3PYEA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
301
structure length
301
Chain Sequence
b'MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
total genus 86
structure length 301
sequence length 301
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyeA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyeA01
4DPUA 4LFAE 4DR6E 4DU7A 1H72C 1Z0WA 1XNRE 1B62A 5IT9Q 2OI2A 2V34A 4HXZA 1MX0A 1N34I 1VISA 2HK2A 3LPSA 4LF4I 4DR5E 1N32I 1BKNA 3WU4A 1FWLA 2VQEE 1XMQI 1KKHA 2UUBI 4LFAI 2HKJA 4DPWA 1U2RA 4GKJE 4UTGA 1ZM2A 4K0KE 1Z0EA 4FN5A 4JG4A 3T1YE 4JV5I 1HR0E 4PRXA 4DUYE 4LF9E 4JYAI 4HY1A 4KHPE 4JI1I 1PVGA 4KHPI 2E5LE 2UUBE 4PRVA 1J5EE 1N0VC 4DR1I 4DR7E 4DV0E 1FJGI 2HK3A 2UXDE 4DR3I 1H73A 4B3RI 2VQFI 2UXCI 1Z59A 5LMUI 4MYTA 1NZ0A 4USMA 1MG7A 2V2QA 3K1JA 4JI3E 1XMOI 4DR2E 4USKA 2E5LI 4NXNE 4DR2I 1N32E 1Z5AA 1A6FA 4LF9I 1RR9A 2ZITA 4DUYI 1Z0BA 3CWVA 2XEXA 1XNQE 3JAMQ 4YHHE 1Z0GA 3ZKDA 1XNQI 4DV1E 4P7AA 3K17A 2UUCI 4DV5I 4DV5E 4JI2I 4AQYI 4LF6I 4X66E 4X66I 4JI5E 1XHKA 1Z5CA 5LL6R 1ZXMA 4DV7E 4HYMA 2EFGA 5BR8E 1HR0I 1OJ4A 1HNZI 4JV5E 2HKEA 5BR8I 2DEJA 4YY3I 5FLXC 4ZVIA 3T1HE 1RREA 3ZKBA 1N33I 3JAMC 2F4VI 3J7AM 3B8HA 1J5EI 1ELOA 2E1RA 1FNMA 3V2UC 1H7UA 1PIEA 3J7AG 1EI1A 4DR5I 2A2CA 4HACA 4LF5I 1MU5A 4HACB 4UT4A 2UUAE 1IBKI 1HNWI 4NXNI 4R1FA 1NHHA 5IT9C 5A2QC 1IBLI 2VQEI 2UXCE 4Z7YA 4FWGA 4NXME 4KQVA 1IBME 3QT7A 1IBKE 1WUUA 4DV3E 4OX9E 2X7IA 1B63A 4JYAE 4LF7I 1XNRI 4LFCE 3LNUA 4DR6I 5FLXQ 2F4VE 4DV4E 1ZM4A 1S4EA 2HFSA 3HULA 1N36I 2UU9E 4GKJI 1UEKA 2VQFE 1H7SA 2AJ4A 4JI6E 4LFBI 3WU3A 4X65I 4AQYE 2ZM6E 4DV2E 3F0NA 4DXLA 4M1KA 4DPTA 4X62I 1FKAE 4DR4E 1FWKA 1DARA 4JI4I 5GMDA 3OTOI 2R42A 4WUDA 4GKKI 2GS8A 1D6TA 2WW4A 4Z7CA 2ZBKB 4RPFA 3WU5A 3PYDA 1Z0VA 1HNZE 4X65E 4X64I 3PYFA 4LF8E 1ZM3A 2UUAI 1XMQE 3OTOE 4MYUA 4JI8I 4DV1I 1S16A 5LMUE 4DR1E 4B3TI 4NXMI 2UXBI 1NHIA 1ZM9A 4EMDA 2UU9I 4DUZI 2CZ9A 2X36A 1XMOE 4XTJA 4OX9I 4JI5I 2HHHI 5LMNI 1Z0CA 1K47A 4DU8A 2VF3A 4YY3E 2BV3A 3T1HI 4K0KI 1QZRA 3B82A 4DR7I 1HNXE 4YHHI 3V5RA 1H74A 4JI4E 4LF8I 3ZZUA 4LF7E 5IWAE 2Q2EB 4DUZE 2UUCE 3M6AA 3ZM7A 3QT6A 1NHJA 3D4JA 2UXBE 4LFBE 1FJGE 4B3ME 3QT5A 4P52A 4B3MI 3H4LA 2BM1A 4DPXA 4WUBA 3ZZTA 4DV7I 4DV0I 1I94E 1IBLE 4LF4E 4JI3I 4I3HA 5IWAI 5A2QQ 3QT8A 1KVKA 1N33E 4JI8E 4JI0I 4JI7I 1Z5BA 4DPYA 1Z0TA 4JI7E 5GMEA 2V2VA 4DR3E 3J80Q 2HHHE 5LMNE 4FWHA 4FWDA 3PYGA 4JI2E 1I94I 4DV6I 3B78A 4B3SI 4DV2I 4B3SE 3T1YI 3LTOA 4LF6E 4PU9A 4B3RE 2NPFA 4X64E 3PYEA 1N34E 2J7KA 4DV4I 2HFUA 4LF5E 4JI6I 1IBMI 1ZXNA 4LFCI 4WUCA 4URLA 5L3JA 4B3TE 1EA6A 1FI4A 1KTVA 2V8PA 2V2ZA 1PKPA 4X62E 4DR4I 4GKKE 2BM0A 1N36E 1N0UA 2A2DA 4JI0E 3J81Q 2UXDI 3WU6A 2DEIA 3Q1QA 3ZZ0A 3J80C 1KIJA 3J81C 2R3VA 1HNXI 4JI1E 4ED4A 4DV6E 2ZM6I 4FW9A 2LJPA 4DV3I 1HNWE 3GONA
chains in the Genus database with same CATH superfamily
2KU7A 4EYIB 2OJ3A 1WG4A 3K0JA 3AFGA 4C4WA 4DR3F 2XI3A 2XS2A 1IBKJ 3MR5A 3MGJA 3ZZRA 4OO1E 2PA3A 2A1BA 5EWGA 1M5PC 1U1PA 2KB2A 4DFKA 3JYTA 2WNRA 1XNRE 2D9OA 1MLAA 1UDNA 3CJ0A 1OO0B 2APOA 2EFQA 4KYZA 2W9BA 5HVHA 1PSDA 1XNQF 1MX0A 5M2UA 2J9EA 2HFOA 2A10A 4CP5A 2AYGA 2HHVA 3NS6A 4JI8F 3R3TA 1Y0HA 2I6WA 1N33J 2JEGA 3BYRA 1HK7A 3D2WA 1KFDA 5ETKA 2CJBA 2W7PA 1N5QA 3SFUA 1OYRA 1NLKL 3L7ZB 3LPSA 4USHA 1SL0A 1EQ0A 1S6PA 1DTQB 1ICEB 1RWKB 2DNPA 2KKHA 3QIPB 4DR1J 3VCDA 1M0SA 2D3O1 5JEAA 5IS2A 3AD9C 1NU4A 4W90B 3R6GB 4KTQA 4PWDB 4EK2A 7FDRA 1JXEA 1JIHA 2C3OA 4MT1A 4LFAF 1NKCA 2OPRA 2C39B 2PO1A 5HBMB 2QO3A 4N5SA 1BKNA 3WU4A 2DNGA 1X4EA 2IJNA 2JZ5A 3QO9B 5A2QU 4U67Q 3BO4A 2R7OA 3SI8A 3W2VB 1MMLA 2HKJA 3UCZP 5J2NB 1U2RA 3OTEA 3O44A 1NH8A 4USUA 3OTBA 4ZVQB 3TZXA 3IRXA 2QJ3A 1FD8A 3I6PA 2XYPB 3KOAA 2UXDJ 3MMAA 1NJWA 4L74A 1D1UA 4B9TA 4KFBB 1J2VA 2A6MA 3B6BA 3SCJE 1ZM2A 2P9GA 5HJYA 3PDNA 2KT3A 4QR0A 2Q6CA 4IH6A 1HBOA 2BRLA 4J9NA 5KFFA 5E7OB 4XPCA 2XMKA 4PUOB 1Z0EA 2ZKUA 3Q2SC 1T9TA 3CD5A 1HR0F 2DO0A 2OKQA 4NLXA 1RDRA 2MZJA 4FP9A 1CJKB 4IFDF 1QVGR 3RAXA 4LF9E 1HNIA 4KHPE 3VGUA 1F5CA 3A8KA 1RA6A 2PD1A 2ROEA 3HHLA 5CYMA 2NR0A 1OYSA 3H5UA 2E5LE 4BWMA 5C25B 4WFAQ 1NDKA 5BR8J 2UV8G 2EBGA 2UUBE 2ACMA 3I32A 3PS3A 1J5EE 2KXFA 3T41A 1OPIA 3KHHA 4DR1I 5KG4A 4AQYJ 1BWVA 4UOHA 4ILMA 1AT1B 1JNZB 2RE1A 2UXCF 4H4KC 2UUCJ 1FJGI 2DTJA 3RBDA 4S0MA 1VRTA 2Z30B 2BKPA 5F8GA 4Q2LA 3L95X 1JKHA 4LSNB 3Q8SB 2XSJA 4AYBD 1TKXA 2MKKA 1NUEA 4JI4J 4ZN1A 5F8LA 3T5HA 1FRIA 1HWJA 4G1IA 4P2SA 4MYTA 1LFPA 5L46A 1K73T 3ZNUA 2G0IA 4HI1A 1QSSA 1VBKA 1NZ0A 1HFEL 3GFYA 3GYXB 3MD3A 2QEXS 2E1MC 1R0CB 4M5KA 5AT1B 1HMVB 4IYQA 2BQUA 4DR2E 1R8HA 3LGMA 1HIYA 4MKVA 5KFKA 4QWDA 4DV0F 1R6LA 2OPPB 3KLEA 1DLOA 2HQ3A 3THPA 2ZITA 4LF9I 2D7SA 4M5HA 4OLOA 2Z5BA 2UUTA 4ILRA 4B3SF 2NN6D 3JAMQ 4YHHE 1R3NA 3NKYA 4NXMF 3SFGA 3GR1A 1ULRA 2X1AA 3MHYA 2JOQA 1RTDA 5H9EK 3NZKA 4ID8A 1A6LA 3FMWA 3W2WB 1VJQA 2RJZA 5EUHA 2AGPA 1VQOS 1YBUA 4OJHA 1UA0A 3Q8UA 4K4TA 1G4CA 2GW8A 1T05B 4OX9F 3RTVA 3SV4A 3T1AA 5GAHU 4JI2I 4NCBA 2CYYA 2BE2A 5C24A 4YDDB 1G1XA 4AQYI 4LF6I 2CJQA 2KTQA 4Y2IA 2A6OA 4RW4B 2OUGA 5ETVA 3MDFA 2AJQA 1ZAVA 1S0VA 5DRRA 4H54A 3PR5B 3A8IA 1XNQJ 4U8VA 1S99A 1Z5CA 3AB4B 5HI7A 2VG6B 3TOQA 5KG2A 1HPZB 2H3EB 4ECQA 4JI8J 1YSJA 1DAXA 2EFGA 3TZYA 3CT9A 1N33F 4JV5E 4ED6A 2NXJA 1YJRA 4C0OC 4DI6A 1PYSB 4RUCA 3T1HE 1S7HA 4CYUB 3UCUP 2XS7A 3ILLA 1FNXH 1NDLA 4KH0B 5D15A 2DNKA 3J7ZT 1N33I 4X84A 2V9WA 1EKSA 3BGRB 4KSEB 1PAEX 5T7LA 4LFCF 2CIMA 3J7AM 3GMEA 4OI0A 2RRNA 4C7QA 3IG1A 1FNMA 4XO0A 1UPPA 2HEKA 3VAMA 5C0XA 4DUZE 3MM6B 2PSZA 5KFBA 2YH1A 2E1PA 4DS4A 3CMES 4ATNA 1HLWA 3M6VA 3RRKA 5K8PA 5KFJA 3H2VE 4O23A 4TVAB 4Y00A 3Q8QB 2GHPA 3U7JA 1PIEA 2HIQA 3G6ES 1EI1A 4OX7A 3Q2TC 1JLFA 2ZZMA 1S0OA 3UO0A 3PO5A 2MTLA 3J7A1 2A2CA 1R6YA 3VQSA 1U47A 1IKWB 4LF5I 3PJXA 1KFSA 2XNQA 1Q4RA 1T94A 2QLWA 1BD6A 2DBBA 2YWWA 3CMQA 3NGRA 3QSIA 5KFVA 5CA5A 2RHQB 4F4AA 1U1QA 1HHTP 3PY8A 2C39A 3BF4A 3TUIC 2NN6F 5C0XE 2BRKA 5BJRA 2CZVC 1HNWI 4M5LA 1U1MA 4JYAJ 1Y5NB 2HQCA 3CC4S 4LF5F 2GVZB 1HR0J 5G4DA 1Q8IA 3HKMA 1S6PB 1S0NA 1Q78A 2FZCB 4FKXA 4IFDB 1VQLS 1SQFA 3QGGA 5D0EA 5KFIA 1WHYA 3D6HB 2DCLA 1JLCA 2XMJA 3PX4A 5EX3A 2BX6A 2ZE2A 4CO0A 2NN6C 3WX4A 3MM7B 3QLHA 1RTJB 2DITA 3KHGA 3NXZA 2OHDA 3SMZA 4YMEA 1H2UX 2HS0A 2JLGA 1DFDA 3JTOA 3RBZA 2UXCJ 4CNZA 3MR2A 4DCPB 3PZPA 1OIAA 4ICLB 5L1KA 1JJ4A 2Z8QA 4PXCA 2B6AA 1J5OA 3SBMA 4XK8C 3US5A 1B64A 1IBKE 1FHTA 3DRXA 1IBME 1B0PA 4JB8B 1TP7A 3WIVA 4CWBA 4LF7J 1E3PA 2VPWB 3M30B 4EGLA 4OX9E 4FF1A 1S48A 2I38A 2HQFA 1WEZA 1RKJA 4P74A 1U4BA 2HVHA 1LWCB 2XGPA 3DFEA 3UN5A 1O51A 3UFCX 4NLWA 3JSBA 4RR5A 1WC6A 2F8MA 2W25A 3EZ5A 3SV3A 3OL9A 4LFCE 1UZDA 4K5RA 1D9DA 1N32F 1SJRA 1HNZJ 3K5OA 3BN4A 2YWKA 1TQLA 2YNIB 4I7FB 3KK3A 2I8EA 5HQLA 5LXRA 2GO3A 2LEPA 1V3RA 1REVA 3DI6A 4K50A 5B09A 4DS5A 2BBEA 3C16A 1ZH5A 