5LMUE

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmuE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuE02
1YYWA 4DU7A 4RPFA 3C4BA 4DV4I 4JI6I 2DMYA 1PVGA 1B62A 2R3VA 4Z7YA 1NHIA 1ZM2A 4JI2E 2L2MA 4DKKA 2VQFE 2X36A 4LFCE 4PU9A 4AQYI 1EI1A 4M1KA 3OTOE 4EMDA 4YY3I 2LJHA 4DR2I 3QT8A 3J7AM 2CZ9A 4LF9I 4LF4I 1NHJA 2JVAA 4DV3E 1FJGI 5LMNE 2BM0A 3ADGA 4B3MI 4LF8I 4JI4I 4YHHE 1N36I 1WHNA 2X7IA 4B3TI 4LFAI 4GKKE 2XEXA 2DEJA 2AJ4A 4NXNE 1N34E 4Z7CA 1HNXI 2UUCE 2UXBE 4FWHA 3QT5A 1T4OA 4DUYE 2VF3A 4DV5I 3M6AA 4DV7E 1Z0TA 1MU5A 3ADIA 4DV2E 3T1HE 4OX9I 2A2CA 1J26A 2A2DA 2V2VA 4JI0I 4MYUA 2LTRA 5BR8E 1HNWE 4WYQB 4JI8E 4XTJA 4UT4A 4GKJI 4K0KI 1N32I 3WU4A 2L3CA 1A6FA 1Z0GA 1X47A 4HY1A 2HK2A 2V2QA 3J7Yp 1YYKA 4DV0I 1ELOA 4X64E 1N0UA 1XNQI 2V8PA 1X49A 2F4VE 1IBKI 2B7TA 4ED4A 3B8HA 1KKHA 4DU8A 1X48A 4I3HA 4LF5I 2NPFA 4JI7I 4DR5I 2IHR1 2NUGA 3HTXA 4DR4I 1HR0I 1EKZA 1QU6A 4DPXA 2GS8A 4MYTA 5LMUI 4DPWA 1ZBTA 1RQ0A 2UUBI 4DR6E 4FN5A 2ZM6I 1XNRI 1FWLA 1T4NA 3F0NA 4DUZE 4B3RI 3ZKBA 4JG4A 1I94E 4NXME 3HULA 4JI3I 2NUEA 1STUA 2LUPB 2RS6A 1UHZA 4FW9A 2E5LE 4FWGA 2J7KA 1YZ9A 1H74A 2VQFI 1FKAE 3ADJA 1N33E 2DEIA 3V5RA 1WUUA 3PYEA 2EZ6A 2HFUA 3H4LA 2HHHI 2LRSA 3PYDA 2WW4A 2UXDE 4P7AA 2Q2EB 4WFTA 4ZVIA 3JAMQ 4YHHI 4AQYE 4X62I 4LF7E 4JYAI 4URLA 4LF6E 4GKKI 3ZZTA 4DR3E 4R1FA 2UUCI 1UEKA 2UXBI 4LF4E 4DUYI 2B3TB 4LFBI 3J81Q 2LBSB 4KHPI 3ZKDA 2JY9A 4B3ME 4X65E 1UILA 2UU9I 1N36E 2N3HA 1DARA 4B3TE 4HYMA 3ZZ0A 4LFAE 1H73A 1Z5BA 1GQEA 1Z5CA 2L3JA 2BM1A 3JAMC 2EFGA 2UUAI 4HACB 2NUFA 3CWVA 3B78A 4JI5I 1K47A 4DV6I 1D6TA 1EA6A 1FI4A 4JI0E 3J81C 1J5EI 1MG7A 1NHHA 1QZRA 1IBMI 3T1YI 2RSMA 1FWKA 1S4EA 2DB2A 1XMQE 2HFSA 4KQVA 5LL6R 2MDRA 2F4VI 4PRXA 3LNUA 3ZM7A 1Z0EA 1N32E 5GMDA 4WUDA 4B3SI 3VYXA 2V2ZA 1IBLI 4DR7E 4DXLA 4DV0E 4DR1I 1XHKA 2OI2A 1S16A 5IWAE 2UXCI 1XMOE 2LUQA 1IBKE 4X66E 2DIXA 4DV1E 3K1JA 4LF5E 4DR6I 1O0WA 4JI7E 4DR5E 4JI1I 3J7AG 4DR4E 3ADLA 1HR0E 3LLHA 1HNZE 1DI2A 2HKJA 5LMUE 2VQEE 4DPYA 1Z0VA 3D4JA 4JV5E 2UUBE 5GMEA 1RR9A 4JI2I 2ZM6E 1RREA 2E1RA 4WUBA 5A2QQ 4M2ZA 3LTOA 4LFCI 1ZXNA 1YYOA 4B3RE 1NZ0A 3OTOI 3QT7A 4FWDA 2LTSA 3PYFA 4DV4E 4JI6E 2ZBKB 4JI3E 3PYGA 2UXDI 4DV3I 5LMNI 3QT6A 1PIEA 2RTXA 1BKNA 4USKA 2RS7A 4LF7I 4LF6I 4YY3E 2HHHE 4DR2E 3WU3A 4NXNI 4DR3I 1ZXMA 2HK3A 5A2QC 1N34I 4LF9E 1N0VC 1FJGE 4UTGA 1Z0CA 4DV7I 4USMA 4LF8E 4X65I 4JI4E 4DV2I 3T1HI 2L33A 4X62E 3VYYA 3J80Q 4M30A 4JYAE 5BR8I 1HNWI 3P1XA 4PRVA 4JI8I 1ZM4A 1HNXE 2BV3A 3K17A 4LFBE 1Z0WA 4DV5E 1MX0A 1Z5AA 1Z59A 4KHPE 1OJ4A 4OX9E 4OOGC 4DPTA 5FLXQ 2UU9E 4X8WA 1FNMA 1RC7A 3LPSA 2V34A 2CPNA 2ZITA 3Q1QA 1T4LB 4HXZA 3GONA 4X64I 2UUAE 4GKJE 1XMQI 1WHQA 2KHXA 3J80C 3V2UC 4JI5E 4K0KE 5CFFE 1H72C 2NA2A 4DV6E 2L2NA 2N3GA 4DR7I 2L2KB 5IT9Q 3B82A 1B63A 1J5EE 1IBME 1KIJA 3T1YE 5FLXC 4WUCA 2YT4A 5IWAI 1XNQE 1XMOI 2B7VA 1H7SA 4X66I 4DV1I 2HKEA 1VISA 1U2RA 4B3SE 2LJPA 1IBLE 1KTVA 4DUZI 3C4TA 1PKPA 4DR1E 3WU5A 1I94I 4NXMI 1KVKA 1HNZI 2R42A 1ZM9A 1Z0BA 4DPUA 2UXCE 2VQEI 5L3JA 1ZM3A 1H7UA 4JV5I 5IT9C 3ZZUA 3WU6A 4HACA 2E5LI 1XNRE 1N33I 4JI1E 4P52A
chains in the Genus database with same CATH superfamily
2EMFA 2PRTA 1YYWA 4DU7A 3PRYA 3IWDA 2EN6A 4RPFA 3C4BA 2GO3A 4IZKB 4R2CA 2JP9A 2RQLA 4DV4I 4JI6I 2DMYA 1PVGA 2O1WA 2B9DA 2YSOA 2AE8A 1B62A 2R3VA 4Z7YA 1X6EA 2V88A 2IOPA 1NHIA 2YTPA 1ZM2A 4JI2E 2YTOA 2L2MA 4DKKA 2VQFE 2X36A 4BBYA 4LFCE 4PU9A 4MDTA 3L7ZA 1EI1A 4AQYI 4M1KA 2YSPA 1LLMC 3IWCA 5A6AA 3OTOE 2YTIA 4BHCA 4R8OA 4EMDA 4YY3I 5K36F 2LJHA 1UDQA 4DR2I 2YTFA 3QT8A 2ELYA 3K6QA 3J7AM 2G7HA 2CZ9A 4LF9I 4LF4I 4TUIA 2CTDA 1YFHA 1NHJA 2O3ZA 4AM3A 2E72A 2Z5BB 2JVAA 4DV3E 1FJGI 5LMNE 2EMZA 2BM0A 2Z5EA 3ADGA 2EN7A 4B3MI 4LF8I 1A1HA 4JI4I 4IFDB 4WX9A 4YHHE 4ISAA 2EM7A 2N8XA 1UN6B 2VE7C 4Q35B 1WHNA 1USUA 1N36I 2X7IA 1F2IG 4B3TI 4LFAI 4GKKE 2XEXA 1E3PA 5A6BD 2AJ4A 4NXNE 2DEJA 1N34E 3EPLA 2EE8A 4L5NC 4Z7CA 1HNXI 2HGHA 2UUCE 2UXBE 2EQ1A 4TUGA 3QT5A 4FWHA 1GZ6A 2DSYA 3THNA 1T4OA 1HK7A 2V8QB 4DUYE 2VF3A 4FW6A 3THOB 4DV5I 4GQUA 5K36A 3M6AA 2EM9A 2EN1A 4DV7E 1Z0TA 3TQMA 5IXMB 1MU5A 3IWBA 3HKMA 3RMPA 3ADIA 1YHCA 4DV2E 3T1HE 2C37B 2A2CA 1J26A 4P78A 4WXCA 2NN6F 4OX9I 1PDAA 5JEAE 1Z1BA 2A2DA 4LPFA 2I9IA 3CDIA 2PNMA 2V2VA 4JI0I 4MYUA 5DRRA 2EPCA 2LTRA 4WSPA 5BR8E 1HNWE 2EPUA 1OYSA 4WYQB 4JI8E 