4KHPI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
molecule tags Ribosome/antibiotic
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpI00
3T1YE 4DR3E 4DV3I 4LF8I 1KTVA 2DEIA 2XEXA 4JI4E 4FN5A 3JAMQ 2NPFA 4M1KA 4JI0I 3ZZ0A 1N36E 4DV1I 1IBMI 3PYDA 3K17A 1OJ4A 4FW9A 4NXNE 1XNQI 2UUCE 4DV5E 4LF7E 1I94I 1WUUA 2HK3A 4PU9A 4LF4E 2GS8A 1RR9A 1PIEA 4LF9E 4DV2I 1HR0E 4DR3I 1IBKE 1NHIA 1N0VC 2V2QA 4GKKI 2E1RA 2ZM6I 4B3MI 1XMQE 2A2DA 3GONA 1N36I 1U2RA 4LFCE 2HKJA 1H73A 5IWAI 4JI2E 2Q2EB 4GKJE 4DR4I 2V2VA 1Z0CA 1Z5BA 2UUAI 1PVGA 2VF3A 1HNWI 4JYAI 1A6FA 5BR8E 3B82A 4JI5E 4AQYE 4DR7I 4LFBE 4B3ME 2LJPA 4JI1E 2ZBKB 3PYGA 1S4EA 2DEJA 5LMUI 1FJGI 4JI0E 2HKEA 4YHHI 2UXDI 1ZM9A 4KHPI 1EA6A 3Q1QA 4URLA 1D6TA 1MG7A 1S16A 1UEKA 2HHHE 1HR0I 2R3VA 4DR1E 3QT7A 3HULA 1B63A 1N33I 4HACA 4DPYA 3H4LA 4DR5E 4B3SI 4PRXA 3ZKDA 3OTOI 4Z7YA 4JV5E 2UXCE 1Z0WA 1ZM3A 3M6AA 1MX0A 2V8PA 1ZM2A 5LL6R 4ED4A 1Z5CA 4X66E 1FWKA 1MU5A 4JYAE 4DV6E 4WUDA 3J80Q 3K1JA 4HXZA 4DUZE 5IWAE 4DV0I 4GKJI 4FWGA 4OX9I 3LTOA 3CWVA 2UU9E 4JI8I 4DV3E 1HNWE 2BV3A 5A2QC 5LMNI 2V34A 4DPXA 1XMOE 4JI1I 4USMA 2UXBE 1Z59A 2VQFI 4DR2E 2OI2A 4LFAE 4UT4A 4LF6E 4DV0E 4B3TE 2UUCI 4UTGA 4LFCI 4NXMI 3LNUA 1N34I 1EI1A 4JI3I 1Z0VA 2X7IA 4DR6I 1B62A 4KHPE 2HFUA 3J81C 2E5LI 4X62I 2UUBI 1IBKI 5LMNE 4ZVIA 1XMQI 3OTOE 2J7KA 2ZM6E 3J81Q 4DV4E 1RREA 4YY3E 2HFSA 1XNRE 3LPSA 2X36A 1NHJA 4DR5I 3V2UC 1ELOA 4JI3E 4RPFA 4DXLA 2EFGA 2UXCI 4DR6E 2E5LE 4DUYE 1HNZE 3ZZTA 2CZ9A 1FI4A 2HK2A 4WUCA 5L3JA 4XTJA 2BM1A 3B8HA 4LF5I 5LMUE 2UXBI 3WU6A 2VQFE 2ZITA 3QT6A 5FLXC 1K47A 1N33E 3PYFA 1Z5AA 1IBLI 4HACB 4P7AA 4FWDA 3ZZUA 3B78A 2HHHI 4Z7CA 4JI6E 2UUBE 3QT8A 4DR1I 1KVKA 2V2ZA 5IT9C 1H7UA 4LF5E 2VQEI 1N32I 5FLXQ 4JI2I 1IBME 4DU8A 4X64E 2WW4A 2UUAE 3T1YI 3QT5A 4X62E 4DPUA 3ZM7A 1N0UA 4DV5I 4DR7E 4LF4I 5IT9Q 4LF9I 1HNZI 4JI8E 3WU3A 1J5EE 4DV6I 4R1FA 1VISA 1N32E 4K0KI 4DUZI 4NXNI 4X64I 1XNQE 1ZXNA 4EMDA 4YHHE 1Z0BA 2AJ4A 4LFAI 1XHKA 4USKA 1HNXE 4DV2E 4FWHA 1ZM4A 4DR4E 1PKPA 1FWLA 4I3HA 1XMOI 1Z0TA 4LF8E 4WUBA 1J5EI 1QZRA 3V5RA 4DPWA 3T1HI 4B3TI 2VQEE 4DPTA 4DV1E 4DV7I 4NXME 5GMEA 2R42A 3D4JA 1KKHA 1HNXI 5GMDA 2A2CA 3JAMC 2UXDE 4JI7E 4MYTA 4AQYI 4JI5I 4X65E 4HYMA 4DUYI 2F4VI 4DU7A 4DV4I 1H74A 4GKKE 4YY3I 1FJGE 1H72C 1BKNA 3F0NA 1FKAE 4B3RI 1DARA 4LF6I 1Z0EA 2UU9I 4P52A 3J7AG 2BM0A 4JI7I 1IBLE 3J80C 1N34E 1NZ0A 3WU4A 4PRVA 4X65I 1Z0GA 1FNMA 2F4VE 4JI4I 4DR2I 4JI6I 4KQVA 4K0KE 3PYEA 4X66I 1KIJA 3T1HE 5A2QQ 3WU5A 4B3SE 3ZKBA 1XNRI 4B3RE 1ZXMA 1H7SA 4DV7E 4JV5I 4MYUA 1NHHA 4OX9E 3J7AM 1I94E 4LF7I 4JG4A 5BR8I 4HY1A 4LFBI
chains in the Genus database with same CATH superfamily
