4KHPI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpI00
4JI5I 1Z0CA 4FWGA 1Z0BA 1MU5A 4EMDA 4GKKI 4DR2E 2UXDE 4B3SE 2DEJA 3ZM7A 2HK2A 2BM0A 1BKNA 4X65E 1ZM3A 3ZZUA 1HNWE 1Z0EA 3J7AG 4OX9E 5LMNE 4DR3I 2X7IA 3F0NA 5IWAE 4M1KA 2Q2EB 4JI7I 4DUZI 2A2CA 4USMA 4JI3I 2V2QA 4WUBA 4NXME 4LFBE 2R3VA 4AQYE 4B3TE 4URLA 3WU6A 4LF6E 1RR9A 2HHHE 3LNUA 3PYDA 2V8PA 1EA6A 1IBLE 1H74A 1I94E 1IBKI 4UTGA 4DR5I 1DARA 4DV5I 4DPTA 2V2ZA 4WUCA 1FWLA 4KQVA 3PYEA 5GMDA 3J7AM 1KIJA 4ZVIA 3JAMC 2XEXA 5A2QC 2VF3A 4DUYI 1Z0VA 4DV3I 3D4JA 1IBME 4YY3E 4USKA 1MG7A 1FJGI 1Z0TA 1Z5BA 1XNQI 2CZ9A 1FWKA 4NXNE 5LL6R 4DR7E 2F4VI 1FKAE 3WU5A 1Z59A 4WUDA 4JI8I 2UXCI 4LF4E 4JI6E 4JI1E 1XMOE 1NHHA 4DV7I 1KTVA 1N36I 4X64I 4DU8A 1Z0GA 1VISA 2A2DA 4JYAE 3QT8A 2OI2A 1N33I 1ZM4A 2X36A 4DR4E 4P52A 5IT9C 4B3ME 2BM1A 4LF5I 4JI5E 2E5LI 4JV5I 4K0KI 4LF7I 1HNXI 4LF9I 5FLXC 4DPWA 4GKKE 3PYFA 4MYTA 4LFCI 3ZZTA 1QZRA 1ELOA 3J81C 4X66I 4FW9A 3B78A 4DR3E 4B3RI 3J80C 3QT7A 1HNZI 4RPFA 4JI7E 4DV6I 2R42A 1H7UA 2UXBI 4DU7A 4HYMA 4DUZE 1RREA 4DR6I 4JI3E 4DV0I 2BV3A 2WW4A 3PYGA 4PRXA 4DV4I 3ZKBA 3LPSA 5BR8E 2HKJA 4DV2I 1IBKE 5A2QQ 4DR5E 1XMQI 5BR8I 4DV5E 4KHPI 3QT6A 3T1HI 4FN5A 5GMEA 3V2UC 4JI0I 1H73A 4DPXA 2ZM6I 1S16A 2EFGA 4DUYE 4DR1I 2UUBI 3LTOA 4DV3E 4JI4I 4GKJI 1FJGE 1NHIA 4X62I 3T1YI 1XNQE 1XNRI 4YHHI 1ZM2A 1XHKA 1N0UA 2F4VE 1HR0I 4JI8E 2UXCE 4DV1E 1Z0WA 4DV1I 3B82A 2HFUA 4DPYA 4DV7E 1N36E 4X64E 4Z7CA 2UU9I 5FLXQ 4PU9A 3M6AA 2UUCI 1N33E 1N34I 4I3HA 1A6FA 2HFSA 2V2VA 3CWVA 4LF5E 3OTOI 2E5LE 4JV5E 4K0KE 4LF7E 1HNXE 4LF9E 1J5EI 2UUAI 4LF8I 4HXZA 4PRVA 1NZ0A 1KVKA 4JI2I 4HACB 3J80Q 5LMUI 4LFCE 2ZITA 1FI4A 3Q1QA 2V34A 4XTJA 2VQFI 4X66E 1S4EA 1NHJA 4B3RE 2VQEI 1HNZE 1Z5CA 4DV6E 2UXBE 3K17A 4JG4A 1H72C 4UT4A 4DR6E 3WU3A 4DR2I 2UXDI 4B3SI 3HULA 4X65I 1EI1A 4DV0E 4P7AA 1HNWI 2E1RA 1U2RA 2ZBKB 4DV4E 4OX9I 2J7KA 4Z7YA 3V5RA 5L3JA 5LMNI 4DV2E 1OJ4A 4DXLA 1XMQE 3JAMQ 5IWAI 1H7SA 4LFAE 1WUUA 4KHPE 3T1HE 4HACA 4LFAI 4JI0E 3GONA 3H4LA 2ZM6E 1PKPA 1ZXNA 4NXMI 4LFBI 1N32E 1ZXMA 4AQYI 1K47A 4B3TI 4DR1E 2UUBE 4LF6I 1N32I 2HHHI 4JI4E 2HK3A 4GKJE 3B8HA 4R1FA 2NPFA 1IBLI 4X62E 3T1YE 1I94I 1XNRE 4YHHE 1PIEA 1UEKA 1HR0E 2LJPA 5IT9Q 4DPUA 2UU9E 1FNMA 4HY1A 1KKHA 2UUCE 4FWDA 1IBMI 4YY3I 1N34E 3K1JA 4FWHA 3QT5A 4NXNI 4DR7I 1B62A 3OTOE 3ZKDA 1J5EE 2UUAE 4LF8E 1PVGA 4LF4I 2HKEA 4JI6I 4JI1I 1XMOI 2GS8A 1B63A 3J81Q 4JI2E 5LMUE 1D6TA 3WU4A 1N0VC 3ZZ0A 4JYAI 2AJ4A 2DEIA 1Z5AA 4ED4A 2VQFE 4MYUA 4DR4I 2VQEE 4B3MI 1ZM9A 1MX0A
chains in the Genus database with same CATH superfamily
