5LMUE

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmuE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuE02
4DKKA 1MX0A 4WFTA 4DV6E 3ADGA 4JI5I 1ZM3A 2LJPA 4LF5I 1XMOI 3J7AG 2NUEA 4DV1I 2UXCE 2L33A 4DR1E 2DEJA 1S16A 2UXBE 2UXDE 1N0VC 1WHNA 1ZM9A 4HACB 4P7AA 3K1JA 1N34E 4GKJI 1STUA 1RREA 2UXCI 2DMYA 2RS7A 1QZRA 2B7TA 5IT9Q 2UXBI 2UXDI 1IBLI 1H73A 4UT4A 1FWKA 2IHR1 3T1YI 3J80Q 1Z0WA 1XNQE 1Z0CA 1N34I 4X65E 3ZZUA 1ELOA 4DXLA 1EA6A 4B3TI 2LTRA 4WUBA 3GONA 1ZBTA 5BR8I 1XNQI 4X65I 2UUAI 2RS6A 5IWAI 2NUGA 4M2ZA 3CWVA 4B3SE 3PYEA 4DPXA 3JAMQ 4HY1A 1FJGE 4P52A 2HHHI 5LMUE 4X66E 1UEKA 4DPTA 3ZM7A 3PYGA 1ZM2A 4DPYA 4JYAE 1FWLA 3J81Q 4LF9I 1Z0GA 4KHPE 2HK2A 4DV0E 1BKNA 4MYTA 4X64E 5FLXQ 3WU3A 4B3SI 1FJGI 5A2QC 5LMUI 1X48A 4DUZE 4X62E 1EI1A 4LF6E 2ZBKB 4JI1I 2L2KB 1J26A 4JYAI 4NXNE 4DR5E 1UHZA 3QT5A 1QU6A 1YYOA 2LRSA 2B7VA 4LF7E 4LF4E 1KTVA 3LPSA 4WUCA 2UU9I 3V5RA 4DV4I 4DR3I 4DU8A 4DUYI 1D6TA 1NHHA 4LF6I 4JI4I 2DEIA 4GKKE 4ZVIA 4NXNI 4JI2I 4MYUA 2V2ZA 4UTGA 4DR5I 4LF4I 4AQYE 3PYDA 2HFSA 4YY3E 4DR2E 2L3CA 1XNRI 2UUBE 1Z5CA 4GKKI 4FWDA 3LNUA 3ADJA 1X49A 1Z0VA 1T4LB 2OI2A 4DV5E 4AQYI 4OOGC 1XMOE 4DR2I 2ZITA 1N32E 1YYKA 2UUBI 2EZ6A 3T1HE 1PKPA 2L2MA 2N3HA 4DV5I 1ZXMA 1HR0I 1OJ4A 4GKJE 1WHQA 1N32I 1XHKA 4R1FA 4LFAE 2HK3A 1IBLE 2NPFA 2E1RA 3T1HI 4JI7E 1B63A 3T1YE 4JI0E 4LF8E 1GQEA 3ZZTA 4LFBE 1HNXE 1FNMA 3WU6A 4YHHE 3B8HA 3D4JA 4LFAI 4B3TE 4JI7I 4JI0I 4M30A 4LF8I 4JI8E 5BR8E 4B3ME 2AJ4A 1UILA 2V2VA 4NXME 1IBKE 2VQFE 2UUAE 1H74A 4DPWA 4LFBI 5CFFE 5IT9C 1HNXI 4DR7E 4ED4A 5IWAE 4YHHI 3QT8A 3J80C 2E5LI 1T4OA 4URLA 3Q1QA 2X36A 3B78A 2HHHE 4HYMA 4JI8I 3LLHA 4B3MI 1NHIA 2ZM6I 2DIXA 1O0WA 4LF9E 4NXMI 3J7Yp 2VQFI 1IBKI 4DR7I 3HTXA 4RPFA 1RQ0A 4Z7YA 4EMDA 5LMNE 2BM1A 1ZM4A 1H7SA 3ZKBA 4JI1E 2J7KA 1VISA 3JAMC 4JI6I 1KVKA 4JI3I 3OTOE 3QT6A 2R3VA 2UUCE 2UU9E 2VQEE 4DV2E 1B62A 3J81C 4DV4E 2EFGA 4DR3E 5LMNI 4DUYE 4PRXA 4JI4E 4M1KA 4FN5A 1MG7A 5FLXC 4JI2E 4DR4E 1K47A 4I3HA 2BM0A 4LFCI 