3T1YE 4DR3E 4DV3I 4LF8I 1KTVA 2DEIA 2XEXA 2C39B 3DD6A 4JI4E 2O1WA 4FN5A 3JAMQ 4FW4A 2BR2A 5EL9A 1P42A 2NPFA 2PO0A 4M1KA 4JI0I 4OO1E 3ZZ0A 1N36E 5C0XF 4DV1I 1IBMI 3PYDA 3K17A 3GMEA 1OJ4A 2C39A 2Z5BB 2GO4A 2WP8A 4FW9A 4NXNE 1XNQI 4OKGA 2UUCE 4DV5E 1I94I 4LF7E 3CDJA 1WUUA 2HK3A 4PU9A 4LF4E 2GS8A 1RR9A 2BA1D 1PIEA 4LF9E 4DV2I 4U3DA 1HR0E 4DR3I 1IBKE 1UDOA 1NHIA 1N0VC 1RHYA 2V2QA 4GKKI 2E1RA 2ZM6I 4B3MI 1XMQE 2A2DA 3GONA 4OO1B 1N36I 4QNJA 1U2RA 2IESA 2WNRB 4LFCE 2HKJA 4BA2A 1H73A 5C0XA 2PNZA 5IWAI 2CG9A 2JEBB 4JI2E 2Q2EB 4GKJE 4DR4I 1Y4SA 2V2VA 4LCHA 1Z0CA 1Z5BA 2BA0D 2UUAI 2BR2B 4MU3A 5C0XB 4GQUA 1PVGA 2VF3A 2PNZB 1HNWI 4JYAI 1A6FA 5BR8E 3B82A 4AQYE 4JI5E 4DR7I 4LFBE 4B3ME 2LJPA 1UDQA 2O1UA 2ZBKB 4JI1E 3PRYA 3L7ZB 2NN6B 3PYGA 4FW6A 1S4EA 4BA1B 2DEJA 4LCGA 5LMUI 1FJGI 4JI0E 1Y6ZA 2HKEA 4YHHI 1R6LA 2UXDI 1ZM9A 4KHPI 1EA6A 3GCMA 3Q1QA 5JEAE 4URLA 2Z5BA 1D6TA 5C0XE 1MG7A 1S16A 5C0XC 5JEAD 1UEKA 2PO0B 1HR0I 2HHHE 2R3VA 4DR1E 3QT7A 3HULA 1B63A 1N33I 2O3ZA 4HACA 4DPYA 3H4LA 5DRQA 2NN6A 4DR5E 3Q6MA 1E3PA 3M7ND 4B3SI 2VESA 3H1CA 3HKMA 4PRXA 3ZKDA 3OTOI 4Z7YA 4JV5E 2UXCE 1OYRA 1Z0WA 1ZM3A 3M6AA 1MX0A 5K36A 2V8PA 1ZM2A 5LL6R 4ED4A 1Z5CA 4X66E 1FWKA 1VI7A 1MU5A 4JYAE 4DV6E 1XXEA 4WUDA 3PS2A 3J80Q 3K1JA 2GO3A 4HXZA 4DUZE 5IWAE 2BA1G 4DV0I 2C37A 4GKJI 4FWGA 4OX9I 5DNLA 3LTOA 4OO1A 3CWVA 2UU9E 4JI8I 4DV3E 2WP8B 4OO1F 1HNWE 2BV3A 5A2QC 5LMNI 2F1DA 2V34A 4DPXA 1XMOE 3B4TA 4JI1I 4USMA 5JEAB 2UXBE 1Z59A 1YH8A 2VQFI 2C38B 2PO1A 4DR2E 2OI2A 4LFAE 5DRPA 4UT4A 4LF6E 4DV0E 4B3TE 2UUCI 2PO2B 3P3EA 4UTGA 1Y5YA 5EKWA 4LFCI 4IS9A 4FW7A 3LNUA 1N34I 4NXMI 1EI1A 2Z5CB 4JI3I 1Z0VA 2X7IA 4DR6I 1B62A 2JEAB 2HFUA 3J81C 2E5LI 4KHPE 4FW5A 1OYSA 3GLLA 3PS1A 4X62I 3M85G 2UUBI 1IBKI 5LMNE 4ZVIA 1XMQI 3OTOE 2J7KA 2ZM6E 3J81Q 4IZKA 4DV4E 1RREA 5C0XD 4YY3E 2HFSA 5ELWA 4AIMA 1XNRE 3LPSA 4IZJA 3P3GA 2X36A 1NHJA 1UDNA 4DR5I 3V2UC 1ELOA 3HJCA 4JI3E 4RPFA 3KRNA 3P76A 4DXLA 3P06A 4U3BA 2EFGA 4NBQA 2UXCI 4DR6E 2BA0G 2E5LE 4DUYE 1HNZE 3ZZTA 2CZ9A 1FI4A 3U1KA 3M7NG 4BA2B 4OO1D 5DROA 2C37B 2JEBA 2HK2A 4WUCA 5L3JA 4XTJA 2BM1A 3B8HA 4LF5I 5LMUE 1OYPA 2UXBI 5JEAA 4AM3A 3WU6A 2VQFE 2JE6A 2ZITA 3QT6A 5FLXC 2NN6F 1K47A 5JEAF 1N33E 3PYFA 4OO1C 1Z5AA 1IBLI 4HACB 3PS3A 2IOQA 4P7AA 4FWDA 3ZZUA 3L7ZA 3B78A 4MU0A 2HHHI 2PO2A 4Z7CA 4JI6E 2UUBE 3QT8A 4DR1I 1KVKA 2V2ZA 5IT9C 1H7UA 4LF5E 2VQEI 2PNMA 1N32I 5FLXQ 1E3HA 4AIDA 4JI2I 1IBME 4DU8A 4X64E 2WW4A 4IZJB 4BA1A 2UUAE 3T1YI 3QT5A 4X62E 4DPUA 3UHMA 3ZM7A 1N0UA 4DV5I 4DR7E 4IZKB 4LF4I 5IT9Q 1Y60A 4LF9I 1HNZI 2JE6B 4JI8E 3M85D 2J65A 3WU3A 1J5EE 4DV6I 4QNKA 4R1FA 4LOMA 2JEAA 1VISA 4IFDB 1YHCA 1N32E 4K0KI 4DUZI 3CDIA 4NXNI 4X64I 1XNQE 1ZXNA 4EMDA 4ISAA 4YHHE 5K36B 1Z0BA 2AJ4A 4LFAI 1XHKA 4USKA 1HNXE 4DV2E 5K36D 4FWHA 1ZM4A 4DR4E 1PKPA 1FWLA 4I3HA 4MU1A 1XMOI 1Z0TA 4IFDD 4LF8E 4WUBA 1J5EI 1QZRA 3V5RA 4DPWA 2NN6E 1Y4UA 2WNRA 3T1HI 2NN6C 2CVEA 5JEAC 4J3DA 4IFDE 4B3TI 4IFDC 2VQEE 1HK7A 4DPTA 4DV1E 