3PYEA

Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
301
structure length
301
Chain Sequence
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title The Structural Basis for anti-TB Drug Discovery targeting of 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (IspE) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 86
structure length 301
sequence length 301
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3pyeA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3pyeA01
1N33E 4K0KE 5A2QQ 2HKEA 4X62I 1KTVA 3ZKBA 4X64E 1UEKA 5LMUI 2ZM6E 4DPXA 4DR5I 2R42A 1FWLA 4JYAI 4JI4E 3T1YI 2VQEI 4DR1I 3OTOI 4LF4I 4B3ME 4URLA 2Q2EB 4LF9E 1IBLE 1MU5A 1Z0GA 2UUBI 2UXBI 1FJGI 3LNUA 1Z0TA 1XNQE 2ZITA 1NZ0A 4X65E 1PIEA 4JI7E 2HKJA 1NHJA 4JI5E 4JI6I 2UU9E 4LFCI 3WU5A 4DUZI 4M1KA 4DU8A 1WUUA 4YY3E 4R1FA 1ZM4A 1IBKI 4NXMI 1XMOE 1KVKA 1N34E 3QT5A 2UXDE 2BM0A 1Z0VA 1XMQI 4LFAI 4DUYE 2V34A 5LMNI 1QZRA 1Z0BA 4MYUA 2BV3A 3T1HE 1Z5BA 4LF6E 1A6FA 1RREA 4B3TI 3ZM7A 1H73A 1S4EA 1K47A 1MX0A 1U2RA 4DV6E 2UUAI 5IT9C 4RPFA 4B3RE 3J81C 3LTOA 3QT8A 1HR0I 4NXNI 1KKHA 4JI0E 1Z5CA 3PYGA 1B63A 2HFSA 4GKJI 4JG4A 4JV5I 4PRVA 4P7AA 2V2ZA 1FKAE 1HNWE 2A2CA 4LFBE 4DPTA 4DU7A 4YHHI 4DR6E 4DV3E 5IT9Q 4DR3E 1S16A 4DPUA 4I3HA 3K1JA 3M6AA 4DV2E 1BKNA 3H4LA 2ZBKB 1RR9A 2F4VE 4JI1I 4GKKI 3WU3A 1HNZE 1XHKA 4DV0E 1N33I 1DARA 4K0KI 4DR4E 2A2DA 1D6TA 4B3SI 1H74A 4UT4A 4WUBA 3CWVA 4X62E 3JAMC 1PKPA 3ZZTA 5LMUE 5BR8I 4HY1A 2DEJA 2CZ9A 2HFUA 2OI2A 4JYAE 3T1YE 1IBLI 4LF8E 2UXCE 3OTOE 1N36I 4LF4E 3HULA 4AQYI 3GONA 1J5EI 4USKA 4WUDA 2LJPA 4JI2I 4JI7I 5IWAE 2UXBE 1HNXI 1FJGE 4KHPE 4Z7CA 2UU9I 4Z7YA 4LF7I 2HK3A 2GS8A 2E5LE 4JI6E 2HK2A 1Z59A 4YY3I 4LFCE 4DUZE 3QT7A 4JI8E 3PYEA 1PVGA 4OX9I 1KIJA 5LL6R 4NXME 4DR7E 5FLXC 4DUYI 1FNMA 5GMEA 4DR2E 2V2VA 4KQVA 4LFAE 2VQFE 1XNRI 1FWKA 4LF6I 5LMNE 4FW9A 3LPSA 1N32I 4USMA 2UUCI 4LF5I 4B3RI 4DV4I 4B3TE 3B8HA 4HACB 2HHHI 2UUAE 4DV7I 4JI0I 5FLXQ 1HR0E 1I94I 2EFGA 5L3JA 4JV5E 4JI3I 4DV1E 3J81Q 5A2QC 1IBMI 1Z5AA 4YHHE 2X36A 3ZZUA 1NHHA 4X66E 4PRXA 4P52A 2F4VI 1ZM3A 2J7KA 1HNZI 1H72C 3ZKDA 4DV5E 1OJ4A 4X64I 4JI1E 3V2UC 2ZM6I 4GKKE 4DXLA 3B78A 4JI4I 1ELOA 1VISA 3QT6A 2XEXA 4B3SE 4DR5E 4B3MI 1Z0CA 4LF9I 2VQEE 4DR1E 1FI4A 1MG7A 4FN5A 1ZXNA 1N0VC 5BR8E 4LF8I 1XNQI 2UXCI 3K17A 1NHIA 4X65I 4DPWA 2UUBE 4JI5I 1N36E 5IWAI 4AQYE 1J5EE 3JAMQ 1B62A 2VF3A 4KHPI 4JI2E 3B82A 2E5LI 1Z0WA 1HNXE 1ZM2A 3PYFA 5GMDA 4HYMA 1XMOI 4LF7E 3J80C 1N34I 4DPYA 2UXDI 1IBKE 2V2QA 4XTJA 4JI8I 2DEIA 4DR7I 2R3VA 3WU4A 3T1HI 1XMQE 4OX9E 4HACA 4DR2I 1H7SA 1Z0EA 1N0UA 2VQFI 4DV6I 4FWGA 3J7AG 4PU9A 3ZZ0A 4UTGA 3J80Q 1XNRE 4MYTA 3WU6A 1H7UA 2WW4A 1N32E 3Q1QA 2UUCE 4LF5E 4DV4E 4FWDA 2BM1A 4NXNE 2HHHE 4EMDA 4ED4A 1HNWI 1EA6A 4GKJE 4LFBI 4DV7E 4DR6I 4DV3I 4HXZA 4FWHA 4DR3I 3F0NA 2AJ4A 3D4JA 1I94E 4DV2I 3J7AM 4DV1I 4ZVIA 3PYDA 1ZM9A 2E1RA 2NPFA 4JI3E 2V8PA 1ZXMA 4X66I 1IBME 2X7IA 3V5RA 4DV0I 1EI1A 4DR4I 4WUCA 4DV5I
chains in the Genus database with same CATH superfamily
3OHBA 4MKVA 4K0KE 3OT9A 3CDUA 2XWXA 5K9FA 4DUZJ 2R2TA 3BEGB 4QIEA 4CTAA 3ZC4A 3T1YI 1WTBA 4LF4I 4CLWA 4OYBA 4Y2KA 4PABA 4KBIA 2C2RA 2FHJA 2QE5A 2CVEA 1TUGB 1BC6A 1JIHA 1YTYA 2V8VA 5AJ3F 2XYGB 1ZYQA 2YX4A 1HBUA 4LFCI 2ASYA 1X4BA 5KFUA 4ALZA 4RNHA 1U26A 3CIZA 1U0SA 1WDDA 2J6SA 5GAEU 5CZXA 1W25A 2RUSA 3BO4A 3H42A 1Z0VA 1XMQI 1CJVB 5L39A 2DYAA 4NLPA 1OYRA 5LMNI 4F4WA 2B3TB 2R7RA 3VR1A 1USVA 1M5KC 3BZQA 4RNNA 3CJ0A 3CULA 3BV8A 5FDLB 4RO0A 4HH0A 2O1VA 5CYMB 1EIYB 4LF6F 1S1VA 1Y5IB 1HARA 1B63A 3CE8A 1IQTA 1HWKA 3EZOA 2I9SA 4YHHI 3T5HA 2YPZA 4MU4A 3LPEA 2VFUA 2MEWA 3H4LA 1SKRA 2BKPA 4Y65A 1QSLA 3D67A 2CPJA 2AHOB 4QQBA 2NN6C 3DCAA 1B64A 3G8QA 1FJ7A 2KKHA 3WU3A 2R7WA 4R5PB 1XHKA 3FVYA 4WP9A 4F67A 2EFPA 1S12A 3ICLA 2EEYA 5DM6Q 4RUBA 1C0TA 3QWUA 1VC0A 5LXRA 2DEJA 1MN9A 5HROB 2LKZA 1JJ4A 5GAGU 4DG1A 3MPYA 4DL3A 3HULA 3E3XA 3DLGA 6AT1B 2JX2A 1IR0A 4USKA 1JXVA 2IIHA 4KSEB 3T3FA 2C2EA 3TAMA 1TV6A 2CQ2A 3UWTA 5D3GB 2DR9A 4KO0B 3QFWA 4KGKA 3I9V9 3D6HB 5ETMA 3OUYB 1OSDA 2HW3A 4MU0A 2PGCA 1RWMB 4WZMA 4DR7E 2LA6A 3GLLA 4ECQA 5KT3A 4J9RA 4IFDB 4FKYA 2PMHA 4DR2E 2ZWPA 1NKCA 3W5XA 4Q0BA 3UNGC 1S10A 1TL3A 4I1TA 3EDQB 1QTNB 4DV4I 5LSRA 2VUGA 1VQMS 4ZCLA 4LFAF 2BOPA 1LW0A 5F3TA 1HR0E 4LR7A 2ZBCA 3MECA 4JI4J 1EP4B 2OJ3A 1R0BG 3FEZA 4C97A 3AOAA 2IFXA 3Q8QB 1RAOA 1VQKS 4C9DA 2QV6A 4ENOA 1REGX 3OTCA 1IBLJ 3SCKE 1N36J 1HQEB 4B9UA 4MKYA 1RT7B 3ZZUA 3NOGA 2DNOA 5GMKa 2Q3PA 3TVKA 1HNZI 3UPFA 3SSSA 3PJWA 4KR0B 5IM0B 4ED5A 4ZHRA 2ROEA 3IFEA 5J1EA 3AAWB 3NNHA 1JLEA 2VOOA 3FFIA 5FLXU 4DR5E 3MCOA 1PYTA 1X4CA 2CFXA 3VGTA 1P9YA 4RUAA 1RAJA 1PBUA 2B0GA 4X65I 4DPWA 2UUBE 2GVZB 5IWAI 3EZUA 2GZOA 1Q8KA 2HQGA 4WWSA 3HD1A 2VQEF 2V5HG 4I6AA 4FVCA 2ZVSA 2MY7A 2RHSB 1H38A 3MMAB 2QL7B 1VFJA 4WFXA 4DL7A 2YH1A 3G6XA 2EXUA 4MT1A 1KDNA 1O8BA 5HQ8A 3CJRA 4KGZB 2R7OA 2JEBB 1CSJA 1H7UA 1MROB 3U1MA 1IM6A 2MKCA 4FWDA 2FVSA 3JTPA 2IJNA 2CQCA 5LXYA 3FQKA 4ECYA 4LFBI 2FY8A 1NK4A 2K7JA 2JLFA 1KOOA 1ZH5A 4O0IA 3QIPA 1HR0F 2UUTA 3ET6B 3JQJA 4OZNA 3NGSA 1DTQB 4DV0I 4EGLA 5KFYA 1FJGJ 1NSPA 4JI6J 2ACYA 2Y0SD 2C37A 3RB0A 2CZVC 2ZM6E 4NPOA 1ITPA 2YNGA 1FFSB 2PMZD 4LSNB 4F26A 1C2PA 2ZBPA 2Q2EB 4OFZA 3CJ2A 3CC2S 1Q8BA 4WE1B 4UQGA 2ZDPA 1OS5A 2XULA 2D69A 2XMJA 3GE9A 5H1SV 3M7ND 5KFOA 4JI7E 5CYQA 2BANA 3U27A 1VLOA 1HBMA 1RHYA 2N3OA 1X0FA 2UUAJ 4K4YA 2OUGA 3HZGA 4DFPA 4ILLA 4HHJA 3CW2C 1RAIB 5I3UA 4OLOA 5KG3A 2HZAA 1N5TA 1PC4A 4DV1J 3UN2A 2HBZB 2LLZA 5T7LA 4YY3F 2HRTA 3D2WA 4ICLB 2DD8S 2COLA 2O1PA 4UQTA 3R5DA 4OHYA 1N34F 3UCGA 1BQXA 3J7AN 4ZVHA 1BWVA 3CDBA 2CKWA 5HMYA 4TU9A 3RYLA 3LTOA 5E3QA 3TI0A 1RI7A 5F0WA 4NI2B 4G1QA 3NBPA 1XBWA 4OO1F 1CJUA 2AWZA 3KUEA 2IYIA 2A2CA 5HLFB 2HHSA 1WSRA 4GO7X 3EX7B 2WRMA 1N6QB 4GO5X 4ED7A 4QIFA 4C48A 1VQOS 1OPIA 4M8LA 2YNHA 4KHMA 4C3LA 2GO4A 1VQLS 4M5DB 2VJVA 2HRYA 1WOSA 1URNA 2JOQA 1YK9A 4PRFA 2D3UA 7AT1B 2P6SA 3CJ4A 3CWJA 1GMWD 2YBVA 2P9CA 4L3NA 1JLFA 1X4HA 1S4FA 3QAEA 1IBLI 3OTOE 1N36I 4XIUA 3GP9A 3RU0A 2ZHAA 4A8FA 2GMJA 4CIOA 2HNZB 4KHPE 3DHWC 3QRPA 2C39A 2R8IA 5HMXA 2E5LE 4ZP7A 1HWJA 3L7UA 3T6JA 4FBUA 1WC5A 4KJIA 4MQYA 3UR0A 3QLHA 3M32A 2GHVC 4JI8E 4IH5A 1R6YA 4DJBA 4N76A 4FYWB 3MEKA 3EGWB 2IM0A 3IR5B 2B8QA 1QLNA 2HLUA 2H65B 5KFZA 3OFEA 5EUHA 1JB0C 2AZ3A 2HQIA 5HJXA 2IM1A 2CPDA 3H0PA 4RBTA 1TZ0A 3AODA 2JEGA 3HVAA 2KXNB 5LT5A 4P2SA 1MW7A 3QFHA 5AJ3J 5EX0A 2HVDA 2H54B 2VESA 4P72A 1VYAA 3RAQA 1S0NA 3JSMB 1UKUA 1D8ZA 3D7SB 4JV5F 2R8JA 2SXLA 3D1HA 5A76A 5FIIA 1ZA1B 2GC8A 4QNKA 1NNDA 3N6NA 2VFTA 3P45B 2XS2A 4NEYA 4DQPA 3TEHB 2G9OA 2ZH6A 4JI5I 4HT7A 3G82A 2R4FA 3PIOQ 4LF6J 2OPQB 4PUOB 1G6BA 5BJRA 5I42B 3JAMQ 1TUWA 3D66A 4DR1F 4V1Ak 3OTOF 2Q6BA 2Z57B 1YZ6A 4HI2A 3BDPA 2CYYA 1M5PC 4E8UA 1JLQB 2ILYA 2EG2A 1NB7A 