4KHPI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpI00
1HNWI 1XNRI 1NHHA 1Z5AA 4JI8I 2E1RA 4NXNI 3PYDA 1VISA 1FI4A 5LMNI 4GKJI 1FJGE 1B63A 3J7AG 4DV0E 4Z7CA 2NPFA 4FN5A 4DV4I 4DUZI 4UT4A 3HULA 1U2RA 2HHHI 4M1KA 4ZVIA 2X36A 2VQFI 4LF9I 3LTOA 4YHHE 4KQVA 1BKNA 1XMQE 4X64E 1N36E 1FKAE 2F4VE 4X65E 2V8PA 1HNWE 4JI4I 4LF5I 4K0KI 3V5RA 4NXNE 1RREA 3JAMQ 1PIEA 1NHIA 4DR3I 5LMNE 3J81C 1FNMA 3ZKBA 4JV5E 4DUZE 3M6AA 4DV6E 4MYUA 4JYAE 4DV1E 2VQFE 2UXBI 1FWLA 5A2QC 4JI5I 4DPTA 1Z5BA 4YY3E 1HR0I 4DV2I 3QT8A 1H72C 1Z0GA 1Z0WA 4JI4E 4OX9E 4LF5E 4K0KE 3OTOI 1DARA 4DR4I 3PYFA 4LF8I 1H73A 3LNUA 4JI3I 4DR3E 3CWVA 2BM0A 5FLXC 4HXZA 4AQYI 4HACB 3D4JA 1N32I 4GKKI 2HFUA 4B3RI 5IWAI 3ZM7A 1J5EI 1RR9A 2UXBE 4DPUA 4PRXA 4USKA 4X62E 4JI5E 4EMDA 5LL6R 4KHPE 3ZZTA 1B62A 2VQEE 1IBLI 1N33I 2XEXA 3OTOE 4DR4E 2UU9I 2X7IA 4LF8E 3J81Q 4JI3E 3QT7A 1K47A 4AQYE 3T1YI 1N32E 4B3RE 4JI1E 5IWAE 1J5EE 4DUYI 5A2QQ 1N0VC 1ELOA 4DV3E 4P52A 1IBLE 1N33E 4JI6I 2ZM6I 4DR7E 4Z7YA 3WU5A 3ZZUA 2HKEA 2UUBI 1IBKE 1N0UA 3WU6A 5FLXQ 4DR5I 4JI0I 1H7SA 4X66E 3T1HI 1Z0BA 4LF7E 2BM1A 3T1YE 1H74A 3ZKDA 4B3TI 1XNRE 4HY1A 4JI8E 2ZBKB 3K17A 5GMDA 4B3MI 4GKJE 2HFSA 1ZXMA 3J80C 1PVGA 4DV4E 3H4LA 5IT9C 2V2ZA 4JI6E 4FWHA 2HHHE 1KTVA 2HK3A 2ZM6E 1XNQI 4JG4A 1UEKA 4LF9E 2HK2A 4DR1I 2UUBE 1KKHA 3T1HE 1I94I 1N34I 2J7KA 4DU8A 4PRVA 5L3JA 2HKJA 4B3TE 3Q1QA 4DPXA 1XMOI 4R1FA 2R3VA 1MU5A 2UUCI 1S16A 2V2VA 4FWDA 2UXCI 3QT6A 1XNQE 1HNZI 1EA6A 4DV5I 2Q2EB 4DR1E 4FW9A 5LMUI 1Z0EA 4DPYA 1QZRA 1I94E 2E5LI 1MG7A 2BV3A 1HR0E 1H7UA 4DV2E 2DEJA 4P7AA 1XMOE 2R42A 3J80Q 3F0NA 5IT9Q 2GS8A 1ZM3A 2VF3A 4GKKE 4WUDA 1S4EA 3WU4A 1MX0A 3ZZ0A 4LFCI 1HNZE 4DV5E 1OJ4A 5GMEA 4NXMI 1KVKA 4YHHI 4USMA 4LFBI 2E5LE 1D6TA 1Z0VA 1ZM9A 4X64I 2ZITA 2V34A 1EI1A 1Z59A 4DR6I 2V2QA 2UU9E 2A2DA 4B3SI 4DV7I 2EFGA 1IBMI 2CZ9A 4JV5I 4DV6I 4DR2I 4DUYE 4URLA 4LFCE 2UXDI 4JYAI 4DV1I 2DEIA 4JI2I 4UTGA 4NXME 1NZ0A 1XHKA 4LFBE 4DXLA 4XTJA 4I3HA 3LPSA 1NHJA 1ZM2A 3PYGA 1Z5CA 4YY3I 3PYEA 4PU9A 4DR6E 2OI2A 4HYMA 1ZM4A 4FWGA 4B3SE 2UUAI 4LFAI 4OX9I 4DV7E 2A2CA 4LF4I 4DR5E 4JI0E 1IBME 4RPFA 4WUCA 4DR2E 2UXDE 3QT5A 4JI2E 1Z0TA 4LF6I 4WUBA 4DU7A 4B3ME 4X62I 1FWKA 4KHPI 5BR8I 2VQEI 4LFAE 2UUAE 4JI7I 3GONA 4LF4E 1ZXNA 1A6FA 1N34E 1Z0CA 3B8HA 3B78A 1HNXI 3J7AM 4JI1I 4HACA 4LF6E 3JAMC 1PKPA 1FJGI 4DPWA 2UUCE 3K1JA 3WU3A 4DV0I 4DV3I 4MYTA 2UXCE 5BR8E 2LJPA 5LMUE 2AJ4A 4DR7I 4JI7E 2WW4A 3V2UC 1IBKI 1KIJA 4ED4A 3B82A 1XMQI 1WUUA 4X66I 1N36I 2F4VI 4X65I 4LF7I 1HNXE
chains in the Genus database with same CATH superfamily
