 4HACB 4P52A 4MYUA 2EFGA 5IT9C 2VF3A 4R1FA 2UXDE 3J80Q 3WU4A 3QT8A 3ZKDA 1Y6ZA 4LFCE 2V8PA 1HK7A 4UTGA 1ELOA 5LMNI 2O1UA 3ZKBA 4M1KA 4LF5E 1Y4UA 1I94I 2E1RA 3ZZ0A 2UXCI 2DEIA 1KKHA 4FWHA 4DV2E 4YHHI 2CZ9A 3JAMC 4DUZE 1K47A 4KHPE 1HNXI 2UUAI 4DPUA 1XNRI 5GMDA 1ZXMA 3OTOI 4DV0E 4JI8I 2CGEA 3B82A 1VISA 4DV5I 5LMUI 2UUCE 4JV5I 1FNMA 4LF9I 2O1WA 4X65I 3PYFA 1ZM3A 4B3SE 4PRVA 1Z0BA 1DARA 4OX9I 1HNWE 4DV6I 1J5EE 4JYAI 1N34E 4HACA 2V34A 4USMA 5BR8E 4LF7I 2XEXA 3WU3A 4JI6I 1IBLE 2Z5EA 3Q6MA 1PVGA 1N0VC 2E5LE 2J7KA 1NHHA 5LL6R 2UUBE 1IBKI 2Z5BA 1D6TA 1ZM9A 3ZZUA 1XMOE 4B3MI 4JI1I 1FI4A 4ZVIA 1NHIA 4PU9A 4DU8A 4LF6I 1H7SA 1KVKA 1FJGI 2ZM6I 1FWKA 2VQFE 4AQYE 4X64E 1XHKA 1UEKA 4NXME 4FW9A 2BV3A 3B78A 5IT9Q 4DR1I 4DV4E 4K0KE 2UXBI 4KQVA 1N36E 2HHHE 3LPSA 4LFAI 5L3JA 3T1HI 3WU5A 4GKJI 1MX0A 3J7AM 3T1YE 2F4VE 1WUUA 1Z5BA 4DXLA 2PNLA 1U2RA 5FLXC 1XNQI 4JI7E 3M6AA 4DV3E 1XMQE 4X62I 5IWAE 2Z5BB 2O1TA 4LFBE 4JG4A 4DV7I 3JAMQ 4DU7A 4DR3I 1FWLA 1Z0CA 4WUCA 4NXNE 3ZM7A 1MG7A 1HR0I 4JI0E 1Z59A 1HNZE 3Q1QA 1H7UA 3CWVA 2UXDI 2V2ZA 3LTOA 3J80C 2HK3A 4DV1E 5FWKA 3PYEA 2NPFA 4LFCI 1S16A 4I3HA 2O1VA 4B3TE 4DPTA 4Z7YA 4LF8E 4DR7E 4JI5E 2Q2EB 4DPXA 4LF5I 4JI2E 4DR5E 2VQEE 4DV2I 5A2QC 1IBME 3QT6A 3ZZTA 4DPWA 1ZM4A 4DUZI 4KHPI 4WUDA 2UU9E 1H74A 2Z5CA 4LF4E 2IOQA 4DV0I 3P06A 2X7IA 4DR2E 1Z5AA 1A6FA 2HK2A 1OJ4A 4JI4E 4DUYE 1H73A 4DR4E 3K1JA 1B63A 4GKKE 2UUCI 4B3RE 2BM1A 1N33E 4WUBA 2ZITA 4FWGA 2R42A 4DR6E 4B3SI 4X66E 3F0NA 4HY1A 3B8HA 4EMDA 1HNWI 1MU5A 4JI3E 1J5EI 1N34I 4YY3E 1USVA 3K17A 2OI2A 5BR8I 1N32E 3J7AG 1IBLI 1Z0TA 4PRXA 1BKNA 3QT5A 4RPFA 1ZXNA 2R3VA 2E5LI 5GMEA 3V2UC 3WU6A 4UT4A 4URLA 3HJCA 2BM0A 2UUBI 1FKAE 2IOPA 5FLXQ 2LJPA 2Z5CB 1XMOI 3J81C 1H72C 1PKPA 5LMNE 1Z0VA 2HFUA 3V5RA 2X36A 1I94E 2VQFI 4AQYI 3PRYA 2UXCE 4X64I 4Z7CA 4YHHE 4NXMI 1ZM2A 2V2VA 1HNXE 4DV4I 2UUAE 2WW4A 4K0KI 1XNRE 4P7AA 2V2QA 2A2DA 3OTOE 3K85A 1N36I 2HHHI 4IZJD 4JI8E 4DV5E 5LMUE 3T1YI 4JV5E 4LF9E 1Z5CA 2F4VI 4X65E 1Z0EA 