4DV7I 4NXME 3Q6NA 5GMEA 2R42A 3D4JA 1KKHA 4IFDF 1HNXI 5K36E 5K36C 1USUA 4OZEA 5GMDA 4IZJD 2A2CA 3JAMC 3K85A 4IFDA 2UXDE 2GQ0A 4JI7E 4MYTA 4MU4A 3NZKA 4AQYI 4JI5I 4X65E 5K36F 4HYMA 4DUYI 2F4VI 4DU7A 2IOPA 4DV4I 1H74A 4GKKE 4YY3I 1FJGE 1H72C 3P3CA 1BKNA 2NN6D 3F0NA 1FKAE 4B3RI 4MQYA 1DARA 5DRRA 4LF6I 1Z0EA 2JT2A 2O1VA 2UU9I 4P52A 2Z5EA 3J7AG 2BM0A 4LPFA 4JI7I 1IBLE 3J80C 1N34E 1NZ0A 3WU4A 5DNXA 2IERA 4PRVA 4X65I 2Z5CA 2O1TA 1Z0GA 1FNMA 4FW3A 2F4VE 4JI4I 4DR2I 4JI6I 4KQVA 4K0KE 3U1YA 3PYEA 4X66I 1KIJA 4LCFA 3T1HE 2PNLA 1R6MA 2AE8A 5A2QQ 3WU5A 2CGEA 4B3SE 3ZKBA 1XNRI 4B3RE 1ZXMA 4N3OA 1USVA 1H7SA 4DV7E 4JV5I 4MYUA 1UDSA 1NHHA 4OX9E 3J7AM 2PO1B 5FWKA 1I94E 2C38A 4JG4A 4MDTA 4LF7I 5BR8I 4HY1A 4LFBI
chains in the Genus database with same CATH topology
3T1YE 4DR3E 4DV3I 4LF8I 1KTVA 2DEIA 2XEXA 4JI4E 2O1WA 4FN5A 3JAMQ 2NPFA 4M1KA 4JI0I 3ZZ0A 1N36E 4DV1I 1IBMI 3PYDA 3K17A 1OJ4A 2Z5BB 4FW9A 4NXNE 1XNQI 2UUCE 4DV5E 1I94I 4LF7E 1WUUA 2HK3A 4PU9A 4LF4E 2GS8A 1RR9A 1PIEA 4LF9E 4DV2I 1HR0E 4DR3I 1IBKE 1NHIA 1N0VC 2V2QA 4GKKI 2E1RA 2ZM6I 4B3MI 1XMQE 2A2DA 3GONA 1N36I 1U2RA 4LFCE 2HKJA 1H73A 5IWAI 2CG9A 4JI2E 2Q2EB 4GKJE 4DR4I 1Y4SA 2V2VA 1Z0CA 1Z5BA 2UUAI 1PVGA 2VF3A 1HNWI 4JYAI 1A6FA 5BR8E 3B82A 4AQYE 4JI5E 4DR7I 4LFBE 4B3ME 2LJPA 2O1UA 4JI1E 2ZBKB 3PRYA 3PYGA 1S4EA 2DEJA 5LMUI 1FJGI 4JI0E 1Y6ZA 2HKEA 4YHHI 2UXDI 1ZM9A 4KHPI 1EA6A 3Q1QA 4URLA 2Z5BA 1D6TA 1MG7A 1S16A 1UEKA 2HHHE 1HR0I 2R3VA 4DR1E 3QT7A 3HULA 1B63A 1N33I 4HACA 4DPYA 3H4LA 4DR5E 3Q6MA 4B3SI 4PRXA 3ZKDA 3OTOI 4Z7YA 4JV5E 2UXCE 1Z0WA 1ZM3A 3M6AA 1MX0A 2V8PA 1ZM2A 5LL6R 4ED4A 1Z5CA 4X66E 1FWKA 1MU5A 4JYAE 4DV6E 4WUDA 3J80Q 3K1JA 4HXZA 4DUZE 5IWAE 4DV0I 4GKJI 4FWGA 4OX9I 3LTOA 3CWVA 2UU9E 4JI8I 4DV3E 1HNWE 2BV3A 5A2QC 5LMNI 2V34A 4DPXA 1XMOE 4JI1I 4USMA 2UXBE 1Z59A 2VQFI 4DR2E 2OI2A 4LFAE 4UT4A 4LF6E 4DV0E 4B3TE 2UUCI 4UTGA 4LFCI 4NXMI 3LNUA 1N34I 1EI1A 2Z5CB 4JI3I 1Z0VA 2X7IA 4DR6I 1B62A 4KHPE 2HFUA 3J81C 2E5LI 4X62I 2UUBI 1IBKI 5LMNE 4ZVIA 1XMQI 3OTOE 2J7KA 2ZM6E 3J81Q 4IZKA 4DV4E 1RREA 4YY3E 2HFSA 1XNRE 3LPSA 4IZJA 2X36A 1NHJA 4DR5I 3V2UC 1ELOA 3HJCA 4JI3E 4RPFA 4DXLA 3P06A 2EFGA 2UXCI 4DR6E 2E5LE 4DUYE 1HNZE 3ZZTA 2CZ9A 1FI4A 2HK2A 4WUCA 5L3JA 4XTJA 2BM1A 3B8HA 4LF5I 5LMUE 2UXBI 3WU6A 2VQFE 2ZITA 3QT6A 5FLXC 1K47A 1N33E 3PYFA 1Z5AA 1IBLI 4HACB 2IOQA 4P7AA 4FWDA 3ZZUA 3B78A 2HHHI 4Z7CA 4JI6E 2UUBE 3QT8A 4DR1I 1KVKA 2V2ZA 5IT9C 1H7UA 4LF5E 2VQEI 2PNMA 1N32I 5FLXQ 4JI2I 1IBME 4DU8A 4X64E 2WW4A 4IZJB 2UUAE 3T1YI 3QT5A 4X62E 4DPUA 3ZM7A 1N0UA 4DV5I 4DR7E 4IZKB 4LF4I 5IT9Q 4LF9I 1HNZI 4JI8E 3WU3A 1J5EE 4DV6I 4R1FA 1VISA 1N32E 4K0KI 4DUZI 4NXNI 4X64I 1XNQE 1ZXNA 4EMDA 4YHHE 1Z0BA 2AJ4A 4LFAI 1XHKA 4USKA 1HNXE 4DV2E 4FWHA 1ZM4A 4DR4E 1PKPA 1FWLA 4I3HA 1XMOI 1Z0TA 4LF8E 4WUBA 1J5EI 1QZRA 