2JE6B 4MU4A 1HNWI 1XNRI 4IFDA 1NHHA 2NN6A 5JEAA 4LPFA 1Z5AA 4JI8I 2E1RA 4NXNI 3PYDA 1VISA 2PO0B 1FI4A 5LMNI 4GKJI 1FJGE 1B63A 3J7AG 4DV0E 4Z7CA 2NPFA 4FN5A 4DV4I 4DUZI 2GO3A 4UT4A 3HULA 2Z5CA 1U2RA 2HHHI 4M1KA 4ZVIA 2X36A 2VQFI 4LF9I 3LTOA 4YHHE 2PO1A 4KQVA 1BKNA 1XMQE 4X64E 2C39A 3P3CA 1N36E 1FKAE 2F4VE 2C37A 4X65E 2V8PA 3PS1A 4IS9A 4J3DA 3HKMA 2O3ZA 1HNWE 4JI4I 4LF5I 4K0KI 2GQ0A 3V5RA 4NXNE 1RREA 3JAMQ 1PIEA 1NHIA 4AIDA 4DR3I 5LMNE 3J81C 1FNMA 3ZKBA 4JV5E 4DUZE 3M6AA 4DV6E 4MYUA 3DD6A 2AE8A 4JYAE 4DV1E 2VQFE 2UXBI 1FWLA 4LCHA 5A2QC 4JI5I 1E3HA 4DPTA 1Z5BA 4NBQA 4YY3E 3GMEA 1HR0I 4MU3A 4DV2I 3PS2A 3QT8A 1H72C 1Z0GA 1Z0WA 4JI4E 4OX9E 4LF5E 4K0KE 3OTOI 1DARA 2C38B 4DR4I 3PYFA 2PNLA 4LF8I 1H73A 4IFDD 2NN6D 5JEAD 3LNUA 4JI3I 4DR3E 3CWVA 2BM0A 5FLXC 2VESA 4HXZA 4AQYI 4HACB 3D4JA 1N32I 1VI7A 4GKKI 2HFUA 4B3RI 5IWAI 3H1CA 3ZM7A 1J5EI 2F1DA 1RR9A 2UXBE 4DPUA 4PRXA 4USKA 4X62E 4JI5E 4IZKB 4EMDA 1E3PA 1R6MA 5LL6R 4KHPE 2PO2A 3ZZTA 4MDTA 1B62A 2VQEE 1IBLI 1N33I 2XEXA 1HK7A 2WP8B 3OTOE 4DR4E 2Z5EA 3M85D 5K36E 2WNRA 2UU9I 2X7IA 4LF8E 3J81Q 4JI3E 2J65A 3QT7A 4MU1A 1K47A 4AQYE 3HJCA 3T1YI 1N32E 4B3RE 4JI1E 4IFDB 2NN6B 5IWAE 1J5EE 4DUYI 5K36D 2BR2A 3L7ZA 5A2QQ 4BA1A 4LCFA 3GLLA 5DROA 1N0VC 4QNJA 1ELOA 4DV3E 4P52A 1IBLE 1N33E 4JI6I 2CGEA 2GO4A 2ZM6I 2PO1B 4Z7YA 3WU5A 4DR7E 1OYRA 3ZZUA 2HKEA 2C39B 1IBKE 2UUBI 1N0UA 5DNLA 3WU6A 5FLXQ 4DR5I 4JI0I 1H7SA 4X66E 3T1HI 1Z0BA 4FW6A 4LF7E 2BM1A 3T1YE 3PS3A 3M85G 4IFDC 2NN6C 5JEAC 4OKGA 1H74A 4MU0A 4QNKA 3ZKDA 4B3TI 1XNRE 4HY1A 5C0XE 4JI8E 2ZBKB 3K17A 5GMDA 4B3MI 3K85A 4GKJE 2HFSA 1ZXMA 3J80C 4U3DA 1PVGA 4DV4E 3H4LA 5IT9C 2V2ZA 4N3OA 4JI6E 5K36A 4FWHA 2HHHE 1KTVA 2HK3A 2ZM6E 1XNQI 1XXEA 4JG4A 5C0XD 1UEKA 4LF9E 2HK2A 4DR1I 3CDJA 2UUBE 4OO1E 1KKHA 3T1HE 1I94I 1N34I 2J7KA 2PNZA 4DU8A 4PRVA 5L3JA 2IERA 3P3EA 2HKJA 4B3TE 2JEBA 3Q1QA 4DPXA 4OO1D 1XMOI 2JEAA 4GQUA 4R1FA 1YH8A 1UDOA 2R3VA 1MU5A 3NZKA 2UUCI 1S16A 2V2VA 4FWDA 3UHMA 2UXCI 3QT6A 1XNQE 1HNZI 1EA6A 4DV5I 2Q2EB 4DR1E 1OYPA 4FW9A 5LMUI 3M7ND 5EKWA 1Z0EA 2IOPA 4DPYA 2PO2B 1QZRA 1I94E 4U3BA 2E5LI 1MG7A 2BV3A 1HR0E 1H7UA 4IZJA 4DV2E 5C0XA 2O1WA 2DEJA 4P7AA 1XMOE 2R42A 3J80Q 3P76A 3F0NA 4LCGA 5IT9Q 2GS8A 1ZM3A 2VF3A 4GKKE 5JEAB 2BR2B 4OO1A 3L7ZB 1S4EA 4WUDA 1MX0A 3WU4A 4LFCI 3ZZ0A 1HNZE 4BA2A 4DV5E 1OJ4A 5GMEA 4IFDF 2NN6F 5JEAF 4NXMI 2Z5BA 1KVKA 4YHHI 2WP8A 4USMA 4LFBI 2E5LE 1D6TA 2O1TA 4FW5A 1Z0VA 1ZM9A 2Z5CB 2ZITA 2V34A 4X64I 3M7NG 1EI1A 1Z59A 1Y5YA 4DR6I 5DRRA 2V2QA 1YHCA 2UU9E 2A2DA 4B3SI 2JE6A 2CG9A 4DV7I 1UDQA 4FW4A 2C37B 3B4TA 2EFGA 1IBMI 4OO1C 2PO0A 2CZ9A 4FW7A 5DNXA 4JV5I 2O1VA 2BA0D 4DV6I 4DR2I 4DUYE 4URLA 4LFCE 1OYSA 2UXDI 1Y6ZA 5FWKA 4MQYA 4DV1I 2DEIA 4JI2I 4UTGA 4JYAI 2O1UA 4NXME 1NZ0A 4OZEA 5DRPA 3U1YA 1XHKA 4LFBE 4DXLA 4XTJA 4I3HA 5K36B 2IOQA 3LPSA 5ELWA 3P3GA 4ISAA 1NHJA 1ZM2A 3PYGA 1Z5CA 4YY3I 3PYEA 3U1KA 4IZJD 4PU9A 4DR6E 5K36F 2OI2A 4HYMA 1ZM4A 4FWGA 4B3SE 2UUAI 4LFAI 4OX9I 4DV7E 2A2CA 4LF4I 4DR5E 1P42A 4JI0E 1Y60A 2PNZB 3Q6NA 1IBME 4RPFA 2JEBB 