3OTOI 2UUCI 4FW9A 2VQEI 4DV2I 2YT4A 1XNRE 2LJHA 4DU7A 1A6FA 4Z7CA 4DR4I 3B82A 3H4LA 2HFUA 2MDRA 3ADLA 3PYFA 1N33E 4DR6E 4PRVA 4X8WA 3K17A 3ZZ0A 3J7AM 1HR0E 1XMQI 2F4VI 4DV3E 4OX9E 4USMA 1PIEA 1Z0BA 5GMEA 4FWHA 1N33I 4DR6I 2KHXA 1EKZA 1YYWA 4DV7E 3P1XA 1N36E 4DV3I 2HKEA 4OX9I 4PU9A 1KIJA 3M6AA 2L3JA 2JVAA 3LTOA 2XEXA 1NZ0A 4DV7I 1N36I 2E5LE 2A2CA 1Z0EA 1NHJA 1HNZI 1Z0TA 1Z5AA 2ZM6E 1FI4A 4DV6I 3ADIA 1I94E 1S4EA 1DARA 1WUUA 2GS8A 1ZXNA 4DR1I 2Q2EB 2N3GA 1Z5BA 4JI6E 1I94I 2L2NA 4JI3E 5GMDA 4XTJA 4KQVA 4B3RE 2LUPB 1KKHA 4WUDA 3VYYA 1U2RA 2V34A 1RR9A 3WU5A 1H72C 2V8PA 4LFCE 2CPNA 3VYXA 3HULA 2A2DA 4JV5E 4B3RI 2WW4A 5LL6R 2X7IA 4K0KE 2JY9A 4FWGA 1H7UA 4HACA 1N0UA 1IBME 2NA2A 2HKJA 1Z59A 4HXZA 5A2QQ 1PVGA 4JV5I 3QT7A 1J5EE 3ZKDA 4K0KI 4USKA 2NUFA 1IBMI 4X66I 4JG4A 2V2QA 1T4NA 4KHPI 3C4TA 1XMQE 1MU5A 4DV0I 1J5EI 1RC7A 2F4VE 4X64I 1FKAE 3C4BA 2B3TB 2CZ9A 4DUZI 4X62I 1X47A 3WU4A 3F0NA 2RSMA 1DI2A 2LUQA 2LBSB 1YZ9A 2VF3A 4DPUA 4LF7I 2DB2A 4WYQB 1HNWE 2RTXA 2R42A 5L3JA 2BV3A 4JI5E 1HNWI 3V2UC 2LTSA 4LF5E 4YY3I 4DV1E 1HNZE
chains in the Genus database with same CATH superfamily
4DKKA 1MX0A 1SFEA 3VK6A 2JXPA 2EQ1A 4IFDC 4OO1C 2EOJA 3UK3C 4WFTA 4DV6E 1UDSA 4O24A 3ADGA 2BA1D 2H36X 4JI5I 2ELZA 1ZM3A 2LJPA 2YRKA 4BC9A 1EH6A 4WSPA 4LF5I 1XMOI 1PDAA 3J7AG 2NUEA 2GLIA 2VE7C 2UXCE 2L33A 2LJUA 2EMYA 4WXCA 3CDJA 4DV1I 4DR1E 1YH8A 4IFDD 1YUJA 2DEJA 4OO1D 3PS3A 1S16A 3BBGA 2UXBE 2UXDE 4LTYA 4MLQA 1KJKA 1N0VC 4IFDF 1WHNA 4OO1F 1T39A 1A1HA 1UDOA 1ZM9A 4HACB 4P7AA 3K1JA 1N34E 4O43A 2V89A 2YU8A 2Z5EA 1N3GA 1STUA 1RREA 3Q6MA 4GKJI 2UXCI 2EL6A 1Z1BA 2DMYA 1PJQA 2GPIA 2RS7A 1QZRA 2B7TA 5IT9Q 4ZYHA 2UXBI 2UXDI 1IBLI 2O1VA 1H73A 4UT4A 3GLLA 1FWKA 2FTXB 2R1FA 2IHR1 2C38A 2Z5CB 3J80Q 3T1YI 1Z0WA 1XNQE 1Z0CA 1N34I 3HPZA 4X65E 2CT1A 2YTNA 3ZZUA 2PO1B 1ELOA 4ZYGA 5KL3A 2YTOA 4IFDA 2EPCA 4OO1A 4BA2B 4KZSA 2L8TA 2LMZA 2EMCA 5DRPA 4DXLA 1R6LA 1EA6A 1G2DC 2EM5A 4B3TI 4NHRA 4F9CB 5A6JA 2I13A 2RQLA 2LTRA 