3PYEA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
301
structure length
301
Chain Sequence
b'MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 86
structure length 301
sequence length 301
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyeA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyeA01
1N36I 4DV4I 4DPTA 3PYFA 1Z0WA 1FJGE 4JI1I 2VQEI 3ZKBA 4DPXA 1IBME 4DUZE 5BR8I 1H7SA 3J81C 1HNZI 4B3ME 2HHHE 2NPFA 1KTVA 4DR4I 3ZZTA 4PRXA 1MX0A 4LF8I 1Z5CA 3QT8A 1KIJA 4DU8A 4DR1E 1FWKA 3T1HE 4FN5A 4DV5E 4HACB 4LF6I 4JI4E 4DU7A 4AQYI 2GS8A 4JI7I 4UT4A 1N34I 2VF3A 5LMNI 1NHJA 1B63A 3D4JA 1Z0VA 2ZM6E 1RREA 4HY1A 2OI2A 3OTOI 1EI1A 1J5EI 4JI3E 1NZ0A 4UTGA 4B3RE 1N33I 4KHPI 3ZM7A 4JI0I 3GONA 4DUYE 4Z7CA 1FJGI 1ZM4A 5IWAE 1IBMI 4DR3E 1PVGA 5A2QQ 4DUZI 1IBKI 2HHHI 3PYEA 4FWHA 4URLA 1N36E 2HFUA 4JI1E 2VQEE 2BV3A 1VISA 4DR1I 1A6FA 1N32I 2R3VA 4DV5I 3WU6A 4JI4I 4P7AA 4WUBA 3WU3A 5FLXC 1HR0I 1Z5AA 1MU5A 2ZM6I 2V8PA 4AQYE 4JI3I 4JI7E 1Z0EA 1N34E 4DR7I 4DV6E 3LPSA 5LMNE 2LJPA 4DV3E 4JI5I 4B3RI 2UUAE 2UUBI 2HFSA 2DEJA 3WU5A 4ZVIA 1J5EE 3J81Q 2DEIA 4DPUA 3B82A 1HNWE 4DV1I 5IWAI 4X65I 1RR9A 2XEXA 2V2ZA 4LF9E 4JI8I 1H7UA 4YHHI 3JAMQ 4RPFA 1NHHA 1IBKE 1XNRI 2X7IA 2UUCI 3LTOA 5IT9C 4LF4I 1N32E 2V34A 4DV2I 1ZXMA 3ZKDA 1ZM3A 1HR0E 4DR6E 4DV6I 4DV3I 4JI6I 2UUAI 4PRVA 2E5LI 1N0UA 2A2CA 4NXMI 1HNWI 1S16A 4DR7E 2Q2EB 4JI5E 4WUDA 4DXLA 2UUBE 4GKJI 4B3SI 4I3HA 4DR5E 2V2VA 3T1YI 4LF9I 5GMDA 1D6TA 1NHIA 4HYMA 2A2DA 2AJ4A 4DV1E 3V5RA 4X66I 1PKPA 4LFBI 4X65E 4JV5E 2HKJA 2UXCE 4JI8E 4YHHE 3J7AM 4USKA 4ED4A 1B62A 3CWVA 4USMA 1XNRE 2R42A 1HNXE 4LFCE 2UUCE 4R1FA 5GMEA 2VQFE 1XMOI 1H73A 1I94I 4DR6I 1Z0BA 4LF4E 2UXBE 5L3JA 1IBLI 4LF7I 4X62I 4DR2I 1ZM9A 4DV2E 4JI2E 3J80Q 3F0NA 3B8HA 3B78A 2F4VE 3LNUA 4EMDA 4JI6E 2UXDI 2E5LE 1H72C 4DR5I 4MYTA 1DARA 4NXME 4JYAI 2E1RA 1XNQE 3WU4A 1XMQI 1FKAE 3QT5A 4HACA 1Z0TA 4DPYA 4JV5I 4B3SE 4GKJE 4K0KI 3T1YE 2UXCI 2UU9I 4X66E 1FWLA 3K17A 4LFBE 3Q1QA 1K47A 1HNXI 4LFCI 2EFGA 2X36A 1PIEA 2VQFI 1FI4A 2HK2A 4X64E 1ZM2A 2UXBI 4NXNE 3PYGA 3QT6A 4YY3E 4JI2I 4DV7I 1XMOE 1I94E 2HK3A 2F4VI 4KQVA 2BM1A 1IBLE 4LF7E 4X62E 2BM0A 1ELOA 4DR2E 2ZITA 3JAMC 4OX9E 1XNQI 4FWGA 2J7KA 2UXDE 1UEKA 4PU9A 3H4LA 4DV0E 2WW4A 1Z0CA 4JYAE 4FWDA 1XMQE 4MYUA 1FNMA 5FLXQ 4LFAE 4LF5I 5LMUE 4K0KE 3ZZ0A 3V2UC 2V2QA 4P52A 1EA6A 4B3TE 2UU9E 3HULA 1KKHA 4X64I 4NXNI 3M6AA 4FW9A 1XHKA 4YY3I 1U2RA 4DPWA 4GKKE 4B3MI 1Z5BA 1N0VC 3ZZUA 2ZBKB 4JG4A 4DV4E 4Z7YA 2HKEA 3QT7A 5BR8E 3T1HI 4DV7E 1MG7A 1HNZE 1KVKA 1H74A 4OX9I 4DR4E 5A2QC 4LF8E 1WUUA 4DV0I 4XTJA 1Z0GA 4LF6E 1Z59A 3PYDA 1ZXNA 5IT9Q 4LFAI 5LMUI 3J7AG 4WUCA 3K1JA 5LL6R 1QZRA 4B3TI 3OTOE 4HXZA 2CZ9A 1BKNA 4DUYI 4LF5E 1S4EA 1N33E 4KHPE 4DR3I 4JI0E 1OJ4A 4GKKI 4M1KA 3J80C
chains in the Genus database with same CATH superfamily
1X9MA 3BGOP 1QDUB 5D4NA 4C8OA 4M94A 1TELA 4ES3A 3HHEA 2HHHE 1MX0A 1NU4A 3QT8A 1HQUB 1FWKA 2BJ9A 1H2UX 3IXQA 2HBRB 4KFBB 2CPXA 2GA7A 3T1HJ 1KR4A 4U3BA 3OTDA 1Y5YA 4Y65A 3I31A 4EK2A 4C11B 1N88A 3P8BB 4KH0B 1NXIA 2HQDA 3D4JA 2AYBA 2MEWA 1B0TA 2OI2A 1OWXA 4OHXA 1XR6A 1Y4SA 1IKXA 4DZ6A 1DLOB 1RHMB 4QR1A 3GONA 4AE5A 1UVIA 5E3RA 1YJUA 2IA0A 1S6UA 2BKPA 4KIAA 5KFFA 2ABYA 5HO4A 3IWXA 4ECRA 1IM6A 3MHYA 1SUQB 1FA0A 3NGTA 5HBMB 3OL8A 4ZJOA 2QL7B 4HVZA 5A8RB 3EPIA 2K2PA 2CJYB 5ETPA 2QL5B 1JLEB 2MLZA 2LQ9A 2CPHA 5KFXA 2D9OA 2PSZA 5HROA 5C25B 3SV3A 2UUCF 4JI7E 5CCLA 1PSDA 1N34E 4AUKA 3GJTB 2HFSA 2VG7A 3LGNA 5J2NB 2HAIA 1IQTA 3BDEA 4C8ZA 1LW0A 1CC7A 4DV3F 2E9TA 2XEXA 1L3TA 4LOMA 4YHHI 1XIQA 3L4BC 1PG5B 4WTYA 4DL2A 2CQ4A 4YOEA 3D1HA 2MQLA 3H59A 4X66F 4A8XA 3QJLA 5D8HB 2ZJQQ 2AZ1A 4AL7A 1XR7A 3NL0A 3C6TA 4QWEA 2RQKA 3P3CA 2ZH3A 3FFIA 2I0XA 3WBZA 2Q3PA 3OJUA 2DVIA 3EZ5A 4B9SA 2HSEB 4OKGA 4IZJA 4FNIA 2ZWOA 5ELWA 1BQNB 4DL5A 1X4CA 1FDDA 2M0GB 3I87A 3RBEA 4DL0C 4ECVA 1E6YB 2Y8WA 4FZVA 1URRA 4WFNQ 4YHHJ 3P5BP 4F8RA 1RWPB 3DLLQ 1CG2A 5DJBA 2VFTA 1SQEA 2JVRA 1CSJA 1GTEA 1TP7A 3HT0A 4CP5A 3DMJB 4A48A 2M5YA 4NBQA 1KP6A 4M8LA 2C3YA 1YSJA 3CCUS 2XMWA 4NLUA 4AFFA 1IWGA 4DMZA 5DQHA 3CDIA 4O3OA 3M30B 2YWEA 2C2KB 2E9RX 4ILMA 1NUEA 3Q8QB 3PS2A 2HVHA 5K36E 3M6WA 5IQ6A 2CPZA 3C15A 4ZVGA 3DLGA 2EPIA 3R2CJ 1RKIA 1RBAA 4EUVA 3MOZA 3UD4P 1W2BR 3ZC4A 1OQ3A 1FWLA 2DRBA 2EC2A 3K5PA 4ZVHA 5L1JA 1WC4A 1Y5LB 2R8JA 2KXFA 1FI4A 3EUNA 3DFEA 3NAHA 4X64E 1M5KC 3TNVA 4LFBF 5J2PB 4YB5A 4N56A 4YY3E 4AIDA 1XMOE 2GAHC 1GMWA 5KFTA 3CCMS 2ZEJA 3BGFA 2FLLA 2FC9A 1U7LA 1TL3A 1UEKA 1QE1A 1Z1ZA 1FTCA 2FJBB 5LSLA 1RGVA 2AEJA 4HHHA 3BO4A 4BC7A 1V3ZA 4JYAE 4CQ1A 5EUHA 3MOJB 1E6VB 4ID5B 4MH8A 1WC5A 3ZZ0A 1OMSA 1TTHB 3W63A 1RWNB 1F9HA 3MEDA 3I0SA 4TXSA 2XWXA 4LFAF 4GKKE 3MUVP 3K89A 4FKXA 4A47A 1Q16B 2F9DA 2CPFA 3D6TB 4ZLPA 4Z37A 4K4ZA 2ALZA 1VRUB 4MQYA 2MZQA 4NA1A 4LF8E 1FKOA 1QVFR 5ETNA 1LQ9A 1IR2A 5BR8F 1UFLA 3TOQA 3IRXA 2GVZA 1BQXA 5JJBA 3J7A1 2DRDA 1TV6A 4KPCA 1EX8A 5E0OA 2D41A 2IRXA 3QATA 1BKNA 2BR2A 2WSEC 4Q0BB 1YHQS 3CCQS 4FS1A 2CPYA 2PDAA 3O6QA 5DRQA 3NMRA 4C8LA 4DUZE 4CLSA 4NRTA 1Y0HA 2AF6A 1V5IB 1NKBA 1FVQA 2LXIA 2VASA 3J80Y 3CCES 1B64A 2XCAA 1VQ8S 1WD6A 4ZPTR 5KG6A 2B4OA 3TVZA 2I8EA 2DNHA 2HHHF 2BA1D 1NRKA 4OO1A 2GS8A 1N5VA 2N7CA 1KBRA 4DL3A 2MZTA 1HBUA 1JLQB 3SV4A 2DNPA 4NZ6A 2HPUA 4OHWA 2JC1A 4BS2A 1SIZA 4IFDA 2ZVSA 3R1HA 4WIIA 1NJWA 4MKBA 3OSPA 3ZNJ1 5EKWA 2RNEA 4WTOB 2I5JA 1S6PB 2MJUA 1IWAA 4Y0FA 1N5SA 3ISZA 4MU1A 4JI1E 2HRYA 4Q8EA 3NWGA 4RW9A 4RNMA 4QCLA 2NUHA 1TL5A 4LCHA 5FLXC 1TKTB 2KM8B 2G1HA 4R5PB 2CXEA 4IQXA 1TUGB 2G0JA 5EX3A 3EICA 4B9TA 2OPQA 2GC8A 4DV3J 3H2LA 3VAKA 3WU5A 3H2UB 4G3IA 1UFKA 4LSZB 2XO7A 2JT2A 3B82A 2V8VA 4JI7F 4OZ3A 2L08A 1N34F 2ZC3A 3V4IA 2C2DA 3CCRS 2DO4A 2BUNA 3M9MB 3ILLA 3PRBA 2AE8A 4B08A 3EGWB 5KAKA 2D1CA 2WSCC 4TU9A 3T1YF 4P74A 5L38A 1IBCB 2KFYA 2BQ3A 4K4UA 4K7QA 4MFBB 3CMAS 1P27B 2KU7A 4LRFA 1N32E 5DO2A 1OS5A 1UP1A 3OTCA 4QOTA 2E1PA 1TKXB 4ZVSB 4DN0A 4ZOSA 3JTPA 4RW4A 1M1HA 4WU3A 2XY7A 4PRVA 2B8QA 2RJZA 2A2CA 2FDNA 4KE5A 4KHRA 3RBZA 3LP2B 4KB7A 4FP9A 4WYLA 2BE7D 1UFWA 5GAEU 2GAGC 5A0YA 4X62F 2XZDB 4OZJA 3OSNA 4ZP9A 1NHIA 3MR3A 1VJWA 4LFBI 5IXUA 2BX6A 1AUSL 2MZRA 2JVOA 1HMVB 2GGPB 4ZLJA 4IUFA 4QIEA 2GQ2A 2CPDA 3MPUB 2OMLA 5MAOA 4AIMA 3EDQB 5D0EA 3J80Q 1RP5A 3F0NA 1Q5YA 3H7HB 2IRUA 3AB2B 5AXKA 1Y9OA 2E7XA 4FF4A 2NXEA 2UV8G 2RD5C 5K20B 2EKNA 3CJRA 3PNIA 2WK4A 4RUAA 2DGXA 2EW9A 2OKQA 3MGJA 3W7BA 3F73A 2GCFA 4ED0A 4PG4A 4EFAC 3DYAA 3MTKA 4LFBJ 1H3DA 1NCLA 2JNJA 3O3LA 1L3UA 2H65B 4MTPA 1G6BA 3CC7S 1J5OB 2XMKA 2M8HA 3HSZA 4OQJA 3PHTA 4G1QA 4X64F 4LF7E 1QSLA 4YY3F 2VD3A 4F26A 2DGQA 3NNAA 1XMOF 2B4VA 1AYEA 1WKKA 1RKJA 1JJ4A 2DHAA 1J27A 2JRSA 2V94A 1UWBB 2YXLA 3OFEA 1G1XA 1RTHA 3V2UC 4DFKA 3OR2A 2MKHA 4IDKA 2WP8B 3ZTOA 1VQSA 3HHLB 4IFYB 2PO1A 4DFJA 