2EM5A 2EM0A 5C0XB 2BA0D 4KWYA 3F6HA 1MGTA 4XTJA 4UT4A 4OO1B 2JR1A 5IV8B 4AIMA 2EPPA 4AIDA 2O1UA 2R76A 3VHTB 4GKJI 2BR2B 4J3DA 1AAYA 4K0KI 1KYQA 1N32I 3WU4A 2L3CA 4F6MA 1A6FA 1Z0GA 1X47A 4IFDC 1ZBQA 2YTDA 4HY1A 4BCAA 1T38A 4F2JC 2Z5CB 5DNXA 1WRJA 1SR9A 2HK2A 2V2QA 2J7JA 2LE2A 2J65A 3B4TA 4F54A 3J7Yp 2HJJA 1YYKA 4DV0I 2NN6A 1ELOA 2LMZA 1A1GA 4X64E 1N0UA 2WCC3 4KZSA 1A1JA 1XNQI 2V8PA 1X49A 2F4VE 1IBKI 2B7TA 4I8OA 2MC5A 4ED4A 3B8HA 3NZKA 1KKHA 4DU8A 2PNZA 4F9AB 1X48A 5A69A 4I3HA 4LF5I 5DRQA 2NPFA 2EOZA 4JI7I 4DR5I 3UK3C 2EJ4A 1YSAC 2EMXA 1NEIA 2JEBA 3L7ZB 3P3CA 4LCHA 1BBGA 2PO1B 2EM4A 2IHR1 2EM6A 2NUGA 1A1FA 2BA1G 1PJSA 4WXDA 1KJKA 4IS9A 3HTXA 5KL3A 4DR4I 5C0XC 1HR0I 3HPZA 4IFDE 4OO1C 1EKZA 5JEAD 1QU6A 3GCMA 4RH8A 4DPXA 2GS8A 4MYTA 1A1KA 5LMUI 2M4IA 3DD6A 4DPWA 2V87A 5KL6A 2YTQA 1ZBTA 2YWQA 5KL4A 4F6NA 1RQ0A 2CT1A 4P7DA 2UUBI 4DR6E 4FW4A 4FN5A 1E3HA 2ZM6I 4BMJA 1XNRI 1FWLA 1T4NA 2EM3A 1EH6A 3F0NA 4DUZE 4O24A 2EPAA 4BC9A 2IESA 4B3RI 2KOUA 4ZYGA 3ZKBA 2GPIA 2ODRD 4JG4A 1I94E 4NXME 5AC5A 5DNLA 3HULA 3KZYA 5KL7A 2DLKA 4GEQB 3M85D 4JI3I 2NUEA 1WJPA 3P3EA 2L92A 2EP3A 1STUA 5K36B 2LUPB 4GZNC 2EMKA 5AE1A 3M7NG 2RS6A 1UHZA 4FW9A 2MDGA 1WXRA 5C0XE 5KL5A 1G2DC 2E5LE 1TN9A 4FWGA 4OO1E 2J7KA 1YZ9A 1H74A 5DROA 1FKAE 3ADJA 4NZVA 1N33E 1MEYC 2DEIA 4FW7A 2VQFI 4LTYA 3V5RA 1WUUA 2WNRA 2DMIA 2V83A 3HPSA 2YTEA 3PYEA 2EZ6A 2HFUA 4FK5C 2C38B 1EH7A 3H4LA 2HHHI 1IQSA 5JEAF 2EPMX 5AASA 2EMCA 2LRSA 1R6LA 4ZYDA 3JTZA 5A6JA 3PYDA 3EPJA 2WW4A 2UXDE 2EMBA 2GLIA 4P7AA 2LO3A 4IFDD 3GLLA 2Q2EB 2EMLA 1BBOA 4WFTA 2WP8A 2M1SA 2EMWA 5AE3A 1SFEA 2EOOA 4ZVIA 3JAMQ 4J8ZA 4YHHI 4AQYE 2EM8A 2MKNA 3Q6MA 4X62I 4LF7E 2NN6B 4FW3A 4JYAI 4URLA 3ZOQB 4LF6E 4GKKI 2A25A 4DR3E 3ZZTA 1T39A 4R1FA 2PO2A 1X6HA 3BBGA 5K36C 1OYRA 2UUCI 1UEKA 2VRDA 2E1MA 4LF4E 2UXBI 2YU8A 4DUYI 2B3TB 4LFBI 2EOFA 4R2EA 3J81Q 2LBSB 4KHPI 2EPNA 2K4VA 3ZKDA 5JEAA 2JY9A 2JEBB 4B3ME 2EN8A 2GQ0A 4X65E 4R2SA 3LMLA 1UILA 1Y5YA 2UU9I 1N36E 4N3OA 3BIDA 2N3HA 1DARA 3C6KA 4Q28A 3HXLA 4R2DA 4B3TE 4HYMA 4LFAE 3CDJA 3ZZ0A 1H73A 3PS2A 1Z5BA 4OO1D 3BGHA 1GQEA 1Z5CA 2L3JA 2BM1A 2GO4A 3JAMC 2EFGA 2UUAI 2I13A 2LCEA 2NABA 4IFDF 2ENHA 4O5GA 1IQOA 2NUFA 4HACB 4U3DA 3CWVA 3B78A 4JI5I 2GHFA 4DMIA 4U3BA 5K36E 3H09A 1K47A 2BB8A 3BF2A 4DV6I 1D6TA 5DRPA 2NN6C 2EPRA 2YTGA 1EA6A 1FI4A 4MQYA 2YU5A 4JI0E 4IZJD 4M9VC 3J81C 2MKDA 1J5EI 1MG7A 1NHHA 2DRPA 2EN3A 3DJWA 1QZRA 1IBMI 2M7QA 3EPKA 3T1YI 2JXPA 3QG5C 2YZTA 4MU4A 2RSMA 1FWKA 1S4EA 2DB2A 1YH8A 1XMQE 2HFSA 4KQVA 5LL6R 2MDRA 2F4VI 4PRXA 3LNUA 1TF6A 3ZM7A 2ADRA 1Z0EA 1N32E 4QNJA 2EOJA 5GMDA 4WUDA 4B3SI 4MU1A 4F9BB 2WNRB 3P06A 2WBSA 2LJUA 3VYXA 1Y4UA 2V2ZA 1IBLI 4IFDA 4DR7E 4DXLA 3U1YA 4LCFA 2EL6A 5ELWA 2JEAA 2F1DA 4OO1F 4DV0E 3AUZA 4DR1I 4MLQA 1X3CA 2EMIA 1XHKA 4HTGA 2OI2A 1S16A 1G2FC 5IWAE 2C39A 1A1IA 1DGCA 2NN6E 2UXCI 1XMOE 2EPOA 2LUQA 1IBKE 2PO0A 4IJDA 4O4KA 2L8TA 5A6BA 2DIXA 2EMHA 2YRHA 4WSGA 4X66E 4DV1E 2WP8B 4LF5E 3K1JA 5FWKA 4DR6I 2BA0G 1O0WA 4JI7E 4DR5E 2IOQA 4JI1I 3K85A 4MU3A 3J7AG 1UDOA 2WBUA 1Y60A 5TSEA 2DGCA 2IERA 1VI7A 4DR4E 3ADLA 1IMUA 1HR0E 3LLHA 1RHYA 1HNZE 2EM2A 2EPLX 5ADZA 2PO2B 4MU0A 1BB8A 1DI2A 1OYPA 2HKJA 2JT2A 5K36D 5LMUE 2FV4B 2VQEE 2ENAA 1B69A 4DPYA 1Z0VA 2EN4A 3D4JA 4BHBA 5JEAB 4OO1A 4JV5E 3MHSC 2UUBE 3PS1A 1PJQA 2CGEA 2H36X 5GMEA 2CVEA 1RR9A 4JI2I 1N3GA 2ZM6E 1RREA 2E1RA 4WUBA 5A2QQ 4R2RA 3C6MA 2EMYA 3MHHC 4R2PA 4M2ZA 3FIGA 2O1TA 3LTOA 4LFCI 1P47A 1ZXNA 1X5WA 1YYOA 4B3RE 2Z5CA 3AV0A 3PS3A 5EL9A 1NZ0A 3OTOI 4X9JA 3M99B 1YUJA 3QT7A 4OZEA 2D9HA 2V89A 4LCGA 3P76A 4FWDA 2LTSA 3PYFA 2EMAA 2LVHA 2EOIA 4DV4E 4JI6E 2ZBKB 4JI3E 4BA2A 2JWOA 2RSIA 4IZJA 3PYGA 2UXDI 4WPYA 4DV3I 5LMNI 3QT6A 1PIEA 2RTXA 4ZYHA 1BKNA 2EOXA 4USKA 2VESA 2NN6D 4LOMA 3VK6A 2RS7A 4LF7I 2PO1A 2JE6A 2EOQA 4BA1A 3EPHA 4LF6I 4YY3E 2HHHE 4DR2E 3WU3A 2JOBA 4NXNI 4DR3I 2EL4A 2EMGA 2K7IA 2V86A 5A2QC 4R03A 1ZXMA 2HK3A 1N34I 5JEAC 4LF9E 2EPXA 1UDSA 2ENCA 1R6MA 1N0VC 2PNZB 1FJGE 4UTGA 2HC5A 1Z0CA 4DV7I 2EPKX 4USMA 1DQ3A 4LF8E 3M85G 4R2AA 4X65I 4JI4E 4DV2I 3T1HI 2EOEA 2L33A 4N4RB 2RPCA 2EQ3A 1A1LA 2JEAB 2YRKA 4X62E 3VYYA 3J80Q 4M30A 5A6KA 4JYAE 2O1VA 5C0XD 4NHRA 5LLQA 5BR8I 1UBDC 1HNWI 2EOSA 2ODRC 3P1XA 4PRVA 1L4SA 4JI8I 2EQ0A 1ZM4A 2C39B 1HNXE 2VF1A 2PO0B 4IZKA 2BV3A 4O43A 2M9AA 