3PYEA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
301
structure length
301
Chain Sequence
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 86
structure length 301
sequence length 301
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyeA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyeA01
2BV3A 4DV0I 3ZKDA 1PIEA 4DV3I 5GMEA 1HR0I 3CWVA 4LF5I 4JI7E 4P52A 3T1YI 2ZM6E 2F4VE 1XMQI 3M6AA 4DV6E 4DR7I 2HK3A 2HFSA 5A2QC 2LJPA 4DR2I 1Z0WA 4JI8I 2DEJA 2VQFE 3T1HI 4B3MI 1Z0EA 4HY1A 4URLA 4X66E 1KTVA 4KQVA 4NXMI 2V34A 3B8HA 3HULA 2R42A 2VQFI 4YY3E 4DV7I 1IBME 1FNMA 1XMOI 2UUBE 4X62I 3B82A 2X36A 3QT5A 1UEKA 4X64E 1HNXE 1K47A 3WU5A 3PYGA 1EI1A 1MX0A 2A2CA 1H7SA 4GKKI 4HXZA 1HNWI 4K0KE 1IBLE 5A2QQ 2UU9I 4DR1I 4FWHA 4B3TI 1Z0BA 4NXNI 1ZXNA 4DR3E 2BM1A 4JI8E 3J80Q 4DV0E 3PYDA 4X64I 4USKA 1S4EA 1KVKA 2VQEI 2V8PA 2CZ9A 3ZM7A 4JI5I 4R1FA 4LF6I 5FLXQ 2UUCI 4Z7YA 1N33I 2VQEE 4USMA 4DPYA 4X65I 1H74A 2EFGA 4FWDA 4OX9I 1FJGE 1HNWE 4DXLA 3H4LA 4JI3E 2Q2EB 4UTGA 3ZKBA 3WU6A 2HKEA 1HNZE 3J7AG 2GS8A 2UXDI 4YY3I 1Z5AA 1N0VC 4AQYE 4WUDA 1H73A 1H72C 1HNZI 4K0KI 4DUZI 2UXBI 4DR7E 4YHHI 4LFBI 4LFAI 1FJGI 1QZRA 3ZZ0A 1FKAE 2UU9E 4NXNE 5LMNI 1B62A 1N34I 4JI5E 4I3HA 4PRXA 4JI4I 4GKJI 2UXBE 1H7UA 4DUZE 1XNRI 1Z59A 4DUYE 4UT4A 1VISA 4FW9A 1N33E 1IBMI 5IWAI 4LF5E 4DR4E 1S16A 1Z5BA 4DR3I 1XMQE 4WUCA 1U2RA 4LF8E 1J5EE 4JI3I 1HNXI 1RREA 1XNQE 2BM0A 5GMDA 1FWLA 4RPFA 4B3RI 3OTOE 3WU3A 5IWAE 1XMOE 2UUBI 1B63A 4DV6I 1J5EI 3GONA 4KHPI 4DR2E 4B3TE 4JV5I 5LMNE 4DPTA 2V2VA 4XTJA 4JI6E 3T1HE 4DPUA 2ZBKB 4LF7I 4JI2I 4KHPE 3V2UC 1KIJA 3V5RA 4B3SI 4DU7A 3B78A 5IT9Q 4JI0E 4LF4E 2HK2A 2X7IA 1Z0TA 1EA6A 2ZITA 4DV7E 3QT6A 4WUBA 3T1YE 4FWGA 4JI7I 4DPXA 1NZ0A 3ZZUA 4JI6I 2J7KA 4DV2I 1XHKA 4DV3E 3D4JA 1ZM9A 2E5LI 2E1RA 2A2DA 4LF6E 4LF8I 2R3VA 4DR1E 4JI1E 4JYAI 4B3RE 4JI0I 1Z0VA 1NHHA 2HHHI 4AQYI 2HFUA 2V2ZA 4PU9A 3JAMC 2UXCI 3LNUA 1NHIA 4NXME 3QT8A 2OI2A 4MYTA 3ZZTA 4DPWA 2NPFA 4ED4A 3J81Q 1HR0E 1D6TA 1Z5CA 3J80C 5LL6R 4X62E 4M1KA 1FWKA 2XEXA 2UUCE 4YHHE 4B3SE 4DR4I 1N34E 1A6FA 1OJ4A 4DV4E 4OX9E 1IBLI 4HACA 4DUYI 4DV2E 1PVGA 1ZM2A 1RR9A 3K17A 2WW4A 5BR8E 4LF4I 1WUUA 1ZM3A 4LFCI 2E5LE 4EMDA 4DR5E 1I94I 4GKKE 4ZVIA 4DR6E 1BKNA 4B3ME 4LF9E 4HACB 4DR5I 1I94E 3OTOI 2ZM6I 2F4VI 4Z7CA 2HHHE 1IBKE 4DR6I 4LFCE 4MYUA 3J81C 4JI2E 1MU5A 4LFBE 3PYFA 4X65E 4JG4A 2V2QA 2UUAI 1KKHA 1XNRE 1N36I 1N32I 2UXCE 3F0NA 4X66I 5FLXC 4JI4E 4GKJE 4DV5I 5L3JA 4FN5A 1DARA 4HYMA 2UUAE 2UXDE 3J7AM 5LMUI 1XNQI 2DEIA 4DU8A 1ZM4A 4JV5E 4LFAE 5BR8I 3WU4A 4DV1I 5IT9C 1Z0CA 1IBKI 1N36E 1FI4A 2VF3A 4DV4I 4DV5E 3LTOA 2AJ4A 3PYEA 4P7AA 1ZXMA 3Q1QA 4LF7E 5LMUE 1N32E 3JAMQ 1Z0GA 4JI1I 4JYAE 4LF9I 1ELOA 1MG7A 3K1JA 4DV1E 1PKPA 3QT7A 4PRVA 1N0UA 3LPSA 2HKJA 1NHJA
chains in the Genus database with same CATH superfamily
1AB8A 1D3WA 1LW2A 1WC5A 2Z57B 4PYAA 4RNHA 1TL7B 2XO7A 5IC6B 3BGRB 4FNHA 3HSGA 2HS4A 1X4FA 3FSXA 1REVA 5HATA 3SFUA 4RUHA 3QIPA 4O0IA 2GAGC 2P9CA 4NA3A 3VGTA 1NDCA 1LXJA 1VC0A 4C8ZA 3CWVA 4DV3F 3T1YI 2X3DA 4P52A 1WOSA 1R6YA 3DRRA 2ACYA 3RR7A 2ZM6E 4CCHA 2MY8A 4JP8A 3M6AA 5FWKA 4DV6E 2DTJA 5E5NA 3S7RA 2HFSA 3PX6A 4YHHF 1Q8BA 2IYGA 2E29A 1I5OB 2JFKA 2MDAA 2QTWA 5G0RB 3JSYA 5AXKA 4ANCA 1N34J 5KFWA 2PFFB 4I64A 1Z0WA 3IRXB 1YRUA 4FYWB 3J80U 2DITA 4LF7I 2FZKB 5F8NA 3J7YI 3MM7B 5DQIA 3R1HA 4JI8I 4RW4B 2I5JA 1RSCA 1P6TA 1W2IA 2BEFA 2DEJA 1F60B 2PT0A 3LP0B 4NOHA 1X4GA 4USWA 8AT1B 2VQFE 3Q2SC 2Z2LA 1B70B 3D6HB 2MXYA 1RZMA 2ZH1A 3NZKA 4IFDB 4OO1C 5A2QY 1WORA 2VC1A 4AQYF 3CDEA 4IG3A 4ICLA 2IAJB 1NJYA 4R25A 3T9ZA 2MKYA 1KTVA 1LFWA 3DDKA 4B17A 3PRDA 2VG5A 1ZPVA 3IC1A 4B02A 2ZOMA 2PNZA 2D3ZA 3KK1B 4NZ6A 1WC4A 3DRRB 1MROA 4CI0B 3AJ2A 2DGWA 1M1GA 2M8HA 3VCDA 2RRNA 2YWEA 3BKUA 1J2VA 2NZCA 4YB5A 3Q8PB 3KNGA 1UJ6A 4YB7A 4NXMI 2NPIA 3HKZD 4JI6J 2BRKA 3M8PA 3MI7X 2D3OR 2VBZA 2R42A 1E6YA 1S76D 4USTA 2R2SA 3UI3A 2MTLA 3GPAA 5F9LA 3M32B 5LXRA 4U6PA 4NXNF 4OYPA 5F41A 3A8JA 1QAIA 1XEZA 4OZJA 3ZFVA 2UUBE 1OSDA 4X62I 3B82A 2W9CA 4PG6A 2BR2B 1R0BG 3AAWB 3PHEA 5GAHU 1VC5A 1FK9B 3M9MB 2QL9B 1K47A 2GA7A 2L41A 3CJKA 3RR8A 1XQIA 3MECA 3C19A 3TANA 4NL5A 1TUWA 4B3RF 1SV5A 3IGVA 3MM5B 3D1QA 4EU0A 1EI1A 2DNZA 3VAFA 4M5DA 3TZZA 4IZKB 4YY3J 3MR7A 3SCKE 3M85D 3UN2A 5L9NA 1JLFA 1YGYA 3CD0A 4KGXB 3R6LB 1BQNA 4KFBB 2C39A 1HNWI 1XWLA 2UUWA 4ZP9A 5LT5A 4NI2A 2DRBA 2XGPA 4V1Ak 2GJ2A 3WZ0A 4C48A 5CXTA 1RQ0A 3C66A 2J8AA 1MN7A 2BE7D 3MCSA 4FZVA 4DZ6A 3OHBA 1TU0B 4K4WA 4ZPDA 2UUAJ 1R6VA 2J7UA 3S6EA 5HP1A 1HNIA 1YRTA 1OYDA 2EFNA 3O8WA 5FDLB 4M94A 4LFCJ 4OHZA 1EKSA 1KS2A 3EDRB 1RWWB 3U7JA 4C0HA 1TUVA 1V5IB 2R8KA 1XN9A 2BM1A 4K5RA 1KOOA 2QMXA 4LRAA 2ASDA 2Y8YA 2YKNA 2NQPA 3J80Q 3UD3P 5B0CA 1OYEA 1BD6A 2FPHX 2MKHA 2RE1A 2F8EX 1S4EA 2NXJA 3DRYA 4USKA 3CJ0A 3ZNUA 3K5MA 4NEZA 3MEGA 1QSSA 1T9TA 3FMWA 3RBEA 2DCUB 3GE9A 2UVWA 1RHRB 4C3LA 2ZDPA 4KHRA 4WFZA 1SKSA 4IFDF 2UU9J 3RRHA 2CZ9A 3ZM7A 3ILOA 3C15B 2PMHA 1ZETA 5EKWA 4LF6I 2KT2A 3RBDA 2MKKA 4ZVTB 1F9HA 2MGZB 2CQGA 1WOOA 4TQRA 3GYGA 2WVFA 3AA8A 3MF5A 3NBPA 4C4WA 4DG1A 4F4WA 2NN6A 1S1VA 2YKMB 1RABB 3IGNA 2Z0GA 2MLYA 4USMA 5BYQA 4NYZA 4DPYA 5JEAA 4X4NA 5HJYA 3H8YA 3RAMA 4IOCQ 4X65I 1LWEB 1H74A 1Z4UA 3BGRA 5SUHA 1UVKA 3KXDA 3MZIA 5KFLA 3A3PB 1BXNA 4GVBB 2Y0SD 1HNIB 2YKOA 5K8OA 1U2FA 2PO2B 3EPIA 4RU2A 1UDNA 5L9XA 5HLFA 4NLVA 3C14A 3K89A 3DLHA 3Q8YA 1EKRA 1NZAA 2IIHA 3Q23A 1XMOF 1CC7A 1QJHA 2MZRA 3D7SB 4NLGA 3P49B 2RHQB 1FX2A 2HKEA 5D77A 2GS8A 1S48A 2VPWB 1RT7A 3DMJA 1FXRA 3NGRA 2PGCA 2LVWA 4EK2A 5KOWA 4L3KA 5HQLA 4I2QA 1Z5AA 4IZJD 3H1CA 3J7ZT 3MMCB 4DV5J 2UP1A 3MM7A 1SL1A 4AQYE 4X4RA 2HLUA 2CPYA 1ZS6A 3OSPA 2L3MA 4H4MB 3MD3A 4IRKA 4DFJA 3CCQS 1VQMS 4V19J 2C37A 3DRPA 3IR6B 1RHUB 1YK9A 4WJBA 1L3TA 4N41A 3HI9A 2BA0G 1KFSA 2GO3A 1VR6A 1S4FA 3M2VB 4OL8A 1Q78A 2V2KA 2W4DA 4YHHI 1RWVB 4O4RA 2DB1A 5HK4A 2LCWA 1RT5B 4LFAI 2Z2YB 2JDJA 2LP4A 2AJFE 4IS9A 3EM1A 3KLEB 4X64J 1DQ9A 4Q2MA 1XIQA 3IBCB 2DBBA 1D9FA 4FYDA 3BS9A 2RU9A 4ZPAA 2JEBA 4JI8F 4F8RA 1LOUA 4O3QA 2BYCA 2CNLB 5AJ3J 2KM8C 3G82A 2ZUAA 3GZ7A 1TVRB 2D9OA 3MPUB 2UUBF 3L7OA 1U1RA 4YUDA 3UO0A 2LQ8A 5LMNI 1PAEX 4QIWD 1SVDA 4NCGB 3EMTA 1GTHA 5F9NA 4ED7A 1HWKA 2H1YA 1RA6A 3DLLQ 2Y8WA 3M8YA 4JI4I 1RHMB 2B5JA 2DH7A 3NOCA 2E5LF 3H7HB 1T7PA 2LECA 4DUZE 4DR5F 2HVIA 2Y1RI 3HZGA 1UJ5A 4HDGA 5KFYA 5DZ7A 4UT4A 1YIJS 1BY9A 3I0RA 3AHPA 2VL1A 4O4GB 5MLCV 3HHKA 1Y0HA 4ALZA 3H59A 1QAYA 4KPYA 3L7UA 1Z5BA 4DR3I 3MEEB 4EBCA 2ERRA 3KRNA 3MM5A 2AYEA 5C42B 1JLGB 4ED8A 3EVOA 1B0PA 1PG5B 3AD9C 3ISNC 4JI3I 1HNXI 2G13A 5HMZA 2XY6A 1RREA 1B0TA 1UAWA 2BM0A 1U0SA 3LQVA 4RLEA 5GMDA 3WX8A 3KJNB 1RBAA 2W1BA 5KT5A 2ZM6J 1H0HB 1LV5A 4V19X 5IWAE 4B3RI 1B63A 4DMZA 2FGCA 4BLGA 2C28A 3W63A 1FA0A 2Q79A 4B9TA 1TL3A 3KLIB 2YQ1A 3ZTQA 4DR6I 