4JI5I 1E3HA 1Z0CA 4FWGA 1Z0BA 1MU5A 4EMDA 4GKKI 4IFDF 4DR2E 5JEAC 2UXDE 1R6LA 4B3SE 2DEJA 3CDIA 4J3DA 3ZM7A 2HK2A 2BM0A 1BKNA 4X65E 2Z5EA 5JEAE 1ZM3A 3ZZUA 1HNWE 1Z0EA 2WNRB 3J7AG 4OX9E 2VESA 5LMNE 4MU4A 2JE6A 2JT2A 4DR3I 2X7IA 5JEAA 2JEAB 3F0NA 2CG9A 4M1KA 5IWAE 2Q2EB 4JI7I 1Y4UA 2Z5BA 4DUZI 2A2CA 3PS1A 4FW4A 4MQYA 4USMA 4JI3I 2V2QA 4WUBA 4NXME 4LFBE 2R3VA 5JEAD 4AQYE 4QNJA 4B3TE 4URLA 3WU6A 4LF6E 1RR9A 2HHHE 3LNUA 3PYDA 3L7ZB 2V8PA 1EA6A 1IBLE 4AIDA 1H74A 1I94E 1IBKI 4UTGA 3PS2A 4BA1B 4DR5I 1DARA 3GCMA 4IZKB 4DV5I 2AE8A 4DPTA 2V2ZA 4WUCA 1FWLA 4KQVA 3PYEA 5GMDA 2WNRA 3J7AM 4ZVIA 1KIJA 3JAMC 1OYPA 2XEXA 5A2QC 2VF3A 4DUYI 1Z0VA 4DV3I 3D4JA 1IBME 4YY3E 4USKA 1MG7A 1FJGI 1Z0TA 1Z5BA 3Q6NA 1XNQI 2CZ9A 1FWKA 4NXNE 5LL6R 4DR7E 2F4VI 1FKAE 3WU5A 1USUA 5DRRA 1Z59A 4WUDA 4JI8I 2UXCI 4LF4E 4JI6E 4IZJA 4JI1E 1XMOE 4OO1F 1Y60A 5JEAB 1NHHA 4DV7I 4IFDC 2PO0B 3L7ZA 1KTVA 4FW5A 1N36I 4X64I 4DU8A 1Z0GA 1VISA 2A2DA 4JYAE 4IFDE 3QT8A 2OI2A 4BA1A 1N33I 1ZM4A 2X36A 4IZKA 4DR4E 4NBQA 4MU1A 4P52A 2O1WA 5IT9C 4B3ME 2NN6C 2BM1A 2BA1G 4LF5I 4JI5E 4IFDA 3GMEA 2E5LI 4JV5I 4K0KI 4LF7I 1HNXI 4LF9I 5DRQA 1OYRA 4DPWA 5FLXC 4GKKE 5EL9A 3P3EA 4LCHA 2PO2A 3PYFA 4MYTA 4LFCI 3ZZTA 4IFDD 4MU3A 1QZRA 5K36C 3M85D 1ELOA 2CVEA 2CGEA 3J81C 4X66I 4FW9A 3B78A 4DR3E 2NN6F 5K36E 4B3RI 5DRPA 3J80C 3QT7A 3HKMA 1HNZI 4RPFA 4JI7E 2O1VA 4DV6I 2R42A 1H7UA 2UXBI 4DU7A 2NN6D 4HYMA 4DUZE 2PO0A 4FW6A 1RREA 4DR6I 5K36A 4JI3E 4IZJB 4DV0I 5K36F 3P06A 4GQUA 3P76A 2BV3A 2WW4A 3PYGA 4PRXA 4DV4I 3ZKBA 3LPSA 5K36D 2JEBB 5BR8E 2HKJA 3K85A 4DV2I 5A2QQ 1IBKE 4DR5E 1XMQI 5BR8I 3U1KA 4DV5E 2GO4A 4KHPI 3QT6A 3T1HI 4FN5A 5GMEA 2O1UA 3V2UC 4JI0I 1R6MA 1H73A 4DPXA 2ZM6I 4OO1C 1S16A 4IFDB 2EFGA 4DUYE 4DR1I 2UUBI 3LTOA 4DV3E 2WP8B 4OO1E 4JI4I 4GKJI 1FJGE 1NHIA 1E3PA 2PO2B 4X62I 1VI7A 2GO3A 3T1YI 1XNQE 1YHCA 3M7NG 1XNRI 4YHHI 1ZM2A 1XHKA 2NN6B 1N0UA 2F4VE 1UDSA 2GQ0A 4OO1A 1USVA 3KRNA 1HR0I 2O3ZA 4JI8E 2UXCE 4DV1E 3B4TA 1Z0WA 4DV1I 3B82A 2HFUA 2PNZA 4DPYA 4DV7E 1N36E 4X64E 4OO1D 2BA0G 4IS9A 4Z7CA 5C0XC 2UU9I 5FLXQ 2JEBA 4LPFA 4PU9A 1HK7A 5K36B 3M6AA 2UUCI 1N33E 1N34I 4I3HA 3P3GA 2C38B 1A6FA 1Y6ZA 2HFSA 2V2VA 3CWVA 4LF5E 3OTOI 2E5LE 4JV5E 4K0KE 5FWKA 4LCGA 4LF7E 1HNXE 4LF9E 1J5EI 2UUAI 4LF8I 4HXZA 2IESA 2IOPA 1P42A 4PRVA 4BA2B 1NZ0A 2NN6E 2PNLA 1KVKA 2WP8A 4JI2I 4HACB 3J80Q 5LMUI 4LFCE 5C0XF 3M7ND 2ZITA 1FI4A 2NN6A 3Q1QA 2V34A 5C0XD 3CDJA 4XTJA 2VQFI 4X66E 1S4EA 1NHJA 5ELWA 4B3RE 2VQEI 1HNZE 1Y5YA 1Z5CA 4DV6E 2UXBE 1YH8A 3K17A 4JG4A 2BA0D 1H72C 4UT4A 4DR6E 5DNXA 3WU3A 4DR2I 2UXDI 2Z5CA 4OO1B 4B3SI 1XXEA 2IERA 2O1TA 3HULA 4X65I 1EI1A 4DV0E 4P7AA 1HNWI 2E1RA 3P3CA 1U2RA 2C38A 2ZBKB 4U3DA 2PNZB 4DV4E 4AM3A 4OX9I 4FW3A 2J7KA 4Z7YA 3V5RA 5L3JA 2BA1D 3NZKA 4MDTA 5LMNI 2C39A 4DV2E 1OJ4A 4DXLA 4OKGA 1XMQE 3JAMQ 5IWAI 1Y4SA 3DD6A 3U1YA 1H7SA 4LFAE 1WUUA 3PRYA 4BA2A 4KHPE 3T1HE 1UDQA 5JEAF 4HACA 4LFAI 4JI0E 2C37B 3GONA 3H4LA 2ZM6E 1PKPA 1ZXNA 4NXMI 4LFBI 1UDOA 1N32E 1ZXMA 4AQYI 1K47A 4B3TI 4DR1E 2UUBE 5C0XB 4LF6I 1N32I 