3LNUA 4JI7I 4OX9E 4DV6E 4MYTA 4DV3I 1XMQI 4JYAE 1USUA 5IWAI 2HKEA 5A2QQ 4ED4A 4LFBI 4LF7E 2A2CA 1QZRA 2GS8A 4FWDA 4JI6E 4NXNI 4HXZA 2DEJA 1S4EA 4JI0I 4IZKA 1Y4SA 1HNZI 4DPYA 4IZJA 4FN5A 1KTVA 1Z0GA 3D4JA 2CG9A 4XTJA 1NHJA 1IBKE 4DV1I 3QT7A 4B3ME 4JI1E 4B3TI 4LF6E 2ZBKB 3PYGA 1FJGE 1N0UA 4LF8I 4DR7I 2ZM6E 4JI5I 1B62A 1PIEA 4JI2I 4DR5I 1EA6A 2VQEI 4DR1E 1IBMI 2UXBE 2UU9I 2HFSA 4LFAE 1RREA 4LF4I 3T1HE 4GKJE 4DR2I 3J81Q 3GONA 4JI4I 4IZKB 2PNMA 4DUYI 4N3OA 4DR4I 4GKKI 4IZJB 4B3RI 2GQ0A 2AJ4A 1N33I 1Z0WA 1XNQE 1NZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 I;  4X66 I;  3PYD A;  4HYM A;  4X62 E;  1EI1 A;  2HKJ A;  3H4L A;  4DV7 E;  1KIJ A;  4JI3 I;  4DR3 E;  3HUL A;  4USK A;  4YY3 I;  1HR0 E;  1RR9 A;  1N32 I;  4HAC B;  4P52 A;  4MYU A;  2EFG A;  5IT9 C;  2VF3 A;  4R1F A;  2UXD E;  3J80 Q;  3WU4 A;  3QT8 A;  3ZKD A;  4LFC E;  2V8P A;  4UTG A;  1ELO A;  5LMN I;  3ZKB A;  4M1K A;  4LF5 E;  1I94 I;  2E1R A;  3ZZ0 A;  2UXC I;  2DEI A;  1KKH A;  4FWH A;  4DV2 E;  4YHH I;  2CZ9 A;  3JAM C;  4DUZ E;  1K47 A;  4KHP E;  1HNX I;  2UUA I;  4DPU A;  1XNR I;  5GMD A;  1ZXM A;  3OTO I;  4DV0 E;  4JI8 I;  3B82 A;  1VIS A;  4DV5 I;  5LMU I;  2UUC E;  4JV5 I;  1FNM A;  4LF9 I;  4X65 I;  3PYF A;  1ZM3 A;  4B3S E;  4PRV A;  1Z0B A;  1DAR A;  4OX9 I;  1HNW E;  4DV6 I;  1J5E E;  4JYA I;  1N34 E;  4HAC A;  2V34 A;  4USM A;  5BR8 E;  4LF7 I;  2XEX A;  3WU3 A;  4JI6 I;  1IBL E;  1PVG A;  1N0V C;  2E5L E;  2J7K A;  1NHH A;  5LL6 R;  2UUB E;  1IBK I;  1D6T A;  1ZM9 A;  3ZZU A;  1XMO E;  4B3M I;  4JI1 I;  1FI4 A;  4ZVI A;  1NHI A;  4PU9 A;  4DU8 A;  4LF6 I;  1H7S A;  1KVK A;  1FJG I;  2ZM6 I;  1FWK A;  2VQF E;  4AQY E;  4X64 E;  1XHK A;  1UEK A;  4NXM E;  4FW9 A;  2BV3 A;  3B78 A;  5IT9 Q;  4DR1 I;  4DV4 E;  4K0K E;  2UXB I;  4KQV A;  1N36 E;  2HHH E;  3LPS A;  4LFA I;  5L3J A;  3T1H I;  3WU5 A;  4GKJ I;  1MX0 A;  3J7A M;  3T1Y E;  2F4V E;  1WUU A;  1Z5B A;  4DXL A;  1U2R A;  5FLX C;  