3TRGA 4O3PA 3W62A 4OZNA 2GO9A 3EGVA 3FQKA 3QGHA 4MDTA 5EN1A 1S6PA 1URRA 4P71A 4KE5A 3BH6B 4Q45A 1QE1A 3KK1A 1BHNA 3OR2A 2F65A 3FSIA 4DPTA 2N3LA 1RP5A 4ZIVA 1YH8A 4USUA 4K4ZA 2EG1A 4I6YA 3JQMA 4J7CA 4U96A 3ELHA 2R9LA 2SXLA 4IO1A 1M5SA 1UKUA 3VALA 5IOLA 3TUPA 2R7UA 1RT4B 2HSEB 5CYQA 2OIHA 4N3OA 1U8WA 4M63A 5ETLA 5JXSA 3V2UC 3R7NB 5H9EJ 4B3SI 4XPEA 3ONQA 2AYGA 5I42A 1KHVA 4P6QA 2C42A 3SSSA 3KLHA 4CO0A 3HT3A 5L8RC 2HNYA 2ZNZA 3QWPA 2QA4G 4ECXA 3BSCA 5DNXA 1TKXA 3HT0A 1QSLA 2RIJA 2CQ2A 4WXOA 3Q8RB 4C7QA 2XLKA 3CMAS 3BO3A 3V4IA 4DR4E 3DOKA 2HQFA 2ZITA 1X4CA 1QD1A 2OPSA 3MHYA 4YDXA 1D1UA 4LF8J 2KTQA 2KFYA 1HBUA 2J0QD 1LW0A 1JB0C 3Q8QB 3QMQA 4ATNA 5E41A 1WJ9A 2MY7A 2RDDA 1FRJA 2ZE2A 4DL0C 1U6ZA 2H5EA 2YNFA 3TAMA 2H5IB 2OLWA 2Q3PA 2ADCA 4WFYA 1RU1A 3IA0A 4KFBA 4X2BA 2B9YA 5J1NA 5IV4A 1BLUA 1LWXA 4LREA 2IC3B 4WIQA 1BWVA 2Z2MA 4DUYF 3IAM9 3OJSA 1TFWA 3HKMA 4CH7A 1T9YA 1B0VA 2YNIB 4Q43A 1Y4SA 3KUEA 1PJ7A 4UZCA 4LF6E 3NS7B 2LQ9A 3AODA 3MMCA 2J0WA 4RUBA 2HG4A 2MQMA 1XNQF 5DGAA 4NLWA 1PILA 3KTQA 4JYAF 2NUUG 3RU0A 2R3VA 1KQSR 4G1PA 1Y00A 1CQNA 1C4AA 1LWFB 3LOUA 4ZJOA 3VF0B 5B0BA 1IR0A 1MWQA 2OEMA 4OYXA 4DDFA 4Q8FA 3MAAB 4ZPTR 2B7CB 2QA1A 2XSFA 3OUYA 2KT3A 4X4OA 1U8SA 2DR6A 2Q43A 1FTCA 1RAGB 4A8QA 3A3OB 1NK9A 1C0TA 2PEHA 2PDAA 1HQUA 1WACA 4DI6A 4EZ9A 3M6XA 4TYAA 3NNCA 5JEAC 1CJVB 2GO4A 1FJ7A 3JAMC 1RT2A 3OL6A 5T7LA 4ZN3A 4JI5F 3GCMA 4Z2XA 1NLKL 1VDHA 2YWWA 3W9IA 1NHIA 2M88A 2JLGA 3FGVA 4TU8A 4L76A 2R8JA 4OX7A 2AIRB 2UXDJ 3MOJB 3PO4A 4USIA 5F8LA 4MYTA 2IRYA 2IAJA 3Q83A 1DTQB 5KFIA 4GKJJ 3PJWA 5KT4A 4FYXB 5AJ3F 3FRYA 3UD5A 3J81Q 2BRLA 5IM0A 3VTIA 3TO8A 3LALA 1CJTA 2G2YA 2PO1A 1D6TA 2APOA 5E3RA 3D0IE 2IM3A 5ITHA 1NH8A 4DX5A 3U1KA 2FC9A 4FXVA 3EICA 3MAHA 3HSJA 4N76A 4QR0A 2WNRA 1H2VZ 1HHSA 3B54A 4DV6F 1M5HA 1O5JA 3BPDA 1J5EF 3GSIA 1UVMA 3D66A 2YKAA 1LWCA 2DHHA 3OTBA 4GO5X 2C38B 2J5AA 4JOUA 2CPJA 4X84A 3FSYA 2BDPA 1CS4B 5D78A 4OV6A 3DOMA 2FVQA 1FD2A 2QFIA 1YBUA 3A12A 4FPRA 4JV0A 2X1BA 3D3CJ 1KLMA 4P72A 1X9SA 2UXDF 1IQTA 3PW2A 1RT3A 1N34E 5KFSA 4LSNA 2KG1A 3M9NB 1N54B 3V81A 5T7LB 1IBLI 3ENWA 2DGSA 5KFAA 4ID5B 1PVGA 3GJTB 2CQ4A 1IKVB 2A0FB 2X51A 2YTCA 3B6BA 1YJWS 4OKGA 2GQ0A 3I87A 3K17A 3MR2A 1FDDA 4ZVRB 1SV5B 2YPZA 4ZOSA 5BR8E 5HROB 2OFGX 1TV6B 2BE2A 5K14B 3ZZZA 4I56A 3WC2A 2B9XA 1JMTA 5C24B 4Y00A 3E8OA 4ES3A 4U7UK 4OI6A 3KHHA 4NWBA 1R8BA 2WSFC 2CPXA 2X1GA 3KG4A 2VUGA 3MTJA 2E1PA 2W7OA 4BA1A 1S49A 4DJBA 3HHLB 3UR3C 1I94I 3OFGA 3K57A 2OMOA 4DFKA 3WIVA 1F2HA 4OYOA 2QJ3A 3ENAA 4LRDA 4NPOA 4CLKA 3GU0A 5HP1B 2RRAA 1HMVA 2BZ2A 4HLBA 4B3SJ 1TL1B 4H54A 2EKNA 3TUJC 2C2RA 3SDEA 3TYTA 2HBYB 5FDLA 2ZJPQ 4LF5F 3J7AN 1R6MA 3TWZA 3DLGB 4J9VA 2UZAA 4LF2A 4OJ1A 4ZVOB 3UW1A 2GO8A 1NHKL 2J6SA 5D3GA 4B3ME 5LXYA 1TKXB 3W66A 5B09A 1I94E 2XM3A 1HW9A 1MMDA 1C1BB 2KXFA 1ACMB 1N32J 3MEGB 2ZM6I 4IH7A 5JEAF 4H4OA 1FDBA 3NS5A 5A6WA 1NKEA 4MH8A 4EO8A 3EXCX 1LW0B 3KG0A 1S97A 1VRUB 1IBKE 4DV6J 2CAJA 3SV4A 2V68A 1Q5YA 2DNQA 2UVUA 1BWEA 3J81C 2H48B 1RTZA 3L7PA 4JI2E 1RTJA 1WHXA 2BOAA 4LFBE 3JAMY 3PYFA 2RB7A 8RUCA 4I67A 2PEBA 4ZLPA 2V8HA 2KXNB 1RDRA 2DYAA 4ZCMA 4C8OA 4X65E 3VGVA 4OIXA 1YKWA 2EXUA 3QJLA 2V2QA 3T5LA 5FD1A 3MFHA 1I94F 5KG4A 3E01B 1N36I 4RJVA 2EFVA 2EW9A 1N34F 4LIRA 3RAQA 1NNDA 2WCXA 5EL9A 3DRXA 4DR3J 3E51A 4DQRA 2UVVA 3MGJA 2W9BA 4KHPF 5D3GB 5A8KA 4DV5I 3JYTB 2QSFA 2OPRA 3OTEA 4LF5J 4X4UA 2DNYA 1DARA 4HYMA 2Y0BB 3QFWA 5JEAD 3M8QA 2R2RA 1YBAA 2KYZA 1IXKA 5JVHQ 4DX7A 1X4HA 1XNQI 1YJTA 1M5PC 1Z2LA 2DR9A 2C3YA 1N34I 2AYMA 3UNGC 1KOHA 1ZM4A 2E1AA 3M2UB 2PD1A 4DX6A 2PO0B 1NDLA 2MZJA 2F4FA 1HWUA 3RRKA 2ALYB 4OO1F 1KP6A 2HVDA 3M32A 3HXMA 2DO4A 2HURA 1TZ0A 3BH7B 1JLEA 1GX5A 1ROFA 4F3OA 1OYSA 3TQEA 4J9OA 1N6QA 3CJ3A 4X65J 4A8KA 3GG0A 1RJJA 2VKZG 2N82B 3FMBA 1FI4A 1KRPA 3W9HA 2GHVC 3GIIA 1HWLA 2V9WA 3SQOP 2VOOA 2WONB 2G1HA 3IWXA 1HBMA 1KVJA 2COLA 3IRXA 4DS5A 3KKFA 2LEBA 3UDEA 1FT8A 3W2WB 3X3UA 1EQ0A 2ZZNA 2NXCA 1AA1B 2BJ8A 4ZN1A 1UZDA 1IBCB 2QMUB 2CZVC 2W7AA 3DLEB 5L38A 3BGLA 3Q1QA 4B3OA 3UHMA 2BR0A 2OHDA 2JEBB 1E3HA 1Z0GA 3FEYB 2FLLA 2IM2A 3PJXA 2WNRB 4PAAA 4RR5A 1MLAA 2H4WB 2BXJA 2AJQA 4U3BA 1ELOA 3OTCA 3TUZC 2NSCA 2NYIA 1L3UA 4ICLB 5KG3A 4DQSA 1T8EA 1WG1A 5DRQA 4O3NA 2W2PP 1IR2A 3DLKB 3C6UA 1I6JA 3CJRA 2B51A 2YKNB 2B4OA 3QT7A 2I5JB 2ALZA 4O3RA 4PRFA 3W5ZA 4QNJA 1ZA1B 1RAFB 1Q86T 3VVUA 1G1XA 1Y4UA 3UPFA 3C2PA 4OZ0A 4R0EA 4AXJA 4X64F 1W26A 2R8HA 4DR2J 2ACMA 3DI6B 2BV3A 1Q7LB 3FEXB 2MKIA 1N4LA 3NGUA 1FE4A 3BQ0A 1PIEA 3M8PB 3MM9B 4YHHJ 5B08A 2UV8G 2NN6D 3KK3A 1NZ8A 3JQJA 4A8WA 2BKNA 2KDOA 3N79A 3CD5A 1JLGA 5DM6Q 3GIKA 4QQBA 1F9FA 3NCPA 5IT9Y 4URLA 3IRWP 1F5CA 2WB4A 1SBRA 2QLFB 4GKKF 1LKZA 2IJRA 2ZHOA 2FVPA 4DR7I 2HK3A 2DY9A 2Y1LB 1IJFB 2VU5A 5HJXA 2C3PA 3CJ2A 1RTHA 5LJ3Y 4QWCA 3H25A 1RTIB 4FF1A 1U4BA 4QR1A 1LFPA 1M1HA 1T9XA 2CPFA 4WYLA 1NB7A 3MWBA 4U3DA 3CE8A 4DR2I 2DVIA 3GG1A 3MD1A 1VQ5S 3OT9A 4DUZF 2FZGB 1RYSA 3GMEA 2VIHA 4M5DB 3PFEA 3P76A 4UQTA 1V6HA 4EUVA 2LFVA 3ITHB 1VQSA 3PKYA 3H4BA 2R8IA 2ZH6A 2I1RA 4ECWA 4CH1A 2XY5A 2OPQB 2HEKA 2E7WA 1IBMJ 4HI1A 3G71S 1WSVA 3IBWA 1OY9A 1YTYA 1QUPA 2ZBQA 4LR8A 4QZVB 3DOLB 1YWXA 2Q6CA 2ZUGA 4KRWA 3T9NA 3TW0A 2FJEB 4ZK7M 3H5YA 1RKIA 1Z0EA 4HY1A 4J90A 2CFXA 3M1VB 2Z2ZA 4KQVA 3TA0A 1MNEA 3N9UC 3DGVA 1WD6A 2PO4A 5G4DA 4ETZA 3TZYA 3U02A 3PW7A 2AU0A 4LF4J 3QRQA 1VRTA 3KLFA 3FZ2A 3CSKA 2EPIA 1NJXA 1YJRA 1L3VA 1TL4A 2XMVA 3IWLA 5FLXU 2GGPA 1S0OA 2MYFA 2RAQA 1JLAA 2GVDB 2WAQD 2V69A 3LPEA 2OPSB 3TZWA 3E01A 3ZO7A 2UXCF 2XLIA 4H4KA 3BZQA 1HHQA 4DR6F 3DRSB 5EWFA 4DR2F 1S6QB 3K8VA 3HM9A 3HMJG 3G6VA 2XYHB 1C2PA 1TAQA 4DF4A 4QIVA 4J9MA 5HMXA 3CD6S 4EGLA 1DLOB 1VI7A 2M3DA 3D0HE 1FNMA 3ILLA 5T41A 2V8GA 4OHWA 5KFHA 1Y6ZA 1YG0A 3BN4A 5K8MA 4QBUA 2W8LA 4ECUA 1NEEA 3M9OB 2ZNYA 1WC6A 4FKYA 1E6VA 2V5HG 4J3DA 1YRXA 3QT5A 4I7FA 4ECYA 5DM7Q 1NJZA 3CDBA 1R0AA 2VQFJ 2HFOA 3OD2A 1HNXE 3G8SA 3WU5A 1AUDA 2HGNA 3L3CA 2DR7A 3M6VA 1UJ4A 4FVMA 2PO2A 5ETNA 4AIMA 4O23A 3D1OA 1H7SA 1RYRA 4BS2A 3C3LA 3K5LA 4WTYA 3A13A 2VA3A 2EKYA 4ZJQA 5EX0A 1W7WA 2IVMA 3Q22A 3BB5A 4TVAB 2RF2A 4DR4F 1XMQJ 4HHUA 3RYLA 4HTIA 4B9UA 1U1PA 4IG3B 1HNVA 5BYSA 5A2QQ 1U1QA 5J2PB 3J7YU 2CPZA 4DQIA 5F8JA 4KPCA 4DR1I 4E2FB 3HFKA 3DKDA 4B3TI 3DRSA 1PGZA 3L95X 3FCWA 5HVHA 1U1OA 1SI9A 2ZKTA 4NXNI 3JQKA 3CO9A 4BWJA 3OHAA 1MMNA 2B43A 3KFWX 3WHIA 4JI8E 5IV3A 1JLBB 1FFWB 1CG2A 1PC5A 3CDJA 5GAEI 4C3MA 4F4ZA 3TARA 2YY3A 1YJVA 1WHYA 3I5BA 2ZD1B 2HZCA 4FW7A 1KVKA 1HYSB 4ED3A 4YQWA 2VJVA 4HYKA 4UQGA 2RQ4A 3UNYA 3TJ8A 5J2MA 3RB3A 3OL9A 5ETSA 2IBKA 1JXEA 2HBQB 1DQ8A 1WOPA 5F8HA 2CJKA 2YWHA 3D54A 2DPJA 1M1KT 3MPDA 2CQDA 2D3O1 1VQ4S 5FLXQ 1VC6A 1QE1B 1REGX 3H5XA 3AB2B 4CNYA 2UUCI 1C1CA 1R0CB 3RJMB 3KMSA 2ZHAA 2OPRB 3BR8A 1SH0A 1L5UA 4YEAA 4OFZA 3RB4A 4A8YA 