3PYEA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
301
structure length
301
Chain Sequence
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 86
structure length 301
sequence length 301
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyeA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyeA01
2UU9E 2F4VI 3H4LA 4JI7E 3M6AA 3T1HE 5LMUE 2R3VA 5LL6R 4NXNE 4DR2E 1I94E 3V5RA 1S16A 4PRVA 3CWVA 2ZM6E 5GMDA 1DARA 4ED4A 4USKA 1BKNA 1XHKA 1J5EE 4X62I 1MX0A 4DR7E 2UXDE 4LF7I 4LFBE 4DPWA 1HR0I 1XMQI 4LF8E 2VQEI 3LTOA 3QT7A 3LNUA 4JI3I 4LFCE 1B63A 4JYAE 1XNQE 1MU5A 4LF4E 4HXZA 2HK2A 4I3HA 4B3RI 4X65I 4JI6I 2VQFI 1N32E 3T1YE 1Z59A 3JAMQ 1S4EA 2X7IA 4LFAI 4DU7A 1N0VC 3OTOE 4WUCA 1N33E 4JI7I 3D4JA 4JI1E 1FJGE 2BV3A 2CZ9A 1NHIA 2ZM6I 1PKPA 4JI4E 5IWAE 5IT9C 4JV5E 3F0NA 4DUZI 4X64I 1IBKE 1K47A 3QT6A 4LFBI 3WU4A 4XTJA 4LF8I 1XMQE 4DV7I 3WU6A 1N34I 1NZ0A 4HACA 2F4VE 2UXCI 3ZM7A 3B78A 4DV4I 4Z7YA 1IBME 2J7KA 3ZKBA 1HR0E 2UUCE 2UUAE 3PYFA 1I94I 4DV0I 1N36E 4NXMI 1ZM2A 4JI0I 4DV3I 4LFCI 1N0UA 2UU9I 1Z5CA 2E5LI 4JG4A 2ZITA 4JI2I 3J81Q 2DEJA 4WUBA 3B8HA 5GMEA 3OTOI 4DUZE 2UUBE 1ZM9A 4JI3E 4HY1A 4DPXA 4MYTA 5L3JA 3PYGA 3T1HI 4JI5E 4DUYE 5BR8I 4NXNI 1XMOE 3PYEA 1D6TA 1H7SA 4DV2I 4DR3E 4JYAI 4Z7CA 2HKEA 4YHHE 5FLXC 1XNQI 2UUAI 5LMUI 3PYDA 4DR5I 1HNXI 1VISA 4KHPE 2GS8A 5LMNI 2V8PA 4DPYA 3JAMC 1J5EI 4DR6I 2A2CA 4OX9I 3Q1QA 1Z0GA 4B3MI 2HHHI 4DV7E 1N34E 4GKKE 2V2ZA 4DV6I 1FJGI 1RREA 4DPTA 4LF6E 4B3TE 5BR8E 4JI6E 5FLXQ 1IBMI 1XNRE 4DV1E 2XEXA 1NHJA 1FNMA 4YY3I 4DV3E 4DPUA 4YHHI 4JI1I 4DV4E 4AQYE 2E5LE 3J7AM 1IBKI 4LF9I 3HULA 4LF5I 1Z5AA 4KHPI 4K0KE 4X64E 1Z5BA 2HFSA 4B3SI 2UXBI 1FKAE 1FWKA 1KTVA 3V2UC 1QZRA 2UUBI 4KQVA 1EA6A 1HNZE 1IBLI 4DV2E 1PVGA 2WW4A 5IT9Q 1Z0CA 2OI2A 4FWDA 5LMNE 4GKJI 1U2RA 4DXLA 3ZZTA 2AJ4A 4DU8A 4DUYI 2VF3A 1EI1A 1KIJA 4HYMA 4PRXA 3ZKDA 4URLA 4B3ME 4DV5E 2A2DA 2NPFA 1B62A 1Z0VA 1H7UA 1HNWE 4JI0E 1ZM4A 4LF6I 1H73A 4P52A 2HK3A 2BM0A 4JI5I 1XNRI 2DEIA 4JI8I 1HNXE 4UTGA 4DR3I 4DR4E 4FW9A 2R42A 4DR6E 4LF7E 1IBLE 4RPFA 2Q2EB 4YY3E 3J80C 4FN5A 4GKKI 4LF5E 4P7AA 2ZBKB 4LF9E 4B3TI 4AQYI 2UXDI 4OX9E 3K17A 4DV5I 1Z0BA 4DR5E 2HHHE 3J7AG 1HNWI 1ZM3A 4X66E 5A2QQ 2VQFE 4X62E 1N32I 4LFAE 2EFGA 4R1FA 1FWLA 3J80Q 2V34A 4ZVIA 1NHHA 4K0KI 4FWGA 4DR7I 2UXBE 4DV6E 2HKJA 4FWHA 2V2QA 4DR1E 1KKHA 4DR2I 1ELOA 4M1KA 4B3SE 1H74A 3WU5A 4DV1I 4MYUA 3ZZ0A 4USMA 4DR4I 1RR9A 1ZXNA 3K1JA 4B3RE 3LPSA 3T1YI 1ZXMA 1HNZI 1UEKA 4LF4I 5A2QC 2UUCI 4DV0E 1H72C 2VQEE 4WUDA 2E1RA 4EMDA 1A6FA 1MG7A 3B82A 1PIEA 4JI2E 4PU9A 1FI4A 4NXME 3GONA 3QT5A 2LJPA 1N33I 4JI4I 1KVKA 2V2VA 1Z0EA 2UXCE 4X66I 3QT8A 4X65E 4UT4A 1Z0TA 2X36A 1Z0WA 3ZZUA 1N36I 4JV5I 3WU3A 1WUUA 2HFUA 4DR1I 4GKJE 1OJ4A 1XMOI 4HACB 3J81C 5IWAI 2BM1A 4JI8E
chains in the Genus database with same CATH superfamily
1HHQA 4AE5A 2F4VI 1CJTB 2QJ3A 3K89A 2DGUA 2IRYA 4JI3F 1I94J 4HT7A 2GO9A 1IQTA 5K9FA 5D4NA 4FW7A 1NCLA 2N3LA 4HLBA 3H4LA 5FWKA 2P6TA 3R97A 4LBHA 2CQ0A 2BE9B 4ZVRB 1HI0P 4RO0A 3M6AA 2ZNYA 1WC0A 3M8PA 1YJNS 2Q3PA 1IUJA 1S1VA 1NDCA 2B5JB 4O3PA 3SDEB 1KONA 4N47A 4M5DA 1S6PA 4CLUA 4LOMA 4ZVOB 2J0SD 2MHNA 3GFYA 4ISAA 1TL7A 3AXMA 5IT4A 5KG7A 2D3OR 2LYVA 3RUBL 4CCHA 4IG0B 2EC0A 1YRXA 3DRPA 4ICLB 3BKFA 3MTJA 3GIIA 2U2FA 4ZPTR 2KB2A 3BDPA 3OFEA 2ZC4A 4USKA 3J7AN 3IRXA 3M7ND 3H4DA 1Q53A 3AOCA 2RQMA 3GG1A 4OLOA 4OYXA 3NS5A 3VGVA 2LQ9A 4X62I 1IKXB 1R27B 1GFWB 3BSNA 3DI6A 2NN6C 3GLLA 1TMJA 2VBYA 3W2WA 7FDRA 2UXDE 1YX2A 3A1YG 2B43A 4TYBA 1Q7YT 2VG5A 4Z2XA 1V9OA 3EZUA 5IT9U 5BXIA 4DWIA 3RB4A 2AMCB 3JAMY 4DR1F 2A3JA 2DTJA 3FQKA 1XMQF 1AW0A 4DN0A 4J9KA 2CJYB 1P9YA 2PO1A 3ZNUA 4MKYA 3SI8A 3P96A 1XNQE 2NUUG 2VFTA 4RW6B 1N54B 1VRTB 2HG4A 1XMBA 4WE1A 2DBBA 3B54A 4JB8B 4ZPVR 5JXSA 5I42A 3HKWA 4FZVA 3KK1A 2ASDA 3T1YE 4QR1A 2GNKA 3SV4A 2XB2D 4RKUC 1YZ7A 1S4EA 2HLUA 1RAIB 2Z0GA 4OHWA 1PAEX 5KG6A 4DU7A 4HVZA 4B3RJ 3P3CA 1RJJA 1VHIA 2IAJA 2IJRA 3MGJA 3OXLA 1FVSA 4O4RA 3L7PA 3P5TL 2XWXA 4USTA 4UZCA 5IV3A 3RG6A 3CJ0A 4ETZA 5F8JA 2GA7A 2CJKA 3BEGB 2I8EA 3Q6NA 3OTOE 3DCAA 3D4JA 4I7FA 3BKUA 2I0XA 1VQSA 3FSXA 2BBEA 1V5VA 2V0NA 3TRGA 5ADZA 2GGPB 4YUDA 4IZJD 1CJKA 3EYZA 1R0AB 1FRIA 5CQGA 4JI8F 2EI5A 2LDYA 1H2TZ 1MN9A 4NLVA 4R5PB 1K0TA 2OEMA 1M5HA 3NEKA 2HURA 4OJ1A 4OZLA 1Q82T 5C0XF 3IR7B 1LW0B 2KHCA 2XMKA 4X64J 1X4CA 4U96A 1WI6A 1ZOTA 1RWWB 3CD0A 3IS9A 2YWHA 2C3PA 3NOGA 4LSLB 4PXEA 1YK9A 1DFDA 2MGZA 1TR0A 4WXWA 1ZZNA 1NJXA 4GVBA 3TEGA 3ZZOA 2EEYA 2QMXA 2IDEA 1SVDA 3DRRA 4M5DB 3QT6A 2V4JB 1S59A 2XYHB 3I32A 3PFOA 4BCAA 5C7PA 7AT1B 2I2YA 3NGUA 4XTJA 1XMQE 3T5LA 2BJ9A 1XR7A 2Y0SD 3MEDB 4NLWA 4AXJA 3SZ2A 4B9LA 3UW1A 4A8SA 4YR0A 4DFPA 4WYWA 2QV6A 2AYEA 1URNA 3L3CA 1KLMB 1HQ2A 1X4DA 3ETMA 3C16B 4TLQA 3LAKA 3QRRA 2F4VE 4KKOB 2EW9A 5DLGA 3LPYA 3KFWX 4I2PA 4QR0A 3TAMA 4WFZA 2RKIA 3LANA 2HEKA 5C2CA 4M95A 4WFYA 2FLPA 4CLSA 3EPIA 4Z7YA 1G2EA 4DV4I 2HS3A 3I55S 3RR7A 3CCSS 1FESA 3EGWB 4NASA 1VQ4S 4NXMJ 1RHYA 3RR8A 3PS1A 3GE9A 3I56S 2YNFA 2ZWOA 4LRDA 5KFIA 2XMAA 1ACMB 3GV8B 4N41A 1N36E 1ZM2A 5DQGA 4OZJA 2OFHX 2O1VA 4DV0F 4ZIWA 2DR9A 4MU0A 2PMWA 5ETQA 1N0UA 1FX2A 2D9OA 2CKWA 1B70B 3BR9A 3OT9A 2PN6A 2GVZB 3R7NB 5LMUF 4H4MB 4IFYA 2XSFA 1NKEA 3ZO7A 1QTNB 4KRWA 4YB6A 2MMYA 4RU9A 3M85G 3J81U 3K8VA 4RUBA 2EFVA 2XLJA 2GJIA 2C2DA 5HI7A 1REGX 3CJ2A 3H5SA 3NGRA 3MTKA 4C8OA 4A47A 1FKOA 1C1BA 5GAGI 2C2OB 3O1LA 4RNMA 5M2PA 2M8DB 2H65B 1T9YA 3OTOI 4F4AA 3U1NA 2IOPA 5K36C 3CCZA 2JNJA 4ZLJA 4NLUA 1UVNA 1ZM9A 3CEDA 4HY1A 3UD4P 1YH8A 1NSKL 1QAYA 3JQJA 4IRKA 1RT2B 4DPXA 3H20A 3CCTA 2GAHC 3UE2A 3GWCA 1WNEA 3W60A 4JI5E 1TU0B 3CTRA 4QIEA 3M9OB 4RU2A 4KO0B 1UA1A 3DDKA 8ATCB 2VQEJ 4PAAA 4ECYA 1D6TA 5DQHA 3GJTB 2CQ4A 3TX8A 4IOCQ 5CXTA 2BW7A 4NCGB 4GVLA 5KG3A 2ZBPA 4DR3E 4CQ1A 2EKYA 3NNAA 2ZM6F 5AE1A 3M6VA 1S6QA 1X9SA 1WG4A 5D4OA 1U6ZA 3OTEA 1KQKA 5C25A 3K5NA 1T9UA 1D1UA 1RQ0A 2E7WA 2OPQA 3U1LA 2DY1A 4JYAI 1SBRA 5K8OA 4C4WA 4F4WA 1QE1A 2DRBA 2UUAI 5LMUI 5LJ5Y 4MMOA 4DR5I 2DCUB 3AA9A 4FXWA 4IZJA 2MKYA 3GMEA 3FSYA 2UUTA 1SCJB 4C0OC 1QAJA 3QIDA 1E3PA 2YTCA 1RT3B 4RUHA 3A8IA 4DF4A 2OEJA 1X4BA 3BGRB 4ZPCA 3HT3A 2BQRA 4ILMA 3KWMA 1VJQA 9RUBA 4CYUA 2GS8A 4YR3A 3T1YI 4DPYA 2ROGA 4OX9F 3JAMC 2R7UA 2YBVA 1NK0A 3BBBA 4PWDB 1WHYA 2A2CA 2HHHJ 4P73A 3TJ9A 3TP2A 5AJ3F 3UO0A 4FS1A 2HHHF 3PW2A 2QZ8A 4UOFA 3FCHA 3FK4A 1QD1A 5EWGA 4C0HA 1HBMA 3ILIA 4DX8H 3GIMA 3C19A 2GQ0A 1Q4RA 2NXEA 5LL6d 3TZYA 4QWDA 4Q2LA 2FGOA 2J0XA 1SKSA 1SL2A 2NN6D 3UDLA 3ENQA 1M5PC 1GX5A 4LMZA 1Y0HA 3HKZD 2MSTA 1DTTB 1VK8A 3KJVB 3DRYA 2Z5BA 5B0EA 3QWUA 1DTQB 5H9EJ 3TQEA 4LF4F 4B3TE 3LGNA 1HWJA 4Q5VA 1YHCA 5BR8E 4LFCF 3AY0A 3N5BA 1S99A 3TAPA 1PBAA 3AHPA 3HFVA 4B3OB 2CGEA 2AJ1A 4O4GA 2FJAB 2CAJA 2C39B 2XEXA 3MI7X 4WK3A 1L3SA 5F8HA 1W7WA 4X4TA 4DLEA 1IBMJ 