3PYEA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
301
structure length
301
Chain Sequence
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 86
structure length 301
sequence length 301
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyeA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyeA01
4B3TE 1ZM3A 2X7IA 4DUYI 3K17A 1IBLI 4P7AA 2HK3A 1B62A 4URLA 3PYFA 3Q1QA 4JI3E 4DR1I 1NHJA 4ZVIA 4DUYE 1IBLE 1RREA 3J80Q 4I3HA 3LNUA 2ZM6I 2A2DA 4KQVA 4YHHI 4DR1E 4EMDA 4JI0I 3OTOE 1N34I 4DV0I 2UU9E 1A6FA 1Z0WA 1Z59A 2UXDI 2ZM6E 3ZKDA 4LF9I 4DV6E 3PYGA 2BM1A 4DR4I 4JI0E 1ZXNA 3B78A 4FW9A 2VQFI 4LF5I 4NXME 2UXDE 4OX9I 4GKKE 3T1YI 1NZ0A 4JI4I 4X66E 1XNRE 4XTJA 4B3SE 1FKAE 1Z0CA 4JI2E 2X36A 4Z7YA 4HACB 4DR5I 4JYAI 1FWKA 4DR6I 2V2ZA 1K47A 3QT8A 3J81C 4PU9A 1Z5BA 5LL6R 4K0KI 1OJ4A 2UUCI 2E5LI 1Z5AA 4NXNE 1Z0EA 1KVKA 3B8HA 2VF3A 5LMNE 1IBMI 4K0KE 2UUCE 4DV5I 3B82A 4DUZE 1PVGA 1FI4A 4KHPI 4X65I 2HKJA 2DEJA 2GS8A 4B3TI 5LMUE 4LFAE 2UUAI 4FWHA 1RR9A 3QT7A 3WU3A 3V5RA 1WUUA 4X62E 4KHPE 2HK2A 1FWLA 5FLXQ 5FLXC 4JI3I 1N36I 1Z0GA 4FN5A 2UUAE 1BKNA 4DPTA 2V2QA 2R42A 3T1HE 3QT5A 4AQYI 1HNWE 4GKJI 2V34A 5IWAE 1XMOE 4JI5E 1HNXI 1N36E 3OTOI 2UU9I 1D6TA 2WW4A 1N32E 3JAMC 4AQYE 4GKJE 4DPWA 4M1KA 4PRXA 4DV6I 1HNXE 2LJPA 2HFSA 4NXMI 2ZITA 3CWVA 1N33E 4LF4E 4GKKI 2VQEE 1IBKI 4X66I 1XNRI 4JI7I 4B3SI 3ZKBA 2CZ9A 3J7AG 4RPFA 4JI2I 1PIEA 1IBKE 5IT9Q 3D4JA 5IT9C 2E1RA 4Z7CA 1H74A 4JI7E 4FWGA 1HNZE 3LTOA 4YY3I 2HHHI 1KKHA 3WU5A 4UTGA 4DV2E 4DR7E 1UEKA 2HFUA 4NXNI 1N0UA 3HULA 4P52A 4LF7I 4YY3E 3J81Q 4WUBA 2HHHE 1Z0VA 5L3JA 4X64E 1VISA 5LMNI 4R1FA 4DUZI 1Z5CA 4DPXA 1Z0BA 1J5EE 4LF7E 5LMUI 4LFAI 2ZBKB 2UXCE 3QT6A 3PYDA 2UXBE 4X62I 1H73A 4ED4A 3H4LA 2UUBE 3ZM7A 3ZZTA 5GMDA 3T1HI 1HNWI 4JG4A 5IWAI 1XMOI 4WUDA 1Z0TA 4JI5I 4FWDA 4USMA 1H7UA 1N32I 4DPYA 4MYTA 4HACA 4DU8A 1S4EA 1MG7A 1N0VC 4DR3I 5A2QC 4JI8E 4WUCA 2AJ4A 4DV7E 1EA6A 4JV5I 1N33I 3JAMQ 4LF4I 2R3VA 4LFBE 2VQEI 1ZM9A 3V2UC 4DV3E 4DV4I 4DR3E 1NHHA 4DR2I 4HXZA 4UT4A 4JV5E 2V2VA 2J7KA 2A2CA 4DV4E 1NHIA 3J80C 1HNZI 4DR2E 4DXLA 1XNQI 1KTVA 4LF8I 2F4VI 3ZZUA 3WU4A 4USKA 1HR0I 4HYMA 4DV2I 3GONA 4B3MI 3ZZ0A 3F0NA 4DR7I 1XNQE 4LF8E 1ELOA 1H7SA 4YHHE 3WU6A 2F4VE 1N34E 2Q2EB 4B3RI 4DV0E 4X64I 1HR0E 4B3ME 1FNMA 3K1JA 1J5EI 4LF9E 1DARA 1EI1A 4DR4E 1MU5A 4B3RE 2VQFE 4LF5E 2UXCI 4OX9E 5BR8I 1QZRA 3T1YE 1MX0A 2UXBI 4DPUA 4DU7A 2DEIA 4JI4E 4JI1I 5GMEA 4PRVA 2XEXA 2V8PA 3LPSA 2BM0A 1FJGI 2UUBI 1I94I 3PYEA 1ZM4A 1XMQI 4LF6I 4DR5E 1B63A 2NPFA 5BR8E 4JYAE 4MYUA 4JI1E 4DV1I 2HKEA 4DR6E 4JI6I 1FJGE 1S16A 1ZXMA 1I94E 2OI2A 1XMQE 2EFGA 4LF6E 1U2RA 1KIJA 4DV1E 4JI8I 2E5LE 4LFCI 4JI6E 3M6AA 1XHKA 4DV7I 1PKPA 4HY1A 4LFBI 1H72C 4DV3I 1IBME 5A2QQ 4DV5E 4LFCE 2BV3A 3J7AM 1ZM2A 4X65E
chains in the Genus database with same CATH superfamily
4LRBA 1U25A 4EZ6A 3L7ZB 2CPEA 4LCFA 2CAJA 2HVEA 5IC6B 5HP1B 3FSIA 2MHNA 3FCVA 3RW6A 3N6MA 4KY3A 1S12A 5KG3A 2QFJA 3KLGA 3J7Z5 3MUMP 4WIQA 4ZVIA 1E6VA 2RVJA 3OVSA 3W8PA 2M8HA 2BBEA 2JT2A 1YTYA 1P27B 1Z0WA 5ETTA 1TL7B 3AY0A 3CULA 4EI2A 3VTIA 1BQXA 2WHOA 1HNIA 5K5MA 2W8KA 2QSFA 2CPJA 1URRA 4TYBA 3GG0A 3H5UA 4QR1A 3RAQA 2FHOB 2CPDA 2ADCA 4LPFA 2QTWA 1TMMA 3NGTA 4ER8A 4PG6A 5LSOA 2B9XA 1HPZA 2B7BB 3W62A 4O44B 4K2JA 4CCHA 2PI4A 1JLCA 2XZTB 5AJ3F 1S1VA 3CCES 4DG1B 3OXLA 4NPOA 3I0RB 4QNKA 1RHUB 3SQOP 3UD4P 1KD1T 4OZ0A 5L9NA 3PXGa 2ZNZA 3DLHA 3DM2B 2UVVA 2XMJA 5BYQA 1Q16B 4CYUA 2GQCA 4CP5A 3A13A 3PO4A 3GJQB 2C28A 4CT9A 3DOLA 1OY6A 4WBFA 2HZCA 2QLJB 1HNWE 2A0FB 4DV6F 2ASLA 2OJ3A 3HFZB 4ECWA 3BR8A 2AYGA 1ZH5A 4KGKA 3BGFA 4B3SF 4DV6I 1VBKA 2PO4A 1SKRA 1T9WA 2GZOA 3MEDA 4OZNA 3KG4A 1IBKI 1REGX 4XPCA 4C8MA 4B3SI 3JTPA 3J7AG 2DGVA 3OQ2A 2B4VA 1YWXA 1SC4B 2XCAA 3CJSA 1HNZE 3DCAA 4R5PA 3WU5A 2XMWA 2OH2A 1CULA 1A9NB 3F44A 4P52A 1VDHA 3KFWX 4ZLNA 2HHHE 2WONA 1TKXB 1SL1A 1RT3A 3HLUA 1RWOB 2FLPA 4RW8A 4ES2A 1FJCA 4USJC 2MMYA 4U3DA 3L7UA 5KFFA 3RZAA 3FCHA 3I32A 3PW0A 1EQMA 4CLTA 1WKKA 4O4RA 4ED4A 3VVUA 2DBBA 3TARA 3PZPA 2VESA 2UXCJ 3ELHA 1C4AA 4OI0A 2DR6A 3W64A 1V3RA 3RGIA 4NE9C 2LDIA 4Q2MA 4ANCA 4TN2A 4P73A 1Y5LB 2WRMA 2GQQA 3RBXA 4YN3B 1G1XA 3CJKA 1LWEA 3KLHA 2IJFA 2NXJA 2RKIA 5DROA 1LWCB 2W9CA 3MEEB 2OGUA 1NDPA 5KAKA 1GT8A 1V6HA 1TL3A 2EFNA 2MYFA 4URSA 3H2LA 2BA9A 4CO4A 1RT1A 1RWPB 3K8VA 1SUQA 4IRKA 2HEKA 5EUHA 4OI2A 1U1NA 3IR6B 4DXLA 3IWXA 1DBDA 3DXSX 4LF8I 4BA1B 2CFXA 4LSLB 4YY3F 2CQCA 4GRSA 3HHKA 2JLGA 1P1TA 3KLVA 1SIWB 2DRBA 3ILLA 3NS5A 1YHCA 2UV8A 4IFDF 1B70B 3HT3A 1VHIA 3RTVA 2R7UA 4BBYA 3V6DA 3DC2A 3SIPB 4HEA9 1PYSB 4KB7A 1FNMA 3V81A 4NI2B 5IZHA 1HD1A 5A6PA 5EWGA 4IDKA 4CIOA 3GYNA 3PEHA 4J9QA 3RW7A 1QZRA 2FLLA 5LL6d 2HQCA 1GXTA 3KHRA 3TVKA 2OSQA 4OX8A 4OYOA 3BO2A 3W2VA 4FXDA 3D1QA 4DF8A 3MAAA 1ZXMA 1I94E 3MAQA 3CO9A 4DR5J 5ETMA 2A6MA 4JI6E 3OR2A 2CYYA 4JV5F 3BQ1A 2BYCA 3P3DA 1IBME 1R6LA 3HVTA 3I5CA 5CD4A 4B3TE 3A8EA 4B9UA 3QFHA 1S7IA 4KPCA 4EZ9A 3OTCA 5K36E 2HVIA 4RW4A 2VBWA 3VHQA 3CF5Q 4TU9A 1X4CA 3AODA 3R3TA 3KDOA 5DO2A 5DETA 2K06A 4M5GA 2O01C 4LRFA 3ICLA 1CS4B 1NJYA 2BR0A 1ZA1B 2J76E 4NXME 2KZMA 3MR3A 1NZ0A 5I42A 2VA3A 4J9LA 2R7QA 1TKDA 1S48A 4Z37A 3I6PA 3LP2B 4LUBA 5DNLA 2J5AA 3FFIB 2VPXB 2WBMA 4EBEA 4FS2A 3D0IE 1K47A 4JI2J 4EYIB 4M5NA 1FTRA 3SBMA 3EWGA 3HF5A 1FRKA 3Q8QB 3IP0A 2WB1D 2DGXA 4K0KI 4H4MA 1TVRB 3UPFA 1U2CA 1FEHA 3M8QB 3EGZA 3D2WA 4CO0A 2BE2A 2WP8A 1TL1A 2YWEA 4ZPAA 2ILYA 4BWMA 4U6PA 5D4LA 4H54A 1IM6A 2C1EB 3T19A 1U48A 2UUTA 1WUUA 4X62E 3RYLA 4CRJA 1HL6A 3IXQA 1SKUB 5I3UA 1RT7A 2B4OA 4UY8T 2YNHB 4AL6A 2UU9F 4IZKA 3LGHA 3QRQA 4ERDA 2CZ4A 3M1VA 5J2MB 4EEYA 3L09A 4KFBB 4GKJI 4P2XA 4DV5J 4KHPJ 5E3QA 2SXLA 1XWLA 2F9JA 2BR2A 2UU9I 1Y7PA 2CA9A 1RTIA 4ES1A 2XS2A 4JP8A 5J1EA 5CZXA 2RD5C 2BANA 1PYOB 3TA0A 3DMJB 4JI3J 3W66A 3MUVP 2KYZA 2ZITA 3Q24A 2IYIA 2MJUA 3P5BP 2OSRA 3BBFA 1L3UA 4RR5A 2DHHA 2MSSA 4C0BA 4M5IA 2VPYB 2NXEA 3FEXB 3H1CA 3U27A 3SCLE 2VG5B 1AZSB 5F8LA 2YNIB 3W7BA 2DH9A 3H5YA 1UVNA 1LFWA 1NKEA 3CMQA 1XNRJ 5J2MA 1UVKA 3G71S 4DUZF 3ETOA 2BW7A 2HQDA 2N4DA 2X1GA 2WOMA 3LAMA 3IBFB 4ILRA 2EC0A 1C1BA 3ISZA 1Q8IA 3AD8C 4DUZI 3MURP 1S97A 2R8JA 1OQ3A 1CJKB 4RBUA 1SKWA 3EVMA 4USTA 1USUA 2CPZA 2HWIA 2B56A 3QSYB 4A8FA 2YQ3A 5DJBA 4O3NA 3AQOA 1N6QA 1OSDA 2BKPA 2YPZA 2XTJP 5D8HB 3MM5B 5GMDA 5H9EJ 2DIVA 2R7XA 5KFGA 3TA1A 5F3TA 2OEJA 4WU2A 1Q53A 4ZVOB 4OX6A 2VODA 4FWDA 4RW9A 3HHLB 3GCMA 4P9SA 1HFEL 2VQEF 2A10A 4TLQA 3JTOA 1ULRA 5AXMA 2JEGA 3MEKA 1Q8LA 4Y2KA 3HSDA 2LCWA 3DRRB 3HHEA 2VQEI 4UZBA 2CQDA 1TAUA 3V2UC 4DV3E 2KKHA 1TELA 4NLYA 2RRBA 3VALA 2NZCA 4LFBJ 4N47A 3VV2B 3ADAC 4Y00A 3MM8A 1M5OC 4DV4E 4X4QA 1UDSA 1TZ0A 1FT8A 1XR7A 1U09A 4TXSA 1ELOA 1J5EF 1FVSA 1H7SA 2FLNA 2CJYB 1H2VZ 4RO0A 3HM9A 4B3RI 4NEZA 1C0TA 3TQEA 2L3MA 2AYBA 1J5EI 