1P42A 3K17A 4NBQA 2EOMA 2YTNA 4LFBE 1Z0WA 3P3GA 4DV5E 1MX0A 1Z5AA 1Z59A 2BA1D 4KHPE 4HEIA 1OJ4A 2EWLA 2YRMA 4OX9E 3EQ1A 3JU0A 4OOGC 4DPTA 2EPZA 5FLXQ 1JK1A 2UU9E 4X8WA 3HQ1A 5F3WA 3KZZA 1FNMA 2BBGA 1RC7A 3LPSA 2V34A 1GTKA 2CPNA 2MC6A 4BC7A 2EN2A 2ZITA 2YPNA 3Q1QA 1T4LB 2F8BA 4HXZA 3GONA 2C38A 1EH8A 4X64I 4R2QA 1PJTA 2UUAE 2FGGA 4GKJE 1XMQI 1WHQA 2KHXA 3MSWA 3J80C 4M0VA 3V2UC 1ZU1A 1TF3A 4JI5E 4K0KE 3OMLA 5CFFE 1YPNA 1H72C 2Z5BA 3GMEA 2NA2A 2EOYA 1QNTA 4DV6E 3U1KA 2L2NA 2N3GA 2LT7A 2L6MA 1X6FA 5KL2A 4IS1C 5C0XF 4DR7I 2PNLA 1JK2A 2CSHA 3L00A 2L2KB 5DNYA 5IT9Q 2EL5A 3B82A 3M7ND 1B63A 1J5EE 3DF6A 1Y4SA 4BA2B 4FW5A 1IBME 1KIJA 5T6JA 4IZJB 3T1YE 3UHMA 5EKWA 5FLXC 4WUCA 2YTJA 2YT4A 5IWAI 1XNQE 2FTXB 1XMOI 2B7VA 1H7SA 5AC4A 4X66I 4DV1I 3HJCA 3Q6NA 2HKEA 2V85A 1VISA 1U2RA 4B3SE 3KRNA 2LJPA 1XXEA 1Y6ZA 2WBTA 2C37A 3H1CA 2WZOA 1RMDA 1IBLE 4MLVA 2JE6B 1KTVA 4BA1B 4DUZI 4ZYEA 4F9CB 2DLQA 3C4TA 2JPAA 4L8NA 1AH5A 1PKPA 3ECRA 4DR1E 3WU5A 1I94I 2R1FA 1KVKA 1YUIA 1HNZI 4NXMI 2R42A 1ZM9A 1NCSA 1Z0BA 4DPUA 4OKGA 4QNKA 2JOXA 2CG9A 2KONA 5AE2A 3F6GA 4LU9A 2UXCE 2JYAA 5C0XA 2EOHA 2VQEI 5L3JA 1ZM3A 1H7UA 1ZR9A 5IT9C 4JV5I 1USVA 2BR2A 1ZAAC 3WU6A 1UDNA 4HACA 3KWRA 2Q8UA 2LV2A 3ZZUA 1XNRE 2E5LI 4RHBB 2EORA 1N33I 4JI1E 2ELZA 4BS9A 4P52A
chains in the Genus database with same CATH topology
1YYWA 4DU7A 3PRYA 3IWDA 4RPFA 3C4BA 4IZKB 4DV4I 4JI6I 2DMYA 1PVGA 2O1WA 2B9DA 1B62A 2R3VA 4Z7YA 2V88A 2IOPA 1NHIA 1ZM2A 4JI2E 2L2MA 4DKKA 2VQFE 2X36A 4BBYA 4LFCE 4PU9A 4AQYI 1EI1A 4M1KA 3IWCA 3OTOE 4R8OA 4EMDA 4YY3I 2LJHA 4DR2I 3QT8A 3K6QA 3J7AM 2G7HA 2CZ9A 4LF9I 4LF4I 4TUIA 1NHJA 2Z5BB 2JVAA 4DV3E 1FJGI 5LMNE 2BM0A 2Z5EA 3ADGA 4B3MI 4LF8I 4JI4I 4YHHE 2VE7C 1USUA 1WHNA 1N36I 2X7IA 4B3TI 4LFAI 4GKKE 2XEXA 2DEJA 2AJ4A 4NXNE 1N34E 4L5NC 4Z7CA 1HNXI 2UUCE 2UXBE 4TUGA 4FWHA 3QT5A 1GZ6A 2DSYA 1T4OA 1HK7A 2V8QB 4DUYE 2VF3A 4DV5I 3M6AA 4DV7E 1Z0TA 1MU5A 3IWBA 3RMPA 3ADIA 4DV2E 3T1HE 4OX9I 2A2CA 1J26A 4P78A 2A2DA 2PNMA 2V2VA 4JI0I 4MYUA 2LTRA 4WSPA 5BR8E 1HNWE 4WYQB 4JI8E 3F6HA 4XTJA 4UT4A 2JR1A 2O1UA 4GKJI 4K0KI 1N32I 3WU4A 2L3CA 1A6FA 1Z0GA 1X47A 1ZBQA 4HY1A 4BCAA 2Z5CB 1SR9A 2HK2A 2V2QA 2LE2A 4F54A 3J7Yp 1YYKA 4DV0I 1ELOA 2LMZA 4X64E 1N0UA 4KZSA 1XNQI 2V8PA 1X49A 2F4VE 1IBKI 2B7TA 4I8OA 2MC5A 4ED4A 3B8HA 1KKHA 4DU8A 4F9AB 1X48A 4I3HA 4LF5I 2NPFA 4JI7I 4DR5I 2IHR1 2NUGA 3HTXA 4DR4I 1HR0I 3HPZA 1EKZA 1QU6A 4DPXA 2GS8A 4MYTA 5LMUI 2M4IA 4DPWA 2V87A 1ZBTA 1RQ0A 4P7DA 2UUBI 4DR6E 4FN5A 2ZM6I 4BMJA 1XNRI 1FWLA 1T4NA 3F0NA 4DUZE 4BC9A 4B3RI 2KOUA 3ZKBA 2ODRD 4JG4A 1I94E 4NXME 3HULA 4GEQB 4JI3I 2NUEA 2L92A 1STUA 2LUPB 5AE1A 2RS6A 1UHZA 4FW9A 1WXRA 2E5LE 4FWGA 2J7KA 1YZ9A 1H74A 2VQFI 1FKAE 3ADJA 1N33E 2DEIA 4LTYA 3V5RA 1WUUA 2V83A 3HPSA 3PYEA 2EZ6A 2HFUA 3H4LA 2HHHI 5AASA 2LRSA 3PYDA 3JTZA 2WW4A 2UXDE 4P7AA 2Q2EB 4WFTA 2M1SA 5AE3A 4ZVIA 3JAMQ 4J8ZA 4YHHI 4AQYE 3Q6MA 4X62I 4LF7E 4JYAI 4URLA 3ZOQB 4LF6E 4GKKI 3ZZTA 4DR3E 4R1FA 2UUCI 1UEKA 2UXBI 2E1MA 4LF4E 4DUYI 2B3TB 4LFBI 3J81Q 2LBSB 4KHPI 2K4VA 3ZKDA 2JY9A 4B3ME 2GQ0A 4X65E 3LMLA 1UILA 2UU9I 1N36E 4N3OA 2N3HA 1DARA 4Q28A 3HXLA 4B3TE 4HYMA 3ZZ0A 4LFAE 1H73A 1Z5BA 1GQEA 1Z5CA 2L3JA 2BM1A 3JAMC 2EFGA 2UUAI 4HACB 2NUFA 3CWVA 3B78A 4JI5I 4DMIA 3H09A 1K47A 4DV6I 1D6TA 1EA6A 1FI4A 4JI0E 4IZJD 3J81C 1J5EI 1MG7A 1NHHA 3DJWA 1QZRA 1IBMI 2M7QA 3T1YI 2YZTA 2RSMA 1FWKA 1S4EA 2DB2A 1XMQE 2HFSA 4KQVA 5LL6R 2MDRA 2F4VI 4PRXA 3LNUA 3ZM7A 1Z0EA 1N32E 5GMDA 4WUDA 4B3SI 4F9BB 3P06A 3VYXA 1Y4UA 2V2ZA 1IBLI 4DR7E 4DXLA 4DV0E 3AUZA 4DR1I 1XHKA 2OI2A 1S16A 5IWAE 2UXCI 1XMOE 2LUQA 1IBKE 2L8TA 4X66E 2DIXA 4DV1E 3K1JA 4LF5E 5FWKA 4DR6I 1O0WA 4JI7E 4DR5E 2IOQA 4JI1I 3K85A 3J7AG 4DR4E 3ADLA 1HR0E 3LLHA 1HNZE 5ADZA 1DI2A 2HKJA 5LMUE 2FV4B 2VQEE 4DPYA 1Z0VA 3D4JA 4JV5E 2UUBE 2CGEA 2H36X 5GMEA 1RR9A 4JI2I 2ZM6E 1RREA 2E1RA 4WUBA 5A2QQ 4M2ZA 3LTOA 2O1TA 3FIGA 4LFCI 1ZXNA 1YYOA 4B3RE 2Z5CA 3AV0A 1NZ0A 3OTOI 3QT7A 2V89A 4FWDA 2LTSA 3PYFA 4DV4E 4JI6E 2ZBKB 4JI3E 2JWOA 4IZJA 3PYGA 2UXDI 4WPYA 4DV3I 5LMNI 3QT6A 1PIEA 2RTXA 1BKNA 4USKA 3VK6A 2RS7A 4LF7I 4LF6I 4YY3E 2HHHE 4DR2E 3WU3A 2JOBA 4NXNI 4DR3I 1ZXMA 5A2QC 2V86A 2HK3A 1N34I 4R03A 4LF9E 1N0VC 1FJGE 4UTGA 1Z0CA 4DV7I 4USMA 1DQ3A 4LF8E 4X65I 4JI4E 4DV2I 3T1HI 2L33A 4X62E 3VYYA 3J80Q 