4DR2I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr2I00
3PYGA 5IT9Q 2HHHE 1HNZE 2UXDI 2V2VA 4LF4I 2DEIA 3K17A 4X64I 4P7AA 4YY3I 3ZZ0A 4OX9E 1N0UA 3OTOI 2HFUA 2VQEI 5LMUE 1NHIA 2UXDE 4LF4E 4GKJE 4DR7E 4X66I 4DU7A 3J80C 3PYDA 2UXCI 1Z5AA 1QZRA 4PRXA 4JI1E 3OTOE 4DV6I 3PYEA 1PVGA 1N32E 4LF6I 4Z7CA 4LFAE 2R42A 3H4LA 4WUBA 2V34A 3LTOA 4AQYI 4JI8I 4JI5I 2E5LE 3PYFA 4DV7I 4JI7I 1B63A 1MG7A 2V2QA 3D4JA 2UU9I 4YHHE 4LF7I 5BR8I 4DR3I 1KIJA 3J7AG 4JYAI 4NXMI 3M6AA 4K0KE 1KTVA 4LF7E 4FWGA 5BR8E 1HNWI 1IBKE 1RREA 4B3RI 1A6FA 1N34E 2X36A 4JYAE 4WUDA 5IWAI 1U2RA 1XNRE 1HNXE 1NHHA 1UEKA 4DR4E 4ED4A 1XNQI 3ZM7A 2BM1A 4X62I 5GMDA 4DUZE 4B3SI 1DARA 3J80Q 4JI0I 4USMA 4I3HA 4DV0I 4MYTA 1I94E 4JI3E 2GS8A 1PKPA 1ZM3A 1NZ0A 3T1YI 4B3SE 2UXBE 4DR2E 4LF8I 4DUYI 1NHJA 1B62A 4DU8A 1H72C 4DR1I 2X7IA 4MYUA 4FN5A 2UUBI 1EA6A 4JG4A 4LF5E 1N36I 4LF8E 3WU4A 1XMOI 1ZXNA 2A2DA 1FNMA 1XMQI 1MX0A 4RPFA 2UUBE 4X64E 4YY3E 1FJGI 3LNUA 3QT6A 5LL6R 5FLXC 1XMQE 1D6TA 2HKJA 2VQEE 3ZKBA 4JI6I 3ZZTA 4X66E 2NPFA 2UXCE 4JI4I 4DV6E 5A2QC 4B3MI 4DR6I 1H7UA 1FWKA 1RR9A 1ZM4A 4DPXA 4LF6E 3V5RA 4NXNI 4PRVA 1KKHA 4DPYA 3QT7A 3HULA 1H7SA 4AQYE 4DV2I 4DV1I 4R1FA 3LPSA 4DV3I 4JI8E 4JI5E 1WUUA 4JV5I 4JI7E 4DV7E 1J5EI 2VQFI 4DV1E 4DV5I 1Z0GA 2UU9E 3T1HI 1KVKA 4DR3E 3CWVA 1PIEA 2ZM6I 1J5EE 2HK2A 4NXME 2F4VI 1IBLI 4KQVA 1Z5CA 3T1HE 1Z59A 1HR0I 1HNWE 2UUCI 4B3RE 4DPTA 1FWLA 4HY1A 2LJPA 2R3VA 3B78A 5IWAE 1ZXMA 4DV4I 2EFGA 4LFBI 4HYMA 5FLXQ 1XNQE 4URLA 4ZVIA 4X62E 4GKKI 4JI0E 1N33I 4DR5I 4DV0E 4Z7YA 2E1RA 2HHHI 5A2QQ 1HNZI 1Z0CA 4FWHA 1FI4A 4P52A 2HK3A 1ZM2A 1BKNA 3T1YE 2DEJA 4JI2I 2A2CA 4PU9A 2UUAI 2V8PA 4DUYE 4XTJA 2Q2EB 1ELOA 2ZBKB 4DR1E 4OX9I 5LMUI 4JI2E 4GKJI 4DR7I 4LFCI 2ZITA 1N36E 1XMOE 3QT5A 2UUAE 4UTGA 3JAMC 2VF3A 4JI1I 4DPUA 2WW4A 1S4EA 4LF9I 4FWDA 3WU5A 3J81C 2XEXA 4B3TI 1OJ4A 1VISA 1Z0BA 4LFCE 2HFSA 1FJGE 1N32I 1Z0WA 1Z5BA 4LFAI 1Z0TA 2V2ZA 1H73A 4LF9E 4JI6E 4B3TE 1K47A 3ZZUA 4X65I 4HXZA 2E5LI 4JI4E 2J7KA 5IT9C 4B3ME 1EI1A 4DR6E 1Z0EA 4UT4A 4NXNE 4DPWA 1MU5A 4X65E 4YHHI 3V2UC 1XHKA 4DV2E 3GONA 2BM0A 4DV3E 1Z0VA 4JV5E 4K0KI 3WU6A 2AJ4A 1IBKI 4HACB 2VQFE 1N34I 2CZ9A 3F0NA 4DV5E 4HACA 1XNRI 1ZM9A 1HNXI 4DR4I 4KHPI 3WU3A 3ZKDA 1FKAE 3B82A 4USKA 1N0VC 2ZM6E 2F4VE 5L3JA 4DUZI 1IBLE 1S16A 3JAMQ 4DXLA 2HKEA 2BV3A 1I94I 1HR0E 4KHPE 4JI3I 3Q1QA 3J81Q 1IBMI 2UUCE 5LMNI 3J7AM 4EMDA 4WUCA 2OI2A 4FW9A 5GMEA 4DV4E 4LFBE 2UXBI 4DR2I 1H74A 1IBME 5LMNE 4M1KA 3QT8A 4GKKE 1N33E 4DR5E 3B8HA 4LF5I 3K1JA
chains in the Genus database with same CATH superfamily