2K7KA 2AMCB 5B0EA 4DBQA 3G8TA 2E29A 4OV1A 2JRSA 4LF9J 1JNZB 4X4TA 3UCZP 1KQGB 2MLZA 4OYAA 2Z8QA 4LF6I 2JFDA 4KKOB 4P2FA 2W2PP 4FW7A 4K4UA 4ZVHA 3FZBA 4EBCA 2KDOA 2PMZD 1FJGE 2OI2A 1KEKA 1APSA 3QAUA 3M2RB 4X4VA 3MI7X 4QIWD 3R9LA 2HWTA 2Y8YA 2NXUA 3SSQA 2RS8A 4OX7A 2FHJD 3VAGA 4Y28C 4IO9Q 2LMIA 3MEGB 4U7CA 1NK5A 5KFRA 4PPDA 4WE1A 3MPUB 2FHKA 2N7CA 3LWLA 3MM6B 3LGMA 1WOPA 3P8BB 5C25B 3K17A 3FCWA 1ZETA 3BGOP 4ZVRB 4J91A 1PCAA 3ZZZA 2AD9A 2LQ5A 3WIVA 4DV0F 1NHJA 2NN6A 5L8RC 1IBLE 1MN7A 4PUOB 2XQCA 3LNUA 4KYZA 4Y2IA 2E7XA 5KFHA 4OV6A 4DV0I 1YQHA 2BJ3A 2W25A 2BM1A 1NM2A 1HHQA 4LR9A 4B9VA 4UQGA 3TANA 3EVWA 1WOOA 2QMWA 2R7VA 2Q1LA 1FKAE 3CDAA 4O0NA 1RTDB 5K36D 3KUEA 6AT1B 3EGWB 1RAGB 2DNPA 2JC1A 3CCVS 4G6VB 1ZAXA 1UKUA 3M2VA 2ZHBA 3ILOA 1OJ4A 5B0AA 2E1CA 4Y65A 3WC0A 1S10A 2AJ0A 2I5JB 4C11B 2GV1A 1PJ6A 5DDQC 4LFAE 1D0EA 2N3OA 5KOXA 5AXNA 3TZWA 5CD4H 1RR9A 4M95A 1VQLS 4Q45A 2HGNA 3HKWA 1C2PA 5G0RA 4KPYA 4CO3A 2YBVA 2M3DA 1HNXF 1IUJA 1E3PA 4RW7B 3RB3A 3DYAB 1RK8A 1Z0GA 1VBXA 2UUAE 1NEEA 3IMQJ 5A0YA 2V2QA 2GNKA 5LXYA 1S0VA 3MM9A 4FPRA 2V34A 4FBTA 2V8DA 1XMOE 4JI5E 1HNXI 2V94A 1X4AA 4ZVPB 1IKVA 3ZNJ1 2XGQA 2DHXA 2CQIA 3T1HJ 2OTLS 3MR6A 1Q7YT 1V5VA 3RAMA 2I1RA 4QIGA 3Q8VA 2E44A 1JLEB 5IQQA 2HFSA 4PXEA 3O6QA 1VQ9S 3CB4A 2ZUGA 1PJ7A 4RNOA 4ED5A 3IO1A 2W24A 1Y4SA 3U1KA 1VMBA 3GV7B 2DXFA 3BGLA 4DQQA 4NASA 4W92B 3GFZA 5DLGA 3D4JA 4ILLA 2QZ8A 3CDJA 1KQKA 4CLKA 1X31C 3LTOA 2HGMA 3TW0A 4I56A 1DY3A 2XM3A 4I68A 2NZ4A 1C0UB 4O4GA 2RRAA 1WWHA 3MPWA 2DHSA 2O3ZA 4PG7A 1YBAA 2M5YA 4OYZA 4DR7J 1JMTA 3KRNA 3PHTA 2BA1D 3D6FB 5F9LA 2ZBKB 2Q6CA 5KFYA 5HATA 2Q3PA 2D74B 4FF1A 4NLXA 5IM0A 4NXNJ 2X3DA 2IDLA 4LCHA 1N32F 3M32A 4GO7X 3MMBB 2YKQA 3HSJA 1N32I 2ZH5A 3TI0A 2HVDA 2CVIA 1WKLA 2HVHA 5HQLA 2UUWA 3QATA 3BH7B 1HBOA 3RG6A 2G1HA 3DOMA 2IC3B 3VVTA 3A3OB 2NSCA 3D1HA 5KOWA 2Z5CB 4BC9A 1OSCA 1T02A 3SQGB 4PABA 3A8KA 3SFUA 1JLBB 2XHWA 4IFVB 2KHCA 3LO3A 5KFEA 2VG6B 2FB0A 4DR3J 1WC0A 1XNQI 2NQPA 3DI6A 3D6MB 2ZBQA 4X84A 3WHIA 1QJHA 3CJRA 3PRDA 4OQJA 3DU5A 2PDAA 3ZZOA 4LSZB 2Y1RI 1N34E 1R31A 5H9EK 9RUBA 4U7UD 1ZAWA 2UXCF 3BBBA 4DSFA 2EI5A 1ACMB 4R8UA 5D6GA 1DARA 4DL7A 1GK8A 3Q83A 1F0XA 2LVWA 2ZH4A 2UXCI 3BSNA 1RTHB 1R8AA 4JI1I 1Z1ZA 4YR3A 2DR9A 3L7PA 2PFFB 4ZN1A 3MD1A 2ZJPQ 5K8PA 4IG3B 1V9OA 1HI0P 3FDSA 4DV1I 4NLSA 2ZZTA 3HT0A 2ZUAA 2XMAA 5BR8J 3CCWA 1IQZA 5ETOA 1OY9A 2VBZA 1IKWA 2RT3A 1N48A 3P49B 1QAIA 2U2FA 1Y6ZA 4IYQA 2OPSA 4G1IA 1TL5A 4OI1A 2FVQA 5MLCV 4WCEQ 2HQFA 2DITA 1IJFB 4NRUA 1JKHB 5KFMA 2BMBA 4G1QB 1OYRA 4IR1A 2OKQA 3HFVA 2EKNA 1IBCB 3HI9A 4DR1I 4JI0F 3W60A 2HRTA 3OVBA 1OPIA 1UWBA 5MAOA 4FP9A 3LUYA 2OPRB 3GYGA 3TJAA 4JI0I 2Q79A 2VQFF 1NK8A 5CCMA 4KGMA 3HFKA 3CW2C 5DRKA 2JEBB 3DLEB 3UN3A 1HQEA 1S9EA 4EO8A 1B0VA 2ZDPA 2VQFI 4NLDA 1WEYA 4WTOB 2Y0SD 4DR5F 3QWUA 1FRIA 2DCUB 4CH7A 3POTA 4DR5I 3TUPA 1CJTB 2PE8A 1SQEA 1TFWA 4M94A 4ECQA 4PCQA 1RTJB 3SCKE 1CC7A 4M5DA 3OR1A 2VL1A 2FVPA 3ZZPA 1F9FA 3AXMA 2HNDA 5LMNE 3UFCX 4J9OA 2C39B 3R5DA 4KV8B 5L1IA 2XI2A 3OXFA 1UJ5A 2NCKL 2J7WA 3PJXA 4QWDA 3IRXB 2FUG9 4XPEA 5CYMA 2E5LJ 3H0PA 1HBNA 3PIPQ 1N36I 5EN1A 1BKNA 2NUUG 3D0HE 3O5TB 1JXVA 1WKJA 3NGKA 5LSLA 3IR7B 2ILZA 1SH2A 3QO9B 2N82B 4F4KA 3NKYA 1HNWJ 2HAFA 3TVZA 1SJQA 3CC2S 2ZEJA 5JEAF 2HNYB 5A2QU 4JI2F 2J9DA 1WG1A 3CWVA 5CZVA 3A3NB 3BF4A 2BA1G 3O3LA 2DGSA 3G6ES 3J7AN 2RB7A 2MXYA 4JI7I 2PC6A 2LYVA 2XMTA 4JI2I 3PY8A 3RB6A 1NH7A 2Z58B 5IT9Q 3U1YA 3W9IA 2YX1A 5KG1A 4IZJA 3MF5A 2R7TA 2DB1A 4CO5A 2DNKA 3X1LB 1X5TA 4OHWA 1FK9A 2M4MA 1DQ8A 3T5HA 2EG1A 1WORA 3QIPB 1B64A 2JLEA 1T9TA 1MMLA 4GMKA 2K3IA 1WEZA 4ED6A 2YQ0A 2DNOA 4LF7I 1S79A 4TU7A 5AXLA 2C42A 1FDAA 2ZBRA 4A8YA 4KHPF 2YXLA 3IM9A 3AB4B 3C15B 3ENVA 3MZIA 4IFDA 1DQAA 2HHHJ 2W4PA 2VPWB 2BOAA 3PX6A 4I2QA 2QLFB 4IH7A 2E1AA 4HT5A 1X5OA 2F4FA 5D77A 2XHCA 2CQBA 5H9FJ 3UDEA 3DNCA 2HLTA 1J27A 2KT2A 1HBUB 2VIHA 3NBPB 4EK2A 1N0VC 4CZCA 2L48A 4ENOA 4ZVEA 4WUCA 2IM0A 1N56A 3KK2A 2FJDB 2C37B 2D69A 2U1AA 1XMBA 1RB0A 1EJ7L 5JVGQ 1GAOA 3KJNB 1H2UX 2E1MC 1S9GB 4ZCKA 4MIWA 4IQXA 4F4ZA 2MLXA 1S6QB 2IIHA 2DY9A 5HSPA 4UUXA 1SJFA 4LF4J 2B9YA 4IR9A 1WG4A 1MU2A 1HR0I 5ETVA 5D0GA 3B4TA 2RRNA 5C0XC 2MKIA 2BJDA 4B3ME 5KFNA 2KL8A 2UXBF 1REVA 2JE6A 1E6YB 3DRSB 1FDBA 3KK3B 5KFLA 4ZPVR 2YKAA 2EG2A 1MX0A 2UXBI 3H25A 1UTAA 1V3ZA 2DEIA 2FYXA 4K7QA 2CQ0A 4PRVA 1H98A 4YFUA 1Q86T 1UETA 4ECZA 2E9ZA 5HBMB 1XMQI 3AFGA 3M8PA 4N56A 4OLPA 3GILA 4PWWA 3MMAA 4AFFA 4C2MA 4DV7F 3P45B 4LFBF 1YJTA 3J81U 3VF0B 2HFZA 3CCRS 3DLBA 3CD7A 5DGAA 3M6WA 2G0IA 1YSJA 1F5CA 3UW1A 1GNKA 1S1XA 4DV7I 2UZAA 1I94J 4LFBI 5HMZA 3CJ4A 4CH1A 3D68A 8AT1B 1HQUB 5HI7A 1W2BR 1RT5A 4NYOA 5A2QQ 1YRTA 2PFDA 4ZVGA 1FRHA 4JI6J 4LT6A 2HQ3A 4IOAQ 3DOKB 5AE1A 1RI7A 4DUYI 2H4YB 4DFMA 4F4AA 4ZOSA 1XIQA 3T41A 3QQCD 4WZMA 2P6SA 5FLXU 4B3TJ 5L1JA 5LXRA 4GVBB 3R6LB 5CXTA 2DGUA 3DRXA 2YNFA 1RREA 3I56S 3CDIA 1WOSA 4U96A 2ZM6I 1RHYA 4LF9F 3T5LA 2AW0A 3IRWP 3JSMA 4EMDA 1S0NA 5HLFA 2UV8G 3PM9A 4NCAA 3T1YF 1USVA 2WNRB 4LF9I 4MIBA 2XC9A 2W01A 4IFYB 3M30B 2K1RA 1FRLA 3GMGA 3T1YI 3TAMA 3QFWA 2MQLA 1ZA2B 4XTJA 3MR2A 1RT2A 2RMLA 3M9MB 3OJSA 2RQ4A 4FYDA 4LF1A 1IKXB 5EGYA 2IESA 1X60A 3NGRA 3NS6A 2MQPA 2UUCF 4LR8A 1S99A 5K14B 4DLGA 2DNYA 4RWWA 4PWDB 1DURA 3MMCB 2QYGA 4K4ZA 1RAEB 2E66A 2UUCI 1WG5A 2COLA 4YR2A 1Z5AA 4Q8FA 2OLWA 2G2OA 4B08A 2DXEA 2VJVA 2XO7A 3W1YC 1SPBP 2D7SA 4OMFG 4DR6J 3C6TB 1N5QA 4Q0BB 1XERA 2XSJB 2BQUA 3BGUA 2XSFA 3WU3A 2J0QD 4DX8H 4IG0B 4AYBD 1NDLA 5F0UA 4WP8A 3M8WA 2CWKA 1R43A 2I6WA 2QA2A 5T7LB 1UDOA 4AQYI 4FS1A 3M8YA 1VQNS 1VS3A 3Q8SB 4FYYB 5AE3A 1RACB 2CNNB 3UDVA 3EVOA 5L9XA 3JSRA 2JFKA 1KVIA 5AE2A 1RWMB 2C38B 1UFWA 3O2IA 4O0IA 3Q22A 2G9OA 2HRUA 3VAFA 3QLHB 2ZH6A 1EKSA 1L5UA 3RB0A 1WF2A 4RPFA 3ENWA 2AU0A 4P74A 1HIYA 1VFJA 4MQYA 1Y5NB 1FF2A 1IBKE 1EARA 4OYPA 2R7RA 4DL2A 2MLYA 3KMSA 3J80U 1Y5YA 1UFKA 4QCLA 1KKHA 1G4CA 3DLGA 2NN6D 4X66J 2W8LA 1NB2A 1RABB 2N7YA 2V63A 3J81Q 2G0CA 3H40A 3R5BA 5B0BA 3CPWR 3GFYA 2DHGA 1Z2ZA 2LLZA 4QIVA 3I31A 5CHCB 1ZOTA 4R1FA 3FJ2A 3M05A 2DH7A 5F3ZA 2VFSA 2QL5B 1T0TV 1X4HA 1NHUA 4WFNQ 3T1HF 1T11A 1H73A 3LWMA 2DGTA 2J8SA 3CCQS 1QDUB 2H9ZA 1NMEB 2IAJA 3T1HI 3W5XA 3MAHA 2V50A 1R0CB 3KHGA 1WC3A 2POKA 1F9HA 1Y0HA 4L73A 1X4EA 2WZ1A 3KUGA 3CIZA 1D9FA 3D3BJ 1HHSA 3GTYX 3MGJA 4DQIA 4K50A 2HURA 4Y2MA 4FF2A 5B0GA 3G8QA 4HH1A 1LW0B 1ZM9A 4OO1F 1RKIA 1RU2A 4I7FA 2R2UA 4M8LA 2ALYB 4JUZA 3KNAA 2QGFB 5U47A 5CA5A 2CJAA 2BQ3A 3H2VE 2F4VF 2HHSA 3I87A 3PNIA 5DM7Q 1UA1A 4DR7F 1D8YA 4C9DA 2BE9B 1KTVA 1RBLA 3PCOB 3GPAA 2V4RA 1S76D 2F4VI 2FJAB 2GO3A 4A8XA 3MOJB 2YWFA 2FQQB 4I67A 2AT1B 4DR7I 4DV4J 3UD3P 5EKWA 1MN9A 2A1BA 4LF8E 5H9FK 3OL6A 4ECVA 2XB2D 4NCBA 3M9OB 1YGYA 1A7GE 4H4OB 2Y1JA 1HW8A 1F3VA 1Z4UA 2DNZA 2UUBF 2L41A 4ZDNA 2IMWP 1NZ8A 