4M30A 4JYAE 2O1VA 5BR8I 1HNWI 2ODRC 3P1XA 4PRVA 4JI8I 1ZM4A 1HNXE 2VF1A 4IZKA 2BV3A 3K17A 4LFBE 1Z0WA 4DV5E 1MX0A 1Z5AA 1Z59A 4KHPE 1OJ4A 2EWLA 4OX9E 3JU0A 4OOGC 4DPTA 5FLXQ 2UU9E 4X8WA 3HQ1A 5F3WA 1FNMA 1RC7A 3LPSA 2V34A 2CPNA 4BC7A 2MC6A 2ZITA 3Q1QA 1T4LB 2F8BA 4HXZA 3GONA 4X64I 2UUAE 2FGGA 4GKJE 1XMQI 1WHQA 2KHXA 3MSWA 3J80C 4M0VA 3V2UC 4JI5E 4K0KE 3OMLA 5CFFE 1H72C 2Z5BA 2NA2A 4DV6E 2L2NA 2N3GA 2L6MA 4DR7I 2PNLA 2L2KB 5IT9Q 5DNYA 3B82A 1B63A 1J5EE 3DF6A 1Y4SA 1IBME 1KIJA 5T6JA 4IZJB 3T1YE 5FLXC 4WUCA 2YT4A 5IWAI 1XNQE 2FTXB 1XMOI 2B7VA 1H7SA 4X66I 4DV1I 3HJCA 3Q6NA 2HKEA 2V85A 1VISA 1U2RA 4B3SE 2LJPA 1Y6ZA 2WZOA 1IBLE 1KTVA 4DUZI 4F9CB 3C4TA 4L8NA 1PKPA 4DR1E 3WU5A 1I94I 4NXMI 1KVKA 1HNZI 2R42A 1ZM9A 1Z0BA 4DPUA 2JOXA 2CG9A 2KONA 5AE2A 3F6GA 4LU9A 2UXCE 2VQEI 5L3JA 1ZM3A 1H7UA 4JV5I 5IT9C 1USVA 3ZZUA 3WU6A 4HACA 2E5LI 3KWRA 1XNRE 1N33I 4JI1E 4BS9A 4P52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYW A;  4DU7 A;  4RPF A;  3C4B A;  4DV4 I;  4JI6 I;  2DMY A;  1PVG A;  1B62 A;  2R3V A;  4Z7Y A;  1NHI A;  1ZM2 A;  4JI2 E;  2L2M A;  4DKK A;  2VQF E;  2X36 A;  4LFC E;  4PU9 A;  4AQY I;  1EI1 A;  4M1K A;  3OTO E;  4EMD A;  4YY3 I;  2LJH A;  4DR2 I;  3QT8 A;  3J7A M;  2CZ9 A;  4LF9 I;  4LF4 I;  1NHJ A;  2JVA A;  4DV3 E;  1FJG I;  5LMN E;  2BM0 A;  3ADG A;  4B3M I;  4LF8 I;  4JI4 I;  4YHH E;  1N36 I;  1WHN A;  2X7I A;  4B3T I;  4LFA I;  4GKK E;  2XEX A;  2DEJ A;  2AJ4 A;  4NXN E;  1N34 E;  4Z7C A;  1HNX I;  2UUC E;  2UXB E;  4FWH A;  3QT5 A;  1T4O A;  4DUY E;  2VF3 A;  4DV5 I;  3M6A A;  4DV7 E;  1Z0T A;  1MU5 A;  3ADI A;  4DV2 E;  3T1H E;  4OX9 I;  2A2C A;  1J26 A;  2A2D A;  2V2V A;  4JI0 I;  4MYU A;  2LTR A;  5BR8 E;  1HNW E;  4WYQ B;  4JI8 E;  4XTJ A;  4UT4 A;  4GKJ I;  4K0K I;  1N32 I;  3WU4 A;  2L3C A;  1A6F A;  1Z0G A;  1X47 A;  4HY1 A;  2HK2 A;  2V2Q A;  3J7Y p;  1YYK A;  4DV0 I;  1ELO A;  4X64 E;  1N0U A;  1XNQ I;  2V8P A;  1X49 A;  2F4V E;  1IBK I;  2B7T A;  4ED4 A;  3B8H A;  1KKH A;  4DU8 A;  1X48 A;  4I3H A;  4LF5 I;  2NPF A;  4JI7 I;  4DR5 I;  2IHR 1;  2NUG A;  3HTX A;  4DR4 I;  1HR0 I;  1EKZ A;  1QU6 A;  4DPX A;  2GS8 A;  4MYT A;  5LMU I;  4DPW A;  1ZBT A;  1RQ0 A;  2UUB I;  4DR6 E;  4FN5 A;  2ZM6 I;  1XNR I;  1FWL A;  1T4N A;  3F0N A;  4DUZ E;  4B3R I;  3ZKB A;  4JG4 A;  1I94 E;  4NXM E;  3HUL A;  4JI3 I;  2NUE A;  1STU A;  2LUP B;  2RS6 A;  1UHZ A;  4FW9 A;  2E5L E;  4FWG A;  2J7K A;  1YZ9 A;  1H74 A;  2VQF I;  1FKA E;  3ADJ A;  1N33 E;  2DEI A;  3V5R A;  1WUU A;  3PYE A;  2EZ6 A;  2HFU A;  3H4L A;  2HHH I;  2LRS A;  3PYD A;  2WW4 A;  2UXD E;  4P7A A;  2Q2E B;  4WFT A;  4ZVI A;  3JAM Q;  4YHH I;  4AQY E;  4X62 I;  4LF7 E;  4JYA I;  4URL A;  4LF6 E;  4GKK I;  3ZZT A;  4DR3 E;  4R1F A;  2UUC I;  1UEK A;  2UXB I;  4LF4 E;  4DUY I;  2B3T B;  4LFB I;  3J81 Q;  2LBS B;  4KHP I;  3ZKD A;  2JY9 A;  4B3M E;  4X65 E;  1UIL A;  2UU9 I;  1N36 E;  2N3H A;  1DAR A;  4B3T E;  4HYM A;  3ZZ0 A;  4LFA E;  1H73 A;  1Z5B A;  1GQE A;  1Z5C A;  2L3J A;  2BM1 A;  3JAM C;  2EFG A;  2UUA I;  4HAC B;  2NUF A;  3CWV A;  3B78 A;  4JI5 I;  1K47 A;  4DV6 I;  1D6T A;  1EA6 A;  1FI4 A;  4JI0 E;  3J81 C;  1J5E I;  1MG7 A;  1NHH A;  1QZR A;  1IBM I;  3T1Y I;  2RSM A;  1FWK A;  1S4E A;  2DB2 A;  1XMQ E;  2HFS A;  4KQV A;  5LL6 R;  2MDR A;  2F4V I;  4PRX A;  3LNU A;  3ZM7 A;  1Z0E A;  1N32 E;  5GMD A;  4WUD A;  4B3S I;  3VYX A;  2V2Z A;  1IBL I;  4DR7 E;  4DXL A;  4DV0 E;  4DR1 I;  1XHK A;  2OI2 A;  1S16 A;  5IWA E;  2UXC I;  1XMO E;  2LUQ A;  1IBK E;  4X66 E;  2DIX A;  4DV1 E;  3K1J A;  4LF5 E;  4DR6 I;  1O0W A;  4JI7 E;  4DR5 E;  4JI1 I;  3J7A G;  4DR4 E;  3ADL A;  1HR0 E;  3LLH A;  1HNZ E;  1DI2 A;  2HKJ A;  5LMU E;  2VQE E;  4DPY A;  1Z0V A;  3D4J A;  4JV5 E;  2UUB E;  5GME A;  1RR9 A;  4JI2 I;  2ZM6 E;  1RRE A;  2E1R A;  4WUB A;  5A2Q Q;  4M2Z A;  3LTO A;  4LFC I;  1ZXN A;  1YYO A;  4B3R E;  1NZ0 A;  3OTO I;  3QT7 A;  4FWD A;  2LTS A;  3PYF A;  4DV4 E;  4JI6 E;  2ZBK B;  4JI3 E;  3PYG A;  2UXD I;  4DV3 I;  5LMN I;  3QT6 A;  1PIE A;  2RTX A;  1BKN A;  4USK A;  2RS7 A;  4LF7 I;  4LF6 I;  4YY3 E;  2HHH E;  4DR2 E;  3WU3 A;  4NXN I;  4DR3 I;  1ZXM A;  2HK3 A;  5A2Q C;  1N34 I;  4LF9 E;  1N0V C;  1FJG E;  4UTG A;  