3PYGA 2IESA 4FW3A 5IT9Q 2HHHE 1HNZE 2UXDI 2V2VA 3U1KA 4LF4I 2DEIA 5C0XC 3K17A 4MDTA 4X64I 4P7AA 4BA1B 4YY3I 2IOQA 4MU1A 3ZZ0A 2CGEA 5C0XD 4BA1A 4OX9E 4FW5A 1N0UA 3OTOI 2HFUA 5C0XB 2VQEI 5LMUE 1NHIA 2UXDE 5C0XA 4LF4E 4GKJE 3M85G 3P06A 4DR7E 4X66I 4DU7A 3J80C 1E3PA 3PYDA 2UXCI 1Z5AA 1QZRA 4PRXA 4JI1E 3OTOE 4DV6I 3PYEA 1PVGA 1Y4UA 1N32E 1P42A 4LF6I 4Z7CA 4OO1E 4LFAE 5ELWA 2R42A 3H4LA 4WUBA 3DD6A 2V34A 4LCFA 3LTOA 4AQYI 5DNLA 2BA0D 4GQUA 3GCMA 4JI8I 4JI5I 2E5LE 3PYFA 4DV7I 4U3BA 2NN6E 4JI7I 1B63A 1MG7A 2Z5BB 2V2QA 1UDNA 1VI7A 3D4JA 2Z5BA 1USVA 4IFDC 2UU9I 4YHHE 4LF7I 5JEAE 5BR8I 2JEAB 4DR3I 1KIJA 4IFDD 2JEAA 3J7AG 4JYAI 4NXMI 1Y6ZA 2NN6F 4IFDB 3M6AA 1HK7A 4IFDA 3U1YA 4K0KE 2JT2A 1KTVA 4LF7E 4FWGA 5BR8E 3M7NG 1HNWI 1RREA 1IBKE 4B3RI 1A6FA 5JEAF 1N34E 2X36A 4JYAE 4WUDA 5IWAI 1U2RA 1XNRE 1HNXE 1NHHA 1UEKA 4DR4E 4ED4A 1XNQI 3PS2A 3ZM7A 2BM1A 4FW7A 5DRRA 4X62I 5K36E 3UHMA 5GMDA 4DUZE 4B3SI 1DARA 2IOPA 2BA1D 3J80Q 4JI0I 4USMA 2PNZB 4I3HA 2IERA 4DV0I 4MYTA 1I94E 2PNZA 4LPFA 4JI3E 2GS8A 3K85A 1PKPA 1ZM3A 1NZ0A 5FWKA 3T1YI 4B3SE 5K36F 2UXBE 4DR2E 4LF8I 4DUYI 1NHJA 1B62A 4DU8A 4MQYA 1H72C 4DR1I 2X7IA 4MYUA 4FN5A 4FW6A 2UUBI 1EA6A 4JG4A 4LF5E 1OYPA 1N36I 4LF8E 3WU4A 1XMOI 1ZXNA 2A2DA 1FNMA 1XMQI 1MX0A 4OKGA 4RPFA 2UUBE 2Z5CB 4X64E 2GO3A 4YY3E 2Z5CA 1FJGI 3LNUA 3QT6A 2CG9A 5LL6R 5FLXC 1XMQE 1D6TA 2HKJA 2VQEE 3ZKBA 4JI6I 3ZZTA 4N3OA 4X66E 2J65A 2NPFA 2O1TA 2UXCE 2WNRB 1RHYA 4JI4I 2WNRA 4DV6E 4MU4A 1E3HA 5A2QC 5DROA 4B3MI 4DR6I 1H7UA 1FWKA 4BA2B 1RR9A 1ZM4A 4DPXA 4LF6E 2JE6B 3V5RA 4BA2A 4OO1C 4NXNI 4PRVA 2JE6A 1KKHA 4DPYA 4OO1F 3QT7A 3HULA 4OO1D 1H7SA 4AQYE 4DV2I 4OO1B 4DV1I 3P76A 4R1FA 3LPSA 3Q6MA 3H1CA 4OO1A 4DV3I 4JI8E 3B4TA 4JI5E 3PS3A 1WUUA 4JV5I 2NN6C 4JI7E 4DV7E 1J5EI 3P3EA 2NN6D 2VQFI 4DV1E 4DV5I 2NN6B 1Z0GA 1XXEA 2UU9E 3T1HI 5JEAC 2BA0G 2AE8A 2NN6A 1KVKA 4DR3E 3CWVA 5JEAD 1PIEA 4MU0A 2ZM6I 1J5EE 2HK2A 4NXME 2F4VI 2O1WA 5JEAB 1IBLI 4KQVA 1Z5CA 5JEAA 2F1DA 4IZJD 3T1HE 1Z59A 1HR0I 1HNWE 2UUCI 4B3RE 1Y4SA 4IZJB 4MU3A 4DPTA 1FWLA 4HY1A 2LJPA 2CVEA 2R3VA 3B78A 4QNJA 4IZJA 5EL9A 4J3DA 5IWAE 1ZXMA 4DV4I 1YH8A 2EFGA 4ISAA 4LFBI 4HYMA 5FLXQ 1XNQE 4URLA 4ZVIA 5K36C 3HKMA 4X62E 1R6MA 4NBQA 5K36D 1USUA 4GKKI 4JI0E 1N33I 4DR5I 4DV0E 5K36B 4Z7YA 1UDOA 4QNKA 5K36A 2E1RA 2HHHI 5A2QQ 4IS9A 1Z0CA 1HNZI 4FWHA 1FI4A 4P52A 2HK3A 1ZM2A 1BKNA 3T1YE 2DEJA 3M85D 3HJCA 4JI2I 4AIDA 2O3ZA 3Q6NA 2A2CA 2PO1B 4PU9A 2UUAI 3KRNA 2JEBB 2GO4A 2BA1G 2V8PA 5C0XE 4DUYE 2C39B 2PO1A 4XTJA 2Q2EB 1ELOA 2JEBA 2C39A 2ZBKB 4DR1E 4OX9I 5EKWA 1UDQA 5LMUI 4JI2E 4GKJI 4DR7I 4LFCI 2BR2B 2GQ0A 2ZITA 1N36E 1XMOE 3QT5A 2UUAE 1UDSA 4UTGA 2BR2A 2PO2B 5DNXA 3JAMC 5C0XF 2VF3A 4JI1I 2PO2A 4DPUA 2WW4A 1S4EA 4LF9I 2WP8B 4FWDA 5DRPA 3WU5A 3J81C 2XEXA 4B3TI 2VESA 1OJ4A 1OYRA 2WP8A 1VISA 1Z0BA 4LFCE 2HFSA 1FJGE 1N32I 1Z0WA 2Z5EA 3CDIA 1Z5BA 4LFAI 1Z0TA 2V2ZA 1H73A 2O1VA 4LF9E 4JI6E 4B3TE 3P3CA 1K47A 3ZZUA 3PS1A 4X65I 4LCGA 4HXZA 2E5LI 2PNMA 4JI4E 2J7KA 4U3DA 3CDJA 3P3GA 5IT9C 1Y5YA 4B3ME 1EI1A 4DR6E 1Z0EA 