3D67A 3W2WB 1G6BA 4DV2J 5GMEA 3OW2R 2MQOA 5IQ6A 2UUBI 3FMBA 1QVFR 2RDJA 2NPFA 3PJ9A 1PBUA 1FNXH 2RS2A 4MFBA 2VH7A 2H5EA 3JXOA 3VAIA 4HYKA 3DHXA 4LSNB 2W2NP 3AD7C 1RWUA 1IKYB 2HHVA 1WEXA 1QUVA 3PFOA 2W9AA 4J90A 4RJVA 1XHKA 3LGNA 1PBAA 1FJGJ 4PXCA 2W7OA 2WB4A 4OYXA 1K1SA 3QNWB 4LREA 1SVDA 3SCIE 2H3EB 1S1TA 2ZWPA 5C24A 4DV5E 2MQ8A 1KLMB 5I4MA 1B7YB 1O5JA 2X7IA 1VQYA 3CCTA 5L38A 4K4XA 3GIJA 2VG7A 3EYZA 2ZC3A 1VLYA 4AL7A 4JI3E 1T3NA 3OFHA 1ZBTA 1RAHB 3UN5A 2CJQA 3TO8A 4QJVA 3J80Q 1R0AA 4QBUA 3PX4A 3IBWA 1Y00A 2VD3A 3KLEA 1IBLJ 1NPPA 4A47A 2RDIA 4X4OA 4HHHA 1GX5A 4QNJA 3R5AA 3KTQA 5BR8F 4F4YA 2IVYA 1NJZA 1KLNA 3K85A 4AUKA 4ECUA 5D0HA 1XNRE 3D5MA 3GR0A 2XLJA 1VRTA 4MH8A 1MNEA 1M5VC 2QLXA 3J7YU 3LP0A 2AJ1A 3PKYA 4PQUA 1B0PA 3A12A 3KLFA 1XJWB 1C1CB 1NK4A 4K4VA 5FWKA 4PEOA 1XEZA 3U1MA 4X65F 2Y1IA 1JLFB 3N6NA 1Z0EA 2IA6A 3FSXA 4C4WA 5A8KA 3QBCA 4K0KE 2YWKA 4X65I 5GAEU 2HKJA 2HBRB 4L72B 2BXJA 1T05B 2WVDA 1S72S 2GS8A 3EGVA 3I9ZA 1F3FA 5KTQA 3V4MA 5DG8A 5C0XB 4ZMMA 2H54B 1FESA 3HKZD 1N5VA 4AD6A 3BH6B 4FN5A 1KRPA 3TZYA 4A4JA 2MQNA 3AD9C 2YNGB 5F8JA 3AJDA 5IWAE 4O3PA 3C16A 3C6UB 3KJFB 1YHQS 3IS9B 2UUAJ 3RB4A 1JLGB 2MZSA 2D3O1 2MGZA 4GKJE 4F2SA 1XMOJ 1DZ5A 3ZTPA 3AA8A 2LEBA 3HZGA 4OYIA 4ZHRA 4DX7A 2ADBA 1NNDA 5HMWA 4ZCIA 3TRGA 3T9NA 2E7WA 2G4BA 4P75A 5HMYA 4TVAB 4CLLA 2DXDA 4YQWA 4ECSA 4NWBA 1EZZB 3GIRA 1Q79A 3BQ2A 4LOMA 5K8OA 3D28A 5THWA 4GKKJ 3CMAS 5FIIA 3HP6A 4DL0C 1RZMA 3ITHB 3FZ2A 2AJ2A 4DL3A 4WUBA 3UN2A 1O6XA 4X64E 4OZ3A 3D0GE 2VOOA 1VJWA 1FKOA 5L39A 1VRUA 3R5GA 2GJIA 3K58A 2FZGB 2W1BA 1HNWF 2BUNA 4KIAA 4CH0S 1VQSA 1KC8T 5D4OA 1DTQB 4WXWA 4DUTA 5HROA 3Q6MA 2HHWA 4MIAA 1HNWI 3ENAA 4C3LA 4OI6A 4ED1A 2YX7A 1UDNA 3GLLA 3QPIA 4AL5A 4DCPB 3BSAA 5ITHA 1Q7LB 4OZEA 4R0JA 1V5IB 2P9CA 2V4JB 3TX0A 5A2QC 1U26A 5A8WB 4FXVA 3MHYA 1T9XA 3OFFA 4EUVA 3LOUA 2EWHA 1S1WB 4KTQA 4ED7A 1HNZF 3EMTA 2RF2A 3W3SA 1VOMA 3FEZA 3SSSA 1LWXA 1U8WA 4DSIA 2GVDA 4ALZA 3KKFA 1HNZI 3EZUA 1GFWB 1QUPA 3HVRA 2HHHF 3THPA 2YKNB 2GCFA 2IDEA 2MSTA 2VU5A 3KJVA 5J2NA 2C2EA 4PKDB 2H48B 2KB2A 2BJEA 1TK5A 5IT9Y 2QA4G 3VZHA 1AFIA 3A4TA 1VQ6S 4Q5VA 4B9LA 4B3RE 1FDNA 1N34J 2KG0A 2GO4A 5FDLB 2R7SA 2BM0A 3PW5A 1YLXA 2M70A 2NYIA 1YIJS 4TY8B 5LJ3Y 4J7CA 2XG8A 4MDTA 4IZJD 3TAQA 2KFZA 5K9FA 4LFCF 1HWUA 1RP5A 4EGLA 4U7UK 2H51B 4LF6E 1RBOB 1S7HA 3J7A1 5F8IA 5HMXA 4LFCI 1WNEA 1VBYA 3IAM9 3HXMA 5B0DA 1XC9A 2Z56B 4BC7A 4ZP9A 4YB6A 4U8VA 5F8MA 1SBRA 3RBDA 1VRQC 5DG7A 4CLSA 3TQ1A 3I82A 2X3GA 1VC0A 2GMHA 3M2UA 3FNNA 2VUGA 2Z4PA 3BEGB 1F1BB 4DWIA 3BQ0A 4PG5A 2GHVC 2MZJA 3BGRB 3AA9A 4FKYA 4MKVA 2B8QA 4OI3A 1NH8A 3IA0A 2P6TA 3LP1B 3KK1B 3E01A 2IBOA 4LF2A 5GADI 2KXNB 3SDEB 1M1KT 2Z5BB 3Q8YA 2FJBB 3HSGA 2PEHA 5D4NA 3QGPA 5C2GA 1S59A 2HG4A 1RWKB 2XO6A 4E0DA 3FUYA 2CGEA 4EWTA 3OSPA 3P06A 3MOZA 5JEAA 3CCSS 4Z7YA 3I9V9 1N52B 4DSJA 3MM7A 5BYRA 5HANA 2Y9HA 4KRWA 4JI6F 3UWTA 2MEWA 2NXCA 4FF4A 4X4RA 4ZVFA 4LF5J 3J81C 1BQMB 5BJRA 2JEJA 2CQGA 5KFAA 1IBMF 2QL9B 2QIFA 2JJ4D 4NXNE 4WK1A 5K36B 4B3TF 5DQIA 4JYAJ 2EBEA 1GTHA 1IBMI 5KFWA 4ID5B 2B8PA 1PVGA 1RT4A 2ZJRQ 5K36F 1JLAB 2DR7A 4P72A 4B3TI 2MKSA 1YI2S 3GP9A 2QX0A 5J2PA 5LMNJ 1MSWD 1IWGA 3DFEA 1WI6A 5FLXC 2B5JB 2RU3A 3WX8A 1FRJA 5F8NA 2KTQA 2JC0A 4A48A 4DX5A 3VAMA 3V6KA 1JIHA 1D6TA 1U0HA 2NUHA 4NXMF 1A6LA 3OXGA 4BWJA 1U45A 2RSQA 3FEYB 2GVZA 1HNXE 4USWA 1SKSA 2RNEA 3MPYA 3TUJC 4NXMI 2CUYA 4CLWA 1FFGB 1SV5B 2DGQA 4UOGA 3H98A 4ZITA 3PRBA 2JX2A 2XI3A 3U1LA 5KFBA 2GGPB 4RNHA 2J6SA 4DFJA 4ZJOA 2E5JA 4I4BA 1N5TA 1RAJA 1UAWA 3M6XA 5D3GB 4CO1A 1DRZA 3N28A 3QJLA 1J5OB 1WTBA 1M5PC 2X1FA 2HFUA 1IJEB 2PO0A 1U8SA 1YZ7A 3I4PA 3QJPA 4FNHA 4X62F 4KSEB 4NMLA 5KFOA 3KLGB 2BDPA 3ZO7A 2ZH7A 1R7IA 3IG1A 1E6VB 4K4WA 4X62I 4FVCA 5KG6A 2ASDA 3ONQA 1T3OA 2AX0A 4UW2A 1F5AA 2OFGX 3P76A 3W61A 1HBMA 2FPHX 1OIAA 1X5SA 2WBRA 3ZNUA 5EX0A 2FJEB 1HNIB 4WUDA 1JXEA 4KQZA 3B4MA 4P6QA 1SB6A 2DR8A 5A8RA 4BA2A 1S4EA 1SJRA 4I69A 4OI4A 2VZ9A 4DLEA 2CQ2A 3FK4A 4F3QA 2JEAA 4OHVA 1RQ0A 1H38A 5E7OB 1FE0A 1HPZB 5E5NA 1JLCB 1U7LA 4DR2I 3EE3A 1YBUA 3G2XA 3CNQP 1S1VB 4WKYA 2PMWA 3JAMY 4CQ1A 4DL5A 3E51A 1BGXT 3J80C 4IOBA 3R1LA 2EEYA 1N33J 4KE5A 4F0MA 5C0XE 3EM1A 3F56A 3Q23A 2GAHC 4ED8A 4I6YA 1XNQE 2IJRA 1UJ4A 3D66A 2J9EA 4CYUB 1Y60A 1ZPVA 2AX1A 2KXHA 1MWYA 2LEAA 1K73T 4NLUA 5KFCA 3DOLB 4ZCMA 1WC5A 2HPUA 4L6V3 2MZ1A 2PNZA 1SH0A 3GIKA 4B3MJ 5GAHI 1HWKA 2XEXA 3TX8A 2GMJA 2IHR1 5E3AA 1ZM4A 1V3SA 4LIRA 4JI1E 3W9JA 3MEDB 1AFJA 3HMJG 1TUWA 2EFGA 3VQSA 4CO2A 4DV1E 4DV3F 2JL9A 1JWWA 2O1VA 2E5LE 2VPZB 2PSZA 1S6PA 2XMUA 1CSJA 4S0MA 4DV3I 4DV4F 1ZM2A 2ROPA 3M8RA 2WW8A 4R5PB 3AXKA 4Y34A 2DO0A 2GQ2A 1CULB 4MAKA 2BJ7A 3H4BA 4EO6A 1KQFB 3EXCX 4JI8J 4AXIA 2WONB 3DDNA 1RT3B 2RHQB 1R3NA 2UXDF 1K44A 4RW8B 1N8RT 1XTZA 5F0WA 4F04B 1UP1A 4DMZA 3CJ0A 1HMVA 1OY8A 3OHAA 4DR1E 1S6OA 2HZAA 1IVZA 1A6FA 4OKGA 2UXDI 2NN6C 3L3CA 4CTAA 3ZTRA 4ZK7M 5DG9A 4JI0E 3B78A 2KJVA 1UEVA 3KWMA 3W8GA 1P8GA 1HNVA 2ZKTA 3MFIA 2C2OB 2MKHA 3G82A 1FJGF 4PYAA 4DI6A 1SI9A 5KFQA 1UVJA 2KZZA 3CJKB 2IY5B 1LWEB 1SC3B 1UMJA 2YWWA 1AXQA 3KLHB 3CXCR 2JOQA 2R8IA 2Z2YB 2RKIB 3MCOA 4R0EA 2W9CB 3RBEA 2XBPA 3DLKA 3OHBA 3TYTA 4BHQA 3JS9A 3T1AA 3ET6A 1TL3B 1NJWA 4I2PA 1G2EA 3DLJA 1LWFA 2F8EX 1RT1B 2DK2A 3CD5A 5IV4A 1SUQB 1NLKL 2OTJS 4HLBA 2IPOB 3B8HA 3MCNA 2Z30B 2NS1B 3B54A 4B9TA 2NYHA 3HVAA 2JWNA 1T9VA 4RKUC 5LMUE 4QPTA 2JDJA 3GV8B 3BO4A 1FKPA 3VGTA 4JV2A 1IBLF 1RAAB 5M2UA 1LK5A 1HLWA 1B0TA 2RUSA 3M8SA 3PR4A 4DX6A 4OZ1A 2HFNA 3V6DB 5AJ3J 4LBIA 3UE2A 3V81B 1TMJA 3Q2TC 3OL8A 3GR1A 2WK4A 4IDKB 2XY7A 1GQEA 1N36E 2D9OA 2HNZA 2VDIA 3NOGA 2ZVIA 5HAOA 4ZLJA 2OPQA 2H5JB 4NYZA 1QM9A 2W2QP 1RGVA 2XCPA 1FKAF 3CDUA 3RAXA 3W2VB 2YWGA 4LF4E 2C3MA 2DNLA 4UOHA 2ZH1A 2MHEA 2EFVA 2O1WA 2F63A 2GW8A 3MECA 3MAAB 4CT8A 3OTBA 4WFZA 3LPYA 1MROA 3EZ5A 1EQ0A 1SXLA 2DGWA 3AHPA 5CYQA 7AT1B 2ZBPA 3QGGA 1K8AT 2AHOB 2J6TA 3S8SA 4OO1A 4JI7E 1JLQA 4E2FB 4DV6J 3VWSA 5JEAE 3OR2B 2KVIA 4YY3I 4J9MA 3EDQB 3G6VA 3EDRB 3VAJA 3A3PB 1IBKJ 1FNOA 4JB8B 4UTGA 5C5JA 1Q8KA 3QMQA 4B3SJ 3HVTB 1L3SA 1AA1B 3I0SA 5LSRA 4LFAF 1BWEA 2RDDA 2FJXA 4DPXA 1MW7A 4LF7E 4RW4B 4LFAI 2UUAF 3LANA 1NSAA 5HVHA 3J7ZT 2DNRA 4J9VA 2I0XA 3AAWB 1XMOF 4JI5F 2WSFC 4JG4A 2YKMA 5E3PA 5DRQA 1XMOI 4JI5I 2V9WA 4ZN3A 4UZCA 3JB9k 1EETA 4ELTA 4HACA 5I42B 3P5TL 4H4KA 3DRYA 1G3OA 2R4FA 2ATCB 2MY8A 1EA6A 4JV5I 4X4PA 4F2RA 4K8RA 5D0EA 2E9RX 2ASJA 1SIZA 4PRFA 1K9MT 3V6JA 1HA1A 4DZDA 3UI3A 2VC0A 1R6MA 4OYMA 2V2VA 5J2QA 1YKWA 1NU4A 1JX4A 4H4MB 2E5GA 1HWIA 4F26A 2MJNA 4IOCQ 4WXOA 3NNAA 2BE2B 2WP8B 1TL1B 3NLCA 1HKAA 4ZJLA 4ITSA 3G87A 1HR0E 2A3JA 1N5YA 1TQLA 6FDRA 5I3UB 4JBCA 2QYCA 1RT7B 3ZTOA 4LF8J 2OEKA 3HK2A 1FJEB 4DR4E 1MU5A 1BMQB 4IZKB 1BUXA 3M1VB 1PAUB 2Y0BB 4JV0A 4OX9E 2BJ1A 3PVXA 3K5PA 2DKOB 