1Z0C A;  4DV7 I;  4USM A;  4LF8 E;  4X65 I;  4JI4 E;  4DV2 I;  3T1H I;  2L33 A;  4X62 E;  3VYY A;  3J80 Q;  4M30 A;  4JYA E;  5BR8 I;  1HNW I;  3P1X A;  4PRV A;  4JI8 I;  1ZM4 A;  1HNX E;  2BV3 A;  3K17 A;  4LFB E;  1Z0W A;  4DV5 E;  1MX0 A;  1Z5A A;  1Z59 A;  4KHP E;  1OJ4 A;  4OX9 E;  4OOG C;  4DPT A;  5FLX Q;  2UU9 E;  4X8W A;  1FNM A;  1RC7 A;  3LPS A;  2V34 A;  2CPN A;  2ZIT A;  3Q1Q A;  1T4L B;  4HXZ A;  3GON A;  4X64 I;  2UUA E;  4GKJ E;  1XMQ I;  1WHQ A;  2KHX A;  3J80 C;  3V2U C;  4JI5 E;  4K0K E;  5CFF E;  1H72 C;  2NA2 A;  4DV6 E;  2L2N A;  2N3G A;  4DR7 I;  2L2K B;  5IT9 Q;  3B82 A;  1B63 A;  1J5E E;  1IBM E;  1KIJ A;  3T1Y E;  5FLX C;  4WUC A;  2YT4 A;  5IWA I;  1XNQ E;  1XMO I;  2B7V A;  1H7S A;  4X66 I;  4DV1 I;  2HKE A;  1VIS A;  1U2R A;  4B3S E;  2LJP A;  1IBL E;  1KTV A;  4DUZ I;  3C4T A;  1PKP A;  4DR1 E;  3WU5 A;  1I94 I;  4NXM I;  1KVK A;  1HNZ I;  2R42 A;  1ZM9 A;  1Z0B A;  4DPU A;  2UXC E;  2VQE I;  5L3J A;  1ZM3 A;  1H7U A;  4JV5 I;  5IT9 C;  3ZZU A;  3WU6 A;  4HAC A;  2E5L I;  1XNR E;  1N33 I;  4JI1 E;  4P52 A; 
#chains in the Genus database with same CATH topology
 2EMF A;  2PRT A;  1YYW A;  4DU7 A;  3PRY A;  3IWD A;  2EN6 A;  4RPF A;  3C4B A;  2GO3 A;  4IZK B;  4R2C A;  2JP9 A;  2RQL A;  4DV4 I;  4JI6 I;  2DMY A;  1PVG A;  2O1W A;  2B9D A;  2YSO A;  2AE8 A;  1B62 A;  2R3V A;  4Z7Y A;  1X6E A;  2V88 A;  2IOP A;  1NHI A;  2YTP A;  1ZM2 A;  4JI2 E;  2YTO A;  2L2M A;  4DKK A;  2VQF E;  2X36 A;  4BBY A;  4LFC E;  4PU9 A;  4MDT A;  3L7Z A;  1EI1 A;  4AQY I;  4M1K A;  2YSP A;  1LLM C;  3IWC A;  5A6A A;  3OTO E;  2YTI A;  4BHC A;  4R8O A;  4EMD A;  4YY3 I;  5K36 F;  2LJH A;  1UDQ A;  4DR2 I;  2YTF A;  3QT8 A;  2ELY A;  3K6Q A;  3J7A M;  2G7H A;  2CZ9 A;  4LF9 I;  4LF4 I;  4TUI A;  2CTD A;  1YFH A;  1NHJ A;  2O3Z A;  4AM3 A;  2E72 A;  2Z5B B;  2JVA A;  4DV3 E;  1FJG I;  5LMN E;  2EMZ A;  2BM0 A;  2Z5E A;  3ADG A;  2EN7 A;  4B3M I;  4LF8 I;  1A1H A;  4JI4 I;  4IFD B;  4WX9 A;  4YHH E;  4ISA A;  2EM7 A;  2N8X A;  1UN6 B;  2VE7 C;  4Q35 B;  1WHN A;  1USU A;  1N36 I;  2X7I A;  1F2I G;  4B3T I;  4LFA I;  4GKK E;  2XEX A;  1E3P A;  5A6B D;  2AJ4 A;  4NXN E;  2DEJ A;  1N34 E;  3EPL A;  2EE8 A;  4L5N C;  4Z7C A;  1HNX I;  2HGH A;  2UUC E;  2UXB E;  2EQ1 A;  4TUG A;  3QT5 A;  4FWH A;  1GZ6 A;  2DSY A;  3THN A;  1T4O A;  1HK7 A;  2V8Q B;  4DUY E;  2VF3 A;  4FW6 A;  3THO B;  4DV5 I;  4GQU A;  5K36 A;  3M6A A;  2EM9 A;  2EN1 A;  4DV7 E;  1Z0T A;  3TQM A;  5IXM B;  1MU5 A;  3IWB A;  3HKM A;  3RMP A;  3ADI A;  1YHC A;  4DV2 E;  3T1H E;  2C37 B;  2A2C A;  1J26 A;  4P78 A;  4WXC A;  2NN6 F;  4OX9 I;  1PDA A;  5JEA E;  1Z1B A;  2A2D A;  4LPF A;  2I9I A;  3CDI A;  2PNM A;  2V2V A;  4JI0 I;  4MYU A;  5DRR A;  2EPC A;  2LTR A;  4WSP A;  5BR8 E;  1HNW E;  2EPU A;  1OYS A;  4WYQ B;  4JI8 E;  2EM5 A;  2EM0 A;  5C0X B;  2BA0 D;  4KWY A;  3F6H A;  1MGT A;  4XTJ A;  4UT4 A;  4OO1 B;  2JR1 A;  5IV8 B;  4AIM A;  2EPP A;  4AID A;  2O1U A;  2R76 A;  3VHT B;  4GKJ I;  2BR2 B;  4J3D A;  1AAY A;  4K0K I;  1KYQ A;  1N32 I;  3WU4 A;  2L3C A;  4F6M A;  1A6F A;  1Z0G A;  1X47 A;  4IFD C;  1ZBQ A;  2YTD A;  4HY1 A;  4BCA A;  1T38 A;  4F2J C;  2Z5C B;  5DNX A;  1WRJ A;  1SR9 A;  2HK2 A;  2V2Q A;  2J7J A;  2LE2 A;  2J65 A;  3B4T A;  4F54 A;  3J7Y p;  2HJJ A;  1YYK A;  4DV0 I;  2NN6 A;  1ELO A;  2LMZ A;  1A1G A;  4X64 E;  1N0U A;  2WCC 3;  4KZS A;  1A1J A;  1XNQ I;  2V8P A;  1X49 A;  2F4V E;  1IBK I;  2B7T A;  4I8O A;  2MC5 A;  4ED4 A;  3B8H A;  3NZK A;  1KKH A;  4DU8 A;  2PNZ A;  4F9A B;  1X48 A;  5A69 A;  4I3H A;  4LF5 I;  5DRQ A;  2NPF A;  2EOZ A;  4JI7 I;  4DR5 I;  3UK3 C;  2EJ4 A;  1YSA C;  2EMX A;  1NEI A;  2JEB A;  3L7Z B;  3P3C A;  4LCH A;  1BBG A;  2PO1 B;  2EM4 A;  2IHR 1;  2EM6 A;  2NUG A;  1A1F A;  2BA1 G;  1PJS A;  4WXD A;  1KJK A;  4IS9 A;  3HTX A;  5KL3 A;  4DR4 I;  5C0X C;  1HR0 I;  3HPZ A;  4IFD E;  4OO1 C;  1EKZ A;  5JEA D;  1QU6 A;  3GCM A;  4RH8 A;  4DPX A;  2GS8 A;  4MYT A;  1A1K A;  5LMU I;  2M4I A;  3DD6 A;  4DPW A;  2V87 A;  5KL6 A;  2YTQ A;  1ZBT A;  2YWQ A;  5KL4 A;  4F6N A;  1RQ0 A;  2CT1 A;  4P7D A;  2UUB I;  4DR6 E;  4FW4 A;  4FN5 A;  1E3H A;  2ZM6 I;  4BMJ A;  1XNR I;  1FWL A;  1T4N A;  