1RHYA 4FW7A 2HHHI 2J65A 4JI4E 2HK3A 4GKJE 2F1DA 3B8HA 1UDNA 4R1FA 2NPFA 1IBLI 4X62E 3T1YE 1I94I 1XNRE 4YHHE 4N3OA 2BR2B 5DROA 5EKWA 1PIEA 1UEKA 1HR0E 4AIMA 2PNMA 2LJPA 3UHMA 2PO1B 1OYSA 5IT9Q 4QNKA 4DPUA 2UU9E 1FNMA 2JEAA 4HY1A 1KKHA 2UUCE 2Z5CB 4FWDA 1IBMI 4YY3I 1N34E 4OZEA 3PS3A 3K1JA 3M85G 5C0XE 4FWHA 3QT5A 4NXNI 4DR7I 4LCFA 1B62A 2C37A 3OTOE 3HJCA 4ISAA 3ZKDA 4LOMA 2JE6B 1J5EE 2UUAE 4LF8E 1PVGA 4LF4I 4MU0A 2HKEA 2C39B 1MX0A 4JI1I 3Q6MA 1XMOI 4JI6I 2GS8A 5C0XA 1B63A 2Z5BB 3J81Q 4JI2E 5LMUE 1D6TA 2IOQA 3GLLA 3WU4A 3H1CA 1N0VC 3ZZ0A 4IZJD 4JYAI 2AJ4A 2BR2A 2DEIA 1Z5AA 5DNLA 4ED4A 2VQFE 4MYUA 4DR4I 2VQEE 4B3MI 1ZM9A 2PO1A 4U3BA
chains in the Genus database with same CATH topology
4JI5I 1Z0CA 4FWGA 1Z0BA 1MU5A 4EMDA 4GKKI 4DR2E 2UXDE 4B3SE 2DEJA 3ZM7A 2HK2A 2BM0A 1BKNA 4X65E 2Z5EA 1ZM3A 3ZZUA 1HNWE 1Z0EA 3J7AG 4OX9E 5LMNE 4DR3I 2X7IA 3F0NA 2CG9A 4M1KA 5IWAE 2Q2EB 4JI7I 1Y4UA 2Z5BA 4DUZI 2A2CA 4USMA 4JI3I 2V2QA 4WUBA 4NXME 4LFBE 2R3VA 4AQYE 4B3TE 4URLA 3WU6A 4LF6E 1RR9A 2HHHE 3LNUA 3PYDA 2V8PA 1EA6A 1IBLE 1H74A 1I94E 1IBKI 4UTGA 4DR5I 1DARA 4IZKB 4DV5I 4DPTA 2V2ZA 4WUCA 1FWLA 4KQVA 3PYEA 5GMDA 3J7AM 1KIJA 4ZVIA 3JAMC 2XEXA 5A2QC 2VF3A 4DUYI 1Z0VA 4DV3I 3D4JA 1IBME 4YY3E 4USKA 1MG7A 1FJGI 1Z0TA 1Z5BA 3Q6NA 1XNQI 2CZ9A 1FWKA 4NXNE 5LL6R 4DR7E 2F4VI 1FKAE 3WU5A 1USUA 1Z59A 4WUDA 4JI8I 2UXCI 4LF4E 4JI6E 4IZJA 4JI1E 1XMOE 1NHHA 4DV7I 1KTVA 1N36I 4X64I 4DU8A 1Z0GA 1VISA 2A2DA 4JYAE 3QT8A 2OI2A 1N33I 1ZM4A 2X36A 4IZKA 4DR4E 4P52A 2O1WA 5IT9C 4B3ME 2BM1A 4LF5I 4JI5E 2E5LI 4JV5I 4K0KI 4LF7I 1HNXI 4LF9I 5FLXC 4DPWA 4GKKE 3PYFA 4MYTA 4LFCI 3ZZTA 1QZRA 1ELOA 2CGEA 3J81C 4X66I 4FW9A 3B78A 4DR3E 4B3RI 3J80C 3QT7A 1HNZI 4RPFA 4JI7E 2O1VA 4DV6I 2R42A 1H7UA 2UXBI 4DU7A 4HYMA 4DUZE 1RREA 4DR6I 4JI3E 4IZJB 4DV0I 3P06A 2BV3A 2WW4A 3PYGA 4PRXA 4DV4I 3ZKBA 3LPSA 5BR8E 2HKJA 3K85A 4DV2I 5A2QQ 1IBKE 4DR5E 1XMQI 5BR8I 4DV5E 4KHPI 3QT6A 3T1HI 4FN5A 5GMEA 2O1UA 3V2UC 4JI0I 1H73A 4DPXA 2ZM6I 1S16A 2EFGA 4DUYE 4DR1I 2UUBI 3LTOA 4DV3E 4JI4I 4GKJI 1FJGE 1NHIA 4X62I 3T1YI 1XNQE 1XNRI 4YHHI 1ZM2A 1XHKA 1N0UA 2F4VE 2GQ0A 1USVA 1HR0I 4JI8E 2UXCE 4DV1E 1Z0WA 4DV1I 3B82A 2HFUA 4DPYA 4DV7E 1N36E 4X64E 4Z7CA 2UU9I 5FLXQ 4PU9A 1HK7A 3M6AA 2UUCI 1N33E 1N34I 4I3HA 1A6FA 1Y6ZA 2HFSA 2V2VA 3CWVA 4LF5E 3OTOI 2E5LE 4JV5E 4K0KE 5FWKA 4LF7E 1HNXE 4LF9E 1J5EI 2UUAI 4LF8I 4HXZA 2IOPA 4PRVA 1NZ0A 2PNLA 1KVKA 4JI2I 4HACB 3J80Q 5LMUI 4LFCE 2ZITA 1FI4A 3Q1QA 2V34A 4XTJA 2VQFI 4X66E 1S4EA 1NHJA 4B3RE 2VQEI 1HNZE 1Z5CA 4DV6E 2UXBE 3K17A 4JG4A 1H72C 4UT4A 4DR6E 3WU3A 4DR2I 2UXDI 2Z5CA 4B3SI 2O1TA 3HULA 4X65I 1EI1A 4DV0E 4P7AA 1HNWI 2E1RA 1U2RA 2ZBKB 4DV4E 4OX9I 2J7KA 4Z7YA 3V5RA 5L3JA 5LMNI 4DV2E 1OJ4A 4DXLA 1XMQE 3JAMQ 5IWAI 1Y4SA 1H7SA 4LFAE 1WUUA 3PRYA 4KHPE 3T1HE 