4KHPI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpI00
1WUUA 2V34A 1FI4A 1HNZE 4X62E 4GKJE 4LF5I 4DV3E 3J81C 2HKJA 1Z0TA 4DV2I 1Z0GA 1N32E 1RR9A 2UXDI 1J5EI 4JI0E 1H72C 1RREA 1N36E 1HNWE 1KIJA 3J7AM 4YHHI 4KHPE 2UUAE 1IBLE 5FLXC 1H73A 4X62I 3H4LA 3QT5A 3B82A 3LTOA 2ZM6E 4DR3E 3ZKBA 2VQFE 1KKHA 4DR4E 1N32I 4X65I 5LMUI 4LFAI 2GS8A 4URLA 1H74A 4NXMI 4X64E 4LF6E 4JI0I 4JI8E 3V5RA 4NXNI 1DARA 4B3MI 1I94I 4WUCA 1FWLA 4HY1A 4DV6E 5LMNE 1B63A 1IBME 1Z0WA 1UEKA 1FNMA 1IBLI 3PYEA 3LPSA 2ZM6I 1XNRE 4DR3I 1S4EA 5GMDA 2DEJA 1FWKA 1N0UA 1HNXI 3Q1QA 4LF6I 4JV5I 1Z0CA 1PVGA 4HACB 4DV6I 4LF8I 2NPFA 5LMNI 1XNQE 5IWAE 1NHIA 1D6TA 2E1RA 4DUZE 1Z5BA 4JI4E 5GMEA 4UTGA 1ZM9A 1XMOI 5A2QC 4DR2I 2R42A 4LF5E 1XHKA 4LFCE 4DV2E 4B3TI 1KTVA 5LL6R 3ZZTA 2UXDE 4USMA 1J5EE 1XNQI 4ZVIA 5IWAI 4DXLA 4YHHE 4B3RI 4K0KE 1K47A 3ZZUA 4OX9E 4MYTA 4LFCI 4USKA 4M1KA 4DU7A 2ZBKB 1XMQI 2X36A 4DUYI 4X65E 5LMUE 2BM1A 4LFAE 4NXME 4DPYA 1ZM4A 2CZ9A 1PKPA 1MU5A 4NXNE 4B3ME 4DR1I 1I94E 3PYDA 2UUCI 3B8HA 1NHJA 4K0KI 1N0VC 4OX9I 4P52A 3LNUA 3J81Q 3JAMC 3QT7A 4LF4I 1ZXMA 2LJPA 4FN5A 2A2CA 2VQEE 4MYUA 3J80C 3J7AG 4DV1I 1VISA 1HNXE 3M6AA 4B3SE 4JV5E 1ZXNA 4DV5E 3T1YI 4LFBE 4KQVA 4WUBA 4LF8E 3V2UC 5FLXQ 1A6FA 3CWVA 4PRXA 4JG4A 2UU9I 1XMOE 2VQEI 4DR2E 2DEIA 3PYGA 3QT6A 4DV0I 4B3TE 2V2QA 4B3SI 1NZ0A 4JI6E 5BR8I 3PYFA 4DV5I 1H7SA 4LFBI 1NHHA 2F4VI 4DR6E 2Q2EB 2HFUA 4B3RE 4JI1E 4WUDA 1HR0I 2A2DA 1B62A 5L3JA 1EA6A 2HHHI 3B78A 5IT9C 4DPWA 2UXCI 1N34E 2UUBE 4JI6I 1XMQE 4GKKI 4FWDA 4EMDA 4DUYE 4ED4A 1Z0VA 2HFSA 4PU9A 1PIEA 4DR6I 1Z0EA 1IBKE 4DR1E 4UT4A 4FW9A 1FKAE 5A2QQ 2UUCE 3HULA 4P7AA 4JI1I 1ELOA 4JI7E 4YY3I 2HK3A 4LF7E 4RPFA 2UXBI 4LF4E 4AQYE 4HXZA 2XEXA 3OTOE 1N34I 2UUBI 4DV1E 4LF9I 4JI2E 2HK2A 4DPUA 3ZKDA 3ZM7A 2V2ZA 1IBKI 3T1YE 2J7KA 3F0NA 4JI7I 4LF7I 4JYAI 4DPXA 4AQYI 2UU9E 2V2VA 3WU5A 2V8PA 4JI5I 3OTOI 1OJ4A 4DV0E 1H7UA 4JI2I 4DV4I 3WU3A 4DV7E 1U2RA 5BR8E 3T1HE 3K1JA 1ZM2A 1HNZI 4GKJI 1KVKA 4R1FA 4DV3I 4DR5E 3JAMQ 3GONA 2F4VE 4Z7YA 1MX0A 4DPTA 1ZM3A 3J80Q 2OI2A 4PRVA 4Z7CA 1HR0E 1Z5AA 1N36I 1HNWI 2WW4A 4DR7E 2HHHE 2UXCE 4KHPI 4X66E 1FJGE 3WU6A 4DV7I 2UUAI 3T1HI 4DU8A 4GKKE 4I3HA 2ZITA 2EFGA 4JI3E 4DR5I 2VQFI 2HKEA 2X7IA 4DR4I 3D4JA 1Z0BA 1MG7A 1EI1A 4YY3E 3QT8A 4X64I 2E5LE 1S16A 2BM0A 4JI8I 1BKNA 2BV3A 4HACA 2UXBE 3ZZ0A 4DR7I 4X66I 1IBMI 1FJGI 1N33E 1Z59A 4LF9E 2VF3A 4HYMA 4JI3I 1QZRA 1XNRI 2AJ4A 4XTJA 2R3VA 4FWHA 2E5LI 4JYAE 1Z5CA 5IT9Q 3WU4A 4JI5E 3K17A 1N33I 4FWGA 4DUZI 4DV4E 4JI4I
chains in the Genus database with same CATH superfamily