3BS9A 1Q78A 3GJTB 3OV7A 2BR2B 3NMAA 2IM3A 1RTIB 2RHSB 2ABYA 1FCAA 5CCLA 2O3DA 5J1EB 1UA0A 3O8WA 5C0XD 2BANB 1PG5B 2HHUA 2OD4A 4YB5A 4DR6E 1MMNA 2AZ3A 2RQKA 4A8KA 3CUNA 1XMQE 3N6LA 3JQJA 1VQKS 4TQSA 3ZTQA 1JJHA 3O1LA 1O51A 1HWLA 4NLWA 3RU0A 4HY1A 3LAKA 3GJSB 4CI0B 2W7AA 1VQ7S 2UVWA 1QE1A 1U6ZA 3PG9A 1PJ5A 2RU9A 2P8IA 1EB0A 4B3OA 4OJ1A 3DGVA 1LW2A 1EP4A 1WHWA 3BBCA 2B9WA 2WOMB 1S4FA 4RUBA 2ZD1A 1H7XA 1N34F 1XBWA 1C1BB 2QSWA 2IBKA 3I5BA 4DUYE 1KR4A 2QRRA 3THTA 1FXRA 5KT3A 2HHXA 4DL6A 1N34I 3KG1A 1VQ8S 2G0JA 1I51B 3CJQA 4IRDA 2ZM6E 3ZKDA 1OQ6A 2R8GA 2HW3A 1N6QB 3CCUS 1CJVA 1S1UA 5K20B 4ZS6A 1X4GA 4X66E 2ZHOA 5GAGU 5E33A 3V4IB 4RW9B 1AYEA 2W9BA 1FWPA 1OYPA 2YH0A 3QZ8A 3H20A 3H8YA 3UNGC 5KFPA 2F8HA 2O5DA 4WIIA 1UVMA 4DEZA 2LECA 4DF4A 4HTJA 1Q82T 2VKZG 1SQGA 1IN0A 5CYJA 3TA2A 5J1PA 3PFEA 4U95A 4FYXB 4GO5X 2KH9A 1KVKA 1VLOA 5A76A 1KONA 3MM8B 3PHEA 2UUCE 4DZ6A 2ZH2A 2GHPA 5ETQA 1FI4A 3C66A 1GXUA 3LALA 2XLIA 4F3OA 3LF0A 4K0KJ 5KG7A 3GIIA 1FWLA 4C48A 2HBQB 4RW6A 3DGPA 3KG0A 3BKUA 1C0TB 1KHWA 3H2UB 3V4IA 2E1PA 2EXUA 3HCXA 2R42A 2QG9B 4WFAQ 1TKTA 3R27A 3NP5A 4OYWA 3C14A 2WW4A 2EKYA 5I3QA 4GVLA 4KC5A 4AQYE 1U1MA 1R89A 3N5BA 4O3OA 5IWAJ 4P10A 3FC9A 3KLIA 1JXLA 2F9DA 3X3UA 3GSDA 1Q1KA 1TK0A 3KOAA 1U1OA 5KFKA 1BD6A 1X4FA 4GKJJ 4FDFA 3GFHA 2G13A 4Q2LA 1WACA 3K7RA 2MKJA 3KUHA 2UU9J 2A6OA 5LT5A 3EUNA 4USHA 4Z2XA 2C3UA 3GQCA 4A8MP 4J37A 2D9PA 5C42A 1ZPWX 1U49A 2CADA 2DISA 3E3XA 1CBKA 1RDRA 5LMNF 4DV2E 4DQSA 4WE1B 4N77A 3FGVA 1UEKA 3M7VA 4FW4A 5KFXA 1RU1A 1DLOA 5IT0A 1LKZA 3AOCA 4OZLA 1VISA 5LMNI 3P3EA 2OP5A 2BW2A 3C19A 2F40A 4HHJA 2ZZNA 2NN6B 2CIMA 4X64J 2ZE2A 2Y1LB 3L4BC 5KG4A 4ZPWR 4IFDC 3BJYA 5JEAD 4QPXA 4BDPA 4TLRA 2XS5A 1FX4A 3UNYA 4DUZJ 2OPPA 2HFVA 3KHHA 2L9DA 4GC6A 1R6VA 1YJ9S 1UWAA 2C2NA 4NBQA 3SZ2A 1X8DA 3FQLA 1BWVA 1FD8A 4PR6A 4CNZA 4ZIVA 1GH8A 3VCDA 1LEOA 2ZOMA 3ENQA 5K8MA 3TJ9A 1NHHA 1OS5A 3M2VB 3DDIA 1IQTA 1P6TA 2J7KA 4DCJB 4NLOA 3UVJB 2BABA 2KVQE 3ZZUA 4OO1E 4NRTA 2JH3A 1X0PA 3QIDA 2J7UA 3MWBA 2GIFA 1UVIA 2YWHA 1FJ7A 4YHHE 2F4VE 1QLNA 5G0RB 2YKOA 2IRUA 3OTEA 3JYTA 2XWYA 3D54A 5RUBA 4K4TA 2FHJA 5A0YB 4A8QA 3MM9B 4DU7A 2KFYA 4JI4E 1TUGB 2ALZA 3LPSA 1IKVB 4B3RJ 3AB2B 1YITS 1TKZA 3K0JA 1UZHA 3R2DJ 1RLCL 4RUAA 4FBUA 4O3RA 4PWUA 3UVJA 4DN9A 3EZOA 4C98A 2GQ0A 5L46A 1BE4A 4MU0A 4C8OA 2KT5A 2CQ3A 3FBBA 1HYSA 3VZIA 2B43A 2VBYA 1T7PA 2QE5A 4LF6J 1O8BA 4WF9Q 3QYYA 4DJBA 1KWMA 5KT6A 1Q8BA 2V8GA 4ZKAA 3M6VA 3TNVA 1Z2LA 1I1GA 4WFXA 4HVZA 1ZM3A 1B7FA 2ZFHA 2VOPA 4WZQA 4D3HA 1HQ2A 3ZFVA 4ZCLA 3PYFA 4O4GB 2HHTA 5KFTA 2V67A 5F8GA 3MTKA 1IR0A 1D3WA 3O44A 2EK6A 1Z59A 2C2MB 2PEBA 2ZHAA 4F8RA 3US5A 5IM0B 2B6AA 3IFEA 4XK8C 1VC5A 3M32B 2PO2A 1T03A 4QR2A 3D7SB 4GKKE 2QC3A 3OUYA 1RWVB 1DTTA 4F67A 1FXLA 3BR9A 4WP3A 1K1QA 2HRYA 4E98A 2CQ1A 4MMOA 1HBOB 4I6WA 3DOMB 3CD0A 2V2ZA 2HMIA 7FDRA 3QT8A 2Z57B 2QFIA 5LL6R 2YY3A 2FJVA 2PO1A 1HI1A 4ZVTB 1S5ZA 4ANDA 4J9UE 1U02A 4ED2A 3DI6B 2C2KB 3DRPA 3R7BB 1BQNA 4FWHA 4HT7A 4NCGA 3BKTA 4WJBA 2APOA 4ICLA 2H1YA 4TY9A 4PXBA 1YX2A 1RHJB 3IWNC 1I3OB 2HS0A 3BSCA 5GAGI 3R6GB 4R8UB 3H59A 5E3CA 4QWEA 2CQ4A 3CD6S 1M5HA 1UPMB 4C7QA 2D3OR 2X1AA 3HHNB 4KHMA 3PW7A 3IBCB 4XDDA 4XTTA 4QW9A 5KFIA 4D3GA 2K3KA 2BACA 4OZJA 3H5SA 3ISNC 3CC4S 1RT6A 4KO0A 5G4DA 1HNXJ 1NK7A 2VASA 3EXYA 5B7WA 4LVOP 2BZ2A 1CJUA 3KMQA 2K7JA 1WC4A 3HHLC 1IKWB 3L7ZA 1YJRA 4LRCA 1FO1A 4GC7A 5HP1A 3D9BA 2NPIA 2OPSB 4L74A 3HULA 3HKMA 1YZ6A 5KG2A 2XYHB 4HTIA 3OTDA 3H5XA 2IOPA 2DO4A 1Z0VA 2FDNA 2KRRA 3WQPA 2D1CA 3Q0AA 1Z5CA 4DDFA 1F2GA 1NRKA 1UWBB 3QT6A 3OD2A 1TL7A 3K8WA 2LA4A 4LMZA 1CLFA 3IAS9 4ED3A 1ZZFA 1YJNS 1HQEB 1S9EB 3TEGA 2XMMA 3LQVA 1X4BA 3OVAA 4EBDA 1WTFA 3R5CA 2CZVC 1KTQA 1WF0A 2WVBA 4C8LA 5LOQA 5HN0A 3MTJA 3C46A 2GFFA 2DNMA 3POTB 4O44A 4ZP6A 1IBKF 1D1UA 4DG1A 2PI5A 1CQMA 3I0RA 1WSRA 3FRZA 1N32J 5HQ8A 4RUHA 2JVRA 3GSIA 3GZ7A 3DM2A 4M5DB 3OR1B 1UFLA 2HNDB 1UVLA 4UY85 3NAIA 4F50A 3JSBA 3T3FA 4ISAA 4EU0A 2FIUA 3L9ZA 4IRCA 3FSYA 5CYMB 1ICEB 5F9NA 1XNQJ 1HBNB 4ZP8A 2IERA 5IT4A 3K5NA 2ASYA 1FERA 4LF5E 2V9KA 3I5AA 4V19X 1FE4A 4DPUA 5FD1A 5DQHA 1SQFA 4QR0A 1S0OA 5AT1B 4JYAE 2PMHA 4OO1D 3N9UC 2C22A 2M0GB 1Y9OA 2MQQA 3U7JA 4V1Ak 4J9KA 2MZTA 1U2RA 4QWAA 4JI1J 1RAOA 4N8OA 2VC1A 1PAEX 4IZJB 4DV1J 4LFCE 1FK9B 5L1KA 3BV8A 1TKXA 5CABA 5C7PA 3MFHA 2AF6A 2R9LA 5EHHA 3PRVA 4OZ2A 4G3IA 4LF8F 3I96A 4U67Q 3Q1QA 4MTPA 2NN6E 4DOZA 3N4WA 3BSOA 4FYWB 4IFDB 1P9YA 4QYRA 3OTOE 2HLUA 2AKWB 4I2QB 2V8HA 1OO0B 4QYZJ 4NLRA 1ZXNA 4OZ5A 4DR1J 2MQMA 3QAEA 2CPXA 2NSBA 1QAJA 3IGVA 5F8HA 4JI0J 1MWQA 1LWCA 3D6HB 4FYVB 4UUWA 3MEEA 4XDCA 1RSCA 4OFZA 3PTWA 2WVFA 1PC5A 3L95X 2VQFJ 3KK2B 3OL7A 1Z5BA 1R27B 3HD2A 2QJ3A 4DV5F 4C8YA 2JVOA 4BA1A 1CC8A 4LSLA 4DV5I 4KHPI 3G6XA 4PG4A 4PAAA 4JI3F 3B6BA 2X1BA 1MU2B 2JNJA 3NZKA 3N5FA 2FVSA 1K0VA 4NI2A 4JI3I 4CDIA 5LMUJ 4Y2CA 3A1YG 1REVB 2JE6B 2V5HG 1CQNA 4KBIA 1WF1A 3GCXP 4N76A 1R8PA 1HW9A 5EX3A 3DLLQ 2MTLA 2JEIA 2CPHA 1XNRF 2DD8S 4M1KA 2IYGA 3MR5A 1Y3JA 5BXIA 1N36J 3FVYA 2LJPA 3JSYA 1N33E 1KHVA 1NB7A 1GMUA 2XYGB 3M8PB 1XNRI 3ZC4A 2IRXA 2BVZA 4Y3CA 4AXJA 3MMAB 3SEOA 2AEFA 2BKOA 5EWFA 1TAQA 3VGUA 4Z7CA 2PNMA 2W2OP 3DXBA 1S1XB 3CJ8A 4DQRA 4ED0A 5IFMA 2VDHA 4LBPA 4O3QA 1RT5B 2F7VA 1U24A 4OHZA 4K0KF 4JI7J 2F3JA 4FW6A 4C8KA 1YG0A 4UQTA 1YJWS 1TV6B 2LQ8A 2CPIA 5ETNA 3N01A 2F1FA 2E5IA 3GJRB 5DDRC 2YVSA 1HHTP 4X4NA 2YNFB 1X9MA 4C0HA 3PYDA 4URQU 2CPFA 2CPYA 2HHPA 1CS4A 4B02A 5IWAF 3JSMB 4LF7J 5HLFB 3HJFA 1NCLA 3HVWA 1SJ1A 1RHMB 4GKJF 3NWRA 4F25A 1M90T 2KU7A 5IWAI 1VQMS 1OYDA 5IOLA 3LP2A 2K1RB 2G2ZA 4USMA 1H7UA 4RZRA 1E3HA 5D0RA 4DU8A 2YKPA 3TAMB 3TUZC 3FFIA 4UF4A 2Y8WA 1RT2B 1RISA 4JI8E 2FVCA 2J0SD 3Q89A 5E0OA 4ZVSB 4OJ3A 4C8ZA 1X9SA 1RLDA 3JQMA 5KFUA 1D9DA 1TV6A 2CG4A 3D6TB 4FXWA 3T6BA 2JSXA 3GV5B 1TVRA 1WC1A 5DDOC 4RBVA 3M8QA 1VJQA 3LPEA 3ZXWA 2DPIA 4DR2E 1PC4A 2GJ2A 4K4SA 4WWSA 3IGNA 3PJWA 1F2HA 4X64F 3H7HB 3ZTSA 1D09B 3ZZ0A 3LH2S 4OIXA 1KSPA 1RAFB 1XQIA 4M5JA 2DR5A 2YNHA 2F5GA 4X64I 2DY1A 2ZDOA 4KFBA 1U1QA 3QRPA 3JTNA 4URGA 2CJKA 5DGBA 4JOUA 1HR0J 3BZQA 3GIMA 5DRPA 4M5MA 4F0KA 4FNIA 4Y0FA 4DR4J 3DMJA 4OX9J 1X4DA 4C3KA 2HWHA 1LNQA 2GMLA 1QSLA 2UXBJ 1KQSR 2DH8A 1L3VA 2KM8C 2PNLA 2VG5A 1U47A 1AB8A 1AZSA 1XMQJ 2YNIA 4WFYA 2MKCA 1HI8A 4YUDA 3Q8PB 2ERRA 5JJBA 2VFUA 4RU9A 3MPDA 2BV3A 2R7OA 3J7AM 3SFGA 1S77D 3DLGB 1XK8A 2ZJQQ 5KFJA 4OHXA 3PO5A 3HPOA 1NSQA 5K8NA 4DV7J 1CJKA 2D3UA 1VC6A 3CJ3A 2CG8A 8RUCA 3FRYA 4I3HA 1WELA 3TAPA 3RRHA 4FW5A 4B3RF 3GG1A 4HI1A 4DUYJ 2G1DA 2J8AA 3MM5A 4ZLLA 3OPKA 1S49A 5B0CA 4DV6E 2UXDE 1NAQA 2IAJB 3HO1A 3NMRA 3HHLA 3RR8A 2F8MA 2VJUA 4USVA 2ZM6J 1FA0A 4B3SE 1S9FA 3AQPA 1VBZA 1T9UA 3DRRA 3UCGA 4LF6F 3OJUA 4Q7AA 3T9ZA 4DS4A 1EHWA 1FWKA 2BRKA 3W65A 2EVZA 1YRXA 5JEAC 1LFPA 3PW2A 3NEKA 2WSCC 