4J37A 2VICA 4ECWA 4FYVB 1SC3B 1O0PA 4WK1A 1RTZA 4G1QB 1R31A 2R7QA 3WIVA 1BY9A 2B0GA 1IBKJ 4YHHI 4YS2A 4JI1I 4TN2A 3W63A 4LF9J 2NLWA 3NBPA 3KLIA 4MJKA 4ZLLA 4AYBD 2CFXA 2D69A 1QUVA 2MZQA 5AE3A 4DV0J 2CQGA 2VG7A 3ZXWA 3CCQS 4FF4A 3L7ZB 1SUQA 2CADA 2VUGA 4LCGA 3NWRA 1MSWD 4DV3J 1ZH5A 4FW6A 2CZVC 1VQNS 3EDQB 2UU9J 2X51A 3GIKA 4NXNF 1EP4B 1CJTA 1UVKA 2CQBA 2W1BA 4WTYA 5I3PA 4ZLPA 2XGQA 5DLFA 2BRKA 4LFAF 1NK4A 3SIPB 4Y2CA 2AGOA 4WIQA 3TQ1A 4WPAA 2WSFC 3KMQA 2LDIA 2QX0A 5D15A 3UD5A 1IKYA 5EWFA 4LF5J 3PXGa 6FD1A 3MFHA 2VFUA 1S12A 2DH7A 3RTVA 2ASLA 1RYSA 3JQMA 4X4NA 2RRNA 2HQDA 1KEKA 3AJ2A 4MU4A 3C6TB 4F50A 1RT2A 2E9TA 1FXLA 3Q83A 4LVOP 3TJAA 3KLHA 4B3SI 2ZDPA 3DGPB 4X66F 2UXBJ 3Q8RB 3PW5A 4QIFA 1RABB 1RE1B 4FPIA 5KFMA 2CPEA 2Z58B 4I2QA 4NYPA 2Z2ZA 1SJ4P 3BBCA 1V3ZA 1AZSA 2HNYB 4L6V3 2GV1A 2KM8B 3OW2R 3QYYA 1BQNA 1FWKA 4ZVHA 2H4YB 2F65A 3V2UC 1JXLA 5JMNA 5DM6Q 2UUBI 2A6MA 2JLEA 2MEWA 2CA9A 4NWBA 4YB1P 3NG8A 2HGNA 1B7YB 1I51B 5HLFA 4ZMMA 2OIHA 3PO5A 4PABA 2DISA 2AEJA 3ONQA 4HDGA 4DV2J 3PS2A 3BREA 5HJXA 2ASJA 4DV2E 3FFIA 4IG3A 4AL7A 2WW4A 4MK9A 3JTNA 2C1EB 1H3DA 3KG0A 3NS7B 3TARA 4FYDA 4J91A 1RBLA 4ZN1A 2CNNB 2RF2A 1TQLA 3UDEA 3M7NG 1HNIA 4DV1J 3FEYB 1S48A 3UDVA 1ZS6A 3G71S 1NAQA 3PJWA 1JLAA 4IRCA 4GKJI 1DLOB 4PWUA 5K36F 2AJ4A 4M5NA 4DU8A 4QPXA 4KR0B 5A0YA 3DMJA 1UP1A 2OELA 2RILA 5H1SV 3EZ5A 2VF3A 1WEXA 1KIJA 2BA0D 2YWGA 1T8EA 4PRXA 5ETOA 1S0NA 4URLA 3V6DB 4DV5E 1XBWA 5J2QA 1KOHA 2NXUA 1Y4UA 2FQQB 1B62A 2G13A 2P9EA 1VJWA 4B9MA 1Z0VA 1HNWE 4NLXA 4X4OA 2G2OA 1NBEB 3J7YI 4JI0E 1EB0A 2X3DA 1ZM4A 5IM0B 3QIPA 2WSCC 4OMFG 2L08A 1RTHB 1ICEB 2B51A 3HI9A 4P52A 1NJYA 5D8HB 3LQVA 4O3NA 2IYGA 3X1LB 2XI2A 2RDDA 4NCBA 4JI5I 3NGTA 4A4JA 2C2EA 2BEFA 5C42A 5F8MA 3ET6A 4DR3J 1LW2A 2DEIA 4KO0A 5FJ4A 5AE2A 4JI8I 1TUGB 3QFHA 1F5BA 1LW0A 2BJEA 2QO3A 3IA0A 2CPIA 3Q89A 4IUFA 4KV8A 2C39A 4TLRA 1NM2A 4ETXA 5KFJA 2HNZB 3CDAA 4PG6A 3R8YA 4FW9A 2FLNA 1N33J 2JRSA 2VDHA 3ZZRA 1X4EA 3CDJA 3BN4A 1RHQB 3UVJA 2B8QA 4YDXA 1U47A 1C1BB 3MCNA 3TUZC 2J6TA 1IBLE 2OGUA 3QGHA 3TVKA 4PRFA 2C28A 3DLEA 4YY3E 2ADCA 3QQCD 2GQCA 3MPYA 2ZH6A 3MAHA 1C0TB 2DR8A 3AB2B 3HHLC 2L3MA 2HS0A 4XPEA 2R2TA 1JLGA 4GKKI 1Q8KA 2J7UA 2Y1RI 5BYQA 5HROA 3T5HA 4WFXA 2HW3A 5DETA 4QIVA 1NXIA 2AYMA 3G2XA 5CYQB 4AQYJ 3ILLA 2VA2A 1URRA 3VWSA 3F41A 3SMZA 4DV5J 3QATA 1RAGB 3ITHA 3MMBA 3U7JA 2VBZA 3AB4B 1WWHA 5CYMB 5F0WA 3CO9A 3SCLE 2PEHA 4DV4F 3M1VA 3HHLA 2VOPA 4R25A 3O6QA 1HNWF 3A12A 3HT0A 2HNDB 3HZEA 1NK7A 1H6KX 1HW8A 5HP1B 2ZD1B 4K8RA 2HGMA 1TUVA 2IBKA 3OR2B 2E5JA 1LOUA 1OYEA 4WF9Q 3NCPA 3HKMA 4I4BA 4DX5A 2MKJA 1B0TA 1IR2A 1QE1B 2XMVA 3QGIA 4ZOSA 4C98A 4DSIA 5DO2A 1R89A 2ACYA 2DY9A 2DGVA 2ZOGA 1E3HA 5A2QQ 4X66E 1N32I 1U1RA 2GJ2A 2BMBA 1ZTTA 2Z30B 4LRCA 1SH3A 2QG9B 2IRUA 4R1FA 1H7WA 3G6YA 2YKMB 3MM9A 1REVA 4I64A 3TEHB 5EGYA 3LWLA 3NRBA 2QL9B 2FPHX 3R7BB 1VIOA 1LFPA 1YDLA 2FGCA 4X64F 3KLFA 5IT9Y 1FJGE 2V34A 5HATA 2P5VA 1C0UA 3PTWA 4HHHA 1C0UB 2H1YA 5AXNA 3PIPQ 3HP6A 3VAFA 1NHHA 4K0KI 3HZGA 5ETVA 5KT5A 2C2KB 1OWXA 5FLXY 2G1DA 5KFUA 2QL7B 4AL6A 4A8FA 2H9ZA 2UXBE 5U47A 2MQNA 2IYIA 2QSFA 4DV6E 2DO0A 4QWAA 1H2UX 1FDDA 2V2QA 2YXLA 4CNYA 1Y6ZA 3D3BJ 2BVZA 1KKHA 2MKKA 3P3EA 5AXMA 4C8LA 2VESA 5IXUA 2JC0A 2FIUA 3M05A 4DR4J 3FKBA 1VCTA 2NS1B 2QYCA 4C7QA 3HVRA 2OMLA 4QIGA 1NPPA 4ECQA 1Y00A 2HQCA 1UFWA 4HEA9 3RZAA 4USMA 1DBDA 3CVKA 3G96A 3IWNC 1ZXNA 4KE5A 1XMQJ 4KGMA 3K1JA 5HP1A 3HSZA 2D3ZA 1NMEB 2V8GA 3R1HA 1S6UA 3DRXA 1KN6A 3LPSA 1F9HA 1VLOA 4I7FB 3ENVA 2KFZA 3FC9A 1R6LA 1WKJA 4O4GB 3BH7B 3ITHB 2IOQA 1M1GA 1WI8A 3RB0A 4DV0E 2IJNA 3BPDA 1RLCL 2XNRA 4NLOA 1S9GB 2YKOA 4X65J 1JJ4A 1G1XA 2JEGA 4JI7F 3LP0B 4NCAA 2Z5BB 2JL9A 1RWMB 3H2UB 4Y2KA 4WUDA 4DI6A 4N5SA 2E1RA 4OL8A 1L3TA 2PO2A 2ILZA 3PG9A 1A6FA 3GR0A 1YJ7A 5GAHU 3EPGA 1B0PA 1U1NA 3IAS9 1SIWB 4USJC 3KK2B 2A6OA 2J0WA 1JLBB 1HBUB 3K85A 3QSYB 5DQIA 5CH7B 4LPFA 4R8UA 3E01B 1CULA 3UWTA 5HQMA 5AJ3J 4FXDA 4PU9A 2M8HA 3GFHA 2HVZA 3HVTA 2PDAA 3M2VB 3T6BA 1XN9A 4UQGA 1VQ8S 1D9FA 3DXSX 1NU4A 1T0TV 2B3TB 1TL1A 3GONA 2OPPA 1FDBA 3OR1B 5E3PA 4K4TA 2O01C 2BA9A 2XYPB 3CJ8A 4ZPDA 1FJGF 2ZM6J 1K1SA 1N5TA 3MMAB 4CDIA 5DGAA 1NB7A 4EBCA 1V3SA 4TQSA 2UXCE 2FB0A 1KFDA 2HBRB 2DXFA 3EICA 3R3TA 2KJVA 4B08A 4QBUA 2CG4A 4X66I 2QMUB 5BYSA 2IY5B 4KY3A 2MB0B 3QT8A 1MROB 2AE8A 3BO3A 2EFNA 1NB2A 2HS4A 3MMCA 3NS6A 3PCOB 1PBUA 3C15A 1R8BA 3IBCB 4PYAA 1CQMA 3CJQA 3T1YF 1Z0TA 1EETA 1KTQA 1MWZA 2Z2LA 4JV5F 2HAIA 3ZZUA 1S7HA 3OVAA 1WKKA 2UU9F 4LF8J 2XY5A 1J2VA 1SH0A 4G1PA 4IFDA 1BQXA 3G8TA 3OV7A 1UPMB 2CPHA 2CPYA 3V6DA 1IBKF 1SPBP 3M8YA 2JJ4D 4OI0A 3EGZA 2IPOB 4I6AA 5E3AA 2UXDJ 1QJHA 1X4AA 3NAHA 3R7SB 1XMOJ 3ZTSA 3KRNA 3H98A 1UZHA 2V5HG 2ZBQA 4J9VA 4ZP9A 5J2PA 1XMOF 5JEAC 3O5TB 3I5BA 4LFBF 3CUNA 1V6HA 1HPZA 2PO0B 1PG5B 1TL5A 1HIYA 2MQLA 3VVUA 1SQEA 3W5XA 5HVHA 4N3OA 4DUZF 4W98A 2PNZB 3J81C 2QLXA 4NLPA 3KUEA 3T19A 5A8WB 3MEGB 4BDPA 1NHKL 2HQGA 4PR6A 2LEAA 5ETLA 3ILJA 1NK9A 1JLFB 4JBCA 1SL1A 2QFIA 2CWXA 2A10A 2EK6A 4U9RA 4ZHRB 2F4VJ 5J1EA 4JI0J 5JEAA 5HMYA 4DL7A 4UF4A 5GADI 4IO1A 4LFCJ 4QU7A 4C8YA 3IAM9 1ROFA 3KK3A 5HMZA 3GP9A 4K4WA 3CPWR 5LL6R 8AT1B 5KG1A 3G4SS 4LRBA 4NXNE 1R0BG 1GMUA 3FDSA 2NR0A 5HAOA 3OTCA 3V5RA 2DGSA 3K5MA 1S49A 3D67A 3JSYA 4OJ3A 1T02A 3KHLA 3CCMS 2JEFA 4K5SA 4Y6IA 1PGZA 2HNYA 4ZHRA 2B9YA 4DR7J 2Z5CB 3EJMA 5JEAB 3MR2A 1PC4A 2U1AA 2VD3A 2ZJRQ 1XHKA 3GLJA 2AZ1A 3FBFA 4CLKA 2XC9A 3C6TA 4NMXA 2WOMA 3MEGA 1SB6A 2KL8A 2KT2A 2W4DA 1XERA 4OZ3A 4B17A 4O3OA 4O3QA 4DN9A 2GIRA 3ULHA 2NZ4A 2QA1A 4X62J 4UQTA 1B3TA 4LF7I 4YQWA 3M8SA 4QW8A 1CSJA 1AUSL 2I5JB 2FLOA 4JI3J 2KT3A 3MMJA 4WIIA 3GYXB 3I82A 5A76A 4RNNA 2R2SA 2R8GA 4NXNJ 2B56A 4P71A 2HBZB 3LTOA 2B9EA 3QT7A 4DQQA 3BR8A 3SDEA 5JEAE 1RAEB 1RTDA 4JI6J 1EP4A 1RBAA 4LF4J 1B63A 1MU5A 3CO0P 2VFSA 3L95X 4LF4E 1HFEL 2HK2A 2E1MC 3D3CJ 3V6HA 4QYZJ 1FTRA 4HI2A 3VAGA 5DG9A 3DLHA 3MPVA 5HL7Q 4MKAA 2ZH9A 3D1HA 4ECZA 2VU5A 3MD1A 4DS4A 2Z4PA 4F4ZA 4NBQA 1BE4A 3HJFA 4GQUA 2KN4A 2RS8A 4MU3A 1LWEA 1WF1A 4RWXA 2AT1B 2YQ1A 1WG5A 1U24A 2LMIA 2XLKA 1PYSB 4WUCA 1Q86T 2RS2A 2UXCF 4H4OA 4C97A 4F26A 4ELTA 3IR5B 3W9JA 3CGIA 2HMIA 2K3KA 3MMAA 4OLPA 4LQ9A 1LWFA 1NK5A 4KTQA 4NXMF 1KOOA 1U48A 2CZ9A 3BGLA 3THPA 4A8QA 4N76A 1CLFA 2R7XA 2PD1A 3M6XA 4DR6J 1PKPA 3PEJA 4GRSA 4M5LA 2Y9HA 1Q1KA 4U6PA 2E1AA 4IFDF 5JVGQ 2L41A 1EQMA 3GV7B 5IT9C 1UL3A 1UWBB 2IVMA 1VC5A 4A8OA 5KFLA 3FVYA 1LEOA 6FDRA 1SKUB 1T3NA 1BQNB 2ZUGA 4X64I 3D0HE 1HKAA 1Z2LA 1ZAVA 2GAGC 4CP5A 2LECA 3FMBA 1JMTA 1K47A 3N9UC 3Q8SB 4B3RF 1M5KC 2VQFF 1WTBA 1VQ9S 3ZTQA 4E2FB 1MMDA 1RT5A 2AZ3A 2IM1A 2KRBA 1RACB 3C14B 2KDOA 4CYUB 4BA2A 1KD1T 3FBCA 4CO3A 2F4FA 3DLLQ 3W66A 3M7VA 3WU6A 1P27B 1C0TA 1NZ0A 1DHMA 1F6TA 3OVBA 2W4CA 4M8LA 5LMUE 1R7IA 2GMLA 4DL5A 2HFVA 3N28A 