3V5RA 4DPWA 1Y4UA 3T1HI 4B3TI 2VQEE 1HK7A 4DPTA 4DV1E 4DV7I 4NXME 3Q6NA 5GMEA 2R42A 3D4JA 1KKHA 1HNXI 1USUA 5GMDA 4IZJD 2A2CA 3JAMC 3K85A 2UXDE 2GQ0A 4JI7E 4MYTA 4AQYI 4JI5I 4X65E 4HYMA 4DUYI 2F4VI 4DU7A 2IOPA 4DV4I 1H74A 4GKKE 4YY3I 1FJGE 1H72C 1BKNA 3F0NA 1FKAE 4B3RI 1DARA 4LF6I 1Z0EA 2O1VA 2UU9I 4P52A 2Z5EA 3J7AG 2BM0A 4JI7I 1IBLE 3J80C 1N34E 1NZ0A 3WU4A 4PRVA 4X65I 2Z5CA 2O1TA 1Z0GA 1FNMA 2F4VE 4JI4I 4DR2I 4JI6I 4KQVA 4K0KE 3PYEA 4X66I 1KIJA 3T1HE 2PNLA 5A2QQ 3WU5A 2CGEA 4B3SE 3ZKBA 1XNRI 4B3RE 1ZXMA 4N3OA 1USVA 1H7SA 4DV7E 4JV5I 4MYUA 1NHHA 4OX9E 3J7AM 5FWKA 1I94E 4LF7I 4JG4A 5BR8I 4HY1A 4LFBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y E;  4DR3 E;  4DV3 I;  4LF8 I;  1KTV A;  2DEI A;  2XEX A;  4JI4 E;  4FN5 A;  3JAM Q;  2NPF A;  4M1K A;  4JI0 I;  3ZZ0 A;  1N36 E;  4DV1 I;  1IBM I;  3PYD A;  3K17 A;  1OJ4 A;  4FW9 A;  4NXN E;  1XNQ I;  2UUC E;  4DV5 E;  4LF7 E;  1I94 I;  1WUU A;  2HK3 A;  4PU9 A;  4LF4 E;  2GS8 A;  1RR9 A;  1PIE A;  4LF9 E;  4DV2 I;  1HR0 E;  4DR3 I;  1IBK E;  1NHI A;  1N0V C;  2V2Q A;  4GKK I;  2E1R A;  2ZM6 I;  4B3M I;  1XMQ E;  2A2D A;  3GON A;  1N36 I;  1U2R A;  4LFC E;  2HKJ A;  1H73 A;  5IWA I;  4JI2 E;  2Q2E B;  4GKJ E;  4DR4 I;  2V2V A;  1Z0C A;  1Z5B A;  2UUA I;  1PVG A;  2VF3 A;  1HNW I;  4JYA I;  1A6F A;  5BR8 E;  3B82 A;  4JI5 E;  4AQY E;  4DR7 I;  4LFB E;  4B3M E;  2LJP A;  4JI1 E;  2ZBK B;  3PYG A;  1S4E A;  2DEJ A;  5LMU I;  1FJG I;  4JI0 E;  2HKE A;  4YHH I;  2UXD I;  1ZM9 A;  4KHP I;  1EA6 A;  3Q1Q A;  4URL A;  1D6T A;  1MG7 A;  1S16 A;  1UEK A;  2HHH E;  1HR0 I;  2R3V A;  4DR1 E;  3QT7 A;  3HUL A;  1B63 A;  1N33 I;  4HAC A;  4DPY A;  3H4L A;  4DR5 E;  4B3S I;  4PRX A;  3ZKD A;  3OTO I;  4Z7Y A;  4JV5 E;  2UXC E;  1Z0W A;  1ZM3 A;  3M6A A;  1MX0 A;  2V8P A;  1ZM2 A;  5LL6 R;  4ED4 A;  1Z5C A;  4X66 E;  1FWK A;  1MU5 A;  4JYA E;  4DV6 E;  4WUD A;  3J80 Q;  3K1J A;  4HXZ A;  4DUZ E;  5IWA E;  4DV0 I;  4GKJ I;  4FWG A;  4OX9 I;  3LTO A;  3CWV A;  2UU9 E;  4JI8 I;  4DV3 E;  1HNW E;  2BV3 A;  5A2Q C;  5LMN I;  2V34 A;  4DPX A;  1XMO E;  4JI1 I;  4USM A;  2UXB E;  1Z59 A;  2VQF I;  4DR2 E;  2OI2 A;  4LFA E;  4UT4 A;  4LF6 E;  4DV0 E;  4B3T E;  2UUC I;  4UTG A;  4LFC I;  4NXM I;  3LNU A;  1N34 I;  1EI1 A;  4JI3 I;  1Z0V A;  2X7I A;  4DR6 I;  1B62 A;  4KHP E;  2HFU A;  3J81 C;  2E5L I;  4X62 I;  2UUB I;  1IBK I;  5LMN E;  4ZVI A;  1XMQ I;  3OTO E;  2J7K A;  2ZM6 E;  3J81 Q;  4DV4 E;  1RRE A;  4YY3 E;  2HFS A;  1XNR E;  3LPS A;  2X36 A;  1NHJ A;  4DR5 I;  3V2U C;  1ELO A;  4JI3 E;  4RPF A;  4DXL A;  2EFG A;  2UXC I;  4DR6 E;  2E5L E;  4DUY E;  1HNZ E;  3ZZT A;  2CZ9 A;  1FI4 A;  2HK2 A;  4WUC A;  5L3J A;  4XTJ A;  2BM1 A;  3B8H A;  4LF5 I;  5LMU E;  2UXB I;  3WU6 A;  2VQF E;  2ZIT A;  