1WUUA 4IZJD 2V34A 1FI4A 1HNZE 5C0XF 4X62E 4GKJE 4ISAA 2Z5CA 4DV3E 4LF5I 5DRPA 3J81C 4NBQA 2HKJA 3B4TA 4IZJA 1Z0TA 4DV2I 1Z0GA 1N32E 4OO1F 5EL9A 1RR9A 3GCMA 2UXDI 2O3ZA 2CG9A 1J5EI 4JI0E 2BR2B 1H72C 1RREA 1N36E 1HNWE 5FWKA 1KIJA 3J7AM 4YHHI 4KHPE 2UUAE 2AE8A 1IBLE 2PO0B 5FLXC 1H73A 4X62I 3H4LA 1XXEA 3QT5A 3B82A 3LTOA 4MDTA 5ELWA 2ZM6E 4DR3E 3ZKBA 4GQUA 2VQFE 4OZEA 4FW5A 1KKHA 4DR4E 1N32I 5K36E 1E3HA 4X65I 5LMUI 4MU3A 2GS8A 4URLA 1H74A 4LFAI 4NXMI 2JT2A 4X64E 4LF6E 4JI0I 4JI8E 3V5RA 4NXNI 1DARA 4B3MI 5JEAF 1I94I 4WUCA 1FWLA 4HY1A 4DV6E 2BA0G 5LMNE 1B63A 1IBME 5EKWA 2JEAA 1Z0WA 1UEKA 1FNMA 1IBLI 3PYEA 3LPSA 4LCFA 2ZM6I 2VESA 1YHCA 1XNRE 4DR3I 1UDNA 3GMEA 1S4EA 5GMDA 4U3DA 2DEJA 1USVA 1FWKA 5K36F 2WP8B 2Z5BB 1N0UA 1HNXI 3Q1QA 2PO2A 4LF6I 4JV5I 1Z0CA 1PVGA 2JE6A 3PRYA 2PNZB 4HACB 4MU4A 4DV6I 4LF8I 2NPFA 2C38A 5LMNI 1R6LA 1XNQE 1UDSA 5IWAE 1NHIA 1D6TA 4IFDE 2E1RA 4DUZE 1Z5BA 4JI4E 5GMEA 4UTGA 1ZM9A 1XMOI 5A2QC 5C0XE 4DR2I 2C39A 2R42A 2NN6B 2GQ0A 4LPFA 1Y5YA 4LF5E 4J3DA 1XHKA 4LFCE 5DNXA 4DV2E 4B3TI 4OO1C 3U1YA 1KTVA 5LL6R 3ZZTA 2UXDE 4USMA 1J5EE 1UDQA 1XNQI 2PNMA 4ZVIA 5IWAI 3M85D 4IS9A 4AM3A 3M7NG 1USUA 4IFDF 4DXLA 4YHHE 4B3RI 4BA1B 4K0KE 1K47A 3L7ZA 4FW7A 3ZZUA 5K36A 4OX9E 2BA1G 4MYTA 2Z5CB 4LFCI 4USKA 4IZKA 4M1KA 4DU7A 2ZBKB 4IZJB 3PS3A 4IZKB 3UHMA 4MQYA 3P3GA 1XMQI 3PS1A 2X36A 4DUYI 4X65E 2J65A 2BM1A 5LMUE 4LFAE 4NXME 4DPYA 2PO1A 4U3BA 1ZM4A 2CZ9A 3NZKA 1PKPA 1MU5A 3HJCA 4NXNE 4LOMA 5JEAE 3P76A 4B3ME 4DR1I 1I94E 3PYDA 4AIMA 2UUCI 3B8HA 1NHJA 4K0KI 1N0VC 4OX9I 4P52A 3LNUA 3J81Q 3JAMC 3QT7A 2IESA 4BA2A 2JEBA 2NN6E 1ZXMA 4LF4I 2LJPA 4FN5A 2A2CA 2VQEE 4MYUA 3J80C 3J7AG 4DV1I 5K36C 2CVEA 1VISA 1HK7A 5C0XD 1HNXE 3M6AA 4IFDA 4B3SE 4JV5E 1ZXNA 4DV5E 3T1YI 4LFBE 4KQVA 4WUBA 5C0XA 4LF8E 3V2UC 5FLXQ 4OO1D 5DROA 1A6FA 1Y4UA 2JEAB 3DD6A 5DRRA 3CWVA 4PRXA 4OO1A 2NN6F 4JG4A 3GLLA 1XMOE 2UU9I 2VQEI 4DR2E 2DEIA 3PYGA 3QT6A 4DV0I 4B3TE 2V2QA 4QNJA 4B3SI 1NZ0A 4JI6E 5BR8I 2PO2B 3PYFA 1Y6ZA 4DV5I 1H7SA 4LFBI 2JE6B 2WNRA 1NHHA 2F4VI 1OYRA 2C38B 4DR6E 4IFDC 4MU0A 2Q2EB 2HFUA 4B3RE 4JI1E 5C0XC 4WUDA 5JEAD 1HR0I 2A2DA 3P06A 1B62A 5L3JA 2C39B 1EA6A 2GO4A 5JEAA 3B78A 5IT9C 4LCGA 4DPWA 2HHHI 2UXCI 1N34E 2UUBE 4JI6I 1XMQE 4AIDA 4GKKI 4FWDA 4EMDA 4DUYE 4ED4A 1Z0VA 2HFSA 4PU9A 1PIEA 4FW4A 5K36D 4DR6I 1Z0EA 2IERA 1IBKE 4DR1E 4UT4A 3U1KA 4FW9A 1E3PA 1FKAE 5A2QQ 2UUCE 1OYSA 3HULA 4P7AA 4LCHA 4JI1I 1ELOA 4JI7E 4YY3I 2HK3A 4LF7E 3CDIA 3L7ZB 5K36B 4RPFA 2UXBI 4LF4E 1R6MA 4AQYE 2C37A 4HXZA 2XEXA 3OTOE 1N34I 2UUBI 4DV1E 2IOPA 4LF9I 4JI2E 1YH8A 2HK2A 4DPUA 4N3OA 2PO1B 3ZKDA 3ZM7A 5JEAC 2V2ZA 1IBKI 3T1YE 1UDOA 2F1DA 3HKMA 2J7KA 3M85G 3F0NA 2Z5EA 4JI7I 4LF7I 4JYAI 3H1CA 4DPXA 2NN6C 4AQYI 4BA2B 2BR2A 2JEBB 2V2VA 2UU9E 3WU5A 2V8PA 4JI5I 4IFDD 3OTOI 3KRNA 1OJ4A 2BA0D 2GO3A 4DV0E 3PS2A 1H7UA 4JI2I 4DV4I 3WU3A 2PO0A 4DV7E 1U2RA 5BR8E 4IFDB 3T1HE 3K1JA 1ZM2A 1HNZI 3Q6NA 4GKJI 1KVKA 4R1FA 4DV3I 4DR5E 5C0XB 3JAMQ 3GONA 2O1WA 2F4VE 4Z7YA 1MX0A 4DPTA 1RHYA 1ZM3A 5DRQA 3J80Q 2OI2A 4OO1B 