4DR2I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr2I00
2R3VA 3ZZUA 4K0KI 4DV7I 1Z5BA 1N34E 1FKAE 1ZM9A 1NHHA 5BR8I 2OI2A 1N36I 4LF4I 1EI1A 5LMNI 3B78A 4JI5I 2ZM6I 1XMQI 4R1FA 4JI1I 4LFAI 2V34A 1KTVA 1QZRA 2AJ4A 4WUDA 3T1HE 1HNXI 1N33E 1IBLI 2UU9E 2UXCE 2J7KA 1Z0WA 1IBMI 4DR7E 4FWDA 2BM1A 1N0UA 4I3HA 4FWHA 3J7AM 5IT9C 4UTGA 4JI6E 4JI4I 4YY3E 4YHHE 2HHHE 4PU9A 4MYUA 5FLXC 2XEXA 2VQEI 3WU5A 2E1RA 3HULA 4JI7E 4UT4A 1ZM2A 1HNWE 1FI4A 1KKHA 5LL6R 4JI3E 1IBKI 3WU3A 4GKKI 3PYGA 4NXNE 1ELOA 4P52A 4LFCE 4JYAI 2BV3A 1Z0CA 3GONA 3LPSA 4DR5I 4DXLA 3ZZTA 4DV3E 2ZITA 4AQYI 3PYDA 1ZXNA 4LF7E 4B3SE 1FJGE 4WUBA 5L3JA 4LF5E 1XNQE 4DR2E 1NZ0A 4HACB 3J80C 4DR6E 1HNZI 4DR4E 1RREA 2BM0A 2Q2EB 4DUZI 4X62E 1S16A 1HR0I 4DV4E 3K17A 2CZ9A 4B3ME 3B8HA 4USKA 4KHPI 1RR9A 1J5EE 3J7AG 2ZBKB 4KQVA 4DPXA 1KVKA 4X64I 4M1KA 1XMOI 2R42A 3V2UC 4RPFA 1XNRI 4P7AA 4OX9E 4JI0I 5LMUE 4JG4A 4DR1I 1H7SA 4JI2E 1H74A 1U2RA 4K0KE 4B3TI 3J81Q 4DPYA 3ZM7A 5BR8E 3ZKDA 1Z0VA 2GS8A 3H4LA 2V2ZA 4MYTA 4ED4A 1B63A 1PVGA 4XTJA 1N34I 4LFAE 2HFSA 2UXDE 4DV0E 1FWLA 2EFGA 4HY1A 2X7IA 1IBME 1Z0TA 3CWVA 3LNUA 4LF9I 1WUUA 4JV5E 1N33I 4LF8I 2UU9I 2E5LE 1N0VC 4DV1I 2DEIA 4HYMA 3WU4A 4DR7I 2UUAI 4JI4E 4JI6I 4USMA 1N32E 2HKJA 3B82A 4YHHI 3PYEA 2HHHI 4B3RE 3QT5A 2NPFA 1Z5CA 4NXMI 4GKJE 2UUBE 1FWKA 4DR3E 5IWAE 1FNMA 3WU6A 4DU7A 2UXBI 2F4VE 4FW9A 4LFBE 1IBKE 1VISA 3QT6A 4URLA 4Z7CA 1HNWI 4X66E 2A2DA 1I94E 4JYAE 1PIEA 4JI8I 4DV2E 1ZM3A 4EMDA 1H7UA 1Z5AA 3K1JA 4Z7YA 3OTOI 4AQYE 4DUYE 4DV6E 1Z59A 4FN5A 2UUCI 1NHJA 4LF7I 1HR0E 4LF6E 4B3SI 1FJGI 2VQFI 4X65E 4LF5I 4DR2I 1Z0BA 4KHPE 4DR4I 4DV4I 4X64E 3D4JA 4DV5E 3T1YE 1J5EI 4DPTA 1PKPA 4DU8A 4DR1E 4DV7E 4HXZA 1OJ4A 1H73A 4OX9I 1N36E 4LF4E 5LMNE 4JI5E 2V2VA 1NHIA 2A2CA 3LTOA 2ZM6E 1XMQE 4JI1E 4JI2I 4WUCA 1H72C 5IT9Q 1D6TA 1HNXE 1Z0EA 2V2QA 3V5RA 1IBLE 1S4EA 5FLXQ 4DPUA 3T1HI 1XHKA 3ZKBA 1DARA 2V8PA 4DPWA 2UXDI 2UXCI 4LF9E 4DV0I 3F0NA 3J81C 4LF8E 4ZVIA 4DV1E 3QT7A 4JV5I 2UUAE 1ZM4A 1MX0A 2VQEE 2E5LI 5GMEA 2HFUA 4PRXA 1B62A 4PRVA 4YY3I 1UEKA 2HK3A 1ZXMA 2LJPA 4NXME 1N32I 1A6FA 4B3RI 1Z0GA 4JI7I 1MU5A 2UXBE 4GKKE 5A2QQ 4GKJI 2UUBI 5IWAI 4DR3I 2VF3A 4JI3I 2DEJA 2F4VI 3J80Q 4DR5E 4LFBI 4FWGA 4NXNI 1K47A 4JI8E 4LFCI 4X66I 1I94I 1EA6A 3JAMQ 4DV2I 2HK2A 3OTOE 4DV3I 2X36A 1HNZE 3M6AA 4DUZE 2UUCE 2HKEA 5A2QC 1XNQI 4DUYI 4DV6I 5GMDA 4DR6I 3QT8A 2VQFE 4HACA 4X62I 1KIJA 3PYFA 4B3MI 1XMOE 4LF6I 1MG7A 1XNRE 4X65I 4JI0E 1BKNA 2WW4A 3ZZ0A 3JAMC 4B3TE 5LMUI 4DV5I 3Q1QA 3T1YI
chains in the Genus database with same CATH superfamily