2CYYA 2QN6B 1U2RA 5K8OA 1VQ6S 3AQOA 2QMUB 4OX6A 2CADA 2RUSA 1TKDA 2EWHA 1GK8A 4ZCKA 2Z0GA 2LECA 1MG7A 3RG6A 4NCGB 1H74A 4GKKF 4TY8A 3BPSP 1HWIA 2Y0SD 1T02A 2WHOA 2DNLA 2CPIA 4C97A 5E3PA 1LWFB 4LF8F 3V81B 2W8KA 3ULHA 4WCEQ 5KOXA 4PZVA 4NYZA 4KHPE 3HD2A 1WACA 2C2RA 4CI0B 2D3OR 3RR7A 4DPTA 3PS1A 2JOQA 4B3ME 2NPFA 1KTVA 1HWKA 4DR4I 4NA2A 3VGTA 1SL1A 3R5AA 1IR1A 3US5A 4TQSA 1YDLA 4DUZF 3M85G 4LF6I 4OV6A 3J81Y 2C3MA 2AZ3A 2VG6A 3V6KA 3DLEA 4JI7I 4LUBA 1MWQA 1N34I 1HNVB 1Y6ZA 3LPEA 4KGVB 5K14B 2ZH8A 2NPIA 2ZH7A 4HDHA 5FD1A 4O4GB 4OHVA 2PD1A 5K8PA 4QR0A 1S4FA 4K4XA 2HRUA 5IWAE 1IBMI 2YKMA 1CC8A 1S49A 3P3DA 4U7CA 1SL2A 3I96A 2ATLA 2VQEE 4DF4A 2FZKB 3G8TA 2W9CA 4DR4J 5DM6Q 4EO6A 3MR6A 3ETMA 5KT6A 3H1CA 4JI1F 1IR0A 4RW7A 4LF6J 2XI3A 4ED2A 1D9AA 4JI7J 1N34J 3P06A 4UUWA 3RB0A 3VQTA 3U7JA 1HNWE 3QLHA 2JDJA 2F63A 5CQGA 3D7SB 1H7UA 5G0RB 4F02A 1UDQA 2OHDA 1IBMJ 3CCJS 3L7ZB 4P7VA 3SDEA 3GIIA 3DGPB 4F4WA 4CO5A 2VB6A 2JJ4D 1VQLS 5CHCB 5J1EB 2YNIA 1VQ5S 4HT7A 2XMMA 1H2VZ 2YKNB 4CLPA 2UUAI 3PO4A 5K36A 1N32F 3GIKA 3MEGB 4MMOA 2B6AA 2C39B 1RYRA 2J6UA 1MMDA 2OPRB 2HBQB 2MXYA 4PCQA 5GADI 2VG5A 5CYMB 2DD8S 1WI6A 4IFVB 3MWBA 4DHVA 1RWXB 5GMDA 5FDLA 2VODA 4ED1A 2PEHA 1WWHA 2V68A 4CLLA 3GYXB 5AE2A 4F4XA 2QSFA 2ACYA 3IR7B 5HMXA 4JI8E 3I82A 4ZVUB 2ZOFA 3ZZZA 1JXLA 3PW7A 5BXIA 4F3QA 2B43A 2DR8A 4R1FA 5B0AA 4DS4A 5KG7A 3VZHA 1XMOI 1TL7B 1I6JA 1JLCB 2DCUB 2DR9A 1QAYA 5E3CA 2HZVA 1RTZA 4TYBA 4QIWD 1RAIB 7AT1B 4JI6E 1VHFA 2WVCA 2UUAJ 4A8FA 4LQ9A 4C48A 1DARA 2JFKA 3MFHA 4JYAI 3TP2A 3NCPA 3MCMA 1FO1A 2BYCA 4MIBA 1VQ9S 4HACA 4FPIA 4ED5A 2LKZA 2UUTA 3GFHA 3DCAA 3O5TB 2HVDA 2IMOA 1RT5B 1RT2A 2YTCA 1Q81T 3E3XA 3Q1QA 1WC3A 4V1Ak 4ETXA 1X5TA 1IKYA 3CCLS 1PIEA 3KOAA 1E3HA 2OH2A 3JS9A 3N6LA 2UUWA 1FFGB 3RZAA 2DBBA 1CS4B 3GCMA 1P8GA 2ZZNA 1S9EA 1XMOJ 2XMUA 2RDIA 4DR2E 5CD4A 1VIOA 3H5UA 4NMLA 2PO4A 1X8DA 1HBMB 3LQVA 4PAAA 4LCGA 2ZHAA 2LQ5A 3W5YA 1R0AB 1RAHB 1YRXA 3VGUA 3W2WB 2CQ0A 2HGLA 3PW5A 5DM7Q 4JYAJ 2MQOA 2B4PA 3ZTQA 2BR0A 2R7QA 4B3TE 2IBOA 5D0RA 2OPSB 1WNEA 4IRCA 2XS7A 4WIQA 2VH7A 3HDSA 4YMEA 3TO8A 2AQ4A 1Z5BA 4P7TA 4OHZA 4UQTA 2ZOMA 2HNDB 3FJ2A 3FSXA 1FEHA 5D78A 4B9VA 4RUCA 1S9GA 4WE1B 3CEDA 1S0VA 3Q2SC 3CDUA 4NLWA 1C0UB 2A6OA 4EO8A 1KSPA 4U7UK 2CQPA 2MHNA 4LSLB 2XLKA 3NNHA 4WUCA 1I51B 2HS3A 3A8KA 3T9NA 2IBKA 3FQLA 4KRWA 1VBKA 3BGUA 1PYTA 1SKWA 2MY7A 4JI0E 3NS5A 5D77A 3BPDA 9ATCB 4DL4A 1IVZA 4DV4I 5I42A 4JI1I 2RKIB 1FX2A 4KHPF 4NX9A 4QWBA 4IH5A 3R27A 3GR0A 4LCFA 3KLFA 3VVTA 4M63A 3NG8A 3TEHB 5KFYA 1YRTA 4WU2A 4G65A 3M9NB 3TX0A 1HL6A 8ATCB 2UVVA 3HM9A 3GYNA 2V67A 4RR5A 2DITA 4OO1C 4H4OB 3PJ9A 4ZHRB 3OR1B 3OTOI 4W4MA 1SQFA 4B3RE 1P42A 2CRLA 3ILOA 3P96A 4ZK7M 3TW0A 3M6UA 3E01A 2XYGB 2XTJP 1S1WA 1CULB 4DR3E 2DNZA 4IFDC 1FDNA 1F5AA 5LSOA 1MMNA 1HNIB 3QGIA 1HW9A 2VUGA 3M7VA 4DV4J 4DV1F 2DISA 4JI1J 1N32I 5IWAF 2FJXA 1EB0A 3G9CA 3KK1A 3TAMB 3BO3A 3GIRA 4ECWA 2KFZA 5AJ3F 2XNRA 2IC3A 1X4HA 3MFIA 1MNEA 4NZ0A 2QZ8A 5EHHA 2DR5A 3WIUA 1UPPA 1RT4B 4TNOA 1WTFA 3HVRA 1AT1B 3MMAA 3M8RA 5D0HA 2QSWA 3W64A 3PACA 2Y1LB 2AJ2A 4EYHB 1NK0A 1LFWA 3PZPA 3OTOJ 5IC6B 3W8PA 2G2ZA 1KOHA 2Z2ZA 3J7Z5 4E8UA 2KT2A 3DRRB 4LF9E 3DDIA 3J80U 4RPFA 1HNWF 3LANA 4YR2A 4HTIA 2XY5A 4KSEB 4LQ3A 1XMBA 1TK5A 5CCMA 1EQ0A 3DLBA 2B9XA 2AKWB 2VC0A 1N32J 4OZEA 3E51A 1SPBP 1QY7A 2CQ2A 2BXJA 3WC0A 1RHYA 2JEAA 4QW8A 4LJMA 4ES2A 2K7KA 4GVBA 1UZDA 2RS2A 2IM3A 3DI6A 4QWAA 5DLFA 3NOGA 2ZKUA 1T3NA 2H5IB 1IBLF 2MY8A 4DR5E 1WDDA 5F8IA 4F3OA 2YY3A 1FRKA 5B0CA 5DG8A 3J7AM 4OYXA 3D3BJ 3FZBA 4OI4A 1RT7A 1RZMA 4TKTA 2IIHA 4JI8F 4IQMA 3G6YA 4LBHA 4PUOA 4J9UE 1FFWB 3GLJA 4XDCA 3G6VA 3T41A 4LF7I 4L3NA 4JI2E 1IKXB 1GNKA 2FHJD 3JQJA 3SEOA 2Z5CA 4NLXA 3BS9A 2KRBA 1FXRA 5AXLA 2QRRA 3BH6B 1EQMA 2HVZA 3TR5A 3TWZA 5F0UA 4NXME 4USUA 4DV7F 1LW2A 3IRWP 3IAS9 4KC5A 3CMQA 4LSNA 1XWLA 4OZLA 1J2VA 4O4RA 5J2MA 2E7VA 1YJ7A 4FW5A 1UEUA 1RTIA 3KUHA 1VYAA 1YZ7A 2KHCA 5E41A 4D3GA 3H42A 2PEBA 1LWCA 5HROB 4LRAA 1H38A 4M5LA 3R97A 2PN6A 1R8BA 3K5NA 2EFOA 1T9XA 2VG7B 2BM0A 4LF7J 4PWDA 1LW0B 4QBUA 2PO2A 1HIYA 4ECUA 4ES1A 3S8SA 2HVIA 1MMLA 3ZNUA 4DR2F 2PI5A 2WB4A 5A76A 3BKFA 4K4TA 2HLUA 5CABA 2IYIA 2LFVA 1HHTP 1X5PA 3TA1A 3Q0AA 5A6PA 1HFEL 2DNOA 5JEAC 2V2QA 1CBKA 1Q78A 5B0EA 3O2IA 3UN3A 5C0XC 4C8KA 2JLGA 4LVNP 1LFPA 4DPWA 4B3MI 1HKAA 3C6TB 4B3TF 4IOAQ 4FBTA 2RRBA 3FFIB 1FD8A 2B7CB 3GPAA 5T7LA 5ETOA 4U3DA 4OJGA 2IM0A 1PGZA 4IZJB 5H9FJ 2OGUA 4EWTA 4Y2AA 2WTFA 2XO6A 1VK3A 3NXZA 3UVJA 1NJXA 4QIVA 2K1RA 2C22A 2KVIA 1BC6A 3DLHA 2PT0A 3JSMA 1ZXNA 5E3QA 1YG0A 4OI6A 2AT1B 4XPEA 2E1CA 4AXIA 4K5RA 1AA1B 1GX5A 3CIMA 4KHPJ 4ECYA 4LBPA 4RBTA 1NNDA 4ELVA 3SQOP 1FERA 1WI8A 2WAQD 4WP3A 2VQEI 3EXCX 4JI0F 3EYZA 4B3MJ 3QAUA 4YR3A 1UKUA 2WCXA 1OYRA 2KL8A 1RAFB 4DR1E 3FBFA 3D0IE 2FJWA 1RAEB 1L5UA 2ERRA 2Z2YB 3I9V9 4O3NA 3NBPA 2KT3A 3C15B 5KOWA 5H9FK 3DLGB 1ZTTA 2FC8A 5L9NA 2HZAA 1P6TA 2JX2A 2FIUA 2J65A 3QRQA 3ISNC 5DLGA 1IKVA 3CSKA 3OL7A 1VK8A 1D1UA 1XEZA 1BLUA 4M5IA 1PC4A 4DR7F 2AJQA 5A2QQ 4B3RF 1NSAA 1QAXA 1PILA 1VDHA 2VDHA 4TQRA 2DGSA 1PYOB 4URLA 3B6BA 1X9SA 4X2BA 2VQEJ 4DR3F 2RDJA 1TL3B 1QE1B 1WEYA 3BH7B 1LNQA 2GQQA 5GAHI 3OBIA 4DV6E 4YS2A 1YK9A 1VOMA 3MEDB 3I0SB 2DEJA 4ZVIA 1Y10A 1J5EE 3AD7C 3Q83A 2BJDA 2PC6A 1RQ0A 2NSBA 4OYMA 1RR9A 3K59A 3OTBA 2V2ZA 2XHWA 2V63A 4JI8I 2C2NA 2YWKA 1NHHA 1LV5A 3SSSA 3M8SA 2QA2A 3J81U 1FKOB 4LF9F 3LTOA 1SJRA 1VQYA 4ZVTB 3KYLA 2GVZB 4CT9A 1TV6B 1KNZA 4C8MA 4HTJA 4WPAA 4JI6I 1KVJA 3R7NB 2BJ8A 5KFQA 2BR2B 5IT9Y 1U8SA 2Y0BB 5L1IA 5K36C 4RNNA 4X4UA 2UUBE 3CCWA 3G8QA 5KFWA 2MQQA 4OI2A 5HMZA 4X4TA 1MW7A 2FGOA 3FZ2A 5HL7Q 1NK4A 4JV5E 4O0NA 2UXCE 4DR5F 1AFIA 4ER8A 4C3KA 4JI8J 3NAIA 4USMA 1XNRE 2W2OP 3QSIA 4OO1B 4DBQA 5LT5A 2E9ZA 3Q6MA 5GMEA 2HW3A 5HJYA 2NXUA 2KVQE 3MZIA 2MYFA 5L3JA 1HBUB 2B9YA 4DR2I 3TZYA 3H40A 1P1TA 5HLFA 4YB1P 3P6YC 3AOCA 1T9UA 3P3GA 5EWGA 4IFDB 4JI6J 2BE2A 4OJ3A 4QQBA 1NJZA 2GIQA 3IGNA 1JB0C 4JI2F 2I5JB 3PJXA 4N8OA 1AZSA 2FB0A 2F7VA 2FVQA 2Z5BA 2ZH6A 3HXMA 3PFEA 4NXMF 1N5YA 4CLWA 4RW9B 3BGRA 4LFCI 4RWWA 2ZDOA 2BQUA 3NOCA 4FYXB 3RTVA 2DY1A 3KHRA 3T5JA 4ZS6A 2R8GA 1FJ7A 3MMBA 1NEEA 3H4DA 1HW8A 2OPQB 2ZH1A 2VPZB 1RTJA 4TN2A 4DR2J 4JB8B 3SCJE 1DBDA 3V4IB 1XNQI 3OL9A 1Q79A 1TQLA 3H4LA 3HSJA 2ZHOA 2VICA 3D6HB 2W4CA 3G87A 4H4MA 4K0KE 1Q7YT 3BZQA 2UU9E 2Z56B 4NXNI 1NPRA 3M6AA 2R9LA 2JL9A 2GJFA 4M5DA 4LFCJ 4RW4B 5ITHA 4TU7A 4CO0A 1Z4UA 4DQRA 4UOFA 3A12A 5EGYA 1C1CA 1YITS 4KGKA 2QGFB 3MDFA 4U96A 5A0YB 1OY6A 3MUTP 5A2QC 2YWWA 1WUUA 2JZ5A 2W9BA 4B9LA 4DV0I 4DSKA 2YWGA 3VAFA 4CO1A 3T19A 2ZNZA 2W2QP 1XNQJ 1CEZA 2AWZA 1T3OA 3H98A 5IT9Q 5KFNA 1T9TA 2ZNYA 1P9QC 1ZETA 1FF2A 3CJSA 4DR3I 5LMNF 1H2TZ 1L3VA 1F3VA 4U9RA 2CQBA 2CZ4A 4NXNJ 2ZE2A 2JH3A 2XSFA 2ALYB 2N82B 3BR9A 2AHOB 4ZPDA 5CXTA 