2PNLA 4UT4A 1YHCA 2PO0B 4NXNE 4DPWA 1MU5A 4X65E 3M7ND 4YHHI 4IFDE 2PO0A 3GLLA 3V2UC 1XHKA 4DV2E 4AIMA 3GONA 2BM0A 4DV3E 1Z0VA 4JV5E 2C38B 4K0KI 1Y60A 3WU6A 2AJ4A 2C38A 4LCHA 3L7ZB 1IBKI 4IFDF 4HACB 2VQFE 1N34I 2CZ9A 3F0NA 3L7ZA 4DV5E 4HACA 3NZKA 1XNRI 1ZM9A 1HNXI 4DR4I 4KHPI 3WU3A 3ZKDA 1FKAE 3B82A 3GMEA 3PRYA 4USKA 1N0VC 2ZM6E 2F4VE 4LOMA 2C37B 5L3JA 4DUZI 1IBLE 4OZEA 1S16A 2C37A 3JAMQ 4DXLA 2HKEA 2BV3A 1I94I 1HR0E 4KHPE 4JI3I 3Q1QA 1R6LA 3J81Q 1IBMI 2UUCE 2O1UA 5LMNI 4IZKB 4EMDA 3J7AM 4WUCA 2OI2A 4IZKA 4FW9A 5GMEA 4DV4E 4LFBE 2UXBI 4DR2I 1H74A 5DRQA 1IBME 5LMNE 4M1KA 3QT8A 1OYSA 4GKKE 1N33E 4DR5E 4FW4A 4AM3A 3B8HA 4LF5I 3K1JA
chains in the Genus database with same CATH topology
3PYGA 5IT9Q 2HHHE 1HNZE 2UXDI 2V2VA 4LF4I 2DEIA 3K17A 4X64I 4P7AA 4YY3I 2IOQA 3ZZ0A 2CGEA 4OX9E 1N0UA 3OTOI 2HFUA 2VQEI 5LMUE 1NHIA 2UXDE 4LF4E 4GKJE 3P06A 4DR7E 4X66I 4DU7A 3J80C 3PYDA 2UXCI 1Z5AA 1QZRA 4PRXA 4JI1E 3OTOE 4DV6I 3PYEA 1PVGA 1Y4UA 1N32E 4LF6I 4Z7CA 4LFAE 2R42A 3H4LA 4WUBA 2V34A 3LTOA 4AQYI 4JI8I 4JI5I 2E5LE 3PYFA 4DV7I 4JI7I 1B63A 1MG7A 2Z5BB 2V2QA 3D4JA 2Z5BA 1USVA 2UU9I 4YHHE 4LF7I 5BR8I 4DR3I 1KIJA 3J7AG 4JYAI 4NXMI 1Y6ZA 3M6AA 1HK7A 4K0KE 1KTVA 4LF7E 4FWGA 5BR8E 1HNWI 1RREA 1IBKE 4B3RI 1A6FA 1N34E 2X36A 4JYAE 4WUDA 5IWAI 1U2RA 1XNRE 1HNXE 1NHHA 1UEKA 4DR4E 4ED4A 1XNQI 3ZM7A 2BM1A 4X62I 5GMDA 4DUZE 4B3SI 1DARA 2IOPA 3J80Q 4JI0I 4USMA 4I3HA 4DV0I 4MYTA 1I94E 4JI3E 2GS8A 3K85A 1PKPA 1ZM3A 1NZ0A 5FWKA 3T1YI 4B3SE 2UXBE 4DR2E 4LF8I 4DUYI 1NHJA 1B62A 4DU8A 1H72C 4DR1I 2X7IA 4MYUA 4FN5A 2UUBI 1EA6A 4JG4A 4LF5E 1N36I 4LF8E 3WU4A 1XMOI 1ZXNA 2A2DA 1FNMA 1XMQI 1MX0A 4RPFA 2UUBE 2Z5CB 4X64E 4YY3E 2Z5CA 1FJGI 3LNUA 3QT6A 2CG9A 5LL6R 5FLXC 1XMQE 1D6TA 2HKJA 2VQEE 3ZKBA 4JI6I 3ZZTA 4N3OA 4X66E 2NPFA 2O1TA 2UXCE 4JI4I 4DV6E 5A2QC 4B3MI 4DR6I 1H7UA 1FWKA 1RR9A 1ZM4A 4DPXA 4LF6E 3V5RA 4NXNI 4PRVA 1KKHA 4DPYA 3QT7A 3HULA 1H7SA 4AQYE 4DV2I 4DV1I 4R1FA 3LPSA 3Q6MA 4DV3I 4JI8E 4JI5E 1WUUA 4JV5I 4JI7E 4DV7E 1J5EI 2VQFI 4DV1E 4DV5I 1Z0GA 2UU9E 3T1HI 1KVKA 4DR3E 3CWVA 1PIEA 2ZM6I 1J5EE 2HK2A 4NXME 2F4VI 2O1WA 1IBLI 4KQVA 1Z5CA 4IZJD 3T1HE 1Z59A 1HR0I 1HNWE 2UUCI 4B3RE 1Y4SA 4IZJB 4DPTA 1FWLA 4HY1A 2LJPA 2R3VA 3B78A 4IZJA 5IWAE 1ZXMA 4DV4I 2EFGA 4LFBI 4HYMA 5FLXQ 1XNQE 4URLA 4ZVIA 4X62E 1USUA 4GKKI 4JI0E 1N33I 4DR5I 4DV0E 4Z7YA 2E1RA 2HHHI 5A2QQ 1HNZI 1Z0CA 4FWHA 1FI4A 4P52A 2HK3A 1ZM2A 1BKNA 3T1YE 2DEJA 3HJCA 4JI2I 3Q6NA 2A2CA 4PU9A 2UUAI 2V8PA 4DUYE 4XTJA 2Q2EB 1ELOA 2ZBKB 4DR1E 4OX9I 5LMUI 4JI2E 4GKJI 4DR7I 4LFCI 2GQ0A 2ZITA 1N36E 1XMOE 3QT5A 2UUAE 4UTGA 3JAMC 2VF3A 4JI1I 4DPUA 2WW4A 1S4EA 4LF9I 4FWDA 3WU5A 3J81C 2XEXA 4B3TI 1OJ4A 1VISA 1Z0BA 4LFCE 2HFSA 1FJGE 1N32I 1Z0WA 2Z5EA 1Z5BA 4LFAI 1Z0TA 2V2ZA 1H73A 2O1VA 4LF9E 4JI6E 4B3TE 1K47A 