1XNQ I;  4JI7 E;  3M6A A;  4DV3 E;  1XMQ E;  4X62 I;  5IWA E;  4LFB E;  4JG4 A;  4DV7 I;  3JAM Q;  4DU7 A;  4DR3 I;  1FWL A;  1Z0C A;  4WUC A;  4NXN E;  3ZM7 A;  1MG7 A;  1HR0 I;  4JI0 E;  1Z59 A;  1HNZ E;  3Q1Q A;  1H7U A;  3CWV A;  2UXD I;  2V2Z A;  3LTO A;  3J80 C;  2HK3 A;  4DV1 E;  3PYE A;  2NPF A;  4LFC I;  1S16 A;  4I3H A;  4B3T E;  4DPT A;  4Z7Y A;  4LF8 E;  4DR7 E;  4JI5 E;  2Q2E B;  4DPX A;  4LF5 I;  4JI2 E;  4DR5 E;  2VQE E;  4DV2 I;  5A2Q C;  1IBM E;  3QT6 A;  3ZZT A;  4DPW A;  1ZM4 A;  4DUZ I;  4KHP I;  4WUD A;  2UU9 E;  1H74 A;  4LF4 E;  4DV0 I;  2X7I A;  4DR2 E;  1Z5A A;  1A6F A;  2HK2 A;  1OJ4 A;  4JI4 E;  4DUY E;  1H73 A;  4DR4 E;  3K1J A;  1B63 A;  4GKK E;  2UUC I;  4B3R E;  2BM1 A;  1N33 E;  4WUB A;  2ZIT A;  4FWG A;  2R42 A;  4DR6 E;  4B3S I;  4X66 E;  3F0N A;  4HY1 A;  3B8H A;  4EMD A;  1HNW I;  1MU5 A;  4JI3 E;  1J5E I;  1N34 I;  4YY3 E;  3K17 A;  2OI2 A;  5BR8 I;  1N32 E;  3J7A G;  1IBL I;  1Z0T A;  4PRX A;  1BKN A;  3QT5 A;  4RPF A;  1ZXN A;  2R3V A;  2E5L I;  5GME A;  3V2U C;  3WU6 A;  4UT4 A;  4URL A;  2BM0 A;  2UUB I;  1FKA E;  5FLX Q;  2LJP A;  1XMO I;  3J81 C;  1H72 C;  1PKP A;  5LMN E;  1Z0V A;  2HFU A;  3V5R A;  2X36 A;  1I94 E;  2VQF I;  4AQY I;  2UXC E;  4X64 I;  4Z7C A;  4YHH E;  4NXM I;  1ZM2 A;  2V2V A;  1HNX E;  4DV4 I;  2UUA E;  2WW4 A;  4K0K I;  1XNR E;  4P7A A;  2V2Q A;  2A2D A;  3OTO E;  1N36 I;  2HHH I;  4JI8 E;  4DV5 E;  5LMU E;  3T1Y I;  4JV5 E;  4LF9 E;  1Z5C A;  2F4V I;  4X65 E;  1Z0E A;  3LNU A;  4JI7 I;  4OX9 E;  4DV6 E;  4MYT A;  4DV3 I;  1XMQ I;  4JYA E;  5IWA I;  2HKE A;  5A2Q Q;  4ED4 A;  4LFB I;  4LF7 E;  2A2C A;  1QZR A;  2GS8 A;  4FWD A;  4JI6 E;  4NXN I;  4HXZ A;  2DEJ A;  1S4E A;  4JI0 I;  1HNZ I;  4DPY A;  4FN5 A;  1KTV A;  1Z0G A;  3D4J A;  4XTJ A;  1NHJ A;  1IBK E;  4DV1 I;  3QT7 A;  4B3M E;  4JI1 E;  4B3T I;  4LF6 E;  2ZBK B;  3PYG A;  1FJG E;  1N0U A;  4LF8 I;  4DR7 I;  2ZM6 E;  4JI5 I;  1B62 A;  1PIE A;  4JI2 I;  4DR5 I;  1EA6 A;  2VQE I;  4DR1 E;  1IBM I;  2UXB E;  2UU9 I;  2HFS A;  4LFA E;  1RRE A;  4LF4 I;  3T1H E;  4GKJ E;  4DR2 I;  3J81 Q;  3GON A;  4JI4 I;  4DUY I;  4DR4 I;  4GKK I;  4B3R I;  1N33 I;  2AJ4 A;  1Z0W A;  1XNQ E;  1NZ0 A; 