4HACA 4LFAI 4JI0E 3GONA 3H4LA 2ZM6E 1PKPA 1ZXNA 4NXMI 4LFBI 1N32E 1ZXMA 4AQYI 1K47A 4B3TI 4DR1E 2UUBE 4LF6I 1N32I 2HHHI 4JI4E 2HK3A 4GKJE 3B8HA 4R1FA 2NPFA 1IBLI 4X62E 3T1YE 1I94I 1XNRE 4YHHE 4N3OA 1PIEA 1UEKA 1HR0E 2PNMA 2LJPA 5IT9Q 4DPUA 2UU9E 1FNMA 4HY1A 1KKHA 2UUCE 2Z5CB 4FWDA 1IBMI 4YY3I 1N34E 3K1JA 4FWHA 3QT5A 4NXNI 4DR7I 1B62A 3OTOE 3HJCA 3ZKDA 1J5EE 2UUAE 4LF8E 1PVGA 4LF4I 2HKEA 4JI6I 4JI1I 3Q6MA 1XMOI 2GS8A 1B63A 2Z5BB 3J81Q 4JI2E 5LMUE 1D6TA 2IOQA 3WU4A 1N0VC 3ZZ0A 4IZJD 4JYAI 2AJ4A 2DEIA 1Z5AA 4ED4A 2VQFE 4MYUA 4DR4I 2VQEE 4B3MI 1ZM9A 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 I;  1Z0C A;  4FWG A;  1Z0B A;  1MU5 A;  4EMD A;  4GKK I;  4DR2 E;  2UXD E;  4B3S E;  2DEJ A;  3ZM7 A;  2HK2 A;  2BM0 A;  1BKN A;  4X65 E;  1ZM3 A;  3ZZU A;  1HNW E;  1Z0E A;  3J7A G;  4OX9 E;  5LMN E;  4DR3 I;  2X7I A;  3F0N A;  5IWA E;  4M1K A;  2Q2E B;  4JI7 I;  4DUZ I;  2A2C A;  4USM A;  4JI3 I;  2V2Q A;  4WUB A;  4NXM E;  4LFB E;  2R3V A;  4AQY E;  4B3T E;  4URL A;  3WU6 A;  4LF6 E;  1RR9 A;  2HHH E;  3LNU A;  3PYD A;  2V8P A;  1EA6 A;  1IBL E;  1H74 A;  1I94 E;  1IBK I;  4UTG A;  4DR5 I;  1DAR A;  4DV5 I;  4DPT A;  2V2Z A;  4WUC A;  1FWL A;  4KQV A;  3PYE A;  5GMD A;  3J7A M;  1KIJ A;  4ZVI A;  3JAM C;  2XEX A;  5A2Q C;  2VF3 A;  4DUY I;  1Z0V A;  4DV3 I;  3D4J A;  1IBM E;  4YY3 E;  4USK A;  1MG7 A;  1FJG I;  1Z0T A;  1Z5B A;  1XNQ I;  2CZ9 A;  1FWK A;  4NXN E;  5LL6 R;  4DR7 E;  2F4V I;  1FKA E;  3WU5 A;  1Z59 A;  4WUD A;  4JI8 I;  2UXC I;  4LF4 E;  4JI6 E;  4JI1 E;  1XMO E;  1NHH A;  4DV7 I;  1KTV A;  1N36 I;  4X64 I;  4DU8 A;  1Z0G A;  1VIS A;  2A2D A;  4JYA E;  3QT8 A;  2OI2 A;  1N33 I;  1ZM4 A;  2X36 A;  4DR4 E;  4P52 A;  5IT9 C;  4B3M E;  2BM1 A;  4LF5 I;  4JI5 E;  2E5L I;  4JV5 I;  4K0K I;  4LF7 I;  1HNX I;  4LF9 I;  5FLX C;  4DPW A;  4GKK E;  3PYF A;  4MYT A;  4LFC I;  3ZZT A;  1QZR A;  1ELO A;  3J81 C;  4X66 I;  4FW9 A;  3B78 A;  4DR3 E;  4B3R I;  3J80 C;  3QT7 A;  1HNZ I;  4RPF A;  4JI7 E;  4DV6 I;  2R42 A;  1H7U A;  2UXB I;  4DU7 A;  4HYM A;  4DUZ E;  1RRE A;  4DR6 I;  4JI3 E;  4DV0 I;  2BV3 A;  2WW4 A;  3PYG A;  4PRX A;  4DV4 I;  3ZKB A;  3LPS A;  5BR8 E;  2HKJ A;  4DV2 I;  1IBK E;  5A2Q Q;  4DR5 E;  1XMQ I;  5BR8 I;  4DV5 E;  4KHP I;  3QT6 A;  3T1H I;  4FN5 A;  5GME A;  3V2U C;  4JI0 I;  1H73 A;  4DPX A;  2ZM6 I;  1S16 A;  2EFG A;  4DUY E;  4DR1 I;  2UUB I;  3LTO A;  4DV3 E;  4JI4 I;  4GKJ I;  1FJG E;  1NHI A;  4X62 I;  3T1Y I;  1XNQ E;  1XNR I;  4YHH I;  1ZM2 A;  1XHK A;  1N0U A;  2F4V E;  1HR0 I;  4JI8 E;  2UXC E;  4DV1 E;  1Z0W A;  4DV1 I;  3B82 A;  2HFU A;  4DPY A;  4DV7 E;  1N36 E;  4X64 E;  4Z7C A;  2UU9 I;  5FLX Q;  4PU9 A;  3M6A A;  2UUC I;  1N33 E;  1N34 I;  4I3H A;  1A6F A;  2HFS A;  2V2V A;  