4PRVA 4Z7CA 1HR0E 1Z5AA 5DNLA 1N36I 1HNWI 2O1UA 2WW4A 4DR7E 2HHHE 2UXCE 4KHPI 4X66E 1FJGE 3WU6A 4DV7I 4MU1A 3K85A 2UUAI 3T1HI 4DU8A 4GKKE 4I3HA 2ZITA 2EFGA 4JI3E 4DR5I 2WNRB 1Y4SA 2IOQA 2VQFI 3P3CA 2HKEA 2X7IA 2WP8A 2Z5BA 4DR4I 3D4JA 1Z0BA 1MG7A 1EI1A 4YY3E 1OYPA 3QT8A 4X64I 2PNZA 2E5LE 1S16A 2BM0A 4JI8I 1BKNA 2BV3A 4HACA 2UXBE 3ZZ0A 4DR7I 4OKGA 3M7ND 4X66I 1IBMI 1FJGI 1N33E 5JEAB 1Z59A 2NN6D 3P3EA 4LF9E 2PNLA 2VF3A 4HYMA 4JI3I 1QZRA 1XNRI 2BA1D 4FW3A 2NN6A 2AJ4A 4XTJA 1Y60A 1P42A 2R3VA 3Q6MA 4FWHA 2E5LI 4JYAE 4FW6A 2O1VA 1Z5CA 4OO1E 5IT9Q 3WU4A 2CGEA 4JI5E 3K17A 4QNKA 2C37B 1N33I 1VI7A 4FWGA 3CDJA 4BA1A 4DUZI 4DV4E 4JI4I 2O1TA
chains in the Genus database with same CATH topology
1WUUA 4IZJD 2V34A 1FI4A 1HNZE 4X62E 4GKJE 2Z5CA 4DV3E 4LF5I 3J81C 2HKJA 4IZJA 1Z0TA 4DV2I 1Z0GA 1N32E 1RR9A 2UXDI 2CG9A 1J5EI 4JI0E 1H72C 1RREA 1N36E 1HNWE 5FWKA 1KIJA 3J7AM 4YHHI 4KHPE 2UUAE 1IBLE 5FLXC 1H73A 4X62I 3H4LA 3QT5A 3B82A 3LTOA 2ZM6E 4DR3E 3ZKBA 2VQFE 1KKHA 4DR4E 1N32I 4X65I 5LMUI 4LFAI 2GS8A 4URLA 1H74A 4NXMI 4X64E 4LF6E 4JI0I 4JI8E 3V5RA 4NXNI 1DARA 4B3MI 1I94I 4WUCA 1FWLA 4HY1A 4DV6E 5LMNE 1B63A 1IBME 1Z0WA 1UEKA 1FNMA 1IBLI 3PYEA 3LPSA 2ZM6I 1XNRE 4DR3I 1S4EA 5GMDA 2DEJA 1USVA 1FWKA 2Z5BB 1N0UA 1HNXI 3Q1QA 4LF6I 4JV5I 1Z0CA 1PVGA 3PRYA 4HACB 4DV6I 4LF8I 2NPFA 5LMNI 1XNQE 5IWAE 1NHIA 1D6TA 2E1RA 4DUZE 1Z5BA 4JI4E 5GMEA 4UTGA 1ZM9A 1XMOI 5A2QC 4DR2I 2R42A 2GQ0A 4LF5E 1XHKA 4LFCE 4DV2E 4B3TI 1KTVA 5LL6R 3ZZTA 2UXDE 4USMA 1J5EE 1XNQI 2PNMA 4ZVIA 5IWAI 1USUA 4DXLA 4YHHE 4B3RI 4K0KE 1K47A 3ZZUA 4OX9E 4MYTA 2Z5CB 4LFCI 4USKA 4IZKA 4M1KA 4DU7A 2ZBKB 4IZJB 4IZKB 1XMQI 2X36A 4DUYI 4X65E 5LMUE 2BM1A 4LFAE 4NXME 4DPYA 1ZM4A 2CZ9A 1PKPA 1MU5A 3HJCA 4NXNE 4B3ME 4DR1I 1I94E 3PYDA 2UUCI 3B8HA 1NHJA 4K0KI 1N0VC 4OX9I 4P52A 3LNUA 3J81Q 3JAMC 3QT7A 4LF4I 1ZXMA 2LJPA 4FN5A 2A2CA 2VQEE 4MYUA 3J80C 3J7AG 4DV1I 1VISA 1HK7A 1HNXE 3M6AA 4B3SE 4JV5E 1ZXNA 4DV5E 3T1YI 4LFBE 4KQVA 4WUBA 4LF8E 3V2UC 5FLXQ 1A6FA 1Y4UA 3CWVA 4PRXA 4JG4A 2UU9I 1XMOE 2VQEI 4DR2E 2DEIA 3PYGA 3QT6A 4DV0I 4B3TE 2V2QA 4B3SI 1NZ0A 4JI6E 5BR8I 3PYFA 1Y6ZA 4DV5I 1H7SA 4LFBI 1NHHA 2F4VI 4DR6E 2Q2EB 2HFUA 4B3RE 4JI1E 4WUDA 1HR0I 2A2DA 3P06A 1B62A 5L3JA 1EA6A 2HHHI 3B78A 5IT9C 4DPWA 2UXCI 1N34E 2UUBE 4JI6I 1XMQE 4GKKI 4FWDA 4EMDA 4DUYE 4ED4A 1Z0VA 2HFSA 4PU9A 1PIEA 4DR6I 1Z0EA 1IBKE 4DR1E 4UT4A 4FW9A 1FKAE 5A2QQ 2UUCE 3HULA 4P7AA 4JI1I 1ELOA 4JI7E 4YY3I 2HK3A 4LF7E 4RPFA 2UXBI 4LF4E 4AQYE 4HXZA 2XEXA 3OTOE 1N34I 2UUBI 4DV1E 2IOPA 4LF9I 4JI2E 2HK2A 4DPUA 4N3OA 3ZKDA 3ZM7A 2V2ZA 1IBKI 3T1YE 2J7KA 3F0NA 2Z5EA 4JI7I 4LF7I 4JYAI 4DPXA 4AQYI 2UU9E 2V2VA 3WU5A 2V8PA 4JI5I 3OTOI 1OJ4A 4DV0E 1H7UA 4JI2I 4DV4I 3WU3A 4DV7E 1U2RA 5BR8E 3T1HE 3K1JA 1ZM2A 1HNZI 3Q6NA 4GKJI 1KVKA 4R1FA 4DV3I 4DR5E 