4QCLA 1NK5A 3ET6B 4K4SA 2JX2A 4FW5A 3TUIC 1VIXA 4RUCA 3CC7S 2EFGA 1FJGE 4OX9I 3QO9B 4MKVA 4DV2F 3OQ2A 4QW8A 1Y11A 4JI0J 4DUTA 2HHWA 3SCIE 5MAOA 1CLFA 2C38A 1RHKB 5LMUF 4L73A 1NCLA 4KGKA 1NHVA 5M2RA 3VR1A 2ZDOA 4TY8B 5A8RA 4OYMA 4A8XA 3OSNA 1JKHB 3RB0A 3P5TL 4DWIA 2FVSA 3PS3A 3R5BA 2XZDB 4Y3CA 2DNRA 4RO0A 4N7TA 3NWGA 2RS8A 4ZPWR 2UUTA 4ZPVR 2BQ3A 4F4KA 3ZKBA 1VBZA 3JTNA 4RBTA 4DV1F 3V4IB 4USHA 4MK9A 1WKJA 4ZVQB 3J7AG 4LOMA 4WE1A 2XNRA 3GIRA 1U0HA 3ISND 4PCQA 1EP4B 1XTZA 3IR5B 4RW7B 1CULA 4DCJB 2N3OA 3CNQP 2K3IA 3MEEA 3ZNJ1 5IT0A 3PIOQ 4OI0A 2CNNB 5K36A 2M0GB 4NX9A 2RILA 2MGZA 2YNFB 5ETRA 3TAMB 2E5JA 1H72C 3BN7A 1T02A 1U1MA 2LXUA 2BVZA 2OD6A 3J80Y 1TKTB 1Q79A 1WWHA 3M30B 2UUBJ 4OMFG 4X66F 2XZWA 4BA2A 4K0KI 4EBEA 4DUZI 4CO5A 3DLBA 1I3OB 4CO4A 2RQCA 2YWGA 4DR7E 2JSXA 2GZOA 4RL1A 5M2UA 1VBKA 2RMLA 4PZVA 1TL1A 2ASYA 1S1UB 3SQGA 4NRTA 4RW6B 1TL3B 3KLIA 3K0JA 1U1KA 3DM2B 4A4JA 2XHWA 1QAXA 4QOTA 2EK6A 3G87A 4WKRA 4AD6A 4PABA 2ASLA 4WXWA 1DHMA 4FVCA 2KRRA 2Z5CA 1SJRA 1UW9A 1FX4A 3FRZA 2B4PA 3R2DJ 2NXNA 1Y5YA 2YKPA 1T11A 2XLJA 2K2PA 2FTRA 2XO6A 4CWBA 1HQEB 1FNXH 1RB0A 5DDQC 1XBWA 3UR0A 4WK1A 3LGHA 1NPRA 1FHTA 2DT9A 4P9SA 3U27A 4JI5E 3DFEA 4RNOA 4PRXA 4GKJI 4WK3A 2XB2D 4P2SA 2YH0A 3PX0A 1H7UA 3W65A 4ZVIA 2UXBE 3D0GE 1WG5A 4OX6A 4LF9J 1TK8A 2BJEA 3R27A 4C11A 4FW9A 2BW2A 3CJ4A 3DU5A 4AL5A 1FCAA 1U47A 1N33E 3DHWC 2QYCA 1IBMI 3CULA 2FY1A 3GSDA 1RWUA 4LMZA 2Z58B 4CLWA 5IWAI 4LF5E 4KAIA 1EB0A 2VB6A 5BXIA 4QWEA 1S16A 5F8MA 3CCRS 1XMQE 3BGOP 2B0GA 2L9NA 3QPIA 3Q89A 1SIWB 2ZZTA 1VGYA 3ICLA 5C25B 1KLNA 1Q95G 4W4MA 3VQTA 5IT9U 4DV0E 1F1BB 1WHWA 3NEKA 1XNQE 4FS2A 2HNYB 3JTOA 5GADU 2LYVA 5U47A 1TFYA 4IFDA 4NLSA 4DV4F 2F4VJ 2O1UA 2UUBI 3QLHA 3TEHB 3VZIA 3W5XA 1EETA 3W8GA 1GXLA 4DR6J 5C0XE 1ZYQA 5GADI 4GVLA 5J1EA 4M5KA 1IWAA 4OX8A 3O2IA 5E3QA 2G2OA 3GONA 2KJWA 3KUGA 1OY8A 2KFZA 4OO1D 2CJXB 1MW7A 1F3FA 3BGFA 4OI4A 4YY3F 4ZVFA 4ZDNA 2I6WA 3C16A 1S12A 5LMNE 1NK7A 2A1BA 1FRLA 1R8AA 2O67A 2FC8A 1DFDA 3TAPA 9RUBA 3A3NB 1VJQA 5JMNA 3KDNA 1PSDA 3GFXA 4N56A 1RAAB 2YXLA 4OI2A 5ETKA 3T1HE 2QA4S 5IWAF 3PDNA 2JEAA 3UDVA 2OUGA 4WF9Q 2MSTA 4LSLB 2WVDA 4DU7A 1TELA 3EVMA 1T05A 1FJGF 1LK7A 1RAIB 5KFFA 3D2WA 4X4VA 3HSDA 5C0XF 1CVJA 1H7XA 4JI6I 5IT9Q 2JH3A 3HLUA 4LF4E 4F67A 2G0CA 1XNQJ 2HK2A 4K7QA 5HI7A 1UDQA 2C22A 4LCHA 1TR0A 3T19A 4C8MA 4U67Q 4USJC 1EA6A 3ENVA 5IS2A 1DQAA 5ETMA 4WKYA 1IKWA 4LJMA 4UUXA 3AJ1A 4PG8A 1WTBA 3T1YE 1UDSA 1BMQB 1XMBA 1O51A 3MEDA 3JB9k 5D0GA 1C0UB 2I9SA 3ZZUA 4H4MA 4KH0B 1CJVA 3ZTOA 4ELUA 4Q8EA 2F7VA 2WSEC 3O1LA 3OPKA 2F1FA 3J7Z5 3CCLS 3BSNA 2WBMA 1B64A 1V3ZA 3P3EA 4QWDA 2BJ9A 4DV2I 4DV3E 4WE1B 4PEOA 3DXSX 5A76A 3ZZRA 5BR8F 1R6LA 2E1RA 2K7KA 1NBEB 4OJHA 1JLCA 1MWZA 2M70A 3IS9A 3MECB 5E2QA 3KDOA 2VQEJ 5B0FA 5KTQA 2CQ0A 2AD9A 1K9MT 4HL9A 4P10A 3TEGA 1T3NA 1X5OA 2ZBPA 3TOQA 4ETXA 1SC1B 2WVEA 1FRXA 1JXVA 2AZ1A 4IRCA 4DR1E 1CQMA 1RE1B 2JC0A 2HLTA 4MU4A 4JI1E 2ZBRA 3GB0A 4B3RE 2IVYA 1KN6A 4JI0I 4ZKAA 2FY8A 4RW8A 1T03B 1O6XA 3MUVP 1GEHA 2AJ0A 4AUKA 2NYHA 4TKTA 2HFUA 3ZTSA 5LMNF 4B3MF 4PU9A 2C3UA 4WPAA 4RUAA 4WTOB 3VGUA 4JV5F 1YITS 1EAYC 3LNUA 2FDNA 3LP1B 1HNZF 2R7SA 2EWHA 2BW7A 4ILLA 1LNQA 2ZZMA 4X4TA 1R8PA 1YJNS 4NXME 2C1EB 3AOBA 5HN0A 2ZBIA 2FVRA 1GX6A 1UZHA 2OI2A 4DSJA 2NZ4A 4Y2KA 4JI4J 4R8UA 4I68A 3ZTPA 3ZZTA 4JI1F 2V4RA 3BSOA 1HMVB 1TL5A 4ED4A 5CZXA 1PBUA 1HR0E 1WSRA 4NCBA 1JLEB 2CGEA 1HPZB 5K36E 3QSYB 3AB4B 1Z5CA 1S6OA 3J80C 1XR6A 2NXUA 4PQUB 2OO4A 4LRFA 3UE2A 2R2UA 5D0EA 4M1KA 4JI1J 4BA1B 3HSZA 1GAOA 3IM9A 5IQQA 1SJQA 2L9WA 1N5YA 1S1WB 1NDKA 1DY3A 4LR9A 2XS7A 4YHHE 5AE3A 1S6QA 2EVZA 3LPYA 4PUOA 3H5SA 4Q5VA 3BDPA 3CIZA 3K85A 2H5JB 2D74B 2DNMA 1O0PA 3L9ZA 4LVNP 2AWZA 3AXMA 2HRYA 3CIMA 4HTJA 4NLPA 4NRUA 4G1IA 2G1DA 2MJNA 2E5LJ 3R3TA 1FTRA 2LU2A 2VFSA 3CWJA 2V0NA 4CLUA 3CC4S 3NAHA 4DSKA 4FBTA 4HACA 1J5OB 1IKYB 4PR6A 1OYRA 4WP9A 1NMEB 4I7FB 5KG0A 3W61A 2GHPA 4DQQA 5A8WA 1E6VB 1X9MA 4ZVSB 1TP7A 3FBEA 2CADA 5C5JA 1SPBP 2UU9F 3L7ZA 1MMLA 2WW4A 3GTYX 1I1GA 1WUUA 4LF4I 2A6OA 4QWAA 4NLOA 1OPZA 2N4DA 1G3OA 2IERA 5FLXY 3M8RA 3GCXP 3DYAA 2J7WA 3EVWA 5A0YB 4KYZA 1DTTB 3F56A 5I3UB 3M8QB 4XPCA 4DS4A 4MU1A 3K7RA 3NWRA 5J2PA 4LFCF 1AYEA 3V6JA 3CDWA 2QLWA 2PA8D 2E66A 1NKCA 3EGWB 1HBUB 3SZ2A 4LSLA 5E3PA 3I56S 4DL6A 3MAQA 2VZ9A 1XR5A 4ZVHA 1H2UX 2OSQA 2WSCC 4CQ1A 1YI2S 2DR8A 4DR6E 4IFDE 1LXNA 1IUJA 4IKAA 4ISAA 1BQNB 2C39B 4LF9E 2HNDA 2VH7A 1XNRF 1SQEA 1M5VC 2MQ8A 4AXIA 3MM8B 3P3GA 4KBIA 2VQFF 4HT5A 4IOBA 1VRQC 3VWSA 3RUBL 4NLXA 5HAOA 5DO2A 4Z7CA 2XG8A 5LSOA 5KG5A 3OTOF 5KG2A 1T95A 1RHQB 3R5GA 2QT7A 1SC4B 5ETOA 3TP2A 2C2EA 2VA2A 4MYUA 4LFCE 2CKWA 1VHIA 3BV8A 3UWTA 4OHVA 2FJWA 5L1IA 2NUHA 2QRRA 2U2FA 3Q86A 2OGUA 1SJFA 2CA9A 3TJ9A 5ETVA 3ILJA 3OFFA 2BANB 7FDRA 1U26A 2ZC4A 3BGUA 2MQPA 5DDPC 2XGQA 5IT4A 2BA9A 1NK0A 2YH1A 1NK8A 5KOXA 1QTMA 4FW4A 2O5DA 4JG4A 2UUAI 1KKHA 1XNRE 4F3QA 1S59A 2AZ3A 3DDIA 3MEKA 2FJDB 1W25A 4DOZA 5CABA 2X3GA 5KFGA 3QRRA 1QTNB 1KQGB 2GMHA 3CCWA 4I4BA 2EFPA 3LANA 5KFUA 1TKZA 3M2RB 1RLCL 1JWWA 2J65A 3SBMA 4WCEQ 2HMIA 3PRVA 1KEKA 4OO1B 2EC2A 2NREA 1GXTA 3G8QA 1U25A 5EDWA 4FN5A 4XO0A 2YKMA 1RUSA 1Y3KA 4IG0A 2FZCB 2UUAE 2MQOA 2QX0A 3HHLA 3PVXA 1Q8KA 2UXCJ 3J7AM 3KHRA 3QYYA 2LXFA 2GC8A 3DI6A 5HVGA 2HBZB 2RRBA 1PKUA 1EP4A 3R5CA 3OXGA 4X62J 1SJ3P 1XNRI 2XULA 3VAHA 4OYZA 5E7OB 2C2ZB 2HQIA 3NS6A 3SDEB 4CZCA 1XXEA 1HBOB 1X9WA 2HHXA 4IZKA 3WU4A 5BR8I 1RT1B 1PJ5A 4A8OA 4ED1A 1NU4A 2FHJA 4CYUB 1U49A 2WP8A 4C8NA 1F2GA 4WU3A 3C6TA 1X4DA 4LIWA 4MIAA 1YDLA 4P73A 2ZH8A 2CNKB 3KYLA 4F4XA 1F9EB 3HFVA 4U8YA 4X62F 1N33J 2XZTB 1HNWE 3KNAA 2W9AA 2JEIA 2CQPA 3RB6A 4NASA 2J9EA 4OYWA 4TYBA 3PRBA 4RW6A 4ECVA 3LO3A 3PYEA 4Q44A 2ASJA 4LF9F 2O01C 2D1CA 2AF6A 1UVJA 1VOMA 2JT2A 4TLRA 5CYJA 3BQ1A 3ZZOA 2GJFA 3JAMQ 2NLWA 2UUCF 3EZOA 4K5SA 4PG4A 4ZMMA 4GC6A 2VKRA 4JI1I 4DV3J 3F73A 1U02A 2K8GA 1FD8A 2KG0A 3GLLA 2AEMA 1Q82T 4GO7X 1RTHB 5DETA 1YHCA 2MLZA 1MG7A 3QNWB 1LEOA 2HIYA 2IPOB 5HQMA 4DV1E 5DZ6A 3WBZA 4QYRA 4TQSA 4J9LA 3G6ES 3PX4A 2N4CA 1JJHA 1P9QC 2QN6B 4RKUC 2E7VA 3MMAA 3HJCA 1B7YB 3GYNA 3KLVA 3K59A 1RHYA 2W8KA 4I6WA 1D9DA 4YOEA 4UOFA 3MMBA 1NHJA 4DEZA 2HKJA 1SQFA 2QA2A 5D8HB 1X4AA 4DCPB 1IM4A 2BOPA 5DRPA 3FBCA 2D41A 3FKBA 1R27B 4YP3A 2AMCB 3ZKDA 4DV3I 1SIZA 2HZAA 4DL3A 5GMEA 1AZSB 3CC2S 2UUCJ 5HVFA 1UEVA 3CF5Q 5J2QB 3T5HA 5FJ4A 4LF5I 2W2QP 4G1QB 4ELTA 2KJVA 4JI7E 1U6BA 3R7SB 4JUZA 3KLFB 1HWIA 2IDEA 3OXFA 3CDUA 3CMES 2HVEA 3OLBA 1XMQI 4F4YA 4OYBA 1HNWF 4O4GA 2C2NA 2KI2A 3QLHB 5A2QC 2KRBA 5LMNJ 5F3TA 4ID8A 4NLYA 5ETQA 1J5EJ 2I38A 4DFPA 4PPZA 4YDDB 4RBVA 1T0TV 2IJNA 2IVFB 1HHTP 2XTJP 1C0TB 1KQKA 1UP1A 1OSCA 4KB7A 4XDCA 4KC5A 2BUNA 1VMBA 1HPZA 4J9NA 4GC7A 5JUMA 2VBYA 3P45B 3S1TA 4IH6A 5KT2A 3P5BP 3T1HI 3AH6A 1R3NA 