2B8PA 5LL6d 1EJ7L 4LPFA 4ED7A 4C0HA 3DHXA 1CJTA 3IWNC 4J9SA 1LOUA 2A10A 4FYWB 4UT4A 1RHQB 4ZMMA 2VF3A 2R7VA 1NHJA 2HBYB 3DYAB 4DR1F 4O0IA 1F1BB 3KUGA 4DV0J 2Q79A 1IKWA 5KT5A 4ZVQB 4ED6A 3HCXA 2UVWA 2BKOA 2HQ3A 3CJKA 5K8MA 4IH6A 4PQUA 2QO3A 4DR3J 1UDSA 4G1QB 1N36E 1T9VA 4HYKA 4FYVB 2IAJA 1AUDA 5AT1B 2HVEA 1S0NA 2FVSA 4WUBA 1T11A 4B9UA 5GAGI 2KG0A 3VR1A 1QLNA 1MU5A 2WNRA 1BD6A 5C24A 1NK6A 2E5JA 3ELHA 5HMYA 2YQ1A 1RTHB 3E2EA 3OR2B 2C28A 4IDKB 3NGDA 4A8YA 4LF4F 1KTQA 4OI1A 2CQHA 2PO1B 2HZCA 1ZBTA 1U45A 1MN7A 4DPUA 4DV6F 1RT1A 5IM0A 5D4PA 1NB7A 1HBOA 4EEYA 1L3KA 1P1LA 3FSYA 1X4AA 3WDOA 4I64A 1ZA2B 2H9ZA 2HGNA 1VQMS 4UF4A 3HHKA 2FVCA 1IBKE 3OFHA 4TY8B 4K4YA 2DJWA 1M5HA 4WF9Q 3GB0A 1RT3A 2L48A 3RAMA 1GTHA 1SJ1A 2J7UA 1UZHA 3LP1A 1IM4A 4ZDNA 1JLBA 4CM2A 2B9EA 3G2XA 3DHWC 3TJ9A 3G4SS 4RW6A 4F3MA 3ENAA 4W90B 4NXMI 2M7SA 3GP9A 3TEGA 2IDEA 4P6QA 1JJHA 3NGRA 2J7WA 2EBGA 1LWXA 3V5RA 4YDDB 3K0JA 5I4MA 3B54A 2UUBF 2HKJA 4DSLA 3D6MB 1CPZA 4L72B 2Y1IA 2EXUA 4HH0A 2KB2A 1WC1A 4QZVB 1FDAA 1QVGR 2DNGA 4JV5F 5KG5A 3DLEB 2UXCF 1VRQC 4YDXA 3UDEA 2Y1JA 4OLPA 5B0DA 3BQ0A 1KVIA 3DRYA 2YBVA 2CQGA 1XNRF 4WBFA 1Y3JA 4DV2E 4UOHA 2O67A 4O3QA 2YWHA 1T9WA 4JI2J 2G9OA 3W62A 4EMDA 2RH3A 1U6FA 6AT1B 3FBCA 1S99A 3DM2A 1A0OB 3KLVA 1SB6A 1S0OA 2YKMB 4NXMJ 1BY9A 1FKAE 2IESA 4DPYA 4GKJE 4Y2MA 1XTZA 4LRDA 1R6YA 2QLWA 1RWOB 3PHEA 3PCOB 2AX0A 4I6YA 3OFFA 4CLFA 2NLWA 2W9CB 1RWUA 3TA0A 5C5JA 4Y28C 1ZM2A 4RW7B 2EG2A 4F2SA 2F4VI 4IG0A 2ZVIA 4F25A 1HI0P 2XMAA 3KG1A 3QLHB 3M85D 1U1KA 3KFWX 5DDRC 1DQAA 3I4HX 4OYWA 1VC0A 2UV8A 2MHEA 5HI7A 4FWDA 1U24A 4LF2A 1NPKA 3M2VA 2WONA 3SDEB 3JAMY 3B4DA 1H98A 3GIJA 4C3LA 2G1DA 2ASYA 3IR5B 4FW4A 1N48A 3G6ES 1FRJA 2YNIB 4E98A 4KJIA 2YQ3A 2QL9B 4K0KF 5M2PA 2NSCA 1SJFA 5DG7A 3JTNA 5K36B 2UU9F 2B6AB 1NSPA 1X4EA 2HLTA 4Z7YA 3R8YA 3QJJA 2J8SA 2BE9B 3B4TA 3FC9A 2VG5B 4CYUA 1JKHA 1E3PA 2F4VJ 1VGYA 1WSRA 5FDLB 4CO4A 1YI2S 1QUVA 4RO0A 1Z0GA 4F0HA 1BXNA 4DI6A 3AHPA 1NAQA 2Z57B 2V4JA 4Q44A 1UCNA 1V3RA 4NLRA 4OO1E 3IC1A 1QZRA 4UOGA 2CQIA 3LALA 5EWEA 1PJ6A 1X5OA 2MQPA 3OXGA 1CJKA 1HBNA 4ZKAA 2YVSA 4IFDE 3DXBA 1PCAA 3M6XA 3ZZTA 3QFHA 1D9DA 4NEYA 1KIJA 5HATA 1ZPVA 4HACB 4ZVRB 3C16A 4FXVA 4DU7A 2BBEA 1LEOA 4C8YA 2PMWA 1RT2B 3PEHA 4HY1A 2FPHX 1J5EI 3R6LB 3M7NG 1IKYB 1WKLA 4GRSA 2KT5A 2HHQA 3KJNB 3SCLE 3SBMA 3PFOA 4F04B 3VAJA 4P2MA 3THPA 1FJGI 1FK9A 5DZ6A 3DC2A 1S9EB 4X4VA 1PJ5A 3HFKA 3SZ2A 5AE1A 4ILRA 4WFAQ 3J7ZT 5E5NA 1VISA 2RUGA 3P49B 4C9DA 1H6KX 2F9JA 3GV5B 2W01A 4FF2A 1T8EA 2K8GA 2G2YA 2HNYA 3CGIA 3JQKA 4YHHF 3SIPB 1S1VA 4KGMA 2RU3A 2PNMA 1TVRA 3WX4A 2BZ2A 1D9FA 1FXDA 1GXLA 3FQKA 2XHCA 5DDQC 3ZZPA 2UUBI 1KEKA 2N4DA 2PI4A 4J9LA 1J5EJ 3DOMA 2P2CB 1QUPA 3TUZC 4AD6A 2LEAA 1VQ4S 2JEGA 4OFZA 2GJIA 3L7OA 3JAMQ 3VAHA 1FJGJ 1XNRI 1S9GB 5F3TA 4FW7A 3CD6S 2QYCA 5LM7E 4Y2IA 3NZKA 1LWEA 1AROP 3UFCX 1IBKF 2HHUA 2H5JB 4ED8A 1BMQB 2W2MP 3HO1A 3FEXB 4ANCA 3R5DA 2V4RA 1D8ZA 2V50A 1AB8A 3IP0A 5B08A 5KT4A 2UUBJ 1WOPA 2DXEA 1UPMB 3D2WA 2NN6E 5I42B 4HYMA 2HIYA 4IRDA 3W9HA 3QAEA 1PKPA 1SC6A 2C2EA 1XK8A 4X65E 3HT3A 1FJCA 1C4AA 3KLFB 2QLBB 2ZBCA 5J1PA 3CWVA 3ZO7A 1QJHA 2BA0D 2WBMA 1XNRJ 1NM2A 4X4NA 3D28A 1H73A 1S12A 2JEBA 1VQ7S 5HANA 2FY1A 3QWUA 1HARA 3Q22A 4DS5A 3Q6NA 4ISAA 4FKYA 3D66A 4OYAA 3ZFVA 3E01B 2RHSB 4DV2F 2LP4A 3QJPA 1S1WB 3NWRA 4JV0A 4DG1A 2VFSA 3VTIA 4UY85 3LP0A 4K0KI 3D6FB 3HKZD 2FUG9 1HHQA 3GFXA 2UU9I 3KK1B 1VQNS 2HMIA 1RTDA 4J37A 2MKKA 1FKAF 1HNXI 5JEAE 4KQZA 4J9QA 1H7XA 2GHPA 2IC3B 1ZH5A 1WSVA 3EGZA 2CNNB 1UDNA 1NMEB 5C0XE 5IT9U 3M8PA 2XBPA 5IT4A 3G6XA 2BA1G 2YNHA 3MMAB 2EBEA 2NXCA 5C42A 3TANA 1KQFB 5M2RA 4NLDA 2JC0A 3KKFA 5F8NA 2PMHA 3M6VA 3MM5A 2ZITA 4ID8A 3DGVA 4RU9A 2W8LA 2Q6CA 1HQ2A 3S6EA 1A6LA 1Z0CA 2AV5A 3U02A 4CH0S 5DQIA 3NP5A 3G8SA 2L9DA 1Q86T 2DGTA 1SJ4P 4K0KJ 4P52A 4IR1A 3JXOA 2XY6A 4R8UA 4B9NA 2UU9J 1OY9A 1YLXA 4LRCA 4IRKA 1HWJA 1I1GA 1HNXJ 2D3ZA 1GFWB 1S77D 2JEAB 4IKAA 3DU6A 3M2RA 3BKTA 4GVBB 4P2SA 4F50A 1U8WA 1S97A 3MR7A 3DI6B 4DL6A 4NLGA 3CT9A 1O5JA 1KVKA 3VGVA 4DR4E 1N8RT 2CGEA 3GCXP 4A8MP 1Q82T 2W7PA 1GMWD 3GG0A 5IFMA 4QWDA 4LF6E 4USVA 1H0HB 4A8KA 3NLCA 3DLJA 2WSFC 2D74B 1YJRA 3PDNA 1QAIA 1RT7B 3PTWA 1S72S 3H20A 3CCZA 2A3JA 2J8AA 4PUOB 4OO1F 1OIAA 1QD1A 4ETZA 3WQPA 2VBZA 2XSJA 1N36I 5KFLA 2HAFA 2W7OA 1IBME 1FFSB 2HYIB 1Y5IB 1HNZI 2CJQA 2Z5CB 5ETMA 2B9WA 1RB0A 2NREA 4IFDF 4RU2A 1LW2B 2RT3A 4ZITA 1DZ5A 4KTQA 1Z2ZA 1OY8A 4LSNB 1KS2A 3J7YI 5J2MB 4FW3A 1RTIB 1QSYA 4HR2A 3KMQA 3UD5A 4USWA 3CDBA 3S7RA 3ETOA 2Y9HA 3CCSS 1REVA 3T6BA 1C4CA 1LWCB 3TVKA 4ZPVR 3RRKA 4ZJLA 1BGXT 1IBKI 2FLNA 4ZPWR 2AX1A 2X3DA 4PWDB 1X4BA 4P73A 4C0OC 1N36J 3KDOA 1KC8T 2PO2B 2IPOB 4ECTA 2F8MA 2QMXA 1RBOB 2XM3A 3QQCD 1HNZJ 2EFPA 2CJXB 5J2QA 5ETKA 1Z5AA 3D3CJ 3OTEA 5HVGA 1YWXA 4PR6A 4OI0A 4CH7A 3P4UB 1RU1A 4U95A 4OO1D 1KLMA 1DURA 3UDVA 2M2BA 4WWSA 5E3AA 4OX7A 2UUAE 2BMBA 3HVTB 2CJKA 3RB6A 5KFRA 4DFPA 3BSNA 3PR5B 1F0XA 3BJYA 2CG4A 4RUHA 1X60A 3UW1A 2DHSA 2MGZA 3Q8RB 1T03A 1WG1A 1WHYA 3KLIA 3CJTA 1VC5A 4IFDD 1T05A 5T7LB 2HFVA 2PNZA 2KJWA 2R8IA 3UQSA 3CD0A 4Y2CA 1EHWA 3CC4S 3U1YA 1IBKJ 2ZBRA 4KGZB 3UVJB 1EIYB 4Q5VA 2K1RB 1VQKS 2Z4PA 3PRYA 2M4MA 3PIOQ 3JSMB 4DV2I 2V6AA 4N76A 2R2TA 2XGQA 4DSEA 4WFXA 5IZHA 4WKRA 2BABA 2MLXA 1BE4A 4FNHA 2RSQA 3VF0B 5HP1A 3OUYA 3K57A 2M70A 1K44A 4GKJI 4YUDA 2AEFA 3TAPA 1EAYC 1XR5A 2YX7A 2FYXA 4NA3A 3PM9A 2FZGB 5I3QA 1ULRA 3NBPB 3MCSA 2IJRA 2RIJA 1RLCL 1X0PA 4DR6I 2L9NA 2CNLB 2AJ1A 1SQGA 2W2NP 4DV2J 3CC2S 3PW0A 1PAEX 4ECXA 1IKVB 4OLOA 5F3ZA 1JWWA 2VOPA 3N01A 5A8WA 4Q45A 3AY0A 5DGBA 4KGXB 2ZHBA 4NLQA 1NH7A 2O3ZA 4GKJJ 4FBUA 2E5GA 9RUBA 3AA8A 3EGNA 3TI0A 4RNFA 3H0PA 3DD6A 2IOPA 2GX8A 2W2PP 2EFGA 3EX7B 2VQFI 3KLHA 3G96A 2F4FA 3HHLA 3KNGA 2QA4S 1S1TA 2E1AA 3DXSX 5JEAF 4J91A 1PO6A 2MKCA 3KWMA 1XQIA 4DR6J 3CVKA 4MU0A 1ELOA 4ZVEA 3TRGA 4PXEA 3MPVA 1RSCA 2I38A 3CJ3A 3OPKA 3BN4A 3BF4A 1USVA 1DTQB 3FDSA 1U2CA 1KN6A 1VBZA 2AMCB 5KT2A 2BDPA 4DQPA 1WORA 1FNMA 1SBRA 1VLOA 4KBIA 3BBFA 3G86A 3MMCA 2I2YA 1WJ9A 4IR9A 3CCTA 3BO2A 3DLKA 4NLVA 2RRNA 1TK8A 3UWTA 2BOPA 4C8NA 3HMJG 3VCDA 4ZCLA 3LAMA 3DKDA 2VQFJ 3N79A 4FVMA 3MMJA 4DV4E 2RDDA 2HHVA 2B5JA 4O23A 2RQCA 3P5TL 2HWHA 3A3NB 3EZUA 1FE4A 3CUNA 2YWFA 3L7PA 1FJEB 2H4WB 1RACB 5CAAA 4DR4F 2B4UA 4DLGA 1B0PA 3KK2A 3P3EA 4N77A 2KN4A 4F7VA 2ZJRQ 4DWIA 1AFJA 3NY0A 1ITPA 4LF6F 3OTOE 3QO9A 1WHXA 1RAOA 3EM1A 4F36A 4M5MA 3GLLA 4HKQA 3ADAC 2E44A 4M1KA 3BBCA 4WZMA 1QAJA 3AD8C 5CYQA 4QNJA 2JE6A 5HLFB 4I2QA 1JK9B 4DPXA 4EI2A 3Q8UA 3GILA 5DDOC 1V3SA 4CT8A 5I3PA 1RHUB 2BE2B 1K0TA 4OV1A 3IBFB 4DU8A 2FJEB 1IBMF 1AZSB 3JAMU 2NCKL 2DPJA 2HHWA 1WOSA 5GADU 2RB7A 4DCOB 3CJ8A 1N5YB 2YPYA 2LYVA 4K2XA 1RREA 3BGRB 1HQEA 1R8HA 2WB1D 4GO5X 3PEJA 4PQAA 4DSIA 1SV5A 4ANDA 4BDPA 3MMBB 