2R3VA 3ZZUA 4K0KI 4DV7I 1Z5BA 2O1TA 2Z5BA 1N34E 1FKAE 1ZM9A 1NHHA 5BR8I 2OI2A 3DD6A 1N36I 4LF4I 2JE6A 1EI1A 5LMNI 3B78A 4JI5I 1HK7A 2ZM6I 1XMQI 1USVA 4R1FA 4JI1I 4LFAI 2V34A 1KTVA 1QZRA 1UDOA 2AJ4A 4WUDA 3T1HE 5ELWA 1HNXI 2PNLA 1N33E 1IBLI 2UU9E 2UXCE 2J7KA 1Z0WA 1IBMI 3M85D 4DR7E 4FWDA 1Y4UA 4QNJA 2BM1A 1N0UA 2JEBA 4I3HA 4U3DA 3U1KA 4FWHA 3J7AM 5DRPA 5IT9C 4UTGA 4JI6E 5JEAC 3P06A 4IZKA 4JI4I 2PO2A 4YY3E 4YHHE 2HHHE 4LCFA 4PU9A 4MYUA 4FW3A 5FLXC 2XEXA 2VQEI 2BA1G 3WU5A 2E1RA 3HULA 2Z5CB 2BR2A 1RHYA 4JI7E 4UT4A 1ZM2A 4OO1E 1HNWE 2PO0A 1FI4A 5DRRA 4MU0A 3K85A 2AE8A 1KKHA 5LL6R 5JEAB 4JI3E 1IBKI 3WU3A 2C39A 2J65A 3Q6MA 5EKWA 4GKKI 3PYGA 2C39B 4NXNE 1ELOA 3P76A 4P52A 4LFCE 4JYAI 5K36B 3GMEA 2BV3A 1Z0CA 1XXEA 3GONA 2IERA 3LPSA 2Z5EA 4DR5I 2PNMA 4DXLA 4AIDA 3ZZTA 1OYPA 4QNKA 3PS3A 4DV3E 2ZITA 4AQYI 1R6LA 3PYDA 1R6MA 5C0XC 4IZJB 1ZXNA 4LF7E 4IFDF 3HKMA 4B3SE 1FJGE 4WUBA 4OO1D 2NN6F 5L3JA 3H1CA 4LF5E 1XNQE 4DR2E 1NZ0A 4HACB 3J80C 4DR6E 1HNZI 4DR4E 1RREA 2BM0A 2Q2EB 3PS1A 4OZEA 4X62E 1S16A 2WP8A 3M85G 3KRNA 4DUZI 1HR0I 4DV4E 2PNZA 3K17A 2CZ9A 1Y5YA 4B3ME 3B8HA 4USKA 4KHPI 1RR9A 3P3GA 1J5EE 3J7AG 2ZBKB 4KQVA 4DPXA 1KVKA 4X64I 4IFDA 4M1KA 2C38A 1XMOI 2NN6A 1E3HA 2R42A 3V2UC 4RPFA 5C0XB 1XNRI 4P7AA 4OX9E 2JEAA 4JI0I 5LMUE 4JG4A 4DR1I 1H7SA 4GQUA 2IOQA 4JI2E 1H74A 1U2RA 2Z5BB 4K0KE 4B3TI 3J81Q 4MU1A 4DPYA 1P42A 2JE6B 1VI7A 2O3ZA 5BR8E 3ZM7A 3ZKDA 1Z0VA 2GS8A 1Y60A 1Y4SA 2V2ZA 3H4LA 4MYTA 4ED4A 1B63A 2CVEA 3M7NG 1PVGA 2IESA 4XTJA 1N34I 2WNRA 4LFAE 4LCGA 4FW5A 2CGEA 2HFSA 2UXDE 5JEAE 1UDNA 4DV0E 1FWLA 2VESA 4FW7A 2EFGA 4HY1A 2X7IA 1IBME 1Z0TA 3CWVA 3LNUA 4FW6A 4LF9I 2JEBB 1WUUA 4JV5E 1N33I 4LF8I 2UU9I 2E5LE 1N0VC 4DV1I 2DEIA 4HYMA 3WU4A 4DR7I 1E3PA 4IZKB 5DRQA 2PO2B 2BA0D 2UUAI 1UDQA 4JI4E 5K36C 3B4TA 4JI6I 4USMA 1N32E 5DNXA 2HKJA 3B82A 4YHHI 3PYEA 2HHHI 4B3RE 3QT5A 5JEAD 2BR2B 2NPFA 1Z5CA 4BA2A 4NXMI 4GKJE 2UUBE 1FWKA 2PO0B 3M7ND 5IWAE 4DR3E 1FNMA 1USUA 5K36D 3P3CA 3WU6A 4DU7A 2UXBI 2F4VE 4LCHA 2F1DA 4FW9A 4LFBE 1IBKE 1VISA 3QT6A 4URLA 4Z7CA 1HNWI 4X66E 2A2DA 2C37A 5C0XE 1I94E 4JYAE 1PIEA 4JI8I 4DV2E 3L7ZA 1ZM3A 4N3OA 4BA1A 4IZJD 2GO3A 4EMDA 1H7UA 4IFDC 1Z5AA 3K1JA 4Z7YA 3OTOI 4AQYE 2PO1A 4OO1F 4DUYE 4MU3A 4DV6E 1Z59A 4FN5A 3HJCA 5EL9A 4FW4A 2UUCI 2WP8B 1NHJA 2PNZB 4LF7I 1HR0E 4LF6E 4B3SI 1FJGI 2VQFI 3PS2A 4X65E 4LF5I 4DR2I 5C0XD 1Z0BA 4KHPE 4DR4I 1YH8A 4IFDB 2C38B 4OO1A 3UHMA 4DV4I 2NN6B 4X64E 2BA0G 3U1YA 3D4JA 4DV5E 3T1YE 1J5EI 2JEAB 4LPFA 4MDTA 3GLLA 4DPTA 1PKPA 4DU8A 4DR1E 2GQ0A 4DV7E 4HXZA 1OJ4A 1H73A 4OX9I 1N36E 4LF4E 5LMNE 4JI5E 4AIMA 2V2VA 1NHIA 2A2CA 3LTOA 2ZM6E 1XMQE 1UDSA 4JI1E 3GCMA 4JI2I 4NBQA 4WUCA 1H72C 2WNRB 5FWKA 5IT9Q 1D6TA 1HNXE 1Z0EA 2V2QA 2CG9A 3V5RA 1IBLE 1S4EA 5FLXQ 4DPUA 3T1HI 1XHKA 3ZKBA 1DARA 5K36E 2V8PA 4DPWA 2GO4A 3P3EA 2UXDI 2UXCI 4LF9E 4DV0I 3F0NA 3J81C 4LF8E 4ZVIA 2JT2A 4DV1E 4ISAA 3QT7A 1OYSA 4JV5I 2UUAE 1ZM4A 1MX0A 2VQEE 2E5LI 5GMEA 2HFUA 3PRYA 1B62A 4PRXA 4PRVA 4YY3I 1UEKA 2HK3A 5JEAF 3CDJA 4MU4A 4BA2B 1ZXMA 2LJPA 