3CWV A;  4LF5 E;  3OTO I;  2E5L E;  4JV5 E;  4K0K E;  4LF7 E;  1HNX E;  4LF9 E;  1J5E I;  2UUA I;  4LF8 I;  4HXZ A;  4PRV A;  1NZ0 A;  1KVK A;  4JI2 I;  4HAC B;  3J80 Q;  5LMU I;  4LFC E;  2ZIT A;  1FI4 A;  3Q1Q A;  2V34 A;  4XTJ A;  2VQF I;  4X66 E;  1S4E A;  1NHJ A;  4B3R E;  2VQE I;  1HNZ E;  1Z5C A;  4DV6 E;  2UXB E;  3K17 A;  4JG4 A;  1H72 C;  4UT4 A;  4DR6 E;  3WU3 A;  4DR2 I;  2UXD I;  4B3S I;  3HUL A;  4X65 I;  1EI1 A;  4DV0 E;  4P7A A;  1HNW I;  2E1R A;  1U2R A;  2ZBK B;  4DV4 E;  4OX9 I;  2J7K A;  4Z7Y A;  3V5R A;  5L3J A;  5LMN I;  4DV2 E;  1OJ4 A;  4DXL A;  1XMQ E;  3JAM Q;  5IWA I;  1H7S A;  4LFA E;  1WUU A;  4KHP E;  3T1H E;  4HAC A;  4LFA I;  4JI0 E;  3GON A;  3H4L A;  2ZM6 E;  1PKP A;  1ZXN A;  4NXM I;  4LFB I;  1N32 E;  1ZXM A;  4AQY I;  1K47 A;  4B3T I;  4DR1 E;  2UUB E;  4LF6 I;  1N32 I;  2HHH I;  4JI4 E;  2HK3 A;  4GKJ E;  3B8H A;  4R1F A;  2NPF A;  1IBL I;  4X62 E;  3T1Y E;  1I94 I;  1XNR E;  4YHH E;  1PIE A;  1UEK A;  1HR0 E;  2LJP A;  5IT9 Q;  4DPU A;  2UU9 E;  1FNM A;  4HY1 A;  1KKH A;  2UUC E;  4FWD A;  1IBM I;  4YY3 I;  1N34 E;  3K1J A;  4FWH A;  3QT5 A;  4NXN I;  4DR7 I;  1B62 A;  3OTO E;  3ZKD A;  1J5E E;  2UUA E;  4LF8 E;  1PVG A;  4LF4 I;  2HKE A;  4JI6 I;  4JI1 I;  1XMO I;  2GS8 A;  1B63 A;  3J81 Q;  4JI2 E;  5LMU E;  1D6T A;  3WU4 A;  1N0V C;  3ZZ0 A;  4JYA I;  2AJ4 A;  2DEI A;  1Z5A A;  4ED4 A;  2VQF E;  4MYU A;  4DR4 I;  2VQE E;  4B3M I;  1ZM9 A;  1MX0 A; 
#chains in the Genus database with same CATH topology
 4JI5 I;  1E3H A;  1Z0C A;  4FWG A;  1Z0B A;  1MU5 A;  4EMD A;  4GKK I;  4IFD F;  4DR2 E;  5JEA C;  2UXD E;  1R6L A;  4B3S E;  2DEJ A;  3CDI A;  4J3D A;  3ZM7 A;  2HK2 A;  2BM0 A;  1BKN A;  4X65 E;  2Z5E A;  5JEA E;  1ZM3 A;  3ZZU A;  1HNW E;  1Z0E A;  2WNR B;  3J7A G;  4OX9 E;  2VES A;  5LMN E;  4MU4 A;  2JE6 A;  2JT2 A;  4DR3 I;  2X7I A;  5JEA A;  2JEA B;  3F0N A;  2CG9 A;  4M1K A;  5IWA E;  2Q2E B;  4JI7 I;  1Y4U A;  2Z5B A;  4DUZ I;  2A2C A;  3PS1 A;  4FW4 A;  4MQY A;  4USM A;  4JI3 I;  2V2Q A;  4WUB A;  4NXM E;  4LFB E;  2R3V A;  5JEA D;  4AQY E;  4QNJ A;  4B3T E;  4URL A;  3WU6 A;  4LF6 E;  1RR9 A;  2HHH E;  3LNU A;  3PYD A;  3L7Z B;  2V8P A;  1EA6 A;  1IBL E;  4AID A;  1H74 A;  1I94 E;  1IBK I;  4UTG A;  3PS2 A;  4BA1 B;  4DR5 I;  1DAR A;  3GCM A;  4IZK B;  4DV5 I;  2AE8 A;  4DPT A;  2V2Z A;  4WUC A;  1FWL A;  4KQV A;  3PYE A;  5GMD A;  2WNR A;  3J7A M;  4ZVI A;  1KIJ A;  3JAM C;  1OYP A;  2XEX A;  5A2Q C;  2VF3 A;  4DUY I;  1Z0V A;  4DV3 I;  3D4J A;  1IBM E;  4YY3 E;  4USK A;  1MG7 A;  1FJG I;  1Z0T A;  1Z5B A;  3Q6N A;  1XNQ I;  2CZ9 A;  1FWK A;  4NXN E;  5LL6 R;  4DR7 E;  2F4V I;  1FKA E;  3WU5 A;  1USU A;  5DRR A;  1Z59 A;  4WUD A;  4JI8 I;  2UXC I;  4LF4 E;  4JI6 