1R8PA 3GYNA 3HKMA 3S8SA 4LF7F 3TUPA 1BXNA 3OSNA 4FXVA 1UEUA 4QWDA 3RB6A 2QLXA 3ILIA 4ITSA 2H3EB 1M5SA 5K36E 3MCSA 1FRJA 3PV8A 2J5AA 5IC4B 4B9MA 1NKBA 2HHHE 1FDNA 3G4SS 4GKJE 2DY9A 2UZAA 3EJMA 3J7AM 1NRKA 4DV1I 4TVAB 4A46A 2RS8A 2IRUA 1AB8A 4QBUA 4A8MP 1UWAA 3MOZA 4O0NA 1UDSA 1YJWS 3ZTPA 2W25A 1JLAB 1XK8A 1HNVB 5DRQA 3HHLA 4CH1A 4RW4B 2R7UA 1IBCB 4OYXA 1PJ5A 2RIJA 2BA1G 3IAS9 2A1BA 1FWLA 3AA8A 4RBUA 4JYAI 4WTOB 4FBTA 4WE1A 1RZMA 1NPRA 2GJIA 1ZAWA 3UD5A 3QATA 1MU5A 2Z5CA 4LFAJ 3SFUA 5KG2A 2IA6A 4OO1D 2WNRA 2HKJA 1NHJA 5EWGA 2Z8QA 1H2UX 4PQUB 1KLMA 3C2PA 3JXOA 3MD3A 5DNXA 1ZM4A 3ZZPA 4Y0FA 4NXMI 4ERDA 3C14A 2QSWA 2E66A 2G0JA 4UUWA 3AOBA 1FT8A 1SC6A 4DSLA 2E5HA 3R5JB 2Y1LB 2VODA 2GJ2A 3ILLA 2AMCB 2VG5B 4C8KA 4B3RE 2OPPB 1MU2A 2C2DA 4ZIWA 5HVHA 1JLCB 2G2ZA 2KHDA 3ITHB 3BR8A 4JI0E 5KFDA 2VJUA 2E9RX 3LP1B 4C98A 5KFMA 3PX0A 4HH1A 2WVBA 3D3CJ 1QAJA 1HNWE 4PWUA 2VQEJ 1HLWA 2IDLA 3TA1A 2HHHF 2ZFHA 5DQIA 5IT9Q 5ETLA 1UJ5A 1D0EA 5C42B 2B8PA 2BOAA 1XC9A 1LKZA 4EBDA 2OIHA 1S77D 2JEAB 2AW0A 1FKAF 4DUTA 4KFBA 3HFKA 1VRTA 1NZAA 2M3DA 3IBWA 3G87A 1HNXJ 2DXDA 3TANA 3E51A 2FHJD 2HG4A 2GMLA 3K57A 2UP1A 3MDFA 3ZZTA 3J81Y 3H2LA 2MJNA 3FK4A 2KN4A 5LOQA 1TAUA 2OMOA 2DRBA 5DGBA 4ZLLA 1GTEA 2CNOB 5J2QB 4F0KA 1X8DA 2BE2B 2BE9B 3ELHA 1FE0A 4MU1A 5F8MA 1HR0J 1RXOB 2YKAA 2QA4G 3PCOB 2CUYA 2UXBF 3PYEA 5DRKA 2HWTA 1USUA 2DHAA 2B4OA 1H7XA 4AM3A 1M1HA 4CO1A 1Q53A 3MPUB 4FZVA 5HBMA 1RK8A 4RW6B 2OPSB 4LF6I 2RD5C 2XHWA 2YWEA 5DS7A 4MKAA 1VJQA 3TYTA 1DZ5A 2L3MA 4X4TA 4C8LA 4P7VA 3CCUS 3ZTOA 3R1HA 3ZTSA 4PG5A 1Y3KA 2RDDA 1U0HA 2DNQA 1YBTA 3BSAA 1NM2A 2BABA 2DNHA 3KLGB 3HSZA 4G65A 2GJFA 1EETB 2IBOA 4ISAA 3KRNA 2V50A 4A8XA 3VAGA 1HW9A 4FS1A 4KGVB 2GX8A 2KZMA 1IBMI 1WJ9A 3DGPA 1L5UA 1D8YA 4OHWA 4EBCA 4CO3A 2ZOFA 2V0NA 2KDOA 5C0XB 1SPBP 2IMOA 1ZPVA 5CABA 4N47A 3MMBA 1SKUB 2VDIA 1S6OA 4YY3J 2H48B 1AUDA 1RB0A 3OHAA 4WKRA 2ADBA 2DR8A 2JNJA 1N34J 1LW2B 5DETA 4N56A 1QSSA 2MZRA 2CPIA 1REVB 2KTQA 4GKKF 1NHIA 1RT6A 4MDTA 1L3SA 3KLFB 2UVVA 2YNIB 4YN3B 1V5IB 1J5EE 3WIVA 1MLAA 1C4AA 5A2QY 1YJVA 1RTHB 1Z0WA 1KHWA 4G1PA 4A8YA 4K2JA 2HBQB 2XI3A 4DPYA 5KG6A 2CQ0A 2XMAA 2A18A 4ANEA 4CLTA 3MEGB 3PS2A 5KFLA 3EXCX 4P2FA 1NJZA 1PAUB 2Z2LA 1VLYA 2E44A 4MYTA 1VQ6S 3VAMA 3LALA 3ZXWA 5KFRA 1F2HA 1U1LA 1XTZA 2BM1A 1R8BA 1RT4B 1BQNB 2M7SA 2MGZA 5DRPA 1UFWA 3KJNB 4K59A 4K4UA 1IKWB 3R27A 2VPYB 3I6PA 1R8HA 3ETMA 3PYDA 3OFFA 4JBCA 1GXLA 4IOCQ 3UVJA 2NPFA 2O1WA 2HGMA 3WX8A 1WC6A 3GV7B 3V4IA 4LMZA 2V9WA 1N33E 3IXQA 4PYDA 5E3AA 5ETSA 3TZWA 3CF5Q 1ZOTA 2R8GA 4PG4A 2HHPA 3M2VB 2MKJA 2RF2B 3IS9A 3E01B 2VQEI 3AFGA 1WOPA 4LF9E 2ZDOA 3OLBA 4ZPVR 3M8YA 3SMZA 1RKIA 3NAHA 1XJWB 2QL5B 3RBZA 2CQBA 2DH9A 4B3TJ 3IWLA 3ADAC 4IH6A 4LSLA 1DLOB 4B9NA 2V69A 1HKAA 2EC2A 2MKKA 5KFNA 4TU8A 4M63A 2D74B 5H9EK 3PX6A 4JV5J 1RAFB 4DUYE 2E29A 1HNIA 4ID8A 2KJVA 1Y0HA 1VC6A 2BBEA 1Y5LB 1A6FA 2WP8A 4F0MA 4DV6E 4OJ1A 4KE5A 3SV3A 2IVYA 4CT8A 4AL7A 5J2PB 4CLPA 1HI0P 1HR0I 4HDHA 3M8SA 3R2DJ 1QVFR 1T9TA 4I6WA 5FJ4A 5D4NA 3L7PA 2XYPB 2JSXA 1O0PA 2EFVA 3M8WA 4DR1J 4DR6E 3PS1A 2F65A 1IKYB 1S9GB 3TZXA 4J9NA 7FDRA 2ZBKB 1YWXA 4LR9A 1RP5A 3O5TB 4AQYJ 1GH8A 3PNIA 1RR9A 1FWPA 2XYHB 5CCLA 1CS4B 3HFZB 2W8KA 1M90T 2PO4A 1EQMA 4LF7J 4OYZA 3Q0AA 2JVOA 3LWMA 2F4VF 3MFHA 4X4NA 4LJMA 4MK8A 4DX7A 5CD4H 1R0AA 1ZZFA 3F56A 4OKGA 2HGNA 3GR0A 2PNLA 5HQMA 3DRYA 3BJYA 3HT0A 3HHDA 3MEDB 1Q5VA 1TL7B 4OZ2A 1S1WB 1TKXB 1SBRA 4ZVGA 3LGHA 2CQGA 1HHSA 2BW2A 3C6TA 2FZCB 5AXMA 4O23A 4YY3I 2RS2A 3P3EA 2HBYB 3JSYA 2Y1IA 4H4MB 4NZ0A 4B02A 1GT8A 3PG9A 4Y2IA 4JV0A 4JV1A 2OTJS 1FNMA 2AJ0A 2CPZA 2ALZA 1HW8A 2AT1B 1VRUB 1N52B 2F1DA 3E8OA 4RX6A 4ZIVA 5GAGI 3LPSA 1PYSB 1EJ7L 1TL1A 4USMA 2L9DA 3T5LA 5C7PA 2J8SA 2ATLA 3LAKA 2I1RA 3MD1A 2DNKA 2PEBA 3DRSB 1TUVA 1Q86T 3RB3A 1DQ9A 3V6DB 2HS3A 3NMAA 4TY8B 2WK4A 4LRFA 3CDJA 2YKPA 1XN9A 3FBFA 2HAIA 2AU0A 2FGOA 4ID5A 4EU0A 5C0XA 1Z5AA 1S6PB 1W2IA 4NYPA 3UW1A 4DR6F 1K1SA 2XMKA 5F8IA 4OYOA 1PYOB 2R9LA 2WVFA 2HYIB 2ZM6I 4CO5A 4XO0A 3HXMA 4DXLA 3LWLA 4WCEQ 3M85D 1T94A 3SDEB 1FXLA 4L74A 3KJVA 1WF1A 2JC0A 1IKVA 2L41A 3GMGA 4MIAA 2XZDB 1UMJA 4QW8A 1Q81T 1OQ3A 1FXDA 3W5ZA 4DCPB 1KR4A 3FC9A 2WSEC 4FYYB 2HHHJ 2XB2D 4KPCA 2CWKA 1RACB 2HQDA 2ZH7A 1N5SA 1QTMA 4AE5A 1AZSA 3P96A 2ZH1A 4YDDB 3Q24A 3FZ2A 3WU4A 4WFYA 2M0GB 5AXLA 2EFOA 4OLPA 5J2NA 3KDNA 4HACA 1RT2A 2WVDA 2OKQA 2GHPA 4OJGA 2CQ4A 1F9HA 3PJXA 1XNRE 2OLWA 1P8GA 2AGPA 2RKIB 2WW4A 4OX9F 3RBXA 2UUCE 3M7NG 1RDRA 1KQSR 1MNEA 5H9EJ 2DITA 2X1FA 1FXRA 2VB6A 1RTJA 1HMVA 3OXFA 3V4MA 5JVHQ 1CG2A 1TK0A 1R7IA 3D68A 4B3OA 3HDSA 2NCKL 1JLBA 1N32F 5JEAE 4ZVIA 1NJWA 3LW5C 2N4CA 2XMVA 5KAKA 1X5TA 5HI7A 4N7TA 3UO0A 1NDLA 3QO9A 2HHWA 4ZITA 3G2XA 4WP3A 4NLWA 1XEZA 3V5RA 2UXBJ 1EI1A 1I94F 2Z5BB 2IYGA 3J80U 3X1LB 3KLEB 1UVJA 3MHYA 2HKEA 4OI4A 1FX2A 2ZC3A 4HI1A 1KTVA 3KG0A 2IRXA 3GSIA 3DOMA 1N5YB 1IJEB 1GMUA 4RUHA 4DR1I 3OTOI 1UWBA 2OMLA 3H5XA 4ZVUB 2RUGA 1KSPA 1DHMA 2F1FA 4DLEA 2GVDA 4XDCA 4IDKB 1Z0TA 3LNUA 2XG8A 1VQ8S 1P9QC 3EGVA 3F41A 5H9FK 3JSRA 3G6YA 2IESA 4YB7A 2YQ0A 1QDUB 4DU8A 1ZTTA 2RNEA 1Q4RA 1B99A 3OVSA 2HSEB 4CM2A 1KVKA 2NPIA 3NRBA 2ZD1B 1WG1A 2DRDA 2V34A 3AD8C 1Z0BA 4BBYA 2BA0G 5K8MA 3RW7A 4NRTA 3I9ZA 1RREA 2ADCA 2G13A 4BS2A 5D4LA 1KBRA 5EDWA 3DOLA 1DTTA 1BGXT 1CC7A 4GKKJ 1HPZB 2JEFA 1UJ6A 2I5JB 1XNRF 1UPPA 3W64A 1J5OA 2APOA 3PYGA 5DO2A 1VIXA 4LSZB 5KFXA 2FJBB 3CVKA 2NQPA 5DDRC 2VZ9A 3CMES 1FNXH 2FGCA 5A8KB 3TZZA 4DV2E 3KFWX 3AB4B 3POTA 3SBMA 1UA0A 3I5AA 1CULA 2YKNB 3GB0A 5JJBA 3CCWA 3M1VA 2VDHA 2LQ8A 4ZCKA 3TVZA 5T41A 5FLXY 3FEYB 4RW7B 1H74A 1S5ZA 1TVRB 4CH7A 1R8AA 1YBUA 3GWCA 3JAMC 4WBFA 2YPYA 2HFUA 1TKTA 1PCAA 4QR0A 2J0WA 4DR4F 5DG8A 1KD1T 2NUUG 2J65A 4X2BA 1HIYA 1F5CA 2Y1RI 1FEHA 3J7YI 2HK3A 4BWMA 5DM7Q 4LF4F 2BE7D 4J3DA 1M0SA 4PG8A 3CSKA 3BSCA 3QT7A 4KPYA 2ATCB 4U3DA 3RAMA 2J7UA 3MPDA 9RUBA 1X5OA 2VFSA 3DMJB 1WD6A 2H1YA 2Y1JA 2V8DA 2WHOA 4PYAA 1FTRA 4C11B 2QJ3A 3LANA 5HN0A 4P75A 4URGA 2J7WA 2VICA 2HHHI 3PRBA 4URQU 3M8QA 1RHMB 1F9FA 4TQSA 1OY9A 3KWMA 5LMNF 1ROFA 2K2PA 3C19A 3DLEA 4MK9A 2HQCA 2QLFB 3OVAA 5C25A 4IG3B 2U1AA 2HHUA 1O6XA 2ALYB 2W2QP 3N6MA 2BJ9A 2J9EA 1YJ9S 4RU2A 4DOZA 3R5GA 1R31A 4NA2A 5KFWA 4X66E 2DK2A 4PXEA 4DV2F 4I64A 5K14B 2V4JA 3BN4A 1RLCL 2PFFB 2YXLA 2NN6F 2C2MB 4IKAA 3NGUA 3KK3A 4USUA 3OR1A 1BUXA 3GYXB 2KFZA 2F3JA 4FW7A 3UN5A 4DHVA 3FGVA 2WONA 1NHVA 1PAEX 3MM7B 2J9CA 2KB2A 3HMJG 4C3KA 2BJEA 4ZCMA 1NK6A 4PPZA 2ZC4A 2CA9A 1YJTA 3B82A 4PXCA 2LMIA 4DS5A 1S76D 3UCZP 2RRNA 4HYMA 2OGUA 1YBAA 2WBRA 2JWNA 3OFHA 2AJQA 1TKZA 4H4OA 2EI5A 2PNZB 3NOCA 4DX5A 1FO1A 1WC1A 2MZQA 4PWDB 1DQAA 2R7TA 5H9FJ 1UW9A 2E9TA 2DGOA 1GAOA 1HWUA 4CLUA 3W1YC 5DZ7A 2BRLA 4BA1B 3CCMS 3Q8YA 1SUQB 2F4VJ 4J9KA 3VV2B 2DY1A 2BJ7A 5E5NA 3DM2A 5FD1A 3OFGA 1HNWI 1EA6A 1IQZA 