1YHCA 4NXME 1N32I 3NZKA 2O1WA 1A6FA 5K36F 2Z5CA 4B3RI 1Z0GA 4JI7I 1MU5A 2UXBE 4GKKE 4IFDE 5A2QQ 3Q6NA 4GKJI 2UUBI 2NN6E 4U3BA 5IWAI 4DR3I 2VF3A 2C37B 4JI3I 2O1VA 5JEAA 2DEJA 2F4VI 3J80Q 5DROA 4DR5E 4LFBI 4FWGA 4NXNI 1K47A 4JI8E 3L7ZB 5DNLA 4BA1B 4LFCI 4X66I 2NN6C 5K36A 1I94I 4OO1C 2IOPA 1EA6A 3JAMQ 4DV2I 2PO1B 1OYRA 2HK2A 3OTOE 4DV3I 2X36A 4OKGA 3M6AA 1HNZE 4DUZE 4IZJA 2UUCE 2HKEA 4IFDD 5A2QC 1XNQI 2NN6D 4DUYI 4DV6I 5GMDA 4DR6I 4AM3A 3QT8A 4MQYA 2BA1D 3CDIA 5C0XF 4HACA 4X62I 2VQFE 1KIJA 4LOMA 3PYFA 1Y6ZA 4B3MI 4OO1B 1XMOE 4LF6I 1MG7A 1XNRE 2O1UA 4X65I 4JI0E 1BKNA 2WW4A 3ZZ0A 3JAMC 4IS9A 4J3DA 4B3TE 5LMUI 4DV5I 3Q1QA 5C0XA 3T1YI
chains in the Genus database with same CATH topology
2R3VA 3ZZUA 4K0KI 4DV7I 1Z5BA 2O1TA 2Z5BA 1N34E 1FKAE 1ZM9A 1NHHA 5BR8I 2OI2A 1N36I 4LF4I 1EI1A 5LMNI 3B78A 4JI5I 1HK7A 2ZM6I 1XMQI 1USVA 4R1FA 4JI1I 4LFAI 2V34A 1KTVA 1QZRA 2AJ4A 4WUDA 3T1HE 1HNXI 2PNLA 1N33E 1IBLI 2UU9E 2UXCE 2J7KA 1Z0WA 1IBMI 4DR7E 4FWDA 1Y4UA 2BM1A 1N0UA 4I3HA 4FWHA 3J7AM 5IT9C 4UTGA 4JI6E 3P06A 4IZKA 4JI4I 4YY3E 4YHHE 2HHHE 4PU9A 4MYUA 5FLXC 2XEXA 2VQEI 3WU5A 2E1RA 3HULA 2Z5CB 4JI7E 4UT4A 1ZM2A 1HNWE 1FI4A 3K85A 1KKHA 5LL6R 4JI3E 1IBKI 3WU3A 3Q6MA 4GKKI 3PYGA 4NXNE 1ELOA 4P52A 4LFCE 4JYAI 2BV3A 1Z0CA 3GONA 3LPSA 2Z5EA 4DR5I 2PNMA 4DXLA 3ZZTA 4DV3E 2ZITA 4AQYI 3PYDA 4IZJB 1ZXNA 4LF7E 4B3SE 1FJGE 4WUBA 5L3JA 4LF5E 1XNQE 4DR2E 1NZ0A 4HACB 3J80C 4DR6E 1HNZI 4DR4E 1RREA 2BM0A 2Q2EB 4DUZI 4X62E 1S16A 1HR0I 4DV4E 3K17A 2CZ9A 4B3ME 3B8HA 4USKA 4KHPI 1RR9A 1J5EE 3J7AG 2ZBKB 4KQVA 4DPXA 1KVKA 4X64I 4M1KA 1XMOI 2R42A 3V2UC 4RPFA 1XNRI 4P7AA 4OX9E 4JI0I 5LMUE 4JG4A 4DR1I 1H7SA 2IOQA 4JI2E 1H74A 1U2RA 2Z5BB 4K0KE 4B3TI 3J81Q 4DPYA 3ZM7A 5BR8E 3ZKDA 1Z0VA 2GS8A 1Y4SA 2V2ZA 3H4LA 4MYTA 4ED4A 1B63A 1PVGA 4XTJA 1N34I 4LFAE 2CGEA 2HFSA 2UXDE 4DV0E 1FWLA 2EFGA 4HY1A 2X7IA 1IBME 1Z0TA 3CWVA 3LNUA 4LF9I 1WUUA 4JV5E 1N33I 4LF8I 2UU9I 2E5LE 1N0VC 4DV1I 2DEIA 4HYMA 3WU4A 4DR7I 4IZKB 2UUAI 4JI4E 4JI6I 4USMA 1N32E 2HKJA 3B82A 4YHHI 3PYEA 2HHHI 4B3RE 3QT5A 2NPFA 1Z5CA 4NXMI 4GKJE 2UUBE 1FWKA 4DR3E 5IWAE 1FNMA 1USUA 3WU6A 4DU7A 2UXBI 2F4VE 4FW9A 4LFBE 1IBKE 1VISA 3QT6A 4URLA 4Z7CA 1HNWI 4X66E 2A2DA 1I94E 4JYAE 1PIEA 4JI8I 4DV2E 1ZM3A 4N3OA 4IZJD 4EMDA 1H7UA 1Z5AA 3K1JA 4Z7YA 3OTOI 4AQYE 4DUYE 4DV6E 1Z59A 4FN5A 3HJCA 2UUCI 1NHJA 4LF7I 1HR0E 4LF6E 4B3SI 1FJGI 2VQFI 4X65E 4LF5I 4DR2I 1Z0BA 4KHPE 4DR4I 4DV4I 4X64E 3D4JA 4DV5E 3T1YE 1J5EI 4DPTA 1PKPA 4DU8A 4DR1E 2GQ0A 4DV7E 4HXZA 1OJ4A 1H73A 4OX9I 1N36E 4LF4E 5LMNE 4JI5E 2V2VA 1NHIA 2A2CA 3LTOA 2ZM6E 1XMQE 4JI1E 4JI2I 4WUCA 1H72C 5FWKA 5IT9Q 1D6TA 1HNXE 1Z0EA 2V2QA 2CG9A 3V5RA 1IBLE 1S4EA 5FLXQ 4DPUA 3T1HI 1XHKA 3ZKBA 1DARA 2V8PA 4DPWA 2UXDI 2UXCI 4LF9E 4DV0I 3F0NA 3J81C 4LF8E 4ZVIA 4DV1E 3QT7A 4JV5I 