4WUCA 1UDNA 3GCMA 4DR2E 1USUA 2UXDE 3QT5A 4AM3A 4JI2E 1Z0TA 4LF6I 2JEAB 1Y4UA 1R6LA 4WUBA 1UDSA 4DU7A 4B3ME 2BA0G 4X62I 5K36C 4IFDE 1FWKA 2NN6E 5JEAE 2BA1D 4FW3A 4KHPI 5BR8I 2VQEI 1RHYA 4LFAE 1Y4SA 2UUAE 4JI7I 3GONA 4LF4E 1ZXNA 4IZJB 5DRQA 1A6FA 4AIMA 2C38A 1N34E 5C0XB 1Z0CA 3B8HA 3B78A 1HNXI 3J7AM 5C0XF 2WNRB 4JI1I 4HACA 2IESA 4LF6E 3KRNA 4LOMA 2JT2A 3CDIA 3PRYA 3JAMC 1PKPA 1USVA 2CVEA 4OO1B 1FJGI 4DPWA 2UUCE 3K1JA 3WU3A 4DV0I 4BA2B 4DV3I 4IZKA 3Q6MA 4MYTA 2PNMA 2UXCE 5BR8E 4BA1B 2Z5BB 4OO1F 2LJPA 5LMUE 2AJ4A 4DR7I 2BA1G 4JI7E 2WW4A 3V2UC 1IBKI 1KIJA 4ED4A 3B82A 5C0XC 1XMQI 1WUUA 4X66I 1N36I 2F4VI 4X65I 5EL9A 4LF7I 3P06A 1HNXE
chains in the Genus database with same CATH topology
1HNWI 1XNRI 1NHHA 1Z5AA 4JI8I 2E1RA 4NXNI 3PYDA 1VISA 1FI4A 5LMNI 4GKJI 1FJGE 1B63A 3J7AG 4DV0E 4Z7CA 2NPFA 4FN5A 4DV4I 4DUZI 4UT4A 3HULA 2Z5CA 1U2RA 2HHHI 4M1KA 4ZVIA 2X36A 2VQFI 4LF9I 3LTOA 4YHHE 4KQVA 1BKNA 1XMQE 4X64E 1N36E 1FKAE 2F4VE 4X65E 2V8PA 1HNWE 4JI4I 4LF5I 4K0KI 2GQ0A 3V5RA 4NXNE 1RREA 3JAMQ 1PIEA 1NHIA 4DR3I 5LMNE 3J81C 1FNMA 3ZKBA 4JV5E 4DUZE 3M6AA 4DV6E 4MYUA 4JYAE 4DV1E 2VQFE 2UXBI 1FWLA 5A2QC 4JI5I 4DPTA 1Z5BA 4YY3E 1HR0I 4DV2I 3QT8A 1H72C 1Z0GA 1Z0WA 4JI4E 4OX9E 4LF5E 4K0KE 3OTOI 1DARA 4DR4I 3PYFA 2PNLA 4LF8I 1H73A 3LNUA 4JI3I 4DR3E 3CWVA 2BM0A 5FLXC 4HXZA 4AQYI 4HACB 3D4JA 1N32I 4GKKI 2HFUA 4B3RI 5IWAI 3ZM7A 1J5EI 1RR9A 2UXBE 4DPUA 4PRXA 4USKA 4X62E 4JI5E 4IZKB 4EMDA 5LL6R 4KHPE 3ZZTA 1B62A 2VQEE 1IBLI 1N33I 2XEXA 1HK7A 3OTOE 4DR4E 2Z5EA 2UU9I 2X7IA 4LF8E 3J81Q 4JI3E 3QT7A 1K47A 4AQYE 3HJCA 3T1YI 1N32E 4B3RE 4JI1E 5IWAE 1J5EE 4DUYI 5A2QQ 1N0VC 1ELOA 4DV3E 4P52A 1IBLE 1N33E 4JI6I 2CGEA 2ZM6I 4DR7E 4Z7YA 3WU5A 3ZZUA 2HKEA 2UUBI 1IBKE 1N0UA 3WU6A 5FLXQ 4DR5I 4JI0I 1H7SA 4X66E 3T1HI 1Z0BA 4LF7E 2BM1A 3T1YE 1H74A 3ZKDA 4B3TI 1XNRE 4HY1A 4JI8E 2ZBKB 3K17A 5GMDA 4B3MI 3K85A 4GKJE 2HFSA 1ZXMA 3J80C 1PVGA 4DV4E 3H4LA 5IT9C 2V2ZA 4N3OA 4JI6E 4FWHA 2HHHE 1KTVA 2HK3A 2ZM6E 1XNQI 4JG4A 1UEKA 4LF9E 2HK2A 4DR1I 2UUBE 1KKHA 3T1HE 1I94I 1N34I 2J7KA 4DU8A 4PRVA 5L3JA 2HKJA 4B3TE 3Q1QA 4DPXA 1XMOI 4R1FA 2R3VA 1MU5A 2UUCI 1S16A 2V2VA 4FWDA 2UXCI 3QT6A 1XNQE 1HNZI 1EA6A 4DV5I 2Q2EB 4DR1E 4FW9A 5LMUI 1Z0EA 2IOPA 4DPYA 1QZRA 1I94E 2E5LI 1MG7A 2BV3A 1HR0E 1H7UA 4IZJA 4DV2E 2O1WA 2DEJA 4P7AA 1XMOE 2R42A 3J80Q 3F0NA 5IT9Q 2GS8A 1ZM3A 2VF3A 4GKKE 4WUDA 1S4EA 3WU4A 1MX0A 3ZZ0A 4LFCI 1HNZE 4DV5E 1OJ4A 5GMEA 4NXMI 2Z5BA 1KVKA 4YHHI 4USMA 4LFBI 2E5LE 1D6TA 2O1TA 1Z0VA 1ZM9A 2Z5CB 2ZITA 2V34A 4X64I 1EI1A 1Z59A 4DR6I 2V2QA 2UU9E 2A2DA 4B3SI 4DV7I 2CG9A 2EFGA 1IBMI 2CZ9A 4JV5I 2O1VA 4DV6I 4DR2I 4DUYE 4URLA 4LFCE 2UXDI 1Y6ZA 5FWKA 4JYAI 4DV1I 2DEIA 4JI2I 4UTGA 2O1UA 4NXME 1NZ0A 1XHKA 4LFBE 4DXLA 4XTJA 4I3HA 2IOQA 3LPSA 1NHJA 1ZM2A 3PYGA 1Z5CA 4YY3I 3PYEA 