E;  4IZJ A;  4JI1 E;  1XMO E;  4OO1 F;  1Y60 A;  5JEA B;  1NHH A;  4DV7 I;  4IFD C;  2PO0 B;  3L7Z A;  1KTV A;  4FW5 A;  1N36 I;  4X64 I;  4DU8 A;  1Z0G A;  1VIS A;  2A2D A;  4JYA E;  4IFD E;  3QT8 A;  2OI2 A;  4BA1 A;  1N33 I;  1ZM4 A;  2X36 A;  4IZK A;  4DR4 E;  4NBQ A;  4MU1 A;  4P52 A;  2O1W A;  5IT9 C;  4B3M E;  2NN6 C;  2BM1 A;  2BA1 G;  4LF5 I;  4JI5 E;  4IFD A;  3GME A;  2E5L I;  4JV5 I;  4K0K I;  4LF7 I;  1HNX I;  4LF9 I;  5DRQ A;  1OYR A;  4DPW A;  5FLX C;  4GKK E;  5EL9 A;  3P3E A;  4LCH A;  2PO2 A;  3PYF A;  4MYT A;  4LFC I;  3ZZT A;  4IFD D;  4MU3 A;  1QZR A;  5K36 C;  3M85 D;  1ELO A;  2CVE A;  2CGE A;  3J81 C;  4X66 I;  4FW9 A;  3B78 A;  4DR3 E;  2NN6 F;  5K36 E;  4B3R I;  5DRP A;  3J80 C;  3QT7 A;  3HKM A;  1HNZ I;  4RPF A;  4JI7 E;  2O1V A;  4DV6 I;  2R42 A;  1H7U A;  2UXB I;  4DU7 A;  2NN6 D;  4HYM A;  4DUZ E;  2PO0 A;  4FW6 A;  1RRE A;  4DR6 I;  5K36 A;  4JI3 E;  4IZJ B;  4DV0 I;  5K36 F;  3P06 A;  4GQU A;  3P76 A;  2BV3 A;  2WW4 A;  3PYG A;  4PRX A;  4DV4 I;  3ZKB A;  3LPS A;  5K36 D;  2JEB B;  5BR8 E;  2HKJ A;  3K85 A;  4DV2 I;  5A2Q Q;  1IBK E;  4DR5 E;  1XMQ I;  5BR8 I;  3U1K A;  4DV5 E;  2GO4 A;  4KHP I;  3QT6 A;  3T1H I;  4FN5 A;  5GME A;  2O1U A;  3V2U C;  4JI0 I;  1R6M A;  1H73 A;  4DPX A;  2ZM6 I;  4OO1 C;  1S16 A;  4IFD B;  2EFG A;  4DUY E;  4DR1 I;  2UUB I;  3LTO A;  4DV3 E;  2WP8 B;  4OO1 E;  4JI4 I;  4GKJ I;  1FJG E;  1NHI A;  1E3P A;  2PO2 B;  4X62 I;  1VI7 A;  2GO3 A;  3T1Y I;  1XNQ E;  1YHC A;  3M7N G;  1XNR I;  4YHH I;  1ZM2 A;  1XHK A;  2NN6 B;  1N0U A;  2F4V E;  1UDS A;  2GQ0 A;  4OO1 A;  1USV A;  3KRN A;  1HR0 I;  2O3Z A;  4JI8 E;  2UXC E;  4DV1 E;  3B4T A;  1Z0W A;  4DV1 I;  3B82 A;  2HFU A;  2PNZ A;  4DPY A;  4DV7 E;  1N36 E;  4X64 E;  4OO1 D;  2BA0 G;  4IS9 A;  4Z7C A;  5C0X C;  2UU9 I;  5FLX Q;  2JEB A;  4LPF A;  4PU9 A;  1HK7 A;  5K36 B;  3M6A A;  2UUC I;  1N33 E;  1N34 I;  4I3H A;  3P3G A;  2C38 B;  1A6F A;  1Y6Z A;  2HFS A;  2V2V A;  3CWV A;  4LF5 E;  3OTO I;  2E5L E;  4JV5 E;  4K0K E;  5FWK A;  4LCG A;  4LF7 E;  1HNX E;  4LF9 E;  1J5E I;  2UUA I;  4LF8 I;  4HXZ A;  2IES A;  2IOP A;  1P42 A;  4PRV A;  4BA2 B;  1NZ0 A;  2NN6 E;  2PNL A;  1KVK A;  2WP8 A;  4JI2 I;  4HAC B;  3J80 Q;  5LMU I;  4LFC E;  5C0X F;  3M7N D;  2ZIT A;  1FI4 A;  2NN6 A;  3Q1Q A;  2V34 A;  5C0X D;  3CDJ A;  4XTJ A;  2VQF I;  4X66 E;  1S4E A;  1NHJ A;  5ELW A;  4B3R E;  2VQE I;  1HNZ E;  1Y5Y A;  1Z5C A;  4DV6 E;  2UXB E;  1YH8 A;  3K17 A;  4JG4 A;  2BA0 D;  1H72 C;  4UT4 A;  4DR6 E;  5DNX A;  3WU3 A;  4DR2 I;  2UXD I;  2Z5C A;  4OO1 B;  4B3S I;  1XXE A;  2IER A;  2O1T A;  3HUL A;  4X65 I;  1EI1 A;  4DV0 E;  4P7A A;  1HNW I;  2E1R A;  3P3C A;  1U2R A;  2C38 A;  2ZBK B;  4U3D A;  2PNZ B;  4DV4 E;  