4N3OA 1Q4RA 4I7FB 3T1YJ 2IRYA 3R5JB 2LKZA 2O1UA 3U02A 2LXUA 2VHGA 3CDWA 4HDGA 2NLWA 4MU4A 4U8YA 2E7VA 3AT1B 4DSKA 1J2VA 2CQHA 4X4SA 3Q86A 4F4XA 4N5SA 4J9NA 4V19J 4X4UA 3V5RA 1TK8A 4QYZK 4BCAA 2UUCJ 1F5BA 5FLXQ 2FZKB 4IUFA 2V0NA 4M5LA 4DSLA 3K2YA 2GJFA 1MMDA 2KHDA 1AUDA 1QY7A 2PD1A 3NOCA 4KKOA 3NCQA 1WHYA 4RNNA 3PR5B 2J9DE 1EX8A 1SH3A 4CLUA 1IWAA 2KT3A 1ZYQA 2B4PA 3WC2A 4AQYJ 4MFBB 2XGPA 4NZ0A 1FFWB 3M2RA 4FKXA 3ZKBA 4C3MA 3S6EA 5CAAA 3CTRA 3PS2A 2V69A 2WCXA 4OL8A 2BJ9A 2E1RA 2FC8A 3MEGA 4MK9A 4FWGA 1WC6A 4NXNF 3OFEA 4EFAC 2OD6A 3IN5A 4KR0B 2DNHA 2QLWA 3MM6A 1S1TB 5C24B 5C25A 3UQSA 4NXNI 1N0UA 1F6TA 4YY3E 3K5LA 3BO3A 1KDNA 4F7VA 2VG7B 4PUOA 1Z0BA 4IFDE 1RUSA 2NXNA 1YJ7A 4U3BA 2FHMA 1SL2A 4GQUA 1JJ2R 3HZEA 2EBGA 3I55S 1R0AB 3V6HA 2HQGA 5GADU 4C0OC 2L9WA 2OUGA 3KLEB 4KAIA 4XAKA 2WVEA 3Q8RB 2ZH9A 1U1KA 2FY8A 4KGVB 2VB6A 3CVKA 5J1NA 3UR3C 4DR3F 2ROEA 4FF3A 2ACMA 4MYTA 1JJ4A 1RTDA 5ETLA 4YB7A 3BN7A 2FD2A 1KS2A 1VRTB 2K2PA 4DR3I 3KDNA 2ZBIA 3LP0B 2AQ4A 4PQUB 1VK8A 1LXJA 2M7SA 4ECXA 3CDBA 4RNMA 3KLFB 2AEJA 3FKBA 4NLVA 4HXZA 1B3TA 4KH0B 4JV5E 2LU1A 3M7ND 1NSKL 2HBZB 3VAHA 1TU0B 1OWXA 3W5YA 1NBEB 1M5SA 4ZPCA 2RQMA 5IXUA 2RILA 3U1NA 1I6JA 2I5JA 5A8KB 1BY9A 4C11A 1NDCA 2RUGA 2Z2LA 2V6AA 2ATLA 3BN4A 3K89A 4M63A 3THVA 4J9PA 5GMKa 4RW7A 2HSEB 3DYAA 2DNQA 1TFYA 4DQPA 2HQIA 1U4BA 4YHHJ 1EI1A 1BC6A 1DJ0A 2F4VJ 2QL7B 5BR8I 1BHNA 5CQGA 3OSNA 3C16B 1ITPA 4MK8A 1FTCA 1N88A 1JLEA 3PDNA 2MGZB 3H42A 3MXHP 4JI4J 4K4YA 3VR1A 5ETSA 2QLBB 4ZHRB 1X9WA 4A46A 4NEYA 1XR6A 1A0OB 2UUBJ 1TL4A 5C2CA 1KOOA 1C0UA 1W25A 3CT9A 3ETMA 2CRLA 5A6WA 3R7SB 1JJCB 2CWXA 2R8KA 5C0XF 4G65A 1Y10A 1PGZA 1Y3KA 2HK3A 4P7AA 4QU6A 1DHMA 2PT0A 2Z5EA 1XNQF 1B62A 4URLA 4ZP7A 4ZLPA 2CVEA 4FW3A 1M0SA 2LQ9A 4DFPA 2EFQA 1FKOB 3AJ1A 1VRUB 4A8OA 4KQVA 2ROGA 2UU9E 3W9HA 2DVIA 3MMBA 2E5HA 1Q81T 3M85D 4PPZA 2V4QA 3T6JA 1SC6A 3AOAA 5HROB 3P4UB 2P9GA 5T41A 2FVRA 3GMEA 2W2MP 3RRGA 2X51A 4YEAA 1VI7A 3D1OA 4J9SA 4JI1F 4AIDA 2FY1A 1QSSA 3SI8A 1GEHA 3NCPA 2IC3A 1RHKB 3G4SS 1P1LA 2H4WB 5IT9U 4DV1F 3G86A 2B3TB 1UEUA 1UZDA 4K2XA 2E5LF 3IWLA 2Z5CA 3SQGA 1XXEA 3CJ2A 4MKAA 1JLBA 4IFVA 3PS1A 4AIMA 4B9NA 2YX4A 2VG6A 3K57A 2E5LI 2RF2B 1WD6A 5E3RA 1DAXA 4QOTA 4P71A 3G9CA 2GVDB 1U6FA 4DUZE 3K59A 2I38A 4R25A 5I3PA 2OAUA 1XN9A 1HK7A 3QT7A 3KJVB 2N3LA 5J2NB 4AT1B 3EICA 1GX6A 5ETPA 2VBXA 4DR1F 4OHYA 2W4DA 2J0XA 2J0WA 2ZVSA 2WAQD 3GU0A 4LRAA 3QT5A 1RTHA 2NR0A 5ETKA 4X65J 4F0HA 5GAHU 3D3CJ 2GAGC 3L7OA 2OMOA 4IG3A 4ZIWA 3NNHA 3VGVA 4PRXA 1QSYA 2B4UA 1NSPA 4P7VA 2A18A 2VQEE 5KFSA 2GHWA 2LXFA 1Q5YA 1Y4UA 4NLTA 2KM8B 2M2BA 2DNNA 1CG2A 1PIEA 2CJXB 2FTRA 2CG9A 1HWJA 2RH3A 3RRKA 2Q66A 2DRAA 2LQBA 2ZH8A 2HHHI 4KH1B 3NNCA 4OO1C 1TP7A 1JKHA 2KN4A 4G1QA 1QVGR 3CGIA 2R8HA 5LMUF 4WK3A 4ES3A 3M2UB 3H4DA 1J5EE 2PGCA 2HVZA 2OPRA 5LMUI 3NGSA 2AYEA 3AH6A 3M7NG 2C3PA 3EX7B 2JEBA 3DLEA 4TNOA 1U1RA 1N36F 4J5OA 3NL0A 3E01B 2J6UA 3CE8A 5LJ5Y 3ZZTA 4FZVA 3S01A 3TR5A 4YR0A 4CLYA 1AROP 2AWZA 4LF4F 1NK0A 1S57A 2V2KA 5H1SV 4CM0A 1GTEA 3K5MA 1CJTA 5JEAB 2EC2A 3S7RA 3MM7B 4IFDD 2XZDB 4LF4I 4H4KC 3BDPA 3PKMA 4PZVA 2H5IB 3JQKA 4JI7F 1FHTA 2PA3A 1RTJA 3KXDA 3CJTA 2Z0GA 5KT7A 1HD0A 4A8WA 3FBFA 2A2CA 2BA0D 4WYLA 3UD5A 2C39A 5HO4A 4KV8A 3P6YC 5ELWA 1U6BA 2EFOA 3DHWC 4CM2A 4P2MA 3N79A 1I5OB 2WTFA 1RT4B 3IRXA 4LF7F 3WU6A 5DZ6A 1EAYC 3VGSA 4DV0E 4NA2A 5J2PB 3Q2SC 4MK7A 1HNZJ 3SXLA 1B99A 3QGIA 2ZZMA 3QO9A 2F1DA 3S1TA 1NO8A 1I94F 1Q5VA 3Q8UA 2E9TA 1QTNB 3SCJE 4PG8A 2V8PA 5EWEA 1FX2A 1U0HB 3E2EA 2HNYA 1I94I 3PYEA 3BREA 3F73A 4NL5A 4MYUA 1PYTA 2GVZB 5DRRA 4JI6I 2HZVA 3FQKA 2IM2A 5KFDA 3GWCA 3PX0A 1AT1B 2IOQA 3TZXA 2GO9A 2IM1A 4IQMA 4YMEA 2B9EA 4OLOA 2MZQA 3M85G 1WJ9A 5KT4A 2KI2A 4RU2A 4LRDA 4LVNP 2VV5A 1NK6A 3QIPA 3UDLA 2C3OA 2HIYA 4F3MA 2MKYA 4L3NA 3AJ2A 2BKNA 2LQJA 1Y11A 2QMUB 1UW4A 4L75A 4HH0A 2C2DA 2ZOFA 1OMSA 5A2QY 3LW5C 2PO0B 4LFCJ 3C15A 4Y6IA 1P9QC 1W7WA 4ID8A 1VQ4S 1HR0F 3ILJA 1WI8A 2A2DA 5DLFA 2Y3YA 5ETRA 1YRUA 4YB1P 4DR4F 2I2YA 4IH5A 3IG1B 4KT0C 4OX9F 2HGLA 3JAMU 1K0TA 2UVUA 2VA2A 4LIWA 4DR4I 3OTOJ 2EK1A 1HBMB 3M4XA 5KFVA 4OX9I 4YDXA 1HBUA 3NBPA 4PYDA 2KXFA 3SV3A 4DR6F 1LOUA 2UP1A 1Z0CA 1VHFA 1R8CA 5A8RB 1XMQF 4BA2B 5HJXA 2KG1A 2D3ZA 2C37A 2AV5A 4XIUA 4DR6I 2JEAB 1GMWA 5DZ7A 2RQCA 3QZ7A 3P3CA 4A8SA 3ZZYA 2NREA 4PU9A 1S9GA 4M5KA 3CCMS 2QMXA 8ATCB 2CJ9A 1S6QA 3MD3A 3IR5B 1OYSA 1URNA 5KT5A 2V68A 2PIIA 2AJQA 4I1TA 1VQOS 3GFXA 2OMLA 1RXOB 1R6YA 1RTZA 3B82A 3DDKA 3CDEA 1F60B 1NKCA 2DEJA 3RR7A 2AGPA 2O1PA 1JB0C 4DUYF 1PILA 3SMZA 3NGDA 2HK2A 4RNFA 1E6YA 3DRSA 3KK3A 4NA1A 2BX6A 4LJMA 3WBZA 4CLPA 1IBMJ 4CWBA 2ZM6F 4NZ6A 3RUBL 2PNZB 1N32E 3G8SA 4KHRA 5HBMA 5D78A 1S6UA 1LXNA 1RA7A 4X66F 1NZAA 4DFKA 3UO0A 2C2ZB 1QAXA 3CO0P 2R2RA 3C8YA 4I64A 3BB5A 4X66I 3DN9A 2GC8A 4B9MA 1EIYB 1BLUA 1RHRB 4MU1A 1SC1B 1CEZA 4OYBA 4QWCA 2R2TA 1HQUA 3DKDA 4B17A 1WDDA 5AXKA 1S6PB 4HI2A 2KO1A 3ZZRA 4NXMJ 4OJGA 3DOKA 3HJVA 1RYSA 3N0VA 1P42A 4ZVQB 2FC9A 5M2RA 3ISND 3NAHA 6FD1A 2XS7A 1NPKA 1F9EB 2LP4A 4GVBA 2GIRA 2DJWA 1RA6A 5B08A 4QIEA 1AUSL 5IC4B 3J81Y 3HHLD 2UXCE 4P2SA 1QTMA 2OO4A 2FGOA 1HMVB 2WNRA 2MY7A 3UR0A 4CTAB 2BA0G 3KHLA 2HIQA 3TP2A 4MT1A 5LM7E 4IFYA 3M30A 1LK7A 4AQYF 1NUEA 1R0BG 5DS7A 5E41A 1XR5A 4UOFA 2FLOA 1HNVB 2LA6A 2L9NA 1IKXA 4X62J 3G82B 2Q6BA 5FLXY 3R8YA 2IVMA 3EJMA 3NWGA 5K14A 2EFPA 1RWWB 3JAMQ 3WX4A 4PWDA 4RBTA 4CLZA 5HL7Q 3MMCA 4WPAA 3PACA 1S0MA 4DV4I 3DLKB 4NLQA 4UT4A 2XY6A 3ET6B 2QO3A 2LDYA 4I2PB 1LWFB 4RWXA 2DCLA 4DV2F 2KFNA 4DPOA 4F36A 3C6TA 5SUHA 1KVJA 4Q0BA 7FD1A 2XSJA 4DV2I 2RAQA 4DR2J 1M1HA 5IV3A 4IG0A 1FKPB 4HL9A 4W90B 2V8VA 5HVGA 4I6AA 3OLAA 5T7LA 5B09A 1EKRA 1NHVA 2CJBA 1M1GA 4DSEA 2VKRA 3TZZA 2ZNYA 1UL3A 1W2IA 3DU6A 3MCSA 4N8NA 2VQFE 1UPPA 2MDAA 2K8GA 2HNZB 3BYRA 1FEEA 1FJGI 2C38A 4FVMA 2OPQB 4ZJQA 1PSDA 4DR5E 2VFTA 1IM4A 3GE9A 1DQ9A 4K5RA 1DFDA 3QLHA 1RBAA 2WVCA 3TUIC 1JNRB 4QZVB 1IR1A 3MECB 1KFDA 4L3KA 4LBHA 1MROB 1YJUA 5JVHQ 2VICA 2DTJA 5CYQB 2JLFA 1H72C 4CNYA 4HR2A 4OO1B 2MPUA 3WZ0A 1JLQB 1YH8A 1PKUA 3J81j 2IVFB 2YH1A 2D41A 5EL9A 1N4LA 2LEPA 2C2RA 3R7NB 1VQPS 1IBLI 1U1LA 1YBTA 2RE1A 3QSIA 3QRRA 4AM3A 4Q44A 4YHHF 3I0SB 3A8JA 2G2YA 2I9SA 5FJ4A 1FXDA 4DV3J 4WYWA 5K36C 4YHHI 4ANEA 2AIRB 2JHEA 4ECYA 3M6UA 4JI4F 3J80Y 2XWXA 3PYGA 3KYLA 5D15A 4CLFA 2P9EA 1ZAVA 2YKMB 4JI4I 1FFSB 4OJHA 1RWXB 2PA8D 1VR6A 2XYPB 1RE1B 4JI2E 4YDDB 2X36A 1EETB 2GO8A 4HACB 2UXDJ 5ADZA 3PW4A 1LW0A 3NGUA 1T95A 4HDHA 1KNZA 1RADB 4WU3A 3T5KA 1YVFA 3NXZA 4ZPTR 2QV6A 1KP6A 1SCJB 1SL0A 4YS2A 1X5PA 4MKYA 1LV5A 1QAYA 2DNGA 3HSZA 1MLAA 3R1HA 2J9CA 5J2QB 2XLKA 4USIA 3MPVA 4Q8EA 4ZVUB 1H0HB 2UUAI 3UCUP 1RWNB 2DHAA 2AGOA 4NMXA 4KHPE 1IXKA 3FBEA 3CCJS 4H4OA 2CDQA 1PO6A 1YJVA 4ZPDA 1FVQA 3H90A 3P3GA 1N5YB 4DPTA 2XY5A 3W2WA 