4IZJD 4PU9A 4DR6E 2OI2A 4HYMA 1ZM4A 4FWGA 4B3SE 2UUAI 4LFAI 4OX9I 4DV7E 2A2CA 4LF4I 4DR5E 4JI0E 3Q6NA 1IBME 4RPFA 4WUCA 4DR2E 1USUA 2UXDE 3QT5A 4JI2E 1Z0TA 4LF6I 1Y4UA 4WUBA 4DU7A 4B3ME 4X62I 1FWKA 4KHPI 5BR8I 2VQEI 4LFAE 1Y4SA 2UUAE 4JI7I 3GONA 4LF4E 1ZXNA 4IZJB 1A6FA 1N34E 1Z0CA 3B8HA 3B78A 1HNXI 3J7AM 4JI1I 4HACA 4LF6E 3PRYA 3JAMC 1PKPA 1USVA 1FJGI 4DPWA 2UUCE 3K1JA 3WU3A 4DV0I 4DV3I 4IZKA 3Q6MA 4MYTA 2PNMA 2UXCE 5BR8E 2Z5BB 2LJPA 5LMUE 2AJ4A 4DR7I 4JI7E 2WW4A 3V2UC 1IBKI 1KIJA 4ED4A 3B82A 1XMQI 1WUUA 4X66I 1N36I 2F4VI 4X65I 4LF7I 3P06A 1HNXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW I;  1XNR I;  1NHH A;  1Z5A A;  4JI8 I;  2E1R A;  4NXN I;  3PYD A;  1VIS A;  1FI4 A;  5LMN I;  4GKJ I;  1FJG E;  1B63 A;  3J7A G;  4DV0 E;  4Z7C A;  2NPF A;  4FN5 A;  4DV4 I;  4DUZ I;  4UT4 A;  3HUL A;  1U2R A;  2HHH I;  4M1K A;  4ZVI A;  2X36 A;  2VQF I;  4LF9 I;  3LTO A;  4YHH E;  4KQV A;  1BKN A;  1XMQ E;  4X64 E;  1N36 E;  1FKA E;  2F4V E;  4X65 E;  2V8P A;  1HNW E;  4JI4 I;  4LF5 I;  4K0K I;  3V5R A;  4NXN E;  1RRE A;  3JAM Q;  1PIE A;  1NHI A;  4DR3 I;  5LMN E;  3J81 C;  1FNM A;  3ZKB A;  4JV5 E;  4DUZ E;  3M6A A;  4DV6 E;  4MYU A;  4JYA E;  4DV1 E;  2VQF E;  2UXB I;  1FWL A;  5A2Q C;  4JI5 I;  4DPT A;  1Z5B A;  4YY3 E;  1HR0 I;  4DV2 I;  3QT8 A;  1H72 C;  1Z0G A;  1Z0W A;  4JI4 E;  4OX9 E;  4LF5 E;  4K0K E;  3OTO I;  1DAR A;  4DR4 I;  3PYF A;  4LF8 I;  1H73 A;  3LNU A;  4JI3 I;  4DR3 E;  3CWV A;  2BM0 A;  5FLX C;  4HXZ A;  4AQY I;  4HAC B;  3D4J A;  1N32 I;  4GKK I;  2HFU A;  4B3R I;  5IWA I;  3ZM7 A;  1J5E I;  1RR9 A;  2UXB E;  4DPU A;  4PRX A;  4USK A;  4X62 E;  4JI5 E;  4EMD A;  5LL6 R;  4KHP E;  3ZZT A;  1B62 A;  2VQE E;  1IBL I;  1N33 I;  2XEX A;  3OTO E;  4DR4 E;  2UU9 I;  2X7I A;  4LF8 E;  3J81 Q;  4JI3 E;  3QT7 A;  1K47 A;  4AQY E;  3T1Y I;  1N32 E;  4B3R E;  4JI1 E;  5IWA E;  1J5E E;  4DUY I;  5A2Q Q;  1N0V C;  1ELO A;  4DV3 E;  4P52 A;  1IBL E;  1N33 E;  4JI6 I;  2ZM6 I;  4DR7 E;  4Z7Y A;  3WU5 A;  3ZZU A;  2HKE A;  2UUB I;  1IBK E;  1N0U A;  3WU6 A;  5FLX Q;  4DR5 I;  4JI0 I;  1H7S A;  4X66 E;  3T1H I;  1Z0B A;  4LF7 E;  2BM1 A;  3T1Y E;  1H74 A;  3ZKD A;  4B3T I;  1XNR E;  4HY1 A;  4JI8 E;  2ZBK B;  3K17 A;  5GMD A;  4B3M I;  4GKJ E;  2HFS A;  1ZXM A;  3J80 C;  1PVG A;  4DV4 E;  3H4L A;  5IT9 C;  2V2Z A;  4JI6 E;  4FWH A;  2HHH E;  1KTV A;  2HK3 A;  2ZM6 E;  1XNQ I;  4JG4 A;  1UEK A;  4LF9 E;  2HK2 A;  4DR1 I;  2UUB E;  1KKH A;  3T1H E;  1I94 I;  1N34 I;  2J7K A;  4DU8 A;  4PRV A;  5L3J A;  2HKJ A;  4B3T E;  3Q1Q A;  4DPX A;  1XMO I;  4R1F A;  2R3V A;  1MU5 A;  2UUC I;  1S16 A;  2V2V A;  4FWD A;  2UXC I;  3QT6 A;  1XNQ E;  1HNZ I;  1EA6 A;  4DV5 I;  2Q2E B;  4DR1 E;  4FW9 A;  5LMU I;  1Z0E A;  4DPY A;  