#chains in the Genus database with same CATH topology
 4DR6 I;  4X66 I;  3PYD A;  4HYM A;  4X62 E;  1EI1 A;  2HKJ A;  3Q6N A;  3H4L A;  4DV7 E;  1KIJ A;  4JI3 I;  2IER A;  4DR3 E;  3HUL A;  4USK A;  4YY3 I;  1XXE A;  1HR0 E;  1RR9 A;  1N32 I;  2F1D A;  4HAC B;  4P52 A;  4MYU A;  4BA1 B;  2EFG A;  5IT9 C;  2VF3 A;  4R1F A;  2JEB A;  2UXD E;  3J80 Q;  2GO3 A;  2JE6 A;  3QT8 A;  3WU4 A;  2NN6 D;  3H1C A;  3CDJ A;  3ZKD A;  1Y6Z A;  5C0X A;  4LFC E;  2V8P A;  1HK7 A;  5DRO A;  4UTG A;  4AIM A;  4FW3 A;  1ELO A;  5LMN I;  2O1U A;  3ZKB A;  4M1K A;  4LF5 E;  1VI7 A;  1Y4U A;  1I94 I;  2E1R A;  3ZZ0 A;  2UXC I;  4NBQ A;  2DEI A;  5K36 D;  1KKH A;  4FWH A;  4DV2 E;  2WNR A;  3GME A;  4YHH I;  2CZ9 A;  3CDI A;  3JAM C;  4DUZ E;  1K47 A;  4KHP E;  1HNX I;  3B4T A;  4BA2 A;  2UUA I;  4DPU A;  1XNR I;  4OO1 D;  5GMD A;  1ZXM A;  2NN6 E;  3OTO I;  4DV0 E;  2JEA B;  4JI8 I;  1YH8 A;  2CGE A;  3B82 A;  1VIS A;  4DV5 I;  5LMU I;  2UUC E;  2JEB B;  4JV5 I;  1UDO A;  1FNM A;  4LF9 I;  5EL9 A;  2O1W A;  2BA0 G;  4X65 I;  3PYF A;  4LCF A;  1ZM3 A;  4B3S E;  2O3Z A;  4PRV A;  1Z0B A;  1DAR A;  4LCH A;  4OX9 I;  1HNW E;  4DV6 I;  2PO2 B;  1J5E E;  4JYA I;  1N34 E;  5K36 A;  4HAC A;  1UDS A;  2V34 A;  4USM A;  5BR8 E;  1R6L A;  4LF7 I;  2XEX A;  3WU3 A;  4IFD F;  4JI6 I;  1IBL E;  2WP8 B;  2Z5E A;  3L7Z A;  3Q6M A;  2GO4 A;  4OO1 A;  1PVG A;  1N0V C;  2C38 B;  2E5L E;  2J7K A;  1NHH A;  2WNR B;  4OZE A;  5JEA F;  3GCM A;  5C0X F;  5LL6 R;  1P42 A;  2UUB E;  4BA2 B;  1IBK I;  2Z5B A;  1D6T A;  1ZM9 A;  3M85 D;  3ZZU A;  1XMO E;  4J3D A;  4B3M I;  4JI1 I;  1FI4 A;  4ZVI A;  1NHI A;  4PU9 A;  4DU8 A;  2BA1 D;  4LF6 I;  1H7S A;  4LPF A;  1KVK A;  