4W4MA 2M5YA 2O66A 3CJKB 4QCLA 3DOKA 2Z56B 1U1QA 3FCHA 5I3QA 1C1CA 3SEOA 4NE9C 4DV4F 3WC2A 2XGPA 3AXKA 3M2RA 4WP8A 4LCFA 1BE4A 3H5SA 3CJTA 4JI3E 2PA3A 3I5BA 3VAKA 2XO7A 3M9OB 2LEPA 2HHXA 2G4BA 3IRXB 3KLHA 1A0OB 3Q22A 2PE8A 4ECRA 3D5MA 3A3NB 4A47A 5A0YB 2PO2A 1U6ZA 4WJBA 2FTRA 4IO1A 2DXEA 4RW9A 1HA1A 4O3QA 1I1GA 5IXUA 4P74A 1M1GA 4O3SA 3RRKA 1CQMA 5B0AA 2O1TA 2GGPB 2HHQA 1X9MA 3MF5A 1V5VA 3A3OB 1XNQE 1X60A 1PIEA 3SQGA 3CEDA 1X4GA 4NEZA 3HHKA 2E5GA 2QMWA 4B9SA 1L3KA 3ZTRA 4Q45A 3K5MA 4R1FA 4X65F 1E6VB 4YMEA 2YNFB 4DR6J 4TXSA 1B7FA 1S72S 1AUSL 8AT1B 2M8HA 2OPRB 1EHWA 3CMQA 4BC7A 1I6JA 4IFDE 2G2OA 2B51A 2FYXA 5L8RC 3PHTA 2QA4S 1TL4A 3QNWB 2VOPA 3EPIA 1RT5B 4NMXA 1FDBA 3H90A 2XSJB 5DNLA 1FE4A 3MM5A 4YEAA 2G0CA 4FNIA 3KJFB 2QMXA 2KJWA 4M5HA 1XR6A 4PCQA 4JG4A 3MAAA 2VBXA 1ZPWX 4DV3E 1GK8A 3GJTB 4J9QA 2LQ5A 4IZKB 2WOMA 3EWGA 4USJC 1A7GE 1E6YA 5KFJA 2EFQA 2E7XA 4LFBF 3WBZA 2W2MP 3BPDA 1VK3A 2C2OB 4CO2A 5J2MA 4F36A 4K4WA 4JI3F 4W92B 1VQ5S 4A48A 4TYBA 5A6WA 2PO0B 1ZZNA 2F63A 3CWVA 1S59A 4X62E 4MFBA 4DV0F 4ED0A 4OX9J 5KFAA 5B0GA 3OR2A 1B4SA 2KHCA 3FCVA 2FHOB 1J5EI 2NUHA 2HNDB 3WQPA 4FXDA 4DZ6A 1N32J 2C28A 3TZYA 1UVMA 4IRKA 3I31A 4UOFA 1OYPA 1S1XA 4L75A 2V63A 2GQ0A 5F41A 2XMUA 2HFNA 1YLXA 5LL6R 3DLKA 1I94J 1KVIA 3IR7B 2G1HA 2POKA 2NN6D 4OIXA 1CBKA 2O1UA 3DHXA 3W5YA 4OO1B 1CJKB 3KK2B 1SJ3P 2BW7A 2LU2A 2R2UA 3E2EA 2HMIA 1XXEA 4YFUA 2EPIA 3P76A 2KFNA 3CGIA 1EX8A 2B5JA 2VQFF 3PIPQ 2OEKA 1S99A 4ZP9A 2E9ZA 5K8PA 4I7FA 3NAIA 3M05A 4HHUA 1RISA 2R7QA 2XBPA 1HBOA 3MM9B 2YTCA 3KG4A 1UFLA 2F4VI 2O3ZA 2RHQB 4NYZA 1Y10A 1GQEA 4TU7A 1IKXA 1H72C 2VH7A 3MM6A 5HATA 3AQOA 5F8LA 3I55S 2XI2A 2J9DE 3DRRA 4C7QA 4TQRA 3ZO7A 4LF9I 2QA1A 4ZPCA 1N0VC 5BR8E 3K17A 1XNRJ 4CTAB 3MMCA 3D9BA 1P1TA 2WVCA 3G8SA 5HMWA 3OPKA 1ZBTA 4LUBA 2PFDA 3CO9A 3HVTA 1NB2A 3MURP 1NDCA 1Y00A 1BQMA 1NH8A 4TYAA 4LQ3A 2AZ1A 4NX9A 3CUNA 3D0HE 3GFHA 3UD3P 4NCBA 3OL7A 5EL9A 2BZ2A 3JB9k 3EPGA 1RWXB 2Y8WA 1HBUB 3G9CA 4WIQA 4AFFA 1N0UA 4PG7A 1RT1A 3FBEA 4DV6I 2JC1A 3BSNA 2G1DA 1UDOA 1N48A 2JE6A 3Q86A 4HT5A 2V2KA 4IOAQ 2J76E 4W90B 3QPIA 2BA1D 1Y60A 4FYVB 4DR4J 3SQOP 5BYRA 3MZIA 5IV4A 1MWYA 1FERA 4DR6I 1Z2ZA 3W8GA 2ROGA 4QPTA 3T1YJ 3H5UA 3NGTA 4LF4J 2GIFA 1S1VB 3QGHA 2DGUA 2VG7B 4IR9A 5KFTA 2C1EB 4DQRA 5A0YA 1TKDA 1TU0B 3I82A 4I6YA 3U7JA 2D3O1 1V3RA 4WFNQ 1U1KA 4RKUC 4LFCJ 3GZ7A 1NDKA 2IBKA 1Q8IA 2BRKA 1R89A 5CA5A 3UCUP 3QAUA 4B3ME 2PI5A 3SFGA 2OEJA 1P42A 4QIWD 4OV6A 1C0TB 4QIGA 3VCDA 5LMNJ 5DDQC 1WKJA 4R0JA 4XK8C 1S49A 5BR8F 4Q8EA 3IA0A 3VALA 4DG1B 3PEJA 4ATNA 4ANDA 3DLGB 1YI2S 2E5IA 3RGIA 2RVJA 1WUUA 2FJXA 2M8DB 2W8LA 4K4TA 1Z2LA 3TAMB 4JI5F 1TV6B 2YKMA 3A1YG 2UU9F 4PAAA 4CYUA 2CZ4A 3BKUA 4X4VA 1SIZA 3EZ5A 4ANCA 1T9XA 3MR3A 4K4SA 1Y7PA 2ZH2A 2V9KA 3A13A 2C22A 4WK3A 1T8EA 5B0EA 3ENWA 2MSSA 2ZKUA 5C2CA 4Q0BB 3BGLA 3FEXB 3C15A 1H2VZ 1TL3B 5DGAA 1B3TA 4RLEA 1G3OA 1PC5A 3S6EA 5F8NA 2RQMA 1WG4A 1LW0B 4DR3E 3M6AA 3M2UB 1UP1A 4URSA 3I0RA 4DDFA 3FSXA 1YRUA 4CNYA 3AT1B 3MECB 4EUVA 5EKWA 2H9ZA 3VZIA 4Q7AA 3CC7S 2ASLA 5L1JA 2W4PA 3RR7A 1D09B 2A2DA 4A8WA 1ZAXA 1PO6A 1HQ2A 4RWXA 2GQCA 1S9EA 4JB8B 1G7CB 4ZHRB 2PDAA 5J1EB 4LF8E 2UXCE 5ETPA 4K4XA 1JLEB 1QD1A 2BJ8A 2LU1A 3FFIB 4AXJA 2N82B 4BLGA 5KFBA 4QU6A 1JLGA 1QAXA 2LDIA 1JQGA 4JYAF 4RW8A 4DV4J 2MKHA 1T95A 2HK2A 1VQ4S 2F8EX 1Z59A 1SC4B 2Q79A 1S57A 2ZEJA 1KS2A 3G6ES 2JVRA 5FLXC 2DGSA 1DRZA 4OYIA 4OO1A 2BJ3A 2RAQA 3Q6MA 3HHNB 1U1RA 2C3YA 3K59A 4RWWA 4QIVA 1XNRI 4RZRA 4UZCA 4FW9A 3QGIA 2UUCI 2XY7A 4NXMF 1KTQA 3GQCA 2DH7A 1OYDA 1WEXA 4P73A 2CVIA 2K06A 3BS9A 3JYTA 2QRRA 3DLJA 3VQSA 1ZS6A 2BJ1A 5B7WA 5JMNA 4UUXA 3CMAS 1K9MT 1OWXA 2P9GA 3TQ1A 3QMQA 5HSPA 5EWFA 2AEJA 4OQJA 3VWSA 5JEAC 4ZVTB 3AY0A 4CLZA 4X65J 2I0XA 2VFVA 2LYVA 4DR3F 2VD3A 4U7CA 3QIPB 1VQSA 4HHHA 4DV5E 4A4JA 4JI1E 5D77A 2CJQA 1JXEA 3PRYA 4ZVRB 1IJFB 2F4FA 4B3SE 4LRCA 2D9OA 3CJQA 1DQ8A 2QSFA 4BHQA 4F4ZA 2GV1A 1RAAB 2I38A 2C37B 4ZPTR 4I69A 4KKOA 1H7WA 2YNGB 3N5FA 5F9NA 3OXGA 4R8UA 5GADI 3RW6A 4I2PA 1C1BA 2J0XA 5M2UA 4JI2E 4EYHB 2OO4A 2MYFA 3NS7B 3PYFA 1CEZA 2EFNA 4ZMMA 5CYQB 3V81A 2BANB 3AA9A 3Q83A 1HBMB 5HVGA 4LFBJ 1XMQE 3FUYA 3GG1A 1Z0EA 1PJ6A 1F2GA 1IBKF 3R6GB 2FQQB 5I3UB 3A4TA 2CG8A 5EWEA 4DV0J 4ZN3A 5T7LB 2KT2A 1YJUA 4M5IA 1LWCA 1RBOB 4QYRA 3KYLA 3GPAA 1LWEA 1U48A 3D4JA 4DV2I 5A8WA 2VG7A 4NXNF 1DY3A 1UEVA 3C16A 3GJSB 1RHQB 1ZM9A 4G1QB 4DZDA 2UUWA 3NBPB 1VBYA 1CJUB 2IVMA 2NXNA 3SZ2A 4FVMA 2DNGA 4M5MA 3IWNC 1D3WA 3CC4S 2JL9A 2R2RA 2W2PP 4GVBA 4UW2A 4X64E 2U2FA 1IBMF 2FVQA 2YNHB 2XCPA 4K0KF 1WC3A 1XQIA 2BXJA 4NLTA 4WYWA 2VQFJ 1U2CA 4I0WA 4NZ7A 4F4XA 1NZ0A 1JLFB 3A8IA 3BQ0A 1LXJA 1VQ7S 4BDPA 4YP3A 3R8YA 2CG4A 3PW2A 5CQGA 1V9OA 1UDNA 4DQQA 1RHUB 1R0CB 3EE3A 4JI2F 3BO3A 3I0SA 3OVBA 1XMOE 1S0VA 2WAQD 3L7ZA 1U1NA 2C39B 4YB5A 2ZH8A 4AIDA 5BXIA 2OD6A 4MYUA 3QLHB 1KRPA 3M32B 4MH8A 2BV3A 5HJYA 1K47A 2C42A 1RKJA 1SXLA 1R43A 3CCJS 2XS7A 5DLFA 1ZETA 5KFVA 5DQGA 5D4PA 1U6BA 3AJ1A 3M2UA 1YZ7A 1PKUA 3NWGA 2A10A 2Y3YA 2JEIA 4DL4A 2E1AA 2B4PA 1R6MA 4Q8FA 3GFZA 3OJUA 4USWA 3TAPA 3W3SA 1RAGB 4DFJA 2H4WB 2DNRA 1U24A 1LNQA 2Z30B 5C0XE 1HNZE 3CJ3A 4FYDA 1PBAA 2KRRA 1YITS 4OI0A 1XR5A 3TA2A 2AEMA 2V67A 2DJWA 5LMUE 4LBPA 3R7BB 2RRAA 2B6AA 4KYZA 4MKBA 4WUDA 1O5JA 2VBWA 3W2VA 5IWAE 4GQUA 1X0PA 3V6HA 1FRHA 3G82B 2DR6A 1U1MA 3BB5A 4DUZE 5HQLA 1HL6A 2DHXA 2BUNA 1EKSA 5K36A 3EUNA 3DN9A 3LO3A 1A9NB 3VGUA 1N8RT 1SQGA 3TUJC 2PI4A 2CPFA 4DR7F 4OI6A 4XPEA 2HLTA 3O8WA 3PKYA 4ED8A 2VONA 5KFGA 2W9CB 4DR2F 4J37A 4L3KA 4ZK7M 2CJKA 2DHSA 4X4OA 1S6UA 3KLIB 3X3UA 1TTHB 4JI3I 4CLKA 2OH2A 2EC0A 2KT3A 2VASA 1CPZA 1UL3A 3J80Y 3LP0A 4P52A 4DX8H 1WHXA 1D1UA 4JI5J 2MY8A 4ZS6A 1BMQB 4N8OA 2UU9J 2I8EA 4NLDA 4NMLA 4LF2A 1DFDA 4ECZA 3QT6A 1OYSA 2DGVA 1KN6A 3HHLB 1C0UA 1W2BR 3HJCA 1OO0B 4O4GA 2ZUAA 2CDQA 4FN5A 1XNQI 4OYAA 2DKOB 3TP2A 4DR5F 3ILOA 2IVFB 3M6VA 4J9OA 3NP5A 2PC6A 2Z2ZA 3MTKA 2Z5CB 3DNCA 4LQ9A 2UUBF 2XLIA 2WNRB 4IO9Q 1XWLA 5E3PA 2XLKA 3G71S 2R3VA 1KLMB 3KOAA 4DUZF 3MPWA 4GVLA 3S1TA 3C14B 2VQFI 2FLLA 2NREA 4IFDC 4ZKAA 4FWGA 4WF9Q 1BLUA 2OHDA 4PKDB 3ZZ0A 4A8KA 3L9ZA 1VGYA 1HYSA 3KLVA 4FKXA 1GMVA 3PEHA 3JAMU 1JXLA 3CT9A 4M5GA 4Y2MA 2JHEA 3DYAA 2CG9A 4C8MA 4YR0A 1Y4SA 5F0UA 4DV3I 1MU2B 2K1RA 3RR8A 3H4BA 4JYAJ 3I4PA 2DH8A 2MMYA 3MGJA 4ZP8A 5D0RA 3TR5A 4MU3A 1NEEA 2C3UA 5L1IA 2FUG9 2ABYA 4ZVFA 3CCTA 3J7YU 2GW8A 3LOUA 1T05A 2AYEA 1YH8A 1W26A 3OTEA 4X62I 2D3OR 4BA2A 4KFBB 1LOUA 1VRTB 4JI4E 1FFGB 3K85A 4NXMJ 2BA0D 1YJRA 4RU9A 3EVWA 1WKLA 2JLGA 1IBLE 4NWBA 1X4AA 2LECA 2JEJA 5F9LA 1NLKL 2ZM6F 3Q8RB 4F2RA 3NMRA 1B7YB 1IWGA 1MWZA 3UR3C 4CDIA 2QYCA 3BO2A 3M6XA 2PO1A 1DAXA 3BGOP 3UDCA 2AV5A 4FNHA 2YVSA 2VBYA 1UZHA 2EWHA 1T03A 4JI7F 4GRSA 2KVQE 3ETOA 1UVNA 4OX7A 4K50A 3AD7C 2D3ZA 4DR3J 2BM0A 1JKHA 1ULRA 1K0VA 4WFBQ 