3JAMQ 3GONA 2O1WA 2F4VE 4Z7YA 1MX0A 4DPTA 1ZM3A 3J80Q 2OI2A 4PRVA 4Z7CA 1HR0E 1Z5AA 1N36I 1HNWI 2O1UA 2WW4A 4DR7E 2HHHE 2UXCE 4KHPI 4X66E 1FJGE 3WU6A 4DV7I 3K85A 2UUAI 3T1HI 4DU8A 4GKKE 4I3HA 2ZITA 2EFGA 4JI3E 4DR5I 1Y4SA 2IOQA 2VQFI 2HKEA 2X7IA 2Z5BA 4DR4I 3D4JA 1Z0BA 1MG7A 1EI1A 4YY3E 3QT8A 4X64I 2E5LE 1S16A 2BM0A 4JI8I 1BKNA 2BV3A 4HACA 2UXBE 3ZZ0A 4DR7I 4X66I 1IBMI 1FJGI 1N33E 1Z59A 4LF9E 2PNLA 2VF3A 4HYMA 4JI3I 1QZRA 1XNRI 2AJ4A 4XTJA 2R3VA 3Q6MA 4FWHA 2E5LI 4JYAE 2O1VA 1Z5CA 5IT9Q 3WU4A 2CGEA 4JI5E 3K17A 1N33I 4FWGA 4DUZI 4DV4E 4JI4I 2O1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUU A;  2V34 A;  1FI4 A;  1HNZ E;  4X62 E;  4GKJ E;  4LF5 I;  4DV3 E;  3J81 C;  2HKJ A;  1Z0T A;  4DV2 I;  1Z0G A;  1N32 E;  1RR9 A;  2UXD I;  1J5E I;  4JI0 E;  1H72 C;  1RRE A;  1N36 E;  1HNW E;  1KIJ A;  3J7A M;  4YHH I;  4KHP E;  2UUA E;  1IBL E;  5FLX C;  1H73 A;  4X62 I;  3H4L A;  3QT5 A;  3B82 A;  3LTO A;  2ZM6 E;  4DR3 E;  3ZKB A;  2VQF E;  1KKH A;  4DR4 E;  1N32 I;  4X65 I;  5LMU I;  4LFA I;  2GS8 A;  4URL A;  1H74 A;  4NXM I;  4X64 E;  4LF6 E;  4JI0 I;  4JI8 E;  3V5R A;  4NXN I;  1DAR A;  4B3M I;  1I94 I;  4WUC A;  1FWL A;  4HY1 A;  4DV6 E;  5LMN E;  1B63 A;  1IBM E;  1Z0W A;  1UEK A;  1FNM A;  1IBL I;  3PYE A;  3LPS A;  2ZM6 I;  1XNR E;  4DR3 I;  1S4E A;  5GMD A;  2DEJ A;  1FWK A;  1N0U A;  1HNX I;  3Q1Q A;  4LF6 I;  4JV5 I;  1Z0C A;  1PVG A;  4HAC B;  4DV6 I;  4LF8 I;  2NPF A;  5LMN I;  1XNQ E;  5IWA E;  1NHI A;  1D6T A;  2E1R A;  4DUZ E;  1Z5B A;  4JI4 E;  5GME A;  4UTG A;  1ZM9 A;  1XMO I;  5A2Q C;  4DR2 I;  2R42 A;  4LF5 E;  1XHK A;  4LFC E;  4DV2 E;  4B3T I;  1KTV A;  5LL6 R;  3ZZT A;  2UXD E;  4USM A;  1J5E E;  1XNQ I;  4ZVI A;  5IWA I;  4DXL A;  4YHH E;  4B3R I;  4K0K E;  1K47 A;  3ZZU A;  4OX9 E;  4MYT A;  4LFC I;  4USK A;  4M1K A;  4DU7 A;  2ZBK B;  1XMQ I;  2X36 A;  4DUY I;  4X65 E;  5LMU E;  2BM1 A;  4LFA E;  4NXM E;  4DPY A;  1ZM4 A;  2CZ9 A;  1PKP A;  1MU5 A;  4NXN E;  4B3M E;  4DR1 I;  1I94 E;  3PYD A;  2UUC I;  3B8H A;  1NHJ A;  4K0K I;  1N0V C;  4OX9 I;  4P52 A;  3LNU A;  3J81 Q;  3JAM C;  3QT7 A;  4LF4 I;  1ZXM A;  2LJP A;  4FN5 A;  2A2C A;  2VQE E;  4MYU A;  3J80 C;  3J7A G;  4DV1 I;  1VIS A;  1HNX E;  3M6A A;  4B3S E;  4JV5 E;  1ZXN A;  4DV5 E;  3T1Y I;  4LFB E;  4KQV A;  4WUB A;  4LF8 E;  3V2U C;  5FLX Q;  1A6F A;  3CWV A;  4PRX A;  4JG4 A;  2UU9 I;  1XMO E;  2VQE I;  4DR2 E;  2DEI A;  3PYG A;  3QT6 A;  4DV0 I;  4B3T E;  2V2Q A;  4B3S I;  1NZ0 A;  4JI6 E;  5BR8 I;  3PYF A;  4DV5 I;  1H7S A;  4LFB I;  1NHH A;  2F4V I;  4DR6 E;  2Q2E B;  2HFU A;  4B3R E;  4JI1 E;  4WUD A;  1HR0 I;  2A2D A;  1B62 A;  5L3J A;  1EA6 A;  2HHH I;  3B78 A;  5IT9 C;  4DPW A;  2UXC I;  1N34 E;  2UUB E;  4JI6 I;  1XMQ E;  