1QZR A;  1I94 E;  2E5L I;  1MG7 A;  2BV3 A;  1HR0 E;  1H7U A;  4DV2 E;  2DEJ A;  4P7A A;  1XMO E;  2R42 A;  3J80 Q;  3F0N A;  5IT9 Q;  2GS8 A;  1ZM3 A;  2VF3 A;  4GKK E;  4WUD A;  1S4E A;  3WU4 A;  1MX0 A;  3ZZ0 A;  4LFC I;  1HNZ E;  4DV5 E;  1OJ4 A;  5GME A;  4NXM I;  1KVK A;  4YHH I;  4USM A;  4LFB I;  2E5L E;  1D6T A;  1Z0V A;  1ZM9 A;  4X64 I;  2ZIT A;  2V34 A;  1EI1 A;  1Z59 A;  4DR6 I;  2V2Q A;  2UU9 E;  2A2D A;  4B3S I;  4DV7 I;  2EFG A;  1IBM I;  2CZ9 A;  4JV5 I;  4DV6 I;  4DR2 I;  4DUY E;  4URL A;  4LFC E;  2UXD I;  4JYA I;  4DV1 I;  2DEI A;  4JI2 I;  4UTG A;  4NXM E;  1NZ0 A;  1XHK A;  4LFB E;  4DXL A;  4XTJ A;  4I3H A;  3LPS A;  1NHJ A;  1ZM2 A;  3PYG A;  1Z5C A;  4YY3 I;  3PYE A;  4PU9 A;  4DR6 E;  2OI2 A;  4HYM A;  1ZM4 A;  4FWG A;  4B3S E;  2UUA I;  4LFA I;  4OX9 I;  4DV7 E;  2A2C A;  4LF4 I;  4DR5 E;  4JI0 E;  1IBM E;  4RPF A;  4WUC A;  4DR2 E;  2UXD E;  3QT5 A;  4JI2 E;  1Z0T A;  4LF6 I;  4WUB A;  4DU7 A;  4B3M E;  4X62 I;  1FWK A;  4KHP I;  5BR8 I;  2VQE I;  4LFA E;  2UUA E;  4JI7 I;  3GON A;  4LF4 E;  1ZXN A;  1A6F A;  1N34 E;  1Z0C A;  3B8H A;  3B78 A;  1HNX I;  3J7A M;  4JI1 I;  4HAC A;  4LF6 E;  3JAM C;  1PKP A;  1FJG I;  4DPW A;  2UUC E;  3K1J A;  3WU3 A;  4DV0 I;  4DV3 I;  4MYT A;  2UXC E;  5BR8 E;  2LJP A;  5LMU E;  2AJ4 A;  4DR7 I;  4JI7 E;  2WW4 A;  3V2U C;  1IBK I;  1KIJ A;  4ED4 A;  3B82 A;  1XMQ I;  1WUU A;  4X66 I;  1N36 I;  2F4V I;  4X65 I;  4LF7 I;  1HNX E; 
#chains in the Genus database with same CATH topology
 2JE6 B;  4MU4 A;  1HNW I;  1XNR I;  4IFD A;  1NHH A;  2NN6 A;  5JEA A;  4LPF A;  1Z5A A;  4JI8 I;  2E1R A;  4NXN I;  3PYD A;  1VIS A;  2PO0 B;  1FI4 A;  5LMN I;  4GKJ I;  1FJG E;  1B63 A;  3J7A G;  4DV0 E;  4Z7C A;  2NPF A;  4FN5 A;  4DV4 I;  4DUZ I;  2GO3 A;  4UT4 A;  3HUL A;  2Z5C A;  1U2R A;  2HHH I;  4M1K A;  4ZVI A;  2X36 A;  2VQF I;  4LF9 I;  3LTO A;  4YHH E;  2PO1 A;  4KQV A;  1BKN A;  1XMQ E;  4X64 E;  2C39 A;  3P3C A;  1N36 E;  1FKA E;  2F4V E;  2C37 A;  4X65 E;  2V8P A;  3PS1 A;  4IS9 A;  4J3D A;  3HKM A;  2O3Z A;  1HNW E;  4JI4 I;  4LF5 I;  4K0K I;  2GQ0 A;  3V5R A;  4NXN E;  1RRE A;  3JAM Q;  1PIE A;  1NHI A;  4AID A;  4DR3 I;  5LMN E;  3J81 C;  1FNM A;  3ZKB A;  4JV5 E;  4DUZ E;  3M6A A;  4DV6 E;  4MYU A;  3DD6 A;  2AE8 A;  4JYA E;  4DV1 E;  2VQF E;  2UXB I;  1FWL A;  4LCH A;  5A2Q C;  4JI5 I;  1E3H A;  4DPT A;  1Z5B A;  4NBQ A;  4YY3 E;  3GME A;  1HR0 I;  4MU3 A;  4DV2 I;  3PS2 A;  3QT8 A;  1H72 C;  1Z0G A;  1Z0W A;  4JI4 E;  4OX9 E;  4LF5 E;  4K0K E;  3OTO I;  1DAR A;  2C38 B;  4DR4 I;  3PYF A;  2PNL A;  4LF8 I;  1H73 A;  4IFD D;  2NN6 D;  5JEA D;  3LNU A;  4JI3 I;  4DR3 E;  3CWV A;  2BM0 A;  5FLX C;  2VES A;  4HXZ A;  4AQY I;  4HAC B;  3D4J A;  1N32 I;  1VI7 