3N6LA 1DURA 2EK1A 5A8KA 1VDHA 3HULA 4NMXA 4QWAA 4NXMJ 2WRMA 3G82B 4I6YA 4W92B 2HGMA 2YWHA 2HNYA 3QLHB 3Q23A 4GKKJ 2FHJA 2VQFE 3PTWA 2WOMA 1TUWA 3WDOA 4K4WA 1BE4A 3OL8A 2HMIA 1UDQA 2NYHA 3ITHB 4X4PA 2YY3A 4Y2AA 5LJ5Y 3PW2A 3CIMA 4FNIA 4ENOA 2XBPA 1T9WA 3DN9A 1H7SA 3VWSA 1JLQA 3IN5A 4DFMA 4JI6E 4P10A 4LFBI 2XC9A 2C22A 3CDUA 3LGHA 5EKWA 4X65I 1KD1T 1M5HA 2ILYA 4DDFA 2WP8A 1OWXA 2CQIA 3WU3A 4DV2E 5F8JA 2KM8B 4O44A 1MWYA 4QCLA 1TL1A 4DXLA 2ZM6J 2C38A 4DPTA 2CDRB 4DV6J 4X62I 4DR4E 1FWKA 1OMSA 4ZCIA 3HJVA 2R2UA 2DGXA 4R0JA 3VVTA 3HFZB 5KFXA 1XMOJ 4QWBA 4KGKA 1S6QA 2GX8A 5GMDA 1RHJB 1NZAA 3J7AN 4I1TA 3H5SA 3N6NA 4KE5A 2I9SA 2YX4A 2Z56B 4L3NA 4PPDA 5KFYA 5KT3A 4Q8EA 2ZEJA 1CJVB 2CKWA 3E8OA 1N5SA 3GSDA 2DCUB 3AY0A 1YWXA 2PMZD 1LW0A 1RU2A 1UFLA 1RLCL 4HVZA 2ZJPQ 5HJXA 1X0FA 1EKRA 3NEKA 5KFUA 1OSDA 1ZYQA 4LQ3A 5K14A 4BA1A 1D6TA 1GX5A 1WHXA 2GQQA 2L48A 4I69A 3HJFA 2ZBKB 2IA0A 3LA0A 3KRNA 5JXSA 2ACYA 1JK9B 4YB5A 3WU5A 2V4JA 5ADZA 3H25A 2IY5B 2E5JA 2WP8B 4OHWA 2CNLB 4CZCA 5IWAF 2HWIA 3TRGA 3W5XA 3G6VA 4F02A 1V5VA 3GQCA 5IZHA 4I56A 4LF8E 2UUAI 5LMNJ 1KSPA 2R7TA 1HQUB 3WHIA 5D78A 1ITPA 1Y00A 4DQQA 1LW2A 2JC1A 2HMIB 4LF5J 4K4XA 4DV1I 3GLJA 3C14B 4UY85 3GWCA 3QRQA 4KPCA 2H48B 3PFOA 2F7VA 2GC8A 2HNYB 4ZPTR 4CIOA 2XI2A 4DF4A 1XXEA 4ZCLA 4DL2A 3R2DJ 2UXBI 2YNFB 3GFXA 3MCNA 4EMDA 1RAIB 5AE1A 1SL2A 3IR5B 1FFSB 3AODA 4HDHA 2XO7A 2X36A 2C2OB 1YHQS 1NH7A 1J5EJ 3EX7B 4XTJA 2M0GB 1HQEA 3GPAA 4C8YA 2Y3YA 1HHQA 2CUYA 3TQEA 1B3TA 2GIRA 1S5ZA 2H51B 3H5YA 1Z0CA 3H1CA 3DRSB 5E2QA 1HL6A 1RT3B 1TL3A 2L41A 4DV2F 2BV3A 1Z4UA 2IMOA 4OHVA 2M2BA 3KKFA 1NDPA 2OPPA 1LWCA 2E9ZA 5L9NA 3DKDA 2BW7A 3F73A 1TKTB 1PYTA 2JLFA 1RT1A 3KG4A 4RU2A 2BR2A 4L3KA 2KI2A 2MZSA 3NWGA 3U1LA 3LOUA 5KFNA 4ED2A 2XQCA 2VESA 4B9MA 4Q43A 4DR7I 2BXJA 4IFYB 2PT0A 1HNXE 4YHHI 1D9AA 1RAEB 1UCNA 1B4SA 2QYGA 2WVDA 5DZ6A 3T9ZA 2VBZA 4MMOA 4ZVPB 2W9CA 3IMQJ 3KUGA 5DS7A 2UVWA 4M5IA 1AFJA 5IWAE 2MHEA 2J9DE 2Z4PA 1DBDA 3TA2A 3TX0A 4J9VA 2HVIA 1JQGA 3IAM9 3PNIA 5F8IA 2WB4A 3H4DA 1HBNB 1XR6A 2NUUG 4W4MA 4CLUA 1WG1A 1JX4A 2YBVA 1QVFR 4Y3CA 3H8YA 3GP9A 1RBOB 5GADI 1H2TZ 1MWZA 1RA7A 3QT6A 2EFPA 3FC9A 1RAJA 3KYLA 2VQEJ 4IO9Q 2FLLA 2UXBE 4LFBE 4RW8A 3LH2S 1C0UB 1FJGE 3QT5A 1RTHA 4LVNP 3IR6B 1FKAF 1N36E 2VASA 3CDWA 4X62J 3R97A 1UA1A 2W8LA 2KJVA 3CDEA 4ISAA 2M8HA 2PGCA 4B17A 2CNKB 1YQHA 2LXFA 3NS7B 1VQ4S 2ZHAA 1N5VA 2F63A 4DV7I 1DQAA 1HNIB 4USWA 1NJXA 1RE1B 3KG1A 2CVIA 1LV5A 1RHRB 3DLEB 1IBLE 2CQBA 1FKOA 3BDEA 5EWFA 4K8RA 5K9FA 2HZAA 3BS9A 2VPXB 5LMUF 1N4LA 5A2QQ 4JI7F 3ELHA 1H2VZ 1KVKA 2HFZA 3QT8A 1VS3A 5DLGA 1HYSB 3P3GA 2BA9A 5LSRA 1HD1A 3M85D 2RVJA 3G8QA 2ZM6F 4FYXB 3HXMA 3D6MB 3QZ8A 4ECZA 2OPQB 1X4BA 3MM6A 2K7KA 3IM8A 4DPYA 3OL6A 2AF6A 3MPWA 3PACA 4A8KA 2H5JB 2V2VA 2HLTA 1VQNS 2ZKTA 2QA4G 3HK2A 2GGPA 4I4BA 1TKZB 4AXIA 3MAQA 3W2VA 2OGUA 3PV8A 4G1QB 3TUPA 4DUZF 2HHHE 5I3UB 1UJ4A 3K5LA 3UW1A 3IBCB 4HT5A 3K5MA 2VZ9A 1KWMA 2QMUB 2ZJQQ 2VBWA 1S1VA 1GMWA 2OPRB 5FDLB 2PO1B 3HSZA 1FRJA 4IOBA 2ZJRQ 4DV1J 4DV3J 3THVA 2VONA 2J65A 1I94I 3P5TL 3DU6A 4KHRA 4PABA 4YB6A 2FUG9 5MAOA 2IDEA 4WK1A 2VDHA 2RU3A 2FJEB 2LA4A 1U8WA 2VOOA 3HSGA 2V9KA 5ETSA 4EUVA 2OH2A 4JV5J 3R5JB 4NZ6A 1KN6A 3T1YI 3I9ZA 4JUZA 1CPZA 1GMWD 2RS2A 4TYBA 4V19X 1PG5B 3VAKA 3W1YC 1SJ3P 4NLQA 4ELUA 3DOKA 2CDQA 3P4UB 4WPAA 2PNLA 4W98A 1T05A 3ILJA 3AOCA 2NPFA 3WIUA 4YR2A 1TK8A 2RH3A 2W9BB 1N34E 3H2LA 3MEDB 1CC8A 1EQMA 4ZP7A 3A8JA 3L7PA 5KOWA 2XLIA 3KK2A 4TU9A 2CPFA 4RJVA 1JLQB 4DV4I 2HFUA 1YZ6A 2YKQA 4HHHA 3OSPA 1FDNA 1FF2A 3HT0A 3OR2B 4G1QA 2XS5A 1ZXNA 4RUBA 3FQLA 3OBIA 3RBXA 4Q8FA 1WSRA 2VFSA 4AFFA 2OPSB 1N52B 1RT4A 5KFCA 1R6VA 4CTAB 4LF8F 5L1JA 1T7PA 2P9CA 4LIRA 4JI1J 3ZFVA 1U1NA 4NZ0A 4UW2A 3CULA 4MIWA 1XC9A 4OO1D 2XM3A 3MEGA 4N8OA 2N82B 1VQ9S 4KC5A 4PG6A 2CG8A 3DI6B 4R5PA 1TTHB 1IJEB 4X4VA 2C3YA 1B70B 2AP6A 4DZDA 1Q7YT 1HYSA 1N48A 2B8PA 1M5OC 3CXCR 4U7CA 4JI4F 1K0VA 5L39A 1HHSA 4DSLA 1PKPA 3N9UC 3OFEA 2XSJB 4QIVA 4YR0A 3POTA 4LSNA 3DLEA 4LJMA 2AGOA 2VB6A 5HROB 3HPOA 2NS1B 4YB1P 3W65A 3RYLA 2UXDI 1Y11A 2F4VF 2DVIA 3V81A 2L9NA 1UW9A 4FKYA 4OZ2A 1FJ7A 2PN6A 2FJXA 5KFSA 2RKIA 4EBEA 4I68A 1K1SA 2JVOA 2CQDA 4MK9A 1WDDA 2GAHC 2B6AB 2P2CB 1I3OB 1LWEB 5I3QA 2LQBA 1J5OB 2G2ZA 3P49B 1RCOB 3LP0B 2V63A 3EXYA 4LRFA 2AT1B 2B3TB 5FLXU 4NXNJ 1CVJA 1Y4UA 2BA0D 5C42B 1PKUA 1N6QA 2PI5A 2FVCA 4FW9A 5H1SV 4JV1A 1XBWA 2O1UA 3MAAB 2K8GA 5C0XB 1HNWE 1MWQA 3W62A 1FESA 3DRRA 3EVOA 1IJFB 4K7QA 5L9XA 1AW0A 4LFAE 4DR6E 2GV1A 3BREA 3U02A 2GVDB 2UZAA 2MQPA 1U45A 4DU7A 4IRKA 2DGVA 2PEBA 2YQ3A 2EWHA 2MZ1A 2CPEA 2VU5A 3N0VA 3ZTOA 5HP1A 4C8KA 1B62A 5IT9Q 1R7IA 1YZ7A 2MSTA 2K2PA 2CG9A 2QN6B 3ZZPA 4ZLPA 5LMUJ 2QMXA 3M6WA 2NPIA 4O0NA 2V34A 3M32B 1TK0A 1VK8A 4WF9Q 1WF0A 4HXZA 2DY1A 3KXDA 1E6VB 2XCPA 1N34I 4DX8H 2VOPA 3M8PB 3AJ2A 1QJHA 3ONQA 4AUKA 4LSLB 2JEIA 1RT3A 1D3WA 3J7YI 2QE5A 3UPFA 3DLLQ 2HK2A 4K4VA 3RB0A 2KFNA 2GQCA 5ETPA 3CJ8A 1W7WA 3MFIA 2D3OR 2O01C 4WCEQ 4DR5E 4B3RI 1NJIT 1TMMA 2WSFC 1RWUA 3K8VA 3TP2A 4Z37A 4IDKB 5B0CA 2KN4A 3NBPA 4LFCJ 4QZVB 1ZOTA 2MXYA 4H4KA 1DQ9A 2GJIA 1RWNB 4OI3A 2HG4A 3MCMA 4WBFA 3GV7B 3G6XA 3VAIA 3GJTB 3JSMB 3BGRA 3C14A 2KXNB 3J81Y 2NLWA 4C11A 4WKYA 1FNOA 1BLUA 2O1PA 5LSOA 4ZPDA 1T3NA 3R5DA 3D28A 4OIXA 4WP8A 3ZZZA 1JLFB 2AYEA 2M3DA 3K5PA 4DPWA 3HMJG 2GZOA 1U0SA 2WAQD 3P06A 2DGUA 4XPEA 1S1WA 2IBOA 2JHEA 2IHR1 3FSIA 4P7TA 5SZTA 3CF5Q 4DR7F 4PZVA 4OYZA 3RB6A 4K0KE 5CD4A 2GAGC 3JQKA 3RW7A 4JYAF 2HS3A 2NYIA 2QC3A 3I56S 2VJUA 1NSQA 1IBLJ 3DRRB 5IM0A 4LRCA 5IV4A 1T95A 4JG4A 1CBKA 1TU0B 1YK9A 4P72A 4PXBA 1L3VA 4BA1B 3T1YE 2AX1A 1S77D 1N6QB 2CQGA 2J9CA 2ZH5A 4PRXA 4DUYE 2AJFE 5DDOC 4OKGA 2FB0A 5CQGA 1VHIA 4HY1A 1P9YA 1HWIA 1PVGA 3JQMA 4KHPI 3A4TA 2CNOB 2CXEA 1KS2A 3BB5A 2VD3A 4PXDA 4WYWA 2IM0A 4A8QA 4LFBJ 3TEGA 2O67A 2B56A 5AJ3J 2N7CA 1IBMJ 4JI1F 3HVTB 1U1OA 1T03A 4IOAQ 3LPEA 1VC0A 4DQRA 4QNKA 2DHGA 3P3DA 2IRXA 2HK3A 3D0IE 3OVSA 1FRLA 1H73A 2BKOA 2MQNA 4DV5J 2UXDE 2AJ1A 4KY3A 5J1EB 4F4WA 4ALZA 2MQOA 4DL7A 1DQ8A 3CCWA 4TY9A 5F8HA 4LR7A 3M8YA 4ELVA 3MOZA 2WVCA 4IG3A 3TR5A 3HT3A 1LXJA 1TFWA 4AL5A 1Z0BA 1WEXA 4NLVA 3BQ2A 1Q7LB 3UN2A 2DGSA 2JVRA 3M2RA 3AXKA 1MMDA 2V50A 3AA9A 4KHMA 4ID5A 5KTQA 4UF4A 3M9NB 3SDEA 4ID5B 2QIFA 3FMBA 1ZTTA 3KDOA 3ILOA 4LREA 5KFRA 2V2QA 4KV8B 1IKVA 1YJUA 2G2YA 1QTNB 2CPIA 2ZWPA 4FF3A 1LKZA 1SH3A 1C2PA 2C1EB 2RS8A 3GJRB 4I0WA 3TNVA 1Q86T 1JJ2R 2F4VJ 2E5LI 1KR4A 2YPYA 3A3OB 4IFDA 1BMQB 2EFNA 2MY8A 5B7WA 1WC4A 2E7XA 5LT5A 4X4OA 3DLGA 2CPJA 4D3GA 1EP4A 3D0HE 2MKSA 4ZCMA 2O66A 3M1VB 4OZ1A 2XO6A 2VV5A 2DGQA 1RR9A 3FFIB 3AJ1A 1NHVA 2DNMA 2WVFA 3MECB 3N28A 1T03B 3DOMB 2HYIB 1REVB 1X5PA 1XNQI 2A0FB 2A18A 2AW0A 2AMCB 3V4MA 4Q44A 3I55S 5L1LA 1KQGB 4DV1E 3TA0A 5CD4H 2IBKA 1TMJA 2ZD1A 2FJBB 