4P7TA 2CXEA 2L08A 4IO1A 4NLGA 3OL9A 2HAIA 4TYAA 2CNKB 3P96A 4LR7A 3F41A 1RHQB 2YPYA 4GKKF 3MR7A 1KN6A 2RJZA 4G1PA 4FPIA 3WIUA 5KG5A 2JEFA 1TR0A 4LSNA 4GKKI 3EPIA 1UDQA 4X2BA 1IKYA 1YK9A 3MMJA 2HS4A 2VONA 3KJQB 3NCRA 1H7WA 5IT9C 2F65A 1KLMA 2O66A 1QE1B 1R8BA 4ECRA 2BOPA 2M52A 5DNXA 1KBRA 2BEFA 2AP6A 3WDOA 2HS3A 4O23A 2BJ8A 1T94A 1NHKL 2N4CA 4PXDA 4B3OB 1KOHA 3MCMA 4HKQA 5DQGA 4I0WA 4PQAA 4QIFA 3FBCA 5L1LA 1LW2B 3HX9A 1EP4B 3BPDA 1RJJA 5HVFA 2ZD1B 3OFGA 4YY3J 2OEMA 3BKFA 3NG8A 2R7WA 1TTHB 3QGHA 3R2CJ 2UXBE 2DPJA 4LQ3A 2W7PA 2XZWA 3TEHB 3QJJA 2AGQA 4ZPBA 1Q0NA 2IMOA 2DYAA 4NOHA 2DT9A 2UVRA 3TVYA 1Z0TA 3CCLS 3CMES 1CJVB 4LFAJ 4NYPA 1S1UB 4KJIA 2OELA 1ZTTA 2DIUA 3CSKA 3SYZA 2B0GA 1C1CA 2AJ4A 3BM7A 2W9BB 4DV7E 2B51A 4LFBE 4NA3A 2ZOGA 4QWBA 1UW9A 2BQRA 2CNOB 2QN6B 1TUVA 1FRMA 2FZCB 1NKBA 4JI5J 2OIHA 1JLFA 2XULA 3K5OA 4KGXB 3MUTP 4BLGA 1NHIA 1Q95G 1NJIT 1KFSA 5SZTA 1X7VA 3PEJA 4JV5J 1T05A 5HQMA 3WU4A 4NX9A 4USKA 3PS3A 1C4CA 1BXNA 2RIJA 5C0XA 3F0NA 1CPZA 1Y4ZB 3NY0A 5T14A 4ECTA 5E2QA 4C6AA 3AOBA 3TOQA 2QA4S 3BYPA 1L3TA 3K1JA 2YNGA 4RW6B 4LF9E 3DGPB 2QEXS 3G96A 4Y2AA 3OBIA 4ZA1A 3C6UA 3IS9A 4O3SA 4QU7A 3T1YE 1JLGA 1TKTB 4K5SA 2AJFE 2AE8A 2BE7D 3C14B 3FMWA 3NRBA 3MDFA 2VFVA 1VGYA 2H65B 3KLIB 9ATCB 4ILMA 2EW9A 4JV1A 4ATNA 2J65A 2CDRB 4DL4A 1B4SA 4J3DA 5JUMA 2OHDA 2W4CA 2HBYB 3M6AA 1PKPA 2C3YA 5KT2A 3M9NB 1CVJA 2AEMA 4WKRA 1IR2A 5CH7B 3G6YA 4MU3A 5C42B 2Z2MA 3ITHA 2FGCA 1FD2A 2ZC4A 5KFZA 1NDKA 3OLBA 3LA0A 2GA7A 3HDSA 1DLOB 2MKKA 1VYAA 4IS9A 4DN0A 4QW8A 3HJCA 4UOCA 4ELVA 2QA1A 3ULHA 1RYRA 2EPIA 3QWPA 1ROFA 2KJWA 4LF5F 3CWJA 1R8HA 2ZE2B 1DTQA 2ACYA 3T5JA 3Q6NA 5DDPC 1ZTWA 1RCOB 4RX6A 1W26A 4FW9A 1H6KX 4LF5I 2LU2A 4JYAF 4ETXA 3B4DA 2OPPB 4N41A 2V4JA 4LQ9A 2LFVA 5A8WA 3PV8A 2ZBCA 2OFHX 5DM6Q 4JYAI 3TJ8A 1S1WA 3HD1A 4K59A 2YQ1A 3UDCA 4J9RA 3SSRA 3GYXB 2M8DB 4BS2A 4HHUA 2HFOA 2P2CB 2M88A 2IJNA 1SJ3P 2YKNA 4AE5A 2VF3A 3EPGA 2R2SA 2CKWA 5GVQA 2NN6F 4DHVA 5M2PA 4C8NA 1H2TZ 2I8EA 1RCXB 3OT9A 3CIMA 3SV4A 2O67A 4DS5A 4L76A 3OTOF 2GIQA 1T9YA 4WP9A 3T1HE 4USUA 3JYTB 1L3KA 1VIXA 4EYHB 5FDLA 1U1PA 3OTOI 4YOEA 3IC1A 3JAMC 1NJXA 4MJKA 4TY8A 4DPWA 2YTCA 1T8EA 3RBZA 3R97A 1TKZB 1OYEA 5B0FA 2FJWA 4E8UA 2IA0A 1NPRA 5KG0A 4IKAA 5D4PA 3CCZA 2CZ9A 3RJMB 1JQGA 1WSVA 4LCGA 3CC7S 2VQEJ 1H74A 1O0PA 1HYSB 1GMVA 3W5ZA 2MZRA 1RKJA 2ZKUA 5JXSA 3E8OA 4F4WA 5F41A 3M8ZA 2KRBA 2WSEC 4DR7E 1U2FA 4M5HA 4NZ7A 2QT7A 3VAKA 3UHMA 5L3JA 1FDDA 3BGRA 3GLJA 5EDWA 5IS2A 1MWZA 1VCTA 1U0SA 1ZS6A 5JMNA 1JK9B 2LXIA 3NS7B 3CJ5A 3HHDA 3LP1A 2PN6A 4TU8A 3KK1A 4TQRA 4RLEA 3SDEA 1J5EJ 3H4LA 2Z5BA 1G7CB 2UUBE 3ZM7A 3BPSP 1X0FA 2MB0B 2B6AB 2O1TA 4XO0A 2HHQA 1WHVA 1GMWD 2IFXA 2PO2B 1T03B 4DPYA 1N33F 3OUYB 1DTTB 2AZ1A 2DGOA 1QD1A 4RL1A 1MG7A 3GCWP 4B9SA 2P5VA 4MKBA 2CNLB 3J7YI 4IH6A 3A8IA 1Y5IB 2Q43A 4U9RA 1NK9A 1N33I 3GB0A 2R3VA 2HYIB 1BQMA 4NLPA 3ILIA 4DR3E 2HMIB 1WHXA 4C97A 1FRXA 3DD6A 5K36A 4ETZA 4TKTA 2XMVA 2PO1B 4W4MA 1VQ5S 4B3MF 2GX8A 4N7TA 1YDLA 2AYMA 1HARA 4ID5A 1JLAA 5BYSA 1D8ZA 2ZWOA 1N54B 2CQPA 1AW0A 4HYMA 3GONA 4B3MI 2BRLA 5GAEI 4WFBQ 2XMKA 3DRPB 1H3DA 2VFRA 1BQNB 2B5JA 2Q2EB 4NCGB 3C3LA 4DCOB 2Z2ZA 1WDTA 1NXIA 4ICLB 1D9AA 3EGNA 2DRDA 5HK4A 2ZH3A 1M5KC 1N5SA 4DV0J 1UJ6A 1LQ9A 2KYXA 3CEDA 3IM8A 4RUCA 1ZZNA 4F02A 3PRYA 3PIOQ 4YP3A 1B63A 5BR8E 4WTYA 3BDEA 3VQTA 2HKEA 3TWZA 4JI8F 1SV5A 1S16A 1VK3A 4Q43A 1SJ4P 2GGPA 1KIJA 1GXLA 1RT6B 4KGZB 4KO0B 4JI8I 5HJYA 2B7CB 1OPZA 2JZ5A 2M9KA 4W98A 3W63A 4QQBA 5D3GA 3KNGA 3C2PA 1UCNA 4ELUA 1VIOA 3I4HX 1CJUB 1J5OA 2XNQA 4DR2F 1RAIB 4X65E 2XNRA
chains in the Genus database with same CATH topology
4B3TE 1ZM3A 2X7IA 4DUYI 3K17A 1IBLI 4P7AA 2HK3A 2Z5EA 1B62A 4URLA 3PYFA 3Q1QA 4JI3E 4DR1I 1NHJA 3HJCA 4ZVIA 4DUYE 1IBLE 1RREA 3J80Q 4I3HA 3LNUA 2ZM6I 2A2DA 4KQVA 4YHHI 4DR1E 4EMDA 4JI0I 3OTOE 1N34I 4DV0I 2UU9E 1A6FA 1Z0WA 1Z59A 2UXDI 3Q6NA 1USVA 2ZM6E 3ZKDA 4LF9I 4DV6E 2Z5BB 3PYGA 2BM1A 4DR4I 4JI0E 1ZXNA 3B78A 4FW9A 2VQFI 4LF5I 4NXME 2UXDE 4OX9I 4GKKE 3T1YI 1NZ0A 3K85A 4JI4I 4X66E 1XNRE 4XTJA 4B3SE 2CGEA 1FKAE 3P06A 1Z0CA 4JI2E 2X36A 4Z7YA 4HACB 4DR5I 4JYAI 1FWKA 4DR6I 2Z5CA 2V2ZA 1K47A 3QT8A 3J81C 4N3OA 4PU9A 1Z5BA 5LL6R 5FWKA 4K0KI 1OJ4A 2UUCI 2E5LI 1Z5AA 2O1UA 4NXNE 1Z0EA 1KVKA 3B8HA 2VF3A 5LMNE 1IBMI 4K0KE 2UUCE 4DV5I 3B82A 4DUZE 1PVGA 1FI4A 4KHPI 4X65I 2HKJA 2DEJA 2GS8A 4B3TI 5LMUE 4LFAE 1HK7A 2UUAI 4FWHA 1RR9A 3QT7A 3WU3A 3V5RA 1WUUA 4X62E 4KHPE 2HK2A 1FWLA 5FLXQ 5FLXC 4JI3I 1N36I 1Z0GA 4FN5A 2UUAE 4IZKA 1BKNA 4DPTA 2V2QA 2R42A 3T1HE 3QT5A 4AQYI 1HNWE 4GKJI 2V34A 5IWAE 1XMOE 4JI5E 1HNXI 1N36E 3OTOI 2UU9I 1D6TA 2WW4A 1N32E 3JAMC 4AQYE 4GKJE 4DPWA 4M1KA 4PRXA 4DV6I 1HNXE 2LJPA 2HFSA 4NXMI 2ZITA 3CWVA 1N33E 4LF4E 4GKKI 2VQEE 1IBKI 4X66I 1XNRI 1Y4SA 1Y4UA 4JI7I 2O1WA 4B3SI 3ZKBA 2CZ9A 3J7AG 4RPFA 4JI2I 1PIEA 2CG9A 1IBKE 5IT9Q 3D4JA 5IT9C 2E1RA 2PNMA 4Z7CA 1H74A 4IZJA 4JI7E 4FWGA 1HNZE 3LTOA 4YY3I 2HHHI 1KKHA 3WU5A 4UTGA 4DV2E 4DR7E 1UEKA 2HFUA 4NXNI 1N0UA 3HULA 4P52A 4LF7I 4YY3E 3J81Q 4WUBA 2HHHE 2IOPA 1Z0VA 5L3JA 4X64E 1VISA 5LMNI 4R1FA 4DUZI 1Z5CA 4DPXA 1Z0BA 1J5EE 4LF7E 5LMUI 4LFAI 1USUA 2ZBKB 2UXCE 3QT6A 3PYDA 2UXBE 4X62I 1H73A 4ED4A 3H4LA 2Z5BA 2UUBE 3Q6MA 3ZM7A 3ZZTA 5GMDA 3T1HI 1HNWI 4JG4A 2O1TA 5IWAI 1XMOI 4WUDA 1Z0TA 4JI5I 4FWDA 4USMA 1H7UA 1N32I 4DPYA 4MYTA 4HACA 4DU8A 1S4EA 1MG7A 1N0VC 4DR3I 5A2QC 4JI8E 4WUCA 2AJ4A 4DV7E 1EA6A 4JV5I 1N33I 3JAMQ 4LF4I 2R3VA 4LFBE 2VQEI 1ZM9A 3V2UC 4DV3E 4DV4I 4DR3E 2Z5CB 1NHHA 4DR2I 4HXZA 4UT4A 4JV5E 2V2VA 2J7KA 2A2CA 4DV4E 1NHIA 3J80C 1HNZI 4DR2E 4DXLA 1XNQI 1KTVA 4LF8I 2F4VI 3ZZUA 3WU4A 4USKA 1HR0I 4HYMA 4DV2I 3GONA 4B3MI 3ZZ0A 3F0NA 4DR7I 1XNQE 4LF8E 1ELOA 1H7SA 4YHHE 3WU6A 2F4VE 1N34E 2Q2EB 4B3RI 4DV0E 4X64I 1HR0E 4B3ME 1FNMA 3K1JA 1J5EI 4LF9E 1DARA 1EI1A 4DR4E 1MU5A 4IZKB 4B3RE 2VQFE 4LF5E 2UXCI 4OX9E 5BR8I 1QZRA 3T1YE 1MX0A 2UXBI 4DPUA 4DU7A 2DEIA 4JI4E 4JI1I 5GMEA 4PRVA 2XEXA 2V8PA 3LPSA 2BM0A 1FJGI 3PRYA 2UUBI 1I94I 3PYEA 1ZM4A 1XMQI 4LF6I 4DR5E 1B63A 2NPFA 5BR8E 4JYAE 4MYUA 4IZJD 4JI1E 4DV1I 2HKEA 4DR6E 4JI6I 1FJGE 1S16A 1ZXMA 1I94E 2OI2A 1XMQE 2EFGA 2GQ0A 4LF6E 1U2RA 2IOQA 1KIJA 4DV1E 2O1VA 4JI8I 2E5LE 2PNLA 4LFCI 4JI6E 3M6AA 1XHKA 4DV7I 1PKPA 4HY1A 4LFBI 1H72C 4IZJB 4DV3I 1IBME 5A2QQ 4DV5E 4LFCE 2BV3A 3J7AM 1ZM2A 1Y6ZA 4X65E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T E;  1ZM3 A;  2X7I A;  4DUY I;  3K17 A;  1IBL I;  4P7A A;  2HK3 A;  1B62 A;  4URL A;  3PYF A;  3Q1Q A;  4JI3 E;  4DR1 I;  1NHJ A;  4ZVI A;  4DUY E;  1IBL E;  1RRE A;  3J80 Q;  4I3H A;  3LNU A;  2ZM6 I;  2A2D A;  4KQV A;  4YHH I;  4DR1 E;  4EMD A;  4JI0 I;  3OTO E;  1N34 I;  4DV0 I;  2UU9 E;  1A6F A;  1Z0W A;  1Z59 A;  2UXD I;  2ZM6 E;  3ZKD A;  4LF9 I;  4DV6 E;  