2UUAE 1ZM4A 1MX0A 2VQEE 2E5LI 5GMEA 2HFUA 3PRYA 1B62A 4PRXA 4PRVA 4YY3I 1UEKA 2HK3A 1ZXMA 2LJPA 4NXME 1N32I 2O1WA 1A6FA 2Z5CA 4B3RI 1Z0GA 4JI7I 1MU5A 2UXBE 4GKKE 5A2QQ 3Q6NA 4GKJI 2UUBI 5IWAI 4DR3I 2VF3A 4JI3I 2O1VA 2DEJA 2F4VI 3J80Q 4DR5E 4LFBI 4FWGA 4NXNI 1K47A 4JI8E 4LFCI 4X66I 1I94I 2IOPA 1EA6A 3JAMQ 4DV2I 2HK2A 3OTOE 4DV3I 2X36A 1HNZE 3M6AA 4DUZE 4IZJA 2UUCE 2HKEA 5A2QC 1XNQI 4DUYI 4DV6I 5GMDA 4DR6I 3QT8A 2VQFE 4HACA 4X62I 1KIJA 3PYFA 1Y6ZA 4B3MI 1XMOE 4LF6I 1MG7A 1XNRE 2O1UA 4X65I 4JI0E 1BKNA 2WW4A 3ZZ0A 3JAMC 4B3TE 5LMUI 4DV5I 3Q1QA 3T1YI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3V A;  3ZZU A;  4K0K I;  4DV7 I;  1Z5B A;  1N34 E;  1FKA E;  1ZM9 A;  1NHH A;  5BR8 I;  2OI2 A;  1N36 I;  4LF4 I;  1EI1 A;  5LMN I;  3B78 A;  4JI5 I;  2ZM6 I;  1XMQ I;  4R1F A;  4JI1 I;  4LFA I;  2V34 A;  1KTV A;  1QZR A;  2AJ4 A;  4WUD A;  3T1H E;  1HNX I;  1N33 E;  1IBL I;  2UU9 E;  2UXC E;  2J7K A;  1Z0W A;  1IBM I;  4DR7 E;  4FWD A;  2BM1 A;  1N0U A;  4I3H A;  4FWH A;  3J7A M;  5IT9 C;  4UTG A;  4JI6 E;  4JI4 I;  4YY3 E;  4YHH E;  2HHH E;  4PU9 A;  4MYU A;  5FLX C;  2XEX A;  2VQE I;  3WU5 A;  2E1R A;  3HUL A;  4JI7 E;  4UT4 A;  1ZM2 A;  1HNW E;  1FI4 A;  1KKH A;  5LL6 R;  4JI3 E;  1IBK I;  3WU3 A;  4GKK I;  3PYG A;  4NXN E;  1ELO A;  4P52 A;  4LFC E;  4JYA I;  2BV3 A;  1Z0C A;  3GON A;  3LPS A;  4DR5 I;  4DXL A;  3ZZT A;  4DV3 E;  2ZIT A;  4AQY I;  3PYD A;  1ZXN A;  4LF7 E;  4B3S E;  1FJG E;  4WUB A;  5L3J A;  4LF5 E;  1XNQ E;  4DR2 E;  1NZ0 A;  4HAC B;  3J80 C;  4DR6 E;  1HNZ I;  4DR4 E;  1RRE A;  2BM0 A;  2Q2E B;  4DUZ I;  4X62 E;  1S16 A;  1HR0 I;  4DV4 E;  3K17 A;  2CZ9 A;  4B3M E;  3B8H A;  4USK A;  4KHP I;  1RR9 A;  1J5E E;  3J7A G;  2ZBK B;  4KQV A;  4DPX A;  1KVK A;  4X64 I;  4M1K A;  1XMO I;  2R42 A;  3V2U C;  4RPF A;  1XNR I;  4P7A A;  4OX9 E;  4JI0 I;  5LMU E;  4JG4 A;  4DR1 I;  1H7S A;  4JI2 E;  1H74 A;  1U2R A;  4K0K E;  4B3T I;  3J81 Q;  4DPY A;  3ZM7 A;  5BR8 E;  3ZKD A;  1Z0V A;  2GS8 A;  3H4L A;  2V2Z A;  4MYT A;  4ED4 A;  1B63 A;  1PVG A;  4XTJ A;  1N34 I;  4LFA E;  2HFS A;  2UXD E;  4DV0 E;  1FWL A;  2EFG A;  4HY1 A;  2X7I A;  1IBM E;  1Z0T A;  3CWV A;  3LNU A;  4LF9 I;  1WUU A;  4JV5 E;  1N33 I;  4LF8 I;  2UU9 I;  2E5L E;  1N0V C;  4DV1 I;  2DEI A;  4HYM A;  3WU4 A;  4DR7 I;  2UUA I;  4JI4 E;  4JI6 I;  4USM A;  1N32 E;  2HKJ A;  3B82 A;  4YHH I;  3PYE A;  2HHH I;  4B3R E;  3QT5 A;  2NPF A;  1Z5C A;  4NXM I;  4GKJ E;  2UUB E;  1FWK A;  4DR3 E;  5IWA E;  1FNM A;  3WU6 A;  4DU7 A;  2UXB I;  2F4V E;  4FW9 A;  4LFB E;  1IBK E;  1VIS A;  3QT6 A;  4URL A;  4Z7C A;  1HNW I;  4X66 E;  2A2D A;  1I94 E;  4JYA E;  1PIE A;  4JI8 I;  4DV2 E;  1ZM3 A;  4EMD A;  1H7U A;  1Z5A A;  3K1J A;  4Z7Y A;  3OTO I;  4AQY E;  