4IZKA 2I5JA 1CC7A 5T14A 1S76D 2FGCA 3DLKA 1CJTB 2KRBA 4NI2A 2C42A 1JKHB 2CQCA 4DR3J 2R8HA 2ZH2A 4ED5A 1N5YB 2HRUA 3HZEA 4CT8A 3KLHA 2DD8S 2AD9A 2DY9A 2XB2D 4Q2MA 4X4TA 2Y9HA 2QT7A 4O0IA 1PO6A 2KT2A 5HL7Q 1K44A 4YHHJ 2AJ2A 3CWJA 2F65A 2R8JA 1PGZA 2IOQA 1HBOB 3EGWB 1RT6B 3TJAA 3R8YA 4DV6F 3DHWC 5T41A 3OJUA 1NHUA 1NPKA 4ED8A 1ZXMA 4HYMA 4EFAC 2V4QA 3R27A 2YNGA 4Y28C 4K4YA 4OL8A 1FXLA 1NSPA 4DR2J 4YY3I 5HK4A 1U6BA 2M4MA 1S72S 2ZNYA 1CJKA 1R0AB 2NN6A 3MEEA 4U95A 4WIQA 4C11B 3BPDA 3H59A 1H7WA 3VR1A 2FVRA 4ZHRA 4NE9C 3SSSA 5A8WB 3QO9A 1L3TA 4F2SA 2F4VI 2CZ4A 2MGZB 3BQ1A 1R0AA 1ELOA 3PG9A 3DMJB 4YQWA 3MFHA 4FYDA 4PXEA 2G0JA 4B9VA 4IUFA 3UE2A 2O1WA 3UDCA 1FD2A 4Y2CA 3H40A 3M2VB 1WACA 4QJVA 2KM8C 1IWGA 5J2PA 3NGTA 3D3BJ 2RUSA 3AQOA 5LSLA 1FJGJ 1S1TB 3CEDA 3I5CA 4HLBA 5HQMA 2BUNA 2NREA 1S1XB 4NA2A 2JL9A 3LWLA 2W9AA 4CLZA 2XY5A 1M1KT 4DPOA 4EU0A 4DX7A 1N56A 2WSCC 3V4IA 4MU4A 1USUA 4N56A 1B0VA 1GAOA 2Q66A 3KLHB 5G0RA 2HZCA 1GMVA 1RHUB 1VOMA 3M8PA 4NA3A 3W63A 5A2QY 2GQ0A 1KOHA 3FKBA 3M85G 4DX6A 4KGXB 1YJVA 4MKAA 1Q81T 3OXGA 1ZPVA 2C2NA 1IBLF 2HGLA 2ZFHA 1S9FA 4WXWA 1HNXJ 4MDTA 4OV1A 5CYQB 2ZHOA 1FKPB 2V6AA 1J27A 1SBRA 4R25A 1FEEA 2X1FA 5IT9C 2PMHA 3DMJA 1TUGB 1UEUA 2KRRA 4X4QA 5DQIA 4NWBA 2YNHB 1M5VC 4FBUA 5A2QC 3FFIA 3JTPA 3MECA 5T7LB 4DSEA 4WP9A 3RAQA 1VBYA 3H5XA 3IWNC 2Q43A 2BMBA 4GO5X 4I67A 3DLJA 2HRTA 4Z7YA 2B7BB 5L8RC 1XEZA 1NJZA 3H98A 4NXME 1Q16B 3HSDA 4R8UA 3KJVA 4QYZK 2BE7D 2W1BA 3JAMY 5I4MA 3HFVA 3MR7A 2W9CB 1ZZNA 2VG6A 4DV5F 2BJ1A 1U1RA 3BN7A 1JLAB 2Y1LB 3T1YF 4O3RA 4NCGA 3CCJS 1VYAA 3VZHA 3CCVS 1X9SA 2AWZA 4TU7A 1BXNA 3MM9B 4DMZA 3RR7A 4LF9F 4DV3E 5K36F 1VR6A 3I82A 1IN0A 1XMQJ 2K3IA 3CJQA 4ZN3A 4OO1A 2BE2B 4DL0C 5DETA 1S1UB 5CH7B 4DLEA 3GMGA 1GEHA 4I2QA 3FBFA 2EFVA 1RTZA 1WEYA 4LF7I 2EFOA 4CO1A 1HW8A 3ICLA 4AL6A 1C1BB 1FXDA 4OZEA 2AEJA 2XHCA 2ZD1B 4DJBA 2J7UA 1VRQC 3NOCA 2R9LA 5DGAA 1YBAA 4YY3F 1Y5IB 2AYBA 2HHTA 4UZBA 1Q53A 3EMTA 3GJQB 3M6XA 3VVUA 1IBMF 1F3FA 3DOMA 4V1Ak 2ZH1A 1F5AA 3MEGB 3DGPB 2XYHB 4EBDA 4FF2A 2YWGA 3G86A 4PAAA 4RW9A 2XGQA 1Y9OA 3P5BP 3TARA 2D41A 2UUWA 1SC4B 2V8VA 2DPJA 4ZVOB 1NKBA 1AYEA 4CO3A 3QJPA 4JI2F 3ZTRA 4YOEA 2EKYA 2F5GA 1FJGF 1HNVA 4FS2A 2UVRA 5B0DA 1HWUA 1T9VA 2CPYA 1OYEA 3HZGA 1WG5A 3PHEA 2LDIA 4HHJA 3MR3A 3M8SA 3T1HF 4U9RA 2AJ4A 1JLAA 3LP2A 1B7YB 3CB4A 1WORA 4H4MB 3WC2A 2XNRA 2DR7A 1UFKA 3GSIA 4IQXA 3CD6S 1UJ6A 4ECSA 1IR2A 7FD1A 2JEAA 1YDLA 4PKDB 1QE1B 1VRUB 4YHHF 1FXRA 3N79A 3OR1B 3PIOQ 4B3MF 4B9SA 3FDSA 2KG1A 3IO1A 4B3RF 2XY6A 1XK8A 3ZKDA 2J8AA 4QR1A 1FK9A 2Q1LA 2ZUGA 4KB7A 2YNHA 4NLYA 4J91A 4YEAA 3M8ZA 1U02A 4OYIA 3MM8A 3HX9A 2HSEB 3TW0A 2W24A 2HQIA 3GCXP 3WZ0A 4JV2A 4C8NA 1T8EA 2LMIA 3DGVA 4N8NA 4DUZJ 3ZTSA 4AL7A 5HQ8A 3EYZA 2BZ2A 2E5GA 4NCAA 4WUDA 4M5GA 2DR6A 3CTRA 2Y1RI 4DCJB 4IG0A 2GS8A 1ZAWA 2DRDA 3ISNC 4DV3F 4AIDA 1F1BB 2CWXA 5I3UA 3CDJA 5KT5A 3V4IB 5IM0B 2QA4S 2WW4A 3IR7B 4TLQA 2LVWA 2JLEA 1AROP 5F8MA 2QFJA 1TL1B 1WOOA 2HVDA 3DCAA 3PXGa 1T3OA 2MZRA 4L76A 1XN9A 5DDPC 1W2BR 2XLKA 1JWWA 3W64A 1IKYB 3KJQB 4JI3J 3NP5A 4MQYA 4NBQA 3OHAA 3PYDA 4F3QA 2V2KA 2C3PA 2ZH7A 1HNZE 3IRXB 4X64I 4N41A 3Q8YA 1M90T 1ZM3A 4DQPA 2IYGA 4CO2A 4A48A 2LU1A 2MZTA 3U1NA 2MGZA 1WJ9A 1YJ7A 2ERRA 1HBUB 3FUYA 4JI8I 4ZHRB 4UY8T 1XMQE 1CEZA 4TU8A 1HNXF 1U1KA 3SQOP 2PDAA 5LMUE 2DNZA 2XWYA 3MAAA 1FKOB 4X66J 4J9MA 1JLBB 1OSCA 5H9FK 1KBRA 2MZQA 1EHWA 1FEHA 3H20A 3KJNB 1C1CB 3C6TB 3KLGB 1NHIA 2F9JA 1KVIA 3H42A 3DM2A 4ECYA 3N6MA 3R7BB 3KHRA 3LP0A 1SKSA 4OI1A 3OVBA 3NNCA 1UEVA 3R9LA 3L7UA 1Q1KA 2YKPA 4HI2A 4QYRA 4USIA 2E9RX 4FWHA 5CHCB 4JV0A 1LWFA 2KHDA 1A7GE 2XCAA 3AHPA 3L7ZA 4LF8J 1N32E 1WOPA 1CQMA 1P8GA 1HI1A 3V81B 2VJVA 3RB4A 2NSBA 1SCJB 2AEFA 4O3QA 4C97A 4IZJA 4DU8A 2VF3A 1YTYA 3QNWB 2KFYA 3T1HI 1HBMB 4K0KI 1EZZB 3HI9A 1SJ1A 3WBZA 5DDRC 2FHOB 3MWBA 2LDYA 5AXKA 3P3CA 1VRUA 4LF7F 2Q6BA 1I94J 4DUYJ 2WCXA 2RILA 4TQSA 2WTFA 2DNQA 4WZMA 1XMQF 2DR8A 2B9XA 5D8HB 1LQ9A 4I6AA 3I0RA 1H74A 3V5RA 4JI4E 4BCAA 1RHMB 3O2IA 3RZAA 3RGIA 3UN3A 2OLWA 1URNA 3PW5A 2JC0A 4LF7E 5HAOA 1PILA 1RABB 2B5JA 3MMJA 1TKTA 1CJUB 3OV7A 1QTMA 2BR2B 1RTJA 4IH7A 2HNDA 2FYXA 3HHLD 5ETNA 5DQGA 4ZJQA 2FGOA 2IRUA 3ZM7A 5DM6Q 2IM2A 1KRPA 1RTIA 2H4WB 2KL8A 3OR2A 1TL3B 5IT9Y 4KV8A 2CJKA 8AT1B 2UUBJ 4Q0BB 2W8KA 4GO7X 1LWEA 1SI9A 3SDEB 3R5GA 4LMZA 1TL4A 4GKKF 5F0UA 2JH3A 1TUVA 5BYRA 4FW6A 2B4VA 2BM1A 3GV8B 3DU5A 2MDAA 4TYAA 2OSQA 1MW7A 3A3PB 3LQVA 1IBKF 2XG8A 4DV0I 2D74B 5K36A 4CH0S 2EBEA 4ANEA 3SQGB 1PBUA 4G1PA 1HWLA 3EM1A 3HKZD 2IA6A 1I94E 4LF4E 4LIWA 1C4CA 3NWRA 1Q95G 1UL3A 3EWGA 3HVTA 3SIPB 4BC7A 4U7UD 3LP1A 5D4PA 5IWAI 5E33A 3BSNA 3PR4A 2HBQB 4OZ0A 4K59A 3HHNB 2IPOB 1YRTA 4R5PB 3GIJA 3FEYB 5J2QA 4LF8I 1BQMB 4JI7I 2DHAA 3P8BB 5DQHA 2ZBCA 1IKXB 1URRA 1WC5A 1WKKA 2FC9A 5LOQA 4RLEA 1Y10A 1ZS6A 5IC6B 3SYZA 3BSOA 3AXMA 4DR3E 1XERA 3LAMA 3VAHA 3BQ0A 5HMZA 5LL6d 1RT2A 4FVCA 3WX8A 1AUDA 2IERA 4I6WA 3P45B 2FQQB 4C0BA 4RUAA 2VIHA 2ATLA 4P7VA 1FJEB 4CYUA 2EW9A 2IVYA 4UQGA 2GMJA 5JVGQ 3NCQA 3BKUA 3KUEA 2KYZA 4X64J 3QBCA 2HHHF 3GILA 2PNZB 4IKAA 4Y65A 1PAUB 3H0PA 2MKIA 4C8MA 3V6DB 4QU7A 5JEAC 2GQ2A 3OLAA 2DYAA 2EKNA 2HIYA 2Z0GA 5J2MA 2C3UA 3EPGA 2DISA 1WKJA 1S6QB 2QG9B 5KFEA 4BS2A 1IM4A 2MQ8A 3BBCA 3LP1B 1YH8A 3Q6MA 4RBVA 1S4FA 5CZXA 4RU9A 4ECWA 4ZIVA 3CCQS 4NRUA 2J8SA 3PX6A 1KVJA 1OYPA 4J9RA 2ZVSA 3F41A 2Z2YB 3DHXA 4DQIA 1HARA 4PU9A 2DPIA 4X64E 3CJ2A 4KO0A 1U26A 2QLFB 5HANA 3M2VA 1K8AT 3MI7X 3KNGA 3NG8A 2BA0G 5FDLA 2JNJA 3G9CA 2DIUA 2V8DA 3I5BA 4A8MP 1FVSA 4LF5E 4CLYA 1S49A 3BEGB 4OYPA 4C2MA 3QRRA 2ZNZA 2BDPA 3QFHA 4CO5A 2FTRA 1DHMA 4NA1A 4IQMA 3HSJA 1FE4A 1J5EF 5FJ4A 2GJ2A 1Q5YA 2OP5A 4ITSA 1F60B 4PQUB 4LFBF 4WUCA 1BUXA 4ZVRB 4DSFA 5GAEU 4DL6A 4B3OA 1DY3A 5AJ3F 5GAGU 4F4ZA 1YJNS 2IYIA 2XY7A 1QSLA 2M8DB 1ZETA 4DV2J 2YPZA 3C16B 4HR2A 1SJFA 1MNEA 3BDPA 3NGKA 1VC5A 1FI4A 3C2PA 2W2NP 1SKUB 4WFZA 4ZIWA 5F9NA 3KK1B 2L08A 1C0TB 2YNIA 4I7FA 4OI6A 2BE9B 4RNFA 3QQCD 2V2ZA 1N36J 2C37B 4EZ6A 7AT1B 4WWSA 4QIFA 4X62E 4DR4I 1S9EB 4C6AA 3UWTA 1WSVA 3UVJA 5AE3A 2IDLA 2UP1A 1TZ0A 3OTOF 2GHVC 2YKMA 3MMBB 1ROFA 1SKRA 4BLGA 2C37A 1R8AA 3FRZA 4BHQA 3WU6A 2RMLA 2X51A 2IESA 1Y5LB 3EGVA 4TY8A 4O4GB 4WU2A 3ZZ0A 3HHDA 2DGTA 4TY8B 5M2RA 4DV0J 4ZVUB 3D1OA 4ED1A 2CRLA 2DGWA 2FHKA 2WBMA 2VPYB 2D1CA 3EZOA 1KNZA 1B0TA 5F41A 3W9JA 1RP5A 2F3JA 1H6KX 2GHWA 2U2FA 4EO6A 3ILIA 3DLGB 4HTIA 4ED4A 1EARA 3NMRA 2ZH6A 2JEBA 1QAYA 1HBNA 1XR7A 3R1HA 4DV3I 2NQPA 5J2MB 3GONA 4NMLA 3CCLS 3FBBA 2MQQA 1REGX 4DPUA 3BO2A 1G2EA 5C0XC 4DHVA 1HQUA 1RJJA 5CCMA 2R8IA 1C0TA 2PO0B 3KK1A 4OX9J 2JJ4D 1XR5A 2QMWA 4DR6F 1Z0WA 4DR5J 3G87A 4F0KA 2HHXA 2FHJD 2GNKA 5KOXA 2OTJS 1RT7B 1RISA 4DCOB 2VKZG 2GO4A 3MMAB 1KONA 2NXUA 2OI2A 4JOUA 1RK8A 3F56A 3D6FB 1VLYA 4M5DB 1SV5B 4LBPA 