3ZZUA 4X65I 4HXZA 2E5LI 2PNMA 4JI4E 2J7KA 5IT9C 4B3ME 1EI1A 4DR6E 1Z0EA 2PNLA 4UT4A 4NXNE 4DPWA 1MU5A 4X65E 4YHHI 3V2UC 1XHKA 4DV2E 3GONA 2BM0A 4DV3E 1Z0VA 4JV5E 4K0KI 3WU6A 2AJ4A 1IBKI 4HACB 2VQFE 1N34I 2CZ9A 3F0NA 4DV5E 4HACA 1XNRI 1ZM9A 1HNXI 4DR4I 4KHPI 3WU3A 3ZKDA 1FKAE 3B82A 3PRYA 4USKA 1N0VC 2ZM6E 2F4VE 5L3JA 4DUZI 1IBLE 1S16A 3JAMQ 4DXLA 2HKEA 2BV3A 1I94I 1HR0E 4KHPE 4JI3I 3Q1QA 3J81Q 1IBMI 2UUCE 2O1UA 5LMNI 4IZKB 4EMDA 3J7AM 4WUCA 2OI2A 4IZKA 4FW9A 5GMEA 4DV4E 4LFBE 2UXBI 4DR2I 1H74A 1IBME 5LMNE 4M1KA 3QT8A 4GKKE 1N33E 4DR5E 3B8HA 4LF5I 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYG A;  5IT9 Q;  2HHH E;  1HNZ E;  2UXD I;  2V2V A;  4LF4 I;  2DEI A;  3K17 A;  4X64 I;  4P7A A;  4YY3 I;  3ZZ0 A;  4OX9 E;  1N0U A;  3OTO I;  2HFU A;  2VQE I;  5LMU E;  1NHI A;  2UXD E;  4LF4 E;  4GKJ E;  4DR7 E;  4X66 I;  4DU7 A;  3J80 C;  3PYD A;  2UXC I;  1Z5A A;  1QZR A;  4PRX A;  4JI1 E;  3OTO E;  4DV6 I;  3PYE A;  1PVG A;  1N32 E;  4LF6 I;  4Z7C A;  4LFA E;  2R42 A;  3H4L A;  4WUB A;  2V34 A;  3LTO A;  4AQY I;  4JI8 I;  4JI5 I;  2E5L E;  3PYF A;  4DV7 I;  4JI7 I;  1B63 A;  1MG7 A;  2V2Q A;  3D4J A;  2UU9 I;  4YHH E;  4LF7 I;  5BR8 I;  4DR3 I;  1KIJ A;  3J7A G;  4JYA I;  4NXM I;  3M6A A;  4K0K E;  1KTV A;  4LF7 E;  4FWG A;  5BR8 E;  1HNW I;  1IBK E;  1RRE A;  4B3R I;  1A6F A;  1N34 E;  2X36 A;  4JYA E;  4WUD A;  5IWA I;  1U2R A;  1XNR E;  1HNX E;  1NHH A;  1UEK A;  4DR4 E;  4ED4 A;  1XNQ I;  3ZM7 A;  2BM1 A;  4X62 I;  5GMD A;  4DUZ E;  4B3S I;  1DAR A;  3J80 Q;  4JI0 I;  4USM A;  4I3H A;  4DV0 I;  4MYT A;  1I94 E;  4JI3 E;  2GS8 A;  1PKP A;  1ZM3 A;  1NZ0 A;  3T1Y I;  4B3S E;  2UXB E;  4DR2 E;  4LF8 I;  4DUY I;  1NHJ A;  1B62 A;  4DU8 A;  1H72 C;  4DR1 I;  2X7I A;  4MYU A;  4FN5 A;  2UUB I;  1EA6 A;  4JG4 A;  4LF5 E;  1N36 I;  4LF8 E;  3WU4 A;  1XMO I;  1ZXN A;  2A2D A;  1FNM A;  1XMQ I;  1MX0 A;  4RPF A;  2UUB E;  4X64 E;  4YY3 E;  1FJG I;  3LNU A;  3QT6 A;  5LL6 R;  5FLX C;  1XMQ E;  1D6T A;  2HKJ A;  2VQE E;  3ZKB A;  4JI6 I;  3ZZT A;  4X66 E;  2NPF A;  2UXC E;  4JI4 I;  4DV6 E;  5A2Q C;  4B3M I;  4DR6 I;  1H7U A;  1FWK A;  1RR9 A;  1ZM4 A;  4DPX A;  4LF6 E;  3V5R A;  4NXN I;  4PRV A;  1KKH A;  4DPY A;  3QT7 A;  3HUL A;  1H7S A;  4AQY E;  4DV2 I;  4DV1 I;  4R1F A;  3LPS A;  4DV3 I;  4JI8 E;  4JI5 E;  1WUU A;  4JV5 I;  4JI7 E;  4DV7 E;  1J5E I;  2VQF I;  4DV1 E;  4DV5 I;  1Z0G A;  2UU9 E;  3T1H I;  1KVK A;  4DR3 E;  3CWV A;  1PIE A;  2ZM6 I;  1J5E E;  2HK2 A;  4NXM E;  2F4V I;  1IBL I;  4KQV A;  1Z5C A;  3T1H E;  1Z59 A;  1HR0 I;  1HNW E;  2UUC I;  4B3R E;  4DPT A;  1FWL A;  4HY1 A;  2LJP A;  2R3V A;  3B78 A;  5IWA E;  1ZXM A;  4DV4 I;  2EFG A;  4LFB I;  4HYM A;  5FLX Q;  1XNQ E;  4URL A;  4ZVI A;  4X62 E;  4GKK I;  