3B4TA 2EPLX 1E3HA 1PJSA 1ZBTA 3GONA 4WUBA 5BR8I 5KL2A 4F6MA 1XNQI 2EPAA 2B9DA 1YFHA 4X65I 2UUAI 2RS6A 3PRYA 5IWAI 1TF6A 2NUGA 4M2ZA 3CWVA 2F8BA 4B3SE 3PYEA 4IZKA 4DPXA 3JAMQ 4HY1A 2KONA 2YTGA 1FJGE 2JEBB 4P52A 2HHHI 5LMUE 4X66E 1UEKA 4DPTA 3ZM7A 2FGGA 3F6HA 3PYGA 1ZM2A 4DPYA 4JYAE 1FWLA 2EOFA 4R2CA 3J81Q 4LF9I 1Z0GA 4KHPE 2EL5A 2YTPA 2EE8A 2YTJA 2HK2A 2WP8B 4MQYA 2EOMA 1EH8A 4DV0E 1BKNA 1ZBQA 2PO0A 4X64E 4MYTA 5FLXQ 3WU3A 4B3SI 5EKWA 3DF6A 5A2QC 1FJGI 5LMUI 2EPOA 1X48A 4DUZE 4X62E 1EI1A 3QG5C 4LF6E 2PO2B 2A25A 5T6JA 2HGHA 2ZBKB 2L2KB 4JI1I 1J26A 4JYAI 4NXNE 2EN4A 2J7JA 1XXEA 4DR5E 1UHZA 2EN1A 2PNLA 3QT5A 1QU6A 1YYOA 2LRSA 2B7VA 3KWRA 3F6GA 2EPNA 4LF7E 3P76A 3WU6A 4LF4E 1KTVA 3LPSA 4WUCA 2UU9I 4NZVA 4TUGA 1Y4SA 3V5RA 4DV4I 3VHTB 4DU8A 1WJPA 4DR3I 4DUYI 4R2EA 1D6TA 1NHHA 4IJDA 4LF6I 4JI4I 2DEIA 1LLMC 1RHYA 4MU4A 4GKKE 2EM0A 4ZVIA 4NXNI 2EMAA 2EMZA 2YU5A 4MYUA 4JI2I 2JT2A 3TQMA 2V2ZA 1GZ6A 4UTGA 4DR5I 2F1DA 4IS1C 2JEAA 2EN7A 4LF4I 2EM4A 4AQYE 3PYDA 4P78A 5AC5A 2HFSA 4YY3E 4DR2E 2EMFA 2KOUA 2LV2A 3DJWA 2L3CA 1XNRI 3BF2A 2GHFA 2UUBE 2MDGA 1Z5CA 2O1WA 4GKKI 4FWDA 3LNUA 2DSYA 3ADJA 3M99B 4ISAA 2EPZA 1X49A 1Z0VA 1T4LB 1P47A 2ENHA 2OI2A 4IZJA 4DV5E 2C38B 2DLQA 2YTIA 4AQYI 4WX9A 4OOGC 5EL9A 1XMOE 4DR2I 2EP3A 4GEQB 2ZITA 1N32E 1JK1A 1YYKA 2PRTA 2UUBI 2EZ6A 2JOXA 1YPNA 4IFDB 4OO1B 4HEIA 2L6MA 3M7ND 3T1HE 3LMLA 1PKPA 5DNLA 4FW5A 2VESA 2EOXA 5JEAC 3EPKA 2L2MA 2N3HA 2EN6A 2CSHA 3EQ1A 4DV5I 1IQOA 1ZXMA 1HR0I 5ELWA 1OJ4A 2EQ3A 2DMIA 4GKJE 5C0XE 1WHQA 2JP9A 2NN6C 1A1IA 1N32I 4ZYEA 1XHKA 2LT7A 4R1FA 4LFBI 2VRDA 4LFAE 4U3DA 4FW7A 2YPNA 2HK3A 1IBLE 2NPFA 3IWCA 2E1RA 4R2SA 4JI7E 1B63A 2IERA 4IZKB 5JEAD 3T1YE 4JI0E 2FV4B 4LF8E 2DRPA 1GQEA 2PNZA 3ZZTA 3T1HI 2I9IA 5KL7A 1R6MA 5JEAE 4LFBE 1HNXE 1FNMA 2NN6D 1BBGA 3JTZA 3MHHC 3HQ1A 2HJJA 4YHHE 1E3PA 2ENAA 2MC6A 3B8HA 3D4JA 2EORA 3GMEA 2NN6E 2J65A 2PO0B 2L92A 4LFAI 4J8ZA 3CDIA 1UDNA 2EPRA 1X6HA 4B3TE 5A69A 4JI7I 4JI0I 4M30A 4BHBA 1F2IG 4LF8I 