2QSWA 1GTHA 1RWMB 4Y6IA 4TNOA 1VC6A 2EG2A 2JRSA 2QA1A 3RW6A 2NN6E 2H5EA 1FCAA 1Y4ZB 4J90A 1LOUA 2CG4A 3N5FA 4ZA1A 4ZVEA 3QWPA 3NOGA 4DR2F 2QRRA 3CD0A 2HQDA 4LF4I 4IFDE 1F9HA 3ZTQA 1VLOA 3CIZA 4ZVTB 3UI3A 1R6MA 3H90A 2AYMA 1DTTB 1ZA2B 4K2JA 4FW7A 2X1BA 4OQJA 4LUBA 1L3KA 1P6TA 3NAHA 4F67A 3IWLA 4H4OA 1Z2LA 1W26A 3D1HA 2N4CA 1IR1A 3LUYA 1MU2A 3T9NA 2HHHJ 2WSEC 2D3UA 3DOKB 3OD2A 4ANDA 3LPYA 4PEOA 5JEAE 1FK9B 3QRPA 1FWLA 1RAHB 2HHWA 3CD7A 5KFDA 1XMQI 1LW2B 1KQKA 3ZC4A 3OUYB 5KG1A 2CQPA 3TANA 2ZBIA 3JB9k 5HLFB 1OQ3A 4ZPAA 4YN3B 4RL1A 3G8SA 2G13A 3GYGA 1IKXA 4MIAA 2ZDPA 2XHWA 3I31A 3KDNA 2V67A 3ZXWA 4X4RA 1UPMB 3W3SA 3I0SA 3BSCA 3R5BA 2JFDA 3I0SB 4GKJE 3SXLA 2NXEA 3DDKA 4ZK7M 3UNYA 2COLA 1S9GA 2XLJA 5E3RA 3TAMA 1N88A 1R0BG 1SPBP 4NL5A 4PWWA 2MQLA 4A8FA 2BJDA 2C3MA 1XNRJ 2RQCA 4M94A 4FN5A 2EC0A 2FJVA 2LQ5A 5K8MA 3HM9A 4ELTA 3OT9A 3W9IA 1IWAA 3QGIA 3QWUA 2YVSA 4OYXA 1HR0E 5K36B 4JV5F 4DL5A 3NGUA 1YITS 4J9UE 1V5IB 1R43A 4JI1I 1KEKA 2WB1D 3DRPB 2M9KA 3NRBA 1UWBB 3GIMA 5DG8A 5KFZA 3DOLA 3EUNA 4PRVA 4FYYB 3TX8A 3FEZA 3PEJA 1SIWB 3C46A 4DR7E 3M05A 2AJ0A 1NPPA 4ES2A 2PA8D 1KLMA 1P1LA 2HBRB 2BKNA 4C3LA 1NK5A 3PRYA 1RAAB 1RLDA 1E3HA 3HHLC 1X5SA 3IBWA 3D5MA 4KGMA 1SV5A 4U96A 1RCXB 2PO2A 2YWFA 2BQ3A 1GX6A 5DROA 4IFDC 4V19J 2QV6A 1VQ8S 1F2HA 4CLSA 3HFKA 1LXNA 5ETQA 1VBZA 4OYOA 1D0EA 4JI0J 4LF6J 5EX0A 3T5JA 5DG7A 1Z59A 5LMUI 4RX6A 3S7RA 3IGNA 4NCGB 5E3PA 5K5MA 5A76A 2R8GA 2B4PA 3PRVA 2UUAF 1RTHB 4USMA 3ETOA 1QAIA 2DKOB 1HNWF 1RACB 3L09A 4ZCKA 4Q0BA 1P9QC 2VBYA 1YRUA 3T19A 4F3MA 3CDAA 4LT6A 4R8UB 4DSJA 1N32J 1U24A 4JI3E 1O8BA 1WI6A 4USKA 4DOZA 2AZ3A 4NXNE 2G9OA 3GG0A 1OY9A 5B0GA 2FZGB 3KLFA 5D4LA 2ZE2B 3PEHA 1HBMA 2AV5A 2ZZNA 2ABYA 1IR0A 5CYJA 5DG9A 1GT8A 2QFIA 2XEXA 3KJFB 4GRSA 1KHWA 3CCZA 3S8SA 1XNQE 3RRGA 1X60A 3I0RB 1MN7A 5DNLA 4ETXA 4IFYA 4NRTA 4G6VB 3MCOA 1U8SA 2RKIB 1JLGA 1R8PA 1PBAA 5C25A 4QWCA 4P7AA 1E6YB 2GVZA 1UVNA 3MEKA 1M1GA 3RR8A 4DSKA 2CVEA 2UUCI 3DM2B 1SQEA 2MLYA 5D77A 1SC6A 3C6TA 4DR6J 4DV5E 4OJ3A 5F9LA 5G0RB 4OJ1A 3MCSA 4B08A 1JLBA 1UMJA 3DRYA 4WJBA 1XWLA 3KHLA 1G3OA 3UDVA 2CFXA 4ZVGA 1VQ5S 3K7RA 3GIKA 4FZVA 4IZJB 4X66I 2J5AA 3ENQA 4RO0A 3ENAA 4CDIA 2IMWP 4PUOA 2ALYB 4JI5E 4L6V3 3HVWA 1KQSR 3C6UB 2YQ0A 3ET6B 4RWXA 4F26A 3M8QB 4UZCA 3QGHA 1RAGB 1X0PA 5BR8E 1HR0I 1OJ4A 4QIGA 3A12A 2BA1D 2NUHA 1OY8A 2Z57B 3FSXA 4B3OB 2PEHA 3UHMA 3OXFA 2KYXA 2VPZB 4ZVIA 3JQJA 5FLXC 1RREA 4UOFA 2AKWB 2Z5CB 4JI6F 4A47A 1WELA 1JLCB 4CO4A 2R7QA 1HBUA 3SCIE 4WK3A 3MEEB 4P73A 3Q8PB 4LRAA 3CGIA 4RNMA 1X9MA 3CJKA 1S9GB 3BGLA 2VQFJ 2KDOA 4BA2A 4NPOA 2R4FA 3NNHA 3CJTA 1QAJA 5K36C 2N3LA 1H3DA 3OFGA 1EETB 3QSYB 3J7AG 2MKJA 4KO0B 2DK2A 3S01A 3KMQA 2C2KB 3UCGA 2CPXA 3KTQA 1QY7A 4HACA 4JI3F 2UXDF 5K14B 1TL5A 5IWAJ 3O6QA 4IRCA 1IKWA 2H9ZA 2GIQA 1AZSB 4IH5A 5GADU 4UT4A 4ZVFA 4DV7J 3FBEA 1YIJS 2YXLA 1FO1A 1MU2B 1U6FA 4OZNA 3Q22A 2DRBA 4ES1A 4IR1A 4ANCA 2DGOA 3FCHA 1YVFA 3OLBA 2R2RA 4ERDA 4XDCA 4GVBA 2PO4A 1UTAA 2M5YA 3W2WA 5E3QA 4R1FA 1Y3KA 1VCTA 5J1PA 2E1AA 4OO1F 1BHNA 1BQNA 2E7WA 4Y2MA 4GC6A 3AQPA 2YWEA 2GCFA 4FS1A 1TVRB 2B43A 2LEBA 5IXUA 5KFLA 1X7VA 3BSAA 2DNLA 2KZMA 3J80Y 3M1VA 2W7AA 2Y8WA 1NB2A 4GVLA 1C4AA 2VFUA 4QBUA 4ER8A 3IFEA 2IIHA 1R27B 3DDNA 2W2QP 4G3IA 1EX8A 3IBFB 1WD6A 3KFWX 5A8RA 2UVVA 2Z58B 2O1VA 4RUHA 2OPQA 3NGDA 1BQMA 4J3DA 2FD2A 4KQVA 1Z2ZA 4XIUA 1AUSL 3C8YA 3DNCA 2PNMA 2DNNA 2RNEA 1S12A 4KJIA 3M2RB 1V3SA 1VI7A 2I1RA 1MN9A 4DUYF 2IRYA 1JNRB 2PFDA 4JI0F 2J6TA 4PYAA 1NK8A 2GJFA 5D3GB 4OHXA 2VDIA 5E0OA 2X7IA 3CMAS 2JEBB 1GMUA 2QLJB 2L9DA 4DLGA 2EK6A 3T3FA 1QUVA 4F3OA 4OZ5A 4KPYA 4O3SA 1HNWJ 1GNKA 4LPFA 4JYAE 2RQKA 2ZOGA 2QGFB 1S1UA 2R2TA 1F2GA 1LK5A 1SL1A 4Y2KA 5AE2A 3LNUA 9ATCB 4CLLA 1BGXT 3CJ3A 4YS2A 4OFZA 1F3VA 2F4FA 2EXUA 4KR0B 4DV4F 1TELA 3JAMU 2UXBF 4DR6I 4KQZA 5IOLA 5FLXQ 2B51A 2N4DA 4ZJOA 2F4VE 1OPZA 3DC2A 1RHQB 2VG5A 1H38A 1ZM4A 2GO8A 3ULHA 4YR3A 1FVQA 2O3DA 3SSRA 1XMBA 2L3MA 3KJVB 4ECUA 2Z2LA 2G1HA 2UUBF 3PS1A 2OTLS 1YJWS 2OEKA 2UU9E 4X4NA 2DNYA 3AOBA 5ETOA 5EGYA 3NAIA 3GCMA 4ZKAA 3N4WA 3MM9A 4WTYA 4F25A 4A4JA 4ED0A 3PO4A 3K8WA 3CCTA 3LW5C 4TXSA 1TVRA 2H54B 1AB8A 2LYVA 3HF5A 4DL4A 4CM2A 1RWWB 1H0HB 1UVKA 2MEWA 2Z2MA 1FKPA 2JDJA 2ZOFA 4ICLA 5DJBA 3TUZC 2C2DA 3HHKA 1SXLA 4AQYE 1RT1B 2D9PA 2MJNA 1ZA1B 2J0WA 4CNYA 2ZM6E 2WW8A 4FXWA 2VHGA 2VFVA 2HFVA 2FLOA 3F0NA 3W7BA 2DIVA 5D0RA 4NLGA 2J6UA 1FKAE 4ZVHA 1RHKB 1DARA 3F44A 3NS5A 4P2FA 1A0OB 4X65F 3JSMA 4PYDA 2RF2A 2Y1IA 4LR8A 4C9DA 2IVFB 3VGTA 4QYZJ 4CCHA 2GMHA 2FVPA 1I5OB 1S1XA 2HW3A 1S7IA 4DFJA 2R7UA 4M63A 2KJWA 3OTOI 1OY6A 1UKUA 2HNZB 2IC3B 4JI6J 2DH7A 1U2CA 3M6UA 1B7FA 3FCWA 2EEYA 3KLIB 4BA2B 2AQ4A 1NK4A 2F8HA 4GKKI 3CJKB 1N34J 4KGVB 2VQFF 1Y60A 3S1TA 4MAKA 3U27A 3I87A 4LRDA 4CLWA 1UDOA 4ZP9A 3BH6B 1RB0A 3JTNA 3P3EA 2Y0SD 2HWTA 3KG0A 4RPFA 4MFBA 1EB0A 1WDTA 3OSNA 1NDCA 2MPUA 2OSRA 4AXJA 4E2FB 2YX1A 4MK8A 1DJ0A 4L75A 1JJHA 2MSSA 4ZITA 2FJAB 2BANA 3M4XA 5IQQA 1HWKA 4X65E 3A13A 3C6UA 1ZBTA 3IG1B 3PYFA 5C2GA 2HHHI 1YI2S 4MYUA 5A8WA 1D8ZA 1NSKL 3HLUA 3A8EA 4C3MA 3K5NA 3CC2S 1L3UA 2FVQA 1TL7B 3DYAB 2CJ9A 1MSWD 1X5OA 2JEFA 2J9DA 4HT7A 4K4ZA 1D09B 4FDFA 4KT0C 4F0MA 4B3TI 3TEHB 2OFHX 3BJYA 1GXTA 2E7VA 2O1TA 1LW0B 1V9OA 4DG1B 1ZM9A 1CJVA 2W2OP 1H98A 2Y1JA 2CZ9A 3JSYA 5KT6A 4A8OA 1NXIA 2V4RA 3RBEA 5BYSA 4J9OA 4Q7AA 2ZH4A 2FY1A 2ZH8A 3QIPA 3CCRS 1XMOE 4OX9I 1KP6A 2NXNA 2ATCB 2OFGX 3B54A 2VUGA 3ENVA 1T9XA 1S59A 5E5NA 3UR0A 3MUVP 2J0SD 1KTQA 1CLFA 4RW4A 3EE3A 1JLEA 2P6TA 3BR9A 2B7CB 3S6EA 2C28A 5E3CA 3FJ2A 4WE1A 2B4UA 5KG5A 4YY3E 1NAQA 3GE9A 1W25A 4I2PB 1M5SA 1XQIA 2VKRA 4M8LA 4N3OA 1KC8T 2LXIA 1NMEB 4PRFA 1UJ5A 4O44B 1VQMS 4LF9J 4QIEA 3AA8A 4ZLNA 3PX0A 4RBTA 1T02A 2O5DA 2LCWA 3OFFA 1N36F 1PJ7A 1S0MA 1Z5BA 2JEAB 1RTDB 4K2XA 4K0KJ 4J9QA 9RUBA 4JBCA 3W5YA 2Z5EA 4NYPA 4U6PA 1RT5B 3FSYA 3ZZUA 3ISZA 1M1HA 3I9V9 1WOSA 4FNHA 5KFGA 2H4YB 4RZRA 3MURP 4IRDA 1SVDA 2JE6A 1HNZF 1RXOB 2AEMA 4GKJF 3HJCA 3HKWA 2UUCE 3OHBA 4BC9A 2F9DA 4MH8A 3TZWA 2UXBJ 2KVIA 3BR8A 4M5JA 3P76A 1RADB 2QA2A 1KLNA 1NHJA 3D4JA 3MTJA 2JE6B 1RWVB 1VGYA 2ADCA 5A8KB 3GLLA 4OZLA 2P9EA 1DRZA 5FD1A 2E9TA 2JT2A 2RQMA 2U1AA 4B3TJ 4B3ME 2PE8A 4DUTA 4WZQA 4QNJA 2YKOA 1SH0A 2DR5A 3MOJB 4IS9A 2DHHA 3H4LA 2DNHA 3MEDA 4GVBB 4NOHA 2M70A 2E44A 2FIUA 3O3LA 4XDDA 1X4DA 3ZZTA 2FVSA 4C48A 4KBIA 4A46A 2QYCA 4ED7A 4I2QB 5HO4A 1VFJA 1KDNA 3BGFA 1Z0TA 1BY9A 1SIZA 4UOCA 1TL7A 3TJ8A 4I3HA 4JI3I 2KFZA 1RWOB 3OFHA 2BJ3A 4L73A 1N33E 4J5OA 5KG6A 1NK9A 3GFHA 3Q83A 3THTA 4B3MJ 3VAJA 2WVBA 5KFAA 2BOPA 4F4KA 3BBBA 4LRBA 4B3RJ 4JI8E 5K36D 1RQ0A 2BANB 4IFDD 4YDXA 3CUNA 1SJ4P 1WC3A 3OPKA 3R6LB 5F3ZA 1XTZA 4DG1A 1XMOF 2AHOB 3FEXB 2WK4A 4O3NA 1GXLA 1SH2A 5GMEA 2M52A 2XZWA 4WFNQ 4F2RA 2LQ8A 3CJ5A 1TAUA 2LXUA 3M9OB 3J81U 