3PYG A;  2BM1 A;  4DR4 I;  4JI0 E;  1ZXN A;  3B78 A;  4FW9 A;  2VQF I;  4LF5 I;  4NXM E;  2UXD E;  4OX9 I;  4GKK E;  3T1Y I;  1NZ0 A;  4JI4 I;  4X66 E;  1XNR E;  4XTJ A;  4B3S E;  1FKA E;  1Z0C A;  4JI2 E;  2X36 A;  4Z7Y A;  4HAC B;  4DR5 I;  4JYA I;  1FWK A;  4DR6 I;  2V2Z A;  1K47 A;  3QT8 A;  3J81 C;  4PU9 A;  1Z5B A;  5LL6 R;  4K0K I;  1OJ4 A;  2UUC I;  2E5L I;  1Z5A A;  4NXN E;  1Z0E A;  1KVK A;  3B8H A;  2VF3 A;  5LMN E;  1IBM I;  4K0K E;  2UUC E;  4DV5 I;  3B82 A;  4DUZ E;  1PVG A;  1FI4 A;  4KHP I;  4X65 I;  2HKJ A;  2DEJ A;  2GS8 A;  4B3T I;  5LMU E;  4LFA E;  2UUA I;  4FWH A;  1RR9 A;  3QT7 A;  3WU3 A;  3V5R A;  1WUU A;  4X62 E;  4KHP E;  2HK2 A;  1FWL A;  5FLX Q;  5FLX C;  4JI3 I;  1N36 I;  1Z0G A;  4FN5 A;  2UUA E;  1BKN A;  4DPT A;  2V2Q A;  2R42 A;  3T1H E;  3QT5 A;  4AQY I;  1HNW E;  4GKJ I;  2V34 A;  5IWA E;  1XMO E;  4JI5 E;  1HNX I;  1N36 E;  3OTO I;  2UU9 I;  1D6T A;  2WW4 A;  1N32 E;  3JAM C;  4AQY E;  4GKJ E;  4DPW A;  4M1K A;  4PRX A;  4DV6 I;  1HNX E;  2LJP A;  2HFS A;  4NXM I;  2ZIT A;  3CWV A;  1N33 E;  4LF4 E;  4GKK I;  2VQE E;  1IBK I;  4X66 I;  1XNR I;  4JI7 I;  4B3S I;  3ZKB A;  2CZ9 A;  3J7A G;  4RPF A;  4JI2 I;  1PIE A;  1IBK E;  5IT9 Q;  3D4J A;  5IT9 C;  2E1R A;  4Z7C A;  1H74 A;  4JI7 E;  4FWG A;  1HNZ E;  3LTO A;  4YY3 I;  2HHH I;  1KKH A;  3WU5 A;  4UTG A;  4DV2 E;  4DR7 E;  1UEK A;  2HFU A;  4NXN I;  1N0U A;  3HUL A;  4P52 A;  4LF7 I;  4YY3 E;  3J81 Q;  4WUB A;  2HHH E;  1Z0V A;  5L3J A;  4X64 E;  1VIS A;  5LMN I;  4R1F A;  4DUZ I;  1Z5C A;  4DPX A;  1Z0B A;  1J5E E;  4LF7 E;  5LMU I;  4LFA I;  2ZBK B;  2UXC E;  3QT6 A;  3PYD A;  2UXB E;  4X62 I;  1H73 A;  4ED4 A;  3H4L A;  2UUB E;  3ZM7 A;  3ZZT A;  5GMD A;  3T1H I;  1HNW I;  4JG4 A;  5IWA I;  1XMO I;  4WUD A;  1Z0T A;  4JI5 I;  4FWD A;  4USM A;  1H7U A;  1N32 I;  4DPY A;  4MYT A;  4HAC A;  4DU8 A;  1S4E A;  1MG7 A;  1N0V C;  4DR3 I;  5A2Q C;  4JI8 E;  4WUC A;  2AJ4 A;  4DV7 E;  1EA6 A;  4JV5 I;  1N33 I;  3JAM Q;  4LF4 I;  2R3V A;  4LFB E;  2VQE I;  1ZM9 A;  3V2U C;  4DV3 E;  4DV4 I;  4DR3 E;  1NHH A;  4DR2 I;  4HXZ A;  4UT4 A;  4JV5 E;  2V2V A;  2J7K A;  2A2C A;  4DV4 E;  1NHI A;  3J80 C;  1HNZ I;  4DR2 E;  4DXL A;  1XNQ I;  1KTV A;  4LF8 I;  2F4V I;  3ZZU A;  3WU4 A;  4USK A;  1HR0 I;  4HYM A;  4DV2 I;  3GON A;  4B3M I;  3ZZ0 A;  3F0N A;  4DR7 I;  1XNQ E;  4LF8 E;  1ELO A;  1H7S A;  4YHH E;  3WU6 A;  2F4V E;  1N34 E;  2Q2E B;  4B3R I;  4DV0 E;  4X64 I;  1HR0 E;  4B3M E;  1FNM A;  3K1J A;  1J5E I;  4LF9 E;  1DAR A;  1EI1 A;  4DR4 E;  1MU5 A;  4B3R E;  2VQF E;  4LF5 E;  2UXC I;  4OX9 E;  5BR8 I;  1QZR A;  3T1Y E;  1MX0 A;  2UXB I;  4DPU A;  4DU7 A;  2DEI A;  4JI4 E;  4JI1 I;  5GME A;  4PRV A;  2XEX A;  2V8P A;  3LPS A;  2BM0 A;  1FJG I;  2UUB I;  1I94 I;  3PYE A;  1ZM4 A;  1XMQ I;  4LF6 I;  4DR5 E;  1B63 A;  2NPF A;  5BR8 E;  4JYA E;  4MYU A;  4JI1 E;  4DV1 I;  2HKE A;  4DR6 E;  4JI6 I;  1FJG E;  1S16 A;  1ZXM A;  1I94 E;  2OI2 A;  1XMQ E;  2EFG A;  4LF6 E;  1U2R A;  1KIJ A;  4DV1 E;  4JI8 I;  2E5L E;  4LFC I;  4JI6 E;  3M6A A;  1XHK A;  4DV7 I;  1PKP A;  4HY1 A;  4LFB I;  1H72 C;  4DV3 I;  1IBM E;  5A2Q Q;  4DV5 E;  4LFC E;  2BV3 A;  3J7A M;  1ZM2 A;  4X65 E; 
#chains in the Genus database with same CATH topology
 4LRB A;  1U25 A;  4EZ6 A;  3L7Z B;  2CPE A;  4LCF A;  2CAJ A;  2HVE A;  5IC6 B;  5HP1 B;  3FSI A;  2MHN A;  3FCV A;  3RW6 A;  3N6M A;  4KY3 A;  1S12 A;  5KG3 A;  2QFJ A;  3KLG A;  3J7Z 5;  3MUM P;  4WIQ A;  4ZVI A;  1E6V A;  2RVJ A;  3OVS A;  3W8P A;  2M8H A;  2BBE A;  2JT2 A;  1YTY A;  1P27 B;  1Z0W A;  5ETT A;  1TL7 B;  3AY0 A;  3CUL A;  4EI2 A;  3VTI A;  1BQX A;  2WHO A;  1HNI A;  5K5M A;  2W8K A;  2QSF A;  2CPJ A;  1URR A;  4TYB A;  3GG0 A;  3H5U A;  4QR1 A;  3RAQ A;  2FHO B;  2CPD A;  2ADC A;  4LPF A;  2QTW A;  1TMM A;  3NGT A;  4ER8 A;  4PG6 A;  5LSO A;  2B9X A;  1HPZ A;  2B7B B;  3W62 A;  4O44 B;  4K2J A;  4CCH A;  2PI4 A;  1JLC A;  2XZT B;  5AJ3 F;  1S1V A;  3CCE S;  4DG1 B;  3OXL A;  4NPO A;  3I0R B;  4QNK A;  1RHU B;  3SQO P;  3UD4 P;  1KD1 T;  4OZ0 A;  5L9N A;  3PXG a;  2ZNZ A;  3DLH A;  3DM2 B;  2UVV A;  2XMJ A;  5BYQ A;  1Q16 B;  4CYU A;  2GQC A;  4CP5 A;  3A13 A;  3PO4 A;  3GJQ B;  2C28 A;  4CT9 A;  3DOL A;  1OY6 A;  4WBF A;  2HZC A;  2QLJ B;  1HNW E;  2A0F B;  4DV6 F;  2ASL A;  2OJ3 A;  3HFZ B;  4ECW A;  3BR8 A;  2AYG A;  1ZH5 A;  4KGK A;  3BGF A;  4B3S F;  4DV6 I;  1VBK A;  2PO4 A;  1SKR A;  1T9W A;  2GZO A;  3MED A;  4OZN A;  3KG4 A;  1IBK I;  1REG X;  4XPC A;  4C8M A;  4B3S I;  3JTP A;  3J7A G;  2DGV A;  3OQ2 A;  2B4V A;  1YWX A;  1SC4 B;  2XCA A;  3CJS A;  1HNZ E;  3DCA A;  4R5P A;  3WU5 A;  2XMW A;  2OH2 A;  1CUL A;  1A9N B;  3F44 A;  4P52 A;  1VDH A;  3KFW X;  4ZLN A;  2HHH E;  2WON A;  1TKX B;  1SL1 A;  1RT3 A;  3HLU A;  1RWO B;  2FLP A;  4RW8 A;  4ES2 A;  1FJC A;  4USJ C;  2MMY A;  4U3D A;  3L7U A;  5KFF A;  3RZA A;  3FCH A;  3I32 A;  3PW0 A;  1EQM A;  4CLT A;  1WKK A;  4O4R A;  4ED4 A;  3VVU A;  2DBB A;  3TAR A;  3PZP A;  2VES A;  2UXC J;  3ELH A;  1C4A A;  4OI0 A;  2DR6 A;  3W64 A;  1V3R A;  3RGI A;  4NE9 C;  2LDI A;  4Q2M A;  4ANC A;  4TN2 A;  4P73 A;  1Y5L B;  2WRM A;  2GQQ A;  3RBX A;  4YN3 B;  1G1X A;  3CJK A;  1LWE A;  3KLH A;  2IJF A;  2NXJ A;  2RKI A;  5DRO A;  1LWC B;  2W9C A;  3MEE B;  2OGU A;  1NDP A;  5KAK A;  1GT8 A;  1V6H A;  1TL3 A;  2EFN A;  2MYF A;  4URS A;  3H2L A;  2BA9 A;  4CO4 A;  1RT1 A;  1RWP B;  3K8V A;  1SUQ A;  4IRK A;  2HEK A;  5EUH A;  4OI2 A;  1U1N A;  3IR6 B;  4DXL A;  3IWX A;  1DBD A;  3DXS X;  4LF8 I;  4BA1 B;  2CFX A;  4LSL B;  4YY3 F;  2CQC A;  4GRS A;  3HHK A;  2JLG A;  1P1T A;  3KLV A;  1SIW B;  2DRB A;  3ILL A;  3NS5 A;  1YHC A;  2UV8 A;  4IFD F;  1B70 B;  3HT3 A;  1VHI A;  3RTV A;  2R7U A;  4BBY A;  3V6D A;  3DC2 A;  3SIP B;  4HEA 9;  1PYS B;  4KB7 A;  1FNM A;  3V81 A;  4NI2 B;  5IZH A;  1HD1 A;  5A6P A;  5EWG A;  4IDK A;  4CIO A;  3GYN A;  3PEH A;  4J9Q A;  3RW7 A;  1QZR A;  2FLL A;  5LL6 d;  2HQC A;  1GXT A;  3KHR A;  3TVK A;  2OSQ A;  4OX8 A;  4OYO A;  3BO2 A;  3W2V A;  4FXD A;  3D1Q A;  4DF8 A;  3MAA A;  1ZXM A;  1I94 E;  3MAQ A;  3CO9 A;  4DR5 J;  5ETM A;  2A6M A;  4JI6 E;  3OR2 A;  2CYY A;  4JV5 F;  3BQ1 A;  2BYC A;  3P3D A;  1IBM E;  1R6L A;  3HVT A;  3I5C A;  5CD4 A;  4B3T E;  3A8E A;  4B9U A;  3QFH A;  1S7I A;  4KPC A;  4EZ9 A;  3OTC A;  5K36 E;  2HVI A;  4RW4 A;  2VBW A;  3VHQ A;  3CF5 Q;  4TU9 A;  1X4C A;  3AOD A;  3R3T A;  3KDO A;  5DO2 A;  5DET A;  2K06 A;  4M5G A;  2O01 C;  4LRF A;  3ICL A;  1CS4 B;  1NJY A;  2BR0 A;  1ZA1 B;  2J76 E;  4NXM E;  2KZM A;  3MR3 A;  1NZ0 A;  5I42 A;  2VA3 