2NN6 B;  1FJG I;  2ZM6 I;  1FWK A;  2VQF E;  4AQY E;  5ELW A;  4X64 E;  1XHK A;  1UEK A;  5DRQ A;  4NXM E;  3HKM A;  4FW9 A;  2BV3 A;  3B78 A;  4MU1 A;  5IT9 Q;  4DR1 I;  4DV4 E;  4K0K E;  4OKG A;  2JEA A;  2UXB I;  4MU0 A;  4KQV A;  5K36 B;  3M7N D;  1N36 E;  2HHH E;  3LPS A;  4LFA I;  3NZK A;  5L3J A;  3T1H I;  2JT2 A;  2PO0 A;  3WU5 A;  4GKJ I;  3L7Z B;  1MX0 A;  3J7A M;  4OO1 B;  3T1Y E;  2F4V E;  1WUU A;  1Z5B A;  4DXL A;  2PO2 A;  2PNL A;  1U2R A;  5FLX C;  1E3H A;  1XNQ I;  4JI7 E;  3M6A A;  4DV3 E;  1XMQ E;  4X62 I;  5IWA E;  2Z5B B;  2O1T A;  4LFB E;  2WP8 A;  4JG4 A;  4DV7 I;  3JAM Q;  4DU7 A;  4DR3 I;  1FWL A;  1Z0C A;  5DNX A;  4WUC A;  4NXN E;  2PNZ A;  3ZM7 A;  1MG7 A;  2C38 A;  1HR0 I;  4JI0 E;  1Z59 A;  1HNZ E;  5DRP A;  3Q1Q A;  1H7U A;  3CWV A;  2UXD I;  1UDQ A;  2V2Z A;  4MU3 A;  3LTO A;  3J80 C;  2HK3 A;  4DV1 E;  5FWK A;  3PYE A;  2NPF A;  2NN6 A;  1S16 A;  4LFC I;  2O1V A;  4I3H A;  4B3T E;  4DPT A;  1R6M A;  4Z7Y A;  4LF8 E;  3PS3 A;  4DR7 E;  2PO0 B;  4JI5 E;  2Q2E B;  5EKW A;  4DPX A;  4LF5 I;  3P76 A;  4JI2 E;  4DR5 E;  2J65 A;  4FW6 A;  2VQE E;  4U3D A;  4DV2 I;  5A2Q C;  1IBM E;  3QT6 A;  3ZZT A;  4DPW A;  1ZM4 A;  4DUZ I;  4KHP I;  4WUD A;  2UU9 E;  4FW4 A;  1OYP A;  1H74 A;  2Z5C A;  4IFD C;  4LF4 E;  2IOQ A;  4QNJ A;  4DV0 I;  3P06 A;  2X7I A;  2PNZ B;  1RHY A;  4DR2 E;  3PS2 A;  1Z5A A;  4ISA A;  1A6F A;  2HK2 A;  1OJ4 A;  4JI4 E;  4DUY E;  1H73 A;  1OYS A;  4DR4 E;  3K1J A;  1B63 A;  1Y5Y A;  5JEA C;  4GKK E;  2UUC I;  4B3R E;  3P3E A;  5C0X C;  2BM1 A;  1N33 E;  3P3G A;  4WUB A;  2ZIT A;  4FWG A;  1UDN A;  2R42 A;  4DR6 E;  4B3S I;  4X66 E;  2IES A;  3F0N A;  3DD6 A;  3B8H A;  4HY1 A;  4EMD A;  4AM3 A;  2C37 B;  1HNW I;  1MU5 A;  5DRR A;  4JI3 E;  3P3C A;  1J5E I;  1N34 I;  4YY3 E;  1USV A;  3K17 A;  2C39 A;  2OI2 A;  4FW5 A;  5BR8 I;  1N32 E;  3J7A G;  4IFD D;  1IBL I;  1Z0T A;  4PRX A;  1BKN A;  3QT5 A;  4RPF A;  1ZXN A;  4FW7 A;  