1EZZB 2Y1JA 1SJRA 5ETPA 3MM7A 1HR0J 3ZM7A 2GHVC 1UW4A 3KUGA 2RKIB 4V1Ak 5A6WA 2KYZA 2N82B 3KLEB 4DR2F 3PO4A 2OPRA 4GO5X 3DYAA 1ZPVA 2ALYB 2YNIB 4USVA 2AX1A 1UFKA 2DNRA 3S1TA 2PI5A 3C2PA 1HQEB 4NE9C 3OL9A 1OYPA 3TOQA 2FYXA 4OO1C 2E5GA 2AKWB 1Q8BA 3HD1A 4JI7I 1P8GA 4URGA 2HVHA 4NXMI 4KQZA 2QLJB 2VKZG 5CABA 5KAKA 1S6QB 1RTIB 3HLUA 1XTZA 2VV5A 3D1OA 4LF2A 2GVDA 1R6VA 3G87A 2JEBB 1OO0B 3KUHA 2E5LI 2R7WA 3HVWA 1UAWA 3Q24A 1VBZA 4KHPJ 5LOQA 3JSBA 4JG4A 4NZ0A 4OO1F 1RTHA 4ZVUB 3BN7A 3DU5A 3LAMA 2WVCA 3W2VB 2P8IA 3IG1A 4WUBA 4ZS6A 4QYRA 2YKMA 3MM9B 1NHVA 4Y00A 3B8HA 1VOMA 2KXNB 1TL1B 4CNZA 5KG5A 4R5PA 4Q0BB 4PPZA 5JEAF 4XIUA 3NNHA 3TJ8A 5B0CA 4I67A 3Q0AA 4L73A 4Q2MA 4OZ0A 4K59A 5H9EK 2UUBE 2QL5B 1IR0A 1UWAA 2NYIA 4L3KA 4RW4A 3PR5B 4JV1A 2J8AA 3PACA 1J27A 2FJDB 4CH0S 3NGKA 2DK2A 2MQQA 2ZHBA 4MYTA 3BSCA 3OBIA 4MKBA 2Y8YA 3T1HI 1JIHA 4RW8A 2B6AB 2R8IA 1RHJB 4GC7A 2HHUA 4DUYE 2GO4A 2PO2B 1HBMB 1X0PA 4M5MA 2GVZA 4FKXA 2C3MA 3PYEA 5D0EA 5J1EB 4BC7A 2VBXA 4LSZB 1S9GA 7FD1A 3HSGA 2HVEA 1RA6A 3GJSB 3VVTA 4URQU 4I1TA 5KFQA 3SQOP 3K5LA 4NL5A 3QRPA 2JLFA 1BGXT 2XSJB 4DV6F 4DEZA 3SSSA 2VQFJ 5K36D 3HCXA 3R5GA 1T11A 5L46A 3W3SA 3R2DJ 5FLXC 4KGZB 1IM6A 4ZVTB 1UWBA 4X62F 2N4CA 4EUVA 1UETA 1RWVB 2KG1A 1RA7A 1AXQA 2RDIA 4IZJB 4JI7J 4IFDD 4DUYJ 1P6TA 2PGCA 2VPXB 3X3UA 3AOBA 1VQ5S 5KOWA 1SQFA 3QSIA 4I2PB 4KIAA 4ES2A 2N7CA 3OL7A 1HNXI 3BSAA 1HLWA 3W2WB 4P9SA 2R4FA 1HARA 3GYNA 1B4SA 3OJSA 2IM3A 5LMNI 3M8QB 1SC4B 1WSVA 2V8PA 3HFKA 1WEZA 2ASYA 4RWWA 4A46A 2JZ5A 4CH7A 2NUHA 3CMAS 3IRXB 5J2MB 1T9XA 2BRLA 2QIFA 4DUTA 4OX9I 3TW0A 5MAOA 3DRRB 3A3PB 2K1RA 1H2VZ 1KHVA 2HHHI 5AXKA 2RB7A 3GCXP 4LF5F 3E8OA 2Z5EA 1WHXA 5IFMA 1BQMA 1NZAA 2DNKA 2LQ8A 3SQGB 3W5YA 3OFHA 3DDIA 3M8QA 4CIOA 5DM7Q 3D2WA 1BHNA 2LKZA 3PDNA 2V2ZA 4LFBJ 4CLYA 1FJGI 4Q43A 1S0VA 2ZDOA 4YDDB 4DPTA 2C38B 4LF6E 2V69A 1FCAA 4JYAF 2ZBIA 1KWMA 3KLIB 1ZAXA 3OR2A 1N6QA 1FD8A 1XNRE 4YY3J 4DV1E 3HHNB 4N7TA 3ISZA 4ZLNA 2NYHA 3IO1A 1JLBA 4M63A 5C5JA 2UXCJ 1S1XA 1D8ZA 4ER8A 3G8QA 4NLGA 3PW0A 5F41A 2YX7A 1D09B 1VLYA 2RF2B 5DDQC 1U1OA 4DPUA 2W8KA 3KHHA 1VQ7S 1FRKA 4CLTA 5HJYA 2O1PA 3NKYA 3RAXA 2MJUA 2ZH1A 2DPJA 4ECUA 1OS5A 2ZVIA 3CMES 1MMNA 1RT5B 1FEEA 4RR5A 3KK1B 2ZH7A 2AGPA 3LW5C 5L9NA 2W8LA 4LF9I 4KGVB 1U0SA 3DLKB 4ITSA 3LP1A 4M5HA 6AT1B 4KPYA 3DRSA 2BACA 2PT0A 2Q43A 3FMWA 3M2RA 1ZAWA 2B9WA 2DGXA 3JYTA 4DQRA 5DG7A 1T94A 2XMMA 2RSQA 3KJQB 3HULA 1U2FA 2XMTA 1NO8A 1S0MA 3PVXA 1UA0A 3UCUP 3C46A 1SXLA 4UY85 2EG2A 2N7YA 1TL3A 4V19X 1Q81T 3KJNB 2M7SA 3MUTP 4OZ1A 1GTHA 1YJVA 2FDNA 4MK8A 3VAMA 2RDJA 3FBBA 3H2LA 2FJWA 1X9MA 2FVQA 3MZIA 4IH5A 1TFWA 1S76D 1YWXA 5BR8F 2L48A 1ZA2B 2BQ3A 1U4BA 1L5UA 4F2RA 5T14A 2ZZTA 2W24A 4LF1A 4WZMA 2KI2A 3CJTA 3BGRA 3A8EA 1LW2B 1UTAA 4F3OA 2XMWA 4Q44A 1TK5A 2C3OA 4KH0B 2J0QD 1FNOA 3W61A 5F3TA 4N8OA 2UXBI 3SCIE 2M52A 1KTVA 2PIIA 4IFVA 2MGZB 4B9UA 4NYZA 5C24B 1K1QA 4KQVA 5BR8J 1HQUB 2DGQA 3BSOA 5KG4A 1REVB 1S79A 5DZ7A 1HNZE 1YBUA 2F8MA 2M5YA 2P9CA 2Q6BA 4HHJA 3OLBA 3ZZYA 1FNXH 3IMQJ 3CJKB 1BMQB 1H98A 2W2MP 2VG7B 1U2CA 2B7CB 3SV3A 1Z0CA 5D4PA 4YB5A 1HNVB 2FUG9 2YNGB 4DSLA 2ZNZA 3KKFA 3P45B 4J9LA 2F8HA 4CZCA 4FKYA 2R9LA 1MROA 1XNQJ 1RAJA 1P1TA 5HQLA 4DFKA 1YRTA 4M5KA 1JLAB 4FF1A 5LMNE 4PG4A 2M2BA 1U2RA 1YZ6A 2I1RA 3QPIA 4DXLA 4B9TA 3ZZTA 1HBNB 1O6XA 4Q8EA 1BWEA 4DBQA 2NXJA 3RU0A 5KFOA 3PY8A 3D1QA 1L3KA 4NLYA 3MCOA 1LWCB 3GSIA 1Y4SA 1G7CB 1DTQA 1QY7A 3BGUA 2RHSB 2HLTA 2X3GA 3MWBA 3O8WA 1BXNA 4X4VA 2NPFA 2MJNA 3KNAA 2BR2B 3M2UA 4ZPWR 2C37B 1J5EJ 2XYGB 4J90A 1Q8IA 4FXVA 2BUNA 1H7UA 2G4BA 4QIWD 2O1WA 3K57A 3MECA 3MECB 3Q2SC 5KFVA 3FUYA 4KSEB 1VFJA 2L9DA 2JE6B 2JE6A 4LF6I 5D3GA 3G82B 3MFIA 1YVFA 2BA0G 2HVIA 4OYZA 4A8WA 4Y0FA 1XNRI 5DZ6A 2UUAF 2E44A 3M2UB 3ILOA 2XTJP 4LR7A 1W2IA 4RX6A 4BWMA 4CLLA 5KT6A 5I3UB 3F73A 2D1CA 1M5VC 2G2ZA 1R8CA 1NLKL 1Y11A 4CH1A 2XQCA 1NJWA 4MH8A 3WQPA 3NCRA 3P8BB 4DR3I 1OIAA 4DR4E 3ZZPA 1HYSA 1F3FA 3TNVA 4DL4A 1LKZA 3MM8A 4KFBA 4TXSA 4JI4J 2M4MA 1BWVA 3IGVA 2DNLA 3WBZA 4BHQA 4DR6E 1DAXA 3MM6A 1RT3A 2H54B 4Z37A 3DM2B 3OJUA 2KG0A 1XQIA 4RPFA 4PQUB 2OTJS 2P6SA 1RADB 1RHRB 5F3ZA 3MOJB 2RH3A 1H7XA 4LR9A 3MAAB 4PXDA 3G6VA 2V8VA 3PHTA 3R2CJ 3QIPB 4HTJA 3DC2A 3PV8A 2R7TA 4M5GA 3J80U 2ADBA 4W92B 1IVZA 1SUQB 1MMLA 3CT9A 4JI6F 4IS9A 2VHGA 4B3TJ 4DQIA 2HRUA 3BGOP 2HWIA 2W2PP 3IG1B 4IH7A 2FJXA 4B3TF 1RTDB 4NA1A 1VC6A 2ZBKB 4P7AA 4UUXA 3D66A 1TV6A 4Q7AA 4GKKJ 4DX6A 2NXNA 1RHMB 1RU2A 3D6MB 1T9VA 3MM5B 3OSNA 5DNXA 2R7OA 1KR4A 3ENWA 3W5ZA 4ELUA 3RW6A 2I5JA 4AQYI 2V68A 1FT8A 1E6YB 2C2RA 2JT2A 1NH8A 4DV5I 2GFFA 4OX8A 2R8HA 3AA8A 3H40A 1MWYA 5A8RB 5J2MA 4DR5E 2BXJA 3H7HB 2W7OA 2UV8A 3T9NA 1HNWI 2XI3A 1XIQA 4ID5B 3TWZA 3CCVS 4DJBA 3MR7A 3MHYA 3THVA 3TANA 5CHCB 1RWOB 5E3RA 1IBCB 2D7SA 3DYAB 2M3DA 3JTOA 4ES3A 1WJ9A 2VQFE 4X62E 1HNXF 3GCMA 1U1PA 1UW9A 4K4YA 1UEVA 3U1MA 2YQ0A 5CAAA 2DHGA 2LU2A 2NCKL 3LP2A 3PX0A 3QJLA 3OL6A 2EFGA 1FKOB 2DNPA 2HNDA 1AYEA 1U1MA 1CS4A 3O2IA 3SFUA 2KZMA 2C22A 1CEZA 1FWLA 2CUYA 3H8YA 4QJVA 1UJ5A 3GZ7A 3PEHA 4RUCA 3CDEA 1RCXB 2DHXA 3M8WA 5CYMA 3J80Q 4OQJA 1LFWA 3ZC4A 1R3NA 2CQIA 1PCAA 1AB8A 5L1IA 2J65A 1MU2A 2FZCB 2JHEA 5JVHQ 3NP5A 4FBUA 2QSWA 3ETOA 4DR2J 1IQZA 1U6BA 1IBLJ 4FWGA 2CQ1A 3KHGA 4J9OA 2GIQA 4D3HA 3GV5B 2WAQD 2EK1A 1T7PA 2RT3A 1ELOA 1WDTA 3H0PA 2ZH2A 5KFZA 1FKAF 4JI2I 1C1CA 3HD2A 2DH9A 1WC4A 2F9JA 1M1HA 3ZZ0A 1J5OB 4C8KA 4DR4I 1Y60A 1Q8LA 2FHMA 3QFWA 2WBRA 3TX0A 3UVJB 5IOLA 4XTTA 2CNOB 5B0DA 2OPQB 2MLYA 2BJ8A 3NMAA 3NGSA 3V6KA 1U1LA 3CJKA 2R7SA 1TVRB 2V50A 4KV8B 3K5PA 3ZZZA 5LT5A 3BBFA 3Q8UA 2PI4A 1CVJA 2UUCI 2DGWA 3CC4S 3NMRA 5CZVA 1WOOA 2DNNA 3U27A 4XDCA 4R0EA 4ERDA 2VQEE 2IVFB 2FC9A 2V63A 3EVOA 1LXNA 2XWYA 4LFAJ 5KFTA 1RWNB 1UVLA 1MG7A 3DOLA 3THTA 2XLIA 3B82A 2GVDB 2VASA 2NSBA 2RMLA 2LU1A 3MOZA 4O0NA 3PW4A 1YJUA 2HYIB 4JI2E 4IFDE 1SJQA 5C0XE 4LSNB 3JSRA 3AD8C 4WFAQ 1CJUA 2OPSA 3UQSA 1GAOA 2DGOA 1KFSA 4EO6A 2W9BA 4FNIA 3GFXA 2Q1LA 4P6QA 3GILA 1RT7A 2P9GA 4LR8A 4DZ6A 3GG0A 4EFAC 2WSEC 1WELA 5DG8A 1VS3A 2DR7A 2R7VA 1QAXA 1TELA 2EXUA 1CQNA 1MW7A 2F3JA 1S4FA 1TL3B 1VYAA 2KRRA 1WG1A 2GGPA 2ZBRA 2OFGX 3R5DA 4ENOA 4J9SA 1RAFB 3J7A1 1XXEA 3M85D 2ZH8A 5KTQA 4WP3A 3TVZA 3H5UA 4TKTA 3JSMB 1BD6A 4RW7A 5KFEA 3L9ZA 3JYTB 4YN3B 3VALA 1HWIA 3PJXA 2WOMB 4LBPA 1ZPWX 1HNIB 2E5HA 2OSRA 2WVFA 2ZVSA 1GK8A 5D4LA 3MUVP 4S0MA 1KDNA 2BE2A 1HD1A 3J81Y 2R8JA 2F9DA 4MFBA 4NMLA 2EG1A 4ANCA 1N32F 3IR6B 2ACMA 4RBTA 3V81A 4H4KC 5K14A 5KFXA 2IMWP 2JEIA 1N36I 4C11A 4NLSA 5D3GB 4JV5I 2MLZA 2GX8A 1JNRB 1YQHA 1RCOB 2KU7A 2LA6A 3C6UA 4CLZA 2LVWA 2JLGA 1U49A 1CS4B 2AIRB 3H42A 1AFIA 3W65A 3IFEA 4ZN3A 1HR0F 3GJRB 3WU3A 4DG1B 1VQYA 2HZAA 5A2QY 3EMTA 2AJFE 3LUYA 2XMJA 3NOCA 4CO2A 1WOSA 5IWAJ 1FJCA 1LK7A 1OYRA 1XMOI 1E6VA 2HNZA 4KAIA 