1REGX 2XQCA 1MN9A 4HI1A 2MDAA 4IZKA 2B51A 2ACMA 1LXJA 1RTJB 3W60A 5HMWA 4ZJQA 2R3VA 2QMWA 3MEKA 3K5MA 1LXNA 4R25A 4PKDB 4JI4I 3TUPA 4MKAA 1VHIA 3M32A 4WFYA 3R5JB 4J9KA 3DGPA 2I1RA 2L9WA 4X4SA 3IAM9 3IG1A 2ZM6I 3V6HA 1U1PA 1YJWS 4H4MB 1N56A 4NYPA 4JI3I 4KPYA 2LEPA 3A3PB 3N6MA 4PG5A 3MR5A 1VCTA 2DCLA 2NN6A 2EEYA 1M5PC 5HK4A 2MTLA 3BSOA 4LT6A 2MZJA 4ZPCA 4OYPA 5D4OA 2V4QA 3ISND 1T94A 4M5DB 2RQ4A 4X65I 2UUAF 4IG3A 5SUHA 5E33A 3PKYA 3NEKA 2J5AA 2EG1A 2GNKA 3ONQA 1WDTA 2GO3A 5K36F 1C1CB 4J90A 2RU9A 5I3UA 3HX9A 3TAQA 2Y3YA 3HHNB 3TQ1A 1RLDA 3AB4B 3ET6A 2W9BB 1KHWA 2DH9A 2BW7A 2V34A 3MM7A 4MIWA 2VL1A 1NSKL 4BA1A 4CLYA 4BA2A 2N3OA 3A1YG 4PYDA 4QW9A 4JI4J 4TU8A 3TUIC 1WG5A 3WC2A 3RW6A 2ZM6J 3JYTA 3TVYA 1B70B 4JI3J 4EGLA 1VI7A 5IQQA 3UD3P 2DR6A 1D6TA 3JSBA 1WC0A 2ZE2B 3MEEA 4I56A 5JEAA 3GQCA 2QA1A 4DSJA 1OYPA 5BYSA 4X65J 5C0XA 1S9FA 3BR8A 1GMVA 1VRTA 4JYAF 2J9CA 1Q95G 1DTTA 2H5EA 1CJTB 2KO1A 4OL8A 2UUCE 4ELTA 3Q8PB 1EP4A 1HI8A 3THTA 2IMWP 3MAAA 2NQPA 1WKJA 3HVWA 4QU7A 1IKWB 3CE8A 3THVA 1F5CA 4GVLA 2CNOB 4K2JA 3CJKB 3ICLA 2HWTA 1LKZA 5DROA 5K36D 1DQ9A 2DRAA 4PQUB 1VMBA 3QIPA 2J0XA 5KFBA 2W25A 4PXBA 2IAJB 2EFVA 4X66E 1WHVA 1RE1B 4FF1A 8RUCA 5F8JA 3NS6A 2WNRB 5C24B 2UXBI 2MPUA 2QX0A 2JSXA 2LA4A 2D7SA 1FX4A 3PJWA 4PPDA 3MAHA 1WELA 1RWVB 1HD0A 3U1NA 1FNXH 2WOMA 2KFNA 1EARA 3V6DA 4PYAA 1R0CB 4BWMA 2LDIA 2APOA 1F6TA 4DN9A 1RT1B 5IM0B 3PW4A 4U7UD 1HBOB 3QMQA 3I9ZA 3I4PA 2YNGA 2CZVC 2C2MB 5B0FA 3NGSA 2MZSA 3RRGA 1M90T 3SI8A 2CJAA 3JQMA 2AGPA 3M8QA 1RAJA 4EYIB 3RYLA 3GZ7A 4IH7A 3HULA 3O44A 1UDOA 3HLUA 2KXNB 4UQGA 3JSYA 4ED3A 3LP1B 4NLTA 2CPEA 3OXLA 2MKIA 2BANA 3BREA 1JLBB 2MKJA 2AIRB 3GYGA 3GV7B 2ZBKB 4RW6B 4JG4A 2UXBJ 4KO0A 4C98A 2C37A 3DOKA 4WYWA 4OX9I 4PABA 3OW2R 2LXFA 4DV4F 3KDNA 2CG9A 3MCNA 4V19X 3Q2TC 3ZTRA 3LWLA 1YJNS 2WW8A 5LMUI 2DB1A 3BBBA 3CJ0A 5KFUA 2DNYA 3J80C 3C14A 2VPWB 1ZZFA 1NKCA 3OTOF 4XIUA 1Z0WA 2GQ0A 1YBUA 2DR7A 3DOLA 5F8LA 2QG9B 2G4BA 4QR2A 4C3MA 2HBZB 4Y00A 3IGVA 3DM2B 2R8KA 3MPWA 4J3DA 4USJC 1Q4RA 4X4QA 2IM1A 4I68A 3D5MA 2B7BB 2GO9A 4OX9J 4NASA 4URGA 1L3SA 1WEXA 3D9BA 2RILA 3CMES 3IM8A 3N5FA 5LXRA 2QJ3A 1C2PA 5M2UA 3MXHP 3KRNA 2V8DA 1N33I 1DY3A 3ZM7A 2BJ1A 5LMUJ 3N6NA 1Y7PA 3IMQJ 5IS2A 4QNKA 1ZTWA 5F8GA 3VALA 4K8RA 2DY9A 2DGUA 3LWMA 2QV6A 3X1LB 3NGKA 5KFZA 2EC0A 3UDLA 4IG0B 4H4KC 3D1QA 5KT7A 3VAIA 3HVAA 1S48A 4O3RA 3CXCR 2H48B 3RBXA 1O51A 2GQCA 1A6FA 4RW8A 1YVFA 4DV5I 3QRRA 1UJ6A 1I5OB 3T3FA 2F8HA 2FGCA 1UVMA 3AT1B 4QYZJ 3DRSA 3M2VB 4OHYA 3S01A 1S1UA 5KFSA 2WONB 1KQGB 1UJ5A 4JV2A 2CWKA 3N9UC 4KY3A 3UO0A 5FLXY 2Z2MA 3W66A 5AE3A 1U09A 3J81Q 3LPYA 4WK3A 3K58A 2BW2A 1RISA 4DSFA 5IOLA 5JUMA 4KV8A 2PE8A 3FUYA 5CZXA 4BLGA 3R6GB 3CO0P 3FK4A 4CYUB 1JKHB 4HI2A 2D3UA 3OXFA 2BEFA 1M5SA 3UCZP 4FVCA 2P8IA 1UJ4A 4ZLNA 2OUGA 1AXQA 2YX1A 2ILYA 2F1FA 1FRIA 4ELUA 1RCOB 4DV5J 2V4JB 4QYZK 2DXDA 1HR0E 4OYIA 3PX0A 3OJSA 4XO0A 2DNRA 4OIXA 4BBYA 5HN0A 1RU2A 1N0UA 3H5YA 5DDPC 3K85A 4ICLA 2BA9A 2Q2EB 1A7GE 1IXKA 3MPYA 3UNYA 4LF7F 2JHEA 1CJKB 2B3TB 1HBNB 3LW5C 4WXWA 4L3KA 3DRXA 2CNKB 5FWKA 3KXDA 3R2DJ 4I6AA 1RHJB 1D09B 4MDTA 4UY8T 1SC3B 3FMBA 2QIFA 1OPZA 4QJVA 2GIRA 4L74A 3C16B 3OVAA 4DF8A 2HHXA 4LFCE 2IM2A 1FEEA 1U25A 2ZH4A 1EETA 3I55S 2N3LA 4OYBA 4ZP6A 2ZZMA 3I0RA 4MAKA 3RJMB 1EZZB 2DTJA 3GR1A 4I4BA 2BJ3A 1FK9B 4PWWA 4QU6A 1XNQE 4TLRA 3WZ0A 3UHMA 1JX4A 1YGYA 2EK6A 1RWWB 2DKOB 3HFVA 3L9ZA 4O44A 3T1YE 1BWVA 1SKSA 1VQPS 1SH2A 4NYOA 4YEAA 3RBDA 1RCXB 2HNYB 1NBEB 1S1VB 2JLEA 1U0SA 2L41A 1TVRB 5FJ4A 2JWNA 4NXNE 1FD2A 2V8GA 3EJMA 3CULA 5AXNA 2YH1A 1R7IA 3HFZB 1FWPA 3HHLC 4ZIVA 4X62E 5HQMA 3POTA 1YHCA 3DOMB 2KZZA 5EX0A 2XS5A 2IFXA 1KFSA 4B3MF 2CFXA 2J7KA 5F9NA 1JNRB 2NZCA 3AOBA 1S6OA 4NMXA 1VBXA 1D8YA 4DV0E 3UR0A 1KQKA 2LEBA 4BCAA 2N7YA 5FLXQ 1SKUB 3M7ND 2LDYA 2MZ1A 4V19J 1LWEB 4NLSA 1RHRB 2LQJA 3KNAA 1KD1T 1WTBA 4A8WA 2OLWA 2IJFA 2BRLA 1S0MA 2ZUGA 3BM7A 5LJ3Y 3GTYX 4Y2KA 1YTYA 2MSSA 3KJQB 3CW2C 2IRYA 5GAHU 2BOAA 4I69A 4CO3A 3R1LA 1XC9A 1WHWA 3OLAA 3IBWA 2VQEF 1FVSA 2X51A 2Z8QA 1APSA 1TUVA 2RE1A 3K1JA 3C19A 1Q8KA 3E8OA 3IWLA 5DG9A 1U4BA 2CG8A 2JEBB 2ZD1A 1RUSA 3HF5A 1P9YA 1TFWA 4CRJA 1X31C 1Q5VA 3B4MA 4Q2MA 2LU2A 3BKUA 3J81C 1NO8A 2FLPA 4P2XA 4PRXA 3KLGA 4DG1B 2VESA 3D0HE 1NDLA 2F1DA 5EWFA 1QM9A 2E7WA 3LP0B 2DNMA 5KTQA 3ENWA 2C3OA 3H8YA 2MKYA 2Q1LA 3F44A 1QTNB 1D3WA 2HMIB 1QTMA 1NHKL 1RTDB 3PX4A 4CDIA 1EI1A 4D3HA 2R2SA 2O1WA 2R8HA 1NZ0A 3QIDA 3OFGA 3R5GA 3TQEA 3EXYA 2XLIA 2VKZG 5DZ7A 1SJ3P 1Y60A 1DAXA 4IO9Q 3M8PB 2KH9A 3FGVA 3BN7A 2AYMA 3CPWR 1ZM4A 2YNHB 4A8OA 4AL6A 3C8YA 5THWA 5C42B 5KFEA 2UVUA 4L73A 3PYEA 3P76A 4FWHA 2JEIA 2HFUA 3IR6B 5LJ5Y 3MM5B 3OVBA 3KG4A 3NNCA 2GHWA 3FVYA 2PFDA 2OAUA 4FS2A 3KUEA 3I6PA 1RHKB 1BWEA 3Q86A 3CDEA 2ATCB 3BEGB 2MSTA 5KG3A 4CM0A 3UDCA 1FHTA 4R8UB 3QRPA 1S6QA 5B0BA 4AT1B 2NN6C 3C46A 4B17A 4ZN3A 2RQMA 4JI6F 3M2RB 3A8EA 1HWLA 4QIGA 4NWBA 1HA1A 2XB2D 2X7IA 5KT3A 4WJBA 3I5CA 2OSRA 3CJ4A 2UUCI 5D3GA 2Q6BA 3MCOA 4USTA 3W2VA 4YR0A 2MQNA 2G0IA 1NKEA 1DQ8A 2QLFB 4DV3I 1XJWB 3W65A 4BC9A 2ZBPA 4CLKA 1HR0F 4JI5E 2DGVA 2VPYB 4DXLA 5HSPA 2XSJB 3W9JA 2P9EA 1JJ2R 1WOOA 2B0GA 2AJ4A 3PRDA 1ZZNA 2FVPA 1KLNA 4X66I 2DGWA 3H2VE 4IYQA 3T5KA 2XMVA 5B7WA 4FXDA 3R7BB 4N7TA 4RKUC 1VS3A 5DRKA 2UUCJ 3HI9A 1U1NA 1GH8A 3I5AA 5ETQA 1ZM9A 3MF5A 2F5GA 4LFCF 1REVB 2F4VE 3HPOA 1CJUA 4DX8H 4YP3A 4DFMA 2E1MC 2V5HG 1FXLA 2LQ8A 2IY5B 4ECZA 3UCGA 1JMTA 3HKMA 3FEYB 3KJVA 1XNQF 4OJ1A 4X66J 3IS9A 4NI2A 5J2QB 2AEMA 1FDBA 3M8ZA 2BJ7A 4Y34A 3KLEA 2JEFA 3PYGA 4RZRA 4LVOP 3AD9C 1KLMB 2XCPA 3EPGA 4R0EA 2KKHA 4KQVA 4NXNF 2MGZB 2W9AA 1T03B 4ECSA 3KLIB 3R7SB 4FYDA 2F65A 3AFGA 1T05B 1C0TA 2W1BA 2PNZB 5SZTA 4K4VA 4OI3A 2IHR1 2CIMA 1RAAB 1VJQA 5KFAA 4OMFG 5KFJA 2WVDA 2EK1A 4DV0F 1EA6A 3Q23A 5GMKa 3ZZYA 1Z2LA 2VA3A 1VR6A 3F41A 2G2OA 3SCIE 1U26A 3J81j 1XHKA 2CJBA 1WC6A 2CJ9A 1KOOA 2XNQA 1HYSA 2C38A 3KJFB 1ICEB 2F8EX 5F8MA 5GAGU 2IOQA 2HRTA 2HKEA 5HP1B 3OUYB 1TFYA 2H51B 2NXJA 3D0GE 3PO5A 5JVHQ 3M2UA 2CDQA 2Q66A 3CJ5A 2DHHA 4CWBA 3DRPA 4XTJA 4P71A 1GAOA 2VFRA 2NYIA 5CYJA 2FVRA 2AGOA 4I0WA 3PYDA 4LFAI 5CD4H 4W92B 2A6MA 4A8QA 3J7AN 4S0MA 4WXOA 3W5ZA 4MJKA 3A3OB 5A6WA 1NPPA 2IJNA 1HK7A 2EFNA 1MROA 3DN9A 4B3OA 3PXGa 1FJGE 3ZKBA 5BR8I 1H7SA 1TL1A 2CQ1A 3GFYA 5A8WB 3TX8A 4Y3CA 2VBXA 4RX6A 1KONA 3IRXB 2I9SA 1TZ0A 3GMEA 3BQ1A 3RAQA 4HLBA 2LQBA 4LIRA 1NZAA 1W2IA 5DGAA 4KKOA 3VVUA 4AM3A 3SQGA 2Z58B 3G82A 4X4RA 4UTGA 3A8IA 3GFZA 4LFAJ 3KLHB 1QSSA 1O8BA 1S59A 4F4KA 2KZMA 1S1TB 1B99A 4PPZA 1NJIT 1S10A 1PVGA 3IA0A 1W7WA 2RAQA 2HHHI 3MECA 1U48A 4I7FA 3MUMP 1Y11A 3C2PA 2QA4G 2DPIA 2V2KA 4J9NA 5BR8J 4YFUA 1F60B 5F0WA 4P7AA 3VGSA 1Q8BA 3O8WA 3WHIA 1HR0I 1W26A 2PFFB 4OZ0A 3AQPA 4CLTA 3MMCB 1JLFA 1VC6A 1NDCA 1XXEA 1KWMA 1SC1B 3DLKB 