2R3V A;  5JEA D;  2E5L I;  5C0X D;  5GME A;  3V2U C;  3WU6 A;  2VES A;  4URL A;  4UT4 A;  3HJC A;  2NN6 F;  2BM0 A;  2UUB I;  1FKA E;  2IOP A;  4LCG A;  2LJP A;  1YHC A;  5FLX Q;  2Z5C B;  4QNK A;  3U1Y A;  4AID A;  3J81 C;  1XMO I;  1H72 C;  1PKP A;  5LMN E;  1Z0V A;  2HFU A;  2BA0 D;  3V5R A;  2X36 A;  1I94 E;  2VQF I;  4AQY I;  3PRY A;  2UXC E;  4X64 I;  3PS1 A;  4IFD E;  4Z7C A;  4LOM A;  4YHH E;  5K36 F;  4IFD A;  4NXM I;  5K36 C;  3U1K A;  1ZM2 A;  2V2V A;  1HNX E;  4DV4 I;  2UUA E;  5DNL A;  2WW4 A;  4K0K I;  1XNR E;  4P7A A;  5JEA E;  2V2Q A;  2A2D A;  4OO1 F;  2BR2 B;  5JEA A;  5C0X E;  4OO1 C;  3OTO E;  3K85 A;  1N36 I;  2HHH I;  2PO1 A;  4IZJ D;  2C39 B;  4JI8 E;  4DV5 E;  5LMU E;  3M85 G;  4U3B A;  3T1Y I;  4JV5 E;  4IS9 A;  4LF9 E;  2BA1 G;  1Z5C A;  3UHM A;  2F4V I;  2C37 A;  4X65 E;  1Z0E A;  2AE8 A;  4MU4 A;  3LNU A;  4JI7 I;  4OX9 E;  4DV6 E;  4MYT A;  4DV3 I;  1XMQ I;  4JYA E;  1USU A;  5IWA I;  2HKE A;  5A2Q Q;  4ED4 A;  4LFB I;  4MDT A;  4LF7 E;  2A2C A;  1QZR A;  2GS8 A;  4FWD A;  2CVE A;  4JI6 E;  4NXN I;  4HXZ A;  2DEJ A;  1S4E A;  4JI0 I;  3M7N G;  4IZK A;  1Y4S A;  4MQY A;  1HNZ I;  4DPY A;  4IZJ A;  4FN5 A;  1KTV A;  1Z0G A;  3D4J A;  4IFD B;  2CG9 A;  4XTJ A;  1NHJ A;  1IBK E;  4DV1 I;  3QT7 A;  3GLL A;  4B3M E;  2JE6 B;  4JI1 E;  4B3T I;  1E3P A;  5JEA B;  4GQU A;  4LF6 E;  2PO1 B;  5K36 E;  2ZBK B;  3PYG A;  3KRN A;  5C0X B;  1FJG E;  1N0U A;  4LF8 I;  4DR7 I;  2ZM6 E;  4JI5 I;  1B62 A;  1PIE A;  4BA1 A;  4JI2 I;  4DR5 I;  4OO1 E;  1EA6 A;  2VQE I;  4DR1 E;  1IBM I;  2BR2 A;  2UXB E;  2UU9 I;  2HFS A;  4LFA E;  1RRE A;  4LF4 I;  1Y60 A;  3T1H E;  4GKJ E;  4DR2 I;  3J81 Q;  3GON A;  4JI4 I;  4IZK B;  2PNM A;  4DUY I;  4N3O A;  4DR4 I;  4GKK I;  4IZJ B;  4B3R I;  2NN6 C;  2GQ0 A;  2AJ4 A;  1N33 I;  1Z0W A;  1XNQ E;  1OYR A;  1NZ0 A; 
#chains in the Genus database with same CATH homology