2DCLA 3P3CA 4EYHB 2GX8A 4ZCIA 4HHHA 1S9GB 1WHVA 2CPHA 2VFRA 1FF2A 3CD7A 2GAHC 2M4MA 1B4SA 3HHDA 3IP0A 1PJ6A 2PC6A 3QBCA 1DTQA 3LWMA 2Y1JA 3B4TA 3NRBA 4CRJA 1VJWA 2CQ1A 2DHAA 2OELA 1OIAA 1S6PB 4HHJA 5D0RA 3WC0A 4F0HA 5HO4A 2ZH3A 1HD1A 3GJQB 3NNAA 3TZXA 3H4DA 2F9DA 2MZTA 2VG7A 2JNJA 2WK4A 3ETMA 4QJVA 5E3AA 3GV8B 4KV8A 2ZH9A 4YS2A 3EDQB 2HRTA 1WC1A 3CO0P 4FNIA 4IDKA 1PYOB 4LF7F 1AW0A 2HHSA 3W3SA 1HYSA 1X5PA 1VQ7S 5C0XA 4MK8A 4GMKA 1IKWB 3HULA 3BBFA 4LT6A 4EI2A 4KGZB 1FKOA 3CEDA 4ANEA 2B4UA 2DIUA 4WFAQ 3G6XA 3CB4A 3GV7B 4RNMA 4JV1A 4OHYA 2VQFI 2FHOB 4CO3A 2M7SA 2OMLA 4K50A 3MDFA 3UDLA 1KSPA 3A4TA 2KVIA 2DK2A 2M5YA 2OPQA 2V94A 3BF4A 4ZCKA 2KN4A 3T1AA 4EO6A 4DV7I 1IBME 1JLBA 4B3SE 5CZVA 1HBNB 2VODA 1XMOI 2JRSA 2ZJQQ 4PWDB 4C98A 1RTIA 2FD2A 2W2NP 2W2MP 4JI2J 2X36A 3CDIA 2W01A 3PRYA 3LAMA 4IO9Q 2A18A 3EXYA 3H0PA 1K1SA 2FJBB 3N6MA 2NCKL 2Z30B 5KG7A 5IWAJ 4K4TA 4ED2A 4DV0F 1H38A 2QL5B 2CQCA 4ECRA 4ZVUB 3NGSA 4LF7J 2IHR1 1HNZJ 1OQ6A 2PA3A 1HR0J 1RLDA 3DLEA 5J1PA 4U95A 2BJ1A 2MZSA 1SH3A 4KSEB 3LP2B 4P74A 5B7WA 3T5JA 3PZPA 2HQDA 3EGZA 4DR7J 2PNMA 4XDDA 4HH1A 5HMYA 4RBUA 3NNHA 4C0OC 3TNVA 1SL2A 4CLTA 4MFBA 5HL7Q 3SCLE 4RW8B 1T03A 4AL7A 2JE6A 3VAMA 2UU9I 1A0OB 1KDNA 3RG6A 1FXDA 1SC6A 4MMOA 1E6YB 4CO2A 4QPXA 1Y10A 4RNNA 4ECSA 1KC8T 2BKPA 1RTDB 4W92B 5HLFB 5EWGA 3NGKA 2LDYA 1ZXNA 2IBOA 3G86A 3Q6MA 5L1JA 3H40A 2V4JB 3N6LA 2J8SA 4MK7A 5CHCB 1N56A 1Y7PA 3CJTA 4FP9A 4PG7A 3VVTA 1R8CA 3CJ8A 1S5ZA 2VFUA 1ZPWX 4M8LA 3BKTA 2V8PA 1UA1A 4A8FA 3U1LA 5BR8J 4CLPA 1HWJA 3P6YC 2R4FA 3DU6A 3MM6B 2JC1A 1WEZA 1CEZA 2BQRA 2HYIB 2IOQA 4KIAA 1L3SA 2E9ZA 2KFNA 4C8LA 2HMIB 4I69A 3CDAA 1HNWJ 3IAS9 5D15A 1FRMA 4Y2AA 4RU9A 2C37B 4F0MA 2PE8A 4FF3A 4MIWA 1S9EA 4XK8C 2K1RB 1IKXA 4RWXA 4DV0J 3SYZA 2DNPA 2WBRA 4KQZA 1GT8A 2G9OA 3D28A 1R0AB 2DY1A 3Q24A 1S1WA 5K20B 2DNGA 4L74A 3X1LB 1KHWA 1RISA 2HFZA 1RT5A 1P9YA 1S1XB 1IBMF 4H4KC 1NH7A 3H4LA 2CZ4A 2OAUA 4FXWA 3MUMP 1VK3A 1RU2A 2EBEA 4YB6A 4QYZJ 4KY3A 1VQKS 2NN6C 3W8PA 2M2BA 1XMOJ 4MKBA 2AEJA 1FEEA 1UPPA 1Y5LB 1RT6A 3MPYA 2HGMA 2V4JA 2XNQA 3H90A 4OYAA 4A46A 4DUZJ 4DV7J 5C0XC 2PMZD 1HNZE 1PC4A 1NSKL 2EG2A 3DDNA 2F9JA 1UETA 3LGNA 1TAUA 2GCFA 2FLOA 3M2UA 3GWCA 2Z5EA 3PIPQ 1PYSB 4FDFA 1XJWB 5A2QU 4IR1A 4WZMA 4YY3I 4WUDA 1T9UA 1H73A 1T9WA 1U45A 1JJCB 4Q7AA 4B9SA 3I9V9 2QFJA 2Q66A 4LBHA 3V81B 2U1AA 3NBPB 2BBEA 1S1TB 3DLJA 5A0YA 4WFBQ 3H5UA 3DYAB 2ZBCA 5C0XD 4ID5A 3LW5C 4MQYA 1HNZI 2FUG9 1H2TZ 2UXBI 5I3UA 2VDHA 2CVIA 2FB0A 3OUYB 3OJUA 1RCXB 2G4BA 1WDTA 1YX2A 2LLZA 2QSWA 2IDLA 2FVCA 3JXOA 4DV4J 2W4CA 2F4VF 3T1HF 2VESA 1XC9A 2XMMA 3IFEA 3RGIA 3GR1A 1UVNA 3MMAB 3N5FA 4Y2IA 1NJWA 1KWMA 1QZRA 1MWYA 3ZZ0A 2MJUA 5CCLA 4OV1A 4KV8B 4PXEA 5B0DA 2YNGB 4FS1A 3EZUA 1GTEA 1RXOB 2LQBA 3B4DA 4WBFA 1EQMA 1Y60A 1NHUA 3V6DA 1HQ2A 4YR2A 5F8GA 3HVTA 3LA0A 3W60A 3TQ1A 1WF1A 1SJ1A 3HHNB 4NXNE 4PXCA 1B62A 1N32F 5CH7B 5K5MA 3H2LA 4ITSA 4QU6A 2DPIA 2OFHX 4HDHA 3D5MA 4OZ5A 4WU2A 1VLOA 2PN6A 4CTAB 1A9NB 3T1YF 4DUYE 2B56A 2MPUA 3M30A 3NGDA 1RHJB 1VISA 4ZPBA 3M6UA 2F40A 4R5PA 3CPWR 3BO2A 3R9LA 5ETTA 1BE4A 1U0HB 1YZ6A 3AD8C 3CCTA 3FK4A 4RW7A 3I6PA 4P2MA 2XYGB 1H6KX 2ZFHA 3ENQA 3QWUA 2HAFA 4JB8B 4NE9C 2CJYB 5GMKa 2ZOFA 4PXDA 4WUCA 1U2RA 4LF8E 3WIUA 2Y9HA 1HKAA 2B6AB 3O6QA 1NXIA 4CLFA 1T05B 1AFJA 1AFIA 4NA1A 3PR4A 1VQ6S 1SB6A 4YR0A 2YX7A 1JLQA 2IM0A 1U6FA 2ZVSA 4A48A 1FWLA 4NXNJ 1SUQB 4RPFA 1FRIA 3I96A 1ZAWA 3W7BA 2BE9B 2PI4A 3WU3A 3DOKB 2BA0D 4KT0C 4DL5A 2JE6B 4IFDD 5C2GA 5DRKA 3UD4P 1JK9B 4KGMA 4PPDA 3GILA 1WEYA 1QUVA 1QAJA 4DV6I 2RQMA 3U1YA 1J5EI 3EWGA 3THPA 1HBOA 5HSPA 4IZJB 3QGPA 4EEYA 1CBKA 3DCAA 3MR6A 4KHPI 2DXEA 2HHHJ 2FJAB 2DNHA 2MLXA 4CTAA 2XMJA 4BC7A 1EIYB 2XI2A 2IMWP 3MXHP 1G6BA 1N52B 1RWPB 1GMVA 2IC3A 4QPTA 3LWLA 2C2KB 4M5HA 2DGUA 2KVQE 4MTPA 4IFDC 2VDIA 1I94J 2EK1A 4EWTA 3M1VA 4JI6E 5J2NB 3VV2B 5DQGA 1VBXA 4JI7J 4B9LA 4IFYA 2JEJA 5CD4H 4NXMF 5KFCA 2ZBKB 5K36C 2DNKA 4KHPE 2R7RA 1KIJA 3CUNA 2CJAA 3AJDA 2XWXA 3AQPA 1WF0A 3B78A 1VRTB 3K58A 1NSAA 3AY0A 1B99A 2B6AA 3N5BA 3NMRA 5KFZA 1OQ3A 2CUYA 2RDIA 2FHMA 3P96A 1N6QB 2X7IA 2YWFA 5LMUJ 1S77D 1OY6A 1SUQA 1RAJA 1EETB 3HCXA 1AT1B 3IXQA 2WB1D 4H4OB 2UUAF 3TVYA 4O44B 4TU9A 5CQGA 4DV7E 3PO5A 4GVBA 4TNOA 2HHUA 3W2WA 2HS3A 3BBBA 1B7FA 2P2CB 5DG8A 2UV8A 5K36B 4P75A 1IR1A 3QAUA 4DPXA 5CD4A 4QIFA 3I5AA 4M95A 2ILZA 4R0JA 3LUYA 1SKUB 2DISA 4A8SA 3NGTA 3OR2B 5HANA 5KFBA 2N7YA 1TKTA 1NSQA 1MU2A 2RKIB 3D4JA 3EYZA 5DRRA 4UOGA 3EPGA 3MUTP 4UZBA 3HHLD 2J0XA 2HZVA 2E7XA 2XMUA 3H2UB 2C3MA 1KONA 2A2DA 2DH8A 2EFQA 5J1EB 2MKJA 1HI1A 2VICA 1SXLA 1RWOB 3BO4A 4Y28C 3QJJA 1TQLA 2NXEA 4P7TA 1AZSA 5IM0B 2XC9A 1M90T 2DGXA 2OTJS 4TLQA 1KD1T 1KVIA 3TVKA 2KYXA 2WOMA 2JZ5A 4QIGA 5L1KA 5GAEU 1NUEA 2F8HA 1FRKA 1QSYA 2VG6B 1UW4A 2GVZA 2Z5BA 1HLWA 2CXEA 4JYAI 1KTQA 3UDCA 1HNVB 1QM9A 3PNIA 3GV5B 5A8WB 2HHPA 2YKQA 2KH9A 2V9KA 4A8MP 3O3LA 4X66J 9ATCB 3JS9A 1EX8A 4JI4F 3L7ZB 1TKZB 3M2RA 3K5OA 4TU7A 2YPYA 1WG4A 4AQYI 1ICEB 3Q6NA 2V2ZA 1V5VA 3EZ5A 1A6LA 2DGVA 2CQ3A 2GQQA 3BEGB 3HF5A 1Q8IA 4G6VB 2H54B 2RVJA 2MEWA 4FPIA 4GRSA 2AV5A 1UFWA 4J5OA 2VQEI 4B3TF 5E3CA 1D09B 2CVEA 2HWHA 1IKYA 3HDSA 1S0MA 1Y5IB 2JOQA 2XYPB 1JQGA 1TMMA 2C2MB 1HL6A 2ZWPA 2ZWOA 3C8YA 4OYIA 4RWWA 4E8UA 4URGA 3HVWA 4LCFA 4DPWA 3Q8SB 2KKHA 4LFBF 4U7UD 2C3OA 5THWA 3CCMS 2RH3A 4XAKA 2MB0B 1RT1A 2YBVA 2GW8A 5C25A 3QGIA 3HPOA 1TK0A 2IOPA 2CQIA 4CYUA 3RZAA 1X4EA 4MU3A 1GMWD 4ES2A 4X62E 2O3DA 3BDEA 3CXCR 1TKDA 1HIYA 4JI0F 4G3IA 1LQ9A 3PM9A 3NL0A 4YB1P 5KAKA 1YVFA 2BABA 3ADAC 1FWKA 1UWBB 2P6SA 4CNZA 2J9CA 4M5NA 3MFIA 2ZH4A 1VLYA 3IS9B 3R8YA 4LFBJ 1UFKA 1DZ5A 2HVHA 1YJ7A 2E9RX 2MQLA 5H1SV 4NLDA 2MSSA 3C6UB 1OS5A 3FCVA 2ZVIA 3DLGA 2B9EA 1JKHA 3JAMU 1JNRB 1OJ4A 3VHQA 4Y0FA 2XMAA 4J9PA 1U24A 2KL8A 3KOAA 4O0NA 4ZS6A 2BJDA 1NK4A 2HNDB 2QLXA 5KFVA 2HQCA 4X4PA 4DUYI 2BX6A 2HHVA 3GIMA 2LEPA 3I9ZA 1GK8A 1ZM2A 5K8PA 1RR9A 3HD2A 1RI7A 1P8GA 2FJXA 5D4PA 1FJCA 4ED6A 2CPIA 2J6TA 4IZJA 3D6TB 4OZLA 1DURA 3NAIA 1FVQA 4K2JA 1YQHA 4Y2CA 2MMYA 2WRMA 3RW7A 4YFUA 4LFAF 1ZM3A 4JYAJ 1MSWD 3U1NA 1IBKJ 1RBOB 3MMBB 3QFHA 3JSBA 5GAHI 2E5LE 4PYDA 3KMQA 4DR5E 4CLYA 3P8BB 3QIDA 2JL9A 4MFBB 4DZDA 4R8UB 5EX3A 3MR3A 4IFYB 1G4CA 4G65A 3LGMA 4DR4J 4LPFA 3I55S 2OD4A 1NJIT 2HQGA 4DN9A 2OPPB 4ZPCA 1W2BR 3MEDB 4PWUA 2CWKA 2X1AA 1P1LA 1M0SA 1U09A 2AKWB 4U9RA 5DLGA 4K0KJ 4HACB 3GFHA 2A6MA 5KT6A 1J5OA 1P42A 2JVOA 1RACB 4DR5I 2W7PA 3LAKA 2KT5A 3MCNA 2FHKA 3NP5A 3HP6A 2VOPA 1HQEA 1OWXA 4ECZA 2HPUA 3A1YG 4ELVA 2HHQA 2PNLA 4PUOB 3BYPA 2J0SD 1T9VA 3I4HX 3R7BB 3C15A 1XERA 4RW4A 2MZ1A 1MU5A 5C24A 3RBZA 3J81j 1S72S 4LBIA 1F3VA 1LK5A 1AROP 1IKXB 3M85G 2W24A 5DJBA 1DTTA 1WF2A 1WKKA 4I1TA 2JLEA 4JV2A 4FF4A 2IJFA 3SXLA 1USUA 3TX8A 2IESA 1JJ2R 5JEAB 3OVBA 4LRBA 1LWEA 2XSJB 3CTRA 