4DUY E;  4DV6 E;  1Z59 A;  4FN5 A;  2UUC I;  1NHJ A;  4LF7 I;  1HR0 E;  4LF6 E;  4B3S I;  1FJG I;  2VQF I;  4X65 E;  4LF5 I;  4DR2 I;  1Z0B A;  4KHP E;  4DR4 I;  4DV4 I;  4X64 E;  3D4J A;  4DV5 E;  3T1Y E;  1J5E I;  4DPT A;  1PKP A;  4DU8 A;  4DR1 E;  4DV7 E;  4HXZ A;  1OJ4 A;  1H73 A;  4OX9 I;  1N36 E;  4LF4 E;  5LMN E;  4JI5 E;  2V2V A;  1NHI A;  2A2C A;  3LTO A;  2ZM6 E;  1XMQ E;  4JI1 E;  4JI2 I;  4WUC A;  1H72 C;  5IT9 Q;  1D6T A;  1HNX E;  1Z0E A;  2V2Q A;  3V5R A;  1IBL E;  1S4E A;  5FLX Q;  4DPU A;  3T1H I;  1XHK A;  3ZKB A;  1DAR A;  2V8P A;  4DPW A;  2UXD I;  2UXC I;  4LF9 E;  4DV0 I;  3F0N A;  3J81 C;  4LF8 E;  4ZVI A;  4DV1 E;  3QT7 A;  4JV5 I;  2UUA E;  1ZM4 A;  1MX0 A;  2VQE E;  2E5L I;  5GME A;  2HFU A;  4PRX A;  1B62 A;  4PRV A;  4YY3 I;  1UEK A;  2HK3 A;  1ZXM A;  2LJP A;  4NXM E;  1N32 I;  1A6F A;  4B3R I;  1Z0G A;  4JI7 I;  1MU5 A;  2UXB E;  4GKK E;  5A2Q Q;  4GKJ I;  2UUB I;  5IWA I;  4DR3 I;  2VF3 A;  4JI3 I;  2DEJ A;  2F4V I;  3J80 Q;  4DR5 E;  4LFB I;  4FWG A;  4NXN I;  1K47 A;  4JI8 E;  4LFC I;  4X66 I;  1I94 I;  1EA6 A;  3JAM Q;  4DV2 I;  2HK2 A;  3OTO E;  4DV3 I;  2X36 A;  1HNZ E;  3M6A A;  4DUZ E;  2UUC E;  2HKE A;  5A2Q C;  1XNQ I;  4DUY I;  4DV6 I;  5GMD A;  4DR6 I;  3QT8 A;  2VQF E;  4HAC A;  4X62 I;  1KIJ A;  3PYF A;  4B3M I;  1XMO E;  4LF6 I;  1MG7 A;  1XNR E;  4X65 I;  4JI0 E;  1BKN A;  2WW4 A;  3ZZ0 A;  3JAM C;  4B3T E;  5LMU I;  4DV5 I;  3Q1Q A;  3T1Y I; 
#chains in the Genus database with same CATH topology
 2R3V A;  3ZZU A;  4K0K I;  4DV7 I;  1Z5B A;  2O1T A;  2Z5B A;  1N34 E;  1FKA E;  1ZM9 A;  1NHH A;  5BR8 I;  2OI2 A;  3DD6 A;  1N36 I;  4LF4 I;  2JE6 A;  1EI1 A;  5LMN I;  3B78 A;  4JI5 I;  1HK7 A;  2ZM6 I;  1XMQ I;  1USV A;  4R1F A;  4JI1 I;  4LFA I;  2V34 A;  1KTV A;  1QZR A;  1UDO A;  2AJ4 A;  4WUD A;  3T1H E;  5ELW A;  1HNX I;  2PNL A;  1N33 E;  1IBL I;  2UU9 E;  2UXC E;  2J7K A;  1Z0W A;  1IBM I;  3M85 D;  4DR7 E;  4FWD A;  1Y4U A;  4QNJ A;  2BM1 A;  1N0U A;  2JEB A;  4I3H A;  4U3D A;  3U1K A;  4FWH A;  3J7A M;  5DRP A;  5IT9 C;  4UTG A;  4JI6 E;  5JEA C;  3P06 A;  4IZK A;  4JI4 I;  2PO2 A;  4YY3 E;  4YHH E;  2HHH E;  4LCF A;  4PU9 A;  4MYU A;  4FW3 A;  5FLX C;  2XEX A;  2VQE I;  2BA1 G;  3WU5 A;  2E1R A;  3HUL A;  2Z5C B;  2BR2 A;  1RHY A;  4JI7 E;  4UT4 A;  1ZM2 A;  4OO1 E;  1HNW E;  2PO0 A;  1FI4 A;  5DRR A;  4MU0 A;  3K85 A;  2AE8 A;  1KKH A;  5LL6 R;  5JEA B;  4JI3 E;  1IBK I;  3WU3 A;  2C39 A;  2J65 A;  3Q6M A;  5EKW A;  4GKK I;  3PYG A;  2C39 B;  4NXN E;  1ELO A;  3P76 A;  4P52 A;  4LFC E;  4JYA I;  5K36 B;  3GME A;  2BV3 A;  1Z0C A;  1XXE A;  3GON A;  2IER A;  3LPS A;  2Z5E A;  4DR5 I;  2PNM A;  4DXL A;  4AID A;  3ZZT A;  1OYP A;  4QNK A;  3PS3 A;  4DV3 E;  2ZIT