3D67A 1NZ8A 3SYZA 1Y00A 1N6QA 2QT7A 2PO0A 2V0NA 3RU0A 1NH8A 1X4FA 4OZNA 4O3SA 1U1MA 2FHMA 5DNXA 2CAJA 2B5JB 3FMWA 4FXWA 2HHHJ 4RNHA 3CDAA 3MM8A 5KG4A 3KTQA 3RRHA 2P5VA 1HPZA 3KK2B 3H4BA 4IOBA 2QLJB 3RB4A 3ZKDA 2U1AA 2IA6A 3SFGA 1HR0J 3EMTA 3QO9B 3OQ2A 2QEXS 3L09A 3ITHA 2X3GA 2XYHB 2YPZA 1K1QA 3NCRA 5CYQB 4I3HA 3T1YI 3BV8A 2JE6B 4I2QB 4F4ZA 2L3MA 4DV1E 2E29A 3NCQA 4JI5F 1T9YA 5A8KA 4L6V3 2MLYA 4CO2A 3PY8A 1CVJA 2UP1A 3EZOA 3RAXA 2XC9A 3EWGA 1C1BA 3P45B 2OD4A 2R42A 1HNXE 2OEJA 2VONA 4HHJA 4J5OA 4LMZA 3M8WA 2QFIA 5FLXU 4X62I 1HQEB 1JQGA 5ETRA 4I2PA 4P10A 3B78A 5CH7B 1SV5B 3AOAA 1S1XA 4NLPA 4ZIWA 2E5LE 1SH3A 1JLAA 1FKPA 4AYBD 2YNFA 3DDNA 2F4VF 4RBVA 4IZKB 1Z0TA 1OO0B 1MSWD 4B9MA 4F0MA 1F2GA 1NK9A 2YX4A 3T1YJ 3QWPA 5HVFA 2A1BA 3VQSA 3SSQA 4NLOA 1XN9A 1UL3A 4EZ6A 2GMHA 3M32B 2HK2A 3IG1B 3W1YC 1RT6A 4F4AA 2FLOA 1TU0B 2DIUA 2HFNA 3NKYA 2J6TA 5L1KA 2NN6B 2O1TA 2HGMA 2KYXA 1JLGA 1IBLE 1NK5A 3F56A 3IFEA 4X62J 3RUBL 1NHVA 1X0FA 5IT0A 1RADB 4K4SA 2LCWA 4IG3B 2R7SA 2AJFE 1R6LA 2YKAA 2ZH9A 4WZQA 4M5HA 3UNGC 3FEZA 1Q0NA 5CA5A 3RB3A 4XAKA 5I3UB 3M4XA 5KFKA 3NGUA 1CQNA 3BSAA 1N52B 2XS2A 5GAEI 4M5JA 2UVRA 4C7QA 1R8AA 3ET6B 3R9LA 2VHGA 2C42A 4PG6A 2PNLA 3ENVA 3MM7B 3QSYB 4X64I 1CJVA 2J9DE 4DCJB 4B02A 4BA1B 3O1LA 4BA2B 1KQSR 4YY3I 2OIHA 1N54B 3JTOA 7FD1A 3OHBA 2O5DA 4PXDA 2CQCA 3JYTB 3C6UA 2FZCB 1F2HA 4DV7E 2DHGA 1HNZE 1BQMA 1NJYA 1X7VA 3M8YA 3A4TA 3MEEB 3PIPQ 5JEAB 1S57A 3FKBA 2COLA 4QPTA 3KHHA 1Z59A 1YBTA 5MLCV 5C0XB 4FW6A 1B7FA 2OSQA 2OPPA 1VRTB 3IO1A 1NHUA 3G71S 3KK3A 1RDRA 1DTTB 2FTRA 2CZ9A 1EP4B 3FRZA 4EZ9A 1U0HA 1OJ4A 4GKKI 3MAAB 3MURP 4HEA9 1J5EF 3R5BA 4DCPB 2GVDA 4X64J 2D9PA 2V9KA 3U1MA 2M52A 4J9OA 2D69A 4YY3J 3GJSB 1UVNA 3FCHA 3SXLA 4ANEA 3GG1A 4ZVFA 3BSCA 3PR4A 4LF8I 1FJGF 1G2EA 3H25A 4FN5A 1SC4B 3QIPB 4NEZA 3LAKA 2DO0A 4XK8C 2ZKTA 1DHMA 4AXJA 1FE0A 2WVBA 3A13A 1B4SA 4NRUA 2KTQA 3MM9A 1RA7A 1M5VC 4OYZA 4YB6A 1FRHA 2ILZA 2KG1A 2R7RA 1ZYQA 1XERA 2BA0G 1KDNA 4Z7CA 2IDLA 4I6WA 5JXSA 1RBLA 4DUZI 2ZH5A 2YH0A 1U1LA 5HVHA 2WOMB 4GKKJ 3CF5Q 3V6DB 1LK5A 5DRRA 3CTRA 3AXKA 1OYDA 2VG6B 1EKRA 2YNGB 2M8DB 4ZLLA 4RUBA 1TKZA 4LF8J 2WVEA 1U6BA 3QFWA 2CVEA 4O3PA 3M8QB 4AQYE 2ZH2A 4M5KA 3TYTA 1Z0EA 2ZZTA 2IVFB 2LJPA 4JI5I 1JIHA 4MIAA 3QZ7A 1YJVA 2HNZA 2DEIA 5DQGA 5K5MA 2O1UA 2BANB 4IO1A 3GU0A 2JEJA 1TR0A 2BRKA 4U67Q 2OP5A 4KO0B 1G3OA 2C37B 4ZCMA 4CZCA 3H5SA 3DOKB 3MM6A 4DUZJ 2OEKA 3M1VA 2OELA 1SI9A 2GV1A 5IT9C 3R5CA 1NDKA 1PKUA 3ZTPA 4G1IA 1ZM3A 3T9ZA 2X1AA 3ZXWA 4DR6E 2QLXA 2KHDA 2FHKA 4J9RA 4Q7AA 2Y8YA 5LSRA 4CTAA 2H1YA 3BYPA 4DR7E 5KFIA 6FD1A 4JP8A 5KFHA 4N3OA 3TZXA 3C14B 4JI5J 3H90A 4KR0B 3DOLB 3HHDA 5ETLA 2KDOA 2VJUA 5B09A 4OX8A 3HP6A 2FY8A 3EVMA 1N4LA 1GXTA 2RF2A 4DX5A 5L46A 1UWAA 5IV3A 4J9MA 2C2OB 5RUBA 1MU2A 3TZZA 2VQFE 3PRVA 4OZ1A 1R27B 4CLZA 1Q1KA 2VZ9A 3OD2A 1YX2A 1SXLA 2HQCA 4NCBA 1HNXF 4C4WA 5L39A 3K5LA 1JXEA 3LNUA 3CDWA 1H72C 3CNQP 4MYTA 2KRRA 1HQUA 2YKQA 1OSCA 4KFBA 2XMTA 1JXVA 3UR3C 4B3SE 2QC3A 2R7WA 2MB0B 2E5LF 2X1GA 1R6VA 1UW9A 4C11A 4RW8B 1MLAA 3AJ2A 3FBBA 5E7OB 4UUXA 1U1QA 1AW0A 3DRSB 4IS9A 3TARA 1S76D 1S1UB 3KG0A 1DLOA 2DK2A 2GMJA 4DL7A 2BM1A 2ROPA 4UZCA 3J7YU 2Z2LA 5KFCA 1WF0A 3I32A 1F3FA 1SUQA 1G7CB 2GFFA 4KV8B 5HBMA 5A8RA 2PA8D 3OV7A 1JLEA 1N5QA 4BHQA 3SSRA 4MYUA 3L3CA 4UOCA 5C25A 2J0QD 2E66A 1T95A 4IOCQ 2E5IA 5J2NA 4CNZA 4F4YA 3W9IA 3CJ2A 3ILIA 4WKYA 1V6HA 2DYAA 5T41A 3HSGA 1R8CA 1R43A 3K5OA 1O6XA 4ICLB 3QGGA 2PIIA 2CWXA 2P9CA 1K9MT 1RAGB 2PMZD 4XPCA 1N36F 2OD6A 2DHXA 2M9KA 4DEZA 1HNZF 3R3TA 3IM9A 1RXOB 2G13A 4QPXA 5A2QY 3GSIA 2P9GA 4ENOA 3L7UA 2OFHX 4HXZA 2R4FA 4PG8A 1S4EA 1X9WA 1TK0A 3ZZOA 1IQZA 4RWXA 1EETB 1UW4A 2CVIA 4ZVPB 2LA6A 1HWUA 2MQ8A 3PYFA 3ZTSA 4DX7A 4ILLA 1BQNA 2J9EA 3I0RB 4ZPBA 5JMNA 1FRLA 1E6YA 1SIWB 1FNOA 4PEOA 1YZ6A 2DH7A 1WG4A 3DU5A 1R3NA 4TYAA 3AXMA 4JI4E 1U6ZA 1JNZB 4O44B 1X5SA 3MI7X 3BDPA 3DMJA 1ZS6A 3Q89A 1Z0VA 2ZM6E 5KFGA 1PBUA 2KI2A 3PG9A 4JI3E 4DQQA 2ZDPA 1OYSA 4K59A 2E5HA 4KHPI 5KG2A 3KMSA 3HVTA 2LXUA 1SVDA 4DUYE 3M30A 2XLJA 1Q8LA 4C6AA 4P9SA 2VBWA 1ROFA 2VDIA 3POTB 1ZA1B 1RA6A 2VBYA 2BV3A 4LR9A 4C2MA 3EVWA 2FD2A 2VC1A 4DJBA 3WU6A 4HT5A 1K0VA 4XDDA 3W3SA 2PGCA 2PA3A 3W61A 1HHSA 4KT0C 5J2PA 2X1BA 1YKWA 2XWYA 3BYRA 3AJ1A 2F3JA 5LMNE 4DPOA 4KHMA 1UA0A 1S79A 4M5NA 4AQYF 4DV1I 5IWAI 5DETA 3VAMA 3L95X 2OTJS 1S7HA 2GZOA 3DNCA 2O01C 3PX6A 4GKJF 2V8HA 1E6VA 4ID5A 1NLKL 2DNKA 1T7PA 4N41A 3BQ2A 1ZAWA 1X4DA 4DDFA 4RNOA 4ZP8A 1VIXA 4R0JA 4NL5A 2FHJA 1UVLA 5D15A 2E5LI 4ZP7A 1Y3KA 1M1GA 4CIOA 1HNWI 1S16A 1U2FA 1WF1A 1TAQA 4DR6F 2ZD1B 1VRUA 5K8NA 4WUDA 4URQU 2HHSA 4X84A 3GCWP 3S1TA 1GEHA 3RGIA 1A9NB 3CD7A 4DV1J 5EDWA 1FRMA 5IWAJ 3KLGB 4KH1B 3LGHA 2H3EB 4PG7A 2H4YB 4ZPAA 4HH1A 3N4WA 3FRYA 5AJ3J 2EFQA 4HDGA 2BKNA 2WBRA 2M88A 3H5XA 4Q0BA 3GE9A 4ZA1A 3CB4A 4N8NA 1Z0BA 4HHUA 4LF4E 1RI7A 2UXBE 2ADCA 1IBLI 1OYEA 4M5GA 3B8HA 2VQFF 1WEZA 2DH8A 2AP6A 3TUJC 1NSQA 2E5LJ 3AA9A 5T14A 1TL4A 1HNWJ 3WU4A 3QNWB 4OJHA 3QT5A 3K2YA 1BHNA 2J9DA 2LMIA 3HJVA 1DTQA 4WP9A 3DDKA 4EBEA 1JLQA 1K47A 1OPIA 4B3SF 2X36A 2KJVA 4DQIA 2W4PA 2Y1RI 5DS7A 3CDJA 2ASLA 1UMJA 4ZVOB 1K1SA 3OLBA 1EKSA 4DV7I 1D0EA 4GC6A 4AL5A 1I94E 1IN0A 4P72A 1S6PA 2HQFA 1S6QB 1IBLJ 4Q43A 1DJ0A 3U1KA 3JAMC 4OX9E 4FWGA 2GIFA 1Y5NB 2UXDE 4USHA 4PU9A 5BYRA 2P6SA 3VV2B 2QFJA 2EI5A 1I3OB 1TKTA 2WW4A 1T0TV 1V5VA 2K06A 1HD1A 1XMQE 2AGQA 4R5PA 1TMJA 5D3GB 3FBEA 5LMUE 4H4KA 3W2VB 3T6JA 1V9OA 1Y4ZB 4RL1A 2AU0A 5L9XA 2ZOGA 2CQDA 3EVOA 2NS1B 1FRXA 1N0VC 1Q7LB 4FYYB 3OL6A 3EDRB 3U27A 3HHLD 2OEMA 1GMUA 3V6JA 3Q8VA 4DV7J 2QTWA 3Q8SB 4NOHA 3TJAA 4MFBA 1CLFA 4MK9A 4CLUA 4ALZA 2ASDA 2OO4A 1FCAA 3HZGA 4BWJA 4PWUA 3LF0A 4E0DA 4PRFA 3PVXA 1TKXA 4B3TI 1Y4UA 1VLYA 4Q8FA 2HIQA 1UVKA 5C2GA 4LF5E 1N33E 3CIZA 3LP2A 2XMJA 3FCWA 3UCUP 2W4DA 3TA2A 2GJ2A 2ADBA 5F8HA 2OFGX 4TLQA 1Q8IA 4JUZA 2C1EB 1CJUB 2X1FA 2BQRA 4NLYA 2ROGA 1ZPWX 3GWCA 4P2FA 3T1HE 2GW8A 1HMVA 2GGPA 4DV5E 3RR8A 2Z5EA 4AQYI 1O0PA 4I67A 3C3LA 1WF2A 2CQ3A 3KJVB 1UTAA 3IS9B 4NI2B 4JI4F 4DOZA 2CA9A 1RK8A 2GHVC 4JI0I 3KLEB 2ZM6F 3MR2A 4B3TJ 4JI3F 2ZUAA 3HKWA 2HS4A 4KAIA 1IJEB 1TUWA 4RBUA 2NN6F 4DUYF 3I56S 1PBAA 2AYEA 3UE2A 4X65F 3PS3A 1MWZA 1C0TB 1U1RA 2G0CA 3UI3A 1M0SA 1M1KT 2RMLA 2VFUA 2NXNA 4FF3A 1J5OA 4NZ7A 2SXLA 4Z2XA 2K7JA 4MT1A 4AQYJ 5JVGQ 4DR7I 1F9EB 2XULA 4B3RI 4LR8A 5KFOA 2F40A 1B3TA 3GV8B 4CH1A 3MPDA 4NPOA 2KYZA 2V9WA 1HYSB 2O66A 2C38B 3GIMA 1ZAVA 1R8PA 4TY9A 4JI0J 3LH2S 4WFZA 3FNNA 3U1LA 2HS0A 4JV1A 2MMYA 4WP8A 3M2UB 2B56A 1UWBA 1NK8A 3DRPB 4DQSA 2OTLS 4J7CA 3WIVA 2WP8A 5ETSA 1R89A 4IFYA 4XTTA 4ERDA 1W25A 4ECQA 1GXUA 2GO4A 2HWIA 2NYHA 2HURA 3LO3A 5C0XF 3CCVS 5KFVA 3D1OA 3QBCA 2R7OA 3ZZRA 1K73T 2HQIA 4NCGA 5KG1A 4DR7J 4B3RJ 2NN6D 4B3SI 1M5OC 4LRBA 1MROB 2J76E 4B3OB 4LF9I 