2CWXA 3AXKA 2OH2A 1RWMB 1S7IA 2AT1B 4NZ0A 4QYZK 1N32I 2UXCE 4LSZB 1Q16B 1VK8A 3D6MB 4IQMA 3QATA 3IMQJ 4CM0A 3V6KA 4Q0BA 1QY7A 1WKLA 2HBRB 3NXZA 4C2MA 2L48A 3W5YA 1N36F 4B3TJ 2VBXA 4ZVGA 2OPPA 1UVLA 4ERDA 1C1CB 1KBRA 1MROB 1PYTA 4C8YA 2H4YB 1EZZB 2DGOA 3AD7C 5L3JA 4IFVB 4CT9A 4FKXA 1OO0B 2UXDE 1UFLA 2CDQA 5GVQA 2VFVA 3HX9A 3K5NA 4DV5F 1S6UA 4WYWA 8ATCB 1UTAA 2DEIA 4UOCA 4DU8A 4F0KA 2J9DE 3TX0A 3CJQA 3N4WA 4F25A 4JV5E 4LFAE 2B9WA 4PWWA 1FKPA 2YX1A 3W64A 2AX1A 4BCAA 1X4BA 3M4XA 3UVJB 2YQ3A 4NEYA 4URQU 5DQHA 2ZHBA 4LFAJ 5IT9C 3VAGA 1IBKI 3DC2A 2VPZB 1RADB 4QNKA 1J27A 1DAXA 3NG8A 1S0VA 1N36E 1HI8A 5IZHA 1KR4A 1S79A 4PQUA 3D6FB 3DRPB 2VF3A 5CAAA 3HO1A 3M7ND 5EWEA 4K4VA 1JX4A 2JEFA 5HQ8A 3CCVS 2M8DB 2I8EA 4YR3A 2A10A 3GFZA 4DV4I 5K36F 4KTQA 2A3JA 4GKKJ 1NPKA 2IYIA 2W25A 3J7A1 3SCJE 3GCWP 3BYRA 1BQMA 1ZXMA 4DR5J 3THVA 4DL7A 2AGOA 1IBLF 4ZP7A 2BJ7A 2GV1A 4OZ1A 2RNEA 5A8KB 4PKDB 3N28A 1R31A 5LMUE 1OPIA 1P27B 4JYAE 2POKA 4IFVA 5B0EA 4BA2B 4DR3F 3FC9A 2D7SA 2QEXS 4M5GA 2OJ3A 3HVTB 2EEYA 2CPEA 1S9GA 3W2VA 2HS0A 3I82A 3V6DB 3RAXA 2AYBA 3A8EA 2D69A 2UUCE 2EBGA 4OQJA 3DOMB 1WDDA 3DM2A 2YX4A 4OO1A 4ED0A 4A47A 2UVRA 2NS1B 5GAGI 2V67A 3UVJA 3SI8A 3FFIA 3SMZA 4PRVA 1FNOA 1N0UA 2DGQA 5AXLA 5KFXA 5CYMA 3C6TB 4AYBD 5LJ5Y 3UCZP 3LPSA 4OJ3A 4OLOA 2DNLA 1IJEB 3WX4A 2K06A 4ZHRB 5D4NA 3PW5A 1HNXF 4DV0I 1IN0A 1JLCB 4GQUA 5C0XB 4WP3A 4AIDA 4LCGA 3BPSP 4LQ9A 3KWMA 1SL0A 4NLQA 5AE1A 1HR0I 4WZQA 2B7BB 2BMBA 2VASA 2DIVA 4HVZA 3G6YA 1K8AT 2LMIA 3CW2C 2J6UA 1IQZA 1Y9OA 2PNZB 1F0XA 2F4VE 2HGLA 4B3OB 4KH1B 1RT2B 4LF1A 4Q2LA 4ANDA 2B4VA 2VG7B 5F0UA 5KG6A 2YNHA 3M05A 4S0MA 2KHCA 4DL2A 4IRDA 2RU3A 2LJPA 3KJFB 4HEA9 4JI3F 4FXDA 2HHTA 3EGNA 5L1LA 4BWMA 3ZXWA 1Z59A 3O5TB 3HJFA 3GQCA 4MAKA 1HFEL 4NZ7A 4K4UA 3GFYA 3PY8A 4J37A 3HJVA 2R7QA 4AL6A 3C14B 3JSRA 1DLOA 4ZCLA 3KLGA 3H20A 1CJUA 4WIIA 3K5PA 1WI8A 4WWSA 3TR5A 3V4MA 2L9DA 3BJYA 2XS5A 4FW3A 4NBQA 1CJKA 4KO0B 5D0HA 1C1BA 2V6AA 2LA6A 1HBNA 4MIBA 3AT1B 3CCSS 4F50A 1FJGJ 1NDPA 2EFOA 2Q1LA 2Z8QA 4BHQA 5DDRC 3CCJS 4B3MI 3I0SB 3PEHA 4JI4E 5C7PA 1RT4A 1K1QA 2CG4A 5CYQB 2ZJRQ 1OMSA 1VCTA 1ZOTA 2P9GA 3OR1B 4KKOB 3OBIA 4RX6A 5IQ6A 4J9RA 4B9MA 2DHXA 2R7OA 2DRDA 4X66E 4ES1A 3PXGa 4OI1A 2PIIA 1BGXT 1GQEA 2XHCA 3P4UB 1VS3A 1YHQS 3AFGA 1XMQF 2VD3A 2FIUA 1RT3B 1T94A 1B3TA 2ROPA 1VQLS 2RF2B 2EI5A 1L3KA 2JVRA 2XWYA 1PBAA 2HAIA 5SZTA 3MURP 3GIJA 3SV3A 1N36J 2CJ9A 2XSJA 1N88A 1U7LA 2V34A 3B8HA 2CPDA 1GXUA 3AQOA 3VAIA 3M8ZA 4NMXA 3D67A 3MM6A 3KK2A 1DJ0A 4YY3E 5HROA 1D0EA 1X31C 3TVZA 3LP0A 1FWPA 2ROGA 2W9BB 5I4MA 3ZZPA 2HFVA 4NLUA 1G7CB 4FF2A 3ITHA 2KHDA 3POTB 1BUXA 1CJUB 1NPPA 3A8KA 2WP8B 4F26A 1ZTTA 1YBTA 1CJKB 4KO0A 4WP8A 3WDOA 2ADBA 1Q53A 4CO1A 5G0RA 2YNIA 2ABYA 1UEKA 4X64E 3I31A 1EHWA 2XY7A 3GR0A 2PO0A 4NA2A 5JEAE 5DNLA 3PYGA 1R7IA 2A2CA 2VG5B 4ZA1A 4C97A 1OYPA 2ZEJA 4FYVB 1S1XA 2B8PA 2HHHF 4JI5J 3CCES 3G9CA 2BACA 2ROEA 1C0UA 2AW0A 4OHXA 3DN9A 4NCAA 3HK2A 2ILYA 2XMKA 4BDPA 4HXZA 3TA1A 4GKKI 4DR7F 4K0KE 5D4LA 4EZ6A 1U1NA 1GMUA 4IUFA 1IBLE 4LF4F 3MAAA 3DD6A 1TMJA 1HBMB 4FWHA 2GMLA 5D4OA 6FDRA 3Q2TC 3PS1A 1CSJA 1Z0BA 3MCMA 2LU1A 4D3HA 5AXNA 2GQCA 4DV7F 3OW2R 2R8GA 4DPOA 1RAEB 4K8RA 2WZ1A 2FQQB 3GMGA 1VQ8S 2C2OB 2Z56B 2O1VA 3PYDA 4X64I 2E5IA 1RWNB 3POTA 4X4QA 2BA1G 1VQYA 2J9DA 4EFAC 4NLRA 4IDKB 5LOQA 2W9CB 2BR2A 3M7NG 2QLBB 3PJ9A 3ILIA 3MM8A 2R7XA 2HW3A 4DCOB 2RD5C 1O8BA 5AT1B 1C4CA 1ZZNA 3PHTA 3SEOA 3T6JA 1FDAA 3M2VA 5DDOC 3PV8A 2H3EB 1FKOB 2XI3A 4OO1E 2LXIA 4CLZA 4DR1J 4JI5I 2M52A 4DSIA 2QC3A 3KG1A 4XIUA 3QIPB 4R1FA 2CIMA 1X7VA 3OXLA 2H51B 4ILMA 4G1QA 5F0WA 4QR2A 4ENOA 5ADZA 3LP1A 3G2XA 2WVBA 3DGPA 4RW9A 4ZP8A 3W1YC 5KFOA 3JYTA 3NMAA 1G2EA 2DHGA 2OKQA 2W2OP 3FCHA 4Z7YA 4ZHRA 5KFMA 1U1LA 2YNGA 2VQEE 1N33I 3IG1B 3C46A 4LRCA 2MQQA 2H9ZA 2HWTA 4USVA 1ZA2B 1UWBA 4F2RA 3BSAA 4U8VA 5KG1A 4E0DA 4FWDA 4DXLA 1IM6A 5E0OA 3KJVA 3IWNC 2IM1A 2WHOA 2AGPA 1K73T 1CS4A 1FE0A 4JI3E 2HVZA 5I42B 2MZQA 3GLJA 2CJQA 2O3ZA 4ZLJA 2PMWA 2Q2EB 2DGTA 2QGFB 3N0VA 2Z5CB 1Q0NA 4UTGA 1RAHB 4NI2B 1Y5NB 4MKYA 5K36D 5IXUA 3BKFA 3WU6A 4J91A 1VBYA 2RS2A 1SCJB 5T14A 2VPXB 4LR7A 3M8WA 4PQAA 2UXDI 5IC4B 3AOAA 4F2SA 5B0GA 2DJWA 4DFMA 1N0VC 1RTDA 3CJ5A 2IRXA 4NYPA 1RCOB 4Y34A 5KFEA 1QVFR 4QWBA 4K0KF 1F6TA 3EJMA 1WTFA 1YJUA 4DSLA 1AXQA 4Y65A 4DG1B 4DR3E 2VBWA 3OVSA 2VC0A 4K2XA 3DGPB 4RW9B 1HR0F 2GJIA 2OTLS 5H9FK 2JJ4D 1N5VA 2QYGA 3M6WA 3DOLA 2XBPA 5I3PA 2RUGA 2PSZA 1Q4RA 1UMJA 3UCGA 1XK8A 3LF0A 5KFDA 1TK5A 3F41A 4I6AA 2CQBA 3CVKA 1H7WA 2QE5A 4P2XA 1SKRA 4FYYB 4L75A 1YJ9S 4F7VA 1GNKA 2ZM6F 3T41A 1S9FA 3JSMA 3FBFA 2E9TA 2F63A 2VFTA 4ER8A 4LFBI 3OL8A 2WOMB 1FJGI 1RAOA 3I4PA 1PCAA 3FFIB 5HBMA 2FYXA 2CDRB 4PG5A 2VG6A 3SSRA 4JBCA 6AT1B 3OL7A 1FKAE 2CYYA 1VFJA 2G2ZA 2GGPB 1FDNA 1JLQB 1ZAXA 3D1HA 4DF8A 4K59A 2V63A 1URNA 4PXBA 3T6BA 2UU9E 4M5LA 5KFNA 2FLNA 2GIFA 4N5SA 5RUBA 4DUYJ 3NOGA 4WFXA 3OFHA 1D8ZA 4O3OA 5J2NA 3IN5A 1U48A 2NR0A 4CT8A 2BQUA 4M5IA 2UXBJ 2LQJA 2CRLA 3JTPA 1XR7A 2JWNA 4CP5A 1RTJB 3G4SS 2XCPA 4I3HA 4N8OA 2AX0A 2CJBA 4ILRA 1WEXA 2OEKA 3C16B 2C2DA 3MR5A 4DQPA 1JLFB 1HARA 1S1TA 3MMJA 1Y4ZB 3UN5A 1RT6B 3VAJA 4B3MJ 2R7VA 5F8IA 4FW6A 1DBDA 3IBFB 4ZP6A 4NYOA 4F04B 2AGQA 1Q5VA 1FVSA 2L08A 3AA9A 1VQOS 1Q1KA 1TL7A 1FKAF 3B4MA 1LW2B 4C6AA 2R2TA 1N5YB 1REVB 4L3NA 3PEJA 2HWIA 1HI0P 4AT1B 1WC0A 1EJ7L 5KFTA 1CJTB 1UCNA 4D3GA 4DBQA 3OVAA 1J5EE 2P5VA 5BJRA 2ZE2B 1R89A 1F5AA 3HHLC 2BANA 5HBMB 2Y3YA 3KLGB 3KLHB 2IA0A 3G8TA 4BC9A 4EBDA 3TAQA 2RSQA 1SH2A 4K4YA 2GIRA 2P8IA 3LH2S 3ULHA 2XMTA 1SKWA 3RRGA 3OTOE 2RDJA 1XMOE 3PTWA 1CPZA 3ZTRA 2N7CA 3PKMA 5F3ZA 2QG9B 2HNZA 4RZRA 2QL7B 3O44A 2V4QA 1FFGB 1N5TA 4JI7F 4NXMJ 3IM8A 2DXDA 2GMJA 4W98A 4Y2MA 5LSLA 1KLMB 4K4XA 1FO1A 4DR2E 4B3TE 4JV5I 2Z4PA 3QQCD 5LSRA 3FJ2A 4IG0B 2V2VA 3I0RB 3OV7A 2I0XA 1S1VB 1LWFA 3BM7A 4C11B 6FD1A 4ZIWA 4I2PA 2F3JA 1IKVA 3GP9A 4URSA 3Q8UA 1S10A 4XTJA 4B3RJ 3NCRA 4DPUA 1APSA 5CA5A 3NKYA 1NM2A 4NCGA 4JI2I 3CT9A 2EC0A 1Y3JA 1RA7A 1BQMB 2CNOB 2HFNA 2V8DA 3SSQA 3V5RA 7FD1A 2VJUA 1S57A 3T5KA 2AQ4A 4Y6IA 1JXLA 4JI0E 2DO0A 3M8SA 3UCUP 2FLPA 3VAKA 5K9FA 1M5KC 3HD1A 4LVOP 4KJIA 4R5PB 3PW0A 2OSRA 1Z0TA 1K44A 3PG9A 5H9EK 2LEAA 3ET6A 3QZ7A 4OX9J 3VZHA 4OI3A 1UL3A 4MT1A 4LQ3A 1GH8A 5M2PA 3QT6A 4TXSA 2RJZA 5EUHA 3CGIA 1WC3A 3KJVB 1QLNA 1SQGA 2DHSA 4JI6F 2XCAA 2XMWA 4BBYA 4FWGA 4WUBA 3R5DA 1NZ0A 2PFDA 1X5SA 3VGSA 1ZBTA 1HQUB 1RK8A 2IFXA 3EE3A 5KFQA 4CIOA 1A7GE 4IOAQ 1YSJA 5KFPA 3DHXA 2E1MC 3ZZYA 3T1YJ 1HD0A 2JHEA 2J7KA 1K0TA 3MPWA 2ZC3A 1XHKA 2B8QA 3H2VE 1ZM9A 2CG8A 2F8MA 3PR5B 2E5LI 4E98A 2IRUA 2QIFA 1FK9A 1RGVA 3MM9A 1CULB 2GIQA 4L72B 2KO1A 2P9EA 4LUBA 1LWCB 3I5CA 3MTKA 2OEJA 2ZOGA 5KFRA 1ZTWA 1N33F 2R7TA 1NRKA 3CJKB 1QDUB 5AE2A 4X4SA 2BA1D 4NMLA 1HNXJ 4LF8I 1K0VA 5DGBA 