2EM3 A;  1EH6 A;  3F0N A;  4DUZ E;  4O24 A;  2EPA A;  4BC9 A;  2IES A;  4B3R I;  2KOU A;  4ZYG A;  3ZKB A;  2GPI A;  2ODR D;  4JG4 A;  1I94 E;  4NXM E;  5AC5 A;  5DNL A;  3HUL A;  3KZY A;  5KL7 A;  2DLK A;  4GEQ B;  3M85 D;  4JI3 I;  2NUE A;  1WJP A;  3P3E A;  2L92 A;  2EP3 A;  1STU A;  5K36 B;  2LUP B;  4GZN C;  2EMK A;  5AE1 A;  3M7N G;  2RS6 A;  1UHZ A;  4FW9 A;  2MDG A;  1WXR A;  5C0X E;  5KL5 A;  1G2D C;  2E5L E;  1TN9 A;  4FWG A;  4OO1 E;  2J7K A;  1YZ9 A;  1H74 A;  5DRO A;  1FKA E;  3ADJ A;  4NZV A;  1N33 E;  1MEY C;  2DEI A;  4FW7 A;  2VQF I;  4LTY A;  3V5R A;  1WUU A;  2WNR A;  2DMI A;  2V83 A;  3HPS A;  2YTE A;  3PYE A;  2EZ6 A;  2HFU A;  4FK5 C;  2C38 B;  1EH7 A;  3H4L A;  2HHH I;  1IQS A;  5JEA F;  2EPM X;  5AAS A;  2EMC A;  2LRS A;  1R6L A;  4ZYD A;  3JTZ A;  5A6J A;  3PYD A;  3EPJ A;  2WW4 A;  2UXD E;  2EMB A;  2GLI A;  4P7A A;  2LO3 A;  4IFD D;  3GLL A;  2Q2E B;  2EML A;  1BBO A;  4WFT A;  2WP8 A;  2M1S A;  2EMW A;  5AE3 A;  1SFE A;  2EOO A;  4ZVI A;  3JAM Q;  4J8Z A;  4YHH I;  4AQY E;  2EM8 A;  2MKN A;  3Q6M A;  4X62 I;  4LF7 E;  2NN6 B;  4FW3 A;  4JYA I;  4URL A;  3ZOQ B;  4LF6 E;  4GKK I;  2A25 A;  4DR3 E;  3ZZT A;  1T39 A;  4R1F A;  2PO2 A;  1X6H A;  3BBG A;  5K36 C;  1OYR A;  2UUC I;  1UEK A;  2VRD A;  2E1M A;  4LF4 E;  2UXB I;  2YU8 A;  4DUY I;  2B3T B;  4LFB I;  2EOF A;  4R2E A;  3J81 Q;  2LBS B;  4KHP I;  2EPN A;  2K4V A;  3ZKD A;  5JEA A;  2JY9 A;  2JEB B;  4B3M E;  2EN8 A;  2GQ0 A;  4X65 E;  4R2S A;  3LML A;  1UIL A;  1Y5Y A;  2UU9 I;  1N36 E;  4N3O A;  3BID A;  2N3H A;  1DAR A;  3C6K A;  4Q28 A;  3HXL A;  4R2D A;  4B3T E;  4HYM A;  4LFA E;  3CDJ A;  3ZZ0 A;  1H73 A;  3PS2 A;  1Z5B A;  4OO1 D;  3BGH A;  1GQE A;  1Z5C A;  2L3J A;  2BM1 A;  2GO4 A;  3JAM C;  2EFG A;  2UUA I;  2I13 A;  2LCE A;  2NAB A;  4IFD F;  2ENH A;  4O5G A;  1IQO A;  2NUF A;  4HAC B;  4U3D A;  3CWV A;  3B78 A;  4JI5 I;  2GHF A;  4DMI A;  4U3B A;  5K36 E;  3H09 A;  1K47 A;  2BB8 A;  3BF2 A;  4DV6 I;  1D6T A;  5DRP A;  2NN6 C;  2EPR A;  2YTG A;  1EA6 A;  1FI4 A;  4MQY A;  2YU5 A;  4JI0 E;  4IZJ D;  4M9V C;  3J81 C;  2MKD A;  1J5E I;  1MG7 A;  1NHH A;  2DRP A;  2EN3 A;  3DJW A;  1QZR A;  1IBM I;  2M7Q A;  3EPK A;  3T1Y I;  2JXP A;  3QG5 C;  2YZT A;  4MU4 A;  2RSM A;  1FWK A;  1S4E A;  2DB2 A;  1YH8 A;  1XMQ E;  2HFS A;  4KQV A;  5LL6 R;  2MDR A;  2F4V I;  4PRX A;  3LNU A;  1TF6 A;  3ZM7 A;  2ADR A;  1Z0E A;  1N32 E;  4QNJ A;  2EOJ A;  5GMD A;  4WUD A;  4B3S I;  4MU1 A;  4F9B B;  2WNR B;  3P06 A;  2WBS A;  2LJU A;  3VYX A;  1Y4U A;  2V2Z A;  1IBL I;  4IFD A;  4DR7 E;  4DXL A;  3U1Y A;  4LCF A;  2EL6 A;  5ELW A;  2JEA A;  2F1D A;  4OO1 F;  4DV0 E;  3AUZ A;  4DR1 I;  4MLQ A;  1X3C A;  2EMI A;  1XHK A;  4HTG A;  2OI2 A;  1S16 A;  1G2F C;  5IWA E;  2C39 A;  1A1I A;  1DGC A;  2NN6 E;  2UXC I;  1XMO E;  2EPO A;  2LUQ A;  1IBK E;  2PO0 A;  4IJD A;  4O4K A;  2L8T A;  5A6B A;  2DIX A;  2EMH A;  2YRH A;  4WSG A;  4X66 E;  4DV1 E;  2WP8 B;  4LF5 E;  3K1J A;  5FWK A;  4DR6 I;  2BA0 G;  1O0W A;  4JI7 E;  4DR5 E;  2IOQ A;  4JI1 I;  3K85 A;  4MU3 A;  3J7A G;  1UDO A;  2WBU A;  1Y60 A;  5TSE A;  2DGC A;  2IER A;  1VI7 A;  4DR4 E;  3ADL A;  1IMU A;  1HR0 E;  3LLH A;  1RHY A;  1HNZ E;  2EM2 A;  2EPL X;  5ADZ A;  2PO2 B;  4MU0 A;  1BB8 A;  1DI2 A;  1OYP A;  2HKJ A;  2JT2 A;  5K36 D;  5LMU E;  2FV4 B;  2VQE E;  2ENA A;  1B69 A;  4DPY A;  1Z0V A;  2EN4 A;  3D4J A;  4BHB A;  5JEA B;  4OO1 A;  4JV5 E;  3MHS C;  2UUB E;  3PS1 A;  1PJQ A;  2CGE A;  2H36 X;  5GME A;  2CVE A;  1RR9 A;  4JI2 I;  1N3G A;  2ZM6 E;  1RRE A;  2E1R A;  4WUB A;  5A2Q Q;  4R2R A;  3C6M A;  2EMY A;  3MHH C;  4R2P A;  4M2Z A;  3FIG A;  2O1T A;  3LTO A;  4LFC I;  1P47 A;  1ZXN A;  1X5W A;  1YYO A;  4B3R E;  2Z5C A;  3AV0 A;  3PS3 A;  5EL9 A;  1NZ0 A;  3OTO I;  4X9J A;  3M99 B;  1YUJ A;  3QT7 A;  4OZE A;  2D9H A;  2V89 A;  4LCG A;  3P76 A;  4FWD A;  2LTS A;  3PYF A;  2EMA A;  2LVH A;  2EOI A;  4DV4 E;  4JI6 E;  2ZBK B;  4JI3 E;  4BA2 A;  2JWO A;  2RSI A;  4IZJ A;  3PYG A;  2UXD I;  4WPY A;  4DV3 I;  5LMN I;  3QT6 A;  1PIE A;  2RTX A;  4ZYH A;  1BKN A;  2EOX A;  4USK A;  2VES A;  2NN6 D;  4LOM A;  3VK6 A;  2RS7 A;  4LF7 I;  2PO1 A;  2JE6 A;  2EOQ A;  4BA1 A;  