4AM3 A;  4OX9 I;  4FW3 A;  2J7K A;  4Z7Y A;  3V5R A;  5L3J A;  2BA1 D;  3NZK A;  4MDT A;  5LMN I;  2C39 A;  4DV2 E;  1OJ4 A;  4DXL A;  4OKG A;  1XMQ E;  3JAM Q;  5IWA I;  1Y4S A;  3DD6 A;  3U1Y A;  1H7S A;  4LFA E;  1WUU A;  3PRY A;  4BA2 A;  4KHP E;  3T1H E;  1UDQ A;  5JEA F;  4HAC A;  4LFA I;  4JI0 E;  2C37 B;  3GON A;  3H4L A;  2ZM6 E;  1PKP A;  1ZXN A;  4NXM I;  4LFB I;  1UDO A;  1N32 E;  1ZXM A;  4AQY I;  1K47 A;  4B3T I;  4DR1 E;  2UUB E;  5C0X B;  4LF6 I;  1N32 I;  1RHY A;  4FW7 A;  2HHH I;  2J65 A;  4JI4 E;  2HK3 A;  4GKJ E;  2F1D A;  3B8H A;  1UDN A;  4R1F A;  2NPF A;  1IBL I;  4X62 E;  3T1Y E;  1I94 I;  1XNR E;  4YHH E;  4N3O A;  2BR2 B;  5DRO A;  5EKW A;  1PIE A;  1UEK A;  1HR0 E;  4AIM A;  2PNM A;  2LJP A;  3UHM A;  2PO1 B;  1OYS A;  5IT9 Q;  4QNK A;  4DPU A;  2UU9 E;  1FNM A;  2JEA A;  4HY1 A;  1KKH A;  2UUC E;  2Z5C B;  4FWD A;  1IBM I;  4YY3 I;  1N34 E;  4OZE A;  3PS3 A;  3K1J A;  3M85 G;  5C0X E;  4FWH A;  3QT5 A;  4NXN I;  4DR7 I;  4LCF A;  1B62 A;  2C37 A;  3OTO E;  3HJC A;  4ISA A;  3ZKD A;  4LOM A;  2JE6 B;  1J5E E;  2UUA E;  4LF8 E;  1PVG A;  4LF4 I;  4MU0 A;  2HKE A;  2C39 B;  1MX0 A;  4JI1 I;  3Q6M A;  1XMO I;  4JI6 I;  2GS8 A;  5C0X A;  1B63 A;  2Z5B B;  3J81 Q;  4JI2 E;  5LMU E;  1D6T A;  2IOQ A;  3GLL A;  3WU4 A;  3H1C A;  1N0V C;  3ZZ0 A;  4IZJ D;  4JYA I;  2AJ4 A;  2BR2 A;  2DEI A;  1Z5A A;  5DNL A;  4ED4 A;  2VQF E;  4MYU A;  4DR4 I;  2VQE E;  4B3M I;  1ZM9 A;  2PO1 A;  4U3B A; 
#chains in the Genus database with same CATH homology
 4JI5 I;  1Z0C A;  4FWG A;  1Z0B A;  1MU5 A;  4EMD A;  4GKK I;  4DR2 E;  2UXD E;  4B3S E;  2DEJ A;  3ZM7 A;  2HK2 A;  2BM0 A;  1BKN A;  4X65 E;  2Z5E A;  1ZM3 A;  3ZZU A;  1HNW E;  1Z0E A;  3J7A G;  4OX9 E;  5LMN E;  4DR3 I;  2X7I A;  3F0N A;  2CG9 A;  4M1K A;  5IWA E;  2Q2E B;  4JI7 I;  1Y4U A;  2Z5B A;  4DUZ I;  2A2C A;  4USM A;  4JI3 I;  2V2Q A;  4WUB A;  4NXM E;  4LFB E;  2R3V A;  4AQY E;  4B3T E;  4URL A;  3WU6 A;  4LF6 E;  1RR9 A;  2HHH E;  3LNU A;  3PYD A;  2V8P A;  1EA6 A;  1IBL E;  1H74 A;  1I94 E;  1IBK I;  4UTG A;  4DR5 I;  1DAR A;  4IZK B;  4DV5 I;  4DPT A;  2V2Z A;  4WUC A;  1FWL A;  4KQV A;  3PYE A;  5GMD A;  3J7A M;  1KIJ A;  4ZVI A;  3JAM C;  2XEX A;  5A2Q C;  2VF3 A;  4DUY I;  1Z0V A;  4DV3 I;  3D4J A;  1IBM E;  4YY3 E;  4USK A;  1MG7 A;  1FJG I;  1Z0T A;  1Z5B A;  3Q6N A;  1XNQ I;  2CZ9 A;  1FWK A;  4NXN E;  5LL6 R;  4DR7 E;  2F4V I;  1FKA E;  3WU5 A;  1USU A;  1Z59 A;  4WUD A;  4JI8 I;  2UXC I;  4LF4 E;  4JI6 E;  4IZJ A;  4JI1 E;  1XMO E;  1NHH A;  4DV7 I;  1KTV A;  1N36 I;  4X64 I;  4DU8 A;  1Z0G A;  1VIS A;  2A2D A;  4JYA E;  3QT8 A;  2OI2 A;  1N33 I;  1ZM4 A;  2X36 A;  4IZK A;  4DR4 E;  4P52 A;  2O1W A;  5IT9 C;  4B3M E;  2BM1 A;  4LF5 