4JI0 E;  1N33 I;  4DR5 I;  4DV0 E;  4Z7Y A;  2E1R A;  2HHH I;  5A2Q Q;  1HNZ I;  1Z0C A;  4FWH A;  1FI4 A;  4P52 A;  2HK3 A;  1ZM2 A;  1BKN A;  3T1Y E;  2DEJ A;  4JI2 I;  2A2C A;  4PU9 A;  2UUA I;  2V8P A;  4DUY E;  4XTJ A;  2Q2E B;  1ELO A;  2ZBK B;  4DR1 E;  4OX9 I;  5LMU I;  4JI2 E;  4GKJ I;  4DR7 I;  4LFC I;  2ZIT A;  1N36 E;  1XMO E;  3QT5 A;  2UUA E;  4UTG A;  3JAM C;  2VF3 A;  4JI1 I;  4DPU A;  2WW4 A;  1S4E A;  4LF9 I;  4FWD A;  3WU5 A;  3J81 C;  2XEX A;  4B3T I;  1OJ4 A;  1VIS A;  1Z0B A;  4LFC E;  2HFS A;  1FJG E;  1N32 I;  1Z0W A;  1Z5B A;  4LFA I;  1Z0T A;  2V2Z A;  1H73 A;  4LF9 E;  4JI6 E;  4B3T E;  1K47 A;  3ZZU A;  4X65 I;  4HXZ A;  2E5L I;  4JI4 E;  2J7K A;  5IT9 C;  4B3M E;  1EI1 A;  4DR6 E;  1Z0E A;  4UT4 A;  4NXN E;  4DPW A;  1MU5 A;  4X65 E;  4YHH I;  3V2U C;  1XHK A;  4DV2 E;  3GON A;  2BM0 A;  4DV3 E;  1Z0V A;  4JV5 E;  4K0K I;  3WU6 A;  2AJ4 A;  1IBK I;  4HAC B;  2VQF E;  1N34 I;  2CZ9 A;  3F0N A;  4DV5 E;  4HAC A;  1XNR I;  1ZM9 A;  1HNX I;  4DR4 I;  4KHP I;  3WU3 A;  3ZKD A;  1FKA E;  3B82 A;  4USK A;  1N0V C;  2ZM6 E;  2F4V E;  5L3J A;  4DUZ I;  1IBL E;  1S16 A;  3JAM Q;  4DXL A;  2HKE A;  2BV3 A;  1I94 I;  1HR0 E;  4KHP E;  4JI3 I;  3Q1Q A;  3J81 Q;  1IBM I;  2UUC E;  5LMN I;  3J7A M;  4EMD A;  4WUC A;  2OI2 A;  4FW9 A;  5GME A;  4DV4 E;  4LFB E;  2UXB I;  4DR2 I;  1H74 A;  1IBM E;  5LMN E;  4M1K A;  3QT8 A;  4GKK E;  1N33 E;  4DR5 E;  3B8H A;  4LF5 I;  3K1J A; 
#chains in the Genus database with same CATH topology
 3PYG A;  2IES A;  4FW3 A;  5IT9 Q;  2HHH E;  1HNZ E;  2UXD I;  2V2V A;  3U1K A;  4LF4 I;  2DEI A;  5C0X C;  3K17 A;  4MDT A;  4X64 I;  4P7A A;  4BA1 B;  4YY3 I;  2IOQ A;  4MU1 A;  3ZZ0 A;  2CGE A;  5C0X D;  4BA1 A;  4OX9 E;  4FW5 A;  1N0U A;  3OTO I;  2HFU A;  5C0X B;  2VQE I;  5LMU E;  1NHI A;  2UXD E;  5C0X A;  4LF4 E;  4GKJ E;  3M85 G;  3P06 A;  4DR7 E;  4X66 I;  4DU7 A;  3J80 C;  1E3P A;  3PYD A;  2UXC I;  1Z5A A;  1QZR A;  4PRX A;  4JI1 E;  3OTO E;  4DV6 I;  3PYE A;  1PVG A;  1Y4U A;  1N32 E;  1P42 A;  4LF6 I;  4Z7C A;  4OO1 E;  4LFA E;  5ELW A;  2R42 A;  3H4L A;  4WUB A;  3DD6 A;  2V34 A;  4LCF A;  3LTO A;  4AQY I;  5DNL A;  2BA0 D;  4GQU A;  3GCM A;  4JI8 I;  4JI5 I;  2E5L E;  3PYF A;  4DV7 I;  4U3B A;  2NN6 E;  4JI7 I;  1B63 A;  1MG7 A;  2Z5B B;  2V2Q A;  1UDN A;  1VI7 A;  3D4J A;  2Z5B A;  1USV A;  4IFD C;  2UU9 I;  4YHH E;  4LF7 I;  5JEA E;  5BR8 I;  2JEA B;  4DR3 I;  1KIJ A;  4IFD D;  2JEA A;  3J7A G;  4JYA I;  4NXM I;  1Y6Z A;  2NN6 F;  4IFD B;  3M6A A;  1HK7 A;  4IFD A;  3U1Y A;  4K0K E;  2JT2 A;  1KTV A;  4LF7 E;  4FWG A;  5BR8 E;  3M7N G;  1HNW I;  1RRE A;  1IBK E;  4B3R I;  1A6F A;  5JEA F;  1N34 E;  2X36 A;  4JYA E;  4WUD A;  5IWA I;  1U2R A;  1XNR E;  1HNX