3EPH A;  4LF6 I;  4YY3 E;  2HHH E;  4DR2 E;  3WU3 A;  2JOB A;  4NXN I;  4DR3 I;  2EL4 A;  2EMG A;  2K7I A;  2V86 A;  5A2Q C;  4R03 A;  1ZXM A;  2HK3 A;  1N34 I;  5JEA C;  4LF9 E;  2EPX A;  1UDS A;  2ENC A;  1R6M A;  1N0V C;  2PNZ B;  1FJG E;  4UTG A;  2HC5 A;  1Z0C A;  4DV7 I;  2EPK X;  4USM A;  1DQ3 A;  4LF8 E;  3M85 G;  4R2A A;  4X65 I;  4JI4 E;  4DV2 I;  3T1H I;  2EOE A;  2L33 A;  4N4R B;  2RPC A;  2EQ3 A;  1A1L A;  2JEA B;  2YRK A;  4X62 E;  3VYY A;  3J80 Q;  4M30 A;  5A6K A;  4JYA E;  2O1V A;  5C0X D;  4NHR A;  5LLQ A;  5BR8 I;  1UBD C;  1HNW I;  2EOS A;  2ODR C;  3P1X A;  4PRV A;  1L4S A;  4JI8 I;  2EQ0 A;  1ZM4 A;  2C39 B;  1HNX E;  2VF1 A;  2PO0 B;  4IZK A;  2BV3 A;  4O43 A;  2M9A A;  1P42 A;  3K17 A;  4NBQ A;  2EOM A;  2YTN A;  4LFB E;  1Z0W A;  3P3G A;  4DV5 E;  1MX0 A;  1Z5A A;  1Z59 A;  2BA1 D;  4KHP E;  4HEI A;  1OJ4 A;  2EWL A;  2YRM A;  4OX9 E;  3EQ1 A;  3JU0 A;  4OOG C;  4DPT A;  2EPZ A;  5FLX Q;  1JK1 A;  2UU9 E;  4X8W A;  3HQ1 A;  5F3W A;  3KZZ A;  1FNM A;  2BBG A;  1RC7 A;  3LPS A;  2V34 A;  1GTK A;  2CPN A;  2MC6 A;  4BC7 A;  2EN2 A;  2ZIT A;  2YPN A;  3Q1Q A;  1T4L B;  2F8B A;  4HXZ A;  3GON A;  2C38 A;  1EH8 A;  4X64 I;  4R2Q A;  1PJT A;  2UUA E;  2FGG A;  4GKJ E;  1XMQ I;  1WHQ A;  2KHX A;  3MSW A;  3J80 C;  4M0V A;  3V2U C;  1ZU1 A;  1TF3 A;  4JI5 E;  4K0K E;  3OML A;  5CFF E;  1YPN A;  1H72 C;  2Z5B A;  3GME A;  2NA2 A;  2EOY A;  1QNT A;  4DV6 E;  3U1K A;  2L2N A;  2N3G A;  2LT7 A;  2L6M A;  1X6F A;  5KL2 A;  4IS1 C;  5C0X F;  4DR7 I;  2PNL A;  1JK2 A;  2CSH A;  3L00 A;  2L2K B;  5DNY A;  5IT9 Q;  2EL5 A;  3B82 A;  3M7N D;  1B63 A;  1J5E E;  3DF6 A;  1Y4S A;  4BA2 B;  4FW5 A;  1IBM E;  1KIJ A;  5T6J A;  4IZJ B;  3T1Y E;  3UHM A;  5EKW A;  5FLX C;  4WUC A;  2YTJ A;  2YT4 A;  5IWA I;  1XNQ E;  2FTX B;  1XMO I;  2B7V A;  1H7S A;  5AC4 A;  4X66 I;  4DV1 I;  3HJC A;  3Q6N A;  2HKE A;  2V85 A;  1VIS A;  1U2R A;  4B3S E;  3KRN A;  2LJP A;  1XXE A;  1Y6Z A;  2WBT A;  2C37 A;  3H1C A;  2WZO A;  1RMD A;  1IBL E;  4MLV A;  2JE6 B;  1KTV A;  4BA1 B;  4DUZ I;  4ZYE A;  4F9C B;  2DLQ A;  3C4T A;  2JPA A;  4L8N A;  1AH5 A;  1PKP A;  3ECR A;  4DR1 E;  3WU5 A;  1I94 I;  2R1F A;  1KVK A;  1YUI A;  1HNZ I;  4NXM I;  2R42 A;  1ZM9 A;  1NCS A;  1Z0B A;  4DPU A;  4OKG A;  4QNK A;  2JOX A;  2CG9 A;  2KON A;  5AE2 A;  3F6G A;  4LU9 A;  2UXC E;  2JYA A;  5C0X A;  2EOH A;  2VQE I;  5L3J A;  1ZM3 A;  1H7U A;  1ZR9 A;  5IT9 C;  4JV5 I;  1USV A;  2BR2 A;  1ZAA C;  3WU6 A;  1UDN A;  4HAC A;  3KWR A;  2Q8U A;  2LV2 A;  3ZZU A;  1XNR E;  2E5L I;  4RHB B;  2EOR A;  1N33 I;  4JI1 E;  2ELZ A;  4BS9 A;  4P52 A; 
#chains in the Genus database with same CATH homology
 1YYW A;  4DU7 A;  3PRY A;  3IWD A;  4RPF A;  3C4B A;  4IZK B;  4DV4 I;  4JI6 I;  2DMY A;  1PVG A;  2O1W A;  2B9D A;  1B62 A;  2R3V A;  4Z7Y A;  2V88 A;  2IOP A;  1NHI A;  1ZM2 A;  4JI2 E;  2L2M A;  4DKK A;  2VQF E;  2X36 A;  4BBY A;  4LFC E;  4PU9 A;  4AQY I;  1EI1 A;  4M1K A;  3IWC A;  3OTO E;  4R8O A;  4EMD A;  4YY3 I;  2LJH A;  4DR2 I;  3QT8 A;  3K6Q A;  3J7A M;  2G7H A;  2CZ9 A;  4LF9 I;  4LF4 I;  4TUI A;  1NHJ A;  2Z5B B;  2JVA A;  4DV3 E;  1FJG I;  5LMN E;  2BM0 A;  2Z5E A;  3ADG A;  4B3M I;  4LF8 I;  4JI4 I;  4YHH E;  2VE7 C;  1USU A;  1WHN A;  1N36 I;  2X7I A;  4B3T I;  4LFA I;  4GKK E;  2XEX A;  2DEJ A;  2AJ4 A;  4NXN E;  1N34 E;  4L5N C;  4Z7C A;  1HNX I;  2UUC E;  2UXB E;  4TUG A;  4FWH A;  3QT5 A;  1GZ6 A;  2DSY A;  1T4O A;  1HK7 A;  2V8Q B;  4DUY E;  2VF3 A;  4DV5 I;  3M6A A;  4DV7 E;  1Z0T A;  1MU5 A;  3IWB A;  3RMP A;  3ADI A;  4DV2 E;  3T1H E;  4OX9 I;  2A2C A;  1J26 A;  4P78 A;  2A2D A;  2PNM A;  2V2V A;  4JI0 I;  4MYU A;  2LTR A;  4WSP A;  5BR8 E;  1HNW E;  4WYQ B;  4JI8 E;  3F6H A;  4XTJ A;  4UT4 A;  2JR1 A;  2O1U A;  4GKJ I;  4K0K I;  1N32 I;  3WU4 A;  2L3C A;  1A6F A;  1Z0G A;  1X47 A;  1ZBQ A;  4HY1 A;  4BCA A;  2Z5C B;  1SR9 A;  2HK2 A;  2V2Q A;  2LE2 A;  4F54 A;  3J7Y p;  1YYK A;  4DV0 I;  1ELO A;  2LMZ A;  4X64 E;  1N0U A;  4KZS A;  1XNQ I;  2V8P A;  1X49 A;  2F4V E;  1IBK I;  2B7T A;  4I8O A;  2MC5 A;  4ED4 A;  3B8H A;  1KKH A;  4DU8 A;  4F9A B;  1X48 A;  4I3H A;  4LF5 I;  2NPF A;  4JI7 I;  4DR5 I;  2IHR 1;  2NUG