A;  4AQY I;  1R6L A;  3PYD A;  1R6M A;  5C0X C;  4IZJ B;  1ZXN A;  4LF7 E;  4IFD F;  3HKM A;  4B3S E;  1FJG E;  4WUB A;  4OO1 D;  2NN6 F;  5L3J A;  3H1C A;  4LF5 E;  1XNQ E;  4DR2 E;  1NZ0 A;  4HAC B;  3J80 C;  4DR6 E;  1HNZ I;  4DR4 E;  1RRE A;  2BM0 A;  2Q2E B;  3PS1 A;  4OZE A;  4X62 E;  1S16 A;  2WP8 A;  3M85 G;  3KRN A;  4DUZ I;  1HR0 I;  4DV4 E;  2PNZ A;  3K17 A;  2CZ9 A;  1Y5Y A;  4B3M E;  3B8H A;  4USK A;  4KHP I;  1RR9 A;  3P3G A;  1J5E E;  3J7A G;  2ZBK B;  4KQV A;  4DPX A;  1KVK A;  4X64 I;  4IFD A;  4M1K A;  2C38 A;  1XMO I;  2NN6 A;  1E3H A;  2R42 A;  3V2U C;  4RPF A;  5C0X B;  1XNR I;  4P7A A;  4OX9 E;  2JEA A;  4JI0 I;  5LMU E;  4JG4 A;  4DR1 I;  1H7S A;  4GQU A;  2IOQ A;  4JI2 E;  1H74 A;  1U2R A;  2Z5B B;  4K0K E;  4B3T I;  3J81 Q;  4MU1 A;  4DPY A;  1P42 A;  2JE6 B;  1VI7 A;  2O3Z A;  5BR8 E;  3ZM7 A;  3ZKD A;  1Z0V A;  2GS8 A;  1Y60 A;  1Y4S A;  2V2Z A;  3H4L A;  4MYT A;  4ED4 A;  1B63 A;  2CVE A;  3M7N G;  1PVG A;  2IES A;  4XTJ A;  1N34 I;  2WNR A;  4LFA E;  4LCG A;  4FW5 A;  2CGE A;  2HFS A;  2UXD E;  5JEA E;  1UDN A;  4DV0 E;  1FWL A;  2VES A;  4FW7 A;  2EFG A;  4HY1 A;  2X7I A;  1IBM E;  1Z0T A;  3CWV A;  3LNU A;  4FW6 A;  4LF9 I;  2JEB B;  1WUU A;  4JV5 E;  1N33 I;  4LF8 I;  2UU9 I;  2E5L E;  1N0V C;  4DV1 I;  2DEI A;  4HYM A;  3WU4 A;  4DR7 I;  1E3P A;  4IZK B;  5DRQ A;  2PO2 B;  2BA0 D;  2UUA I;  1UDQ A;  4JI4 E;  5K36 C;  3B4T A;  4JI6 I;  4USM A;  1N32 E;  5DNX A;  2HKJ A;  3B82 A;  4YHH I;  3PYE A;  2HHH I;  4B3R E;  3QT5 A;  5JEA D;  2BR2 B;  2NPF A;  1Z5C A;  4BA2 A;  4NXM I;  4GKJ E;  2UUB E;  1FWK A;  2PO0 B;  3M7N D;  5IWA E;  4DR3 E;  1FNM A;  1USU A;  5K36 D;  3P3C A;  3WU6 A;  4DU7 A;  2UXB I;  2F4V E;  4LCH A;  2F1D A;  4FW9 A;  4LFB E;  1IBK E;  1VIS A;  3QT6 A;  4URL A;  4Z7C A;  1HNW I;  4X66 E;  2A2D A;  2C37 A;  5C0X E;  1I94 E;  4JYA E;  1PIE A;  4JI8 I;  4DV2 E;  3L7Z A;  1ZM3 A;  4N3O A;  4BA1 A;  4IZJ D;  2GO3 A;  4EMD A;  1H7U A;  4IFD C;  1Z5A A;  3K1J A;  4Z7Y A;  3OTO I;  4AQY E;  2PO1 A;  4OO1 F;  4DUY E;  4MU3 A;  4DV6 E;  1Z59 A;  4FN5 A;  3HJC A;  5EL9 A;  4FW4 A;  2UUC I;  2WP8 B;  1NHJ A;  2PNZ B;  4LF7 I;  1HR0 E;  4LF6 E;  4B3S I;  1FJG I;  2VQF I;  3PS2 A;  4X65 E;  4LF5 I;  4DR2 I;  5C0X D;  1Z0B A;  4KHP E;  4DR4 I;  1YH8 A;  4IFD B;  2C38 B;  4OO1 A;  3UHM A;  4DV4 I;  2NN6 B;  4X64 E;  2BA0 G;  3U1Y A;  3D4J A;  4DV5 E;  3T1Y E;  1J5E I;  2JEA B;  4LPF A;  4MDT A;  3GLL A;  4DPT A;  1PKP A;  4DU8 A;  4DR1 E;  2GQ0 A;  4DV7 E;  4HXZ A;  1OJ4 A;  1H73 A;  4OX9 I;  1N36 E;  4LF4 E;  5LMN E;  4JI5 E;  4AIM A;  2V2V A;  1NHI A;  2A2C A;  3LTO A;  2ZM6 E;  1XMQ E;  1UDS A;  4JI1 E;  3GCM A;  4JI2 I;  4NBQ A;  4WUC A;  1H72 C;  2WNR B;  5FWK A;  5IT9 Q;  1D6T