4GKK I;  4FWD A;  4EMD A;  4DUY E;  4ED4 A;  1Z0V A;  2HFS A;  4PU9 A;  1PIE A;  4DR6 I;  1Z0E A;  1IBK E;  4DR1 E;  4UT4 A;  4FW9 A;  1FKA E;  5A2Q Q;  2UUC E;  3HUL A;  4P7A A;  4JI1 I;  1ELO A;  4JI7 E;  4YY3 I;  2HK3 A;  4LF7 E;  4RPF A;  2UXB I;  4LF4 E;  4AQY E;  4HXZ A;  2XEX A;  3OTO E;  1N34 I;  2UUB I;  4DV1 E;  4LF9 I;  4JI2 E;  2HK2 A;  4DPU A;  3ZKD A;  3ZM7 A;  2V2Z A;  1IBK I;  3T1Y E;  2J7K A;  3F0N A;  4JI7 I;  4LF7 I;  4JYA I;  4DPX A;  4AQY I;  2UU9 E;  2V2V A;  3WU5 A;  2V8P A;  4JI5 I;  3OTO I;  1OJ4 A;  4DV0 E;  1H7U A;  4JI2 I;  4DV4 I;  3WU3 A;  4DV7 E;  1U2R A;  5BR8 E;  3T1H E;  3K1J A;  1ZM2 A;  1HNZ I;  4GKJ I;  1KVK A;  4R1F A;  4DV3 I;  4DR5 E;  3JAM Q;  3GON A;  2F4V E;  4Z7Y A;  1MX0 A;  4DPT A;  1ZM3 A;  3J80 Q;  2OI2 A;  4PRV A;  4Z7C A;  1HR0 E;  1Z5A A;  1N36 I;  1HNW I;  2WW4 A;  4DR7 E;  2HHH E;  2UXC E;  4KHP I;  4X66 E;  1FJG E;  3WU6 A;  4DV7 I;  2UUA I;  3T1H I;  4DU8 A;  4GKK E;  4I3H A;  2ZIT A;  2EFG A;  4JI3 E;  4DR5 I;  2VQF I;  2HKE A;  2X7I A;  4DR4 I;  3D4J A;  1Z0B A;  1MG7 A;  1EI1 A;  4YY3 E;  3QT8 A;  4X64 I;  2E5L E;  1S16 A;  2BM0 A;  4JI8 I;  1BKN A;  2BV3 A;  4HAC A;  2UXB E;  3ZZ0 A;  4DR7 I;  4X66 I;  1IBM I;  1FJG I;  1N33 E;  1Z59 A;  4LF9 E;  2VF3 A;  4HYM A;  4JI3 I;  1QZR A;  1XNR I;  2AJ4 A;  4XTJ A;  2R3V A;  4FWH A;  2E5L I;  4JYA E;  1Z5C A;  5IT9 Q;  3WU4 A;  4JI5 E;  3K17 A;  1N33 I;  4FWG A;  4DUZ I;  4DV4 E;  4JI4 I; 
#chains in the Genus database with same CATH topology
 1WUU A;  4IZJ D;  2V34 A;  1FI4 A;  1HNZ E;  5C0X F;  4X62 E;  4GKJ E;  4ISA A;  2Z5C A;  4DV3 E;  4LF5 I;  5DRP A;  3J81 C;  4NBQ A;  2HKJ A;  3B4T A;  4IZJ A;  1Z0T A;  4DV2 I;  1Z0G A;  1N32 E;  4OO1 F;  5EL9 A;  1RR9 A;  3GCM A;  2UXD I;  2O3Z A;  2CG9 A;  1J5E I;  4JI0 E;  2BR2 B;  1H72 C;  1RRE A;  1N36 E;  1HNW E;  5FWK A;  1KIJ A;  3J7A M;  4YHH I;  4KHP E;  2UUA E;  2AE8 A;  1IBL E;  2PO0 B;  5FLX C;  1H73 A;  4X62 I;  3H4L A;  1XXE A;  3QT5 A;  3B82 A;  3LTO A;  4MDT A;  5ELW A;  2ZM6 E;  4DR3 E;  3ZKB A;  4GQU A;  2VQF E;  4OZE A;  4FW5 A;  1KKH A;  4DR4 E;  1N32 I;  5K36 E;  1E3H A;  4X65 I;  5LMU I;  4MU3 A;  2GS8 A;  4URL A;  1H74 A;  4LFA I;  4NXM I;  2JT2 A;  4X64 E;  4LF6 E;  4JI0 I;  4JI8 E;  3V5R A;  4NXN I;  1DAR A;  4B3M I;  5JEA F;  1I94 I;  4WUC A;  1FWL A;  4HY1 A;  4DV6 E;  2BA0 G;  5LMN E;  1B63 A;  1IBM E;  5EKW A;  2JEA A;  1Z0W A;  1UEK A;  1FNM A;  1IBL I;  3PYE A;  3LPS A;  4LCF A;  2ZM6 I;  2VES A;  1YHC A;  1XNR E;  4DR3 I;  1UDN A;  3GME A;  1S4E A;  5GMD A;  4U3D A;  2DEJ A;  1USV A;  1FWK A;  5K36 F;  2WP8 B;  2Z5B B;  1N0U A;  1HNX I;  3Q1Q A;  2PO2 A;  4LF6 I;  4JV5 I;  1Z0C A;  1PVG A;  2JE6 A;  3PRY A;  2PNZ B;  4HAC B;  4MU4 A;  4DV6 