2A0FB 1SKRA 1JJCB 2A2DA 1TL1B 3QGHA 5ETVA 2DIVA 1LWFA 2UZAA 4X4PA 2FHOB 3MD1A 4C0BA 4YHHE 1VFJA 1FTRA 2NR0A 3V81A 1H7WA 3PW2A 1ZOTA 5IC4B 3K8WA 3MAQA 5DRPA 2MJNA 1YBAA 4OYOA 1RYSA 2CKWA 2J0WA 4KKOB 4YQWA 1PAUB 1GX6A 2XG8A 3W8GA 3SQGB 3GJRB 1KHVA 3G82B 2IYGA 1U02A 2UXBF 4Q2LA 3HJCA 3T5LA 4DR5I 3LUYA 1SL0A 5H1SV 4EBDA 2E1RA 4E2FB 4X4OA 3MECB 3OT9A 4I7FB 3QZ8A 4B3SJ 5C7PA 1NK7A 2K3KA 4LF9J 1HNVA 5K14A 2CPJA 1SH0A 2OMOA 3K17A 5JEAD 3MD3A 4O4GA 4MK7A 3FCVA 4LBIA 2R2UA 5C0XD 3HK2A 3ENQA 1KFDA 2RS8A 4L76A 3EGVA 2K3IA 1JLFB 3QT6A 2ZWPA 3OHAA 2YKOA 4JI2I 1OQ6A 3AH6A 1X4GA 1B7YB 2M3DA 1N6QB 3TJ8A 3SMZA 2O3DA 5E2QA 4PXCA 2PO0B 5F9LA 4EU0A 2J6SA 3NS7B 1I94F 4LIWA 1UAWA 3UPFA 3K7RA 2Z5BB 3LOUA 3GMGA 2AD9A 4DR5J 1UETA 4RJVA 1DFDA 4L75A 4U6PA 2O1PA 4OX9F 2XI2A 2UXDF 3HD1A 3M05A 5C2CA 4UW2A 3MM8B 1HI1A 1ACMB 4JOUA 2VJVA 5D0GA 3QGPA 1HPZB 3N0VA 1XMQF 4FW9A 4QIFA 1FESA 2ZC4A 3VAGA 5LMUF 3JB9k 4W98A 3VZIA 4LF1A 5K9FA 2RHQB 4GMKA 2AW0A 5G0RA 1NB2A 4DLEA 4EBCA 3ITHB 3L7ZA 5ADZA 1IUJA 2DXFA 2ASJA 2HHPA 2DT9A 4M95A 5A8KB 4NCAA 5J1EA 4U8VA 2VV5A 3D54A 1ZAXA 4DZDA 4FPRA 3J7AG 1YH8A 5LL6R 2YKNA 1C1BB 3D68A 5G4DA 2C39A 3MEGA 1U49A 2GO8A 4DUYI 2OPRA 5IV4A 3AJDA 3V4MA 5CYMA 3N28A 1PYSB 2H54B 4IFVA 5HAOA 4I2PB 3AAWB 3QPIA 4LF5F 2DGOA 4K5SA 3SCKE 3T1AA 1HLWA 1N33F 1KRPA 2R7XA 1S1XB 1DRZA 1R0BG 1S5ZA 1UA1A 5ETTA 1JLAB 1Z5CA 1FKPB 2VFVA 2YNFB 4KYZA 3GJQB 1TAUA 2JLFA 5GVQA 4JBCA 4URSA 4Y6IA 2BJEA 1PJ7A 4J9PA 2W24A 5LMNI 2W7AA 8AT1B 1TL7A 2R7TA 3NRBA 1B63A 3T1HF 1JLCA 5HJXA 4DV5F 2HQGA 2AJ0A 3A8JA 2VPXB 4F2RA 4WFBQ 2LLZA 3LA0A 3HZEA 1URNA 1YRUA 2C3PA 4CNYA 2O1VA 1YQHA 4TVAB 4NE9C 1RT6B 2DNQA 5BJRA 4DUYJ 2HHTA 1B0VA 2EVZA 2IVMA 1JLGB 2XZTB 1RABB 3K8VA 3WX8A 3HJFA 4J9VA 4DR1I 1RT5A 2HFOA 3WU3A 3X3UA 2VA2A 5EN1A 5A2QU 4UZBA 1YJ9S 5D6GA 1OSDA 2V8PA 4DUTA 2Z30B 2WVFA 2GMLA 7FDRA 3LPSA 2JFDA 1CS4A 4DV3E 1F9FA 5LMNJ 2XYPB 1CJVB 4LREA 4OZ2A 3QYYA 2CDRB 2QYGA 3HSDA 1HBMA 3UN5A 4QWCA 2R2RA 2BVZA 4U8YA 3UN2A 1R0AA 1TMMA 4RLEA 5L8RC 1USUA 3C6UB 3W2WA 2ROEA 4WK1A 3BB5A 3TZWA 1BQMB 2VIHA 2QE5A 1UVJA 3LGMA 3CD5A 3PKMA 1VQOS 1U47A 4QYRA 4LF4I 2FJDB 3VHQA 4DR1J 4LR7A 4F67A 1R31A 1ZXMA 4HL9A 5B0GA 2OJ3A 2OPPB 2OPSA 2IVYA 3KK3B 4DV6I 5HQ8A 2RVJA 2ZFHA 4F0KA 2HNDA 1IJFB 2KXHA 1U0HB 3MTJA 4WE1A 4P75A 2R7UA 2GVDB 3BGLA 2V2VA 3I5BA 4N5SA 1VBYA 1C0UA 1S7IA 4MKVA 5HQLA 3CO9A 3CJQA 5LOQA 2LVWA 4USKA 4LSLA 3ILJA 3Q8YA 1RT3B 1K8AT 4ED4A 1B62A 2HEKA 1NDPA 1N5TA 2YQ0A 1F5BA 4MKYA 1GQEA 2ZJPQ 1I94I 2LU1A 4G1PA 2A18A 2HG4A 4FDFA 3MM9B 3PV8A 4LF4J 4DX6A 5H9EJ 2RKIA 5BYQA 4DV6J 2UXDI 2J0SD 2WZ1A 1SJQA 1RJJA 3EE3A 4ITSA 1XMQI 2XZWA 4JV5I 5DNLA 2UXCI 2VU5A 3CWJA 1RWKB 4I1TA 4A4JA 4GO7X 5LXYA 4LFBE 4H4OA 3JSRA 3OR1A 4ZHRA 3T5HA 2N4CA 2AYGA 1TKZB 4YB7A 1MWYA 4K4WA 2C2ZB 1YIJS 4MK8A 2VOOA 4MU3A 5KG0A 4ZN1A 4G6VB 4ATNA 1CULA 2HK3A 2NUUG 5F41A 1G4CA 5KFMA 1I94J 1Q53A 2HNZB 4USIA 1R6MA 4MU4A 3NMAA 2EKYA 1HNIA 5H9EK 3KHLA 2U2FA 1U1OA 5D4LA 1BUXA 2P6TA 3TAMA 1RWMB 3N5BA 2UXDJ 4GQUA 2V69A 3MM6B 3Q24A 2POKA 1XMQJ 2XGPA 4A46A 1LK7A 1RT4A 4LFAE 4LF5I 4JV5J 2MQMA 3M1VB 2KM8C 2IERA 2WRMA 2RRAA 4K50A 2UXCJ 2NZ4A 4GC7A 1KKHA 2MKSA 4YN3B 3AODA 5U47A 1FT8A 5FIIA 3M9OB 2ZBQA 3ZZUA 5L1LA 3DRRA 6FDRA 3RW7A 1CQMA 4CTAB 5CZVA 1XBWA 2C3UA 5BR8E 3QT7A 2FQQB 3T1HI 4ZCIA 3OVSA 3VWSA 2BACA 4H54A 2FJVA 2YKPA 5AXMA 5EL9A 3IN5A 3IBCB 2I6WA 3GSDA 3W5XA 3SFUA 3KHGA 3C66A 1PC5A 5J1NA 2DNNA 2VKRA 2ZBIA 2Q43A 5KFPA 2HFZA 3FSIA 1SCJB 4A8SA 2RF2B 4IZJD 1UEVA 1YJTA 4OZ5A 5KFDA 2FJAB 1GT8A 1MU2B 2D3O1 4LF5J 2CUYA 1N33J 4N47A 4CCHA
chains in the Genus database with same CATH topology
1N36I 4DV4I 4DPTA 3PYFA 1Z0WA 2GQ0A 1FJGE 4JI1I 2VQEI 3ZKBA 4DPXA 1IBME 4DUZE 5BR8I 1H7SA 3J81C 1HNZI 4B3ME 2HHHE 2NPFA 1KTVA 2Z5CB 4DR4I 3ZZTA 4PRXA 1MX0A 4LF8I 1Z5CA 3QT8A 1KIJA 4DU8A 4DR1E 1FWKA 3T1HE 4FN5A 4DV5E 4HACB 4LF6I 2Z5EA 4JI4E 4DU7A 4AQYI 2GS8A 4JI7I 4UT4A 1N34I 2VF3A 1Y6ZA 5LMNI 1NHJA 1B63A 3D4JA 1Z0VA 2ZM6E 1RREA 4HY1A 2OI2A 3OTOI 1EI1A 1J5EI 2O1WA 4JI3E 1NZ0A 1Y4SA 4UTGA 4B3RE 1N33I 4KHPI 3ZM7A 4JI0I 2O1VA 3GONA 4DUYE 4Z7CA 1FJGI 1ZM4A 5IWAE 1IBMI 4DR3E 1PVGA 5A2QQ 4DUZI 1IBKI 2HHHI 4IZKA 3PYEA 4FWHA 4URLA 1N36E 2HFUA 4JI1E 2VQEE 2BV3A 1VISA 4DR1I 1A6FA 1N32I 2R3VA 4DV5I 3WU6A 4JI4I 4P7AA 4WUBA 3WU3A 5FLXC 1HR0I 1Z5AA 2PNMA 1MU5A 2ZM6I 2V8PA 4AQYE 4JI3I 4JI7E 1Z0EA 1N34E 4DR7I 4DV6E 3LPSA 5LMNE 2LJPA 4DV3E 4JI5I 4B3RI 3P06A 2UUAE 2UUBI 2HFSA 2DEJA 3WU5A 4ZVIA 1J5EE 3J81Q 2DEIA 4DPUA 3B82A 1HNWE 2O1UA 4DV1I 5IWAI 4X65I 1RR9A 2XEXA 2V2ZA 4LF9E 4JI8I 1H7UA 1USUA 4YHHI 3JAMQ 4RPFA 1NHHA 1IBKE 1XNRI 2X7IA 2UUCI 3LTOA 5IT9C 4LF4I 1N32E 2V34A 3PRYA 4DV2I 1ZXMA 3ZKDA 1ZM3A 1HR0E 4DR6E 4DV6I 4DV3I 4JI6I 2UUAI 4PRVA 2E5LI 1N0UA 2A2CA 4NXMI 3K85A 1HNWI 1S16A 4DR7E 2Q2EB 4JI5E 4N3OA 4WUDA 4DXLA 2UUBE 4GKJI 4B3SI 4I3HA 4IZJA 4DR5E 2V2VA 3T1YI 4LF9I 5GMDA 1D6TA 1NHIA 4HYMA 2A2DA 2AJ4A 4DV1E 3V5RA 5FWKA 4X66I 1PKPA 4LFBI 4X65E 4JV5E 2HKJA 2UXCE 4JI8E 4YHHE 3J7AM 4USKA 4ED4A 1B62A 3CWVA 4USMA 1XNRE 2R42A 1HNXE 4LFCE 2UUCE 3Q6MA 4R1FA 5GMEA 2VQFE 1XMOI 1H73A 1I94I 4DR6I 1Z0BA 4LF4E 2UXBE 5L3JA 1IBLI 4LF7I 4X62I 4DR2I 1ZM9A 4DV2E 4JI2E 3Q6NA 3J80Q 3F0NA 3B8HA 3B78A 2F4VE 3LNUA 4EMDA 4JI6E 2Z5CA 2UXDI 3HJCA 2E5LE 1H72C 4DR5I 4MYTA 1DARA 4NXME 4JYAI 2E1RA 1XNQE 3WU4A 1XMQI 1FKAE 4IZKB 3QT5A 4HACA 1Z0TA 4DPYA 4JV5I 4B3SE 4GKJE 4K0KI 3T1YE 2UXCI 2Z5BA 2UU9I 4X66E 1FWLA 3K17A 4LFBE 3Q1QA 1K47A 1HNXI 4LFCI 2IOPA 2EFGA 2X36A 1PIEA 2VQFI 1FI4A 2HK2A 4X64E 1ZM2A 2UXBI 4NXNE 3PYGA 3QT6A 4YY3E 4JI2I 4DV7I 2O1TA 1XMOE 1I94E 2HK3A 2F4VI 4KQVA 2BM1A 1IBLE 4LF7E 4X62E 2BM0A 1ELOA 4DR2E 2ZITA 3JAMC 4OX9E 1XNQI 4FWGA 2J7KA 2UXDE 1UEKA 4PU9A 3H4LA 2Z5BB 1USVA 4DV0E 2WW4A 1Z0CA 4JYAE 4FWDA 1XMQE 4MYUA 1FNMA 5FLXQ 4LFAE 4LF5I 5LMUE 4K0KE 3ZZ0A 3V2UC 2V2QA 2PNLA 4P52A 1EA6A 4B3TE 2UU9E 3HULA 1KKHA 4X64I 4NXNI 3M6AA 4FW9A 1XHKA 4YY3I 1U2RA 4DPWA 4GKKE 4B3MI 1Z5BA 1N0VC 3ZZUA 2ZBKB 4JG4A 4DV4E 2IOQA 4Z7YA 2HKEA 3QT7A 5BR8E 3T1HI 4DV7E 1MG7A 1HNZE 1KVKA 1H74A 4OX9I 4DR4E 2CGEA 4IZJB 5A2QC 4LF8E 2CG9A 1WUUA 4DV0I 4XTJA 1Z0GA 4LF6E 1Z59A 3PYDA 1ZXNA 5IT9Q 4LFAI 5LMUI 3J7AG 4WUCA 4IZJD 3K1JA 5LL6R 1QZRA 4B3TI 1Y4UA 3OTOE 4HXZA 2CZ9A 1BKNA 4DUYI 4LF5E 1S4EA 1N33E 4KHPE 4DR3I 4JI0E 1OJ4A 4GKKI 4M1KA 3J80C 1HK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 I;  4DV4 I;  4DPT A;  3PYF A;  1Z0W A;  1FJG E;  4JI1 I;  2VQE I;  3ZKB A;  4DPX A;  1IBM E;  4DUZ E;  5BR8 I;  1H7S A;  3J81 C;  1HNZ I;  4B3M E;  2HHH E;  2NPF A;  1KTV A;  4DR4 I;  3ZZT A;  4PRX A;  1MX0 A;  4LF8 I;  1Z5C A;  3QT8 A;  1KIJ A;  4DU8 A;  4DR1 E;  1FWK A;  3T1H E;  4FN5 A;  4DV5 E;  4HAC B;  4LF6 I;  4JI4 E;  4DU7 A;  4AQY I;  2GS8 A;  4JI7 