5DRRA 5CCMA 2N3LA 5SUHA 2AX1A 1S4EA 3PVXA 5K8OA 4C4WA 5KFKA 4CWBA 2KM8B 5HBMB 3HK2A 3CO0P 3PJ9A 1XMBA 1S0MA 4ZLNA 2KYZA 3UDLA 2GNKA 2NXEA 2BQ3A 1S16A 1U0HB 1N88A 3K1JA 5HAOA 3H20A 1NHKL 1U8SA 4EZ9A 4NBQA 2E5JA 2WSCC 4F4AA 1S97A 3CD0A 4LF1A 3VAIA 1IUJA 2VV5A 3BF4A 4FP9A 1RTIA 1M5HA 4DSJA 3L4BC 4V19J 2HIYA 3HD2A 2R7SA 3DGPB 4WUBA 1YGYA 4U95A 4H54A 1IBKJ 3UQSA 5DDOC 3HHLC 2H5JB 5BR8I 3W8PA 2Z5EA 4DF8A 1LWFA 2OI2A 3P8BB 3MMBB 3B54A 3LH2S 1CJTA 5ITHA 4I67A 3BGRA 4KV8A 1BHNA 5IT9U 3D28A 2LJPA 4QWAA 2AD9A 1F6TA 3WZ0A 1FJGE 6FD1A 2UU9I 4FXWA 1FK9B 2VKZG 1RT6B 1X5PA 4JI6E 1FDDA 1U49A 4NXNJ 2FLPA 1Q82T 4U8VA 4NA1A 4ZJQA 4NA3A 5KG7A 3DU5A 3RRHA 2MKSA 4KHPF 1Z4UA 4F3OA 3PFOA 2GQQA 4YQWA 2E5LF 4MK7A 3FBCA 3SIPB 2DGXA 3GV8B 2HNYA 5LM7E 3TWZA 2LFVA 4JI8F 2DB1A 3R97A 3UFCX 3PW4A 2W9CA 1IBMJ 1FKPA 4OL8A 3BR9A 3PO5A 3BPSP 2UUAE 4TY9A 3N9UC 4K0KJ 1B70B 4R25A 3KUGA 3KLIA 3B4MA 3Q2TC 3R6LB 2ASDA 3KMSA 3M8ZA 2N4DA 1QAYA 3N28A 4DV1E 3J81Q 1MSWD 2BR2A 5ADZA 2MGZB 1Q16B 3M7VA 4JI2J 3KHGA 2J7KA 1VJWA 4OZJA 3ZKDA 3RTVA 4WXWA 3UVJB 4O3OA 1D9FA 1ELOA 1P6TA 1Q79A 3ULHA 4CH0S 4B3MI 3GIMA 3P6YC 3V4IB 1S1UA 1FI4A 5JVGQ 1MG7A 2IOQA 1GEHA 4YR2A 2ZZTA 5D8HB 3L3CA 2JZ5A 2IJRA 3IS9B 5D6GA 1OIAA 2PT0A 1B62A 4UOCA 2C2NA 1OPZA 4NLXA 3NL0A 1XIQA 2GIRA 1UZDA 2LCWA 4OHZA 1YVFA 2GQ2A 4FS2A 1FJGF 3TO8A 2B7CB 2V2QA 4X4PA 1FHTA 4FF4A 5DG7A 4ILRA 3GLJA 3GYGA 4LSLB 4ECTA 3CIMA 2IY5B 1VI7A 2FLOA 1H7SA 5B0CA 4ES1A 1Q78A 3TX8A 3QGGA 5KFFA 5HMZA 3LGNA 4USIA 2BX6A 1HNIB 2M52A 4IZJA 2KM8C 1F1BB 3VZHA 2MQQA 2WP8B 1Y4ZB 4OYMA 3BBBA 4DV7E 4HXZA 5DLGA 5K36F 4DR3I 3ZZRA 3K0JA 4PWWA 2VHGA 2Z58B 3I96A 4QU7A 5A8RA 1SJQA 2FC8A 5I3PA 1QY7A 4GKJF 3GSDA 1N54B 4NCGA 2AP6A 2H5EA 2DGTA 5CAAA 2HFZA 1SJ4P 3PY8A 4LRBA 1VIOA 5A2QQ 2WTFA 4HTJA 1FCAA 1R8CA 1F60B 4DR7J 3M9MB 3FKBA 4DR2J 1VQYA 2MZ1A 3SXLA 4C0OC 1QM9A 1IM4A 1Z0GA 1MMLA 2ZITA 2V8HA 1Y5YA 3AHPA 4FYXB 4OHXA 3FZBA 4C8ZA 1R0AB 1S6QA 2KXHA 4WIIA 5THWA 4I2QA 3ZZYA 3R5BA 3NLCA 3N6LA 2VPXB 3RB4A 5KFEA 2NR0A 3R9LA 2IM2A 1NO8A 1IBKI 4J90A 3TW0A 1NZ8A 1F5AA 4OMFG 3DRXA 4QZVB 1L3UA 2NSBA 2GFFA 1JMTA 4TLQA 1A6LA 3T9ZA 3C6TB 4J9PA 2XM3A 2MQMA 3T1HE 1GX6A 4LF6E 2BR0A 2AGOA 1P1LA 4D3HA 1HI8A 1ACMB 2K8GA 2HVHA 4F4KA 3T9NA 3ISNC 2XO6A 2IAJA 3I5CA 4CNZA 4BCAA 4NXNI 1WNEA 3O2IA 3W9JA 1TL1B 3KG1A 4NLYA 3OL6A 4DR5J 4F4YA 4B3RF 2MQNA 4H4KA 4J91A 3LP2A 4C0BA 3EGNA 1YJ7A 4MIWA 4DV7F 4JI0F 4C8OA 5L46A 4K4VA 2OELA 4AT1B 2UUBJ 1U09A 3BYPA 1NUEA 4HDGA 1HNWF 3T41A 4JI1I 4JUZA 4ID5B 4JP8A 5KG4A 4K0KI 3GJQB 4B3SI 5HP1A 3MXHP 1AFJA 3R7NB 2IRYA 2AKWB 3GG0A 3NS5A 3WX4A 1TMMA 2KT5A 1UJ4A 3IM8A 2JFDA 5M2PA 4NLVA 1DURA 2XC9A 1P27B 1FK9A 3WIUA 4JI2I 4DPOA 3KJVB 1EZZB 3IN5A 3W2WA 1IKVB 1HWLA 1CVJA 4ZP6A 4Z7YA 2MHNA 1DBDA 1K0TA 1FKOA 2DPJA 2XQCA 2O5DA 1KIJA 2CNNB 3DI6A 2IC3A 2GO8A 2MQLA 2MQ8A 2HAFA 3Q8VA 2V2VA 2IPOB 4DSFA 1AZSB 2HIQA 4LFAE 2HQ3A 3M4XA 1RE1B 5IV3A 5J2NB 1ZAVA 3EM1A 3IP0A 4HACB 1RT2B 3T1HF 1RCXB 3H98A 5JEAA 4ZVPB 3DRPA 3KK1A 1HK7A 3AJDA 2ZM6J 2QEXS 2MHEA 3IC1A 3B6BA 5C2GA 1EQ0A 2HHTA 3IMQJ 4EWTA 1RYSA 3IRWP 1M1KT 2QO3A 3PW7A 2WW8A 2F9JA 3M8PA 1RTJB 2EKYA 1HMVB 3CPWR 3VF0B 1YRTA 4B3OB 4JI7J 5K20B 3HP6A 1MWQA 3HKWA 4PRXA 1JLBB 4N8NA 4CRJA 1E3HA 2HS4A 2JJ4D 1RU2A 2C3PA 4X64I 1QE1A 2V6AA 3QO9B 1FESA 4U6PA 4ED3A 1FD2A 5G0RA 1VQ9S 2XY6A 3AQPA 2ZBQA 1AXQA 2VQEE 3IG1A 3CCRS 3DLHA 3BSOA 2E7VA 2OD4A 2XY5A 2O3DA 3DXSX 4IS9A 3DOMB 5LJ5Y 4USTA 4O44A 5HANA 4LIWA 5K36D 3A8EA 4LT6A 4Z2XA 1UWBB 2VG6A 3PHEA 3ZFVA 1HNXE 2GVDB 2O01C 3EXYA 3SSQA 1XMOI 3J80C 4ZJLA 3I32A 1F3FA 1J5EF 2DEIA 1D9DA 5KTQA 2BKOA 1NJIT 4DR7I 2FHMA 2PSZA 1FRXA 1YHQS 4DR2I 1KP6A 3OL8A 3QBCA 5K8NA 3IR6B 1UETA 5CXTA 2VKRA 5D15A 4K8RA 5F8JA 1N5QA 4JOUA 2Z0GA 5EGYA 4IFVA 2AF6A 4ZPAA 2XWYA 4P9SA 5F8GA 1AFIA 1RHRB 1Y4UA 4IFYA 2NN6A 4FWHA 3DOLB 5C24A 1DTTB 3I87A 2MLYA 1QSYA 2ZH4A 3KKFA 2MLZA 3OTOJ 4DLGA 4PEOA 1J5OB 2CQDA 5KFPA 5FWKA 3TARA 3MUVP 1UVIA 3C6UA 4M5NA 4Y2AA 2X7IA 4UY85 3M6WA 3TEGA 4KHPJ 5AE2A 1R6LA 2MZJA 2E5LJ 2W2NP 5C0XC 3MEEA 3POTB 1CULB 4ZPWR 5D0EA 1WACA 1K8AT 5LMUI 2CQPA 3M1VB 5T14A 4JI8J 4DPXA 4DR5I 3CCZA 3MUMP 2QGFB 1T3OA 1HBNA 2LEBA 3M9NB 2HQFA 1N33F 2ZE2A 3GIJA 3OD2A 1S1TA 2HVZA 2UUBI 3V6JA 1KFSA 1YHCA 4J9MA 1TKTB 1M5VC 1XERA 4LF9F 2ILZA 4CP5A 3M30A 2CPYA 3TAQA 4DUZI 3IGVA 4YY3E 1RT3A 4K2XA 4N77A 2ZJRQ 3D0GE 1HNXF 1N34E 3H5YA 3CTRA 3UNYA 2DPIA 3P3GA 5E0OA 5L1LA 2VC1A 1MMDA 2ZZMA 3PR5B 4OZLA 2L48A 3LAMA 1Z5BA 3AB2B 1NJYA 3Q89A 2CNKB 2RT3A 2NLWA 1U2RA 5E33A 3NCQA 1H2TZ 4OO1E 1RWUA 4DUYF 4DFKA 2WSFC 3B4DA 4Q5VA 4NLSA 4RR5A 1FJEB 2W7PA 1S79A 4OX6A 4C0HA 4DV6F 2MZSA 3H7HB 4AXIA 2V2ZA 3UD4P 4QWCA 3M8QB 1UVKA 3AH6A 3ZNJ1 2DNZA 2XTJP 3MAQA 3H2VE 5GADU 3DLEB 5C25B 2W24A 2YY3A 8ATCB 3PTWA 3QIDA 2BQRA 1U47A 4YUDA 1KEKA 3TJ8A 1U1OA 1FEEA 1RA7A 1FTCA 2WB4A 2V4JB 1FRMA 2CZ9A 5J1NA 3CD5A 4YOEA 1AW0A 3ENAA 5EX3A 5HK4A 2QZ8A 4IQMA 3KK3B 2L08A 3OR1B 2ZBIA 2CXEA 4WXOA 4JI7I 1JWWA 2NZCA 5KOXA 2WONB 4ECSA 1JNZB 2W7OA 4WPAA 3T1AA 1CJVA 1WWHA 2CPEA 2B9EA 1JJHA 3N4WA 4GKJJ 1WI6A 5GVQA 1OQ6A 4LPFA 3G6VA 2DO0A 1WHYA 1U8WA 3SI8A 2J6TA 1X9SA 3KDOA 5FDLA 1TKZB 2E7WA 4H4OB 3C3LA 5CYMA 1T0TV 3Q23A 2XZWA 3BH6B 3R5CA 3OV7A 4B3TE 3B8HA 3NEKA 2YX7A 3K89A 3QJPA 1Y5NB 2W4CA 5FLXQ 1SH3A 2AJ1A 5GAHU 4M95A 2YWGA 2AJ2A 1NDPA 4Y6IA 4JV5E 1X5SA 3KHHA 3WC0A 4UY8T 2P8IA 3DM2B 3CCSS 4DX6A 4R5PA 1SI9A 2X36A 2OEMA 4DFMA 3JQMA 2J8AA 3DOKB 2DNNA 1K44A 2M88A 4ZA1A 1C1CB 4OV1A 1Q5YA 3M2RB 3FQLA 2X1BA 4XPCA 1ICEB 1OJ4A 2BA9A 3BKTA 5HROA 3B78A 4JI4I 4OX8A 2DR5A 3NXZA 3JS9A 3OTBA 5ETVA 3BM7A 1Z0CA 3K7RA 3KLHB 2P5VA 2W9AA 4DR1E 2PO2B 2GAHC 2MB0B 1Y6ZA 5D3GA 3GTYX 2CQHA 4RW9B 5EN1A 4KO0A 4AQYE 1HWIA 2IM3A 1GXTA 4KHPI 4J9LA 4B3RJ 4PQAA 3OUYA 4IQXA 1SC3B 2E5LI 3VHQA 2H51B 2W2OP 2V94A 4DV7J 4LF7E 4IFDA 4JI0J 2KO1A 3SQGB 4JI8I 4DSKA 2B9YA 3JSBA 1HNWJ 2GCFA 3C66A 3HFVA 3P49B 1X4EA 2W9BB 1NAQA 4HLBA 2BMBA 1FF2A 2NXCA 2A6MA 4NLQA 5KFSA 3CDWA 2VL1A 2GIQA 2C2KB 1EP4A 3U1YA 4M5JA 3K2YA 3SSRA 1Z1ZA 1FRIA 3ISZA 1VDHA 2LXIA 1F3VA 2AQ4A 4EMDA 1HQEA 4B3TF 2VFRA 1RT7A 1VBXA 2BACA 3D6MB 4LRAA 5KFCA 2X1AA 2UUCF 3MM5B 4DEZA 3NGDA 5KG1A 4OI3A 3NKYA 4YB6A 5IM0A 5F3ZA 2E1RA 2HWIA 4LVOP 1QJHA 3MAAB 2DBBA 4B08A 3UHMA 4K5RA 1KLNA 1AROP 2NXJA 4WUCA 4L72B 5JEAF 3HT3A 4F25A 8RUCA 1JNRB 2WOMB 2FD2A 2YWKA 1E6YB 4IR1A 2GVZA 3IM9A 2CAJA 2C38B 1X4FA 4G6VB 3DLLQ 5J2MB 4AUKA 3K5PA 3T1HJ 2X51A 4F0HA 2VIHA 2IHR1 3MMAA 1FJGI 4MFBB 5HO4A 4LCGA 4JI6I 4UF4A 1RWVB 3OR2B 2HURA 3GU0A 1YX2A 3FCWA 2QFJA 2RRBA 4OI2A 4AQYF 3PX4A 3KNAA 3F73A 3D6FB 1R3NA 3CCVS 3HKZD 3IAM9 3GILA 3T5KA 4X4UA 2UXDE 4F7VA 1Q7YT 2CNLB 3GIRA 2NYHA 2JEBA 2RH3A 4IZJD 2ZJPQ 3SYZA 3JTNA 1WI8A 2MQOA 1MROA 1SC1B 1S1XB 3P3DA 2GO3A 4RUCA 3DLKB 2UUAI 2D7SA 5CD4A 3J81C 2CJ9A 1KKHA 3N01A 