A;  3HTX A;  4DR4 I;  1HR0 I;  3HPZ A;  1EKZ A;  1QU6 A;  4DPX A;  2GS8 A;  4MYT A;  5LMU I;  2M4I A;  4DPW A;  2V87 A;  1ZBT A;  1RQ0 A;  4P7D A;  2UUB I;  4DR6 E;  4FN5 A;  2ZM6 I;  4BMJ A;  1XNR I;  1FWL A;  1T4N A;  3F0N A;  4DUZ E;  4BC9 A;  4B3R I;  2KOU A;  3ZKB A;  2ODR D;  4JG4 A;  1I94 E;  4NXM E;  3HUL A;  4GEQ B;  4JI3 I;  2NUE A;  2L92 A;  1STU A;  2LUP B;  5AE1 A;  2RS6 A;  1UHZ A;  4FW9 A;  1WXR A;  2E5L E;  4FWG A;  2J7K A;  1YZ9 A;  1H74 A;  2VQF I;  1FKA E;  3ADJ A;  1N33 E;  2DEI A;  4LTY A;  3V5R A;  1WUU A;  2V83 A;  3HPS A;  3PYE A;  2EZ6 A;  2HFU A;  3H4L A;  2HHH I;  5AAS A;  2LRS A;  3PYD A;  3JTZ A;  2WW4 A;  2UXD E;  4P7A A;  2Q2E B;  4WFT A;  2M1S A;  5AE3 A;  4ZVI A;  3JAM Q;  4J8Z A;  4YHH I;  4AQY E;  3Q6M A;  4X62 I;  4LF7 E;  4JYA I;  4URL A;  3ZOQ B;  4LF6 E;  4GKK I;  3ZZT A;  4DR3 E;  4R1F A;  2UUC I;  1UEK A;  2UXB I;  2E1M A;  4LF4 E;  4DUY I;  2B3T B;  4LFB I;  3J81 Q;  2LBS B;  4KHP I;  2K4V A;  3ZKD A;  2JY9 A;  4B3M E;  2GQ0 A;  4X65 E;  3LML A;  1UIL A;  2UU9 I;  1N36 E;  4N3O A;  2N3H A;  1DAR A;  4Q28 A;  3HXL A;  4B3T E;  4HYM A;  3ZZ0 A;  4LFA E;  1H73 A;  1Z5B A;  1GQE A;  1Z5C A;  2L3J A;  2BM1 A;  3JAM C;  2EFG A;  2UUA I;  4HAC B;  2NUF A;  3CWV A;  3B78 A;  4JI5 I;  4DMI A;  3H09 A;  1K47 A;  4DV6 I;  1D6T A;  1EA6 A;  1FI4 A;  4JI0 E;  4IZJ D;  3J81 C;  1J5E I;  1MG7 A;  1NHH A;  3DJW A;  1QZR A;  1IBM I;  2M7Q A;  3T1Y I;  2YZT A;  2RSM A;  1FWK A;  1S4E A;  2DB2 A;  1XMQ E;  2HFS A;  4KQV A;  5LL6 R;  2MDR A;  2F4V I;  4PRX A;  3LNU A;  3ZM7 A;  1Z0E A;  1N32 E;  5GMD A;  4WUD A;  4B3S I;  4F9B B;  3P06 A;  3VYX A;  1Y4U A;  2V2Z A;  1IBL I;  4DR7 E;  4DXL A;  4DV0 E;  3AUZ A;  4DR1 I;  1XHK A;  2OI2 A;  1S16 A;  5IWA E;  2UXC I;  1XMO E;  2LUQ A;  1IBK E;  2L8T A;  4X66 E;  2DIX A;  4DV1 E;  3K1J A;  4LF5 E;  5FWK A;  4DR6 I;  1O0W A;  4JI7 E;  4DR5 E;  2IOQ A;  4JI1 I;  3K85 A;  3J7A G;  4DR4 E;  3ADL A;  1HR0 E;  3LLH A;  1HNZ E;  5ADZ A;  1DI2 A;  2HKJ A;  5LMU E;  2FV4 B;  2VQE E;  4DPY A;  1Z0V A;  3D4J A;  4JV5 E;  2UUB E;  2CGE A;  2H36 X;  5GME A;  1RR9 A;  4JI2 I;  2ZM6 E;  1RRE A;  2E1R A;  4WUB A;  5A2Q Q;  4M2Z A;  3LTO A;  2O1T A;  3FIG A;  4LFC I;  1ZXN A;  1YYO A;  4B3R E;  2Z5C A;  3AV0 A;  1NZ0 A;  3OTO I;  3QT7 A;  2V89 A;  4FWD A;  2LTS A;  3PYF A;  4DV4 E;  4JI6 E;  2ZBK B;  4JI3 E;  2JWO A;  4IZJ A;  3PYG A;  2UXD I;  4WPY A;  4DV3 I;  5LMN I;  3QT6 A;  1PIE A;  2RTX A;  1BKN A;  4USK A;  3VK6 A;  2RS7 A;  4LF7 I;  4LF6 I;  4YY3 E;  2HHH E;  4DR2 E;  3WU3 A;  2JOB A;  4NXN I;  4DR3 I;  1ZXM A;  5A2Q C;  2V86 A;  2HK3 A;  1N34 I;  4R03 A;  4LF9 E;  1N0V C;  1FJG E;  4UTG A;  1Z0C A;  4DV7 I;  4USM A;  1DQ3 A;  4LF8 E;  4X65 I;  4JI4 E;  4DV2 I;  3T1H I;  2L33 A;  4X62 E;  3VYY A;  3J80 Q;  4M30 A;  4JYA E;  2O1V A;  5BR8 I;  1HNW I;  2ODR C;  3P1X A;  4PRV A;  4JI8 I;  1ZM4 A;  1HNX E;  2VF1 A;  4IZK A;  2BV3 A;  3K17 A;  4LFB E;  1Z0W A;  4DV5 E;  1MX0 A;  1Z5A A;  1Z59 A;  4KHP E;  1OJ4 A;  2EWL A;  4OX9 E;  3JU0 A;  4OOG C;  4DPT A;  5FLX Q;  2UU9 E;  4X8W A;  3HQ1 A;  5F3W A;  1FNM A;  1RC7 A;  3LPS A;  2V34 A;  2CPN A;  4BC7 A;  2MC6 A;  2ZIT A;  3Q1Q A;  1T4L B;  2F8B A;  4HXZ A;  3GON A;  4X64 I;  2UUA E;  2FGG A;  4GKJ E;  1XMQ I;  1WHQ A;  2KHX A;  3MSW A;  3J80 C;  4M0V A;  3V2U C;  4JI5 E;  4K0K E;  3OML A;  5CFF E;  1H72 C;  2Z5B A;  2NA2 A;  4DV6 E;  2L2N A;  2N3G A;  2L6M A;  4DR7 I;  2PNL A;  2L2K B;  5IT9 Q;  5DNY A;  3B82 A;  1B63 A;  1J5E E;  3DF6 A;  1Y4S A;  1IBM E;  1KIJ A;  5T6J A;  4IZJ B;  3T1Y E;  5FLX C;  4WUC A;  2YT4 A;  5IWA I;  1XNQ E;  2FTX B;  1XMO I;  2B7V A;  1H7S A;  4X66 I;  4DV1 I;  3HJC A;  3Q6N A;  2HKE A;  2V85 A;  1VIS A;  1U2R A;  4B3S E;  2LJP A;  1Y6Z A;  2WZO A;  1IBL E;  1KTV A;  4DUZ I;  4F9C B;  3C4T A;  4L8N A;  1PKP A;  4DR1 E;  3WU5 A;  1I94 I;  4NXM I;  1KVK A;  1HNZ I;  2R42 A;  1ZM9 A;  1Z0B A;  4DPU A;  2JOX A;  2CG9 A;  2KON A;  5AE2 A;  3F6G A;  4LU9 A;  2UXC E;  2VQE I;  5L3J A;  1ZM3 A;  1H7U A;  4JV5 I;  5IT9 C;  1USV A;  3ZZU A;  3WU6 A;  4HAC A;  2E5L I;  3KWR A;  1XNR E;  1N33 I;  4JI1 E;  4BS9 A;  4P52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...