I;  4UT4 A;  1N34 I;  2VF3 A;  5LMN I;  1NHJ A;  1B63 A;  3D4J A;  1Z0V A;  2ZM6 E;  1RRE A;  4HY1 A;  2OI2 A;  3OTO I;  1EI1 A;  1J5E I;  4JI3 E;  1NZ0 A;  4UTG A;  4B3R E;  1N33 I;  4KHP I;  3ZM7 A;  4JI0 I;  3GON A;  4DUY E;  4Z7C A;  1FJG I;  1ZM4 A;  5IWA E;  1IBM I;  4DR3 E;  1PVG A;  5A2Q Q;  4DUZ I;  1IBK I;  2HHH I;  3PYE A;  4FWH A;  4URL A;  1N36 E;  2HFU A;  4JI1 E;  2VQE E;  2BV3 A;  1VIS A;  4DR1 I;  1A6F A;  1N32 I;  2R3V A;  4DV5 I;  3WU6 A;  4JI4 I;  4P7A A;  4WUB A;  3WU3 A;  5FLX C;  1HR0 I;  1Z5A A;  1MU5 A;  2ZM6 I;  2V8P A;  4AQY E;  4JI3 I;  4JI7 E;  1Z0E A;  1N34 E;  4DR7 I;  4DV6 E;  3LPS A;  5LMN E;  2LJP A;  4DV3 E;  4JI5 I;  4B3R I;  2UUA E;  2UUB I;  2HFS A;  2DEJ A;  3WU5 A;  4ZVI A;  1J5E E;  3J81 Q;  2DEI A;  4DPU A;  3B82 A;  1HNW E;  4DV1 I;  5IWA I;  4X65 I;  1RR9 A;  2XEX A;  2V2Z A;  4LF9 E;  4JI8 I;  1H7U A;  4YHH I;  3JAM Q;  4RPF A;  1NHH A;  1IBK E;  1XNR I;  2X7I A;  2UUC I;  3LTO A;  5IT9 C;  4LF4 I;  1N32 E;  2V34 A;  4DV2 I;  1ZXM A;  3ZKD A;  1ZM3 A;  1HR0 E;  4DR6 E;  4DV6 I;  4DV3 I;  4JI6 I;  2UUA I;  4PRV A;  2E5L I;  1N0U A;  2A2C A;  4NXM I;  1HNW I;  1S16 A;  4DR7 E;  2Q2E B;  4JI5 E;  4WUD A;  4DXL A;  2UUB E;  4GKJ I;  4B3S I;  4I3H A;  4DR5 E;  2V2V A;  3T1Y I;  4LF9 I;  5GMD A;  1D6T A;  1NHI A;  4HYM A;  2A2D A;  2AJ4 A;  4DV1 E;  3V5R A;  4X66 I;  1PKP A;  4LFB I;  4X65 E;  4JV5 E;  2HKJ A;  2UXC E;  4JI8 E;  4YHH E;  3J7A M;  4USK A;  4ED4 A;  1B62 A;  3CWV A;  4USM A;  1XNR E;  2R42 A;  1HNX E;  4LFC E;  2UUC E;  4R1F A;  5GME A;  2VQF E;  1XMO I;  1H73 A;  1I94 I;  4DR6 I;  1Z0B A;  4LF4 E;  2UXB E;  5L3J A;  1IBL I;  4LF7 I;  4X62 I;  4DR2 I;  1ZM9 A;  4DV2 E;  4JI2 E;  3J80 Q;  3F0N A;  3B8H A;  3B78 A;  2F4V E;  3LNU A;  4EMD A;  4JI6 E;  2UXD I;  2E5L E;  1H72 C;  4DR5 I;  4MYT A;  1DAR A;  4NXM E;  4JYA I;  2E1R A;  1XNQ E;  3WU4 A;  1XMQ I;  1FKA E;  3QT5 A;  4HAC A;  1Z0T A;  4DPY A;  4JV5 I;  4B3S E;  4GKJ E;  4K0K I;  3T1Y E;  2UXC I;  2UU9 I;  4X66 E;  1FWL A;  3K17 A;  4LFB E;  3Q1Q A;  1K47 A;  1HNX I;  4LFC I;  2EFG A;  2X36 A;  1PIE A;  2VQF I;  1FI4 A;  2HK2 A;  4X64 E;  1ZM2 A;  2UXB I;  4NXN E;  3PYG A;  3QT6 A;  4YY3 E;  4JI2 I;  4DV7 I;  1XMO E;  1I94 E;  2HK3 A;  2F4V I;  4KQV A;  2BM1 A;  1IBL E;  4LF7 E;  4X62 E;  2BM0 A;  1ELO A;  4DR2 E;  2ZIT A;  3JAM C;  4OX9 E;  1XNQ I;  4FWG A;  2J7K A;  2UXD E;  1UEK A;  4PU9 A;  3H4L A;  4DV0 E;  2WW4 A;  1Z0C A;  4JYA E;  4FWD A;  1XMQ E;  4MYU A;  1FNM A;  5FLX Q;  4LFA E;  4LF5 I;  5LMU E;  4K0K E;  3ZZ0 A;  3V2U C;  2V2Q A;  4P52 A;  1EA6 A;  4B3T E;  2UU9 E;  3HUL A;  1KKH A;  4X64 I;  4NXN I;  3M6A A;  4FW9 A;  1XHK A;  4YY3 I;  1U2R A;  4DPW A;  4GKK E;  4B3M I;  1Z5B A;  1N0V C;  3ZZU A;  2ZBK B;  4JG4 A;  4DV4 E;  4Z7Y A;  2HKE A;  3QT7 A;  5BR8 E;  3T1H I;  4DV7 E;  1MG7 A;  1HNZ E;  1KVK A;  1H74 A;  4OX9 I;  4DR4 E;  5A2Q C;  4LF8 E;  1WUU A;  4DV0 I;  4XTJ A;  1Z0G A;  4LF6 E;  1Z59 A;  3PYD A;  1ZXN A;  5IT9 Q;  4LFA I;  5LMU I;  3J7A G;  4WUC A;  3K1J A;  5LL6 R;  1QZR A;  4B3T I;  3OTO E;  4HXZ A;  2CZ9 A;  1BKN A;  4DUY I;  4LF5 E;  1S4E A;  1N33 E;  4KHP E;  4DR3 I;  4JI0 E;  1OJ4 A;  4GKK I;  4M1K A;  3J80 C; 
#chains in the Genus database with same CATH topology
 1X9M A;  3BGO P;  1QDU B;  5D4N A;  4C8O A;  4M94 A;  1TEL A;  4ES3 A;  3HHE A;  2HHH E;  1MX0 A;  1NU4 A;  3QT8 A;  1HQU B;  1FWK A;  2BJ9 A;  1H2U X;  3IXQ A;  2HBR B;  4KFB B;  2CPX A;  2GA7 A;  3T1H J;  1KR4 A;  4U3B A;  3OTD A;  1Y5Y A;  4Y65 A;  3I31 A;  4EK2 A;  4C11 B;  1N88 A;  3P8B B;  4KH0 B;  1NXI A;  2HQD A;  3D4J A;  2AYB A;  2MEW A;  1B0T A;  2OI2 A;  1OWX A;  4OHX A;  1XR6 A;  1Y4S A;  1IKX A;  4DZ6 A;  1DLO B;  1RHM B;  4QR1 A;  3GON A;  4AE5 A;  1UVI A;  5E3R A;  1YJU A;  2IA0 A;  1S6U A;  2BKP A;  4KIA A;  5KFF A;  2ABY A;  5HO4 A;  3IWX A;  4ECR A;  1IM6 A;  3MHY A;  1SUQ B;  1FA0 A;  3NGT A;  5HBM B;  3OL8 A;  4ZJO A;  2QL7 B;  4HVZ A;  5A8R B;  3EPI A;  2K2P A;  2CJY B;  5ETP A;  2QL5 B;  1JLE B;  2MLZ A;  2LQ9 A;  2CPH A;  5KFX A;  2D9O A;  2PSZ A;  5HRO A;  5C25 B;  3SV3 A;  2UUC F;  4JI7 E;  5CCL A;  1PSD A;  1N34 E;  4AUK A;  3GJT B;  2HFS A;  2VG7 A;  3LGN A;  5J2N B;  2HAI A;  1IQT A;  3BDE A;  4C8Z A;  1LW0 A;  1CC7 A;  4DV3 F;  2E9T A;  2XEX A;  1L3T A;  4LOM A;  4YHH I;  1XIQ A;  3L4B C;  1PG5 B;  4WTY A;  4DL2 A;  2CQ4 A;  4YOE A;  3D1H A;  2MQL A;  3H59 A;  4X66 F;  4A8X A;  3QJL A;  5D8H B;  2ZJQ Q;  2AZ1 A;  4AL7 A;  1XR7 A;  3NL0 A;  3C6T A;  4QWE A;  2RQK A;  3P3C A;  2ZH3 A;  3FFI A;  2I0X A;  3WBZ A;  2Q3P A;  3OJU A;  2DVI A;  3EZ5 A;  4B9S A;  2HSE B;  4OKG A;  4IZJ A;  4FNI A;  2ZWO A;  5ELW A;  1BQN B;  4DL5 A;  1X4C A;  1FDD A;  2M0G B;  3I87 A;  3RBE A;  4DL0 C;  4ECV A;  1E6Y B;  2Y8W A;  4FZV A;  1URR A;  4WFN Q;  4YHH J;  3P5B P;  4F8R A;  1RWP B;  3DLL Q;  1CG2 A;  5DJB A;  2VFT A;  1SQE A;  2JVR A;  1CSJ A;  1GTE A;  1TP7 A;  3HT0 A;  4CP5 A;  3DMJ B;  4A48 A;  2M5Y A;  4NBQ A;  1KP6 A;  4M8L A;  2C3Y A;  1YSJ A;  3CCU S;  2XMW A;  4NLU A;  4AFF A;  1IWG A;  4DMZ A;  5DQH A;  3CDI A;  4O3O A;  3M30 B;  2YWE A;  2C2K B;  2E9R X;  4ILM A;  1NUE A;  3Q8Q B;  3PS2 A;  2HVH A;  5K36 E;  3M6W A;  5IQ6 A;  2CPZ A;  3C15 A;  4ZVG A;  3DLG A;  2EPI A;  3R2C J;  1RKI A;  1RBA A;  4EUV A;  3MOZ A;  3UD4 P;  1W2B R;  3ZC4 A;  1OQ3 A;  1FWL A;  2DRB A;  2EC2 A;  3K5P A;  4ZVH A;  5L1J A;  1WC4 A;  1Y5L B;  2R8J A;  2KXF A;  1FI4 A;  3EUN A;  3DFE A;  3NAH A;  4X64 E;  1M5K C;  3TNV A;  4LFB F;  5J2P B;  4YB5 A;  4N56 A;  4YY3 E;  4AID A;  1XMO E;  2GAH C;  1GMW A;  5KFT A;  3CCM S;  2ZEJ A;  3BGF A;  2FLL A;  2FC9 A;  1U7L A;  1TL3 A;  1UEK A;  1QE1 A;  1Z1Z A;  1FTC A;  2FJB B;  5LSL A;  1RGV A;  2AEJ A;  4HHH A;  3BO4 A;  4BC7 A;  1V3Z A;  4JYA E;  4CQ1 A;  5EUH A;  3MOJ B;  1E6V B;  4ID5 B;  4MH8 A;  1WC5 A;  3ZZ0 A;  1OMS A;  1TTH B;  3W63 A;  1RWN B;  1F9H A;  3MED A;  3I0S A;  4TXS A;  2XWX A;  4LFA F;  4GKK E;  3MUV P;  3K89 A;  4FKX A;  4A47 A;  1Q16 B;  2F9D A;  2CPF A;  3D6T B;  4ZLP A;  4Z37 A;  4K4Z A;  2ALZ A;  1VRU B;  4MQY A;  2MZQ A;  4NA1 A;  4LF8 E;  1FKO A;  1QVF R;  5ETN A;  1LQ9 A;  1IR2 A;  5BR8 F;  1UFL A;  3TOQ A;  3IRX A;  2GVZ A;  1BQX A;  5JJB A;  3J7A 1;  2DRD A;  1TV6 A;  4KPC A;  1EX8 A;  5E0O A;  2D41 A;  2IRX A;  3QAT A;  1BKN A;  2BR2 A;  2WSE C;  4Q0B B;  1YHQ S;  3CCQ S;  4FS1 A;  2CPY A;  2PDA A;  3O6Q A;  5DRQ A;  3NMR A;  4C8L A;  4DUZ E;  4CLS A;  4NRT A;  1Y0H A;  2AF6 A;  1V5I B;  1NKB A;  1FVQ A;  2LXI A;  2VAS A;  3J80 Y;  3CCE S;  1B64 A;  2XCA A;  1VQ8 S;  1WD6 A;  4ZPT