5F8NA 1QUPA 2LP4A 1FRXA 1JLCB 3OQ2A 4ZPBA 1HI8A 4CT8A 1RTJA 4PQAA 5J1PA 3M30B 3W1YC 5A8WA 3FCWA 2BM1A 2OTLS 2HAFA 1U45A 2CJ9A 4JI8E 1GMWA 2IM0A 1VHFA 2O1UA 3ET6B 4MU1A 3VF0B 4LBIA 3TI0A 2V9WA 4F2SA 3QLHA 5H9FK 3DFEA 4RNFA 4JI7E 1I5OB 3VAIA 3NLCA 4OHZA 1SH2A 1I1GA 3IGNA 2R3VA 2D9PA 2V2KA 3CIZA 2NN6A 1VRUB 2WK4A 4KYZA 1I94E 2OLWA 2JVRA 2H5JB 2FZKB 4E0DA 2E9ZA 2FJEB 1PILA 3DOMA 1S16A 3CWVA 2YX1A 2KH9A 3DLBA 1NK6A 3CC2S 4W4MA 2VKRA 4FVMA 1DARA 1U02A 1E6VB 1WF2A 3ZTRA 2WW8A 3O44A 4IFVB 4X4PA 1WACA 3CD6S 2J9DA 1J5EE 4J9NA 1S9EA 1TL4A 1KHWA 2B8PA 3GSDA 1VI7A 1TKTB 3QZ7A 3LF0A 2QFJA 1TAUA 2VFRA 4USWA 1MX0A 1UDOA 3M8RA 2PNZA 4DR7E 2BKPA 4RNHA 4FF3A 4C3MA 3CXCR 4OKGA 1FK9B 4K7QA 4LFBE 3RRKA 2W9CB 4DL3A 1HR0I 1HD0A 3BYPA 2BJ1A 5L39A 1PJ7A 1SC1B 3DDNA 3TZZA 2B4PA 3JAMU 3CCRS 4FS2A 1VQKS 1X0FA 5K14B 2VQEI 4LF8E 3PRVA 1R8HA 2CNKB 2VG6B 2FJBB 1N5VA 1NH7A 2RQKA 5HANA 4ANDA 5CA5A 1HBOB 2EBEA 1HNZJ 4JI3I 5KT4A 5GAHI 4EWTA 1UDNA 2O66A 4QNJA 1VRTA 1S5ZA 4RW6A 4I3HA 3WX4A 2PFFB 1DQAA 3VQSA 2AJQA 2H48B 4LRFA 3PJ9A 4L3NA 4WWSA 4IQXA 1GXUA 3WHIA 4QNKA 3JAMQ 1HW9A 1EAYC 2X7IA 5T7LB 1M5OC 3CULA 3BF4A 3CE8A 4TQRA 3IM9A 1TP7A 5LMUJ 5GAEU 4JI4F 2QLFB 4X2BA 1JB0C 4D3GA 2C37A 2FHJA 4LUBA 2ZH3A 2AEFA 3DD6A 1RI7A 2XO6A 2WCXA 4ED6A 5A2QU 2PC6A 2KZZA 5E3QA 1Y5LB 2MHEA 4CLWA 4KGXB 2G0CA 2BV3A 5B09A 5D78A 3HHLD 4J9MA 1JNZB 4FW4A 2F63A 2QC3A 2DH8A 2Z5CA 1X5OA 1G4CA 1IM4A 1U8SA 4DR5F 3NCQA 5ETTA 2Q79A 4M5IA 4JI4E 2DCLA 1Q0NA 2A0FB 3GMGA 4J9PA 3RB3A 1K8AT 1N88A 2K7KA 2J7WA 4RBVA 2FD2A 2AW0A 1FRLA 3KMSA 3QRQA 4EYIB 5K8PA 3F0NA 3HX9A 3OPKA 3QNWB 2KFNA 4DUZI 1W25A 1YGYA 4JV5E 3N79A 4ZKAA 2ROPA 1Y4ZB 3DLGB 3MEKA 3QAEA 2OD6A 1FE4A 1G6BA 1YRUA 1U0HA 4KPCA 4NYOA 1U0HB 5KT7A 3MR3A 4F0KA 2B9XA 3UCZP 2XHCA 3IC1A 3EZOA 2MZTA 1U09A 2KJWA 2OPRB 3F44A 5DRKA 3N6NA 2LEBA 4B9NA 3Q2TC 4F02A 4PG5A 3DMJB 3E51A 2LJPA 2HHXA 4DV7I 1N34I 3IXQA 4C3LA 1FXDA 3I9V9 5HO4A 4KFBB 1RUSA 1UMJA 2PO4A 3KLGA 2OP5A 4DL2A 3V4IB 1FFGB 1N5SA 4HT5A 3UI3A 4DR1J 2CIMA 4CLFA 4B3OA 4UW2A 3MAQA 3OUYB 2QA4S 2OPPB 2HQ3A 1PAUB 3BDEA 2VBWA 4DV2F 3UHMA 2J7KA 3CCES 2H51B 2BQUA 3ZKBA 1HR0E 3IWLA 2B7BB 4OI3A 2AHOB 2JWNA 4K2XA 4L72B 4PXCA 5ETKA 3PYFA 4NLRA 4R8UB 4DV0I 1I94I 3AT1B 4RZRA 2CPJA 4AXIA 2ERRA 3EDRB 4MAKA 3PRBA 4ZCKA 1RT4B 4DSEA 1RT4A 4DV3I 4PCQA 1N36J 1YJ9S 4JI2J 4YP3A 2UU9I 3H2VE 1Z5CA 4Y2MA 2ZC3A 1FJ7A 4H4MA 1FEHA 3V81B 5SUHA 1O8BA 5E0OA 1T9TA 4DCPB 1BLUA 1IBLF 2ROEA 3EE3A 5LSLA 4Q8FA 3RAMA 3OSPA 1XR5A 4RL1A 3GCWP 5K8MA 1F1BB 1RWUA 1JLEB 2JX2A 2MY7A 4TU9A 1U1QA 1Q5YA 2QEXS 3K7RA 3LALA 1X5SA 2MKIA 3LH2S 1EKRA 1SIZA 2HRTA 3CJ5A 4NEYA 1IKYB 4H4KA 5L8RC 3OHAA 3FEXB 1GX6A 2W9CA 4JI3E 2IDLA 1HMVA 3Q8VA 3R5AA 4DFMA 2QT7A 3AH6A 2QLBB 3H90A 5ETNA 4HYKA 2ZZNA 5M2RA 4LRAA 3VZIA 2V94A 2ZOFA 4QPTA 2YH1A 1Q79A 1JWWA 1CC7A 5D0RA 3T1HJ 1B99A 4O44B 4CI0B 3BQ0A 1YIJS 1BQMB 1RT6B 2ALZA 1VBYA 1N5YB 3P5BP 1H7SA 2Q6CA 4DV2I 2YKAA 3MD3A 3P4UB 4OHVA 5C24A 1FERA 1N34F 2W7PA 3EXYA 3P3DA 2DGTA 2E9RX 1T03B 4Z7CA 3NWGA 5B0AA 2O3DA 2HKEA 3FSIA 4PQUA 1P42A 1MLAA 3KG4A 2YQ3A 1S6OA 4F8RA 4AM3A 3UR3C 5J2NB 2ZJPQ 5B0BA 2UUWA 2BANA 5DJBA 2CG8A 2XCAA 1OQ3A 4YY3F 1ZZFA 3FRYA 1A9NB 3PYDA 2JFKA 4GKJJ 1AT1B 1PKUA 1RSCA 2DITA 1JLCA 1R8AA 3EUNA 2R2RA 3QGPA 3VAJA 2X1FA 4QWEA 2ZOMA 2WVBA 3OXFA 3PNIA 5H9FJ 4EI2A 2WB1D 3MPUB 4K50A 1PJ5A 2Z57B 5T41A 1VISA 5F9LA 2UVWA 3DLJA 2RU3A 4PG7A 4PEOA 4JV2A 4ZVGA 1OQ6A 1SJ1A 3LWMA 1KQGB 3GB0A 4KT0C 4EU0A 4EZ6A 3MCMA 4HR2A 4KHPE 3EM1A 5T7LA 5A6PA 4GKJF 4DMZA 3T41A 4KHRA 4C11B 2J6SA 3Q1QA 2AGQA 3T1AA 5THWA 5KFWA 4WYLA 1N33F 1QVFR 2QYGA 3W9IA 1K0VA 4B3MI 4F7VA 4EBDA 4OX9J 1FTCA 1A7GE 2KXFA 4PG8A 4ED5A 2OSQA 1APSA 4DV6J 4DV7E 1PYTA 4FDFA 1V5IB 1N34E 5L1JA 2PEBA 4CO0A 1YKWA 4GKKE 3LPEA 4EYHB 3I87A 4P7TA 1KQFB 4RW7B 5KFNA 4WTOB 3BM7A 1JJHA 4JI6I 3WX8A 1NRKA 1U1KA 3TUPA 3ENAA 3M9MB 2DHSA 2FLLA 5EUHA 3SXLA 1S7IA 3TAMB 2JOQA 4MIAA 2HBYB 1HHSA 1U8WA 4OV6A 4ATNA 3VR1A 1FNMA 2F40A 4LT6A 4ALZA 1NHJA 1HNVA 5D6GA 3H25A 1S1TB 1WEYA 3I0RB 2O67A 3BO2A 4F4YA 4LCFA 4YY3I 4H54A 4IFDB 3CWJA 4U95A 3BB5A 4U7UD 4DV3E 2QRRA 1TZ0A 3L7UA 2J9EA 3I31A 4KH1B 4YEAA 2VONA 1S57A 5HBMB 2BOAA 4DV4E 4AQYE 3DHWC 4I6YA 2BJDA 3M32A 4WXOA 4AFFA 3VQTA 4DQSA 1S1UB 3DGVA 2FC8A 3SFGA 5KFBA 4LF9F 4IH6A 4LSLA 5G0RB 5G0RA 1X4FA 3A8JA 2MZJA 3JB9k 2CJBA 3I9ZA 1D3WA 5I4MA 1NNDA 1JXEA 2LEPA 1QTMA 4HH1A 3TO8A 2ZH5A 2W2QP 3R6LB 4PWWA 2L9WA 4B3MF 2OEKA 4O44A 2AU0A 5LJ3Y 1RBOB 2YNIA 3J7Z5 4K0KE 2C3YA 4FYYB 3AJDA 5ITHA 2GCFA 3AQPA 1R0AA 2O3ZA 2WVDA 3DXBA 4I6WA 4X64E 1J5OA 4R0JA 1CULB 2RAQA 3UNYA 2H3EB 3OTOJ 3I5CA 2NN6F 4RJVA 5K36E 4NLQA 3MM7B 4MK7A 2J8SA 5DRPA 3ELHA 3TVYA 4ZVEA 2LLZA 3EXCX 2XCPA 3HPOA 3K59A 2BA1G 2SXLA 3DKDA 3I0SB 2DNZA 2HWTA 1Y5IB 3CDBA 1S10A 1HYSB 2E5IA 3TUJC 1NUEA 3GU0A 4C2MA 1Q16B 2E1CA 1FKAE 1MN7A 1QZRA 3LP0A 4DLGA 1TKXB 1EHWA 4OX6A 1EA6A 2AEMA 5HROB 4UUWA 5EX0A 5CYQA 3W9HA 4K4VA 2CQHA 4WP9A 1FFSB 1ZA1B 2VIHA 1SKWA 2DR6A 1PVGA 4ANEA 4ZCLA 4FBTA 3PIOQ 3PKMA 3CCWA 1S1XB 5CCMA 2UVUA 3KK3B 1DQ8A 1RU1A 1NKCA 2AJ0A 3FZ2A 1VBKA 4OYIA 4X65F 1QLNA 3HO1A 3RYLA 1RT7B 1F2GA 4FWDA 3K8WA 3Q86A 4K5RA 2UUAJ 4L75A 2ZE2B 4FYXB 4DR5J 2XZTB 2I38A 2RNEA 5BJRA 4IFDC 3NXZA 3MEDA 2BR0A 1LWFB 5RUBA 2MZRA 5KT3A 1EI1A 4HYMA 1N8RT 3CJSA 4BA1B 4GMKA 3DN9A 5KFCA 4B3ME 4HXZA 2XY7A 2A2DA 3C8YA 2GMJA 1EJ7L 4RW9A 2HHWA 4W90B 2K1RB 5J2NA 4Y2AA 1WOPA 3U02A 5LXRA 2RE1A 4V19J 2MLXA 2HSEB 1KVIA 4M94A 3TA1A 2CNLB 2CYYA 1HL6A 1YG0A 1C4CA 3RGIA 2IIHA 2HK3A 3ICLA 1K73T 2HHSA 1EIYB 1PJ6A 4ZP7A 1GQEA 2WONB 3GIRA 2OUGA 1QVGR 2V4RA 3WC2A 1XNRJ 5HN0A 2E5LE 5A0YB 1KS2A 3FJ2A 1VQPS 1NDPA 4CO1A 4JI1F 2XG8A 2VJUA 1HMVB 4OYAA 2XHWA 3BPSP 1F3VA 3L09A 3MM8B 2R42A 3HHLB 4PPDA 1NPKA 2EFPA 4P2FA 5G4DA 1Y7PA 4OX7A 5KFYA 3T6JA 4OJGA 5I3QA 4DSFA 2CXEA 5IV4A 1NKBA 2K3IA 3G6ES 3FGVA 3TR5A 3CD5A 2UVRA 5I3UA 1UVIA 1UKUA 2Q2EB 1EARA 2D74B 3IP0A 4HDHA 3FFIB 4IG3B 4F0HA 4DX7A 5F8LA 4ZJQA 2BABA 3Q8PB 2VA3A 3P3GA 4JI1J 4OO1B 4OZ2A 3G82A 2C42A 4FN5A 2WBMA 4J9RA 1JLGB 1N32E 4J5OA 1GMVA 4ED2A 1KLNA 3QGGA 4IZKB 2AJ2A 3SEOA 2EWHA 1FE0A 3PW7A 1NSPA 2CQCA 3D6HB 4AL5A 2B4VA 4B3TI 4GKJE 1YJRA 1ULRA 2CVIA 5E41A 4IFYB 2EBGA 2LQBA 2UXDI 4OX9E 3K17A 2LFVA 5J1NA 4RW4B 4AQYF 4P72A 2UP1A 2OO4A 4JI5F 4JI0F 5M2UA 1LWCA 1PSDA 4JP8A 4OI4A 1KBRA 1HBOA 4F4XA 2VOOA 4NI2B 2QTWA 1VGYA 1Z0BA 4X4SA 3DI6B 3Q6MA 4G1IA 2HHHE 3J7AG 1ZM3A 4ID5A 1A6LA 2XULA 3Q22A 1RGVA 1TKDA 1U7LA 2NN6E 3MXHP 2F8EX 2A1BA 2ZBCA 4H4OB 3EVWA 3CJRA 2DO4A 2DT9A 4Y34A 2UUBF 4J9UE 3N4WA 3D68A 5CCLA 4ZP8A 3MURP 3R5JB 4WCEQ 3CDIA 4LFAE 4KKOA 3VAHA 1L3VA 1B0VA 1ZYQA 4UOHA 4C48A 5HVGA 5JEAD 1S97A 2WONA 3S01A 3T5KA 2O1TA 2CQPA 2FVRA 5FDLA 4TYAA 5FDLB 1Y3KA 3BV8A 1AFJA 3VV2B 4ZVIA 2CVEA 2YPYA 1O5JA 5EWEA 2BE7D 