4MFBB 3J80Q 3M7ND 3HO1A 2LFVA 3OUYA 5HLFA 1UDSA 4USTA 1FJCA 1MU5A 5JEAD 4R0EA 1JJCB 2IJRA 2ADBA 1V6HA 3D67A 1CQNA 4RBUA 1RAOA 4LFAJ 3RU0A 5B0BA 2ASDA 1N54B 1FX2A 2FHMA 4CRJA 2DR9A 1UP1A 1AA1B 4JI2E 4DV6I 2ZC3A 3B78A 4H4OB 2M7SA 2XMUA 5CYQA 1NCLA 2QLBB 5JUMA 2IAJB 4FW4A 4CLTA 1YJTA 1YG0A 3TO8A 1S10A 1LNQA 4G65A 3TAQA 2GFFA 2VBXA 2OD6A 2PFFB 2HWHA 3GR0A 2KHCA 2ZOMA 3BPSP 3LTOA 4OYWA 3QJJA 1A9NB 2RHSB 2PIIA 2CPHA 1TV6B 4LF6E 1RZMA 4QW9A 5ETRA 3LANA 1VQPS 4B3RE 2OELA 3KLIA 3PYEA 2JWNA 2BJEA 3VV2B 3MF5A 2F1FA 2HVZA 2IM3A 2J7KA 3W8PA 1JLGB 5FIIA 1HQ2A 1SUQB 1TAQA 2CJYB 1N8RT 5HP1B 1XIQA 2HS4A 4PG5A 5J1NA 2F8EX 5C42A 2W2PP 4MU3A 3LO3A 5D4NA 3W9HA 4RW8B 2R7XA 3PM9A 4LSLA 3KMSA 4YUDA 3BM7A 4O4RA 3OTCA 5A6WA 3CPWR 2VA2A 1MMNA 1RHYA 2RRBA 5BR8F 4QPXA 1JXVA 2E29A 3E51A 3IGVA 5BXIA 1WKLA 2CQ1A 2VC1A 3O8WA 1RWPB 4M5MA 4QW8A 4AQYF 4J7CA 4A8XA 3VAGA 3P6YC 4B3TE 5HATA 3NY0A 3V6JA 3Q6NA 4DN9A 3JYTB 2BYCA 1FFWB 1HPZA 1WF1A 4LQ9A 5AXMA 4FVMA 4NLDA 2RRAA 1RT6A 1EA6A 3K85A 5F8NA 3D68A 5RUBA 2WONB 2GVDA 3PW7A 2XMVA 5DRPA 5JEAF 2V8PA 4L72B 3QAUA 3BYPA 3W8GA 2WHOA 4OX6A 4HH0A 2VFRA 1QDUB 3MMBA 2CQ0A 4M5NA 3PKMA 1HW9A 1UVJA 3MPUB 3Q89A 2A2DA 3SSQA 3QGPA 4JI0E 3K89A 3UDEA 4E0DA 1CJTA 3KLVA 3G71S 1U6ZA 1ACMB 3CO0P 3DGPA 2Y0BB 3DRSA 4B9LA 5D3GA 1F5BA 4IZKB 6AT1B 4ECTA 4N76A 4OHZA 3TVYA 2DEIA 3GCWP 4ZOSA 1Y3JA 4Q5VA 1O5JA 3M8RA 3Q1QA 4K4SA 4XAKA 1ZZFA 3DRPA 2VQEF 2OAUA 4EEYA 3R2CJ 1HD0A 3J81C 3E3XA 4B3SJ 2Z5BB 3E01B 1HNXI 1NM2A 1EP4B 4B3TF 5JMNA 3KLEB 5EN1A 2ZM6I 4X62F 1X5TA 5ETMA 1S6UA 3MMCB 2LJPA 3K57A 2CPDA 1OS5A 4TKTA 2DNRA 4OYMA 2E5IA 2NZCA 2N3OA 3T5LA 1FTRA 4GQUA 1LEOA 3OTDA 4E98A 2HPUA 2IOPA 2CPZA 1H72C 4A8YA 4RW7B 2IM1A 1BQNB 2MLXA 5KG0A 1SC1B 1GH8A 1KOOA 1SB6A 4P75A 4BBYA 3K58A 4BDPA 5KFQA 4IOCQ 3FBCA 3CDIA 2RDIA 4JI7J 3UD4P 3PCOB 3MZIA 5A8RB 2P5VA 3FK4A 4MKBA 3Q8RB 1U49A 2KXHA 2OPSA 4HDGA 4ZLLA 1YHCA 5B0FA 1VRTB 3EZUA 4LF6F 4NASA 2JX2A 2X3GA 4WE1B 4LCFA 1VISA 3SCKE 1T11A 3RJMB 4CLPA 3G6YA 2E5LF 4HL9A 4RW6A 1UZHA 4N7TA 4QR2A 3ZZOA 4OJGA 2K1RA 3AOAA 2DRAA 3ZO7A 3C19A 3MPDA 3MUTP 1IM6A 1EAYC 1PC5A 3JS9A 3AT1B 2XMWA 4OZJA 1FDDA 3V6DA 1N32I 4GMKA 2AZ1A 4X64F 2EG1A 3AH6A 1JMTA 2G2OA 5I42B 2ZC4A 2VICA 5DM7Q 1S1VB 2HBYB 2IVMA 2N7YA 3CJ4A 3G96A 5FWKA 4MK7A 1AZSA 1X4FA 4DV1F 2WVEA 1R31A 4WU3A 2W2MP 1G7CB 3DYAA 3G4SS 2VQEE 3PJ9A 4LVOP 3MM5A 1PJ5A 3GG1A 1KKHA 2CNNB 3FZBA 2Z5CA 4LFAI 4U8YA 2BJ8A 3VHQA 4B9NA 2BJ7A 2HRYA 3WC0A 4N77A 4OZ3A 3MXHP 4K4UA 3RG6A 2NXCA 2V0NA 2LKZA 2VH7A 3A1YG 5BYQA 8ATCB 3Q0AA 3V6HA 4KFBA 1IBCB 4UTGA 3TQ1A 4WFXA 2FJWA 4DV7F 3ET6A 4JI5F 2F1DA 2DNOA 2RD5C 3VAFA 1QM9A 4USJC 5LM7E 6FD1A 3OW2R 3ITHA 5K20B 4ZP8A 4EBCA 1JB0C 1X31C 4NLOA 5H9FJ 5DRQA 2WOMB 3T6JA 3R5CA 2CQ2A 2GGPB 2V8GA 4OYAA 2B9YA 1K9MT 1Q8KA 4OI4A 2R7VA 1FRXA 4QIWD 3M7VA 5IT0A 1QUPA 4JV5I 1Y6ZA 1PC4A 2HQGA 3BH7B 1X4CA 2YNGB 4C98A 3NBPB 4JYAI 3UD3P 4PWDA 1DZ5A 4BWJA 3VGSA 2B8QA 1P27B 3X3UA 2UUCF 2YKNB 2FDNA 2OEJA 2HHPA 1CSJA 1M5KC 4IFVA 3W61A 1CULB 2EVZA 1MROA 3ZZYA 1N0VC 5F0WA 1Z0GA 2EC2A 1X4AA 4OX8A 2UU9J 2RAQA 1CS4B 3HCXA 5ITHA 2KO1A 4KHPF 3EICA 1V3ZA 1L3SA 1IVZA 2BA1G 4DV0E 2MB0B 2XULA 3ZTPA 4YP3A 4DR3I 2HFNA 1O0PA 2X3DA 4WXOA 3J7Z5 2V8HA 1VBXA 1S9EA 1N5YA 1I6JA 1NEEA 4NI2B 4P9SA 3M32A 2G1DA 5FLXY 3EDRB 2VODA 1CJUA 4X2BA 2I5JB 2VQFI 2KH9A 2UXCI 2GIFA 4AT1B 4ETZA 4AE5A 3DXBA 5CCLA 4QWEA 2W7OA 4ECRA 4AIMA 1U1LA 5HVFA 5EHHA 1UETA 3NLCA 3O1LA 5KG7A 5JVHQ 4IO1A 4P71A 4KKOA 1MG7A 3OTOJ 2GA7A 4A8SA 4FBTA 3OQ2A 3E2EA 5K36E 4ZJLA 2HURA 1WTFA 4ZPCA 1VHFA 1LK7A 2B9EA 2VFTA 1FT8A 1XMOI 4CLKA 1WNEA 3NNAA 1VQ6S 4YY3J 3KLFB 4EYHB 5DLFA 3ISND 5THWA 1NBEB 3TWZA 4DR2I 2XYGB 2BVZA 3GB0A 3Q8VA 2G0CA 4FPIA 2ASYA 4OYBA 4ZPVR 3TI0A 1A6FA 1Z5AA 4DUYI 2Q79A 3CWVA 3D0GE 3NGSA 3LF0A 3IRWP 2ZBRA 3DDIA 5U47A 1IQTA 4AD6A 2CJAA 3D3CJ 2ZDOA 4NLPA 1CULA 2PC6A 3RUBL 3MUMP 4DSIA 1SUQA 2VC0A 4FW5A 4JI2J 2YKNA 4PG8A 1CG2A 3K17A 4NEYA 1FRHA 2MKHA 2QL9B 4TN2A 5L1IA 2FJDB 4DV5I 2YNFA 3IA0A 5I3PA 2PO2B 1XJWB 5J1EA 3K2YA 2DH8A 2XMMA 2FLNA 2K3KA 1U48A 1WF2A 8RUCA 2MKCA 2XSFA 4WYLA 4J9PA 4X66E 3QFWA 2XZDB 4CQ1A 1FDBA 2VG7B 4KRWA 4URGA 5JJBA 2HAFA 4DR4J 3C15A 2C2ZB 1HQEB 2MJUA 2SXLA 1XHKA 4FXDA 2EI5A 3CVKA 3EGZA 2UV8A 1UWBA 3FZ2A 3KUHA 3QYYA 4FW3A 4DV7E 2IAJA 4X65J 2FC8A 1NK6A 1HNZI 5ETLA 1PJ6A 2HKEA 2E5LJ 2CADA 5KFOA 1FRKA 2DEJA 5BR8I 1KHVA 2YX7A 4CTAA 2HVEA 1UVMA 1Y5YA 3PW0A 2UUAE 3I4HX 4B3SI 3OJSA 3EJMA 2HLUA 2OEMA 1JXLA 2RIJA 2MKYA 2Y8YA 1NJYA 2MQMA 3GZ7A 3ZKBA 3JAMC 1WHWA 5C0XF 3B8HA 3EXCX 4PCQA 3J81j 1J5EI 1F9EB 3TAMB 2E1RA 1NPRA 4IG0B 3V2UC 4KGZB 4EI2A 4DZ6A 2LU2A 4DFPA 3O5TB 3FGVA 3LALA 5L38A 1GFWB 2ZH9A 1U7LA 1TK5A 4LOMA 5JEAB 3CCES 2O3ZA 3KK2B 3L3CA 5K8OA 3BO3A 4QPTA 2CQHA 2V69A 1DTTA 3AB2B 3LGNA 4HEA9 5MLCV 5J2QB 1H7UA 3MM8B 4DR5I 3VGVA 2K06A 4PWUA 4RW6B 3TYTA 1USVA 5DRKA 5C24B 1U25A 4FPRA 4XTTA 1GQEA 3GU0A 1NK7A 2AIRB 2MHNA 3L7OA 1H7XA 1YLXA 4HACB 4DWIA 4DR7J 1IBKI 1RSCA 2GMLA 4FYVB 2C38B 1FE0A 2YQ1A 4OV6A 4M5DA 3BV8A 3OR1A 2IFXA 3TUJC 3G8TA 4LCHA 1QE1A 2B0GA 5H9EJ 2RDDA 3CJSA 4NXNI 1HA1A 2ASLA 1I1GA 3I4PA 1NHHA 3I96A 3L4BC 4OI2A 3FCVA 5KT7A 1S97A 3WQPA 1QAXA 2CA9A 5IFMA 2PO0A 5EL9A 4JI7E 5KFTA 4RKUC 2VQEI 1T0TV 1RTIB 3CE8A 1FFGB 4CI0B 2VL1A 2Z2ZA 1TKZA 4OLPA 1E6VA 2UXCE 5K8NA 3J7YU 3PRBA 4C8OA 5CABA 1BC6A 3PW4A 3G82A 4FWGA 2B5JB 3QPIA 4FXVA 2UU9F 4P2MA 3IAS9 4CH1A 3ADAC 4KH1B 3HD2A 5KFWA 1WI8A 5A0YB 4J9LA 3IWXA 2XWXA 5HSPA 3DD6A 1VIOA 2BEFA 3QT7A 2QTWA 6FDRA 2P6SA 1YBTA 4O4GA 2P8IA 3R1LA 4QU6A 3C15B 3SCLE 1WUUA 1VK3A 1I94F 1D8YA 4CT9A 4FF4A 5B0AA 2H65B 5HVGA 1P1TA 3A3NB 4PG7A 5AXNA 2QL7B 4U3BA 1C1BA 3BBFA 5ETTA 3HDSA 5IV3A 1K0TA 3R7NB 4EWTA 4K0KF 5IT4A 3TA1A 3AAWB 2J0QD 2UUAJ 3RAMA 1NK0A 1B63A 4I64A 1RAFB 4NEZA 2E66A 4WP3A 3QJLA 1XNRI 1NSAA 4X4SA 3NCRA 2XZTB 4LBHA 1WTBA 1D9FA 1JLEB 1SQGA 1X8DA 3QIDA 3UD5A 4J9SA 3M30A 4URSA 3H7HB 4IFVB 2OMOA 2WONA 3KK3B 3CO9A 2V68A 5LXYA 5CZVA 2XMAA 1YJ9S 2K7JA 2D69A 2WBRA 1UAWA 1RYRA 4E8UA 2AGQA 1X4HA 5HMXA 4DV4E 1PCAA 2ROPA 3M9MB 4MU1A 1S4EA 2HFSA 5E3AA 1NKEA 1L5UA 2YKMB 3B4TA 4U3DA 1N36I 5DZ7A 3LWMA 4GKJI 2CQ4A 1UEKA 3UVJB 4Z2XA 2PI4A 2DHXA 3POTB 3W5ZA 4ECXA 2NCKL 3T5KA 3B4DA 4ZPWR 3OVAA 5ELWA 4OMFG 1BWEA 2JEJA 2E5HA 2X1GA 3GFZA 1Q8LA 3VZIA 3HVRA 4KKOB 3QATA 1K1QA 4HYKA 4LF4F 1SJQA 3OXLA 3EPIA 1B99A 3PRDA 5A0YA 3SZ2A 2IJFA 3BKFA 5D0HA 3NL0A 4RWWA 2BR0A 1RYSA 1IKYA 2LLZA 4DR4F 5KT2A 2R7SA 1FX4A 4PQUA 3IC1A 1RT4B 2HGNA 3HD1A 4EO8A 4ZS6A 3B4MA 4M1KA 5DO2A 3GV5B 2AX0A 2JFKA 2PNZA 3P96A 3CSKA 1KLMB 4N47A 1CS4A 1EJ7L 2J76E 4JI4I 2AE8A 4C8ZA 5GAEI 1Q82T 4WFYA 3HHEA 1MROB 4J9KA 5GAGI 1U2FA 1FERA 2DXDA 2W01A 2PMWA 4TQRA 1S1TA 4HKQA 3DOLB 1YX2A 3U1YA 2R8KA 2C2MB 2R42A 1S57A 4CLFA 2FPHX 5J2PB 2EPIA 3PJWA 