3QT6 A;  5FLX C;  1K47 A;  1N33 E;  3PYF A;  1Z5A A;  1IBL I;  4HAC B;  4P7A A;  4FWD A;  3ZZU A;  3B78 A;  2HHH I;  4Z7C A;  4JI6 E;  2UUB E;  3QT8 A;  4DR1 I;  1KVK A;  2V2Z A;  5IT9 C;  1H7U A;  4LF5 E;  2VQE I;  1N32 I;  5FLX Q;  4JI2 I;  1IBM E;  4DU8 A;  4X64 E;  2WW4 A;  2UUA E;  3T1Y I;  3QT5 A;  4X62 E;  4DPU A;  3ZM7 A;  1N0U A;  4DV5 I;  4DR7 E;  4LF4 I;  5IT9 Q;  4LF9 I;  1HNZ I;  4JI8 E;  3WU3 A;  1J5E E;  4DV6 I;  4R1F A;  1VIS A;  1N32 E;  4K0K I;  4DUZ I;  4NXN I;  4X64 I;  1XNQ E;  1ZXN A;  4EMD A;  4YHH E;  1Z0B A;  2AJ4 A;  4LFA I;  1XHK A;  4USK A;  1HNX E;  4DV2 E;  4FWH A;  1ZM4 A;  4DR4 E;  1PKP A;  1FWL A;  4I3H A;  1XMO I;  1Z0T A;  4LF8 E;  4WUB A;  1J5E I;  1QZR A;  3V5R A;  4DPW A;  3T1H I;  4B3T I;  2VQE E;  4DPT A;  4DV1 E;  4DV7 I;  4NXM E;  5GME A;  2R42 A;  3D4J A;  1KKH A;  1HNX I;  5GMD A;  2A2C A;  3JAM C;  2UXD E;  4JI7 E;  4MYT A;  4AQY I;  4JI5 I;  4X65 E;  4HYM A;  4DUY I;  2F4V I;  4DU7 A;  4DV4 I;  1H74 A;  4GKK E;  4YY3 I;  1FJG E;  1H72 C;  1BKN A;  3F0N A;  1FKA E;  4B3R I;  1DAR A;  4LF6 I;  1Z0E A;  2UU9 I;  4P52 A;  3J7A G;  2BM0 A;  4JI7 I;  1IBL E;  3J80 C;  1N34 E;  1NZ0 A;  3WU4 A;  4PRV A;  4X65 I;  1Z0G A;  1FNM A;  2F4V E;  4JI4 I;  4DR2 I;  4JI6 I;  4KQV A;  4K0K E;  3PYE A;  4X66 I;  1KIJ A;  3T1H E;  5A2Q Q;  3WU5 A;  4B3S E;  3ZKB A;  1XNR I;  4B3R E;  1ZXM A;  1H7S A;  4DV7 E;  4JV5 I;  4MYU A;  1NHH A;  4OX9 E;  3J7A M;  1I94 E;  4LF7 I;  4JG4 A;  5BR8 I;  4HY1 A;  4LFB I; 
#chains in the Genus database with same CATH topology
 3T1Y E;  4DR3 E;  4DV3 I;  4LF8 I;  1KTV A;  2DEI A;  2XEX A;  2C39 B;  3DD6 A;  4JI4 E;  2O1W A;  4FN5 A;  3JAM Q;  4FW4 A;  2BR2 A;  5EL9 A;  1P42 A;  2NPF A;  2PO0 A;  4M1K A;  4JI0 I;  4OO1 E;  3ZZ0 A;  1N36 E;  5C0X F;  4DV1 I;  1IBM I;  3PYD A;  3K17 A;  3GME A;  1OJ4 A;  2C39 A;  2Z5B B;  2GO4 A;  2WP8 A;  4FW9 A;  4NXN E;  1XNQ I;  4OKG A;  2UUC E;  4DV5 E;  1I94 I;  4LF7 E;  3CDJ A;  1WUU A;  2HK3 A;  4PU9 A;  4LF4 E;  2GS8 A;  1RR9 A;  2BA1 D;  1PIE A;  4LF9 E;  4DV2 I;  4U3D A;  1HR0 E;  4DR3 I;  1IBK E;  1UDO A;  1NHI A;  1N0V C;  1RHY A;  2V2Q A;  4GKK I;  2E1R A;  2ZM6 I;  4B3M I;  1XMQ E;  2A2D A;  3GON A;  4OO1 B;  1N36 I;  4QNJ A;  1U2R A;  2IES A;  2WNR B;  4LFC E;  2HKJ A;  4BA2 A;  1H73 A;  5C0X A;  2PNZ A;  5IWA I;  2CG9 A;  2JEB B;  4JI2 E;  2Q2E B;  4GKJ E;  4DR4 I;  1Y4S A;  2V2V A;  4LCH A;  1Z0C A;  1Z5B A;  2BA0 D;  2UUA I;  2BR2 B;  4MU3 A;  5C0X B;  4GQU A;  1PVG A;  2VF3 A;  2PNZ B;  1HNW I;  4JYA I;  1A6F A;  5BR8 E;  3B82 A;  4AQY E;  4JI5 E;  4DR7 I;  4LFB E;  4B3M E;  2LJP A;  1UDQ A;  2O1U A;  2ZBK B;  4JI1 E;  3PRY A;  3L7Z B;  2NN6 B;  3PYG A;  4FW6 A;  1S4E A;  4BA1 B;  2DEJ A;  4LCG A;  5LMU I;  1FJG I;  