3M7VA 3S01A 4ECQA 1HW8A 1PAUB 2BJ3A 3QZ8A 2GHWA 3BBCA 1NKBA 3IO1A 3QJPA 2WVCA 1X0FA 2AP6A 2GFFA 4J9KA 2YNHB 1N5QA 2ZD1A 4EYIB 3T1HJ 1RKJA 4N47A 3A8IA 2QLJB 1PO6A 3N01A 3TJAA 2IA6A 1Z0VA 4DV2J 1RWXB 2NN6F 1S1UA 3SQGB 4QW9A 4B9VA 4DHVA 3FDSA 4YN3B 4GKJF 3Q8VA 3HKWA 4C8KA 4L6V3 1NHHA 2GQ2A 4HH0A 3P06A 2HHHI 3QRPA 2BE2B 1X60A 3E3XA 3FQLA 1UEUA 1V3SA 5FIIA 5EGYA 1FERA 4KHPJ 2DRAA 4QU7A 2NN6B 1FJEB 5BYRA 5JJBA 3H42A 3ETOA 1H3DA 3D68A 1I51B 2UXCI 1JNZB 4JI7I 1MU2B 2RKIA 4LSNB 4P7VA 5KFKA 3KHLA 4F02A 2WW8A 3L4BC 3QAEA 4ZVPB 4QIEA 4DN0A 4B3SF 3QT8A 1SC3B 1U2CA 1WI6A 3L09A 3U1MA 1N48A 1MN9A 3I0SA 1NO8A 3TA2A 5KFJA 2XQCA 1UVIA 2X1FA 2AEFA 2NPFA 4OX9F 2VV5A 7AT1B 4P2FA 5B0AA 2ATCB 2QZ8A 4DL4A 3S8SA 2K7JA 2ATLA 1WNEA 3BQ2A 3NCQA 4TY8A 5A8RB 5DLFA 2KM8B 1KFDA 4N8NA 5LL6R 1UDOA 4DSFA 2ZH5A 1FFSB 4DSEA 1NK6A 4AM3A 3KHGA 4MU0A 2K1RA 3K2YA 1GMWA 1FEHA 3BR9A 5CCMA 1FRHA 1JLAB 2GVDA 1YZ7A 2MKSA 2XEXA 3CMQA 1S99A 1ZAVA 2E5GA 3EUNA 3GJRB 4KHMA 2H65B 3FUYA 4JI3J 1BQXA 2D3UA 2FHJD 4OJGA 2WTFA 1VRUA 4MKAA 4B08A 3KK2B 3EX7B 4O3SA 2HQ3A 4HR2A 5I3QA 2O1TA 4DR4I 1VQPS 1V9OA 3OFEA 1A6FA 4DV4E 4OX9E 1TUGB 1VHFA 4KGVB 2GVZB 2QV6A 3HVAA 3R2CJ 5L46A 2Z5BB 1RWKB 1YLXA 3RTVA 2KXHA 4OZEA 4UY8T 1UWAA 4DV2E 2JLFA 3UFCX 3PW4A 4JV5J 1IVZA 1Z1ZA 3ZC4A 2ZH2A 1RT7B 2HNZB 3DMJB 3D9BA 3K8WA 1NB2A 1TTHB 2G0IA 3DLKA 4I2QB 3CCUS 4F36A 4DV1J 2MHEA 5D6GA 2Y1IA 3R1LA 1Q7YT 1QVGR 2J76E 2PO1B 5GAGU 3JSMB 3R97A 3G96A 5LM7E 1F5BA 1UPMB 4IYQA 4ZITA 3RW6A 3US5A 3P3DA 2M9KA 4LFCI 2AJ1A 2ZKUA 5CYMB 4B9NA 2HIQA 1FESA 1GFWB 5KT3A 4UOHA 4YMEA 3HFZB 4EMDA 5AXMA 2NN6E 2RUSA 4RNFA 1JJ4A 4C3KA 4GKKE 2QO3A 4TY9A 2DKOB 2NSBA 4UW2A 1SJ4P 4LBPA 2F1DA 2G0JA 2RT3A 2E5HA 2D9PA 2DNOA 3HZEA 2AJ2A 2R7WA 2E1CA 3J81Y 4Q0BB 1X5TA 2OP5A 5DS7A 2AHOB 4F4AA 1IBLJ 1BKNA 4MJKA 2RHSB 3LP2A 3MOZA 5JVGQ 2FJVA 1UA0A 1FXLA 1JIHA 3OTOI 2YQ0A 1EARA 3W9JA 1M5OC 4F3MA 3THTA 2IY5B 4W90B 5HMWA 4OZ3A 2F4VI 3MCOA 3G82B 3PFOA 1WELA 3R5JB 3BREA 4IH5A 5J2MB 2WONA 1TVRA 3GJSB 3R5AA 4CM2A 3OLAA 2HHHE 3QGGA 4FBUA 4TN2A 4UY85 2JEAB 1N5SA 3FZBA 2B5JB 4M5JA 2CQHA 2I2YA 4ECTA 1HK7A 3FNNA 1HA1A 4U7CA 2LDIA 2CG9A 1VQ9S 2VONA 3UQSA 4IQXA 1H98A 5L39A 1D9AA 3R6GB 1KQFB 4ZLLA 2KZZA 4AE5A 2B3TB 5IFMA 2YVSA 1N8RT 3IG1A 4M5MA 1S7HA 3GYXB 3OTOJ 4DLGA 1MX0A 4Z37A 2KU7A 1R8HA 3QO9A 3W2VB 3FEZA 2MKCA 2O66A 5C42A 1V3RA 1TV6A 2GNKA 2DD8S 5K14A 3V6HA 2QMWA 3NLCA 1S0NA 3N6NA 1XNRJ 1ITPA 3OTDA 3F0NA 2LKZA 3Q0AA 2LA4A 2MQNA 4X66I 5FLXC 4GKJE 3CJSA 4OZ2A 2HRUA 2PI5A 1Q81T 1R43A 4WFNQ 1S9EB 2DR5A 2O1WA 2DXFA 4UUWA 3QSIA 4XTTA 4ZLNA 4C9DA 1BC6A 3PS2A 4I2PB 3F44A 2KB2A 5E33A 3UN3A 4PWDA 5LMUI 3VQSA 4LF8F 1USVA 2ZH7A 4AQYJ 4J9UE 1Q8LA 4N77A 4ED5A 4CDIA 1VYAA 4J9SA 3I32A 4LF6J 1KNZA 2P6TA 3MPVA 3KK3B 1Z2ZA 3HHEA 3E2EA 2LQ5A 3SFGA 2JFDA 2YWKA 3PACA 1P1TA 4HT7A 3J81U 2BKOA 1ZH5A 4DV1I 4JI8J 1Z0CA 5KT7A 1ULRA 5LL6d 2Q6BA 4CLSA 5DG9A 5C2CA 4CLLA 2VHGA 2DH9A 5DG7A 5H9FJ 3T3FA 2DNNA 2VPYB 3DNCA 5A6PA 4LF6F 3KJQB 4ZVEA 2IMOA 1X8DA 2E44A 2VQEF 4DV5E 3LTOA 5J2QA 3PCOB 2AJ4A 3KUHA 3H98A 4J9QA 2W4PA 4P7AA 4IR9A 1AUSL 4CH0S 4ZJLA 3D3BJ 1VQNS 4LF7E 2V50A 1N32E 1T3OA 3CCZA 3ISZA 3SIPB 5K8NA 4DLEA 2O1PA 1D8YA 4LF9I 2UXBF 3TI0A 2F5GA 3IR7B 5ETPA 3HVRA 4DR1F 2RQKA 3RBXA 4O44A 3FBBA 4HI2A 4DX8H 2JEGA 2AE8A 3K1JA 1IWGA 1X0PA 1ZZFA 1RBLA 3NY0A 4JI2F 3OR1A 4KKOA 4AFFA 1PKPA 1FKPB 4OLPA 2MHNA 4C0BA 3FVYA 2KZMA 1E3PA 1CC8A 3WQPA 1DRZA 1IBKF 4X65F 3DXBA 4NLTA 4UF4A 1VIOA 2FGOA 4I0WA 3KLEA 5ELWA 2V8VA 4KR0B 5DROA 5EHHA 1NAQA 1NSPA 2K3KA 2XS2A 4HKQA 3AOCA
chains in the Genus database with same CATH topology
2BV3A 4DV0I 3ZKDA 1PIEA 4DV3I 5GMEA 1HR0I 3CWVA 4LF5I 4JI7E 4P52A 3T1YI 2ZM6E 2F4VE 1XMQI 3M6AA 4DV6E 4DR7I 2HK3A 2HFSA 5A2QC 2LJPA 4DR2I 1Z0WA 4JI8I 2DEJA 2VQFE 3T1HI 4B3MI 1Z0EA 4HY1A 4URLA 4X66E 1KTVA 4KQVA 4NXMI 2V34A 3B8HA 3HULA 2R42A 2VQFI 4YY3E 4DV7I 1IBME 1FNMA 1Y6ZA 1XMOI 2UUBE 4X62I 3B82A 2X36A 3QT5A 1UEKA 4X64E 1HNXE 1K47A 3WU5A 3PYGA 1EI1A 1MX0A 2A2CA 4IZKB 1H7SA 4GKKI 4HXZA 2PNMA 1HNWI 4K0KE 1IBLE 5A2QQ 2UU9I 4DR1I 4FWHA 4B3TI 1Z0BA 4NXNI 1ZXNA 4DR3E 2BM1A 4JI8E 3Q6MA 3J80Q 4DV0E 2O1VA 3PYDA 4X64I 4USKA 1S4EA 1KVKA 2VQEI 2V8PA 2CZ9A 3ZM7A 4JI5I 4R1FA 4LF6I 2IOQA 5FLXQ 2UUCI 4Z7YA 1N33I 2VQEE 4USMA 4DPYA 4X65I 1H74A 2EFGA 4FWDA 4OX9I 1FJGE 1HNWE 4DXLA 3H4LA 4JI3E 2Q2EB 2Z5CB 4UTGA 3ZKBA 3WU6A 2HKEA 1HNZE 3J7AG 2GS8A 2Z5EA 2UXDI 4YY3I 1Z5AA 1N0VC 4AQYE 4WUDA 1H73A 1H72C 1HNZI 4K0KI 4DUZI 2UXBI 4DR7E 4YHHI 4LFBI 4LFAI 1FJGI 1QZRA 3ZZ0A 2Z5CA 1FKAE 2UU9E 1HK7A 4NXNE 5LMNI 1B62A 1N34I 4JI5E 4I3HA 4PRXA 4JI4I 4GKJI 2UXBE 1H7UA 4DUZE 1XNRI 1Z59A 4DUYE 4UT4A 1VISA 4FW9A 1N33E 1IBMI 5IWAI 4LF5E 4DR4E 1S16A 1Z5BA 4DR3I 1XMQE 4WUCA 1U2RA 4LF8E 1J5EE 4JI3I 1HNXI 1RREA 1XNQE 2BM0A 5GMDA 1FWLA 4RPFA 4B3RI 3OTOE 2O1UA 3WU3A 5IWAE 1XMOE 2UUBI 1B63A 4DV6I 1J5EI 4IZJB 3GONA 4KHPI 4DR2E 4B3TE 4JV5I 5LMNE 4DPTA 2V2VA 4XTJA 4JI6E 4N3OA 3T1HE 4DPUA 2ZBKB 4LF7I 4JI2I 4KHPE 3V2UC 1KIJA 3V5RA 4B3SI 4DU7A 3B78A 5IT9Q 4JI0E 4LF4E 2HK2A 2X7IA 1Z0TA 1EA6A 2ZITA 4DV7E 3QT6A 4WUBA 3T1YE 4FWGA 4JI7I 4DPXA 1NZ0A 3ZZUA 4JI6I 2J7KA 4DV2I 1XHKA 4DV3E 3D4JA 1ZM9A 2E5LI 2E1RA 1Y4SA 2A2DA 4LF6E 4LF8I 2R3VA 4DR1E 2Z5BA 4JI1E 4JYAI 4B3RE 4JI0I 1Z0VA 1NHHA 3P06A 2HHHI 4AQYI 2HFUA 3Q6NA 2V2ZA 4PU9A 3JAMC 2UXCI 3LNUA 1NHIA 4NXME 3QT8A 2OI2A 4MYTA 3ZZTA 4DPWA 2NPFA 4ED4A 3J81Q 1HR0E 2CGEA 2IOPA 1D6TA 1Z5CA 3J80C 5LL6R 4X62E 4M1KA 1FWKA 2XEXA 2UUCE 4YHHE 4B3SE 2O1TA 3K85A 4DR4I 1N34E 1A6FA 1OJ4A 4DV4E 4OX9E 3PRYA 2Z5BB 1IBLI 4HACA 4DUYI 4DV2E 1PVGA 1ZM2A 1RR9A 2GQ0A 3K17A 2WW4A 4IZJA 5BR8E 1WUUA 4LF4I 1ZM3A 4LFCI 2E5LE 4EMDA 4DR5E 1I94I 4GKKE 4ZVIA 4DR6E 1BKNA 4B3ME 4LF9E 4HACB 4DR5I 1I94E 3OTOI 2ZM6I 2F4VI 4Z7CA 2PNLA 2HHHE 1IBKE 4DR6I 4LFCE 4MYUA 3J81C 4JI2E 1MU5A 4LFBE 3PYFA 2CG9A 4X65E 1USUA 4JG4A 2V2QA 2UUAI 1KKHA 1XNRE 1N36I 1N32I 2UXCE 5FWKA 3F0NA 4X66I 5FLXC 4IZJD 4JI4E 4DV5I 5L3JA 4GKJE 4FN5A 2O1WA 1DARA 4HYMA 2UUAE 2UXDE 3J7AM 5LMUI 1XNQI 1USVA 2DEIA 4DU8A 1ZM4A 4JV5E 4LFAE 4IZKA 5BR8I 3WU4A 4DV1I 5IT9C 1Z0CA 1IBKI 1N36E 1FI4A 2VF3A 4DV4I 4DV5E 3LTOA 2AJ4A 3PYEA 4P7AA 1ZXMA 3Q1QA 4LF7E 5LMUE 1N32E 3JAMQ 1Z0GA 4JI1I 4JYAE 4LF9I 1ELOA 1MG7A 3K1JA 4DV1E 1PKPA 3HJCA 3QT7A 4PRVA 1N0UA 3LPSA 2HKJA 1NHJA 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BV3 A;  4DV0 I;  3ZKD A;  1PIE A;  4DV3 I;  5GME A;  1HR0 I;  3CWV A;  4LF5 I;  4JI7 E;  4P52 A;  3T1Y I;  2ZM6 E;  2F4V E;  1XMQ I;  3M6A A;  4DV6 E;  4DR7 I;  2HK3 A;  2HFS A;  5A2Q C;  2LJP A;  4DR2 I;  1Z0W A;  4JI8 I;  2DEJ A;  2VQF E;  3T1H I;  4B3M I;  1Z0E A;  4HY1 A;  4URL A;  4X66 E;  1KTV A;  4KQV A;  4NXM I;  2V34 A;  3B8H A;  3HUL A;  2R42 A;  2VQF I;  4YY3 E;  4DV7 I;  1IBM E;  