 4DR6 I;  4X66 I;  3PYD A;  4HYM A;  4X62 E;  1EI1 A;  2HKJ A;  3Q6N A;  3H4L A;  4DV7 E;  1KIJ A;  4JI3 I;  4DR3 E;  3HUL A;  4USK A;  4YY3 I;  1HR0 E;  1RR9 A;  1N32 I;  4HAC B;  4P52 A;  4MYU A;  2EFG A;  5IT9 C;  2VF3 A;  4R1F A;  2UXD E;  3J80 Q;  3WU4 A;  3QT8 A;  3ZKD A;  1Y6Z A;  4LFC E;  2V8P A;  1HK7 A;  4UTG A;  1ELO A;  5LMN I;  2O1U A;  3ZKB A;  4M1K A;  4LF5 E;  1Y4U A;  1I94 I;  2E1R A;  3ZZ0 A;  2UXC I;  2DEI A;  1KKH A;  4FWH A;  4DV2 E;  4YHH I;  2CZ9 A;  3JAM C;  4DUZ E;  1K47 A;  4KHP E;  1HNX I;  2UUA I;  4DPU A;  1XNR I;  5GMD A;  1ZXM A;  3OTO I;  4DV0 E;  4JI8 I;  2CGE A;  3B82 A;  1VIS A;  4DV5 I;  5LMU I;  2UUC E;  4JV5 I;  1FNM A;  4LF9 I;  2O1W A;  4X65 I;  3PYF A;  1ZM3 A;  4B3S E;  4PRV A;  1Z0B A;  1DAR A;  4OX9 I;  1HNW E;  4DV6 I;  1J5E E;  4JYA I;  1N34 E;  4HAC A;  2V34 A;  4USM A;  5BR8 E;  4LF7 I;  2XEX A;  3WU3 A;  4JI6 I;  1IBL E;  2Z5E A;  3Q6M A;  1PVG A;  1N0V C;  2E5L E;  2J7K A;  1NHH A;  5LL6 R;  2UUB E;  1IBK I;  2Z5B A;  1D6T A;  1ZM9 A;  3ZZU A;  1XMO E;  4B3M I;  4JI1 I;  1FI4 A;  4ZVI A;  1NHI A;  4PU9 A;  4DU8 A;  4LF6 I;  1H7S A;  1KVK A;  1FJG I;  2ZM6 I;  1FWK A;  2VQF E;  4AQY E;  4X64 E;  1XHK A;  1UEK A;  4NXM E;  4FW9 A;  2BV3 A;  3B78 A;  5IT9 Q;  4DR1 I;  4DV4 E;  4K0K E;  2UXB I;  4KQV A;  1N36 E;  2HHH E;  3LPS A;  4LFA I;  5L3J A;  3T1H I;  3WU5 A;  4GKJ I;  1MX0 A;  3J7A M;  3T1Y E;  2F4V E;  1WUU A;  1Z5B A;  4DXL A;  2PNL A;  1U2R A;  5FLX C;  1XNQ I;  4JI7 E;  3M6A A;  4DV3 E;  1XMQ E;  4X62 I;  5IWA E;  2Z5B B;  2O1T A;  4LFB E;  4JG4 A;  4DV7 I;  3JAM Q;  4DU7 A;  4DR3 I;  1FWL A;  1Z0C A;  4WUC A;  4NXN E;  3ZM7 A;  1MG7 A;  1HR0 I;  4JI0 E;  1Z59 A;  1HNZ E;  3Q1Q A;  1H7U A;  3CWV A;  2UXD I;  2V2Z A;  3LTO A;  3J80 C;  2HK3 A;  4DV1 E;  5FWK A;  3PYE A;  2NPF A;  4LFC I;  1S16 A;  4I3H A;  2O1V A;  4B3T E;  4DPT A;  4Z7Y A;  4LF8 E;  4DR7 E;  4JI5 E;  2Q2E B;  4DPX A;  4LF5 I;  4JI2 E;  4DR5 E;  2VQE E;  4DV2 I;  5A2Q C;  1IBM E;  3QT6 A;  