A;  1HNX E;  1Z0E A;  2V2Q A;  2CG9 A;  3V5R A;  1IBL E;  1S4E A;  5FLX Q;  4DPU A;  3T1H I;  1XHK A;  3ZKB A;  1DAR A;  5K36 E;  2V8P A;  4DPW A;  2GO4 A;  3P3E A;  2UXD I;  2UXC I;  4LF9 E;  4DV0 I;  3F0N A;  3J81 C;  4LF8 E;  4ZVI A;  2JT2 A;  4DV1 E;  4ISA A;  3QT7 A;  1OYS A;  4JV5 I;  2UUA E;  1ZM4 A;  1MX0 A;  2VQE E;  2E5L I;  5GME A;  2HFU A;  3PRY A;  1B62 A;  4PRX A;  4PRV A;  4YY3 I;  1UEK A;  2HK3 A;  5JEA F;  3CDJ A;  4MU4 A;  4BA2 B;  1ZXM A;  2LJP A;  1YHC A;  4NXM E;  1N32 I;  3NZK A;  2O1W A;  1A6F A;  5K36 F;  2Z5C A;  4B3R I;  1Z0G A;  4JI7 I;  1MU5 A;  2UXB E;  4GKK E;  4IFD E;  5A2Q Q;  3Q6N A;  4GKJ I;  2UUB I;  2NN6 E;  4U3B A;  5IWA I;  4DR3 I;  2VF3 A;  2C37 B;  4JI3 I;  2O1V A;  5JEA A;  2DEJ A;  2F4V I;  3J80 Q;  5DRO A;  4DR5 E;  4LFB I;  4FWG A;  4NXN I;  1K47 A;  4JI8 E;  3L7Z B;  5DNL A;  4BA1 B;  4LFC I;  4X66 I;  2NN6 C;  5K36 A;  1I94 I;  4OO1 C;  2IOP A;  1EA6 A;  3JAM Q;  4DV2 I;  2PO1 B;  1OYR A;  2HK2 A;  3OTO E;  4DV3 I;  2X36 A;  4OKG A;  3M6A A;  1HNZ E;  4DUZ E;  4IZJ A;  2UUC E;  2HKE A;  4IFD D;  5A2Q C;  1XNQ I;  2NN6 D;  4DUY I;  4DV6 I;  5GMD A;  4DR6 I;  4AM3 A;  3QT8 A;  4MQY A;  2BA1 D;  3CDI A;  5C0X F;  4HAC A;  4X62 I;  2VQF E;  1KIJ A;  4LOM A;  3PYF A;  1Y6Z A;  4B3M I;  4OO1 B;  1XMO E;  4LF6 I;  1MG7 A;  1XNR E;  2O1U A;  4X65 I;  4JI0 E;  1BKN A;  2WW4 A;  3ZZ0 A;  3JAM C;  4IS9 A;  4J3D A;  4B3T E;  5LMU I;  4DV5 I;  3Q1Q A;  5C0X A;  3T1Y I; 
#chains in the Genus database with same CATH homology
 2R3V A;  3ZZU A;  4K0K I;  4DV7 I;  1Z5B A;  2O1T A;  2Z5B A;  1N34 E;  1FKA E;  1ZM9 A;  1NHH A;  5BR8 I;  2OI2 A;  1N36 I;  4LF4 I;  1EI1 A;  5LMN I;  3B78 A;  4JI5 I;  1HK7 A;  2ZM6 I;  1XMQ I;  1USV A;  4R1F A;  4JI1 I;  4LFA I;  2V34 A;  1KTV A;  1QZR A;  2AJ4 A;  4WUD A;  3T1H E;  1HNX I;  2PNL A;  1N33 E;  1IBL I;  2UU9 E;  2UXC E;  2J7K A;  1Z0W A;  1IBM I;  4DR7 E;  4FWD A;  1Y4U A;  2BM1 A;  1N0U A;  4I3H A;  4FWH A;  3J7A M;  5IT9 C;  4UTG A;  4JI6 E;  3P06 A;  4IZK A;  4JI4 I;  4YY3 E;  4YHH E;  2HHH E;  4PU9 A;  4MYU A;  5FLX C;  2XEX A;  2VQE I;  3WU5 A;  2E1R A;  3HUL A;  2Z5C B;  4JI7 E;  4UT4 A;  1ZM2 A;  1HNW E;  1FI4 A;  3K85 A;  1KKH A;  5LL6 R;  4JI3 E;  1IBK I;  3WU3 A;  3Q6M A;  4GKK I;  3PYG A;  4NXN E;  1ELO A;  4P52 A;  4LFC E;  4JYA I;  2BV3 A;  1Z0C A;  3GON A;  3LPS A;  2Z5E A;  4DR5 I;  2PNM A;  4DXL A;  3ZZT A;  4DV3 E;  2ZIT A;  4AQY I;  3PYD A;  4IZJ B;  1ZXN A;  4LF7 E;  4B3S E;  1FJG E;  4WUB A;  5L3J A;  4LF5 E;  1XNQ E;  4DR2 E;  1NZ0 A;  4HAC B;  3J80 C;  4DR6 E;  1HNZ I;  4DR4 E;  1RRE A;  2BM0 A;  2Q2E B;  4DUZ I;  4X62 E;  1S16 A;  1HR0 I;  4DV4 E;  3K17 A;  2CZ9 A;  4B3M E;  3B8H A;  4USK A;  4KHP I;  1RR9 A;  1J5E E;  