3M7NG 4YB7A 3SEOA 4B02A 1VIXA 2J0XA 2V94A 4Y0FA 4U7UK 4HH1A 1FTCA 3X1LB 4PQAA 4WIIA 4CH7A 1RU1A 1HKAA 1HI0P 1RT2B 4LCGA 4Z7CA 2MLZA 3TAPA 3GIIA 3ETMA 2NN6B 3U1KA 1ZTWA 4URQU 2CQ3A 4TLRA 2KT5A 1T9UA 4USVA 1Z0VA 1FWPA 3DXSX 4MIBA 1P42A 5C0XD 4B3SE 1FDAA 1R89A 3K59A 3VF0B 3CCMS 1NNDA 3IP0A 2WZ1A 3OTOE 2H5IB 2ZZTA 1OQ6A 1Q5VA 1HNVB 4OHYA 4UQTA 1QD1A 3C3LA 1S16A 3D9BA 3MMCA 4RNNA 2DO4A 4DR1E 4NXMI 5KAKA 3KWMA 3UNGC 2H1YA 3QZ7A 2RU9A 1VJWA 4M95A 1WC1A 5D0GA 4DBQA 3EVMA 4LR9A 2UU9I 4DUZI 2VG5B 3QMQA 2ZBQA 3CW2C 4F7VA 3G2XA 3H4BA 4UUXA 2R2SA 1NO8A 1X4GA 1VQ7S 2FLPA 2UVUA 1Y4SA 4KAIA 4JI5I 4NYZA 3R7SB 1RBAA 1U0HA 1IQZA 5LMNI 1FA0A 2VG7A 4Y34A 1NB7A 2R7RA 3CCUS 1K47A 2VA3A 3HVAA 5M2PA 3MTKA 2LP4A 3OL7A 2RSQA 1VQKS 1DLOB 4F4YA 4DF8A 1QZRA 2ZHBA 1VMBA 4MTPA 3B82A 2ZWOA 3FNNA 5B08A 3T1YJ 2BOAA 3GJSB 4C8LA 4OO1B 5GVQA 5D4OA 4DV2I 2DXEA 4IZJD 3CDBA 1RT7A 4LSZB 1IKVB 1UWAA 1PYOB 3VTIA 1LFWA 2QZ8A 2ZUAA 3MPVA 4RW7A 3CCSS 3M8WA 4FYWB 5KFHA 5D6GA 2BABA 2JSXA 2YTCA 1AFIA 2ALZA 1C0UA 2RB7A 1WHVA 3GIRA 2Q2EB 2NZ4A 1RWXB 1ZPWX 4MKYA 5IT9U 4IG3B 3AD7C 1TKXB 2G4BA 3PS2A 1NHKL 5A6PA 4C3KA 4DV4J 2HNDB 5EWEA 3M6AA 3TVZA 1GTEA 1SKWA 1HMVA 1I51B 4ECVA 3CJRA 4F36A 4P2XA 3PVXA 4ILLA 1F6TA 4NLTA 1LWXA 4NXNF 1UW4A 3IS9B 2MYFA 4P52A 4B3MI 4CM0A 2KG0A 1RI7A 3Q24A 2I2YA 2MMYA 4RNHA 3BGOP 1ZAXA 2MY7A 2W4PA 3QAEA 3VALA 3CC7S 5HMWA 2F40A 4O3OA 2C2RA 5DNXA 1W2IA 4DPXA 2LEAA 4WUBA 4QQBA 3T1HJ 2RQ4A 3PFEA 3N5BA 3NCPA 4PPZA 2CWKA 4LF4J 3TZZA 1C1CA 3T6BA 2DHSA 4DR5F 1TV6A 2XTJP 1UVLA 1Q0NA 4GC7A 2W4DA 2ZBPA 1IUJA 2J6SA 5C5JA 3FRYA 4UUWA 5AXLA 5HMYA 4A8WA 4IR9A 1UVIA 2CGEA 1OYDA 2BJ9A 3GTYX 5DDQC 4AM3A 2OMLA 3M2UA 4ED3A 1LWFB 1T9YA 1EETA 3HHLB 5CYMB 5SUHA 4NZ7A 1S1WB 2ROGA 3UDLA 1S6OA 4ES3A 2RT3A 2LECA 2I0XA 4WTOB 5CXTA 4JI0I 4ZMMA 3D7SB 5GMKa 4D3HA 5IQ6A 3KLGA 3MM7A 2V5HG 1N5TA 3EGNA 3H2UB 5EDWA 2XMTA 2Q3PA 5C7PA 5E41A 4DR1F 5J2NA 2E1CA 1TKDA 1EIYB 3PHTA 2YH0A 2C2EA 3RB3A 4ZVSB 3D1QA 2LQJA 2J7WA 2QLXA 3C66A 5HN0A 3MPYA 1Q79A 5LMNE 4F04B 2LA6A 3MD1A 4ZLJA 4FWDA 4NX9A 2RDJA 4DL3A 3EVWA 2POKA 3PYGA 1N34F 3K1JA 2D3ZA 2HBZB 4MU0A 2KZZA 3EDQB 1WWHA 4F50A 1NRKA 2B9WA 2LQ9A 4IDKA 3W60A 2HZVA 1TFYA 1TR0A 1O6XA 1RKIA 2KVQE 2V4JB 2HNZA 1Y7PA 2IC3A 3D6TB 3M8QA 4PR6A 2ASJA 1QLNA 2BQRA 1DTQA 1AXQA 1VQSA 3M2UB 2ZVIA 3DLBA 2OO4A 2DT9A 1S79A 4NLUA 4P6QA 3MM5B 2RF2B 2BACA 3BZQA 1UFWA 5LJ3Y 4F8RA 1QSYA 1HI8A 1RBLA 5HBMA 4ZPBA 4JI5J 1BQXA 3JXOA 4NYOA 3KNAA 1NZ8A 4C0HA 3IM9A 5LMNF 5I42A 3U1MA 1F0XA 3DLKB 2M88A 3CNQP 2FZKB 1R8BA 1XNRF 2HHUA 1E6YA 1SC3B 3MR6A 3TVKA 4KIAA 5F3TA 4X66F 3W66A 2ZH3A 4F0HA 2DH9A 2K1RB 4NLRA 3NMAA 1F9FA 2BW2A 5B0EA 2DJWA 3LP2B 4H4MA 2W4CA 3IS9A 4DN0A 4F4XA 3JSRA 4MJKA 1IBLI 1IBMI 4JI6I 4Q45A 2OIHA 2HHQA 2R7WA 4LFCI 3UR3C 3VQTA 2GO9A 5GAHI 3RRHA 1U09A 1YKWA 4NLSA 4JP8A 4LF2A 2YKAA 1GXUA 3PKYA 4URLA 5L3JA 1WC0A 1APSA 3IXQA 4HTJA 4KHPJ 3PIPQ 1VQYA 3HP6A 5KT4A 2WNRB 1RT5A 3MAHA 1FRMA 5DGBA 4O3PA 3UQSA 1R8CA 2AU0A 4WKRA 2CJXB 3BGUA 1X9WA 3V6KA 2OD4A 4ZP6A 1KTVA 1Q8BA 2HAIA 3AD8C 3Q86A 4UOGA 1G6BA 4LBIA 2DB1A 3ENWA 2HHSA 3I5AA 4GKKE 3FVYA 4B9UA 3TJ9A 3SQGA 2BM0A 5KFMA 4X4UA 1N0UA 2QL5B 2FY8A 3BKTA 1Z1ZA 3GYNA 4I2PA 4QOTA 5HROA 3R5AA 4RW9B 2CAJA 3E01A 3J80U 3J81Q 2RUGA 1RUSA 2DXFA 4J37A 4ZDNA 4EZ9A 1YGYA 1RGVA 5CAAA 5KG3A 1YRXA 4RNOA 4GKJJ 1IXKA 1U0HB 3LAKA 5LL6R 2L9WA 4LF1A 4PG4A 4YFUA 4DQSA 1KQFB 3J80C 1KIJA 3D54A 4DX5A 1GK8A 4K5SA 3N01A 4WFBQ 3ZNJ1 2R3VA 3D66A 2NSCA 3DLHA 4DEZA 3AJDA 2UUBI 4JI1E 5KFPA 3FQKA 4DV6E 5C2CA 5IC4B 4HHUA 2QX0A 2ILZA 2QSFA 2B4OA 3L9ZA 4OO1C 2A3JA
chains in the Genus database with same CATH topology
4DPUA 4LFAE 4DR6E 4DU7A 2IOPA 1H72C 1Z0WA 1XNRE 1B62A 5IT9Q 2CG9A 2OI2A 2V34A 4HXZA 1MX0A 1N34I 1VISA 2HK2A 1HK7A 3LPSA 4LF4I 4DR5E 1N32I 5FWKA 1BKNA 3WU4A 1FWLA 2VQEE 1XMQI 1KKHA 2Z5CA 2UUBI 4LFAI 2HKJA 4DPWA 1U2RA 3P06A 4GKJE 4UTGA 1ZM2A 4K0KE 1Z0EA 4FN5A 4JG4A 3T1YE 4JV5I 1HR0E 4PRXA 4DUYE 4LF9E 1Y6ZA 4JYAI 4HY1A 4KHPE 4JI1I 1PVGA 4KHPI 2E5LE 2UUBE 4PRVA 1J5EE 1N0VC 4DR1I 4DR7E 4DV0E 3PRYA 1FJGI 2HK3A 2UXDE 4DR3I 1H73A 4B3RI 2VQFI 2UXCI 1Z59A 5LMUI 4MYTA 1NZ0A 4USMA 1MG7A 2V2QA 3K1JA 4JI3E 1XMOI 4DR2E 4USKA 2E5LI 4NXNE 4DR2I 1N32E 1Z5AA 1A6FA 2ZITA 1RR9A 4DUYI 4LF9I 2Z5BA 1Z0BA 3CWVA 2XEXA 1XNQE 3JAMQ 4YHHE 1Z0GA 3ZKDA 1XNQI 4DV1E 4P7AA 3K17A 4IZKA 2UUCI 4DV5I 4DV5E 4JI2I 4AQYI 4LF6I 4X66E 4IZJB 4X66I 4JI5E 1XHKA 1Z5CA 2IOQA 5LL6R 1ZXMA 4DV7E 4HYMA 2EFGA 5BR8E 1HR0I 1OJ4A 1HNZI 4JV5E 2HKEA 5BR8I 2DEJA 4YY3I 5FLXC 4ZVIA 3T1HE 1RREA 2Z5CB 3ZKBA 1N33I 3JAMC 2F4VI 3J7AM 3B8HA 1J5EI 1ELOA 2E1RA 1FNMA 3V2UC 1USUA 2O1WA 1H7UA 1PIEA 3J7AG 1EI1A 4DR5I 2A2CA 4HACA 1USVA 4LF5I 1MU5A 4HACB 4UT4A 2GQ0A 2UUAE 1IBKI 1HNWI 4NXNI 4R1FA 1NHHA 5IT9C 5A2QC 1IBLI 2VQEI 2UXCE 4Z7YA 4FWGA 2O1VA 4NXME 4KQVA 2PNMA 1IBME 3QT7A 1IBKE 1WUUA 4DV3E 4OX9E 2X7IA 1B63A 4JYAE 4LF7I 1XNRI 4LFCE 3LNUA 4DR6I 5FLXQ 2F4VE 4DV4E 1ZM4A 1S4EA 2HFSA 3HULA 1N36I 2UU9E 4GKJI 1UEKA 2VQFE 1H7SA 2AJ4A 4JI6E 4LFBI 3WU3A 4X65I 4AQYE 2ZM6E 4DV2E 3F0NA 4DXLA 4M1KA 4DPTA 4X62I 1FKAE 4DR4E 1FWKA 1DARA 4JI4I 5GMDA 3OTOI 2R42A 4WUDA 4GKKI 2GS8A 1D6TA 2WW4A 4Z7CA 2ZBKB 4RPFA 3WU5A 3PYDA 1Z0VA 1HNZE 4X65E 4X64I 3PYFA 4LF8E 1ZM3A 2UUAI 1XMQE 3OTOE 4MYUA 4JI8I 4DV1I 1S16A 5LMUE 4DR1E 4B3TI 4NXMI 2O1TA 2UXBI 1NHIA 1ZM9A 4EMDA 2UU9I 4DUZI 2CZ9A 2X36A 1XMOE 4XTJA 1Y4SA 4OX9I 4JI5I 2HHHI 5LMNI 1Z0CA 1K47A 4IZJA 4DU8A 2VF3A 4YY3E 2BV3A 4N3OA 3T1HI 4K0KI 1QZRA 3B82A 4IZJD 4DR7I 1HNXE 4YHHI 2Z5EA 3V5RA 1H74A 4JI4E 4LF8I 3ZZUA 4LF7E 5IWAE 2Q2EB 4DUZE 3HJCA 2UUCE 3M6AA 3ZM7A 3QT6A 1NHJA 3D4JA 2UXBE 4LFBE 1FJGE 4B3ME 3QT5A 4P52A 4B3MI 3H4LA 2BM1A 4DPXA 4WUBA 3ZZTA 4DV7I 4DV0I 1I94E 1IBLE 4LF4E 4JI3I 4I3HA 5IWAI 5A2QQ 2CGEA 3QT8A 1KVKA 1N33E 4JI8E 4JI0I 4JI7I 1Z5BA 4DPYA 1Z0TA 4JI7E 5GMEA 2V2VA 4DR3E 3J80Q 2HHHE 5LMNE 4FWHA 4FWDA 3PYGA 4JI2E 1I94I 4DV6I 3B78A 4B3SI 4DV2I 3Q6MA 4B3SE 3T1YI 3LTOA 4LF6E 2PNLA 4PU9A 4B3RE 2NPFA 4X64E 3PYEA 1N34E 2J7KA 4DV4I 2HFUA 4LF5E 4JI6I 1IBMI 1ZXNA 4LFCI 4WUCA 4URLA 5L3JA 4B3TE 3Q6NA 1EA6A 3K85A 1FI4A 1KTVA 2V8PA 2V2ZA 1PKPA 4X62E 4DR4I 4GKKE 2BM0A 1N36E 1N0UA 2A2DA 4JI0E 3J81Q 2UXDI 3WU6A 4IZKB 2DEIA 3Q1QA 3ZZ0A 3J80C 1KIJA 3J81C 2R3VA 1HNXI 2Z5BB 1Y4UA 4JI1E 4ED4A 4DV6E 2ZM6I 4FW9A 2O1UA 2LJPA 4DV3I 1HNWE 3GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPU A;  4LFA E;  4DR6 E;  4DU7 A;  1H72 C;  1Z0W A;  1XNR E;  1B62 A;  5IT9 Q;  2OI2 A;  2V34 A;  4HXZ A;  1MX0 A;  1N34 I;  1VIS A;  2HK2 A;  3LPS A;  4LF4 I;  4DR5 E;  1N32 I;  1BKN A;  3WU4 A;  1FWL A;  2VQE E;  1XMQ I;  1KKH A;  2UUB I;  4LFA I;  2HKJ A;  4DPW A;  1U2R A;  4GKJ E;  4UTG A;  1ZM2 A;  4K0K E;  1Z0E A;  4FN5 A;  4JG4 A;  3T1Y E;  4JV5 I;  