2ILYA 2PNMA 3HMJG 3S8SA 1KSPA 4DR7I 2OMOA 1R6MA 3P49B 2HKJA 2GZOA 1RT1A 1P9QC 2OAUA 4CT9A 3DM2A 2LA4A 3GQCA 1FRMA 3NL0A 4DR2I 3H59A 3D0IE 4M1KA 3UN3A 3QLHB 4BC9A 4E8UA 4AUKA 5HSPA 2XY6A 4B3SE 2G0IA 3EX7B 3WU5A 2JH3A 4F4KA 2KHDA 3D28A 3MPWA 1IXKA 1UEUA 2UXDF 1RDRA 4DV1I 4P2XA 1MNEA 4NI2A 1IKWB 1RR9A 1RTJB 3HVTB 1YSJA 4AIDA 1F5AA 1HWKA 4OHXA 1RZMA 1FHTA 2V6AA 3HVAA 4WFBQ 3IBFB 4I0WA 1KQSR 3KK2A 3C3LA 4LF4I 4OI2A 1EQ0A 2M0GB 3OTBA 4U8VA 5A2QC 5K36B 5K5MA 4RUAA 1Q5VA 1IKVB 1R43A 3M2RB 2MZSA 3ZTOA 3IRWP 2YKQA 5IT0A 4A8MP 4IZKA 1M90T 2DRDA 2UUCJ 2QLWA 1KNZA 1NK8A 1LK5A 4N8NA 2DNQA 5D77A 1WC3A 4EMDA 1JLFA 1YI2S 1SV5B 3I96A 4DCJB 4HKQA 3HHDA 3POTA 3Q8YA 4MFBB 4NA3A 5KFAA 5KG0A 3VHQA 1M1KT 4P74A 2XBPA 5SZTA 5C0XA 3UD3P 1GTEA 2KKHA 5IWAF 4GC6A 2VDIA 4I68A 3GFZA 2WB4A 2CQDA 2CPFA 2ATCB 4LIWA 3VAKA 2HHTA 2DNOA 1PC5A 1QM9A 4RW8B 1Y5YA 2C2NA 4C8MA 1RISA 3KG1A 4BWJA 2RUSA 2I6WA 2HQFA 2KFYA 1Z4UA 5A8KB 2HZVA 4UY8T 1N33I 2DHHA 1VC0A 2VG5B 1KVKA 2V2VA 1XJWB 2DIVA 3NY0A 4USIA 4JV0A 4BLGA 1GT8A 1Z0EA 3QMQA 1VIXA 1FX4A 2HZCA 5C0XC 1IBKI 1KLMA 3D6FB 4OIXA 3M6WA 4IDKB 2HIQA 1ZTWA 1OYDA 4P75A 2BZ2A 2MZ1A 3M6UA 4BS2A 2DVIA 2C38A 1VRUA 2J5AA 3A8KA 1HWLA 5LSRA 4X65E 2JEAA 2DJWA 3U1YA 4NZ6A 1X5PA 1VR6A 2B4OA 2BANB 2KT5A 2PMZD 1TAQA 3VCDA 4K4XA 4CTAA 4IG0A 4JOUA 1I6JA 4K4ZA 2X36A 3CF5Q 3DHXA 4OHYA 2IC3A 4F67A 1TFYA 2IC3B 3G86A 2X1GA 4G1QA 4OYMA 3KNGA 4DOZA 4B02A 1NDKA 2MTLA 1N36F 3QAUA 1S1VB 1WD6A 2ABYA 2B5JA 4OI6A 4USHA 2W01A 2JSXA 2YH0A 3N6MA 3EGNA 4GO7X 4OV1A 5B0FA 2E1PA 2IHR1 5HBMA 3TZXA 2C2MB 4IKAA 1IJFB 3MR5A 2VJVA 1WUUA 1GH8A 2VC0A 1QAIA 5C0XD 1KP6A 1TVRA 2HFUA 3P6YC 3VGTA 2FZGB 4HACB 2MQOA 5HVFA 4KHPF 3JTPA 5EX3A 5IWAI 2F1DA 2UU9E 4ZA1A 4G65A 4DCOB 2DXEA 1XR6A 1N32J 3E2EA 2YKNB 3OFGA 5E5NA 3AD9C 1S1WB 3UN5A 2IM2A 1F60B 3LP1B 3UN2A 3F56A 1X4HA 4ZDNA 2AYBA 3VZHA 3T1HE 2PO1B 2WTFA 2H5IB 1PYOB 1FKPB 1RK8A 2IAJB 1FKPA 2KO1A 2NPIA 2XSJA 3AQOA 4DPOA 3OHBA 2H5EA 1TK0A 4KJIA 1N56A 4DR2E 1UJ6A 4EK2A 2E29A 3E3XA 3DOKA 1W26A 1YITS 5ETMA 4O0IA 1C2PA 2UUCF 3I0SA 1YBTA 1YJTA 4XK8C 3W64A 4PRVA 4LREA 3DLEB 1B7FA 8RUCA 4K4UA 5AT1B 5GMDA 4ED4A 4RNOA 3RRHA 1BKNA 4L76A 2GIFA 4CM2A 1QDUB 3W8PA 2E5LF 1NSQA 1M0SA 2Z56B 3GIJA 1S9EB 2CRLA 1RWPB 4IYQA 3NGDA 1QSLA 4URSA 1UDSA 2AV5A 2HWHA 4ZP6A 2EKNA 3KLVA 2FJVA 3DGPA 4IOBA 1HHTP 2DR5A 4DPWA 3HM9A 4ED8A 2ZJQQ 5EN1A 3IWXA 3CJ4A 4LSNA 2BA1D 1XMQI 4ECXA 2YWWA 4ECTA 3EGVA 2DIUA 4IO9Q 3RB6A 1NZ8A 5DS7A 4DV7F 3T1YJ 4OYBA 3GYGA 3LNUA 2VQEF 2MDAA 4TY8B 4M5JA 3W2VA 1IJEB 2NN6B 4GVBB 4AD6A 1JJ2R 1X60A 4LFCE 4JYAE 1T95A 1Y10A 2V4JA 1RXOB 3L4BC 3N5FA 1DJ0A 1IN0A 3DOLB 4CO5A 4WP8A 4PXBA 3KLFB 3BQ1A 4DFJA 1OPZA 4X65I 3T1HF 5IM0A 2VQFI 4B3RI 2HHPA 1Z59A 5E2QA 2LXUA 1S1UA 4UOGA 2PNLA 3FCVA 1UFLA 3IS9B 4RBUA 4BA1A 1GEHA 3IBWA 2MKHA 2AYGA 5KFFA 4DSKA 1N0VC 3A3OB 4IDKA 4OZNA 4ZIVA 1ITPA 1CG2A 4MTPA 5L1LA 4ECRA 3CCUS 2FHOB 2Z2MA 4ELVA 1UZDA 1N33E 1CBKA 1U6FA 4ZVSB 1FA0A 3KOAA 1HK7A 2BJ7A 2ZE2A 3LGHA 3BO4A 1IWGA 2PA8D 3HHEA 4NEZA 4EBEA 4JI1E 3O3LA 1VQLS 1HNXJ 5GVQA 2QA4G 3OFFA 4E98A 4J7CA 5IQ6A 1C1CB 1CJKB 1RP5A 3BZQA 5DDPC 4A8KA 2NXCA 3C6UB 2RD5C 1RKIA 1NHIA 5HQ8A 2ZM6I 1F2HA 2WZ1A 3PX4A 5IWAE 2CQ2A 2XNQA 1UPPA 3DOKB 1ZETA 4O3SA 2OHDA 3KDNA 3POTB 3SCKE 1NPRA 4BA2B 2YNHA 4JI2F 4PUOA 2QN6B 1GNKA 2IA0A 4USUA 2AX0A 1F9EB 4ZCIA 1V3RA 3HJVA 1I3OB 3AD7C 1S72S 2YNFB 3KYLA 3BH6B 1FD2A 3S6EA 1WF0A 3RBZA 2AD9A 3PRYA 1SI9A 3T5JA 4WJBA 2HIYA 1KRPA 2B6AA 2VPZB 2M88A 3WU4A 1VMBA 1IBKE 4LFBI 1CC8A 3FRZA 2VODA 2ZHAA 4LF8I 2RQ4A 4I2QB 1CJVA 2MYFA 4OJHA 3OTDA 1XWLA 1U26A 1TMMA 3RW7A 5DDOC 4ED7A 4RLEA 4ID8A 3G6XA 2Y1IA 4FF2A 4OO1A 4HACA 3C16A 1IKWA 3KDOA 4DUYF 4HI1A 1UJ4A 2UXCI 4DV4J 4PWDA 3V4MA 5K20B 2O5DA 4CWBA 3BYRA 1RYRA 3FNNA 1QSYA 3US5A 3R5BA 3B78A 3RBXA 5GAGU 1XC9A 4L74A 5DROA 2K06A 1IBME 4B3SF 2P2CB 1E6YA 4ILRA 4U8YA 2X1BA 2AF6A 2NQPA 4FW3A 2UUCE 3B4DA 2UUAE 1LWEB 3QO9A 3UNGC 3ISNC 3A4TA 4KC5A 1I94F 1RTIA 3PHEA 1S6PB 3I4HX 4JI0I 2JEAB 3K5OA 4LFCI 5JJBA 3DOMB 4ED1A 1RAAB 3WIUA 2UZAA 2E7VA 1EETB 2LXFA 3AXKA 1C4AA 2BYCA 2ZITA 4PZVA 4PKDB 2X1AA 2IMOA 3I0RA 3K58A 1EKSA 2VZ9A 2OH2A 4LF7F 1X31C 1FDAA 2KXHA 2DEJA 5IQQA 3ZNJ1 3ZTPA 2WNRA 3J81Q 3CMQA 4OO1E 3KLEA 1OSDA 3QZ8A 5GMEA 3PS3A 1AROP 4C0BA 2HHVA 2IA6A 4DUZE 1ZBTA 2DHAA 4KB7A 3IN5A 4NX9A 3HSDA 4LF8F 1WHWA 5LMNF 3RJMB 4MKVA 2XMUA 3A13A 3OXGA 2W7AA 4LF7J 5L3JA 3PYGA 1FVQA 1GXTA 2G9OA 5KT2A 1MWQA 1VRQC 4TU7A 1X9WA 2FVPA 3JXOA 2ZUAA 5BR8I 4LCHA 4NXNI 3CSKA 4ZITA 4DSJA 3CD7A 3FEZA 1KVJA 1XMOE 1OMSA 2BJ3A 2IERA 3P06A 3CB4A 5F8IA 5GAEI 2V67A 2DNMA 1RAOA 1IKVA 4NRUA 3TA0A 2AQ4A 4QU6A 3HXMA 1BUXA 1FXRA 1HNZF 2W2NP 3UCGA 1LWXA 2IRXA 1DZ5A 2UXBF 5KFHA 2XS2A 1XK8A 2CWKA 2NREA 4YHHE 4C8NA 1XNQI 2CPXA 4NA2A 5FLXU 3J7ZT 1D9AA 3DU6A 3ISND 5DNLA 2BOPA 2MKCA 2DNHA 2NZCA 4KGKA 1K44A 3UDCA 5CZXA 2PE8A 1R0CB 5DGBA 2EVZA 3S7RA 5EDWA 1JX4A 4LJMA 4LVNP 4NOHA 3H1CA 3CCLS 5C42B 1H38A 5EL9A 2F4VF 1TL7B 2F5GA 1X8DA 1F0XA 3LO3A 3M8ZA 2Z8QA 1J5EI 1WKLA 4QR2A 2YKPA 4P7VA 4NPOA 3OVSA 1O51A 2ZKTA 1YTYA 4DR6I 2WRMA 2YNGA 2JC1A 4EGLA 4YFUA 4A48A 5K8NA 4YB7A 4OI1A 4IOAQ 4NRTA 3K2YA 1X4GA 4LF6J 2GHWA 5LM7E 5C25B 1Z0GA 4MIBA 5HK4A 3MMCB 2K7JA 2VPYB 3MUMP 1FJEB 5LSOA 3MAAA 4YOEA 1TKZB 4B3MJ 2L9NA 3GTYX 1TK8A 4K4SA 1USUA 4NCGA 1SQGA 2DYAA 3FZBA 4DL6A 1JXVA 4DS5A 3KJFB 4DR6F 3IM8A 4UOCA 1NJIT 4DV6I 1B64A 1RREA 2Q66A 4DV3F 4TY9A 1U25A 1G3OA 1UVMA 4QZVB 4JI6E 2R2UA 5FLXQ 1IBMI 5E33A 2NSCA 2IFXA 1WHVA 3OR1A 5CD4A 3CC7S 3BGFA 3PM9A 1UCNA 2WP8A 4U3BA 5C0XB 2DNGA 5CD4H 4YHHJ 4I69A 1S1TA 5E7OB 3HDSA 3R1LA 3E01A 2Y1LB 4QW9A 4Y65A 3G9CA 3W62A 3MEEB 3R6GB 3NNCA 3M2VA 2FHKA 4A8YA 2K8GA 2OD4A 3VTIA 5F0UA 2E5LJ 2R8KA 4X4UA 1VBXA 4ED0A 4C6AA 2GMHA 3J7AM 2CJAA 2C3UA 4OZ5A 3I5AA 4F36A 1T05B 1A0OB 1N48A 5KFDA 4DF8A 3QJJA 4MT1A 3TA2A 3H5YA 3DLKA 2BX6A 1F5CA 2EC2A 2YWFA 3MF5A 4QQBA 4YR2A 4Q0BA 3CNQP 1F9FA 1TKXA 1AA1B 3CDUA 1XEZA 4HTIA 2V9KA 4U7UK 4LF5I 1Z5AA 2XZDB 2UV8G 4B9VA 4NZ7A 4CLPA 3OUYA 4LQ3A 4KHPI 2MY8A 4WE1B 3H5XA 2VL1A 2PFDA 1UDQA 2C2ZB 1HNWJ 1T05A 4P2MA 1S1WA 5DRRA 5AXLA 5C2GA 1HPZB 2GQ2A 2PO0A 1NHUA 1PO6A 2R7RA 4B3SJ 2HFSA 1Z5BA 2XM3A 1FO1A 4XO0A 1Y9OA 4IRDA 5L9XA 4B9SA 4OYOA 1GXLA 2CPZA 5KFKA 3CCJS 4DV5F 5EKWA 2WVEA 3J7YU 2ATLA 4TNOA 1N6QB 1D9DA 2V8DA 1UVJA 2PMHA 4ZCMA 1GMWD 3R5CA 4TU8A 2FVSA 4UZBA 2OJ3A 2UUBJ 2F1FA 4C8ZA 2HQIA 4I56A 3L7ZA 3HF5A 2KTQA 1CJUB 2OPSB 3DLGA 4NLTA 4IR1A 1D8YA 5BYRA 1P1LA 5EHHA 3N01A 1HQUA 1JQGA 5A8RA 2ZKUA 2LQ5A 3UFCX 3NBPB 1WTFA 2M70A 3SSRA 4FPRA 3B4MA 3GR1A 1VQ6S 3PX6A 1RWXB 2KYXA 3M32B 1IBLI 2MSSA 1YLXA 2HVDA 1TKZA 3DNCA 3MM5A 3WC0A 2HHQA 3AJ1A 1LXJA 2IBOA 2YY3A 4CTAB 4IR9A 1DRZA 1FRHA 5L38A 1WSRA 5JUMA 2OI2A 1LQ9A 3D54A 4JV5J 4JYAJ 2MQ8A 2DD8S 3CDWA 3M30A 