3J7A G;  2ZBK B;  4KQV A;  4DPX A;  1KVK A;  4X64 I;  4M1K A;  1XMO I;  2R42 A;  3V2U C;  4RPF A;  1XNR I;  4P7A A;  4OX9 E;  4JI0 I;  5LMU E;  4JG4 A;  4DR1 I;  1H7S A;  2IOQ A;  4JI2 E;  1H74 A;  1U2R A;  2Z5B B;  4K0K E;  4B3T I;  3J81 Q;  4DPY A;  3ZM7 A;  5BR8 E;  3ZKD A;  1Z0V A;  2GS8 A;  1Y4S A;  2V2Z A;  3H4L A;  4MYT A;  4ED4 A;  1B63 A;  1PVG A;  4XTJ A;  1N34 I;  4LFA E;  2CGE A;  2HFS A;  2UXD E;  4DV0 E;  1FWL A;  2EFG A;  4HY1 A;  2X7I A;  1IBM E;  1Z0T A;  3CWV A;  3LNU A;  4LF9 I;  1WUU A;  4JV5 E;  1N33 I;  4LF8 I;  2UU9 I;  2E5L E;  1N0V C;  4DV1 I;  2DEI A;  4HYM A;  3WU4 A;  4DR7 I;  4IZK B;  2UUA I;  4JI4 E;  4JI6 I;  4USM A;  1N32 E;  2HKJ A;  3B82 A;  4YHH I;  3PYE A;  2HHH I;  4B3R E;  3QT5 A;  2NPF A;  1Z5C A;  4NXM I;  4GKJ E;  2UUB E;  1FWK A;  4DR3 E;  5IWA E;  1FNM A;  1USU A;  3WU6 A;  4DU7 A;  2UXB I;  2F4V E;  4FW9 A;  4LFB E;  1IBK E;  1VIS A;  3QT6 A;  4URL A;  4Z7C A;  1HNW I;  4X66 E;  2A2D A;  1I94 E;  4JYA E;  1PIE A;  4JI8 I;  4DV2 E;  1ZM3 A;  4N3O A;  4IZJ D;  4EMD A;  1H7U A;  1Z5A A;  3K1J A;  4Z7Y A;  3OTO I;  4AQY E;  4DUY E;  4DV6 E;  1Z59 A;  4FN5 A;  3HJC A;  2UUC I;  1NHJ A;  4LF7 I;  1HR0 E;  4LF6 E;  4B3S I;  1FJG I;  2VQF I;  4X65 E;  4LF5 I;  4DR2 I;  1Z0B A;  4KHP E;  4DR4 I;  4DV4 I;  4X64 E;  3D4J A;  4DV5 E;  3T1Y E;  1J5E I;  4DPT A;  1PKP A;  4DU8 A;  4DR1 E;  2GQ0 A;  4DV7 E;  4HXZ A;  1OJ4 A;  1H73 A;  4OX9 I;  1N36 E;  4LF4 E;  5LMN E;  4JI5 E;  2V2V A;  1NHI A;  2A2C A;  3LTO A;  2ZM6 E;  1XMQ E;  4JI1 E;  4JI2 I;  4WUC A;  1H72 C;  5FWK A;  5IT9 Q;  1D6T A;  1HNX E;  1Z0E A;  2V2Q A;  2CG9 A;  3V5R A;  1IBL E;  1S4E A;  5FLX Q;  4DPU A;  3T1H I;  1XHK A;  3ZKB A;  1DAR A;  2V8P A;  4DPW A;  2UXD I;  2UXC I;  4LF9 E;  4DV0 I;  3F0N A;  3J81 C;  4LF8 E;  4ZVI A;  4DV1 E;  3QT7 A;  4JV5 I;  2UUA E;  1ZM4 A;  1MX0 A;  2VQE E;  2E5L I;  5GME A;  2HFU A;  3PRY A;  1B62 A;  4PRX A;  4PRV A;  4YY3 I;  1UEK A;  2HK3 A;  1ZXM A;  2LJP A;  4NXM E;  1N32 I;  2O1W A;  1A6F A;  2Z5C A;  4B3R I;  1Z0G A;  4JI7 I;  1MU5 A;  2UXB E;  4GKK E;  5A2Q Q;  3Q6N A;  4GKJ I;  2UUB I;  5IWA I;  4DR3 I;  2VF3 A;  4JI3 I;  2O1V A;  2DEJ A;  2F4V I;  3J80 Q;  4DR5 E;  4LFB I;  4FWG A;  4NXN I;  1K47 A;  4JI8 E;  4LFC I;  4X66 I;  1I94 I;  2IOP A;  1EA6 A;  3JAM Q;  4DV2 I;  2HK2 A;  3OTO E;  4DV3 I;  2X36 A;  1HNZ E;  3M6A A;  4DUZ E;  4IZJ A;  2UUC E;  2HKE A;  5A2Q C;  1XNQ I;  4DUY I;  4DV6 I;  5GMD A;  4DR6 I;  3QT8 A;  2VQF E;  4HAC A;  4X62 I;  1KIJ A;  3PYF A;  1Y6Z A;  4B3M I;  1XMO E;  4LF6 I;  1MG7 A;  1XNR E;  2O1U A;  4X65 I;  4JI0 E;  1BKN A;  2WW4 A;  3ZZ0 A;  3JAM C;  4B3T E;  5LMU I;  4DV5 I;  3Q1Q A;  3T1Y I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...