E;  1NHH A;  1UEK A;  4DR4 E;  4ED4 A;  1XNQ I;  3PS2 A;  3ZM7 A;  2BM1 A;  4FW7 A;  5DRR A;  4X62 I;  5K36 E;  3UHM A;  5GMD A;  4DUZ E;  4B3S I;  1DAR A;  2IOP A;  2BA1 D;  3J80 Q;  4JI0 I;  4USM A;  2PNZ B;  4I3H A;  2IER A;  4DV0 I;  4MYT A;  1I94 E;  2PNZ A;  4LPF A;  4JI3 E;  2GS8 A;  3K85 A;  1PKP A;  1ZM3 A;  1NZ0 A;  5FWK A;  3T1Y I;  4B3S E;  5K36 F;  2UXB E;  4DR2 E;  4LF8 I;  4DUY I;  1NHJ A;  1B62 A;  4DU8 A;  4MQY A;  1H72 C;  4DR1 I;  2X7I A;  4MYU A;  4FN5 A;  4FW6 A;  2UUB I;  1EA6 A;  4JG4 A;  4LF5 E;  1OYP A;  1N36 I;  4LF8 E;  3WU4 A;  1XMO I;  1ZXN A;  2A2D A;  1FNM A;  1XMQ I;  1MX0 A;  4OKG A;  4RPF A;  2UUB E;  2Z5C B;  4X64 E;  2GO3 A;  4YY3 E;  2Z5C A;  1FJG I;  3LNU A;  3QT6 A;  2CG9 A;  5LL6 R;  5FLX C;  1XMQ E;  1D6T A;  2HKJ A;  2VQE E;  3ZKB A;  4JI6 I;  3ZZT A;  4N3O A;  4X66 E;  2J65 A;  2NPF A;  2O1T A;  2UXC E;  2WNR B;  1RHY A;  4JI4 I;  2WNR A;  4DV6 E;  4MU4 A;  1E3H A;  5A2Q C;  5DRO A;  4B3M I;  4DR6 I;  1H7U A;  1FWK A;  4BA2 B;  1RR9 A;  1ZM4 A;  4DPX A;  4LF6 E;  2JE6 B;  3V5R A;  4BA2 A;  4OO1 C;  4NXN I;  4PRV A;  2JE6 A;  1KKH A;  4DPY A;  4OO1 F;  3QT7 A;  3HUL A;  4OO1 D;  1H7S A;  4AQY E;  4DV2 I;  4OO1 B;  4DV1 I;  3P76 A;  4R1F A;  3LPS A;  3Q6M A;  3H1C A;  4OO1 A;  4DV3 I;  4JI8 E;  3B4T A;  4JI5 E;  3PS3 A;  1WUU A;  4JV5 I;  2NN6 C;  4JI7 E;  4DV7 E;  1J5E I;  3P3E A;  2NN6 D;  2VQF I;  4DV1 E;  4DV5 I;  2NN6 B;  1Z0G A;  1XXE A;  2UU9 E;  3T1H I;  5JEA C;  2BA0 G;  2AE8 A;  2NN6 A;  1KVK A;  4DR3 E;  3CWV A;  5JEA D;  1PIE A;  4MU0 A;  2ZM6 I;  1J5E E;  2HK2 A;  4NXM E;  2F4V I;  2O1W A;  5JEA B;  1IBL I;  4KQV A;  1Z5C A;  5JEA A;  2F1D A;  4IZJ D;  3T1H E;  1Z59 A;  1HR0 I;  1HNW E;  2UUC I;  4B3R E;  1Y4S A;  4IZJ B;  4MU3 A;  4DPT A;  1FWL A;  4HY1 A;  2LJP A;  2CVE A;  2R3V A;  3B78 A;  4QNJ A;  4IZJ A;  5EL9 A;  4J3D A;  5IWA E;  1ZXM A;  4DV4 I;  1YH8 A;  2EFG A;  4ISA A;  4LFB I;  4HYM A;  5FLX Q;  1XNQ E;  4URL A;  4ZVI A;  5K36 C;  3HKM A;  4X62 E;  1R6M A;  4NBQ A;  5K36 D;  1USU A;  4GKK I;  4JI0 E;  1N33 I;  4DR5 I;  4DV0 E;  5K36 B;  4Z7Y A;  1UDO A;  4QNK A;  5K36 A;  2E1R A;  2HHH I;  5A2Q Q;  4IS9 A;  1Z0C A;  1HNZ I;  4FWH A;  1FI4 A;  4P52 A;  2HK3 A;  1ZM2 A;  1BKN A;  3T1Y E;  2DEJ A;  3M85 D;  3HJC A;  4JI2 I;  4AID A;  2O3Z A;  3Q6N A;  2A2C A;  2PO1 B;  4PU9 A;  2UUA I;  3KRN A;  2JEB B;  2GO4 A;  2BA1 G;  2V8P A;  5C0X E;  4DUY E;  2C39 B;  2PO1 A;  4XTJ A;  2Q2E B;  1ELO A;  2JEB A;  2C39 A;  2ZBK B;  4DR1 E;  4OX9 I;  5EKW A;  1UDQ A;  5LMU I;  4JI2 E;  4GKJ I;  4DR7 I;  4LFC I;  2BR2 B;  2GQ0 A;  2ZIT A;  1N36 E;  1XMO E;  3QT5 A;  2UUA E;  1UDS A;  4UTG A;  2BR2 A;  2PO2 B;  5DNX A;  3JAM C;  5C0X F;  2VF3 A;  4JI1 I;  2PO2 A;  