3OD2A 1N52B 2MQPA 2GHPA 1QSSA 2MXYA 3CJ3A 1OY6A 4FYWB 3VGUA 3HJCA 1OSCA 3TAQA 1OY9A 4OYPA 4N56A 5KFPA 3AAWB 5B0GA 4DG1A 4YMEA 3RBDA 2MPUA 4DUYI 2JVOA 1L3UA 3LA0A 5KG2A 2APOA 4U67Q 1YHQS 1HBUA 1CPZA 2FY1A 3M1VB 3MPDA 4FP9A 3ZKDA 1OPIA 2HGLA 2WHOA 2FTRA 4CRJA 4N77A 1YJWS 2LQJA 1FFWB 2YVSA 3JQKA 5LMNJ 4EO8A 4DR4F 3I6PA 1FF2A 2BKNA 4G3IA 1HA1A 4HHUA 3C14A 4WKYA 3MMBB 3P76A 3SCJE 2D3UA 5KFSA 4AIMA 2V8HA 4JI5J 1VDHA 2D41A 1MU2B 1H73A 2K2PA 2N4DA 2VG6A 1AUDA 2BDPA 2Y8WA 4ECSA 2BM0A 2RJZA 4JI8J 1H0HB 1Z1ZA 3HHKA 2RRAA 3D7SB 1Q78A 5DDRC 2LXIA 1SC6A 3NAIA 1IWAA 5E3CA 2YKNA 3TZWA 5LXYA 4OZEA 1FJGJ 2QMWA 4AT1B 1OYSA 4PYDA 1HNXE 4UTGA 2J9DE 2ZZMA 1Z2ZA 3B6BA 2CDQA 4X4RA 1SKRA 3D0GE 2DPIA 3FQLA 2ZEJA 3SSQA 3UR0A 2IESA 4MQYA 2W9BB 1S77D 5HMXA 2FY8A 2PSZA 5KFGA 1IKXA 5IC4B 4LF7E 2E7XA 5KOXA 1RHKB 4QOTA 2J6UA 2E66A 2UVVA 3H4BA 3RRGA 4ZPAA 1IR1A 3B4TA 1HBNA 1LNQA 2HMIB 2VH7A 3SQGA 3DRPB 4ICLA 4J9QA 3J80Y 4ECVA 2EFOA 1USVA 4X4QA 4MDTA 3VGSA 2J9CA 4GKKF 3J80C 4QCLA 1FRJA 4TVAB 2ZHOA 3W8GA 2Z2YB 2YWEA 1JJCB 1JKHB 2MQMA 1JKHA 2VC1A 3WDOA 4LF5E 4F3MA 4FVCA 4JUZA 2AP6A 3CIMA 4RW9B 5HMWA 3M9NB 2WNRB 2YWKA 5IC6B 5ELWA 2N3OA 4MIWA 2G2YA 2CJXB 1TV6B 2CPDA 4LF9E 1Q95G 4K2JA 2DRAA 1VQMS 1S0OA 1K9MT 2OKQA 1RT6A 1HQEA 2J76E 3PFEA 2ZFHA 1X5TA 3PRDA 1W2BR 1N5YA 2VPWB 2W2OP 2RVJA 4XAKA 1SJFA 4WU2A 3OL8A 3GJQB 5L1KA 5ETRA 4ED3A 1SJ3P 1N4LA 1XNRF 2B4UA 3QO9B 5J2QB 4WU3A 2GJFA 2POKA 4DQPA 4BBYA 2ZD1A 9ATCB 4FW5A 4A8XA 3RAQA 1DLOA 4C3KA 4FNHA 3R9LA 5A8KA 4X84A 5IZHA 2CQ3A 1HWUA 2VFVA 3D9BA 2VB6A 4HH0A 4O23A 1RWKB 1WC1A 3SBMA 1LV5A 2DB1A 2PA3A 2GQQA 2GC8A 4O3RA 1NSAA 5GADU 4ZJLA 4NLDA 4Q45A 4ILLA 5IT9Q 3R27A 3T9ZA 3OTOF 3D6TB 4WZQA 1SL0A 4QYZK 3MCSA 2M9KA 2HFNA 4Y3CA 1HI1A 1S9FA 1JLQB 1DQ9A 3BS9A 4EZ9A 3AODA 3JS9A 2BE2B 2EPIA 4F25A 4ZVPB 5I42B 4K0KJ 1SV5A 3PKYA 1CJVB 4K0KF 1WDDA 3I4PA 2JFDA 2I9SA 4IQMA 3JSMA 4OO1D 3M4XA 4ES1A 2HFOA 2MKSA 1NDLA 2QE5A 3LP2B 4OYWA 4CO4A 3BQ2A 1T03A 4WBFA 4QWCA 2GO3A 4FWHA 3J81j 3HSJA 3A3NB 1Y5NB 3Q8QB 4KBIA 2RU9A 3WZ0A 4WKRA 4DR1E 3CW2C 4LFAI 4KHMA 2Y3YA 3BJYA 3N0VA 4F3QA 1JK9B 2DXDA 3T3FA 2YNHB 4LIRA 4PUOB 2AWZA 1H74A 3SYZA 2KVQE 3BKTA 2WP8B 3QBCA 3AOAA 2KM8C 3UPFA 4MYUA 2GW8A 1D0EA 1N5QA 2FVCA 1WC5A 1RB0A 2A18A 4DV1F 2V4QA 5F8GA 2EFQA 2ZWPA 4ZJOA 3PR4A 3U1KA 2W4PA 3KLGB 3V4IA 4B3RE 4U7CA 2BKOA 5DRQA 2GO8A 5B7WA 4XDDA 1TTHB 4LF6F 1ZXMA 1HNZI 1UEKA 2XZWA 5KFRA 2CJQA 3LGMA 5J2PB 3K0JA 3KHRA 4C9DA 2JEBA 3PZPA 4J3DA 4U3DA 1VK3A 3NZKA 1FDNA 4DZDA 1H72C 2IJFA 1M5SA 2KVIA 2DNYA 3N6LA 5D0HA 3TUIC 2RQCA 3M8PB 1XNQF 2XS5A 3L7OA 2XGPA 5GMKa 4CM0A 1R6YA 3OLAA 1RHUB 4DR3F 3HK2A 1R8PA 3W7BA 4F0MA 4ZK7M 2JDJA 3KXDA 1RLDA 3C15B 2CDRB 1PIEA 2ZM6E 2COLA 3AFGA 3C66A 4QWBA 1NEEA 4P2SA 1X7VA 4DHVA 1BC6A 3RBEA 5F9NA 5FIIA 1RAHB 1T9WA 2LCWA 4TY8A 4XPCA 1FI4A 1J5EF 3MM6B 5IS2A 4EEYA 2IVYA 1YBAA 2JEJA 2RRBA 3KTQA 4NXME 2DKOB 1JLEA 2QA2A 3QT5A 2F7VA 3MDFA 4ZVFA 4JI4I 4X66J 3V6JA 1OY8A 2XO7A 4DL0C 3FBEA 3HFZB 3QJPA 1DTTA 3KJVA 4F04B 4DUZJ 5D0GA 5MLCV 2ZH4A 5ETSA 4DDFA 2RUGA 5HLFB 3GPAA 3QWPA 3EWGA 2W9AA 1KC8T 3LOUA 1RKJA 2W25A 2QGFB 4UT4A 2G0JA 5B08A 5K36A 1EX8A 4YHHF 4WFNQ 1IBMF 1AZSB 4ZVQB 1WORA 3ADAC 3DRSB 5FD1A 1Z0WA 1DY3A 3MEEA 3Q23A 1DURA 2HFZA 2CZ4A 4DV7J 1N34J 3D5MA 2HRYA 2Y0BB 2BR2A 1JLQA 2G1HA 3ZFVA 3KLHB 3EVMA 1TUWA 2FHJD 4Y28C 4OFZA 3TYTA 2HBQB 4P10A 5CYJA 2YPZA 1T3OA 3MR6A 1FK9A 2XS7A 3G8SA 4DR1I 4G6VB 1OJ4A 1NJZA 1WC6A 2HPUA 1VQOS 4Y2IA 2CG9A 2RIJA 1Y3JA 2D3O1 4DR7F 2YX4A 1Q7LB 2RHQB 2BW2A 4HL9A 2H4WB 1RT1B 1FWPA 1TKTA
chains in the Genus database with same CATH topology
2UU9E 2F4VI 2O1UA 5FWKA 3H4LA 4JI7E 3M6AA 3T1HE 5LMUE 2R3VA 5LL6R 4NXNE 4DR2E 1I94E 3V5RA 1S16A 4PRVA 3CWVA 2ZM6E 5GMDA 1DARA 4ED4A 4USKA 1BKNA 1XHKA 1J5EE 4X62I 1MX0A 4DR7E 2UXDE 4LF7I 4LFBE 4DPWA 1HR0I 1XMQI 4LF8E 2VQEI 3LTOA 3QT7A 3LNUA 4JI3I 4LFCE 1B63A 4JYAE 1XNQE 1MU5A 4LF4E 4HXZA 2HK2A 4I3HA 4B3RI 4X65I 4JI6I 2VQFI 1N32E 3T1YE 1Z59A 3JAMQ 1S4EA 2X7IA 2PNLA 4LFAI 4DU7A 1N0VC 3Q6NA 3OTOE 4WUCA 1N33E 4JI7I 3D4JA 1HK7A 4JI1E 1FJGE 4IZJD 2BV3A 2CZ9A 2Z5CA 1NHIA 2ZM6I 1PKPA 4JI4E 5IWAE 5IT9C 4JV5E 3F0NA 4DUZI 4X64I 3PRYA 1IBKE 1K47A 3QT6A 4LFBI 3WU4A 4XTJA 1XMQE 4LF8I 4DV7I 3WU6A 1N34I 1NZ0A 4HACA 2F4VE 2UXCI 3ZM7A 3B78A 4DV4I 4Z7YA 1IBME 2J7KA 3ZKBA 1HR0E 2UUCE 2UUAE 3PYFA 1I94I 4DV0I 1N36E 1ZM2A 4NXMI 2O1VA 4JI0I 4DV3I 4LFCI 1N0UA 2UU9I 1Z5CA 2E5LI 4JG4A 2ZITA 4JI2I 3J81Q 2DEJA 4WUBA 3B8HA 5GMEA 3OTOI 4DUZE 2IOPA 2UUBE 1ZM9A 4JI3E 4HY1A 4DPXA 4MYTA 5L3JA 3PYGA 3T1HI 4JI5E 4DUYE 5BR8I 4NXNI 1XMOE 3PYEA 1D6TA 3P06A 1H7SA 4DV2I 4DR3E 4JYAI 4Z7CA 2HKEA 4YHHE 5FLXC 1XNQI 2UUAI 5LMUI 3PYDA 4DR5I 4IZJA 4IZJB 1HNXI 1VISA 4KHPE 2GS8A 5LMNI 2V8PA 4DPYA 3JAMC 1J5EI 4DR6I 2A2CA 4OX9I 3Q1QA 1Z0GA 4B3MI 2HHHI 2GQ0A 4DV7E 1N34E 2Z5EA 1USUA 4GKKE 2V2ZA 4DV6I 1FJGI 2Z5BA 1RREA 4DPTA 4LF6E 4B3TE 5BR8E 4JI6E 5FLXQ 1IBMI 1XNRE 2CGEA 4DV1E 2XEXA 1NHJA 1FNMA 4YY3I 4DV3E 4DPUA 4YHHI 4JI1I 4DV4E 4AQYE 2E5LE 3J7AM 1IBKI 4LF9I 3HULA 4LF5I 1Z5AA 4KHPI 4K0KE 4X64E 1Z5BA 2HFSA 4B3SI 2UXBI 1FKAE 1FWKA 1KTVA 3V2UC 1QZRA 2UUBI 4KQVA 1EA6A 1HNZE 1IBLI 4DV2E 1PVGA 2WW4A 5IT9Q 1Z0CA 2OI2A 4FWDA 3HJCA 5LMNE 4GKJI 1U2RA 4DXLA 3ZZTA 2AJ4A 4DU8A 4DUYI 2VF3A 1EI1A 1KIJA 4HYMA 4PRXA 1Y4SA 3ZKDA 4URLA 4B3ME 4DV5E 2A2DA 2NPFA 1Y4UA 1B62A 1Z0VA 1H7UA 1HNWE 2O1WA 4JI0E 1ZM4A 4LF6I 1H73A 4P52A 2HK3A 2BM0A 4JI5I 1XNRI 2DEIA 4JI8I 1HNXE 4UTGA 4DR3I 4DR4E 4FW9A 2R42A 4DR6E 4LF7E 1IBLE 4RPFA 2Q2EB 4YY3E 1USVA 3J80C 4FN5A 4GKKI 4LF5E 4IZKB 4P7AA 2ZBKB 4LF9E 4B3TI 4AQYI 2UXDI 4OX9E 3K17A 4DV5I 1Z0BA 3Q6MA 4DR5E 2HHHE 3J7AG 1HNWI 1ZM3A 4X66E 5A2QQ 2VQFE 4X62E 1N32I 4LFAE 2EFGA 4R1FA 1FWLA 2O1TA 3J80Q 2V34A 4ZVIA 2PNMA 1NHHA 4K0KI 4FWGA 4DR7I 2UXBE 4DV6E 2HKJA 4FWHA 1Y6ZA 2V2QA 4DR1E 1KKHA 4DR2I 1ELOA 4M1KA 4B3SE 1H74A 3WU5A 4DV1I 4MYUA 3ZZ0A 4USMA 4DR4I 1RR9A 1ZXNA 3K1JA 4B3RE 3LPSA 3T1YI 1ZXMA 1HNZI 1UEKA 4LF4I 2IOQA 5A2QC 2UUCI 4DV0E 1H72C 4IZKA 2Z5BB 2VQEE 4WUDA 2E1RA 4EMDA 1A6FA 1MG7A 3B82A 1PIEA 4JI2E 3K85A 4PU9A 1FI4A 4NXME 3GONA 3QT5A 2LJPA 1N33I 4JI4I 1KVKA 2V2VA 1Z0EA 2UXCE 4X66I 3QT8A 4X65E 4UT4A 1Z0TA 2X36A 1Z0WA 3ZZUA 1N36I 4JV5I 2Z5CB 3WU3A 1WUUA 2HFUA 4DR1I 4GKJE 1OJ4A 2CG9A 1XMOI 4HACB 4N3OA 3J81C 5IWAI 2BM1A 4JI8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 E;  2F4V I;  3H4L A;  4JI7 E;  3M6A A;  3T1H E;  5LMU E;  2R3V A;  5LL6 R;  4NXN E;  4DR2 E;  1I94 E;  3V5R A;  1S16 A;  4PRV A;  3CWV A;  2ZM6 E;  5GMD A;  1DAR A;  4ED4 A;  4USK A;  1BKN A;  1XHK A;  1J5E E;  4X62 I;  1MX0 A;  4DR7 E;  2UXD E;  4LF7 I;  4LFB E;  4DPW A;  1HR0 I;  1XMQ I;  4LF8 E;  2VQE I;  3LTO A;  3QT7 A;  3LNU A;  4JI3 I;  4LFC E;  1B63 A;  4JYA E;  1XNQ E;  1MU5 A;  