1HR0 E;  4PRX A;  4DUY E;  4LF9 E;  4JYA I;  4HY1 A;  4KHP E;  4JI1 I;  1PVG A;  4KHP I;  2E5L E;  2UUB E;  4PRV A;  1J5E E;  1N0V C;  4DR1 I;  4DR7 E;  4DV0 E;  1FJG I;  2HK3 A;  2UXD E;  4DR3 I;  1H73 A;  4B3R I;  2VQF I;  2UXC I;  1Z59 A;  5LMU I;  4MYT A;  1NZ0 A;  4USM A;  1MG7 A;  2V2Q A;  3K1J A;  4JI3 E;  1XMO I;  4DR2 E;  4USK A;  2E5L I;  4NXN E;  4DR2 I;  1N32 E;  1Z5A A;  1A6F A;  4LF9 I;  1RR9 A;  2ZIT A;  4DUY I;  1Z0B A;  3CWV A;  2XEX A;  1XNQ E;  3JAM Q;  4YHH E;  1Z0G A;  3ZKD A;  1XNQ I;  4DV1 E;  4P7A A;  3K17 A;  2UUC I;  4DV5 I;  4DV5 E;  4JI2 I;  4AQY I;  4LF6 I;  4X66 E;  4X66 I;  4JI5 E;  1XHK A;  1Z5C A;  5LL6 R;  1ZXM A;  4DV7 E;  4HYM A;  2EFG A;  5BR8 E;  1HR0 I;  1OJ4 A;  1HNZ I;  4JV5 E;  2HKE A;  5BR8 I;  2DEJ A;  4YY3 I;  5FLX C;  4ZVI A;  3T1H E;  1RRE A;  3ZKB A;  1N33 I;  3JAM C;  2F4V I;  3J7A M;  3B8H A;  1J5E I;  1ELO A;  2E1R A;  1FNM A;  3V2U C;  1H7U A;  1PIE A;  3J7A G;  1EI1 A;  4DR5 I;  2A2C A;  4HAC A;  4LF5 I;  1MU5 A;  4HAC B;  4UT4 A;  2UUA E;  1IBK I;  1HNW I;  4NXN I;  4R1F A;  1NHH A;  5IT9 C;  5A2Q C;  1IBL I;  2VQE I;  2UXC E;  4Z7Y A;  4FWG A;  4NXM E;  4KQV A;  1IBM E;  3QT7 A;  1IBK E;  1WUU A;  4DV3 E;  4OX9 E;  2X7I A;  1B63 A;  4JYA E;  4LF7 I;  1XNR I;  4LFC E;  3LNU A;  4DR6 I;  5FLX Q;  2F4V E;  4DV4 E;  1ZM4 A;  1S4E A;  2HFS A;  3HUL A;  1N36 I;  2UU9 E;  4GKJ I;  1UEK A;  2VQF E;  1H7S A;  2AJ4 A;  4JI6 E;  4LFB I;  3WU3 A;  4X65 I;  4AQY E;  2ZM6 E;  4DV2 E;  3F0N A;  4DXL A;  4M1K A;  4DPT A;  4X62 I;  1FKA E;  4DR4 E;  1FWK A;  1DAR A;  4JI4 I;  5GMD A;  3OTO I;  2R42 A;  4WUD A;  4GKK I;  2GS8 A;  1D6T A;  2WW4 A;  4Z7C A;  2ZBK B;  4RPF A;  3WU5 A;  3PYD A;  1Z0V A;  1HNZ E;  4X65 E;  4X64 I;  3PYF A;  4LF8 E;  1ZM3 A;  2UUA I;  1XMQ E;  3OTO E;  4MYU A;  4JI8 I;  4DV1 I;  1S16 A;  5LMU E;  4DR1 E;  4B3T I;  4NXM I;  2UXB I;  1NHI A;  1ZM9 A;  4EMD A;  2UU9 I;  4DUZ I;  2CZ9 A;  2X36 A;  1XMO E;  4XTJ A;  4OX9 I;  4JI5 I;  2HHH I;  5LMN I;  1Z0C A;  1K47 A;  4DU8 A;  2VF3 A;  4YY3 E;  2BV3 A;  3T1H I;  4K0K I;  1QZR A;  3B82 A;  4DR7 I;  1HNX E;  4YHH I;  3V5R A;  1H74 A;  4JI4 E;  4LF8 I;  3ZZU A;  4LF7 E;  5IWA E;  2Q2E B;  4DUZ E;  2UUC E;  3M6A A;  3ZM7 A;  3QT6 A;  1NHJ A;  3D4J A;  2UXB E;  4LFB E;  1FJG E;  4B3M E;  3QT5 A;  4P52 A;  4B3M I;  3H4L A;  2BM1 A;  4DPX A;  4WUB A;  3ZZT A;  4DV7 I;  4DV0 I;  1I94 E;  1IBL E;  4LF4 E;  4JI3 I;  4I3H A;  5IWA I;  5A2Q Q;  3QT8 A;  1KVK A;  1N33 E;  4JI8 E;  4JI0 I;  4JI7 I;  1Z5B A;  4DPY A;  1Z0T A;  4JI7 E;  5GME A;  2V2V A;  4DR3 E;  3J80 Q;  2HHH E;  5LMN E;  4FWH A;  4FWD A;  3PYG A;  4JI2 E;  1I94 I;  4DV6 I;  3B78 A;  4B3S I;  4DV2 I;  4B3S E;  3T1Y I;  3LTO A;  4LF6 E;  4PU9 A;  4B3R E;  2NPF A;  4X64 E;  3PYE A;  1N34 E;  2J7K A;  4DV4 I;  2HFU A;  4LF5 E;  4JI6 I;  1IBM I;  1ZXN A;  4LFC I;  4WUC A;  4URL A;  5L3J A;  4B3T E;  1EA6 A;  1FI4 A;  1KTV A;  2V8P A;  2V2Z A;  1PKP A;  4X62 E;  4DR4 I;  4GKK E;  2BM0 A;  1N36 E;  1N0U A;  2A2D A;  4JI0 E;  3J81 Q;  2UXD I;  3WU6 A;  2DEI A;  3Q1Q A;  3ZZ0 A;  3J80 C;  1KIJ A;  3J81 C;  2R3V A;  1HNX I;  4JI1 E;  4ED4 A;  4DV6 E;  2ZM6 I;  4FW9 A;  2LJP A;  4DV3 I;  1HNW E;  3GON A; 
#chains in the Genus database with same CATH topology
 2KU7 A;  4EYI B;  2OJ3 A;  1WG4 A;  3K0J A;  3AFG A;  4C4W A;  4DR3 F;  2XI3 A;  2XS2 A;  1IBK J;  3MR5 A;  3MGJ A;  3ZZR A;  4OO1 E;  2PA3 A;  2A1B A;  5EWG A;  1M5P C;  1U1P A;  2KB2 A;  4DFK A;  3JYT A;  2WNR A;  1XNR E;  2D9O A;  1MLA A;  1UDN A;  3CJ0 A;  1OO0 B;  2APO A;  2EFQ A;  4KYZ A;  2W9B A;  5HVH A;  1PSD A;  1XNQ F;  1MX0 A;  5M2U A;  2J9E A;  2HFO A;  2A10 A;  4CP5 A;  2AYG A;  2HHV A;  3NS6 A;  4JI8 F;  3R3T A;  1Y0H A;  2I6W A;  1N33 J;  2JEG A;  3BYR A;  1HK7 A;  3D2W A;  1KFD A;  5ETK A;  2CJB A;  2W7P A;  1N5Q A;  3SFU A;  1OYR A;  1NLK L;  3L7Z B;  3LPS A;  4USH A;  1SL0 A;  1EQ0 A;  1S6P A;  1DTQ B;  1ICE B;  1RWK B;  2DNP A;  2KKH A;  3QIP B;  4DR1 J;  3VCD A;  1M0S A;  2D3O 1;  5JEA A;  5IS2 A;  3AD9 C;  1NU4 A;  4W90 B;  3R6G B;  4KTQ A;  4PWD B;  4EK2 A;  7FDR A;  1JXE A;  1JIH A;  2C3O A;  4MT1 A;  4LFA F;  1NKC A;  2OPR A;  2C39 B;  2PO1 A;  5HBM B;  2QO3 A;  4N5S A;  1BKN A;  3WU4 A;  2DNG A;  1X4E A;  2IJN A;  2JZ5 A;  3QO9 B;  5A2Q U;  4U67 Q;  3BO4 A;  2R7O A;  3SI8 A;  3W2V B;  1MML A;  2HKJ A;  3UCZ P;  5J2N B;  1U2R A;  3OTE A;  3O44 A;  1NH8 A;  4USU A;  3OTB A;  4ZVQ B;  3TZX A;  3IRX A;  2QJ3 A;  1FD8 A;  3I6P A;  2XYP B;  3KOA A;  2UXD J;  3MMA A;  1NJW A;  4L74 A;  1D1U A;  4B9T A;  4KFB B;  1J2V A;  2A6M A;  3B6B A;  3SCJ E;  1ZM2 A;  2P9G A;  5HJY A;  3PDN A;  2KT3 A;  4QR0 A;  2Q6C A;  4IH6 A;  1HBO A;  2BRL A;  4J9N A;  5KFF A;  5E7O B;  4XPC A;  2XMK A;  4PUO B;  1Z0E A;  2ZKU A;  3Q2S C;  1T9T A;  3CD5 A;  1HR0 F;  2DO0 A;  2OKQ A;  4NLX A;  1RDR A;  2MZJ A;  4FP9 A;  1CJK B;  4IFD F;  1QVG R;  3RAX A;  4LF9 E;  1HNI A;  4KHP E;  3VGU A;  1F5C A;  3A8K A;  1RA6 A;  2PD1 A;  2ROE A;  3HHL A;  5CYM A;  2NR0 A;  1OYS A;  3H5U A;  2E5L E;  4BWM A;  5C25 B;  4WFA Q;  1NDK A;  5BR8 J;  2UV8 G;  2EBG A;  2UUB E;  2ACM A;  3I32 A;  3PS3 A;  1J5E E;  2KXF A;  3T41 A;  1OPI A;  3KHH A;  4DR1 I;  5KG4 A;  4AQY J;  1BWV A;  4UOH A;  4ILM A;  1AT1 B;  1JNZ B;  2RE1 A;  2UXC F;  4H4K C;  2UUC J;  1FJG I;  2DTJ A;  3RBD A;  4S0M A;  1VRT A;  2Z30 B;  2BKP A;  5F8G A;  4Q2L A;  3L95 X;  1JKH A;  4LSN B;  3Q8S B;  2XSJ A;  4AYB D;  1TKX A;  2MKK A;  1NUE A;  4JI4 J;  4ZN1 A;  5F8L A;  3T5H A;  1FRI A;  1HWJ A;  4G1I A;  4P2S A;  4MYT A;  1LFP A;  5L46 A;  1K73 T;  3ZNU A;  2G0I A;  4HI1 A;  1QSS A;  1VBK A;  1NZ0 A;  1HFE L;  3GFY A;  3GYX B;  3MD3 A;  2QEX S;  2E1M C;  1R0C B;  4M5K A;  5AT1 B;  1HMV B;  4IYQ A;  2BQU A;  4DR2 E;  1R8H A;  3LGM A;  1HIY A;  4MKV A;  5KFK A;  4QWD A;  4DV0 F;  1R6L A;  2OPP B;  3KLE A;  1DLO A;  2HQ3 A;  3THP A;  2ZIT A;  4LF9 I;  2D7S A;  4M5H A;  4OLO A;  2Z5B A;  2UUT A;  4ILR A;  4B3S F;  2NN6 D;  3JAM Q;  4YHH E;  1R3N A;  3NKY A;  4NXM F;  3SFG A;  3GR1 A;  1ULR A;  2X1A A;  3MHY A;  2JOQ A;  1RTD A;  5H9E K;  3NZK A;  4ID8 A;  1A6L A;  3FMW A;  3W2W B;  1VJQ A;  2RJZ A;  5EUH A;  2AGP A;  1VQO S;  1YBU A;  4OJH A;  1UA0 A;  3Q8U A;  4K4T A;  1G4C A;  2GW8 A;  1T05 B;  4OX9 F;  3RTV A;  3SV4 A;  3T1A A;  5GAH U;  4JI2 I;  4NCB A;  2CYY A;  2BE2 A;  5C24 A;  4YDD B;  1G1X A;  4AQY I;  4LF6 I;  2CJQ A;  2KTQ A;  4Y2I A;  2A6O A;  4RW4 B;  2OUG A;  5ETV A;  3MDF A;  2AJQ A;  1ZAV A;  1S0V A;  5DRR A;  4H54 A;  3PR5 B;  3A8I A;  1XNQ J;  4U8V A;  1S99 A;  1Z5C A;  3AB4 B;  5HI7 A;  2VG6 