A;  4J9L A;  2R7Q A;  1TKD A;  1S48 A;  4Z37 A;  3I6P A;  3LP2 B;  4LUB A;  5DNL A;  2J5A A;  3FFI B;  2VPX B;  2WBM A;  4EBE A;  4FS2 A;  3D0I E;  1K47 A;  4JI2 J;  4EYI B;  4M5N A;  1FTR A;  3SBM A;  3EWG A;  3HF5 A;  1FRK A;  3Q8Q B;  3IP0 A;  2WB1 D;  2DGX A;  4K0K I;  4H4M A;  1TVR B;  3UPF A;  1U2C A;  1FEH A;  3M8Q B;  3EGZ A;  3D2W A;  4CO0 A;  2BE2 A;  2WP8 A;  1TL1 A;  2YWE A;  4ZPA A;  2ILY A;  4BWM A;  4U6P A;  5D4L A;  4H54 A;  1IM6 A;  2C1E B;  3T19 A;  1U48 A;  2UUT A;  1WUU A;  4X62 E;  3RYL A;  4CRJ A;  1HL6 A;  3IXQ A;  1SKU B;  5I3U A;  1RT7 A;  2B4O A;  4UY8 T;  2YNH B;  4AL6 A;  2UU9 F;  4IZK A;  3LGH A;  3QRQ A;  4ERD A;  2CZ4 A;  3M1V A;  5J2M B;  4EEY A;  3L09 A;  4KFB B;  4GKJ I;  4P2X A;  4DV5 J;  4KHP J;  5E3Q A;  2SXL A;  1XWL A;  2F9J A;  2BR2 A;  2UU9 I;  1Y7P A;  2CA9 A;  1RTI A;  4ES1 A;  2XS2 A;  4JP8 A;  5J1E A;  5CZX A;  2RD5 C;  2BAN A;  1PYO B;  3TA0 A;  3DMJ B;  4JI3 J;  3W66 A;  3MUV P;  2KYZ A;  2ZIT A;  3Q24 A;  2IYI A;  2MJU A;  3P5B P;  2OSR A;  3BBF A;  1L3U A;  4RR5 A;  2DHH A;  2MSS A;  4C0B A;  4M5I A;  2VPY B;  2NXE A;  3FEX B;  3H1C A;  3U27 A;  3SCL E;  2VG5 B;  1AZS B;  5F8L A;  2YNI B;  3W7B A;  2DH9 A;  3H5Y A;  1UVN A;  1LFW A;  1NKE A;  3CMQ A;  1XNR J;  5J2M A;  1UVK A;  3G71 S;  4DUZ F;  3ETO A;  2BW7 A;  2HQD A;  2N4D A;  2X1G A;  2WOM A;  3LAM A;  3IBF B;  4ILR A;  2EC0 A;  1C1B A;  3ISZ A;  1Q8I A;  3AD8 C;  4DUZ I;  3MUR P;  1S97 A;  2R8J A;  1OQ3 A;  1CJK B;  4RBU A;  1SKW A;  3EVM A;  4UST A;  1USU A;  2CPZ A;  2HWI A;  2B56 A;  3QSY B;  4A8F A;  2YQ3 A;  5DJB A;  4O3N A;  3AQO A;  1N6Q A;  1OSD A;  2BKP A;  2YPZ A;  2XTJ P;  5D8H B;  3MM5 B;  5GMD A;  5H9E J;  2DIV A;  2R7X A;  5KFG A;  3TA1 A;  5F3T A;  2OEJ A;  4WU2 A;  1Q53 A;  4ZVO B;  4OX6 A;  2VOD A;  4FWD A;  4RW9 A;  3HHL B;  3GCM A;  4P9S A;  1HFE L;  2VQE F;  2A10 A;  4TLQ A;  3JTO A;  1ULR A;  5AXM A;  2JEG A;  3MEK A;  1Q8L A;  4Y2K A;  3HSD A;  2LCW A;  3DRR B;  3HHE A;  2VQE I;  4UZB A;  2CQD A;  1TAU A;  3V2U C;  4DV3 E;  2KKH A;  1TEL A;  4NLY A;  2RRB A;  3VAL A;  2NZC A;  4LFB J;  4N47 A;  3VV2 B;  3ADA C;  4Y00 A;  3MM8 A;  1M5O C;  4DV4 E;  4X4Q A;  1UDS A;  1TZ0 A;  1FT8 A;  1XR7 A;  1U09 A;  4TXS A;  1ELO A;  1J5E F;  1FVS A;  1H7S A;  2FLN A;  2CJY B;  1H2V Z;  4RO0 A;  3HM9 A;  4B3R I;  4NEZ A;  1C0T A;  3TQE A;  2L3M A;  2AYB A;  1J5E I;  2K7K A;  2AMC B;  5B0E A;  4DBQ A;  3G8T A;  2E29 A;  4OV1 A;  2JRS A;  4LF9 J;  1JNZ B;  4X4T A;  3UCZ P;  1KQG B;  2MLZ A;  4OYA A;  2Z8Q A;  4LF6 I;  2JFD A;  4KKO B;  4P2F A;  2W2P P;  4FW7 A;  4K4U A;  4ZVH A;  3FZB A;  4EBC A;  2KDO A;  2PMZ D;  1FJG E;  2OI2 A;  1KEK A;  1APS A;  3QAU A;  3M2R B;  4X4V A;  3MI7 X;  4QIW D;  3R9L A;  2HWT A;  2Y8Y A;  2NXU A;  3SSQ A;  2RS8 A;  4OX7 A;  2FHJ D;  3VAG A;  4Y28 C;  4IO9 Q;  2LMI A;  3MEG B;  4U7C A;  1NK5 A;  5KFR A;  4PPD A;  4WE1 A;  3MPU B;  2FHK A;  2N7C A;  3LWL A;  3MM6 B;  3LGM A;  1WOP A;  3P8B B;  5C25 B;  3K17 A;  3FCW A;  1ZET A;  3BGO P;  4ZVR B;  4J91 A;  1PCA A;  3ZZZ A;  2AD9 A;  2LQ5 A;  3WIV A;  4DV0 F;  1NHJ A;  2NN6 A;  5L8R C;  1IBL E;  1MN7 A;  4PUO B;  2XQC A;  3LNU A;  4KYZ A;  4Y2I A;  2E7X A;  5KFH A;  4OV6 A;  4DV0 I;  1YQH A;  2BJ3 A;  2W25 A;  2BM1 A;  1NM2 A;  1HHQ A;  4LR9 A;  4B9V A;  4UQG A;  3TAN A;  3EVW A;  1WOO A;  2QMW A;  2R7V A;  2Q1L A;  1FKA E;  3CDA A;  4O0N A;  1RTD B;  5K36 D;  3KUE A;  6AT1 B;  3EGW B;  1RAG B;  2DNP A;  2JC1 A;  3CCV S;  4G6V B;  1ZAX A;  1UKU A;  3M2V A;  2ZHB A;  3ILO A;  1OJ4 A;  5B0A A;  2E1C A;  4Y65 A;  3WC0 A;  1S10 A;  2AJ0 A;  2I5J B;  4C11 B;  2GV1 A;  1PJ6 A;  5DDQ C;  4LFA E;  1D0E A;  2N3O A;  5KOX A;  5AXN A;  3TZW A;  5CD4 H;  1RR9 A;  4M95 A;  1VQL S;  4Q45 A;  2HGN A;  3HKW A;  1C2P A;  5G0R A;  4KPY A;  4CO3 A;  2YBV A;  2M3D A;  1HNX F;  1IUJ A;  1E3P A;  4RW7 B;  3RB3 A;  3DYA B;  1RK8 A;  1Z0G A;  1VBX A;  2UUA E;  1NEE A;  3IMQ J;  5A0Y A;  2V2Q A;  2GNK A;  5LXY A;  1S0V A;  3MM9 A;  4FPR A;  2V34 A;  4FBT A;  2V8D A;  1XMO E;  4JI5 E;  1HNX I;  2V94 A;  1X4A A;  4ZVP B;  1IKV A;  3ZNJ 1;  2XGQ A;  2DHX A;  2CQI A;  3T1H J;  2OTL S;  3MR6 A;  1Q7Y T;  1V5V A;  3RAM A;  2I1R A;  4QIG A;  3Q8V A;  2E44 A;  1JLE B;  5IQQ A;  2HFS A;  4PXE A;  3O6Q A;  1VQ9 S;  3CB4 A;  2ZUG A;  1PJ7 A;  4RNO A;  4ED5 A;  3IO1 A;  2W24 A;  1Y4S A;  3U1K A;  1VMB A;  3GV7 B;  2DXF A;  3BGL A;  4DQQ A;  4NAS A;  4W92 B;  3GFZ A;  5DLG A;  3D4J A;  4ILL A;  2QZ8 A;  3CDJ A;  1KQK A;  4CLK A;  1X31 C;  3LTO A;  2HGM A;  3TW0 A;  4I56 A;  1DY3 A;  2XM3 A;  4I68 A;  2NZ4 A;  1C0U B;  4O4G A;  2RRA A;  1WWH A;  3MPW A;  2DHS A;  2O3Z A;  4PG7 A;  1YBA A;  2M5Y A;  4OYZ A;  4DR7 J;  1JMT A;  3KRN A;  3PHT A;  2BA1 D;  3D6F B;  5F9L A;  2ZBK B;  2Q6C A;  5KFY A;  5HAT A;  2Q3P A;  2D74 B;  4FF1 A;  4NLX A;  5IM0 A;  4NXN J;  2X3D A;  2IDL A;  4LCH A;  1N32 F;  3M32 A;  4GO7 X;  3MMB B;  2YKQ A;  3HSJ A;  1N32 I;  2ZH5 A;  3TI0 A;  2HVD A;  2CVI A;  1WKL A;  2HVH A;  5HQL A;  2UUW A;  3QAT A;  3BH7 B;  1HBO A;  3RG6 A;  2G1H A;  3DOM A;  2IC3 B;  3VVT A;  3A3O B;  2NSC A;  3D1H A;  5KOW A;  2Z5C B;  4BC9 A;  1OSC A;  1T02 A;  3SQG B;  4PAB A;  3A8K A;  3SFU A;  1JLB B;  2XHW A;  4IFV B;  2KHC A;  3LO3 A;  5KFE A;  2VG6 B;  2FB0 A;  4DR3 J;  1WC0 A;  1XNQ I;  2NQP A;  3DI6 A;  3D6M B;  2ZBQ A;  4X84 A;  3WHI A;  1QJH A;  3CJR A;  3PRD A;  4OQJ A;  3DU5 A;  2PDA A;  3ZZO A;  4LSZ B;  2Y1R I;  1N34 E;  1R31 A;  5H9E K;  9RUB A;  4U7U D;  1ZAW A;  2UXC F;  3BBB A;  4DSF A;  2EI5 A;  1ACM B;  4R8U A;  5D6G A;  1DAR A;  4DL7 A;  1GK8 A;  3Q83 A;  1F0X A;  2LVW A;  2ZH4 A;  2UXC I;  3BSN A;  1RTH B;  1R8A A;  4JI1 I;  1Z1Z A;  4YR3 A;  2DR9 A;  3L7P A;  2PFF B;  4ZN1 A;  3MD1 A;  2ZJP Q;  5K8P A;  4IG3 B;  1V9O A;  1HI0 P;  3FDS A;  4DV1 I;  4NLS A;  2ZZT A;  3HT0 A;  2ZUA A;  2XMA A;  5BR8 J;  3CCW A;  1IQZ A;  5ETO A;  1OY9 A;  2VBZ A;  1IKW A;  2RT3 A;  1N48 A;  3P49 B;  1QAI A;  2U2F A;  1Y6Z A;  4IYQ A;  2OPS A;  4G1I A;  1TL5 A;  4OI1 A;  2FVQ A;  5MLC V;  4WCE Q;  2HQF A;  2DIT A;  1IJF B;  4NRU A;  1JKH B;  5KFM A;  2BMB A;  4G1Q B;  1OYR A;  4IR1 A;  2OKQ A;  3HFV A;  2EKN A;  1IBC B;  3HI9 A;  4DR1 I;  4JI0 F;  3W60 A;  2HRT A;  3OVB A;  1OPI A;  1UWB A;  5MAO A;  4FP9 A;  3LUY A;  2OPR B;  3GYG A;  3TJA A;  4JI0 I;  2Q79 A;  2VQF F;  1NK8 A;  5CCM A;  4KGM A;  3HFK A;  3CW2 C;  5DRK A;  2JEB B;  3DLE B;  3UN3 A;  1HQE A;  1S9E A;  4EO8 A;  1B0V A;  2ZDP A;  2VQF I;  4NLD A;  1WEY A;  4WTO B;  2Y0S D;  4DR5 F;  3QWU A;  1FRI A;  2DCU B;  4CH7 A;  3POT A;  4DR5 I;  3TUP A;