R;  5KG6 A;  2B4O A;  3TVZ A;  2I8E A;  2DNH A;  2HHH F;  2BA1 D;  1NRK A;  4OO1 A;  2GS8 A;  1N5V A;  2N7C A;  1KBR A;  4DL3 A;  2MZT A;  1HBU A;  1JLQ B;  3SV4 A;  2DNP A;  4NZ6 A;  2HPU A;  4OHW A;  2JC1 A;  4BS2 A;  1SIZ A;  4IFD A;  2ZVS A;  3R1H A;  4WII A;  1NJW A;  4MKB A;  3OSP A;  3ZNJ 1;  5EKW A;  2RNE A;  4WTO B;  2I5J A;  1S6P B;  2MJU A;  1IWA A;  4Y0F A;  1N5S A;  3ISZ A;  4MU1 A;  4JI1 E;  2HRY A;  4Q8E A;  3NWG A;  4RW9 A;  4RNM A;  4QCL A;  2NUH A;  1TL5 A;  4LCH A;  5FLX C;  1TKT B;  2KM8 B;  2G1H A;  4R5P B;  2CXE A;  4IQX A;  1TUG B;  2G0J A;  5EX3 A;  3EIC A;  4B9T A;  2OPQ A;  2GC8 A;  4DV3 J;  3H2L A;  3VAK A;  3WU5 A;  3H2U B;  4G3I A;  1UFK A;  4LSZ B;  2XO7 A;  2JT2 A;  3B82 A;  2V8V A;  4JI7 F;  4OZ3 A;  2L08 A;  1N34 F;  2ZC3 A;  3V4I A;  2C2D A;  3CCR S;  2DO4 A;  2BUN A;  3M9M B;  3ILL A;  3PRB A;  2AE8 A;  4B08 A;  3EGW B;  5KAK A;  2D1C A;  2WSC C;  4TU9 A;  3T1Y F;  4P74 A;  5L38 A;  1IBC B;  2KFY A;  2BQ3 A;  4K4U A;  4K7Q A;  4MFB B;  3CMA S;  1P27 B;  2KU7 A;  4LRF A;  1N32 E;  5DO2 A;  1OS5 A;  1UP1 A;  3OTC A;  4QOT A;  2E1P A;  1TKX B;  4ZVS B;  4DN0 A;  4ZOS A;  3JTP A;  4RW4 A;  1M1H A;  4WU3 A;  2XY7 A;  4PRV A;  2B8Q A;  2RJZ A;  2A2C A;  2FDN A;  4KE5 A;  4KHR A;  3RBZ A;  3LP2 B;  4KB7 A;  4FP9 A;  4WYL A;  2BE7 D;  1UFW A;  5GAE U;  2GAG C;  5A0Y A;  4X62 F;  2XZD B;  4OZJ A;  3OSN A;  4ZP9 A;  1NHI A;  3MR3 A;  1VJW A;  4LFB I;  5IXU A;  2BX6 A;  1AUS L;  2MZR A;  2JVO A;  1HMV B;  2GGP B;  4ZLJ A;  4IUF A;  4QIE A;  2GQ2 A;  2CPD A;  3MPU B;  2OML A;  5MAO A;  4AIM A;  3EDQ B;  5D0E A;  3J80 Q;  1RP5 A;  3F0N A;  1Q5Y A;  3H7H B;  2IRU A;  3AB2 B;  5AXK A;  1Y9O A;  2E7X A;  4FF4 A;  2NXE A;  2UV8 G;  2RD5 C;  5K20 B;  2EKN A;  3CJR A;  3PNI A;  2WK4 A;  4RUA A;  2DGX A;  2EW9 A;  2OKQ A;  3MGJ A;  3W7B A;  3F73 A;  2GCF A;  4ED0 A;  4PG4 A;  4EFA C;  3DYA A;  3MTK A;  4LFB J;  1H3D A;  1NCL A;  2JNJ A;  3O3L A;  1L3U A;  2H65 B;  4MTP A;  1G6B A;  3CC7 S;  1J5O B;  2XMK A;  2M8H A;  3HSZ A;  4OQJ A;  3PHT A;  4G1Q A;  4X64 F;  4LF7 E;  1QSL A;  4YY3 F;  2VD3 A;  4F26 A;  2DGQ A;  3NNA A;  1XMO F;  2B4V A;  1AYE A;  1WKK A;  1RKJ A;  1JJ4 A;  2DHA A;  1J27 A;  2JRS A;  2V94 A;  1UWB B;  2YXL A;  3OFE A;  1G1X A;  1RTH A;  3V2U C;  4DFK A;  3OR2 A;  2MKH A;  4IDK A;  2WP8 B;  3ZTO A;  1VQS A;  3HHL B;  4IFY B;  2PO1 A;  4DFJ A;  2CYY A;  2QN6 B;  1U2R A;  5K8O A;  1VQ6 S;  3AQO A;  2QMU B;  4OX6 A;  2CAD A;  2RUS A;  1TKD A;  2EWH A;  1GK8 A;  4ZCK A;  2Z0G A;  2LEC A;  1MG7 A;  3RG6 A;  4NCG B;  1H74 A;  4GKK F;  4TY8 A;  3BPS P;  1HWI A;  2Y0S D;  1T02 A;  2WHO A;  2DNL A;  2CPI A;  4C97 A;  5E3P A;  1LWF B;  4LF8 F;  3V81 B;  2W8K A;  3ULH A;  4WCE Q;  5KOX A;  4PZV A;  4NYZ A;  4KHP E;  3HD2 A;  1WAC A;  2C2R A;  4CI0 B;  2D3O R;  3RR7 A;  4DPT A;  3PS1 A;  2JOQ A;  4B3M E;  2NPF A;  1KTV A;  1HWK A;  4DR4 I;  4NA2 A;  3VGT A;  1SL1 A;  3R5A A;  1IR1 A;  3US5 A;  4TQS A;  1YDL A;  4DUZ F;  3M85 G;  4LF6 I;  4OV6 A;  3J81 Y;  2C3M A;  2AZ3 A;  2VG6 A;  3V6K A;  3DLE A;  4JI7 I;  4LUB A;  1MWQ A;  1N34 I;  1HNV B;  1Y6Z A;  3LPE A;  4KGV B;  5K14 B;  2ZH8 A;  2NPI A;  2ZH7 A;  4HDH A;  5FD1 A;  4O4G B;  4OHV A;  2PD1 A;  5K8P A;  4QR0 A;  1S4F A;  4K4X A;  2HRU A;  5IWA E;  1IBM I;  2YKM A;  1CC8 A;  1S49 A;  3P3D A;  4U7C A;  1SL2 A;  3I96 A;  2ATL A;  2VQE E;  4DF4 A;  2FZK B;  3G8T A;  2W9C A;  4DR4 J;  5DM6 Q;  4EO6 A;  3MR6 A;  3ETM A;  5KT6 A;  3H1C A;  4JI1 F;  1IR0 A;  4RW7 A;  4LF6 J;  2XI3 A;  4ED2 A;  1D9A A;  4JI7 J;  1N34 J;  3P06 A;  4UUW A;  3RB0 A;  3VQT A;  3U7J A;  1HNW E;  3QLH A;  2JDJ A;  2F63 A;  5CQG A;  3D7S B;  1H7U A;  5G0R B;  4F02 A;  1UDQ A;  2OHD A;  1IBM J;  3CCJ S;  3L7Z B;  4P7V A;  3SDE A;  3GII A;  3DGP B;  4F4W A;  4CO5 A;  2VB6 A;  2JJ4 D;  1VQL S;  5CHC B;  5J1E B;  2YNI A;  1VQ5 S;  4HT7 A;  2XMM A;  1H2V Z;  2YKN B;  4CLP A;  2UUA I;  3PO4 A;  5K36 A;  1N32 F;  3GIK A;  3MEG B;  4MMO A;  2B6A A;  2C39 B;  1RYR A;  2J6U A;  1MMD A;  2OPR B;  2HBQ B;  2MXY A;  4PCQ A;  5GAD I;  2VG5 A;  5CYM B;  2DD8 S;  1WI6 A;  4IFV B;  3MWB A;  4DHV A;  1RWX B;  5GMD A;  5FDL A;  2VOD A;  4ED1 A;  2PEH A;  1WWH A;  2V68 A;  4CLL A;  3GYX B;  5AE2 A;  4F4X A;  2QSF A;  2ACY A;  3IR7 B;  5HMX A;  4JI8 E;  3I82 A;  4ZVU B;  2ZOF A;  3ZZZ A;  1JXL A;  3PW7 A;  5BXI A;  4F3Q A;  2B43 A;  2DR8 A;  4R1F A;  5B0A A;  4DS4 A;  5KG7 A;  3VZH A;  1XMO I;  1TL7 B;  1I6J A;  1JLC B;  2DCU B;  2DR9 A;  1QAY A;  5E3C A;  2HZV A;  1RTZ A;  4TYB A;  4QIW D;  1RAI B;  7AT1 B;  4JI6 E;  1VHF A;  2WVC A;  2UUA J;  4A8F A;  4LQ9 A;  4C48 A;  1DAR A;  2JFK A;  3MFH A;  4JYA I;  3TP2 A;  3NCP A;  3MCM A;  1FO1 A;  2BYC A;  4MIB A;  1VQ9 S;  4HAC A;  4FPI A;  4ED5 A;  2LKZ A;  2UUT A;  3GFH A;  3DCA A;  3O5T B;  2HVD A;  2IMO A;  1RT5 B;  1RT2 A;  2YTC A;  1Q81 T;  3E3X A;  3Q1Q A;  1WC3 A;  4V1A k;  4ETX A;  1X5T A;  1IKY A;  3CCL S;  1PIE A;  3KOA A;  1E3H A;  2OH2 A;  3JS9 A;  3N6L A;  2UUW A;  1FFG B;  3RZA A;  2DBB A;  1CS4 B;  3GCM A;  1P8G A;  2ZZN A;  1S9E A;  1XMO J;  2XMU A;  2RDI A;  4DR2 E;  5CD4 A;  1VIO A;  3H5U A;  4NML A;  2PO4 A;  1X8D A;  1HBM B;  3LQV A;  4PAA A;  4LCG A;  2ZHA A;  2LQ5 A;  3W5Y A;  1R0A B;  1RAH B;  1YRX A;  3VGU A;  3W2W B;  2CQ0 A;  2HGL A;  3PW5 A;  5DM7 Q;  4JYA J;  2MQO A;  2B4P A;  3ZTQ A;  2BR0 A;  2R7Q A;  4B3T E;  2IBO A;  5D0R A;  2OPS B;  1WNE A;  4IRC A;  2XS7 A;  4WIQ A;  2VH7 A;  3HDS A;  4YME A;  3TO8 A;  2AQ4 A;  1Z5B A;  4P7T A;  4OHZ A;  4UQT A;  2ZOM A;  2HND B;  3FJ2 A;  3FSX A;  1FEH A;  5D78 A;  4B9V A;  4RUC A;  1S9G A;  4WE1 B;  3CED A;  1S0V A;  3Q2S C;  3CDU A;  4NLW A;  1C0U B;  2A6O A;  4EO8 A;  1KSP A;  4U7U K;  2CQP A;  2MHN A;  4LSL B;  2XLK A;  3NNH A;  4WUC A;  1I51 B;  2HS3 A;  3A8K A;  3T9N A;  2IBK A;  3FQL A;  4KRW A;  1VBK A;  3BGU A;  1PYT A;  1SKW A;  2MY7 A;  4JI0 E;  3NS5 A;  5D77 A;  3BPD A;  9ATC B;  4DL4 A;  1IVZ A;  4DV4 I;  5I42 A;  4JI1 I;  2RKI B;  1FX2 A;  4KHP F;  4NX9 A;  4QWB A;  4IH5 A;  3R27 A;  3GR0 A;  4LCF A;  3KLF A;  3VVT A;  4M63 A;  3NG8 A;  3TEH B;  5KFY A;  1YRT A;  4WU2 A;  4G65 A;  3M9N B;  3TX0 A;  1HL6 A;  8ATC B;  2UVV A;  3HM9 A;  3GYN A;  2V67 A;  4RR5 A;  2DIT A;  4OO1 C;  4H4O B;  3PJ9 A;  4ZHR B;  3OR1 B;  3OTO I;  4W4M A;  1SQF A;  4B3R E;  1P42 A;  2CRL A;  3ILO A;  3P96 A;  4ZK7 M;  3TW0 A;  3M6U A;  3E01 A;  2XYG B;  2XTJ P;  1S1W A;  1CUL B;  4DR3 E;  2DNZ A;  4IFD C;  1FDN A;  1F5A A;  5LSO A;  1MMN A;  1HNI B;  3QGI A;  1HW9 A;  2VUG A;  3M7V A;  4DV4 J;  4DV1 F;  2DIS A;  4JI1 J;  1N32 I;