1FNM A;  1XMO I;  2UUB E;  4X62 I;  3B82 A;  2X36 A;  3QT5 A;  1UEK A;  4X64 E;  1HNX E;  1K47 A;  3WU5 A;  3PYG A;  1EI1 A;  1MX0 A;  2A2C A;  1H7S A;  4GKK I;  4HXZ A;  1HNW I;  4K0K E;  1IBL E;  5A2Q Q;  2UU9 I;  4DR1 I;  4FWH A;  4B3T I;  1Z0B A;  4NXN I;  1ZXN A;  4DR3 E;  2BM1 A;  4JI8 E;  3J80 Q;  4DV0 E;  3PYD A;  4X64 I;  4USK A;  1S4E A;  1KVK A;  2VQE I;  2V8P A;  2CZ9 A;  3ZM7 A;  4JI5 I;  4R1F A;  4LF6 I;  5FLX Q;  2UUC I;  4Z7Y A;  1N33 I;  2VQE E;  4USM A;  4DPY A;  4X65 I;  1H74 A;  2EFG A;  4FWD A;  4OX9 I;  1FJG E;  1HNW E;  4DXL A;  3H4L A;  4JI3 E;  2Q2E B;  4UTG A;  3ZKB A;  3WU6 A;  2HKE A;  1HNZ E;  3J7A G;  2GS8 A;  2UXD I;  4YY3 I;  1Z5A A;  1N0V C;  4AQY E;  4WUD A;  1H73 A;  1H72 C;  1HNZ I;  4K0K I;  4DUZ I;  2UXB I;  4DR7 E;  4YHH I;  4LFB I;  4LFA I;  1FJG I;  1QZR A;  3ZZ0 A;  1FKA E;  2UU9 E;  4NXN E;  5LMN I;  1B62 A;  1N34 I;  4JI5 E;  4I3H A;  4PRX A;  4JI4 I;  4GKJ I;  2UXB E;  1H7U A;  4DUZ E;  1XNR I;  1Z59 A;  4DUY E;  4UT4 A;  1VIS A;  4FW9 A;  1N33 E;  1IBM I;  5IWA I;  4LF5 E;  4DR4 E;  1S16 A;  1Z5B A;  4DR3 I;  1XMQ E;  4WUC A;  1U2R A;  4LF8 E;  1J5E E;  4JI3 I;  1HNX I;  1RRE A;  1XNQ E;  2BM0 A;  5GMD A;  1FWL A;  4RPF A;  4B3R I;  3OTO E;  3WU3 A;  5IWA E;  1XMO E;  2UUB I;  1B63 A;  4DV6 I;  1J5E I;  3GON A;  4KHP I;  4DR2 E;  4B3T E;  4JV5 I;  5LMN E;  4DPT A;  2V2V A;  4XTJ A;  4JI6 E;  3T1H E;  4DPU A;  2ZBK B;  4LF7 I;  4JI2 I;  4KHP E;  3V2U C;  1KIJ A;  3V5R A;  4B3S I;  4DU7 A;  3B78 A;  5IT9 Q;  4JI0 E;  4LF4 E;  2HK2 A;  2X7I A;  1Z0T A;  1EA6 A;  2ZIT A;  4DV7 E;  3QT6 A;  4WUB A;  3T1Y E;  4FWG A;  4JI7 I;  4DPX A;  1NZ0 A;  3ZZU A;  4JI6 I;  2J7K A;  4DV2 I;  1XHK A;  4DV3 E;  3D4J A;  1ZM9 A;  2E5L I;  2E1R A;  2A2D A;  4LF6 E;  4LF8 I;  2R3V A;  4DR1 E;  4JI1 E;  4JYA I;  4B3R E;  4JI0 I;  1Z0V A;  1NHH A;  2HHH I;  4AQY I;  2HFU A;  2V2Z A;  4PU9 A;  3JAM C;  2UXC I;  3LNU A;  1NHI A;  4NXM E;  3QT8 A;  2OI2 A;  4MYT A;  3ZZT A;  4DPW A;  2NPF A;  4ED4 A;  3J81 Q;  1HR0 E;  1D6T A;  1Z5C A;  3J80 C;  5LL6 R;  4X62 E;  4M1K A;  1FWK A;  2XEX A;  2UUC E;  4YHH E;  4B3S E;  4DR4 I;  1N34 E;  1A6F A;  1OJ4 A;  4DV4 E;  4OX9 E;  1IBL I;  4HAC A;  4DUY I;  4DV2 E;  1PVG A;  1ZM2 A;  1RR9 A;  3K17 A;  2WW4 A;  5BR8 E;  4LF4 I;  1WUU A;  1ZM3 A;  4LFC I;  2E5L E;  4EMD A;  4DR5 E;  1I94 I;  4GKK E;  4ZVI A;  4DR6 E;  1BKN A;  4B3M E;  4LF9 E;  4HAC B;  4DR5 I;  1I94 E;  3OTO I;  2ZM6 I;  2F4V I;  4Z7C A;  2HHH E;  1IBK E;  4DR6 I;  4LFC E;  4MYU A;  3J81 C;  4JI2 E;  1MU5 A;  4LFB E;  3PYF A;  4X65 E;  4JG4 A;  2V2Q A;  2UUA I;  1KKH A;  1XNR E;  1N36 I;  1N32 I;  2UXC E;  3F0N A;  4X66 I;  5FLX C;  4JI4 E;  4GKJ E;  4DV5 I;  5L3J A;  4FN5 A;  1DAR A;  4HYM A;  2UUA E;  2UXD E;  3J7A M;  5LMU I;  1XNQ I;  2DEI A;  4DU8 A;  1ZM4 A;  4JV5 E;  4LFA E;  5BR8 I;  3WU4 A;  4DV1 I;  5IT9 C;  1Z0C A;  1IBK I;  1N36 E;  1FI4 A;  2VF3 A;  4DV4 I;  4DV5 E;  3LTO A;  2AJ4 A;  3PYE A;  4P7A A;  1ZXM A;  3Q1Q A;  4LF7 E;  5LMU E;  1N32 E;  3JAM Q;  1Z0G A;  4JI1 I;  4JYA E;  4LF9 I;  1ELO A;  1MG7 A;  3K1J A;  4DV1 E;  1PKP A;  3QT7 A;  4PRV A;  1N0U A;  3LPS A;  2HKJ A;  1NHJ A; 
#chains in the Genus database with same CATH topology
 1AB8 A;  1D3W A;  1LW2 A;  1WC5 A;  2Z57 B;  4PYA A;  4RNH A;  1TL7 B;  2XO7 A;  5IC6 B;  3BGR B;  4FNH A;  3HSG A;  2HS4 A;  1X4F A;  3FSX A;  1REV A;  5HAT A;  3SFU A;  4RUH A;  3QIP A;  4O0I A;  2GAG C;  2P9C A;  4NA3 A;  3VGT A;  1NDC A;  1LXJ A;  1VC0 A;  4C8Z A;  3CWV A;  4DV3 F;  3T1Y I;  2X3D A;  4P52 A;  1WOS A;  1R6Y A;  3DRR A;  2ACY A;  3RR7 A;  2ZM6 E;  4CCH A;  2MY8 A;  4JP8 A;  3M6A A;  5FWK A;  4DV6 E;  2DTJ A;  5E5N A;  3S7R A;  2HFS A;  3PX6 A;  4YHH F;  1Q8B A;  2IYG A;  2E29 A;  1I5O B;  2JFK A;  2MDA A;  2QTW A;  5G0R B;  3JSY A;  5AXK A;  4ANC A;  1N34 J;  5KFW A;  2PFF B;  4I64 A;  1Z0W A;  3IRX B;  1YRU A;  4FYW B;  3J80 U;  2DIT A;  4LF7 I;  2FZK B;  5F8N A;  3J7Y I;  3MM7 B;  5DQI A;  3R1H A;  4JI8 I;  4RW4 B;  2I5J A;  1RSC A;  1P6T A;  1W2I A;  2BEF A;  2DEJ A;  1F60 B;  2PT0 A;  3LP0 B;  4NOH A;  1X4G A;  4USW A;  8AT1 B;  2VQF E;  3Q2S C;  2Z2L A;  1B70 B;  3D6H B;  2MXY A;  1RZM A;  2ZH1 A;  3NZK A;  4IFD B;  4OO1 C;  5A2Q Y;  1WOR A;  2VC1 A;  4AQY F;  3CDE A;  4IG3 A;  4ICL A;  2IAJ B;  1NJY A;  4R25 A;  3T9Z A;  2MKY A;  1KTV A;  1LFW A;  3DDK A;  4B17 A;  3PRD A;  2VG5 A;  1ZPV A;  3IC1 A;  4B02 A;  2ZOM A;  2PNZ A;  2D3Z A;  3KK1 B;  4NZ6 A;  1WC4 A;  3DRR B;  1MRO A;  4CI0 B;  3AJ2 A;  2DGW A;  1M1G A;  2M8H A;  3VCD A;  2RRN A;  2YWE A;  3BKU A;  1J2V A;  2NZC A;  4YB5 A;  3Q8P B;  3KNG A;  1UJ6 A;  4YB7 A;  4NXM I;  2NPI A;  3HKZ D;  4JI6 J;  2BRK A;  3M8P A;  3MI7 X;  2D3O R;  2VBZ A;  2R42 A;  1E6Y A;  1S76 D;  4UST A;  2R2S A;  3UI3 A;  2MTL A;  3GPA A;  5F9L A;  3M32 B;  5LXR A;  4U6P A;  4NXN F;  4OYP A;  5F41 A;  3A8J A;  1QAI A;  1XEZ A;  4OZJ A;  3ZFV A;  2UUB E;  1OSD A;  4X62 I;  3B82 A;  2W9C A;  4PG6 A;  2BR2 B;  1R0B G;  3AAW B;  3PHE A;  5GAH U;  1VC5 A;  1FK9 B;  3M9M B;  2QL9 B;  1K47 A;  2GA7 A;  2L41 A;  3CJK A;  3RR8 A;  1XQI A;  3MEC A;  3C19 A;  3TAN A;  4NL5 A;  1TUW A;  4B3R F;  1SV5 A;  3IGV A;  3MM5 B;  3D1Q A;  4EU0 A;  1EI1 A;  2DNZ A;  3VAF A;  4M5D A;  3TZZ A;  4IZK B;  4YY3 J;  3MR7 A;  3SCK E;  3M85 D;  3UN2 A;  5L9N A;  1JLF A;  1YGY A;  3CD0 A;  4KGX B;  3R6L B;  1BQN A;  4KFB B;  2C39 A;  1HNW I;  1XWL A;  2UUW A;  4ZP9 A;  5LT5 A;  4NI2 A;  2DRB A;  2XGP A;  4V1A k;  2GJ2 A;  3WZ0 A;  4C48 A;  5CXT A;  1RQ0 A;  3C66 A;  2J8A A;  1MN7 A;  2BE7 D;  3MCS A;  4FZV A;  4DZ6 A;  3OHB A;  1TU0 B;  4K4W A;  4ZPD A;  2UUA J;  1R6V A;  2J7U A;  3S6E A;  5HP1 A;  1HNI A;  1YRT A;  1OYD A;  2EFN A;  3O8W A;  5FDL B;  4M94 A;  4LFC J;  4OHZ A;  1EKS A;  1KS2 A;  3EDR B;  1RWW B;  3U7J A;  4C0H A;  1TUV A;  1V5I B;  2R8K A;  1XN9 A;  2BM1 A;  4K5R A;  1KOO A;  2QMX A;  4LRA A;  2ASD A;  2Y8Y A;  2YKN A;  2NQP A;  3J80 Q;  3UD3 P;  5B0C A;  1OYE A;  1BD6 A;  2FPH X;  2MKH A;  2RE1 A;  2F8E X;  1S4E A;  2NXJ A;  3DRY A;  4USK A;  3CJ0 A;  3ZNU A;  3K5M A;  4NEZ A;  3MEG A;  1QSS A;  1T9T A;  3FMW A;  3RBE A;  2DCU B;  3GE9 A;  2UVW A;  1RHR B;  4C3L A;  2ZDP A;  4KHR A;  4WFZ A;  1SKS A;  4IFD F;  2UU9 J;  3RRH A;  2CZ9 A;  3ZM7 A;  3ILO A;  3C15 B;  2PMH A;  1ZET A;  5EKW A;  4LF6 I;  2KT2 A;  3RBD A;  2MKK A;  4ZVT B;  1F9H A;  2MGZ B;  2CQG A;  1WOO A;  4TQR A;  3GYG A;  2WVF A;  3AA8 A;  3MF5 A;  3NBP A;  4C4W A;  4DG1 A;  4F4W A;  2NN6 A;  1S1V A;  2YKM B;  1RAB B;  3IGN A;  2Z0G A;  2MLY A;  4USM A;  5BYQ A;  4NYZ A;  4DPY