4DPU A;  2WW4 A;  1S4E A;  4LF9 I;  2WP8 B;  4FWD A;  5DRP A;  3WU5 A;  3J81 C;  2XEX A;  4B3T I;  2VES A;  1OJ4 A;  1OYR A;  2WP8 A;  1VIS A;  1Z0B A;  4LFC E;  2HFS A;  1FJG E;  1N32 I;  1Z0W A;  2Z5E A;  3CDI A;  1Z5B A;  4LFA I;  1Z0T A;  2V2Z A;  1H73 A;  2O1V A;  4LF9 E;  4JI6 E;  4B3T E;  3P3C A;  1K47 A;  3ZZU A;  3PS1 A;  4X65 I;  4LCG A;  4HXZ A;  2E5L I;  2PNM A;  4JI4 E;  2J7K A;  4U3D A;  3CDJ A;  3P3G A;  5IT9 C;  1Y5Y A;  4B3M E;  1EI1 A;  4DR6 E;  1Z0E A;  2PNL A;  4UT4 A;  1YHC A;  2PO0 B;  4NXN E;  4DPW A;  1MU5 A;  4X65 E;  3M7N D;  4YHH I;  4IFD E;  2PO0 A;  3GLL A;  3V2U C;  1XHK A;  4DV2 E;  4AIM A;  3GON A;  2BM0 A;  4DV3 E;  1Z0V A;  4JV5 E;  2C38 B;  4K0K I;  1Y60 A;  3WU6 A;  2AJ4 A;  2C38 A;  4LCH A;  3L7Z B;  1IBK I;  4IFD F;  4HAC B;  2VQF E;  1N34 I;  2CZ9 A;  3F0N A;  3L7Z A;  4DV5 E;  4HAC A;  3NZK A;  1XNR I;  1ZM9 A;  1HNX I;  4DR4 I;  4KHP I;  3WU3 A;  3ZKD A;  1FKA E;  3B82 A;  3GME A;  3PRY A;  4USK A;  1N0V C;  2ZM6 E;  2F4V E;  4LOM A;  2C37 B;  5L3J A;  4DUZ I;  1IBL E;  4OZE A;  1S16 A;  2C37 A;  3JAM Q;  4DXL A;  2HKE A;  2BV3 A;  1I94 I;  1HR0 E;  4KHP E;  4JI3 I;  3Q1Q A;  1R6L A;  3J81 Q;  1IBM I;  2UUC E;  2O1U A;  5LMN I;  4IZK B;  4EMD A;  3J7A M;  4WUC A;  2OI2 A;  4IZK A;  4FW9 A;  5GME A;  4DV4 E;  4LFB E;  2UXB I;  4DR2 I;  1H74 A;  5DRQ A;  1IBM E;  5LMN E;  4M1K A;  3QT8 A;  1OYS A;  4GKK E;  1N33 E;  4DR5 E;  4FW4 A;  4AM3 A;  3B8H A;  4LF5 I;  3K1J A; 
#chains in the Genus database with same CATH homology
 3PYG A;  5IT9 Q;  2HHH E;  1HNZ E;  2UXD I;  2V2V A;  4LF4 I;  2DEI A;  3K17 A;  4X64 I;  4P7A A;  4YY3 I;  2IOQ A;  3ZZ0 A;  2CGE A;  4OX9 E;  1N0U A;  3OTO I;  2HFU A;  2VQE I;  5LMU E;  1NHI A;  2UXD E;  4LF4 E;  4GKJ E;  3P06 A;  4DR7 E;  4X66 I;  4DU7 A;  3J80 C;  3PYD A;  2UXC I;  1Z5A A;  1QZR A;  4PRX A;  4JI1 E;  3OTO E;  4DV6 I;  3PYE A;  1PVG A;  1Y4U A;  1N32 E;  4LF6 I;  4Z7C A;  4LFA E;  2R42 A;  3H4L A;  4WUB A;  2V34 A;  3LTO A;  4AQY I;  4JI8 I;  4JI5 I;  2E5L E;  3PYF A;  4DV7 I;  4JI7 I;  1B63 A;  1MG7 A;  2Z5B B;  2V2Q A;  3D4J A;  2Z5B A;  1USV A;  2UU9 I;  4YHH E;  4LF7 I;  5BR8 I;  4DR3 I;  1KIJ A;  3J7A G;  4JYA I;  4NXM I;  1Y6Z A;  3M6A A;  1HK7 A;  4K0K E;  1KTV A;  4LF7 E;  4FWG A;  5BR8 E;  1HNW I;  1RRE A;  1IBK E;  4B3R I;  1A6F A;  1N34 E;  2X36 A;  4JYA E;  4WUD A;  5IWA I;  1U2R A;  1XNR E;  1HNX E;  1NHH A;  1UEK A;  4DR4 E;  4ED4 A;  1XNQ I;  3ZM7 A;  2BM1 A;  4X62 I;  5GMD A;  4DUZ E;  4B3S I;  1DAR A;  2IOP A;  3J80 Q;  4JI0 I;  4USM A;  4I3H A;  4DV0 I;  4MYT A;  1I94 E;  4JI3 E;  2GS8 A;  3K85 A;  1PKP A;  1ZM3 A;  1NZ0 A;  5FWK A;  3T1Y I;  4B3S E;  2UXB E;  4DR2 E;  4LF8 I;  4DUY I;  1NHJ A;  1B62 A;  4DU8 A;  1H72 