4JI0 E;  1Y6Z A;  2HKE A;  4YHH I;  1R6L A;  2UXD I;  1ZM9 A;  4KHP I;  1EA6 A;  3GCM A;  3Q1Q A;  5JEA E;  4URL A;  2Z5B A;  1D6T A;  5C0X E;  1MG7 A;  1S16 A;  5C0X C;  5JEA D;  1UEK A;  2PO0 B;  1HR0 I;  2HHH E;  2R3V A;  4DR1 E;  3QT7 A;  3HUL A;  1B63 A;  1N33 I;  2O3Z A;  4HAC A;  4DPY A;  3H4L A;  5DRQ A;  2NN6 A;  4DR5 E;  3Q6M A;  1E3P A;  3M7N D;  4B3S I;  2VES A;  3H1C A;  3HKM A;  4PRX A;  3ZKD A;  3OTO I;  4Z7Y A;  4JV5 E;  2UXC E;  1OYR A;  1Z0W A;  1ZM3 A;  3M6A A;  1MX0 A;  5K36 A;  2V8P A;  1ZM2 A;  5LL6 R;  4ED4 A;  1Z5C A;  4X66 E;  1FWK A;  1VI7 A;  1MU5 A;  4JYA E;  4DV6 E;  1XXE A;  4WUD A;  3PS2 A;  3J80 Q;  3K1J A;  2GO3 A;  4HXZ A;  4DUZ E;  5IWA E;  2BA1 G;  4DV0 I;  2C37 A;  4GKJ I;  4FWG A;  4OX9 I;  5DNL A;  3LTO A;  4OO1 A;  3CWV A;  2UU9 E;  4JI8 I;  4DV3 E;  2WP8 B;  4OO1 F;  1HNW E;  2BV3 A;  5A2Q C;  5LMN I;  2F1D A;  2V34 A;  4DPX A;  1XMO E;  3B4T A;  4JI1 I;  4USM A;  5JEA B;  2UXB E;  1Z59 A;  1YH8 A;  2VQF I;  2C38 B;  2PO1 A;  4DR2 E;  2OI2 A;  4LFA E;  5DRP A;  4UT4 A;  4LF6 E;  4DV0 E;  4B3T E;  2UUC I;  2PO2 B;  3P3E A;  4UTG A;  1Y5Y A;  5EKW A;  4LFC I;  4IS9 A;  4FW7 A;  3LNU A;  1N34 I;  4NXM I;  1EI1 A;  2Z5C B;  4JI3 I;  1Z0V A;  2X7I A;  4DR6 I;  1B62 A;  2JEA B;  2HFU A;  3J81 C;  2E5L I;  4KHP E;  4FW5 A;  1OYS A;  3GLL A;  3PS1 A;  4X62 I;  3M85 G;  2UUB I;  1IBK I;  5LMN E;  4ZVI A;  1XMQ I;  3OTO E;  2J7K A;  2ZM6 E;  3J81 Q;  4IZK A;  4DV4 E;  1RRE A;  5C0X D;  4YY3 E;  2HFS A;  5ELW A;  4AIM A;  1XNR E;  3LPS A;  4IZJ A;  3P3G A;  2X36 A;  1NHJ A;  1UDN A;  4DR5 I;  3V2U C;  1ELO A;  3HJC A;  4JI3 E;  4RPF A;  3KRN A;  3P76 A;  4DXL A;  3P06 A;  4U3B A;  2EFG A;  4NBQ A;  2UXC I;  4DR6 E;  2BA0 G;  2E5L E;  4DUY E;  1HNZ E;  3ZZT A;  2CZ9 A;  1FI4 A;  3U1K A;  3M7N G;  4BA2 B;  4OO1 D;  5DRO A;  2C37 B;  2JEB A;  2HK2 A;  4WUC A;  5L3J A;  4XTJ A;  2BM1 A;  3B8H A;  4LF5 I;  5LMU E;  1OYP A;  2UXB I;  5JEA A;  4AM3 A;  3WU6 A;  2VQF E;  2JE6 A;  2ZIT A;  3QT6 A;  5FLX C;  2NN6 F;  1K47 A;  5JEA F;  1N33 E;  3PYF A;  4OO1 C;  1Z5A A;  1IBL I;  4HAC B;  3PS3 A;  2IOQ A;  4P7A A;  4FWD A;  3ZZU A;  3L7Z A;  3B78 A;  4MU0 A;  2HHH I;  2PO2 A;  4Z7C A;  4JI6 E;  2UUB E;  3QT8 A;  4DR1 I;  1KVK A;  2V2Z A;  5IT9 C;  1H7U A;  4LF5 E;  2VQE I;  2PNM A;  1N32 I;  5FLX Q;  1E3H A;  4AID A;  4JI2 I;  1IBM E;  4DU8 A;  4X64 E;  2WW4 A;  4IZJ B;  4BA1 A;  2UUA E;  3T1Y I;  3QT5 A;  4X62 E;  4DPU A;  3UHM A;  3ZM7 A;  1N0U A;  4DV5 I;  4DR7 E;  4IZK B;  4LF4 I;  5IT9 Q;  1Y60 A;  4LF9 I;  1HNZ I;  2JE6 B;  4JI8 E;  3M85 D;  2J65 A;  3WU3 A;  1J5E E;  4DV6 I;  4QNK A;  4R1F A;  4LOM A;  2JEA A;  1VIS A;  4IFD B;  1YHC A;  1N32 E;  4K0K I;  4DUZ I;  3CDI A;  4NXN I;  4X64 I;  1XNQ E;  