4LF4 E;  4HXZ A;  2HK2 A;  4I3H A;  4B3R I;  4X65 I;  4JI6 I;  2VQF I;  1N32 E;  3T1Y E;  1Z59 A;  3JAM Q;  1S4E A;  2X7I A;  4LFA I;  4DU7 A;  1N0V C;  3OTO E;  4WUC A;  1N33 E;  4JI7 I;  3D4J A;  4JI1 E;  1FJG E;  2BV3 A;  2CZ9 A;  1NHI A;  2ZM6 I;  1PKP A;  4JI4 E;  5IWA E;  5IT9 C;  4JV5 E;  3F0N A;  4DUZ I;  4X64 I;  1IBK E;  1K47 A;  3QT6 A;  4LFB I;  3WU4 A;  4XTJ A;  4LF8 I;  1XMQ E;  4DV7 I;  3WU6 A;  1N34 I;  1NZ0 A;  4HAC A;  2F4V E;  2UXC I;  3ZM7 A;  3B78 A;  4DV4 I;  4Z7Y A;  1IBM E;  2J7K A;  3ZKB A;  1HR0 E;  2UUC E;  2UUA E;  3PYF A;  1I94 I;  4DV0 I;  1N36 E;  4NXM I;  1ZM2 A;  4JI0 I;  4DV3 I;  4LFC I;  1N0U A;  2UU9 I;  1Z5C A;  2E5L I;  4JG4 A;  2ZIT A;  4JI2 I;  3J81 Q;  2DEJ A;  4WUB A;  3B8H A;  5GME A;  3OTO I;  4DUZ E;  2UUB E;  1ZM9 A;  4JI3 E;  4HY1 A;  4DPX A;  4MYT A;  5L3J A;  3PYG A;  3T1H I;  4JI5 E;  4DUY E;  5BR8 I;  4NXN I;  1XMO E;  3PYE A;  1D6T A;  1H7S A;  4DV2 I;  4DR3 E;  4JYA I;  4Z7C A;  2HKE A;  4YHH E;  5FLX C;  1XNQ I;  2UUA I;  5LMU I;  3PYD A;  4DR5 I;  1HNX I;  1VIS A;  4KHP E;  2GS8 A;  5LMN I;  2V8P A;  4DPY A;  3JAM C;  1J5E I;  4DR6 I;  2A2C A;  4OX9 I;  3Q1Q A;  1Z0G A;  4B3M I;  2HHH I;  4DV7 E;  1N34 E;  4GKK E;  2V2Z A;  4DV6 I;  1FJG I;  1RRE A;  4DPT A;  4LF6 E;  4B3T E;  5BR8 E;  4JI6 E;  5FLX Q;  1IBM I;  1XNR E;  4DV1 E;  2XEX A;  1NHJ A;  1FNM A;  4YY3 I;  4DV3 E;  4DPU A;  4YHH I;  4JI1 I;  4DV4 E;  4AQY E;  2E5L E;  3J7A M;  1IBK I;  4LF9 I;  3HUL A;  4LF5 I;  1Z5A A;  4KHP I;  4K0K E;  4X64 E;  1Z5B A;  2HFS A;  4B3S I;  2UXB I;  1FKA E;  1FWK A;  1KTV A;  3V2U C;  1QZR A;  2UUB I;  4KQV A;  1EA6 A;  1HNZ E;  1IBL I;  4DV2 E;  1PVG A;  2WW4 A;  5IT9 Q;  1Z0C A;  2OI2 A;  4FWD A;  5LMN E;  4GKJ I;  1U2R A;  4DXL A;  3ZZT A;  2AJ4 A;  4DU8 A;  4DUY I;  2VF3 A;  1EI1 A;  1KIJ A;  4HYM A;  4PRX A;  3ZKD A;  4URL A;  4B3M E;  4DV5 E;  2A2D A;  2NPF A;  1B62 A;  1Z0V A;  1H7U A;  1HNW E;  4JI0 E;  1ZM4 A;  4LF6 I;  1H73 A;  4P52 A;  2HK3 A;  2BM0 A;  4JI5 I;  1XNR I;  2DEI A;  4JI8 I;  1HNX E;  4UTG A;  4DR3 I;  4DR4 E;  4FW9 A;  2R42 A;  4DR6 E;  4LF7 E;  1IBL E;  4RPF A;  2Q2E B;  4YY3 E;  3J80 C;  4FN5 A;  4GKK I;  4LF5 E;  4P7A A;  2ZBK B;  4LF9 E;  4B3T I;  4AQY I;  2UXD I;  4OX9 E;  3K17 A;  4DV5 I;  1Z0B A;  4DR5 E;  2HHH E;  3J7A G;  1HNW I;  1ZM3 A;  4X66 E;  5A2Q Q;  2VQF E;  4X62 E;  1N32 I;  4LFA E;  2EFG A;  4R1F A;  1FWL A;  3J80 Q;  2V34 A;  4ZVI A;  1NHH A;  4K0K I;  4FWG A;  4DR7 I;  2UXB E;  4DV6 E;  2HKJ A;  4FWH A;  2V2Q A;  4DR1 E;  1KKH A;  4DR2 I;  1ELO A;  4M1K A;  4B3S E;  1H74 A;  3WU5 A;  4DV1 I;  4MYU A;  3ZZ0 A;  4USM A;  4DR4 I;  1RR9 A;  1ZXN A;  3K1J A;  4B3R E;  3LPS A;  3T1Y I;  1ZXM A;  1HNZ I;  1UEK A;  4LF4 I;  5A2Q C;  2UUC I;  4DV0 E;  1H72 C;  2VQE E;  4WUD A;  2E1R A;  4EMD A;  1A6F A;  1MG7 A;  3B82 A;  1PIE A;  4JI2 E;  4PU9 A;  1FI4 A;  4NXM E;  3GON A;  3QT5 A;  2LJP A;  1N33 I;  4JI4 I;  1KVK A;  2V2V A;  1Z0E A;  2UXC E;  4X66 I;  3QT8 A;  4X65 E;  4UT4 A;  1Z0T A;  2X36 A;  1Z0W A;  3ZZU A;  1N36 I;  4JV5 I;  3WU3 A;  1WUU A;  2HFU A;  4DR1 I;  4GKJ E;  1OJ4 A;  1XMO I;  4HAC B;  3J81 C;  5IWA I;  2BM1 A;  4JI8 E; 
#chains in the Genus database with same CATH topology
 1HHQ A;  4AE5 A;  2F4V I;  1CJT B;  2QJ3 A;  3K89 A;  2DGU A;  2IRY A;  4JI3 F;  1I94 J;  4HT7 A;  2GO9 A;  1IQT A;  5K9F A;  5D4N A;  4FW7 A;  1NCL A;  2N3L A;  4HLB A;  3H4L A;  5FWK A;  2P6T A;  3R97 A;  4LBH A;  2CQ0 A;  2BE9 B;  4ZVR B;  1HI0 P;  4RO0 A;  3M6A A;  2ZNY A;  1WC0 A;  3M8P A;  1YJN S;  2Q3P A;  1IUJ A;  1S1V A;  1NDC A;  2B5J B;  4O3P A;  3SDE B;  1KON A;  4N47 A;  4M5D A;  1S6P A;  4CLU A;  4LOM A;  4ZVO B;  2J0S D;  2MHN A;  3GFY A;  4ISA A;  1TL7 A;  3AXM A;  5IT4 A;  5KG7 A;  2D3O R;  2LYV A;  3RUB L;  4CCH A;  4IG0 B;  2EC0 A;  1YRX A;  3DRP A;  4ICL B;  3BKF A;  3MTJ A;  3GII A;  2U2F A;  4ZPT R;  2KB2 A;  3BDP A;  3OFE A;  2ZC4 A;  4USK A;  3J7A N;  3IRX A;  3M7N D;  3H4D A;  1Q53 A;  3AOC A;  2RQM A;  3GG1 A;  4OLO A;  4OYX A;  3NS5 A;  3VGV A;  2LQ9 A;  4X62 I;  1IKX B;  1R27 B;  1GFW B;  3BSN A;  3DI6 A;  2NN6 C;  3GLL A;  1TMJ A;  2VBY A;  3W2W A;  7FDR A;  2UXD E;  1YX2 A;  3A1Y G;  2B43 A;  4TYB A;  1Q7Y T;  2VG5 A;  4Z2X A;  1V9O A;  3EZU A;  5IT9 U;  5BXI A;  4DWI A;  3RB4 A;  2AMC B;  3JAM Y;  4DR1 F;  2A3J A;  2DTJ A;  3FQK A;  1XMQ F;  1AW0 A;  4DN0 A;  4J9K A;  2CJY B;  1P9Y A;  2PO1 A;  3ZNU A;  4MKY A;  3SI8 A;  3P96 A;  1XNQ E;  2NUU G;  2VFT A;  4RW6 B;  1N54 B;  1VRT B;  2HG4 A;  1XMB A;  4WE1 A;  2DBB A;  3B54 A;  4JB8 B;  4ZPV R;  5JXS A;  5I42 A;  3HKW A;  4FZV A;  3KK1 A;  2ASD A;  3T1Y E;  4QR1 A;  2GNK A;  3SV4 A;  2XB2 D;  4RKU C;  1YZ7 A;  1S4E A;  2HLU A;  1RAI B;  2Z0G A;  4OHW A;  1PAE X;  5KG6 A;  4DU7 A;  4HVZ A;  4B3R J;  3P3C A;  1RJJ A;  1VHI A;  2IAJ A;  2IJR A;  3MGJ A;  3OXL A;  1FVS A;  4O4R A;  3L7P A;  3P5T L;  2XWX A;  4UST A;  4UZC A;  5IV3 A;  3RG6 A;  3CJ0 A;  4ETZ A;  5F8J A;  2GA7 A;  2CJK A;  3BEG B;  2I8E A;  3Q6N A;  3OTO E;  3DCA A;  3D4J A;  4I7F A;  3BKU A;  2I0X A;  1VQS A;  3FSX A;  2BBE A;  1V5V A;  2V0N A;  3TRG A;  5ADZ A;  2GGP B;  4YUD A;  4IZJ D;  1CJK A;  3EYZ A;  1R0A B;  1FRI A;  5CQG A;  4JI8 F;  2EI5 A;  2LDY A;  1H2T Z;  1MN9 A;  4NLV A;  4R5P B;  1K0T A;  2OEM A;  1M5H A;  3NEK A;  2HUR A;  4OJ1 A;  4OZL A;  1Q82 T;  5C0X F;  3IR7 B;  1LW0 B;  2KHC A;  2XMK A;  4X64 J;  1X4C A;  4U96 A;  1WI6 A;  1ZOT A;  1RWW B;  3CD0 A;  3IS9 A;  2YWH A;  2C3P A;  3NOG A;  4LSL B;  4PXE A;  1YK9 A;  1DFD A;  2MGZ A;  1TR0 A;  4WXW A;  1ZZN A;  1NJX A;  4GVB A;  3TEG A;  3ZZO A;  2EEY A;  2QMX A;  2IDE A;  1SVD A;  3DRR A;  4M5D B;  3QT6 A;  2V4J B;  1S59 A;  2XYH B;  3I32 A;  3PFO A;  4BCA A;  5C7P A;  7AT1 B;  2I2Y A;  3NGU A;  4XTJ A;  1XMQ E;  3T5L A;  2BJ9 A;  1XR7 A;  2Y0S D;  3MED B;  4NLW A;  4AXJ A;  3SZ2 A;  4B9L A;  3UW1 A;  4A8S A;  4YR0 A;  4DFP A;  4WYW A;  2QV6 A;  2AYE A;  1URN A;  3L3C A;  1KLM B;  1HQ2 A;  1X4D A;  3ETM A;  3C16 B;  4TLQ A;  3LAK A;  3QRR A;  2F4V E;  4KKO B;  2EW9 A;  5DLG A;  3LPY A;  3KFW X;  4I2P A;  4QR0 A;  3TAM A;  4WFZ A;  2RKI A;  3LAN A;  2HEK A;  5C2C A;  4M95 A;  4WFY A;  2FLP A;  4CLS A;  3EPI A;  4Z7Y A;  1G2E A;  4DV4 I;  2HS3 A;  3I55 S;  3RR7 A;  3CCS S;  1FES A;  3EGW B;  4NAS A;  1VQ4 S;  4NXM J;  1RHY A;  3RR8 A;  3PS1 A;  3GE9 A;  3I56 S;  2YNF A;  2ZWO A;  4LRD A;  5KFI A;  2XMA A;  1ACM B;  3GV8 B;  4N41 A;  1N36 E;  1ZM2 A;  5DQG A;  4OZJ A;  2OFH X;  2O1V A;  4DV0 F;  4ZIW A;  2DR9 A;  4MU0 A;  2PMW A;  5ETQ A;  1N0U A;  1FX2 A;  2D9O A;  2CKW A;  1B70 