A;  4GKK I;  2HFU A;  4B3R I;  5IWA I;  3H1C A;  3ZM7 A;  1J5E I;  2F1D A;  1RR9 A;  2UXB E;  4DPU A;  4PRX A;  4USK A;  4X62 E;  4JI5 E;  4IZK B;  4EMD A;  1E3P A;  1R6M A;  5LL6 R;  4KHP E;  2PO2 A;  3ZZT A;  4MDT A;  1B62 A;  2VQE E;  1IBL I;  1N33 I;  2XEX A;  1HK7 A;  2WP8 B;  3OTO E;  4DR4 E;  2Z5E A;  3M85 D;  5K36 E;  2WNR A;  2UU9 I;  2X7I A;  4LF8 E;  3J81 Q;  4JI3 E;  2J65 A;  3QT7 A;  4MU1 A;  1K47 A;  4AQY E;  3HJC A;  3T1Y I;  1N32 E;  4B3R E;  4JI1 E;  4IFD B;  2NN6 B;  5IWA E;  1J5E E;  4DUY I;  5K36 D;  2BR2 A;  3L7Z A;  5A2Q Q;  4BA1 A;  4LCF A;  3GLL A;  5DRO A;  1N0V C;  4QNJ A;  1ELO A;  4DV3 E;  4P52 A;  1IBL E;  1N33 E;  4JI6 I;  2CGE A;  2GO4 A;  2ZM6 I;  2PO1 B;  4Z7Y A;  3WU5 A;  4DR7 E;  1OYR A;  3ZZU A;  2HKE A;  2C39 B;  1IBK E;  2UUB I;  1N0U A;  5DNL A;  3WU6 A;  5FLX Q;  4DR5 I;  4JI0 I;  1H7S A;  4X66 E;  3T1H I;  1Z0B A;  4FW6 A;  4LF7 E;  2BM1 A;  3T1Y E;  3PS3 A;  3M85 G;  4IFD C;  2NN6 C;  5JEA C;  4OKG A;  1H74 A;  4MU0 A;  4QNK A;  3ZKD A;  4B3T I;  1XNR E;  4HY1 A;  5C0X E;  4JI8 E;  2ZBK B;  3K17 A;  5GMD A;  4B3M I;  3K85 A;  4GKJ E;  2HFS A;  1ZXM A;  3J80 C;  4U3D A;  1PVG A;  4DV4 E;  3H4L A;  5IT9 C;  2V2Z A;  4N3O A;  4JI6 E;  5K36 A;  4FWH A;  2HHH E;  1KTV A;  2HK3 A;  2ZM6 E;  1XNQ I;  1XXE A;  4JG4 A;  5C0X D;  1UEK A;  4LF9 E;  2HK2 A;  4DR1 I;  3CDJ A;  2UUB E;  4OO1 E;  1KKH A;  3T1H E;  1I94 I;  1N34 I;  2J7K A;  2PNZ A;  4DU8 A;  4PRV A;  5L3J A;  2IER A;  3P3E A;  2HKJ A;  4B3T E;  2JEB A;  3Q1Q A;  4DPX A;  4OO1 D;  1XMO I;  2JEA A;  4GQU A;  4R1F A;  1YH8 A;  1UDO A;  2R3V A;  1MU5 A;  3NZK A;  2UUC I;  1S16 A;  2V2V A;  4FWD A;  3UHM A;  2UXC I;  3QT6 A;  1XNQ E;  1HNZ I;  1EA6 A;  4DV5 I;  2Q2E B;  4DR1 E;  1OYP A;  4FW9 A;  5LMU I;  3M7N D;  5EKW A;  1Z0E A;  2IOP A;  4DPY A;  2PO2 B;  1QZR A;  1I94 E;  4U3B A;  2E5L I;  1MG7 A;  2BV3 A;  1HR0 E;  1H7U A;  4IZJ A;  4DV2 E;  5C0X A;  2O1W A;  2DEJ A;  4P7A A;  1XMO E;  2R42 A;  3J80 Q;  3P76 A;  3F0N A;  4LCG A;  5IT9 Q;  2GS8 A;  1ZM3 A;  2VF3 A;  4GKK E;  5JEA B;  2BR2 B;  4OO1 A;  3L7Z B;  1S4E A;  4WUD A;  1MX0 A;  3WU4 A;  4LFC I;  3ZZ0 A;  1HNZ E;  4BA2 A;  4DV5 E;  1OJ4 A;  5GME A;  4IFD F;  2NN6 F;  5JEA F;  4NXM I;  2Z5B A;  1KVK A;  4YHH I;  2WP8 A;  4USM A;  4LFB I;  2E5L E;  1D6T A;  2O1T A;  4FW5 A;  1Z0V A;  1ZM9 A;  2Z5C B;  2ZIT A;  2V34 A;  4X64 I;  3M7N G;  1EI1 A;  1Z59 A;  1Y5Y A;  4DR6 I;  5DRR A;  2V2Q A;  1YHC A;  2UU9 E;  2A2D A;  4B3S I;  2JE6 A;  2CG9 A;  4DV7 I;  1UDQ A;  4FW4 A;  2C37 B;  3B4T A;  2EFG A;  1IBM I;  4OO1 C;  2PO0 A;  2CZ9 A;  4FW7 A;  5DNX A;  4JV5 I;  2O1V A;  2BA0 D;  4DV6 I;  4DR2 I;  4DUY E;  4URL A;  4LFC E;  1OYS A;  2UXD I;  1Y6Z A;  5FWK A;  4MQY A;  4DV1 