A;  5JEA A;  4X4N A;  5HJY A;  3H8Y A;  3RAM A;  4IOC Q;  4X65 I;  1LWE B;  1H74 A;  1Z4U A;  3BGR A;  5SUH A;  1UVK A;  3KXD A;  3MZI A;  5KFL A;  3A3P B;  1BXN A;  4GVB B;  2Y0S D;  1HNI B;  2YKO A;  5K8O A;  1U2F A;  2PO2 B;  3EPI A;  4RU2 A;  1UDN A;  5L9X A;  5HLF A;  4NLV A;  3C14 A;  3K89 A;  3DLH A;  3Q8Y A;  1EKR A;  1NZA A;  2IIH A;  3Q23 A;  1XMO F;  1CC7 A;  1QJH A;  2MZR A;  3D7S B;  4NLG A;  3P49 B;  2RHQ B;  1FX2 A;  2HKE A;  5D77 A;  2GS8 A;  1S48 A;  2VPW B;  1RT7 A;  3DMJ A;  1FXR A;  3NGR A;  2PGC A;  2LVW A;  4EK2 A;  5KOW A;  4L3K A;  5HQL A;  4I2Q A;  1Z5A A;  4IZJ D;  3H1C A;  3J7Z T;  3MMC B;  4DV5 J;  2UP1 A;  3MM7 A;  1SL1 A;  4AQY E;  4X4R A;  2HLU A;  2CPY A;  1ZS6 A;  3OSP A;  2L3M A;  4H4M B;  3MD3 A;  4IRK A;  4DFJ A;  3CCQ S;  1VQM S;  4V19 J;  2C37 A;  3DRP A;  3IR6 B;  1RHU B;  1YK9 A;  4WJB A;  1L3T A;  4N41 A;  3HI9 A;  2BA0 G;  1KFS A;  2GO3 A;  1VR6 A;  1S4F A;  3M2V B;  4OL8 A;  1Q78 A;  2V2K A;  2W4D A;  4YHH I;  1RWV B;  4O4R A;  2DB1 A;  5HK4 A;  2LCW A;  1RT5 B;  4LFA I;  2Z2Y B;  2JDJ A;  2LP4 A;  2AJF E;  4IS9 A;  3EM1 A;  3KLE B;  4X64 J;  1DQ9 A;  4Q2M A;  1XIQ A;  3IBC B;  2DBB A;  1D9F A;  4FYD A;  3BS9 A;  2RU9 A;  4ZPA A;  2JEB A;  4JI8 F;  4F8R A;  1LOU A;  4O3Q A;  2BYC A;  2CNL B;  5AJ3 J;  2KM8 C;  3G82 A;  2ZUA A;  3GZ7 A;  1TVR B;  2D9O A;  3MPU B;  2UUB F;  3L7O A;  1U1R A;  4YUD A;  3UO0 A;  2LQ8 A;  5LMN I;  1PAE X;  4QIW D;  1SVD A;  4NCG B;  3EMT A;  1GTH A;  5F9N A;  4ED7 A;  1HWK A;  2H1Y A;  1RA6 A;  3DLL Q;  2Y8W A;  3M8Y A;  4JI4 I;  1RHM B;  2B5J A;  2DH7 A;  3NOC A;  2E5L F;  3H7H B;  1T7P A;  2LEC A;  4DUZ E;  4DR5 F;  2HVI A;  2Y1R I;  3HZG A;  1UJ5 A;  4HDG A;  5KFY A;  5DZ7 A;  4UT4 A;  1YIJ S;  1BY9 A;  3I0R A;  3AHP A;  2VL1 A;  4O4G B;  5MLC V;  3HHK A;  1Y0H A;  4ALZ A;  3H59 A;  1QAY A;  4KPY A;  3L7U A;  1Z5B A;  4DR3 I;  3MEE B;  4EBC A;  2ERR A;  3KRN A;  3MM5 A;  2AYE A;  5C42 B;  1JLG B;  4ED8 A;  3EVO A;  1B0P A;  1PG5 B;  3AD9 C;  3ISN C;  4JI3 I;  1HNX I;  2G13 A;  5HMZ A;  2XY6 A;  1RRE A;  1B0T A;  1UAW A;  2BM0 A;  1U0S A;  3LQV A;  4RLE A;  5GMD A;  3WX8 A;  3KJN B;  1RBA A;  2W1B A;  5KT5 A;  2ZM6 J;  1H0H B;  1LV5 A;  4V19 X;  5IWA E;  4B3R I;  1B63 A;  4DMZ A;  2FGC A;  4BLG A;  2C28 A;  3W63 A;  1FA0 A;  2Q79 A;  4B9T A;  1TL3 A;  3KLI B;  2YQ1 A;  3ZTQ A;  4DR6 I;  3TRG A;  4O3P A;  3W62 A;  4OZN A;  2GO9 A;  3EGV A;  3FQK A;  3QGH A;  4MDT A;  5EN1 A;  1S6P A;  1URR A;  4P71 A;  4KE5 A;  3BH6 B;  4Q45 A;  1QE1 A;  3KK1 A;  1BHN A;  3OR2 A;  2F65 A;  3FSI A;  4DPT A;  2N3L A;  1RP5 A;  4ZIV A;  1YH8 A;  4USU A;  4K4Z A;  2EG1 A;  4I6Y A;  3JQM A;  4J7C A;  4U96 A;  3ELH A;  2R9L A;  2SXL A;  4IO1 A;  1M5S A;  1UKU A;  3VAL A;  5IOL A;  3TUP A;  2R7U A;  1RT4 B;  2HSE B;  5CYQ A;  2OIH A;  4N3O A;  1U8W A;  4M63 A;  5ETL A;  5JXS A;  3V2U C;  3R7N B;  5H9E J;  4B3S I;  4XPE A;  3ONQ A;  2AYG A;  5I42 A;  1KHV A;  4P6Q A;  2C42 A;  3SSS A;  3KLH A;  4CO0 A;  3HT3 A;  5L8R C;  2HNY A;  2ZNZ A;  3QWP A;  2QA4 G;  4ECX A;  3BSC A;  5DNX A;  1TKX A;  3HT0 A;  1QSL A;  2RIJ A;  2CQ2 A;  4WXO A;  3Q8R B;  4C7Q A;  2XLK A;  3CMA S;  3BO3 A;  3V4I A;  4DR4 E;  3DOK A;  2HQF A;  2ZIT A;  1X4C A;  1QD1 A;  2OPS A;  3MHY A;  4YDX A;  1D1U A;  4LF8 J;  2KTQ A;  2KFY A;  1HBU A;  2J0Q D;  1LW0 A;  1JB0 C;  3Q8Q B;  3QMQ A;  4ATN A;  5E41 A;  1WJ9 A;  2MY7 A;  2RDD A;  1FRJ A;  2ZE2 A;  4DL0 C;  1U6Z A;  2H5E A;  2YNF A;  3TAM A;  2H5I B;  2OLW A;  2Q3P A;  2ADC A;  4WFY A;  1RU1 A;  3IA0 A;  4KFB A;  4X2B A;  2B9Y A;  5J1N A;  5IV4 A;  1BLU A;  1LWX A;  4LRE A;  2IC3 B;  4WIQ A;  1BWV A;  2Z2M A;  4DUY F;  3IAM 9;  3OJS A;  1TFW A;  3HKM A;  4CH7 A;  1T9Y A;  1B0V A;  2YNI B;  4Q43 A;  1Y4S A;  3KUE A;  1PJ7 A;  4UZC A;  4LF6 E;  3NS7 B;  2LQ9 A;  3AOD A;  3MMC A;  2J0W A;  4RUB A;  2HG4 A;  2MQM A;  1XNQ F;  5DGA A;  4NLW A;  1PIL A;  3KTQ A;  4JYA F;  2NUU G;  3RU0 A;  2R3V A;  1KQS R;  4G1P A;  1Y00 A;  1CQN A;  1C4A A;  1LWF B;  3LOU A;  4ZJO A;  3VF0 B;  5B0B A;  1IR0 A;  1MWQ A;  2OEM A;  4OYX A;  4DDF A;  4Q8F A;  3MAA B;  4ZPT R;  2B7C B;  2QA1 A;  2XSF A;  3OUY A;  2KT3 A;  4X4O A;  1U8S A;  2DR6 A;  2Q43 A;  1FTC A;  1RAG B;  4A8Q A;  3A3O B;  1NK9 A;  1C0T A;  2PEH A;  2PDA A;  1HQU A;  1WAC A;  4DI6 A;  4EZ9 A;  3M6X A;  4TYA A;  3NNC A;  5JEA C;  1CJV B;  2GO4 A;  1FJ7 A;  3JAM C;  1RT2 A;  3OL6 A;  5T7L A;  4ZN3 A;  4JI5 F;  3GCM A;  4Z2X A;  1NLK L;  1VDH A;  2YWW A;  3W9I A;  1NHI A;  2M88 A;  2JLG A;  3FGV A;  4TU8 A;  4L76 A;  2R8J A;  4OX7 A;  2AIR B;  2UXD J;  3MOJ B;  3PO4 A;  4USI A;  5F8L A;  4MYT A;  2IRY A;  2IAJ A;  3Q83 A;  1DTQ B;  5KFI A;  4GKJ J;  3PJW A;  5KT4 A;  4FYX B;  5AJ3 F;  3FRY A;  3UD5 A;  3J81 Q;  2BRL A;  5IM0 A;  3VTI A;  3TO8 A;  3LAL A;  1CJT A;  2G2Y A;  2PO1 A;  1D6T A;  2APO A;  5E3R A;  3D0I E;  2IM3 A;  5ITH A;  1NH8 A;  4DX5 A;  3U1K A;  2FC9 A;  4FXV A;  3EIC A;  3MAH A;  3HSJ A;  4N76 A;  4QR0 A;  2WNR A;  1H2V Z;  1HHS A;  3B54 A;  4DV6 F;  1M5H A;  1O5J A;  3BPD A;  1J5E F;  3GSI A;  1UVM A;  3D66 A;  2YKA A;  1LWC A;  2DHH A;  3OTB A;  4GO5 X;  2C38 B;  2J5A A;  4JOU A;  2CPJ A;  4X84 A;  3FSY A;  2BDP A;  1CS4 B;  5D78 A;  4OV6 A;  3DOM A;  2FVQ A;  1FD2 A;  2QFI A;  1YBU A;  3A12 A;  4FPR A;  4JV0 A;  2X1B A;  3D3C J;  1KLM A;  4P72 A;  1X9S A;  2UXD F;  1IQT A;  3PW2 A;  1RT3 A;  1N34 E;  5KFS A;  4LSN A;  2KG1 A;  3M9N B;  1N54 B;  3V81 A;  5T7L B;  1IBL I;  3ENW A;  2DGS A;  5KFA A;  4ID5 B;  1PVG A;  3GJT B;  2CQ4 A;  1IKV B;  2A0F B;  2X51 A;  2YTC A;  3B6B A;  1YJW S;  4OKG A;  2GQ0 A;  3I87 A;  3K17 A;  3MR2 A;  1FDD A;  4ZVR B;  1SV5 B;  2YPZ A;  4ZOS A;  5BR8 E;  5HRO B;  2OFG X;  1TV6 B;  2BE2 A;  5K14 B;  3ZZZ A;  4I56 A;  3WC2 A;  2B9X A;  1JMT A;  5C24 B;  4Y00 A;  3E8O A;  4ES3 A;  4U7U K;  4OI6 A;  3KHH A;  4NWB A;  1R8B A;  2WSF C;  2CPX A;  2X1G A;  3KG4 A;  2VUG A;  3MTJ A;  2E1P A;  2W7O A;  4BA1 A;  1S49 A;  4DJB A;  3HHL B;  3UR3 C;  1I94 I;  3OFG A;  3K57 A;  2OMO A;  4DFK A;  3WIV A;  1F2H A;  4OYO A;  2QJ3 A;  3ENA A;  4LRD A;  4NPO A;  4CLK A;  3GU0 A;  5HP1 B;  2RRA A;  1HMV A;  2BZ2 A;  4HLB A;  4B3S J;  1TL1 B;  4H54 A;  2EKN A;  3TUJ C;  2C2R A;  3SDE A;  3TYT A;  2HBY B;  5FDL A;  2ZJP Q;  4LF5 F;  3J7A N;  1R6M A;  3TWZ A;  3DLG B;  4J9V A;  2UZA A;  4LF2 A;  4OJ1 A;  4ZVO B;  3UW1 A;  2GO8 A;  1NHK L;  2J6S A;  5D3G A;  4B3M E;  5LXY A;  1TKX B;  3W66 A;  5B09 A;  1I94 E;  2XM3 A;  1HW9 A;  1MMD A;  1C1B B;  2KXF A;  1ACM B;  1N32 J;  3MEG B;  2ZM6 I;  4IH7 A;  5JEA F;  4H4O A;  1FDB A;  3NS