B;  3TOQ A;  5KG2 A;  1HPZ B;  2H3E B;  4ECQ A;  4JI8 J;  1YSJ A;  1DAX A;  2EFG A;  3TZY A;  3CT9 A;  1N33 F;  4JV5 E;  4ED6 A;  2NXJ A;  1YJR A;  4C0O C;  4DI6 A;  1PYS B;  4RUC A;  3T1H E;  1S7H A;  4CYU B;  3UCU P;  2XS7 A;  3ILL A;  1FNX H;  1NDL A;  4KH0 B;  5D15 A;  2DNK A;  3J7Z T;  1N33 I;  4X84 A;  2V9W A;  1EKS A;  3BGR B;  4KSE B;  1PAE X;  5T7L A;  4LFC F;  2CIM A;  3J7A M;  3GME A;  4OI0 A;  2RRN A;  4C7Q A;  3IG1 A;  1FNM A;  4XO0 A;  1UPP A;  2HEK A;  3VAM A;  5C0X A;  4DUZ E;  3MM6 B;  2PSZ A;  5KFB A;  2YH1 A;  2E1P A;  4DS4 A;  3CME S;  4ATN A;  1HLW A;  3M6V A;  3RRK A;  5K8P A;  5KFJ A;  3H2V E;  4O23 A;  4TVA B;  4Y00 A;  3Q8Q B;  2GHP A;  3U7J A;  1PIE A;  2HIQ A;  3G6E S;  1EI1 A;  4OX7 A;  3Q2T C;  1JLF A;  2ZZM A;  1S0O A;  3UO0 A;  3PO5 A;  2MTL A;  3J7A 1;  2A2C A;  1R6Y A;  3VQS A;  1U47 A;  1IKW B;  4LF5 I;  3PJX A;  1KFS A;  2XNQ A;  1Q4R A;  1T94 A;  2QLW A;  1BD6 A;  2DBB A;  2YWW A;  3CMQ A;  3NGR A;  3QSI A;  5KFV A;  5CA5 A;  2RHQ B;  4F4A A;  1U1Q A;  1HHT P;  3PY8 A;  2C39 A;  3BF4 A;  3TUI C;  2NN6 F;  5C0X E;  2BRK A;  5BJR A;  2CZV C;  1HNW I;  4M5L A;  1U1M A;  4JYA J;  1Y5N B;  2HQC A;  3CC4 S;  4LF5 F;  2GVZ B;  1HR0 J;  5G4D A;  1Q8I A;  3HKM A;  1S6P B;  1S0N A;  1Q78 A;  2FZC B;  4FKX A;  4IFD B;  1VQL S;  1SQF A;  3QGG A;  5D0E A;  5KFI A;  1WHY A;  3D6H B;  2DCL A;  1JLC A;  2XMJ A;  3PX4 A;  5EX3 A;  2BX6 A;  2ZE2 A;  4CO0 A;  2NN6 C;  3WX4 A;  3MM7 B;  3QLH A;  1RTJ B;  2DIT A;  3KHG A;  3NXZ A;  2OHD A;  3SMZ A;  4YME A;  1H2U X;  2HS0 A;  2JLG A;  1DFD A;  3JTO A;  3RBZ A;  2UXC J;  4CNZ A;  3MR2 A;  4DCP B;  3PZP A;  1OIA A;  4ICL B;  5L1K A;  1JJ4 A;  2Z8Q A;  4PXC A;  2B6A A;  1J5O A;  3SBM A;  4XK8 C;  3US5 A;  1B64 A;  1IBK E;  1FHT A;  3DRX A;  1IBM E;  1B0P A;  4JB8 B;  1TP7 A;  3WIV A;  4CWB A;  4LF7 J;  1E3P A;  2VPW B;  3M30 B;  4EGL A;  4OX9 E;  4FF1 A;  1S48 A;  2I38 A;  2HQF A;  1WEZ A;  1RKJ A;  4P74 A;  1U4B A;  2HVH A;  1LWC B;  2XGP A;  3DFE A;  3UN5 A;  1O51 A;  3UFC X;  4NLW A;  3JSB A;  4RR5 A;  1WC6 A;  2F8M A;  2W25 A;  3EZ5 A;  3SV3 A;  3OL9 A;  4LFC E;  1UZD A;  4K5R A;  1D9D A;  1N32 F;  1SJR A;  1HNZ J;  3K5O A;  3BN4 A;  2YWK A;  1TQL A;  2YNI B;  4I7F B;  3KK3 A;  2I8E A;  5HQL A;  5LXR A;  2GO3 A;  2LEP A;  1V3R A;  1REV A;  3DI6 A;  4K50 A;  5B09 A;  4DS5 A;  2BBE A;  3C16 A;  1ZH5 A;  3N6L A;  1DUR A;  2EK1 A;  5A8K A;  1VDH A;  3HUL A;  4NMX A;  4QWA A;  4NXM J;  2WRM A;  3G82 B;  4I6Y A;  4W92 B;  2HGM A;  2YWH A;  2HNY A;  3QLH B;  3Q23 A;  4GKK J;  2FHJ A;  2VQF E;  3PTW A;  2WOM A;  1TUW A;  3WDO A;  4K4W A;  1BE4 A;  3OL8 A;  2HMI A;  1UDQ A;  2NYH A;  3ITH B;  4X4P A;  2YY3 A;  4Y2A A;  5LJ5 Y;  3PW2 A;  3CIM A;  4FNI A;  4ENO A;  2XBP A;  1T9W A;  3DN9 A;  1H7S A;  3VWS A;  1JLQ A;  3IN5 A;  4DFM A;  4JI6 E;  4P10 A;  4LFB I;  2XC9 A;  2C22 A;  3CDU A;  3LGH A;  5EKW A;  4X65 I;  1KD1 T;  1M5H A;  2ILY A;  4DDF A;  2WP8 A;  1OWX A;  2CQI A;  3WU3 A;  4DV2 E;  5F8J A;  2KM8 B;  4O44 A;  1MWY A;  4QCL A;  1TL1 A;  4DXL A;  2ZM6 J;  2C38 A;  4DPT A;  2CDR B;  4DV6 J;  4X62 I;  4DR4 E;  1FWK A;  1OMS A;  4ZCI A;  3HJV A;  2R2U A;  2DGX A;  4R0J A;  3VVT A;  3HFZ B;  5KFX A;  1XMO J;  4QWB A;  4KGK A;  1S6Q A;  2GX8 A;  5GMD A;  1RHJ B;  1NZA A;  3J7A N;  4I1T A;  3H5S A;  3N6N A;  4KE5 A;  2I9S A;  2YX4 A;  2Z56 B;  4L3N A;  4PPD A;  5KFY A;  5KT3 A;  4Q8E A;  2ZEJ A;  1CJV B;  2CKW A;  3E8O A;  1N5S A;  3GSD A;  2DCU B;  3AY0 A;  1YWX A;  2PMZ D;  1LW0 A;  1RU2 A;  1UFL A;  1RLC L;  4HVZ A;  2ZJP Q;  5HJX A;  1X0F A;  1EKR A;  3NEK A;  5KFU A;  1OSD A;  1ZYQ A;  4LQ3 A;  5K14 A;  4BA1 A;  1D6T A;  1GX5 A;  1WHX A;  2GQQ A;  2L48 A;  4I69 A;  3HJF A;  2ZBK B;  2IA0 A;  3LA0 A;  3KRN A;  5JXS A;  2ACY A;  1JK9 B;  4YB5 A;  3WU5 A;  2V4J A;  5ADZ A;  3H25 A;  2IY5 B;  2E5J A;  2WP8 B;  4OHW A;  2CNL B;  4CZC A;  5IWA F;  2HWI A;  3TRG A;  3W5X A;  3G6V A;  4F02 A;  1V5V A;  3GQC A;  5IZH A;  4I56 A;  4LF8 E;  2UUA I;  5LMN J;  1KSP A;  2R7T A;  1HQU B;  3WHI A;  5D78 A;  1ITP A;  1Y00 A;  4DQQ A;  1LW2 A;  2JC1 A;  2HMI B;  4LF5 J;  4K4X A;  4DV1 I;  3GLJ A;  3C14 B;  4UY8 5;  3GWC A;  3QRQ A;  4KPC A;  2H48 B;  3PFO A;  2F7V A;  2GC8 A;  2HNY B;  4ZPT R;  4CIO A;  2XI2 A;  4DF4 A;  1XXE A;  4ZCL A;  4DL2 A;  3R2D J;  2UXB I;  2YNF B;  3GFX A;  3MCN A;  4EMD A;  1RAI B;  5AE1 A;  1SL2 A;  3IR5 B;  1FFS B;  3AOD A;  4HDH A;  2XO7 A;  2X36 A;  2C2O B;  1YHQ S;  1NH7 A;  1J5E J;  3EX7 B;  4XTJ A;  2M0G B;  1HQE A;  3GPA A;  4C8Y A;  2Y3Y A;  1HHQ A;  2CUY A;  3TQE A;  1B3T A;  2GIR A;  1S5Z A;  2H51 B;  3H5Y A;  1Z0C A;  3H1C A;  3DRS B;  5E2Q A;  1HL6 A;  1RT3 B;  1TL3 A;  2L41 A;  4DV2 F;  2BV3 A;  1Z4U A;  2IMO A;  4OHV A;  2M2B A;  3KKF A;  1NDP A;  2OPP A;  1LWC A;  2E9Z A;  5L9N A;  3DKD A;  2BW7 A;  3F73 A;  1TKT B;  1PYT A;  2JLF A;  1RT1 A;  3KG4 A;  4RU2 A;  2BR2 A;  4L3K A;  2KI2 A;  2MZS A;  3NWG A;  3U1L A;  3LOU A;  5KFN A;  4ED2 A;  2XQC A;  2VES A;  4B9M A;  4Q43 A;  4DR7 I;  2BXJ A;  4IFY B;  2PT0 A;  1HNX E;  4YHH I;  1D9A A;  1RAE B;  1UCN A;  1B4S A;  2QYG A;  2WVD A;  5DZ6 A;  3T9Z A;  2VBZ A;  4MMO A;  4ZVP B;  2W9C A;  3IMQ J;  3KUG A;  5DS7 A;  2UVW A;  4M5I A;  1AFJ A;  5IWA E;  2MHE A;  2J9D E;  2Z4P A;  1DBD A;  3TA2 A;  3TX0 A;  4J9V A;  2HVI A;  1JQG A;  3IAM 9;  3PNI A;  5F8I A;  2WB4 A;  3H4D A;  1HBN B;  1XR6 A;  2NUU G;  4W4M A;  4CLU A;  1WG1 A;  1JX4 A;  2YBV A;  1QVF R;  4Y3C A;  3H8Y A;  3GP9 A;  1RBO B;  5GAD I;  1H2T Z;  1MWZ A;  1RA7 A;  3QT6 A;  2EFP A;  3FC9 A;  1RAJ A;  3KYL A;  2VQE J;  4IO9 Q;  2FLL A;  2UXB E;  4LFB E;  4RW8 A;  3LH2 S;  1C0U B;  1FJG E;  3QT5 A;  1RTH A;  4LVN P;  3IR6 B;  1FKA F;  1N36 E;  2VAS A;  3CDW A;  4X62 J;  3R97 A;  1UA1 A;  2W8L A;  2KJV A;  3CDE A;  4ISA A;  2M8H A;  2PGC A;  4B17 A;  2CNK B;  1YQH A;  2LXF A;  3NS7 B;  1VQ4 S;  2ZHA A;  1N5V A;  2F63 A;  4DV7 I;  1DQA A;  1HNI B;  4USW A;  1NJX A;  1RE1 B;  3KG1 A;  2CVI A;  1LV5 A;  1RHR B;  3DLE B;  1IBL E;  2CQB A;  1FKO A;  3BDE A;  5EWF A;  4K8R A;  5K9F A;  2HZA A;  3BS9 A;  2VPX B;  5LMU F;  1N4L A;  5A2Q Q;  4JI7 F;  3ELH A;  1H2V Z;  1KVK A;  2HFZ A;  3QT8 A;  1VS3 A;  5DLG A;  1HYS B;  3P3G A;  2BA9 A;  5LSR A;  1HD1 A;  3M85 D;  2RVJ A;  3G8Q A;  2ZM6 F;  4FYX B;  3HXM A;  3D6M B;  3QZ8 A;  4ECZ A;  2OPQ B;  1X4B A;  3MM6 A;  2K7K A;  3IM8 A;  4DPY A;  3OL6 A;  2AF6 A;  3MPW A;  3PAC A;  4A8K A;  2H5J B;  2V2V A;  2HLT A;  1VQN S;  2ZKT A;  2QA4 G;  3HK2 A;  2GGP A;  4I4B A;  1TKZ B;  4AXI A;  3MAQ A;  3W2V A;  2OGU A;  3PV8 A;  4G1Q B;