I;  2DEI A;  4JI2 I;  4UTG A;  4JYA I;  2O1U A;  4NXM E;  1NZ0 A;  4OZE A;  5DRP A;  3U1Y A;  1XHK A;  4LFB E;  4DXL A;  4XTJ A;  4I3H A;  5K36 B;  2IOQ A;  3LPS A;  5ELW A;  3P3G A;  4ISA A;  1NHJ A;  1ZM2 A;  3PYG A;  1Z5C A;  4YY3 I;  3PYE A;  3U1K A;  4IZJ D;  4PU9 A;  4DR6 E;  5K36 F;  2OI2 A;  4HYM A;  1ZM4 A;  4FWG A;  4B3S E;  2UUA I;  4LFA I;  4OX9 I;  4DV7 E;  2A2C A;  4LF4 I;  4DR5 E;  1P42 A;  4JI0 E;  1Y60 A;  2PNZ B;  3Q6N A;  1IBM E;  4RPF A;  2JEB B;  4WUC A;  1UDN A;  3GCM A;  4DR2 E;  1USU A;  2UXD E;  3QT5 A;  4AM3 A;  4JI2 E;  1Z0T A;  4LF6 I;  2JEA B;  1Y4U A;  1R6L A;  4WUB A;  1UDS A;  4DU7 A;  4B3M E;  2BA0 G;  4X62 I;  5K36 C;  4IFD E;  1FWK A;  2NN6 E;  5JEA E;  2BA1 D;  4FW3 A;  4KHP I;  5BR8 I;  2VQE I;  1RHY A;  4LFA E;  1Y4S A;  2UUA E;  4JI7 I;  3GON A;  4LF4 E;  1ZXN A;  4IZJ B;  5DRQ A;  1A6F A;  4AIM A;  2C38 A;  1N34 E;  5C0X B;  1Z0C A;  3B8H A;  3B78 A;  1HNX I;  3J7A M;  5C0X F;  2WNR B;  4JI1 I;  4HAC A;  2IES A;  4LF6 E;  3KRN A;  4LOM A;  2JT2 A;  3CDI A;  3PRY A;  3JAM C;  1PKP A;  1USV A;  2CVE A;  4OO1 B;  1FJG I;  4DPW A;  2UUC E;  3K1J A;  3WU3 A;  4DV0 I;  4BA2 B;  4DV3 I;  4IZK A;  3Q6M A;  4MYT A;  2PNM A;  2UXC E;  5BR8 E;  4BA1 B;  2Z5B B;  4OO1 F;  2LJP A;  5LMU E;  2AJ4 A;  4DR7 I;  2BA1 G;  4JI7 E;  2WW4 A;  3V2U C;  1IBK I;  1KIJ A;  4ED4 A;  3B82 A;  5C0X C;  1XMQ I;  1WUU A;  4X66 I;  1N36 I;  2F4V I;  4X65 I;  5EL9 A;  4LF7 I;  3P06 A;  1HNX E; 
#chains in the Genus database with same CATH homology
 1HNW I;  1XNR I;  1NHH A;  1Z5A A;  4JI8 I;  2E1R A;  4NXN I;  3PYD A;  1VIS A;  1FI4 A;  5LMN I;  4GKJ I;  1FJG E;  1B63 A;  3J7A G;  4DV0 E;  4Z7C A;  2NPF A;  4FN5 A;  4DV4 I;  4DUZ I;  4UT4 A;  3HUL A;  2Z5C A;  1U2R A;  2HHH I;  4M1K A;  4ZVI A;  2X36 A;  2VQF I;  4LF9 I;  3LTO A;  4YHH E;  4KQV A;  1BKN A;  1XMQ E;  4X64 E;  1N36 E;  1FKA E;  2F4V E;  4X65 E;  2V8P A;  1HNW E;  4JI4 I;  4LF5 I;  4K0K I;  2GQ0 A;  3V5R A;  4NXN E;  1RRE A;  3JAM Q;  1PIE A;  1NHI A;  4DR3 I;  5LMN E;  3J81 C;  1FNM A;  3ZKB A;  4JV5 E;  4DUZ E;  3M6A A;  4DV6 E;  4MYU A;  4JYA E;  4DV1 E;  2VQF E;  2UXB I;  1FWL A;  5A2Q C;  4JI5 I;  4DPT A;  1Z5B A;  4YY3 E;  1HR0 I;  4DV2 I;  3QT8 A;  1H72 C;  1Z0G A;  1Z0W A;  4JI4 E;  4OX9 E;  4LF5 E;  4K0K E;  3OTO I;  1DAR A;  4DR4 I;  3PYF A;  2PNL A;  4LF8 I;  1H73 A;  3LNU A;  4JI3 I;  4DR3 E;  3CWV A;  2BM0 A;  5FLX C;  4HXZ A;  4AQY I;  4HAC B;  3D4J A;  1N32 I;  4GKK I;  2HFU A;  4B3R I;  5IWA I;  3ZM7 A;  1J5E I;  1RR9 A;  2UXB E;  4DPU A;  4PRX A;  4USK A;  4X62 E;  4JI5 E;  4IZK B;  4EMD A;  5LL6 R;  4KHP E;  3ZZT A;  1B62 A;  2VQE E;  1IBL I;  1N33 I;  2XEX A;  1HK7 A;  3OTO E;  4DR4 E;  2Z5E A;  2UU9 I;  2X7I A;  4LF8 E;  