3KUHA 4P6QA 3ET6A 4GKJI 3H40A 3DLBA 2KXFA 5LL6d 9ATCB 2HMIB 3LGMA 1FKAE 4S0MA 1DTQA 4F02A 1HHQA 4IOBA 2B5JB 3PKMA 5L9NA 1RBLA 4LOMA 4AL6A 2J9DA 1G1XA 3CDEA 2LDYA 4I7FB 4LREA 1J5EJ 1HBOB 3FSYA 3SV4A 2PIIA 4LSNA 3QZ7A 4FW6A 1D6TA 5KFIA 4P2XA 3LPYA 1FX4A 2D41A 2WVEA 2IMWP 2ZNZA 3OBIA 4M5KA 1B0TA 1IKXB 3MM6B 5CYJA 1VRQC 3TNVA 2KH9A 3DRRB 4Q2MA 4E98A 3PACA 4F3QA 3K58A 1RHJB 4RNMA 2DNYA 4NZ6A 2UXBE 1YJNS 2W1BA 3IBCB 1WSVA 3GCMA 3D0IE 1T9YA 1TQLA 3P5BP 3FSIA 2XZTB 3MMCB 5AE1A 5IFMA 4ICLA 1TK5A 5JUMA 3HVTB 3MAHA 1KVJA 1VBZA 1BQMB 2FHKA 3TJAA 4WFZA 3R1LA 3W9IA 1FFWB 3JAMY 2UXDF 4KAIA 4LBHA 2J0SD 4NI2A 4B3RI 1EB0A 2MJUA 4J9VA 2Z2MA 5HLFA 2ZHOA 1RT1B 1N33J 4DV7I 2OFHX 4JI0I 1N6QA 2JE6B 3J7Z5 4NLRA 1X7VA 1G4CA 4LF9J 1OMSA 1Y9OA 4ECXA 5A2QC 1G2EA 2FPHX 4M5DA 2KI2A 5BYQA 4UOGA 3DU6A 2C3OA 3UDVA 2BDPA 2FZGB 2CWXA 2JH3A 3DDNA 4GKKE 1NPPA 1UPMB 3LF0A 1RTZA 2AGQA 1NK5A 3PRVA 4X66F 2LVWA 3R3TA 3MR2A 2Q6CA 4QOTA 5K5MA 2ZOGA 4CQ1A 4DF4A 2HNZA 1W7WA 4ETXA 4DUYJ 1F0XA 3M6UA 3K5LA 1Q0NA 4WKYA 4PG6A 2UVRA 4B9TA 4DV6J 4CO0A 3LQVA 2FJVA 3SCJE 1IXKA 3HO1A 1RBAA 5CH7B 2JLEA 1RWKB 4DI6A 4N41A 4L73A 2W9BA 2Y9HA 1T02A 4EEYA 3K5NA 3NY0A 5JEAD 3T1HI 5F8HA 1NSQA 2QLJB 3FRZA 5ETKA 2MQPA 3W60A 2YKMB 3J7AG 4PU9A 1VHIA 3MR6A 4CYUB 4UTGA 1VC5A 3CJSA 3Q1QA 4LF5E 1KOHA 2FJAB 1M5OC 1FDAA 4DSEA 1U2FA 4KY3A 3TUZC 4ES2A 4DN0A 1DJ0A 1LQ9A 2EG1A 4LIRA 1H0HB 2AJ4A 4I56A 3JSMA 2WCXA 3A3PB 3IBFB 3C15B 5KT4A 2GA7A 3MI7X 4EO6A 2RSQA 2NZ4A 1SJRA 2EKNA 3VVTA 4AD6A 4A8SA 2OSQA 4B9LA 4DN9A 1CLFA 4DL0C 3PO4A 2Q1LA 3TRGA 1WORA 1QVGR 3GCXP 3O1LA 3I0RB 1IN0A 4N3OA 2C38A 1YG0A 1AT1B 2F9DA 3VVUA 3VGVA 3ZKBA 4HKQA 4WK1A 1KQKA 4X4RA 2OPQA 4PUOA 5IT9Y 1S48A 5I42A 2M9KA 4URLA 1S7HA 4FF1A 1I51B 4Y00A 4ED2A 2JDJA 5C5JA 1VS3A 1TFYA 2AE8A 1S9EB 1JLQA 2KRBA 3MFIA 2CJAA 1S7IA 5KFQA 5HVFA 1AYEA 1SQFA 3FMWA 1HFEL 1XNQF 4NYOA 1JLGB 1KQFB 3CCQS 3BH7B 4IRDA 6FDRA 3W66A 3T5JA 4NASA 4RW8B 3NWRA 4LFAI 2V8GA 2G2YA 3EVMA 4DCOB 5IC6B 5L9XA 4MAKA 1WF0A 3WHIA 2I2YA 3A12A 2VPZB 2AYBA 4WU3A 3TA0A 1S9FA 3W63A 3S7RA 3CJ5A 3J7ZT 1JJCB 3D54A 5J1PA 3I4HX 4IFDF 4QNJA 4IH7A 5KT6A 1Z5CA 5I4MA 2HFVA 2HFSA 2K7KA 2MKIA 4LF5F 1LV5A 4PRVA 4P7AA 1JLAA 4DS4A 2HVEA 1HNVA 3JYTB 3TQEA 4USVA 4RW4A 3KHLA 1X4DA 4U8YA 1JK9B 5ETNA 2QL9B 4RJVA 2F4VE 3QYYA 2NXUA 4KRWA 4DV3F 1N33I 1RAHB 2F8HA 1KNZA 3LA0A 1D9AA 2W7AA 3GJRB 1PKPA 1SCJB 3HF5A 4EZ6A 3NCPA 1VCTA 1KWMA 1RWWB 2MZTA 4PQUA 5IQ6A 4X62F 1HNXI 3PFEA 5AE3A 4EYIB 2UUCJ 1PGZA 4L6V3 4ELTA 4KKOB 3QGPA 4R8UB 2R8HA 4I2PB 3P4UB 1C1BB 1PVGA 3EVOA 1WTFA 2LP4A 2VG5A 2PNMA 3KXDA 2B56A 4NOHA 2QG9B 2OPPA 4DUYI 2IJFA 3K8VA 1JLCA 1WEZA 3V81B 2KYXA 3ITHA 4C2MA 3R7SB 4EFAC 1TR0A 3MR5A 2QLBB 3LP1A 3L09A 2MTLA 1E3PA 1C4CA 2AJFE 4ZVQB 4FW3A 4U3BA 1RTDB 3KJQB 2EBEA 1NSAA 5B0DA 5C42A 1H6KX 1SB6A 2JEAA 4OJHA 5GAEI 2EFGA 2XHCA 3UDEA 5L3JA 1LWCB 4KC5A 4TNOA 1LWEB 2MDAA 2EVZA 5A8WB 4IUFA 1EAYC 2CJYB 2FVPA 3C16B 3D3BJ 4KIAA 2DCLA 2QIFA 4FPIA 1V3ZA 3QQCD 3T6BA 4FW5A 3Q8UA 1VISA 1NHUA 4DQSA 2ZH9A 4NCAA 3H8YA 1R6VA 5J2QA 3C46A 2OTLS 2BE2A 1NXIA 1UAWA 2GHWA 2JFKA 1ZXNA 4W98A 4GVBB 2RDJA 2YWHA 4NLUA 2MLXA 2HS0A 4ZPBA 3DFEA 3W62A 4B17A 2YX1A 4FDFA 2J0QD 3DD6A 3OQ2A 2DT9A 1K1QA 3DC2A 1N34I 3H1CA 1TAQA 2ZH3A 1RHKB 3RRGA 4RW6A 2OPSA 4BWJA 3KHRA 4R0EA 4EI2A 4KH1B 2A6OA 2QN6B 3MTJA 1L3TA 4OX9E 1YQHA 4DV2J 3I0SB 3VAHA 3L7ZB 3VAFA 3GFXA 2HFOA 3MCMA 3HSDA 4HYKA 2RQKA 3RBEA 4OO1C 3KLGA 1N32E 1QAIA 3O3LA 2CJXB 1EETA 2DHGA 1HI1A 3US5A 3RBDA 4V19X 3Q2SC 4E0DA 2N7CA 1HQUB 2DCUB 1GNKA 2R8KA 3CNQP 1I94E 5IS2A 1SL1A 3AJ2A 4Q43A 1L3VA 1MN7A 4F04B 3TJ9A 3O44A 2ZBRA 4M5LA 3CDAA 2FIUA 3QJJA 2HGLA 5LSOA 3OW2R 2FLNA 3T19A 4CO4A 1LW2A 3V6KA 1YIJS 2QYGA 1REVA 2QFIA 4ECUA 3W7BA 3MM8B 1NPKA 3HSGA 1B0PA 3KNGA 3KLFA 2UXDJ 2YNIA 3QZ8A 4QR1A 2KL8A 2UVWA 4PZVA 4EO8A 4IFDD 1RTHA 4WTYA 4LBIA 3IWXA 4DBQA 3TOQA 1U7LA 2EW9A 4ZCIA 4LRDA 2B6AB 4A8OA 4MJKA 4B3MF 2GO9A 3MEGA 5E41A 2PN6A 4ES3A 2CGEA 3W2VB 2H4YB 3OL9A 5ETOA 4N5SA 4JV2A 2ZKTA 3WDOA 2AYGA 4KT0C 2C3MA 2ZUGA 3QWPA 4CLFA 2XS5A 4CZCA 5E7OB 4KHRA 2ACMA 5G4DA 1PSDA 1SIWB 3MWBA 4QR2A 4B3TI 4X66J 2EK6A 1RT4A 1BQNA 5K36B 1XR7A 3I56S 1H98A 1IKWA 3CCES 3QSYB 4DL2A 4QWBA 5LJ3Y 4JV5I 4OYWA 2Y0BB 2QC3A 1FVSA 1U1PA 3JQKA 3PZPA 4DU7A 1UW4A 3EICA 4DMZA 1PILA 2YKOA 1KC8T 1NJXA 2QMUB 3CCLS 3M2VA 4ZLJA 2B9WA 3BKFA 2RF2A 3PR4A 3E01A 3GIIA 2CDRB 4DR4E 3MMJA 3UI3A 4AIMA 3TVYA 3LP0B 5IZHA 1YKWA 4IYQA 4QYZK 4TN2A 2KVIA 2CQ3A 1LK5A 1RGVA 2NYIA 3THPA 4CLSA 5MAOA 3T1YE 3BGFA 2Z4PA 4LF4E 4HTIA 4AQYI 3N5BA 2ZH5A 1DLOA 2B4UA 1C0UB 5DJBA 1HD1A 1WEYA 3NG8A 1UTAA 4O4GB 3DXBA 1F9EB 1LK7A 4LF7I 1RLDA 3J81j 4LF8F 2UXCF 3NNCA 2QTWA 1OY6A 4ETZA 5IOLA 4LFCE 2DHHA 4KTQA 3ZZOA 1URRA 4Y2CA 2X3DA 3DGVA 3HI9A 4QW9A 5GMEA 1V6HA 1SVDA 5KG0A 5J2PA 4JI3J 2DVIA 5LMNE 5D4OA 1RTDA 2P2CB 2AEFA 2NS1B 2MXYA 4AYBD 1Q8LA 1OSCA 3ENQA 4ER8A 4I68A 2GMHA 4RBVA 4K7QA 4F2SA 3ZNUA 2IOPA 1T9WA 2BQUA 2L9NA 3C8YA 3CDIA 3HHLD 1IKYA 1S9GA 3CD7A 2LQJA 1HYSB 2UV8G 2IA0A 1CS4A 2KFYA 3DYAB 4K4ZA 2YWWA 4YDXA 3HVRA 4YHHE 4ZN1A 2NN6E 1OYEA 4K5SA 2FB0A 1XNQJ 1NHHA 4CLLA 1NK0A 2K1RB 4F50A 4GMKA 1X9WA 3B4TA 3NGKA 2HEKA 3VAJA 2VBZA 3HCXA 2W01A 1T3NA 3G8TA 2XEXA 2M4MA 5KT5A 1GXUA 3G96A 2DGWA 5GAHI 3MEDA 2DO4A 1T05B 5KG5A 1TL7A 2BKNA 2QT7A 2XNQA 4DV5F 1HHTP 3PM9A 4JI1F 3KTQA 4CCHA 1IR2A 1S1WA 1TKXA 1FRKA 4BA2B 4OZ5A 4L76A 2DGQA 4B3SF 1SQEA 3T1YF 4Y3CA 4LF5J 3HLUA 4H4MA 4AL5A 1VOMA 1N4LA 3N0VA 3DDKA 4G3IA 2A3JA 1ZM2A 4WZQA 5GMDA 3U02A 1X31C 1VRUA 4ELUA 2UXDI 1NCLA 1ZTWA 4XTJA 2PO1B 2ZNYA 1K73T 2OFGX 5BYSA 4DV3J 4LFCF 4RNFA 1T03B 5D0HA 3GR1A 3DRSA 1FNOA 5L1KA 3O6QA 3A8JA 3W61A 4YB1P 1CQNA 3K8WA 1N5VA 1JKHB 3V6DA 3J80Q 5SZTA 5K36C 4TY8A 5CZVA 1XMQF 7FD1A 1IR1A 4O4RA 2FJWA 4DV4E 3GFYA 1HQUA 4KQZA 2X3GA 2DNPA 4ED4A 3ENVA 1NK9A 1I5OB 1S6PA 2QA2A 3P06A 1VR6A 2AX0A 2R7VA 4X62J 5L38A 4CM0A 5B08A 2RU3A 3NZKA 3PS3A 5KT7A 4LVNP 2VA3A 3RJMB 4KB7A 3CJ8A 4ILMA 3QJLA 4X66I 1BY9A 3BYRA 5D78A 2G0IA 2JT2A 3MCNA 3SDEA 3MM8A 1GTHA 4YHHF 1J2VA 2ZVIA 1Q7LB 3RZAA 1KQGB 1RSCA 5D0GA 1RADB 3PW0A 1NH7A 3ZTQA 4HR2A 1UEKA 4Y34A 1T11A 3BBCA 3H59A 1EARA 1UA1A 1RUSA 1RTIB 2N7YA 2XLJA 1SJFA 1GFWB 1RWNB 1KHVA 2D1CA 4WU2A 2PD1A 4X64F 1T9UA 2UXBI 4TLRA 2FY1A 4LCHA 4X65E 3HJVA 3NGRA 1LWFB 3DDIA 2FZKB 4QYZJ 1CJTB 3WU5A 3BGRB 4KV8B 4UOHA 4HL9A 3EGZA 1KFDA 3H4DA 1F5BA 2E1PA 1HD0A 4X4QA 2ERRA 2RKIA 1QZRA 3IGNA 1U6FA 3BDEA 2LA4A 3HSJA 3HM9A 5A6PA 1XMOF 3NS6A 4QPXA 5IT9C 4OYPA 3H25A 3PW5A 2B7BB 3IO1A 4U9RA 3D6TB 1Q95G 1FD8A 1I3OB 2HNYB 3QT8A 1RYRA 2HZCA 5LSLA 2D9PA 4P2MA 1SH0A 2YKQA 2FJDB 1Y11A 4HEA9 1FKPB 2AIRB 1UFKA 1VMBA 3PXGa 4CT9A 4LFBE 1TP7A 3FRYA 2Z5BA 4YS2A 3Q6NA 4OZEA 5BR8J 4I3HA 1BKNA 3KLEA 2OSRA 2OAUA 2VC0A 1RAEB 2DIUA 4OZ0A 2BEFA 1N5YA 4GKKI 3ZZZA 4P10A 