I;  4LF8 I;  2NPF A;  2C38 A;  5LMN I;  1R6L A;  1XNQ E;  1UDS A;  5IWA E;  1NHI A;  1D6T A;  4IFD E;  2E1R A;  4DUZ E;  1Z5B A;  4JI4 E;  5GME A;  4UTG A;  1ZM9 A;  1XMO I;  5A2Q C;  5C0X E;  4DR2 I;  2C39 A;  2R42 A;  2NN6 B;  2GQ0 A;  4LPF A;  1Y5Y A;  4LF5 E;  4J3D A;  1XHK A;  4LFC E;  5DNX A;  4DV2 E;  4B3T I;  4OO1 C;  3U1Y A;  1KTV A;  5LL6 R;  3ZZT A;  2UXD E;  4USM A;  1J5E E;  1UDQ A;  1XNQ I;  2PNM A;  4ZVI A;  5IWA I;  3M85 D;  4IS9 A;  4AM3 A;  3M7N G;  1USU A;  4IFD F;  4DXL A;  4YHH E;  4B3R I;  4BA1 B;  4K0K E;  1K47 A;  3L7Z A;  4FW7 A;  3ZZU A;  5K36 A;  4OX9 E;  2BA1 G;  4MYT A;  2Z5C B;  4LFC I;  4USK A;  4IZK A;  4M1K A;  4DU7 A;  2ZBK B;  4IZJ B;  3PS3 A;  4IZK B;  3UHM A;  4MQY A;  3P3G A;  1XMQ I;  3PS1 A;  2X36 A;  4DUY I;  4X65 E;  2J65 A;  2BM1 A;  5LMU E;  4LFA E;  4NXM E;  4DPY A;  2PO1 A;  4U3B A;  1ZM4 A;  2CZ9 A;  3NZK A;  1PKP A;  1MU5 A;  3HJC A;  4NXN E;  4LOM A;  5JEA E;  3P76 A;  4B3M E;  4DR1 I;  1I94 E;  3PYD A;  4AIM A;  2UUC I;  3B8H A;  1NHJ A;  4K0K I;  1N0V C;  4OX9 I;  4P52 A;  3LNU A;  3J81 Q;  3JAM C;  3QT7 A;  2IES A;  4BA2 A;  2JEB A;  2NN6 E;  1ZXM A;  4LF4 I;  2LJP A;  4FN5 A;  2A2C A;  2VQE E;  4MYU A;  3J80 C;  3J7A G;  4DV1 I;  5K36 C;  2CVE A;  1VIS A;  1HK7 A;  5C0X D;  1HNX E;  3M6A A;  4IFD A;  4B3S E;  4JV5 E;  1ZXN A;  4DV5 E;  3T1Y I;  4LFB E;  4KQV A;  4WUB A;  5C0X A;  4LF8 E;  3V2U C;  5FLX Q;  4OO1 D;  5DRO A;  1A6F A;  1Y4U A;  2JEA B;  3DD6 A;  5DRR A;  3CWV A;  4PRX A;  4OO1 A;  2NN6 F;  4JG4 A;  3GLL A;  1XMO E;  2UU9 I;  2VQE I;  4DR2 E;  2DEI A;  3PYG A;  3QT6 A;  4DV0 I;  4B3T E;  2V2Q A;  4QNJ A;  4B3S I;  1NZ0 A;  4JI6 E;  5BR8 I;  2PO2 B;  3PYF A;  1Y6Z A;  4DV5 I;  1H7S A;  4LFB I;  2JE6 B;  2WNR A;  1NHH A;  2F4V I;  1OYR A;  2C38 B;  4DR6 E;  4IFD C;  4MU0 A;  2Q2E B;  2HFU A;  4B3R E;  4JI1 E;  5C0X C;  4WUD A;  5JEA D;  1HR0 I;  2A2D A;  3P06 A;  1B62 A;  5L3J A;  2C39 B;  1EA6 A;  2GO4 A;  5JEA A;  3B78 A;  5IT9 C;  4LCG A;  4DPW A;  2HHH I;  2UXC I;  1N34 E;  2UUB E;  4JI6 I;  1XMQ E;  4AID A;  4GKK I;  4FWD A;  4EMD A;  4DUY E;  4ED4 A;  1Z0V A;  2HFS A;  4PU9 A;  1PIE A;  4FW4 A;  5K36 D;  4DR6 I;  1Z0E A;  2IER A;  1IBK E;  4DR1 E;  4UT4 A;  3U1K A;  4FW9 A;  1E3P A;  1FKA E;  5A2Q Q;  2UUC E;  1OYS A;  3HUL A;  4P7A A;  4LCH A;  4JI1 I;  1ELO A;  4JI7 E;  4YY3 I;  2HK3 A;  4LF7 E;  3CDI A;  3L7Z B;  5K36 B;  4RPF A;  2UXB I;  4LF4 E;  1R6M A;  4AQY E;  2C37 A;  4HXZ A;  2XEX A;  3OTO E;  1N34 I;  2UUB I;  4DV1 E;  2IOP A;  4LF9 I;  4JI2 E;  1YH8 A;  2HK2 A;  4DPU A;  4N3O A;  2PO1 B;  3ZKD A;  3ZM7 A;  5JEA C;  2V2Z A;  1IBK I;  3T1Y E;  1UDO A;  2F1D A;  3HKM A;  2J7K A;  3M85 G;  3F0N A;  2Z5E A;  4JI7 I;  4LF7 I;  4JYA I;  