C;  4DR1 I;  2X7I A;  4MYU A;  4FN5 A;  2UUB I;  1EA6 A;  4JG4 A;  4LF5 E;  1N36 I;  4LF8 E;  3WU4 A;  1XMO I;  1ZXN A;  2A2D A;  1FNM A;  1XMQ I;  1MX0 A;  4RPF A;  2UUB E;  2Z5C B;  4X64 E;  4YY3 E;  2Z5C A;  1FJG I;  3LNU A;  3QT6 A;  2CG9 A;  5LL6 R;  5FLX C;  1XMQ E;  1D6T A;  2HKJ A;  2VQE E;  3ZKB A;  4JI6 I;  3ZZT A;  4N3O A;  4X66 E;  2NPF A;  2O1T A;  2UXC E;  4JI4 I;  4DV6 E;  5A2Q C;  4B3M I;  4DR6 I;  1H7U A;  1FWK A;  1RR9 A;  1ZM4 A;  4DPX A;  4LF6 E;  3V5R A;  4NXN I;  4PRV A;  1KKH A;  4DPY A;  3QT7 A;  3HUL A;  1H7S A;  4AQY E;  4DV2 I;  4DV1 I;  4R1F A;  3LPS A;  3Q6M A;  4DV3 I;  4JI8 E;  4JI5 E;  1WUU A;  4JV5 I;  4JI7 E;  4DV7 E;  1J5E I;  2VQF I;  4DV1 E;  4DV5 I;  1Z0G A;  2UU9 E;  3T1H I;  1KVK A;  4DR3 E;  3CWV A;  1PIE A;  2ZM6 I;  1J5E E;  2HK2 A;  4NXM E;  2F4V I;  2O1W A;  1IBL I;  4KQV A;  1Z5C A;  4IZJ D;  3T1H E;  1Z59 A;  1HR0 I;  1HNW E;  2UUC I;  4B3R E;  1Y4S A;  4IZJ B;  4DPT A;  1FWL A;  4HY1 A;  2LJP A;  2R3V A;  3B78 A;  4IZJ A;  5IWA E;  1ZXM A;  4DV4 I;  2EFG A;  4LFB I;  4HYM A;  5FLX Q;  1XNQ E;  4URL A;  4ZVI A;  4X62 E;  1USU A;  4GKK I;  4JI0 E;  1N33 I;  4DR5 I;  4DV0 E;  4Z7Y A;  2E1R A;  2HHH I;  5A2Q Q;  1HNZ I;  1Z0C A;  4FWH A;  1FI4 A;  4P52 A;  2HK3 A;  1ZM2 A;  1BKN A;  3T1Y E;  2DEJ A;  3HJC A;  4JI2 I;  3Q6N A;  2A2C A;  4PU9 A;  2UUA I;  2V8P A;  4DUY E;  4XTJ A;  2Q2E B;  1ELO A;  2ZBK B;  4DR1 E;  4OX9 I;  5LMU I;  4JI2 E;  4GKJ I;  4DR7 I;  4LFC I;  2GQ0 A;  2ZIT A;  1N36 E;  1XMO E;  3QT5 A;  2UUA E;  4UTG A;  3JAM C;  2VF3 A;  4JI1 I;  4DPU A;  2WW4 A;  1S4E A;  4LF9 I;  4FWD A;  3WU5 A;  3J81 C;  2XEX A;  4B3T I;  1OJ4 A;  1VIS A;  1Z0B A;  4LFC E;  2HFS A;  1FJG E;  1N32 I;  1Z0W A;  2Z5E A;  1Z5B A;  4LFA I;  1Z0T A;  2V2Z A;  1H73 A;  2O1V A;  4LF9 E;  4JI6 E;  4B3T E;  1K47 A;  3ZZU A;  4X65 I;  4HXZ A;  2E5L I;  2PNM A;  4JI4 E;  2J7K A;  5IT9 C;  4B3M E;  1EI1 A;  4DR6 E;  1Z0E A;  2PNL A;  4UT4 A;  4NXN E;  4DPW A;  1MU5 A;  4X65 E;  4YHH I;  3V2U C;  1XHK A;  4DV2 E;  3GON A;  2BM0 A;  4DV3 E;  1Z0V A;  4JV5 E;  4K0K I;  3WU6 A;  2AJ4 A;  1IBK I;  4HAC B;  2VQF E;  1N34 I;  2CZ9 A;  3F0N A;  4DV5 E;  4HAC A;  1XNR I;  1ZM9 A;  1HNX I;  4DR4 I;  4KHP I;  3WU3 A;  3ZKD A;  1FKA E;  3B82 A;  3PRY A;  4USK A;  1N0V C;  2ZM6 E;  2F4V E;  5L3J A;  4DUZ I;  1IBL E;  1S16 A;  3JAM Q;  4DXL A;  2HKE A;  2BV3 A;  1I94 I;  1HR0 E;  4KHP E;  4JI3 I;  3Q1Q A;  3J81 Q;  1IBM I;  2UUC E;  2O1U A;  5LMN I;  4IZK B;  4EMD A;  3J7A M;  4WUC A;  2OI2 A;  4IZK A;  4FW9 A;  5GME A;  4DV4 E;  4LFB E;  2UXB I;  4DR2 I;  1H74 A;  1IBM E;  5LMN E;  4M1K A;  3QT8 A;  4GKK E;  1N33 E;  4DR5 E;  3B8H A;  4LF5 I;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...