I;  4JI5 E;  2E5L I;  4JV5 I;  4K0K I;  4LF7 I;  1HNX I;  4LF9 I;  5FLX C;  4DPW A;  4GKK E;  3PYF A;  4MYT A;  4LFC I;  3ZZT A;  1QZR A;  1ELO A;  2CGE A;  3J81 C;  4X66 I;  4FW9 A;  3B78 A;  4DR3 E;  4B3R I;  3J80 C;  3QT7 A;  1HNZ I;  4RPF A;  4JI7 E;  2O1V A;  4DV6 I;  2R42 A;  1H7U A;  2UXB I;  4DU7 A;  4HYM A;  4DUZ E;  1RRE A;  4DR6 I;  4JI3 E;  4IZJ B;  4DV0 I;  3P06 A;  2BV3 A;  2WW4 A;  3PYG A;  4PRX A;  4DV4 I;  3ZKB A;  3LPS A;  5BR8 E;  2HKJ A;  3K85 A;  4DV2 I;  5A2Q Q;  1IBK E;  4DR5 E;  1XMQ I;  5BR8 I;  4DV5 E;  4KHP I;  3QT6 A;  3T1H I;  4FN5 A;  5GME A;  2O1U A;  3V2U C;  4JI0 I;  1H73 A;  4DPX A;  2ZM6 I;  1S16 A;  2EFG A;  4DUY E;  4DR1 I;  2UUB I;  3LTO A;  4DV3 E;  4JI4 I;  4GKJ I;  1FJG E;  1NHI A;  4X62 I;  3T1Y I;  1XNQ E;  1XNR I;  4YHH I;  1ZM2 A;  1XHK A;  1N0U A;  2F4V E;  2GQ0 A;  1USV A;  1HR0 I;  4JI8 E;  2UXC E;  4DV1 E;  1Z0W A;  4DV1 I;  3B82 A;  2HFU A;  4DPY A;  4DV7 E;  1N36 E;  4X64 E;  4Z7C A;  2UU9 I;  5FLX Q;  4PU9 A;  1HK7 A;  3M6A A;  2UUC I;  1N33 E;  1N34 I;  4I3H A;  1A6F A;  1Y6Z A;  2HFS A;  2V2V A;  3CWV A;  4LF5 E;  3OTO I;  2E5L E;  4JV5 E;  4K0K E;  5FWK A;  4LF7 E;  1HNX E;  4LF9 E;  1J5E I;  2UUA I;  4LF8 I;  4HXZ A;  2IOP A;  4PRV A;  1NZ0 A;  2PNL A;  1KVK A;  4JI2 I;  4HAC B;  3J80 Q;  5LMU I;  4LFC E;  2ZIT A;  1FI4 A;  3Q1Q A;  2V34 A;  4XTJ A;  2VQF I;  4X66 E;  1S4E A;  1NHJ A;  4B3R E;  2VQE I;  1HNZ E;  1Z5C A;  4DV6 E;  2UXB E;  3K17 A;  4JG4 A;  1H72 C;  4UT4 A;  4DR6 E;  3WU3 A;  4DR2 I;  2UXD I;  2Z5C A;  4B3S I;  2O1T A;  3HUL A;  4X65 I;  1EI1 A;  4DV0 E;  4P7A A;  1HNW I;  2E1R A;  1U2R A;  2ZBK B;  4DV4 E;  4OX9 I;  2J7K A;  4Z7Y A;  3V5R A;  5L3J A;  5LMN I;  4DV2 E;  1OJ4 A;  4DXL A;  1XMQ E;  3JAM Q;  5IWA I;  1Y4S A;  1H7S A;  4LFA E;  1WUU A;  3PRY A;  4KHP E;  3T1H E;  4HAC A;  4LFA I;  4JI0 E;  3GON A;  3H4L A;  2ZM6 E;  1PKP A;  1ZXN A;  4NXM I;  4LFB I;  1N32 E;  1ZXM A;  4AQY I;  1K47 A;  4B3T I;  4DR1 E;  2UUB E;  4LF6 I;  1N32 I;  2HHH I;  4JI4 E;  2HK3 A;  4GKJ E;  3B8H A;  4R1F A;  2NPF A;  1IBL I;  4X62 E;  3T1Y E;  1I94 I;  1XNR E;  4YHH E;  4N3O A;  1PIE A;  1UEK A;  1HR0 E;  2PNM A;  2LJP A;  5IT9 Q;  4DPU A;  2UU9 E;  1FNM A;  4HY1 A;  1KKH A;  2UUC E;  2Z5C B;  4FWD A;  1IBM I;  4YY3 I;  1N34 E;  3K1J A;  4FWH A;  3QT5 A;  4NXN I;  4DR7 I;  1B62 A;  3OTO E;  3HJC A;  3ZKD A;  1J5E E;  2UUA E;  4LF8 E;  1PVG A;  4LF4 I;  2HKE A;  4JI6 I;  4JI1 I;  3Q6M A;  1XMO I;  2GS8 A;  1B63 A;  2Z5B B;  3J81 Q;  4JI2 E;  5LMU E;  1D6T A;  2IOQ A;  3WU4 A;  1N0V C;  3ZZ0 A;  4IZJ D;  4JYA I;  2AJ4 A;  2DEI A;  1Z5A A;  4ED4 A;  2VQF E;  4MYU A;  4DR4 I;  2VQE E;  4B3M I;  1ZM9 A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...