3J81 Q;  4JI3 E;  3QT7 A;  1K47 A;  4AQY E;  3HJC A;  3T1Y I;  1N32 E;  4B3R E;  4JI1 E;  5IWA E;  1J5E E;  4DUY I;  5A2Q Q;  1N0V C;  1ELO A;  4DV3 E;  4P52 A;  1IBL E;  1N33 E;  4JI6 I;  2CGE A;  2ZM6 I;  4DR7 E;  4Z7Y A;  3WU5 A;  3ZZU A;  2HKE A;  2UUB I;  1IBK E;  1N0U A;  3WU6 A;  5FLX Q;  4DR5 I;  4JI0 I;  1H7S A;  4X66 E;  3T1H I;  1Z0B A;  4LF7 E;  2BM1 A;  3T1Y E;  1H74 A;  3ZKD A;  4B3T I;  1XNR E;  4HY1 A;  4JI8 E;  2ZBK B;  3K17 A;  5GMD A;  4B3M I;  3K85 A;  4GKJ E;  2HFS A;  1ZXM A;  3J80 C;  1PVG A;  4DV4 E;  3H4L A;  5IT9 C;  2V2Z A;  4N3O A;  4JI6 E;  4FWH A;  2HHH E;  1KTV A;  2HK3 A;  2ZM6 E;  1XNQ I;  4JG4 A;  1UEK A;  4LF9 E;  2HK2 A;  4DR1 I;  2UUB E;  1KKH A;  3T1H E;  1I94 I;  1N34 I;  2J7K A;  4DU8 A;  4PRV A;  5L3J A;  2HKJ A;  4B3T E;  3Q1Q A;  4DPX A;  1XMO I;  4R1F A;  2R3V A;  1MU5 A;  2UUC I;  1S16 A;  2V2V A;  4FWD A;  2UXC I;  3QT6 A;  1XNQ E;  1HNZ I;  1EA6 A;  4DV5 I;  2Q2E B;  4DR1 E;  4FW9 A;  5LMU I;  1Z0E A;  2IOP A;  4DPY A;  1QZR A;  1I94 E;  2E5L I;  1MG7 A;  2BV3 A;  1HR0 E;  1H7U A;  4IZJ A;  4DV2 E;  2O1W A;  2DEJ A;  4P7A A;  1XMO E;  2R42 A;  3J80 Q;  3F0N A;  5IT9 Q;  2GS8 A;  1ZM3 A;  2VF3 A;  4GKK E;  4WUD A;  1S4E A;  3WU4 A;  1MX0 A;  3ZZ0 A;  4LFC I;  1HNZ E;  4DV5 E;  1OJ4 A;  5GME A;  4NXM I;  2Z5B A;  1KVK A;  4YHH I;  4USM A;  4LFB I;  2E5L E;  1D6T A;  2O1T A;  1Z0V A;  1ZM9 A;  2Z5C B;  2ZIT A;  2V34 A;  4X64 I;  1EI1 A;  1Z59 A;  4DR6 I;  2V2Q A;  2UU9 E;  2A2D A;  4B3S I;  4DV7 I;  2CG9 A;  2EFG A;  1IBM I;  2CZ9 A;  4JV5 I;  2O1V A;  4DV6 I;  4DR2 I;  4DUY E;  4URL A;  4LFC E;  2UXD I;  1Y6Z A;  5FWK A;  4JYA I;  4DV1 I;  2DEI A;  4JI2 I;  4UTG A;  2O1U A;  4NXM E;  1NZ0 A;  1XHK A;  4LFB E;  4DXL A;  4XTJ A;  4I3H A;  2IOQ A;  3LPS A;  1NHJ A;  1ZM2 A;  3PYG A;  1Z5C A;  4YY3 I;  3PYE A;  4IZJ D;  4PU9 A;  4DR6 E;  2OI2 A;  4HYM A;  1ZM4 A;  4FWG A;  4B3S E;  2UUA I;  4LFA I;  4OX9 I;  4DV7 E;  2A2C A;  4LF4 I;  4DR5 E;  4JI0 E;  3Q6N A;  1IBM E;  4RPF A;  4WUC A;  4DR2 E;  1USU A;  2UXD E;  3QT5 A;  4JI2 E;  1Z0T A;  4LF6 I;  1Y4U A;  4WUB A;  4DU7 A;  4B3M E;  4X62 I;  1FWK A;  4KHP I;  5BR8 I;  2VQE I;  4LFA E;  1Y4S A;  2UUA E;  4JI7 I;  3GON A;  4LF4 E;  1ZXN A;  4IZJ B;  1A6F A;  1N34 E;  1Z0C A;  3B8H A;  3B78 A;  1HNX I;  3J7A M;  4JI1 I;  4HAC A;  4LF6 E;  3PRY A;  3JAM C;  1PKP A;  1USV A;  1FJG I;  4DPW A;  2UUC E;  3K1J A;  3WU3 A;  4DV0 I;  4DV3 I;  4IZK A;  3Q6M A;  4MYT A;  2PNM A;  2UXC E;  5BR8 E;  2Z5B B;  2LJP A;  5LMU E;  2AJ4 A;  4DR7 I;  4JI7 E;  2WW4 A;  3V2U C;  1IBK I;  1KIJ A;  4ED4 A;  3B82 A;  1XMQ I;  1WUU A;  4X66 I;  1N36 I;  2F4V I;  4X65 I;  4LF7 I;  3P06 A;  1HNX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...