3ZZT A;  4DPW A;  1ZM4 A;  4DUZ I;  4KHP I;  4WUD A;  2UU9 E;  1H74 A;  2Z5C A;  4LF4 E;  2IOQ A;  4DV0 I;  3P06 A;  2X7I A;  4DR2 E;  1Z5A A;  1A6F A;  2HK2 A;  1OJ4 A;  4JI4 E;  4DUY E;  1H73 A;  4DR4 E;  3K1J A;  1B63 A;  4GKK E;  2UUC I;  4B3R E;  2BM1 A;  1N33 E;  4WUB A;  2ZIT A;  4FWG A;  2R42 A;  4DR6 E;  4B3S I;  4X66 E;  3F0N A;  4HY1 A;  3B8H A;  4EMD A;  1HNW I;  1MU5 A;  4JI3 E;  1J5E I;  1N34 I;  4YY3 E;  1USV A;  3K17 A;  2OI2 A;  5BR8 I;  1N32 E;  3J7A G;  1IBL I;  1Z0T A;  4PRX A;  1BKN A;  3QT5 A;  4RPF A;  1ZXN A;  2R3V A;  2E5L I;  5GME A;  3V2U C;  3WU6 A;  4UT4 A;  4URL A;  3HJC A;  2BM0 A;  2UUB I;  1FKA E;  2IOP A;  5FLX Q;  2LJP A;  2Z5C B;  1XMO I;  3J81 C;  1H72 C;  1PKP A;  5LMN E;  1Z0V A;  2HFU A;  3V5R A;  2X36 A;  1I94 E;  2VQF I;  4AQY I;  3PRY A;  2UXC E;  4X64 I;  4Z7C A;  4YHH E;  4NXM I;  1ZM2 A;  2V2V A;  1HNX E;  4DV4 I;  2UUA E;  2WW4 A;  4K0K I;  1XNR E;  4P7A A;  2V2Q A;  2A2D A;  3OTO E;  3K85 A;  1N36 I;  2HHH I;  4IZJ D;  4JI8 E;  4DV5 E;  5LMU E;  3T1Y I;  4JV5 E;  4LF9 E;  1Z5C A;  2F4V I;  4X65 E;  1Z0E A;  3LNU A;  4JI7 I;  4OX9 E;  4DV6 E;  4MYT A;  4DV3 I;  1XMQ I;  4JYA E;  1USU A;  5IWA I;  2HKE A;  5A2Q Q;  4ED4 A;  4LFB I;  4LF7 E;  2A2C A;  1QZR A;  2GS8 A;  4FWD A;  4JI6 E;  4NXN I;  4HXZ A;  2DEJ A;  1S4E A;  4JI0 I;  4IZK A;  1Y4S A;  1HNZ I;  4DPY A;  4IZJ A;  4FN5 A;  1KTV A;  1Z0G A;  3D4J A;  2CG9 A;  4XTJ A;  1NHJ A;  1IBK E;  4DV1 I;  3QT7 A;  4B3M E;  4JI1 E;  4B3T I;  4LF6 E;  2ZBK B;  3PYG A;  1FJG E;  1N0U A;  4LF8 I;  4DR7 I;  2ZM6 E;  4JI5 I;  1B62 A;  1PIE A;  4JI2 I;  4DR5 I;  1EA6 A;  2VQE I;  4DR1 E;  1IBM I;  2UXB E;  2UU9 I;  2HFS A;  4LFA E;  1RRE A;  4LF4 I;  3T1H E;  4GKJ E;  4DR2 I;  3J81 Q;  3GON A;  4JI4 I;  4IZK B;  2PNM A;  4DUY I;  4N3O A;  4DR4 I;  4GKK I;  4IZJ B;  4B3R I;  2GQ0 A;  2AJ4 A;  1N33 I;  1Z0W A;  1XNQ E;  1NZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...