B;  3BR9 A;  3OT9 A;  2PN6 A;  2GVZ B;  3R7N B;  5LMU F;  4H4M B;  4IFY A;  2XSF A;  1NKE A;  3ZO7 A;  1QTN B;  4KRW A;  4YB6 A;  2MMY A;  4RU9 A;  3M85 G;  3J81 U;  3K8V A;  4RUB A;  2EFV A;  2XLJ A;  2GJI A;  2C2D A;  5HI7 A;  1REG X;  3CJ2 A;  3H5S A;  3NGR A;  3MTK A;  4C8O A;  4A47 A;  1FKO A;  1C1B A;  5GAG I;  2C2O B;  3O1L A;  4RNM A;  5M2P A;  2M8D B;  2H65 B;  1T9Y A;  3OTO I;  4F4A A;  3U1N A;  2IOP A;  5K36 C;  3CCZ A;  2JNJ A;  4ZLJ A;  4NLU A;  1UVN A;  1ZM9 A;  3CED A;  4HY1 A;  3UD4 P;  1YH8 A;  1NSK L;  1QAY A;  3JQJ A;  4IRK A;  1RT2 B;  4DPX A;  3H20 A;  3CCT A;  2GAH C;  3UE2 A;  3GWC A;  1WNE A;  3W60 A;  4JI5 E;  1TU0 B;  3CTR A;  4QIE A;  3M9O B;  4RU2 A;  4KO0 B;  1UA1 A;  3DDK A;  8ATC B;  2VQE J;  4PAA A;  4ECY A;  1D6T A;  5DQH A;  3GJT B;  2CQ4 A;  3TX8 A;  4IOC Q;  5CXT A;  2BW7 A;  4NCG B;  4GVL A;  5KG3 A;  2ZBP A;  4DR3 E;  4CQ1 A;  2EKY A;  3NNA A;  2ZM6 F;  5AE1 A;  3M6V A;  1S6Q A;  1X9S A;  1WG4 A;  5D4O A;  1U6Z A;  3OTE A;  1KQK A;  5C25 A;  3K5N A;  1T9U A;  1D1U A;  1RQ0 A;  2E7W A;  2OPQ A;  3U1L A;  2DY1 A;  4JYA I;  1SBR A;  5K8O A;  4C4W A;  4F4W A;  1QE1 A;  2DRB A;  2UUA I;  5LMU I;  5LJ5 Y;  4MMO A;  4DR5 I;  2DCU B;  3AA9 A;  4FXW A;  4IZJ A;  2MKY A;  3GME A;  3FSY A;  2UUT A;  1SCJ B;  4C0O C;  1QAJ A;  3QID A;  1E3P A;  2YTC A;  1RT3 B;  4RUH A;  3A8I A;  4DF4 A;  2OEJ A;  1X4B A;  3BGR B;  4ZPC A;  3HT3 A;  2BQR A;  4ILM A;  3KWM A;  1VJQ A;  9RUB A;  4CYU A;  2GS8 A;  4YR3 A;  3T1Y I;  4DPY A;  2ROG A;  4OX9 F;  3JAM C;  2R7U A;  2YBV A;  1NK0 A;  3BBB A;  4PWD B;  1WHY A;  2A2C A;  2HHH J;  4P73 A;  3TJ9 A;  3TP2 A;  5AJ3 F;  3UO0 A;  4FS1 A;  2HHH F;  3PW2 A;  2QZ8 A;  4UOF A;  3FCH A;  3FK4 A;  1QD1 A;  5EWG A;  4C0H A;  1HBM A;  3ILI A;  4DX8 H;  3GIM A;  3C19 A;  2GQ0 A;  1Q4R A;  2NXE A;  5LL6 d;  3TZY A;  4QWD A;  4Q2L A;  2FGO A;  2J0X A;  1SKS A;  1SL2 A;  2NN6 D;  3UDL A;  3ENQ A;  1M5P C;  1GX5 A;  4LMZ A;  1Y0H A;  3HKZ D;  2MST A;  1DTT B;  1VK8 A;  3KJV B;  3DRY A;  2Z5B A;  5B0E A;  3QWU A;  1DTQ B;  5H9E J;  3TQE A;  4LF4 F;  4B3T E;  3LGN A;  1HWJ A;  4Q5V A;  1YHC A;  5BR8 E;  4LFC F;  3AY0 A;  3N5B A;  1S99 A;  3TAP A;  1PBA A;  3AHP A;  3HFV A;  4B3O B;  2CGE A;  2AJ1 A;  4O4G A;  2FJA B;  2CAJ A;  2C39 B;  2XEX A;  3MI7 X;  4WK3 A;  1L3S A;  5F8H A;  1W7W A;  4X4T A;  4DLE A;  1IBM J;  4J37 A;  2VIC A;  4ECW A;  4FYV B;  1SC3 B;  1O0P A;  4WK1 A;  1RTZ A;  4G1Q B;  1R31 A;  2R7Q A;  3WIV A;  1BY9 A;  2B0G A;  1IBK J;  4YHH I;  4YS2 A;  4JI1 I;  4TN2 A;  3W63 A;  4LF9 J;  2NLW A;  3NBP A;  3KLI A;  4MJK A;  4ZLL A;  4AYB D;  2CFX A;  2D69 A;  1QUV A;  2MZQ A;  5AE3 A;  4DV0 J;  2CQG A;  2VG7 A;  3ZXW A;  3CCQ S;  4FF4 A;  3L7Z B;  1SUQ A;  2CAD A;  2VUG A;  4LCG A;  3NWR A;  1MSW D;  4DV3 J;  1ZH5 A;  4FW6 A;  2CZV C;  1VQN S;  3EDQ B;  2UU9 J;  2X51 A;  3GIK A;  4NXN F;  1EP4 B;  1CJT A;  1UVK A;  2CQB A;  2W1B A;  4WTY A;  5I3P A;  4ZLP A;  2XGQ A;  5DLF A;  2BRK A;  4LFA F;  1NK4 A;  3SIP B;  4Y2C A;  2AGO A;  4WIQ A;  3TQ1 A;  4WPA A;  2WSF C;  3KMQ A;  2LDI A;  2QX0 A;  5D15 A;  3UD5 A;  1IKY A;  5EWF A;  4LF5 J;  3PXG a;  6FD1 A;  3MFH A;  2VFU A;  1S12 A;  2DH7 A;  3RTV A;  2ASL A;  1RYS A;  3JQM A;  4X4N A;  2RRN A;  2HQD A;  1KEK A;  3AJ2 A;  4MU4 A;  3C6T B;  4F50 A;  1RT2 A;  2E9T A;  1FXL A;  3Q83 A;  4LVO P;  3TJA A;  3KLH A;  4B3S I;  2ZDP A;  3DGP B;  4X66 F;  2UXB J;  3Q8R B;  3PW5 A;  4QIF A;  1RAB B;  1RE1 B;  4FPI A;  5KFM A;  2CPE A;  2Z58 B;  4I2Q A;  4NYP A;  2Z2Z A;  1SJ4 P;  3BBC A;  1V3Z A;  1AZS A;  2HNY B;  4L6V 3;  2GV1 A;  2KM8 B;  3OW2 R;  3QYY A;  1BQN A;  1FWK A;  4ZVH A;  2H4Y B;  2F65 A;  3V2U C;  1JXL A;  5JMN A;  5DM6 Q;  2UUB I;  2A6M A;  2JLE A;  2MEW A;  2CA9 A;  4NWB A;  4YB1 P;  3NG8 A;  2HGN A;  1B7Y B;  1I51 B;  5HLF A;  4ZMM A;  2OIH A;  3PO5 A;  4PAB A;  2DIS A;  2AEJ A;  3ONQ A;  4HDG A;  4DV2 J;  3PS2 A;  3BRE A;  5HJX A;  2ASJ A;  4DV2 E;  3FFI A;  4IG3 A;  4AL7 A;  2WW4 A;  4MK9 A;  3JTN A;  2C1E B;  1H3D A;  3KG0 A;  3NS7 B;  3TAR A;  4FYD A;  4J91 A;  1RBL A;  4ZN1 A;  2CNN B;  2RF2 A;  1TQL A;  3UDE A;  3M7N G;  1HNI A;  4DV1 J;  3FEY B;  1S48 A;  3UDV A;  1ZS6 A;  3G71 S;  1NAQ A;  3PJW A;  1JLA A;  4IRC A;  4GKJ I;  1DLO B;  4PWU A;  5K36 F;  2AJ4 A;  4M5N A;  4DU8 A;  4QPX A;  4KR0 B;  5A0Y A;  3DMJ A;  1UP1 A;  2OEL A;  2RIL A;  5H1S V;  3EZ5 A;  2VF3 A;  1WEX A;  1KIJ A;  2BA0 D;  2YWG A;  1T8E A;  4PRX A;  5ETO A;  1S0N A;  4URL A;  3V6D B;  4DV5 E;  1XBW A;  5J2Q A;  1KOH A;  2NXU A;  1Y4U A;  2FQQ B;  1B62 A;  2G13 A;  2P9E A;  1VJW A;  4B9M A;  1Z0V A;  1HNW E;  4NLX A;  4X4O A;  2G2O A;  1NBE B;  3J7Y I;  4JI0 E;  1EB0 A;  2X3D A;  1ZM4 A;  5IM0 B;  3QIP A;  2WSC C;  4OMF G;  2L08 A;  1RTH B;  1ICE B;  2B51 A;  3HI9 A;  4P52 A;  1NJY A;  5D8H B;  3LQV A;  4O3N A;  2IYG A;  3X1L B;  2XI2 A;  2RDD A;  4NCB A;  4JI5 I;  3NGT A;  4A4J A;  2C2E A;  2BEF A;  5C42 A;  5F8M A;  3ET6 A;  4DR3 J;  1LW2 A;  2DEI A;  4KO0 A;  5FJ4 A;  5AE2 A;  4JI8 I;  1TUG B;  3QFH A;  1F5B A;  1LW0 A;  2BJE A;  2QO3 A;  3IA0 A;  2CPI A;  3Q89 A;  4IUF A;  4KV8 A;  2C39 A;  4TLR A;  1NM2 A;  4ETX A;  5KFJ A;  2HNZ B;  3CDA A;  4PG6 A;  3R8Y A;  4FW9 A;  2FLN A;  1N33 J;  2JRS A;  2VDH A;  3ZZR A;  1X4E A;  3CDJ A;  3BN4 A;  1RHQ B;  3UVJ A;  2B8Q A;  4YDX A;  1U47 A;  1C1B B;  3MCN A;  3TUZ C;  2J6T A;  1IBL E;  2OGU A;  3QGH A;  3TVK A;  4PRF A;  2C28 A;  3DLE A;  4YY3 E;  2ADC A;  3QQC D;  2GQC A;  3MPY A;  2ZH6 A;  3MAH A;  1C0T B;  2DR8 A;  3AB2 B;  3HHL C;  2L3M A;  2HS0 A;  4XPE A;  2R2T A;  1JLG A;  4GKK I;  1Q8K A;  2J7U A;  2Y1R I;  5BYQ A;  5HRO A;  3T5H A;  4WFX A;  2HW3 A;  5DET A;  4QIV A;  1NXI A;  2AYM A;  3G2X A;  5CYQ B;  4AQY J;  3ILL A;  2VA2 A;  1URR A;  3VWS A;  3F41 A;  3SMZ A;  4DV5 J;  3QAT A;  1RAG B;  3ITH A;  3MMB A;  3U7J A;  2VBZ A;  3AB4 B;  1WWH A;  5CYM B;  5F0W A;  3CO9 A;  3SCL E;  2PEH A;  4DV4 F;  3M1V A;  3HHL A;  2VOP A;  4R25 A;  3O6Q A;  1HNW F;  3A12 A;  3HT0 A;  2HND B;  3HZE A;  1NK7 A;  1H6K X;  1HW8 A;  5HP1 B;  2ZD1 B;  4K8R A;  2HGM A;  1TUV A;  2IBK A;  3OR2 B;  2E5J A;  1LOU A;  1OYE A;  4WF9 Q;  3NCP A;  3HKM A;  4I4B A;  4DX5 A;  2MKJ A;  1B0T A;  1IR2 A;  1QE1 B;  2XMV A;  3QGI A;  4ZOS A;  4C98 A;  4DSI A;  5DO2 A;  1R89 A;  2ACY A;  2DY9 A;  2DGV A;  2ZOG A;  1E3H A;  5A2Q Q;  4X66 E;  1N32 I;  1U1R A;  2GJ2 A;  2BMB A;  1ZTT A;  2Z30 B;  4LRC A;  1SH3 A;  2QG9 B;  2IRU A;  4R1F A;  1H7W A;  3G6Y A;  2YKM B;  3MM9 A;  1REV A;  4I64 A;  3TEH B;  5EGY A;  3LWL A;  3NRB A;  2QL9 B;  2FPH X;  3R7B B;  1VI