1ZXN A;  4EMD A;  4ISA A;  4YHH E;  5K36 B;  1Z0B A;  2AJ4 A;  4LFA I;  1XHK A;  4USK A;  1HNX E;  4DV2 E;  5K36 D;  4FWH A;  1ZM4 A;  4DR4 E;  1PKP A;  1FWL A;  4I3H A;  4MU1 A;  1XMO I;  1Z0T A;  4IFD D;  4LF8 E;  4WUB A;  1J5E I;  1QZR A;  3V5R A;  4DPW A;  2NN6 E;  1Y4U A;  2WNR A;  3T1H I;  2NN6 C;  2CVE A;  5JEA C;  4J3D A;  4IFD E;  4B3T I;  4IFD C;  2VQE E;  1HK7 A;  4DPT A;  4DV1 E;  4DV7 I;  4NXM E;  3Q6N A;  5GME A;  2R42 A;  3D4J A;  1KKH A;  4IFD F;  1HNX I;  5K36 E;  5K36 C;  1USU A;  4OZE A;  5GMD A;  4IZJ D;  2A2C A;  3JAM C;  3K85 A;  4IFD A;  2UXD E;  2GQ0 A;  4JI7 E;  4MYT A;  4MU4 A;  3NZK A;  4AQY I;  4JI5 I;  4X65 E;  5K36 F;  4HYM A;  4DUY I;  2F4V I;  4DU7 A;  2IOP A;  4DV4 I;  1H74 A;  4GKK E;  4YY3 I;  1FJG E;  1H72 C;  3P3C A;  1BKN A;  2NN6 D;  3F0N A;  1FKA E;  4B3R I;  4MQY A;  1DAR A;  5DRR A;  4LF6 I;  1Z0E A;  2JT2 A;  2O1V A;  2UU9 I;  4P52 A;  2Z5E A;  3J7A G;  2BM0 A;  4LPF A;  4JI7 I;  1IBL E;  3J80 C;  1N34 E;  1NZ0 A;  3WU4 A;  5DNX A;  2IER A;  4PRV A;  4X65 I;  2Z5C A;  2O1T A;  1Z0G A;  1FNM A;  4FW3 A;  2F4V E;  4JI4 I;  4DR2 I;  4JI6 I;  4KQV A;  4K0K E;  3U1Y A;  3PYE A;  4X66 I;  1KIJ A;  4LCF A;  3T1H E;  2PNL A;  1R6M A;  2AE8 A;  5A2Q Q;  3WU5 A;  2CGE A;  4B3S E;  3ZKB A;  1XNR I;  4B3R E;  1ZXM A;  4N3O A;  1USV A;  1H7S A;  4DV7 E;  4JV5 I;  4MYU A;  1UDS A;  1NHH A;  4OX9 E;  3J7A M;  2PO1 B;  5FWK A;  1I94 E;  2C38 A;  4JG4 A;  4MDT A;  4LF7 I;  5BR8 I;  4HY1 A;  4LFB I; 
#chains in the Genus database with same CATH homology
 3T1Y E;  4DR3 E;  4DV3 I;  4LF8 I;  1KTV A;  2DEI A;  2XEX A;  4JI4 E;  2O1W A;  4FN5 A;  3JAM Q;  2NPF A;  4M1K A;  4JI0 I;  3ZZ0 A;  1N36 E;  4DV1 I;  1IBM I;  3PYD A;  3K17 A;  1OJ4 A;  2Z5B B;  4FW9 A;  4NXN E;  1XNQ I;  2UUC E;  4DV5 E;  1I94 I;  4LF7 E;  1WUU A;  2HK3 A;  4PU9 A;  4LF4 E;  2GS8 A;  1RR9 A;  1PIE A;  4LF9 E;  4DV2 I;  1HR0 E;  4DR3 I;  1IBK E;  1NHI A;  1N0V C;  2V2Q A;  4GKK I;  2E1R A;  2ZM6 I;  4B3M I;  1XMQ E;  2A2D A;  3GON A;  1N36 I;  1U2R A;  4LFC E;  2HKJ A;  1H73 A;  5IWA I;  2CG9 A;  4JI2 E;  2Q2E B;  4GKJ E;  4DR4 I;  1Y4S A;  2V2V A;  1Z0C A;  1Z5B A;  2UUA I;  1PVG A;  2VF3 A;  1HNW I;  4JYA I;  1A6F A;  5BR8 E;  3B82 A;  4AQY E;  4JI5 E;  4DR7 I;  4LFB E;  4B3M E;  2LJP A;  2O1U A;  4JI1 E;  2ZBK B;  3PRY A;  3PYG A;  1S4E A;  2DEJ A;  5LMU I;  1FJG I;  4JI0 E;  1Y6Z A;  2HKE A;  4YHH I;  2UXD I;  1ZM9 A;  4KHP I;  1EA6 A;  3Q1Q A;  4URL A;  2Z5B A;  1D6T A;  1MG7 A;  1S16 A;  1UEK A;  2HHH E;  1HR0 I;  2R3V A;  4DR1 E;  3QT7 A;  3HUL A;  1B63 A;  1N33 I;  4HAC A;  4DPY A;  3H4L A;  4DR5 E;  3Q6M A;  4B3S I;  4PRX A;  3ZKD A;  3OTO I;  4Z7Y A;  4JV5 E;  2UXC E;  1Z0W A;  1ZM3 A;  3M6A A;  1MX0 A;  2V8P A;  1ZM2 