3H1C A;  4DPX A;  2NN6 C;  4AQY I;  4BA2 B;  2BR2 A;  2JEB B;  2V2V A;  2UU9 E;  3WU5 A;  2V8P A;  4JI5 I;  4IFD D;  3OTO I;  3KRN A;  1OJ4 A;  2BA0 D;  2GO3 A;  4DV0 E;  3PS2 A;  1H7U A;  4JI2 I;  4DV4 I;  3WU3 A;  2PO0 A;  4DV7 E;  1U2R A;  5BR8 E;  4IFD B;  3T1H E;  3K1J A;  1ZM2 A;  1HNZ I;  3Q6N A;  4GKJ I;  1KVK A;  4R1F A;  4DV3 I;  4DR5 E;  5C0X B;  3JAM Q;  3GON A;  2O1W A;  2F4V E;  4Z7Y A;  1MX0 A;  4DPT A;  1RHY A;  1ZM3 A;  5DRQ A;  3J80 Q;  2OI2 A;  4OO1 B;  4PRV A;  4Z7C A;  1HR0 E;  1Z5A A;  5DNL A;  1N36 I;  1HNW I;  2O1U A;  2WW4 A;  4DR7 E;  2HHH E;  2UXC E;  4KHP I;  4X66 E;  1FJG E;  3WU6 A;  4DV7 I;  4MU1 A;  3K85 A;  2UUA I;  3T1H I;  4DU8 A;  4GKK E;  4I3H A;  2ZIT A;  2EFG A;  4JI3 E;  4DR5 I;  2WNR B;  1Y4S A;  2IOQ A;  2VQF I;  3P3C A;  2HKE A;  2X7I A;  2WP8 A;  2Z5B A;  4DR4 I;  3D4J A;  1Z0B A;  1MG7 A;  1EI1 A;  4YY3 E;  1OYP A;  3QT8 A;  4X64 I;  2PNZ A;  2E5L E;  1S16 A;  2BM0 A;  4JI8 I;  1BKN A;  2BV3 A;  4HAC A;  2UXB E;  3ZZ0 A;  4DR7 I;  4OKG A;  3M7N D;  4X66 I;  1IBM I;  1FJG I;  1N33 E;  5JEA B;  1Z59 A;  2NN6 D;  3P3E A;  4LF9 E;  2PNL A;  2VF3 A;  4HYM A;  4JI3 I;  1QZR A;  1XNR I;  2BA1 D;  4FW3 A;  2NN6 A;  2AJ4 A;  4XTJ A;  1Y60 A;  1P42 A;  2R3V A;  3Q6M A;  4FWH A;  2E5L I;  4JYA E;  4FW6 A;  2O1V A;  1Z5C A;  4OO1 E;  5IT9 Q;  3WU4 A;  2CGE A;  4JI5 E;  3K17 A;  4QNK A;  2C37 B;  1N33 I;  1VI7 A;  4FWG A;  3CDJ A;  4BA1 A;  4DUZ I;  4DV4 E;  4JI4 I;  2O1T A; 
#chains in the Genus database with same CATH homology
 1WUU A;  4IZJ D;  2V34 A;  1FI4 A;  1HNZ E;  4X62 E;  4GKJ E;  2Z5C A;  4DV3 E;  4LF5 I;  3J81 C;  2HKJ A;  4IZJ A;  1Z0T A;  4DV2 I;  1Z0G A;  1N32 E;  1RR9 A;  2UXD I;  2CG9 A;  1J5E I;  4JI0 E;  1H72 C;  1RRE A;  1N36 E;  1HNW E;  5FWK A;  1KIJ A;  3J7A M;  4YHH I;  4KHP E;  2UUA E;  1IBL E;  5FLX C;  1H73 A;  4X62 I;  3H4L A;  3QT5 A;  3B82 A;  3LTO A;  2ZM6 E;  4DR3 E;  3ZKB A;  2VQF E;  1KKH A;  4DR4 E;  1N32 I;  4X65 I;  5LMU I;  4LFA I;  2GS8 A;  4URL A;  1H74 A;  4NXM I;  4X64 E;  4LF6 E;  4JI0 I;  4JI8 E;  3V5R A;  4NXN I;  1DAR A;  4B3M I;  1I94 I;  4WUC A;  1FWL A;  4HY1 A;  4DV6 E;  5LMN E;  1B63 A;  1IBM E;  1Z0W A;  1UEK A;  1FNM A;  1IBL I;  3PYE A;  3LPS A;  2ZM6 I;  1XNR E;  4DR3 I;  1S4E A;  5GMD A;  2DEJ A;  1USV A;  1FWK A;  2Z5B B;  1N0U A;  1HNX I;  3Q1Q A;  4LF6 I;  4JV5 I;  1Z0C A;  1PVG A;  3PRY A;  4HAC B;  4DV6 I;  4LF8 I;  2NPF A;  5LMN I;  1XNQ E;  5IWA E;  1NHI A;  1D6T A;  2E1R A;  4DUZ E;  1Z5B A;  4JI4 E;  5GME A;  4UTG A;  1ZM9 A;  1XMO I;  5A2Q C;  4DR2 I;  2R42 A;  2GQ0 A;  4LF5 E;  1XHK A;  4LFC E;  4DV2 E;  4B3T I;  1KTV A;  5LL6 R;  3ZZT A;  2UXD E;  4USM A;  1J5E E;  1XNQ I;  2PNM A;  4ZVI A;  5IWA I;  1USU A;  4DXL A;  4YHH E;  4B3R I;  4K0K E;  1K47 A;  3ZZU A;  4OX9 E;  4MYT A;  2Z5C B;  4LFC I;  4USK A;  4IZK A;  4M1K A;  4DU7 A;  2ZBK B;  4IZJ B;  4IZK B;  1XMQ I;  2X36 A;  4DUY I;  4X65 E;  5LMU E;  2BM1 A;  4LFA E;  4NXM E;  4DPY A;  1ZM4 A;  2CZ9 A;  1PKP A;  1MU5 A;  3HJC A;  4NXN E;  4B3M E;  4DR1 I;  1I94 E;  3PYD A;  2UUC I;  3B8H A;  1NHJ A;  4K0K I;  1N0V C;  4OX9 I;  4P52 A;  3LNU A;  3J81 Q;  3JAM C;  3QT7 A;  4LF4 I;  1ZXM A;  2LJP A;  4FN5 A;  2A2C A;  2VQE E;  4MYU A;  3J80 C;  3J7A G;  4DV1 I;  1VIS A;  1HK7 A;  1HNX E;  3M6A A;  4B3S E;  4JV5 E;  1ZXN A;  4DV5 E;  3T1Y I;  4LFB E;  4KQV A;  4WUB A;  4LF8 E;  3V2U C;  5FLX Q;  1A6F A;  1Y4U A;  3CWV A;  4PRX A;  4JG4 A;  2UU9 I;  1XMO E;  2VQE I;  4DR2 E;  2DEI A;  3PYG A;  3QT6 A;  4DV0 I;  4B3T E;  2V2Q A;  4B3S I;  1NZ0 A;  4JI6 E;  5BR8 I;  3PYF A;  1Y6Z A;  4DV5 I;  1H7S A;  4LFB I;  1NHH A;  2F4V I;  4DR6 E;  2Q2E B;  2HFU A;  4B3R E;  4JI1 E;  4WUD A;  1HR0 I;  2A2D A;  3P06 A;  1B62 A;  5L3J A;  1EA6 A;  2HHH I;  3B78 A;  5IT9 C;  4DPW A;  2UXC I;  1N34 E;  2UUB E;  4JI6 I;  1XMQ E;  4GKK I;  4FWD A;  4EMD A;  4DUY E;  4ED4 A;  1Z0V A;  2HFS A;  4PU9 A;  1PIE A;  4DR6 I;  1Z0E A;  1IBK E;  4DR1 E;  4UT4 A;  4FW9 A;  1FKA E;  5A2Q Q;  2UUC E;  3HUL A;  4P7A A;  4JI1 I;  1ELO A;  4JI7 E;  4YY3 I;  2HK3 A;  4LF7 E;  4RPF A;  2UXB I;  4LF4 E;  4AQY E;  4HXZ A;  2XEX A;  3OTO E;  1N34 I;  2UUB I;  4DV1 E;  2IOP A;  4LF9 I;  4JI2 E;  2HK2 A;  4DPU A;  4N3O A;  3ZKD A;  3ZM7 A;  2V2Z A;  1IBK I;  3T1Y E;  2J7K A;  3F0N A;  2Z5E A;  4JI7 I;  4LF7 I;  4JYA I;  4DPX A;  4AQY I;  2UU9 E;  2V2V A;  3WU5 A;  2V8P A;  4JI5 I;  3OTO I;  1OJ4 A;  4DV0 E;  1H7U A;  4JI2 I;  4DV4 I;  3WU3 A;  4DV7 E;  1U2R A;  5BR8 E;  3T1H E;  3K1J A;  1ZM2 A;  1HNZ I;  3Q6N A;  4GKJ I;  1KVK A;  4R1F A;  4DV3 I;  4DR5 E;  3JAM Q;  3GON A;  2O1W A;  2F4V E;  4Z7Y A;  1MX0 A;  4DPT A;  1ZM3 A;  3J80 Q;  2OI2 A;  4PRV A;  4Z7C A;  1HR0 E;  1Z5A A;  1N36 I;  1HNW I;  2O1U A;  2WW4 A;  4DR7 E;  2HHH E;  2UXC E;  4KHP I;  4X66 E;  1FJG E;  3WU6 A;  4DV7 I;  3K85 A;  2UUA I;  3T1H I;  4DU8 A;  4GKK E;  4I3H A;  2ZIT A;  2EFG A;  4JI3 E;  4DR5 I;  1Y4S A;  2IOQ A;  2VQF I;  2HKE A;  2X7I A;  2Z5B A;  4DR4 I;  3D4J A;  1Z0B A;  1MG7 A;  1EI1 A;  4YY3 E;  3QT8 A;  4X64 I;  2E5L E;  1S16 A;  2BM0 A;  4JI8 I;  1BKN A;  2BV3 A;  4HAC A;  2UXB E;  3ZZ0 A;  4DR7 I;  4X66 I;  1IBM I;  1FJG I;  1N33 E;  1Z59 A;  4LF9 E;  2PNL A;  2VF3 A;  4HYM A;  4JI3 I;  1QZR A;  1XNR I;  2AJ4 A;  4XTJ A;  2R3V A;  3Q6M A;  4FWH A;  2E5L I;  4JYA E;  2O1V A;  1Z5C A;  5IT9 Q;  3WU4 A;  2CGE A;  4JI5 E;  3K17 A;  1N33 I;  4FWG A;  4DUZ I;  4DV4 E;  4JI4 I;  2O1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...