2BR2B 4MTPA 4J9UE 4DV0E 2E1MC 2CJBA 5AXNA 2V4RA 5IT0A 2RE1A 4OZ1A 2RJZA 1SH2A 4UT4A 4P71A 2IDEA 2RU9A 1WC0A 2ZZNA 4IDKA 3M8RA 2DXFA 1LFWA 4HY1A 5C0XF 1HNZF 3HJFA 5ETRA 2WZ1A 1BD6A 3AD9C 3EYZA 4C3MA 4XDDA 2YQ3A 3GONA 1O51A 3ISND 3A8KA 1WHVA 1S1UB 2I6WA 5LMUF 1H3DA 3ONQA 2ZOMA 4Z7CA 2GS8A 1UCNA 2ZD1A 1SV5B 1TL5A 5IWAF 2A0FB 2YH0A 3D1OA 4ZJOA 2HBRB 1VK8A 4PR6A 2AYMA 2RQCA 2ASJA 2HZVA 5IQQA 5JXSA 4KQVA 1TFWA 2FVCA 3K5OA 2VQFE 1FWKA 1HPZA 2FDNA 2I5JA 2NSCA 1GX5A 2CQIA 4USHA 2EBGA 4LF5I 3L7OA 2BYCA 5KT2A 1NSKL 3GMEA 2VU5A 1RWPB 1U45A 3UE2A 2ROPA 3P3CA 4F3MA 1WG5A 5A8KA 1OY8A 2Q66A 2P9EA 2XMTA 3BQ1A 2YKNA 2C2ZB 4IZJB 4B3MJ 4NRUA 2CIMA 3PRDA 5MLCV 2OP5A 2P6TA 2HRUA 1AA1B 4X4SA 4RW7A 2XMWA 1TVRA 1WKKA 1WHWA 1T7PA 4DL5A 3FBBA 4ZDNA 1IVZA 2YQ1A 4Y28C 3GV5B 3CD6S 5A8RB 3R2CJ 2F5GA 3QRRA 4C8NA 3MPVA 2RDIA 4NCGB 4LR8A 3CXCR 2UVUA 3R5AA 1J27A 3HPOA 3UN3A 4RNOA 4UZBA 4EBEA 2HWHA 2B43A 5IT4A 2GAGC 3J81U 3ILJA 1NKEA 1N36E 1SKWA 3CB4A 3W9HA 1LEOA 4QWEA 1RU1A 2Q43A 4PPDA 4J7CA 4E2FB 1VQPS 4O3RA 4O3NA 3FDSA 4DL6A 3DMJA 2KU7A 2F40A 2L9WA 2PMWA 1Q1KA 1S6QB 2MSTA 5DZ6A 4I2QB 4ECVA 1PG5B 4IG0B 4ECWA 4C11A 4FF2A 2WBMA 4DSIA 3J7A1 2R2SA 3NCRA 1U4BA 2DISA 4FW4A 4Q44A 1B0VA 2WB1D 2XGQA 3N79A 3WU6A 3JTOA 3TX0A 2CQ1A 4IG3A 2LQBA 2M2BA 4NLOA 1NK8A 4EK2A 1WC4A 4GC6A 4IRCA 3L95X 2IAJB 4OJ3A 3F0NA 5B09A 5RUBA 1SL2A 1U25A 2K3KA 4NL5A 3AOCA 2DTJA 5K14A 4MIBA 2UXCJ 4LF8J 5KFHA 2CPXA 5E3RA 4ZVSB 4CI0B 4J5OA 1ZXMA 3OSPA 4KH0B 4DWIA 4ZLPA 3LP2B 5DQHA 2RILA 1APSA 4Z37A 3KMQA 2ZJQQ 2V68A 4HVZA 4ED1A 2LXUA 2MPUA 3THVA 2KG1A 3QRQA 3MM7A 2R42A 1SL0A 4YR3A 3DKDA 3HZEA 5ETTA 4KGXB 3RUBL 5HP1B 1RABB 2CPHA 5EHHA 2M70A 2HHVA 1UDQA 4PXBA 4JI4F 5E3CA 2PNZA 1GMWA 4JI5E 5ELWA 3GIKA 4Q2LA 2UU9E 4PWDA 2FC9A 1BWEA 1IBLF 4ZOSA 1N36F 4M1KA 2DR7A 2FJEB 1TMJA 2J6UA 3HVWA 1KONA 4P7TA 2XNRA 1YRXA 3FJ2A 4D3GA 5A2QU 3W2WB 2PEHA 4BA1A 3QT5A 1SUQA 3NNAA 2YWFA 1RA6A 1RWOB 3D1QA 1SKSA 1FKOB 5CHCB 3U1LA 2ZHBA 1PJ7A 5AT1B 2UV8A 3ZM7A 1H73A 3RAXA 2IERA 1MX0A 1U02A 3DI6B 4RPFA 5C0XD 2IC3B 4U67Q 3CJKA 2LEAA 3MOJB 5DROA 4DV5J 1FRLA 4JI1J 5KOWA 3W65A 2CRLA 3BBFA 1LWXA 4B3SJ 3OLAA 2LQ9A 5JEAB 2Y8YA 4X84A 1WF2A 2DIVA 4DPTA 3IRXA 3HHEA 3DRPB 4DPUA 2HPUA 3KK1B 4OZ3A 3HX9A 2DRAA 4TKTA 1CC8A 2Z2YB 3Q8PB 5U47A 3AXMA 3M8PB 1FA0A 1DARA 3QSIA 4OHVA 2LXFA 3VTIA 1RCOB 2GGPA 4DQIA 1NMEB 4A8QA 3VGSA 4ZVEA 1QE1B 1XMQJ 4JYAE 5AXKA 2B4VA 1FJCA 5G0RB 5DDPC 5ETQA 2QLWA 3BQ2A 1SV5A 3IG1B 1E6VA 2YNFA 5DG9A 2R7XA 2OPRA 2KG0A 4FPRA 1WOOA 3FMBA 2B9XA 4O44B 2XMMA 1VQNS 4ED6A 1SJ1A 5B0FA 4OX9I 2VG6B 3U1KA 2F8MA 4NXME 2BJDA 2HVIA 1RT5A 4JI6F 2QX0A 4ZPDA 4YHHJ 1NBEB 2XSJA 4ELVA 4DCJB 1TELA 3VQTA 2V4QA 4MMOA 2H5IB 3BN7A 3SCLE 1N32I 1EKRA 3MR7A 2W4DA 2FVRA 1MMNA 4X64J 1YSJA 2PA8D 4IZKA 1I94I 4O3PA 4IFVB 3EMTA 1T9VA 1Y3JA 4WFAQ 2UUAF 3TUIC 3OTDA 2ZWOA 4U96A 4J9SA 5M2RA 4IFYB 2PO0A 5E2QA 2NN6B 4KGMA 1RJJA 2F7VA 3F44A 3MUTP 5C24B 4H4KC 4FF3A 2BVZA 1ZM3A 4DV1F 3V2UC 1YDLA 3SCIE 3C6UB 4NLGA 4M94A 2VA2A 1NK7A 1VBKA 4QJVA 1JX4A 1XMOJ 2HNDA 2EK1A 2JRSA 3MEEB 1FVQA 2XSFA 3LUYA 4ZVOB 5B0BA 2E1CA 2CADA 3EDRB 4LF8I 2UXCI 1IWAA 2RQ4A 3U1NA 3G86A 2DNMA 1HBNB 2MKYA 3S01A 2VF3A 4I4BA 2ZE2B 1S1TB 2O67A 4G1IA 3RG6A 2K3IA 4U7UK 3P5TL 4IG0A 1QUPA 1IBKE 1CJKA 2RMLA 3M85G 3KK2A 2X1GA 3M30B 1RQ0A 2RB7A 1WDTA 1RT3B 3Q8SB 3GCWP 1UVLA 4GC7A 2DNLA 3OXLA 1LXNA 1V3SA 4U7UD 2XCAA 4XAKA 3PDNA 4PXDA 3BGUA 1R27B 2VPWB 3THTA 1HNZJ 3FNNA 1WELA 4NXNE 1JJ2R 4CLYA 3MM9A 3H2UB 4B9VA 5HL7Q 1TK8A 1ZA2B 3OJSA 5LMUJ 1VHFA 4BC9A 3BREA 4XTTA 1LFPA 1NU4A 2V8PA 4WYLA 4C8YA 4C6AA 4RL1A 5IWAJ 2KZZA 1IBME 1N56A 1S0OA 4F8RA 4DR4I 4OI1A 1QUVA 4DV5I
chains in the Genus database with same CATH topology
4N3OA 1N33E 4K0KE 5A2QQ 2HKEA 4X62I 1KTVA 3ZKBA 4X64E 1UEKA 5LMUI 2ZM6E 4DPXA 4DR5I 2R42A 1FWLA 4JYAI 4JI4E 3K85A 3T1YI 2VQEI 4DR1I 3OTOI 4LF4I 4B3ME 4URLA 2Q2EB 4LF9E 1IBLE 2O1TA 1MU5A 1Z0GA 2UUBI 2Z5CA 2UXBI 1FJGI 3LNUA 1Z0TA 1XNQE 2ZITA 1NZ0A 4X65E 1PIEA 4JI7E 2HKJA 1NHJA 4JI5E 4JI6I 2UU9E 4LFCI 3WU5A 4DUZI 4M1KA 4DU8A 1WUUA 2CGEA 4YY3E 4R1FA 1ZM4A 1IBKI 4NXMI 1XMOE 1KVKA 1N34E 3QT5A 2UXDE 2BM0A 1Z0VA 1XMQI 4IZJD 4LFAI 4DUYE 2V34A 5LMNI 1QZRA 1Z0BA 4MYUA 2BV3A 3T1HE 1Z5BA 4LF6E 1A6FA 1RREA 4B3TI 1USVA 3ZM7A 1H73A 1S4EA 1K47A 1MX0A 1U2RA 4DV6E 2UUAI 5IT9C 4RPFA 4B3RE 3J81C 3LTOA 3QT8A 2O1VA 1HR0I 4NXNI 1KKHA 4JI0E 1Z5CA 3PYGA 1B63A 2HFSA 4GKJI 4JG4A 4JV5I 4PRVA 4P7AA 2V2ZA 1FKAE 1HNWE 2A2CA 4LFBE 4DPTA 4DU7A 2Z5BA 4YHHI 4DV3E 4DR6E 3Q6NA 5IT9Q 4DR3E 1S16A 4DPUA 4I3HA 3K1JA 3M6AA 4DV2E 1BKNA 4IZKB 3H4LA 2ZBKB 1RR9A 2F4VE 4JI1I 4GKKI 3WU3A 1HNZE 1XHKA 4DV0E 1N33I 1DARA 4K0KI 4DR4E 2A2DA 1D6TA 4B3SI 1H74A 4UT4A 4WUBA 3CWVA 4X62E 3JAMC 1PKPA 3ZZTA 5LMUE 5BR8I 4HY1A 2DEJA 2Z5EA 2CZ9A 2HFUA 2OI2A 4JYAE 3T1YE 1IBLI 4LF8E 2UXCE 3OTOE 1N36I 4LF4E 3HULA 4AQYI 3GONA 1J5EI 2PNLA 4USKA 4WUDA 2LJPA 4JI2I 4JI7I 5IWAE 2UXBE 1HNXI 1FJGE 4KHPE 4Z7CA 2UU9I 4Z7YA 4LF7I 2HK3A 2GS8A 2E5LE 4JI6E 2HK2A 1Z59A 4YY3I 4LFCE 4DUZE 3QT7A 4JI8E 3PYEA 1PVGA 2GQ0A 4OX9I 1KIJA 1USUA 5LL6R 2PNMA 4NXME 4DR7E 5FLXC 4DUYI 1FNMA 5GMEA 4DR2E 2V2VA 4KQVA 3Q6MA 4LFAE 2VQFE 1XNRI 1FWKA 2O1UA 4LF6I 5LMNE 4FW9A 3LPSA 1N32I 4USMA 2UUCI 4LF5I 4B3RI 4DV4I 4B3TE 3B8HA 4HACB 2HHHI 2UUAE 2IOPA 4DV7I 4JI0I 5FLXQ 1HK7A 1HR0E 4IZKA 1I94I 2EFGA 4IZJB 5L3JA 4JV5E 4JI3I 4DV1E 3J81Q 5A2QC 1IBMI 1Z5AA 4YHHE 2X36A 3ZZUA 1NHHA 4X66E 4PRXA 4P52A 2F4VI 1ZM3A 2J7KA 1HNZI 1H72C 3ZKDA 4DV5E 1OJ4A 4X64I 4JI1E 3V2UC 2ZM6I 4GKKE 4DXLA 3B78A 4JI4I 1ELOA 1VISA 3QT6A 3PRYA 2XEXA 4B3SE 4DR5E 4B3MI 1Z0CA 4LF9I 3HJCA 2VQEE 4DR1E 1FI4A 1MG7A 4FN5A 1ZXNA 2IOQA 1N0VC 5BR8E 4LF8I 1XNQI 2UXCI 3K17A 1NHIA 4X65I 1Y6ZA 4DPWA 2UUBE 4JI5I 1N36E 5IWAI 4AQYE 1J5EE 3JAMQ 1B62A 2VF3A 4KHPI 4JI2E 3B82A 2E5LI 1Z0WA 1HNXE 1ZM2A 2Z5CB 3PYFA 5GMDA 4HYMA 1XMOI 4LF7E 3J80C 1N34I 4DPYA 2UXDI 1IBKE 2V2QA 4XTJA 4JI8I 2DEIA 4DR7I 2R3VA 3WU4A 3T1HI 1XMQE 4OX9E 4HACA 4DR2I 1H7SA 1Z0EA 1N0UA 2VQFI 4DV6I 4FWGA 3J7AG 4PU9A 3ZZ0A 4UTGA 3J80Q 1XNRE 4MYTA 3WU6A 1H7UA 2WW4A 1N32E 3Q1QA 2UUCE 4LF5E 4IZJA 4DV4E 4FWDA 2BM1A 4NXNE 2CG9A 2HHHE 4EMDA 4ED4A 1Y4SA 1HNWI 1Y4UA 3P06A 1EA6A 4GKJE 4LFBI 4DV7E 4DR6I 4DV3I 4HXZA 4FWHA 4DR3I 3F0NA 2AJ4A 3D4JA 1I94E 4DV2I 3J7AM 4DV1I 4ZVIA 3PYDA 1ZM9A 2E1RA 2NPFA 5FWKA 4JI3E 2O1WA 2V8PA 1ZXMA 4X66I 1IBME 2X7IA 3V5RA 4DV0I 1EI1A 2Z5BB 4DR4I 4WUCA 4DV5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 E;  4K0K E;  5A2Q Q;  2HKE A;  4X62 I;  1KTV A;  3ZKB A;  4X64 E;  1UEK A;  5LMU I;  2ZM6 E;  4DPX A;  4DR5 I;  2R42 A;  1FWL A;  4JYA I;  4JI4 E;  3T1Y I;  2VQE I;  4DR1 I;  3OTO I;  4LF4 I;  4B3M E;  4URL A;  2Q2E B;  4LF9 E;  1IBL E;  1MU5 A;  1Z0G A;  2UUB I;  2UXB I;  1FJG I;  3LNU A;  1Z0T A;  1XNQ E;  2ZIT A;  1NZ0 A;  4X65 E;  1PIE A;  4JI7 E;  2HKJ A;  1NHJ A;  4JI5 E;  4JI6 I;  2UU9 E;  4LFC I;  3WU5 A;  4DUZ I;  4M1K A;  4DU8 A;  1WUU A;  4YY3 E;  4R1F A;  1ZM4 A;  1IBK I;  4NXM I;  1XMO E;  1KVK A;  1N34 E;  3QT5 A;  2UXD E;  2BM0 A;  1Z0V A;  1XMQ I;  4LFA I;  4DUY E;  2V34 A;  5LMN I;  1QZR A;  1Z0B A;  4MYU A;  2BV3 A;  3T1H E;  1Z5B A;  4LF6 E;  1A6F A;  1RRE A;  4B3T I;  3ZM7 A;  1H73 A;  1S4E A;  1K47 A;  1MX0 A;  1U2R A;  4DV6 E;  2UUA I;  5IT9 C;  4RPF A;  4B3R E;  3J81 C;  3LTO A;  3QT8 A;  1HR0 I;  4NXN I;  1KKH A;  4JI0 E;  1Z5C A;  3PYG A;  1B63 A;  2HFS A;  4GKJ I;  4JG4 A;  4JV5 I;  4PRV A;  4P7A A;  2V2Z A;  1FKA E;  1HNW E;  2A2C A;  4LFB E;  4DPT A;  4DU7 A;  4YHH I;  4DR6 E;  4DV3 E;  5IT9 Q;  4DR3 E;  1S16 A;  4DPU A;  4I3H A;  3K1J A;  3M6A A;  4DV2 E;  1BKN A;  3H4L A;  2ZBK B;  1RR9 A;  2F4V E;  4JI1 I;  4GKK I;  3WU3 A;  1HNZ E;  1XHK A;  4DV0 E;  1N33 I;  1DAR A;  4K0K I;  4DR4 E;  2A2D A;  1D6T A;  4B3S I;  1H74 A;  4UT4 A;  4WUB A;  3CWV A;  4X62 E;  3JAM C;  1PKP A;  3ZZT A;  5LMU E;  5BR8 I;  4HY1 A;  2DEJ A;  2CZ9 A;  2HFU A;  2OI2 A;  4JYA E;  3T1Y E;  1IBL I;  4LF8 E;  2UXC E;  3OTO E;  1N36 I;  4LF4 E;  3HUL A;  4AQY I;  3GON A;  1J5E I;  4USK A;  4WUD A;  2LJP A;  4JI2 I;  4JI7 I;  5IWA E;  2UXB E;  1HNX I;  1FJG E;  4KHP E;  4Z7C A;  2UU9 I;  4Z7Y A;  4LF7 I;  2HK3 A;  2GS8 A;  2E5L E;  4JI6 E;  2HK2 A;  1Z59 A;  4YY3 I;  4LFC E;  4DUZ E;  3QT7 A;  4JI8 E;  3PYE A;  1PVG A;  4OX9 I;  1KIJ A;  5LL6 R;  4NXM E;  4DR7 E;  5FLX C;  4DUY I;  1FNM A;  5GME A;  4DR2 E;  2V2V A;  4KQV A;  4LFA E;  2VQF E;  1XNR I;  1FWK A;  4LF6 I;  5LMN E;  4FW9 A;  3LPS A;  1N32 I;  4USM A;  2UUC I;  4LF5 I;  4B3R I;  4DV4 I;  4B3T E;  3B8H A;  4HAC B;  2HHH I;  2UUA E;  4DV7 I;  4JI0 I;  5FLX Q;  1HR0 E;  1I94 I;  2EFG A;  5L3J A;  4JV5 E;  4JI3 I;  4DV1 E;  3J81 Q;  5A2Q C;  1IBM I;  1Z5A A;  4YHH E;  2X36 A;  3ZZU A;  1NHH A;  4X66 E;  4PRX A;  4P52 A;  2F4V I;  1ZM3 A;  2J7K A;  1HNZ I;  1H72 C;  3ZKD A;  4DV5 E;  1OJ4 A;  4X64 I;  4JI1 E;  3V2U C;  2ZM6 I;  4GKK E;  4DXL A;  3B78 A;  4JI4 I;  1ELO A;  1VIS A;  3QT6 A;  2XEX A;  4B3S E;  4DR5 E;  4B3M I;  1Z0C A;  4LF9 I;  2VQE E;  4DR1 E;  1FI4 A;  1MG7 A;  4FN5 A;  1ZXN A;  1N0V C;  5BR8 E;  4LF8 I;  1XNQ I;  2UXC I;  3K17 A;  1NHI A;  4X65 I;  4DPW A;  2UUB E;  4JI5 I;  1N36 E;  5IWA I;  4AQY E;  1J5E E;  3JAM Q;  1B62 A;  2VF3 A;  4KHP I;  4JI2 E;  3B82 A;  2E5L I;  1Z0W A;  1HNX E;  1ZM2 A;  3PYF A;  5GMD A;  4HYM A;  1XMO I;  4LF7 E;  3J80 C;  1N34 I;  4DPY A;  2UXD I;  1IBK E;  2V2Q A;  4XTJ A;  4JI8 I;  2DEI A;  4DR7 I;  2R3V A;  3WU4 A;  3T1H I;  1XMQ E;  4OX9 E;  4HAC A;  4DR2 I;  1H7S A;  1Z0E A;  1N0U A;  2VQF I;  4DV6 I;  4FWG A;  3J7A G;  4PU9 A;  3ZZ0 A;  4UTG A;  3J80 Q;  1XNR E;  4MYT A;  3WU6 A;  1H7U A;  2WW4 A;  1N32 E;  3Q1Q A;  2UUC E;  4LF5 E;  4DV4 E;  4FWD A;  2BM1 A;  4NXN E;  2HHH E;  4EMD A;  4ED4 A;  1HNW I;  1EA6 A;  4GKJ E;  4LFB I;  4DV7 E;  4DR6 I;  4DV3 I;  4HXZ A;  4FWH A;  4DR3 I;  3F0N A;  2AJ4 A;  3D4J A;  1I94 E;  4DV2 I;  3J7A M;  4DV1 I;  4ZVI A;  3PYD A;  1ZM9 A;  2E1R A;  2NPF A;  4JI3 E;  2V8P A;  1ZXM A;  4X66 I;  1IBM E;  2X7I A;  3V5R A;  4DV0 I;  1EI1 A;  4DR4 I;  4WUC A;  4DV5 I; 
#chains in the Genus database with same CATH topology
 3OHB A;  4MKV A;  4K0K E;  3OT9 A;  3CDU A;  2XWX A;  5K9F A;  4DUZ J;  2R2T A;  3BEG B;  4QIE A;  4CTA A;  3ZC4 A;  3T1Y I;  1WTB A;  4LF4 I;  4CLW A;  4OYB A;  4Y2K A;  4PAB A;  4KBI A;  2C2R A;  2FHJ A;  2QE5 A;  2CVE A;  1TUG B;  1BC6 A;  1JIH A;  1YTY A;  2V8V A;  5AJ3 F;  2XYG B;  1ZYQ A;  2YX4 A;  1HBU A;  4LFC I;  2ASY A;  1X4B A;  5KFU A;  4ALZ A;  4RNH A;  1U26 A;  3CIZ A;  1U0S A;  1WDD A;  2J6S A;  5GAE U;  5CZX A;  1W25 A;  2RUS A;  3BO4 A;  3H42 A;  1Z0V A;  1XMQ I;  1CJV B;  5L39 A;  2DYA A;  4NLP A;  1OYR A;  5LMN I;  4F4W A;  2B3T B;  2R7R A;  3VR1 A;  1USV A;  1M5K C;  3BZQ A;  4RNN A;  3CJ0 A;  3CUL A;  3BV8 A;  5FDL B;  4RO0 A;  4HH0 A;  2O1V A;  5CYM B;  1EIY B;  4LF6 F;  1S1V A;  1Y5I B;  1HAR A;  1B63 A;  3CE8 A;  1IQT A;  1HWK A;  3EZO A;  2I9S A;  4YHH I;  3T5H A;  2YPZ A;  4MU4 A;  3LPE A;  2VFU A;  2MEW A;  3H4L A;  1SKR A;  2BKP A;  4Y65 A;  1QSL A;  3D67 A;  2CPJ A;  2AHO B;  4QQB A;  2NN6 C;  3DCA A;  1B64 A;  3G8Q A;  1FJ7 A;  2KKH A;  3WU3 A;  2R7W A;  4R5P B;  1XHK A;  3FVY A;  4WP9 A;  4F67 A;  2EFP A;  1S12 A;  3ICL A;  2EEY A;  5DM6 Q;  4RUB A;  1C0T A;  3QWU A;  1VC0 A;  5LXR A;  2DEJ A;  1MN9 A;  5HRO B;  2LKZ A;  1JJ4 A;  5GAG U;  4DG1 A;  3MPY A;  4DL3 A;  3HUL A;  3E3X A;  3DLG A;  6AT1 B;  2JX2 A;  1IR0 A;  4USK A;  1JXV A;  2IIH A;  4KSE B;  3T3F A;  2C2E A;  3TAM A;  1TV6 A;  2CQ2 A;  3UWT A;  5D3G B;  2DR9 A;  4KO0 B;  3QFW A;  4KGK A;  3I9V 9;  3D6H B;  5ETM A;  3OUY B;  1OSD A;  2HW3 A;  4MU0 A;  2PGC A;  1RWM B;  4WZM A;  4DR7 E;  2LA6 A;  3GLL A;  4ECQ A;  5KT3 A;  4J9R A;  4IFD B;  4FKY A;  2PMH A;  4DR2 E;  2ZWP A;  1NKC A;  3W5X A;  4Q0B A;  3UNG C;  1S10 A;  1TL3 A;  4I1T A;  3EDQ B;  1QTN B;  4DV4 I;  5LSR A;  2VUG A;  1VQM S;  4ZCL A;  4LFA F;  2BOP A;  1LW0 A;  5F3T A;  1HR0 E;  4LR7 A;  2ZBC A;  3MEC A;  4JI4 J;  1EP4 B;  2OJ3 A;  1R0B G;  3FEZ A;  4C97 A;  3AOA A;  2IFX A;  3Q8Q B;  1RAO A;  1VQK S;  4C9D A;  2QV6 A;  4ENO A;  1REG X;  3OTC A;  1IBL J;  3SCK E;  1N36 J;  1HQE B;  4B9U A;  4MKY A;  1RT7 B;  3ZZU A;  3NOG A;  2DNO A;  5GMK a;  2Q3P A;  3TVK A;  1HNZ I;  3UPF A;  3SSS A;  3PJW A;  4KR0 B;  5IM0 B;  4ED5 A;  4ZHR A;  2ROE A;  3IFE A;  5J1E A;  3AAW B;  3NNH A;  1JLE A;  2VOO A;  3FFI A;  5FLX U;  4DR5 E;  3MCO A;  1PYT A;  1X4C A;  2CFX A;  3VGT A;  1P9Y A;  4RUA A;  1RAJ A;  1PBU A;  2B0G A;  4X65 I;  4DPW A;  2UUB E;  2GVZ B;  5IWA I;  3EZU A;  2GZO A;  1Q8K A;  2HQG A;  4WWS A;  3HD1 A;  2VQE F;  2V5H G;  4I6A A;  4FVC A;  2ZVS A;  2MY7 A;  2RHS B;  1H38 A;  3MMA B;  2QL7 B;  1VFJ A;  4WFX A;  4DL7 A;  2YH1 A;  3G6X A;  2EXU A;  4MT1 A;  1KDN A;  1O8B A;  5HQ8 A;  3CJR A;  4KGZ B;  2R7O A;  2JEB B;  1CSJ A;  1H7U A;  1MRO B;  3U1M A;  1IM6 A;  2MKC A;  4FWD A;  2FVS A;  3JTP A;  2IJN A;  2CQC A;  5LXY A;  3FQK A;  4ECY A;  4LFB I;  2FY8 A;  1NK4 A;  2K7J A;  2JLF A;  1KOO A;  1ZH5 A;  4O0I A;  3QIP A;  1HR0 F;  2UUT A;  3ET6 B;  3JQJ A;  4OZN A;  3NGS A;  1DTQ B;  4DV0 I;  4EGL A;  5KFY A;  1FJG J;  1NSP A;  4JI6 J;  2ACY A;  2Y0S D;  2C37 A;  3RB0 A;  2CZV C;  2ZM6 E;  4NPO A;  1ITP A;  2YNG A;  1FFS B;  2PMZ D;  4LSN B;  4F26 A;  1C2P A;  2ZBP A;  2Q2E B;  4OFZ A;  3CJ2 A;  3CC2 S;  1Q8B A;  4WE1 B;  4UQG A;  2ZDP A;  1OS5 A;  2XUL A;  2D69 A;  