A;  5LL6 R;  4ED4 A;  1Z5C A;  4X66 E;  1FWK A;  1MU5 A;  4JYA E;  4DV6 E;  4WUD A;  3J80 Q;  3K1J A;  4HXZ A;  4DUZ E;  5IWA E;  4DV0 I;  4GKJ I;  4FWG A;  4OX9 I;  3LTO A;  3CWV A;  2UU9 E;  4JI8 I;  4DV3 E;  1HNW E;  2BV3 A;  5A2Q C;  5LMN I;  2V34 A;  4DPX A;  1XMO E;  4JI1 I;  4USM A;  2UXB E;  1Z59 A;  2VQF I;  4DR2 E;  2OI2 A;  4LFA E;  4UT4 A;  4LF6 E;  4DV0 E;  4B3T E;  2UUC I;  4UTG A;  4LFC I;  4NXM I;  3LNU A;  1N34 I;  1EI1 A;  2Z5C B;  4JI3 I;  1Z0V A;  2X7I A;  4DR6 I;  1B62 A;  4KHP E;  2HFU A;  3J81 C;  2E5L I;  4X62 I;  2UUB I;  1IBK I;  5LMN E;  4ZVI A;  1XMQ I;  3OTO E;  2J7K A;  2ZM6 E;  3J81 Q;  4IZK A;  4DV4 E;  1RRE A;  4YY3 E;  2HFS A;  1XNR E;  3LPS A;  4IZJ A;  2X36 A;  1NHJ A;  4DR5 I;  3V2U C;  1ELO A;  3HJC A;  4JI3 E;  4RPF A;  4DXL A;  3P06 A;  2EFG A;  2UXC I;  4DR6 E;  2E5L E;  4DUY E;  1HNZ E;  3ZZT A;  2CZ9 A;  1FI4 A;  2HK2 A;  4WUC A;  5L3J A;  4XTJ A;  2BM1 A;  3B8H A;  4LF5 I;  5LMU E;  2UXB I;  3WU6 A;  2VQF E;  2ZIT A;  3QT6 A;  5FLX C;  1K47 A;  1N33 E;  3PYF A;  1Z5A A;  1IBL I;  4HAC B;  2IOQ A;  4P7A A;  4FWD A;  3ZZU A;  3B78 A;  2HHH I;  4Z7C A;  4JI6 E;  2UUB E;  3QT8 A;  4DR1 I;  1KVK A;  2V2Z A;  5IT9 C;  1H7U A;  4LF5 E;  2VQE I;  2PNM A;  1N32 I;  5FLX Q;  4JI2 I;  1IBM E;  4DU8 A;  4X64 E;  2WW4 A;  4IZJ B;  2UUA E;  3T1Y I;  3QT5 A;  4X62 E;  4DPU A;  3ZM7 A;  1N0U A;  4DV5 I;  4DR7 E;  4IZK B;  4LF4 I;  5IT9 Q;  4LF9 I;  1HNZ I;  4JI8 E;  3WU3 A;  1J5E E;  4DV6 I;  4R1F A;  1VIS A;  1N32 E;  4K0K I;  4DUZ I;  4NXN I;  4X64 I;  1XNQ E;  1ZXN A;  4EMD A;  4YHH E;  1Z0B A;  2AJ4 A;  4LFA I;  1XHK A;  4USK A;  1HNX E;  4DV2 E;  4FWH A;  1ZM4 A;  4DR4 E;  1PKP A;  1FWL A;  4I3H A;  1XMO I;  1Z0T A;  4LF8 E;  4WUB A;  1J5E I;  1QZR A;  3V5R A;  4DPW A;  1Y4U A;  3T1H I;  4B3T I;  2VQE E;  1HK7 A;  4DPT A;  4DV1 E;  4DV7 I;  4NXM E;  3Q6N A;  5GME A;  2R42 A;  3D4J A;  1KKH A;  1HNX I;  1USU A;  5GMD A;  4IZJ D;  2A2C A;  3JAM C;  3K85 A;  2UXD E;  2GQ0 A;  4JI7 E;  4MYT A;  4AQY I;  4JI5 I;  4X65 E;  4HYM A;  4DUY I;  2F4V I;  4DU7 A;  2IOP A;  4DV4 I;  1H74 A;  4GKK E;  4YY3 I;  1FJG E;  1H72 C;  1BKN A;  3F0N A;  1FKA E;  4B3R I;  1DAR A;  4LF6 I;  1Z0E A;  2O1V A;  2UU9 I;  4P52 A;  2Z5E A;  3J7A G;  2BM0 A;  4JI7 I;  1IBL E;  3J80 C;  1N34 E;  1NZ0 A;  3WU4 A;  4PRV A;  4X65 I;  2Z5C A;  2O1T A;  1Z0G A;  1FNM A;  2F4V E;  4JI4 I;  4DR2 I;  4JI6 I;  4KQV A;  4K0K E;  3PYE A;  4X66 I;  1KIJ A;  3T1H E;  2PNL A;  5A2Q Q;  3WU5 A;  2CGE A;  4B3S E;  3ZKB A;  1XNR I;  4B3R E;  1ZXM A;  4N3O A;  1USV A;  1H7S A;  4DV7 E;  4JV5 I;  4MYU A;  1NHH A;  4OX9 E;  3J7A M;  5FWK A;  1I94 E;  4LF7 I;  4JG4 A;  5BR8 I;  4HY1 A;  4LFB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...