2XMJ A;  3GE9 A;  5H1S V;  3M7N D;  5KFO A;  4JI7 E;  5CYQ A;  2BAN A;  3U27 A;  1VLO A;  1HBM A;  1RHY A;  2N3O A;  1X0F A;  2UUA J;  4K4Y A;  2OUG A;  3HZG A;  4DFP A;  4ILL A;  4HHJ A;  3CW2 C;  1RAI B;  5I3U A;  4OLO A;  5KG3 A;  2HZA A;  1N5T A;  1PC4 A;  4DV1 J;  3UN2 A;  2HBZ B;  2LLZ A;  5T7L A;  4YY3 F;  2HRT A;  3D2W A;  4ICL B;  2DD8 S;  2COL A;  2O1P A;  4UQT A;  3R5D A;  4OHY A;  1N34 F;  3UCG A;  1BQX A;  3J7A N;  4ZVH A;  1BWV A;  3CDB A;  2CKW A;  5HMY A;  4TU9 A;  3RYL A;  3LTO A;  5E3Q A;  3TI0 A;  1RI7 A;  5F0W A;  4NI2 B;  4G1Q A;  3NBP A;  1XBW A;  4OO1 F;  1CJU A;  2AWZ A;  3KUE A;  2IYI A;  2A2C A;  5HLF B;  2HHS A;  1WSR A;  4GO7 X;  3EX7 B;  2WRM A;  1N6Q B;  4GO5 X;  4ED7 A;  4QIF A;  4C48 A;  1VQO S;  1OPI A;  4M8L A;  2YNH A;  4KHM A;  4C3L A;  2GO4 A;  1VQL S;  4M5D B;  2VJV A;  2HRY A;  1WOS A;  1URN A;  2JOQ A;  1YK9 A;  4PRF A;  2D3U A;  7AT1 B;  2P6S A;  3CJ4 A;  3CWJ A;  1GMW D;  2YBV A;  2P9C A;  4L3N A;  1JLF A;  1X4H A;  1S4F A;  3QAE A;  1IBL I;  3OTO E;  1N36 I;  4XIU A;  3GP9 A;  3RU0 A;  2ZHA A;  4A8F A;  2GMJ A;  4CIO A;  2HNZ B;  4KHP E;  3DHW C;  3QRP A;  2C39 A;  2R8I A;  5HMX A;  2E5L E;  4ZP7 A;  1HWJ A;  3L7U A;  3T6J A;  4FBU A;  1WC5 A;  4KJI A;  4MQY A;  3UR0 A;  3QLH A;  3M32 A;  2GHV C;  4JI8 E;  4IH5 A;  1R6Y A;  4DJB A;  4N76 A;  4FYW B;  3MEK A;  3EGW B;  2IM0 A;  3IR5 B;  2B8Q A;  1QLN A;  2HLU A;  2H65 B;  5KFZ A;  3OFE A;  5EUH A;  1JB0 C;  2AZ3 A;  2HQI A;  5HJX A;  2IM1 A;  2CPD A;  3H0P A;  4RBT A;  1TZ0 A;  3AOD A;  2JEG A;  3HVA A;  2KXN B;  5LT5 A;  4P2S A;  1MW7 A;  3QFH A;  5AJ3 J;  5EX0 A;  2HVD A;  2H54 B;  2VES A;  4P72 A;  1VYA A;  3RAQ A;  1S0N A;  3JSM B;  1UKU A;  1D8Z A;  3D7S B;  4JV5 F;  2R8J A;  2SXL A;  3D1H A;  5A76 A;  5FII A;  1ZA1 B;  2GC8 A;  4QNK A;  1NND A;  3N6N A;  2VFT A;  3P45 B;  2XS2 A;  4NEY A;  4DQP A;  3TEH B;  2G9O A;  2ZH6 A;  4JI5 I;  4HT7 A;  3G82 A;  2R4F A;  3PIO Q;  4LF6 J;  2OPQ B;  4PUO B;  1G6B A;  5BJR A;  5I42 B;  3JAM Q;  1TUW A;  3D66 A;  4DR1 F;  4V1A k;  3OTO F;  2Q6B A;  2Z57 B;  1YZ6 A;  4HI2 A;  3BDP A;  2CYY A;  1M5P C;  4E8U A;  1JLQ B;  2ILY A;  2EG2 A;  1NB7 A;  1R8P A;  3GYN A;  3HKM A;  3S8S A;  4LF7 F;  3TUP A;  1BXN A;  3OSN A;  4FXV A;  1UEU A;  4QWD A;  3RB6 A;  2QLX A;  3ILI A;  4ITS A;  2H3E B;  1M5S A;  5K36 E;  3MCS A;  1FRJ A;  3PV8 A;  2J5A A;  5IC4 B;  4B9M A;  1NKB A;  2HHH E;  1FDN A;  3G4S S;  4GKJ E;  2DY9 A;  2UZA A;  3EJM A;  3J7A M;  1NRK A;  4DV1 I;  4TVA B;  4A46 A;  2RS8 A;  2IRU A;  1AB8 A;  4QBU A;  4A8M P;  1UWA A;  3MOZ A;  4O0N A;  1UDS A;  1YJW S;  3ZTP A;  2W25 A;  1JLA B;  1XK8 A;  1HNV B;  5DRQ A;  3HHL A;  4CH1 A;  4RW4 B;  2R7U A;  1IBC B;  4OYX A;  1PJ5 A;  2RIJ A;  2BA1 G;  3IAS 9;  2A1B A;  1FWL A;  3AA8 A;  4RBU A;  4JYA I;  4WTO B;  4FBT A;  4WE1 A;  1RZM A;  1NPR A;  2GJI A;  1ZAW A;  3UD5 A;  3QAT A;  1MU5 A;  2Z5C A;  4LFA J;  3SFU A;  5KG2 A;  2IA6 A;  4OO1 D;  2WNR A;  2HKJ A;  1NHJ A;  5EWG A;  2Z8Q A;  1H2U X;  4PQU B;  1KLM A;  3C2P A;  3JXO A;  3MD3 A;  5DNX A;  1ZM4 A;  3ZZP A;  4Y0F A;  4NXM I;  4ERD A;  3C14 A;  2QSW A;  2E66 A;  2G0J A;  4UUW A;  3AOB A;  1FT8 A;  1SC6 A;  4DSL A;  2E5H A;  3R5J B;  2Y1L B;  2VOD A;  2GJ2 A;  3ILL A;  2AMC B;  2VG5 B;  4C8K A;  4B3R E;  2OPP B;  1MU2 A;  2C2D A;  4ZIW A;  5HVH A;  1JLC B;  2G2Z A;  2KHD A;  3ITH B;  3BR8 A;  4JI0 E;  5KFD A;  2VJU A;  2E9R X;  3LP1 B;  4C98 A;  5KFM A;  3PX0 A;  4HH1 A;  2WVB A;  3D3C J;  1QAJ A;  1HNW E;  4PWU A;  2VQE J;  1HLW A;  2IDL A;  3TA1 A;  2HHH F;  2ZFH A;  5DQI A;  5IT9 Q;  5ETL A;  1UJ5 A;  1D0E A;  5C42 B;  2B8P A;  2BOA A;  1XC9 A;  1LKZ A;  4EBD A;  2OIH A;  1S77 D;  2JEA B;  2AW0 A;  1FKA F;  4DUT A;  4KFB A;  3HFK A;  1VRT A;  1NZA A;  2M3D A;  3IBW A;  3G87 A;  1HNX J;  2DXD A;  3TAN A;  3E51 A;  2FHJ D;  2HG4 A;  2GML A;  3K57 A;  2UP1 A;  3MDF A;  3ZZT A;  3J81 Y;  3H2L A;  2MJN A;  3FK4 A;  2KN4 A;  5LOQ A;  1TAU A;  2OMO A;  2DRB A;  5DGB A;  4ZLL A;  1GTE A;  2CNO B;  5J2Q B;  4F0K A;  1X8D A;  2BE2 B;  2BE9 B;  3ELH A;  1FE0 A;  4MU1 A;  5F8M A;  1HR0 J;  1RXO B;  2YKA A;  2QA4 G;  3PCO B;  2CUY A;  2UXB F;  3PYE A;  5DRK A;  2HWT A;  1USU A;  2DHA A;  2B4O A;  1H7X A;  4AM3 A;  1M1H A;  4CO1 A;  1Q53 A;  3MPU B;  4FZV A;  5HBM A;  1RK8 A;  4RW6 B;  2OPS B;  4LF6 I;  2RD5 C;  2XHW A;  2YWE A;  5DS7 A;  4MKA A;  1VJQ A;  3TYT A;  1DZ5 A;  2L3M A;  4X4T A;  4C8L A;  4P7V A;  3CCU S;  3ZTO A;  3R1H A;  3ZTS A;  4PG5 A;  1Y3K A;  2RDD A;  1U0H A;  2DNQ A;  1YBT A;  3BSA A;  1NM2 A;  2BAB A;  2DNH A;  3KLG B;  3HSZ A;  4G65 A;  2GJF A;  1EET B;  2IBO A;  4ISA A;  3KRN A;  2V50 A;  4A8X A;  3VAG A;  1HW9 A;  4FS1 A;  4KGV B;  2GX8 A;  2KZM A;  1IBM I;  1WJ9 A;  3DGP A;  1L5U A;  1D8Y A;  4OHW A;  4EBC A;  4CO3 A;  2ZOF A;  2V0N A;  2KDO A;  5C0X B;  1SPB P;  2IMO A;  1ZPV A;  5CAB A;  4N47 A;  3MMB A;  1SKU B;  2VDI A;  1S6O A;  4YY3 J;  2H48 B;  1AUD A;  1RB0 A;  3OHA A;  4WKR A;  2ADB A;  2DR8 A;  2JNJ A;  1N34 J;  1LW2 B;  5DET A;  4N56 A;  1QSS A;  2MZR A;  2CPI A;  1REV B;  2KTQ A;  4GKK F;  1NHI A;  1RT6 A;  4MDT A;  1L3S A;  3KLF B;  2UVV A;  2YNI B;  4YN3 B;  1V5I B;  1J5E E;  3WIV A;  1MLA A;  1C4A A;  5A2Q Y;  1YJV A;  1RTH B;  1Z0W A;  1KHW A;  4G1P A;  4A8Y A;  4K2J A;  2HBQ B;  2XI3 A;  4DPY A;  5KG6 A;  2CQ0 A;  2XMA A;  2A18 A;  4ANE A;  4CLT A;  3MEG B;  3PS2 A;  5KFL A;  3EXC X;  4P2F A;  1NJZ A;  1PAU B;  2Z2L A;  1VLY A;  2E44 A;  4MYT A;  1VQ6 S;  3VAM A;  3LAL A;  3ZXW A;  5KFR A;  1F2H A;  1U1L A;  1XTZ A;  2BM1 A;  1R8B A;  1RT4 B;  1BQN B;  2M7S A;  2MGZ A;  5DRP A;  1UFW A;  3KJN B;  4K59 A;  4K4U A;  1IKW B;  3R27 A;  2VPY B;  3I6P A;  1R8H A;  3ETM A;  3PYD A;  3OFF A;  4JBC A;  1GXL A;  4IOC Q;  3UVJ A;  2NPF A;  2O1W A;  2HGM A;  3WX8 A;  1WC6 A;  3GV7 B;  3V4I A;  4LMZ A;  2V9W A;  1N33 E;  3IXQ A;  4PYD A;  5E3A A;  5ETS A;  3TZW A;  3CF5 Q;  1ZOT A;  2R8G A;  4PG4 A;  2HHP A;  3M2V B;  2MKJ A;  2RF2 B;  3IS9 A;  3E01 B;  2VQE I;  3AFG A;  1WOP A;  4LF9 E;  2ZDO A;  3OLB A;  4ZPV R;  3M8Y A;  3SMZ A;  1RKI A;  3NAH A;  1XJW B;  2QL5 B;  3RBZ A;  2CQB A;  2DH9 A;  4B3T J;  3IWL A;  3ADA C;  4IH6 A;  4LSL A;  1DLO B;  4B9N A;  2V69 A;  1HKA A;  2EC2 A;  2MKK A;  5KFN A;  4TU8 A;  4M63 A;  2D74 B;  5H9E K;  3PX6 A;  4JV5 J;  1RAF B;  4DUY E;  2E29 A;  1HNI A;  4ID8 A;  2KJV A;  1Y0H A;  1VC6 A;  2BBE A;  1Y5L B;  1A6F A;  2WP8 A;  4F0M A;  4DV6 E;  4OJ1 A;  4KE5 A;  3SV3 A;  2IVY A;  4CT8 A;  4AL7 A;  5J2P B;  4CLP A;  1HI0 P;  1HR0 I;  4HDH A;  3M8S A;  3R2D J;  1QVF R;  1T9T A;  4I6W A;  5FJ4 A;