3ZOQB 4JI8E 5BR8E 4B3ME 2AJ4A 1UILA 2V2VA 4NXME 4FW3A 1IBKE 2VQFE 2RPCA 2UUAE 1H74A 2WNRA 4DPWA 5CFFE 1BB8A 5IT9C 1HNXI 4DR7E 2EM9A 2YWQA 4ED4A 4F2JC 1ZR9A 5IWAE 2WBSA 1IQSA 4YHHI 3QT8A 4F9BB 3J80C 4BA1A 4Q35B 2E5LI 1T4OA 2BBGA 4OZEA 2EQ0A 2EN3A 2M1SA 4URLA 2NABA 3Q1QA 2X36A 3B78A 2HHHE 5JEAA 2V83A 4HYMA 1WRJA 2WZOA 3C6KA 4ZYDA 2K7IA 3LLHA 2V85A 3IWDA 1NHIA 4JI8I 2DIXA 1O0WA 4LF9E 2ZM6I 3J7Yp 4MU3A 2VQFI 1IBKI 4NXMI 5AE1A 2NN6A 2YSOA 2LO3A 5DNXA 4DR7I 4M0VA 3HTXA 4RPFA 1RQ0A 4BCAA 4BHCA 1A1JA 4LPFA 4Z7YA 4EMDA 2EM3A 1USVA 3PS2A 4FW4A 2JEAB 1BBOA 4Q28A 5LMNE 2BM1A 1PJTA 1ZM4A 5A6BA 2JR1A 5KL5A 1H7SA 3ZKBA 1JK2A 4JI1E 4AIMA 2J7KA 2E1MA 4F54A 2Q8UA 1VISA 3JAMC 1USUA 4AM3A 4JI6I 2N8XA 3HXLA 1KVKA 4JI3I 3OTOE 3QT6A 2R3VA 2UUCE 4LU9A 2UU9E 4FW6A 2VQEE 4DV2E 3J81C 2E72A 4DV4E 1B62A 2EFGA 4IZJB 4OKGA 4DR3E 5LMNI 4DUYE 2GO3A 4PRXA 4JI4E 4M1KA 4FN5A 1NEIA 1MG7A 5FLXC 4DMIA 4JI2E 4X9JA 1OYPA 4DR4E 1K47A 4I3HA 2M4IA 2BM0A 4NBQA 4LFCI 2R76A 3EPLA 2C37A 3OTOI 3P3CA 2UUCI 4FW9A 4IZJD 2VQEI 4DV2I 3K6QA 4BBYA 4N4RB 2YT4A 1XNRE 4KWYA 2EL4A 2LJHA 4DU7A 5K36E 1A6FA 1NCSA 1Y5YA 4Z7CA 4DR4I 4N3OA 5ADZA 3B82A 3M7NG 3H4LA 5DNYA 2EMIA 3U1KA 2PNZB 2D9HA 1QNTA 4F6NA 3BIDA 2HFUA 2WCC3 2EN8A 2MDRA 3ADLA 2LCEA 2EMWA 2CGEA 3PYFA 1YHCA 2EM8A 1N33E 4DR6E 4I8OA 4R2DA 4WPYA 2M7QA 4PRVA 4B3MI 1AAYA 2IESA 3FIGA 4X8WA 3K17A 3KZZA 5C0XC 3MSWA 2AE8A 3BGHA 3ZZ0A 5K36A 4BC7A 1HR0E 3J7AM 4TUIA 3EPJA 1XMQI 2WNRB 2F4VI 2V86A 4O5GA 1UDQA 4DV3E 4OX9E 3THOB 2MKDA 3HJCA 4USMA 4QNKA 2YTFA 1PIEA 1Y4UA 1ZAAC 1Z0BA 5GMEA 4BA1B 4FWHA 2BR2A 1N33I 2YRMA 4DR6I 1RMDA 4GZNC 2KHXA 5JEAB 2HC5A 5C0XD 4RHBB 1EKZA 2EOOA 1YYWA 2Z5BA 4LCHA 4DV7E 2GO4A 3P1XA 1N36E 1T38A 5F3WA 5C0XF 2EPPA 4AIDA 2NN6B 4DV3I 2HKEA 4OX9I 4PU9A 5AC4A 3IWBA 2DLKA 1KIJA 3M6AA 2BB8A 2L3JA 3L7ZA 2JVAA 5AASA 5AE2A 3H1CA 2XEXA 3LTOA 2CG9A 2ELYA 5JEAF 1NZ0A 2BA0D 2EM2A 4DV7I 4R03A 1N36I 2EOEA 2EJ4A 2M9AA 2EMGA 3UHMA 2E5LE 3M85D 2A2CA 2VF1A 2NN6F 1SR9A 1Z0EA 1Y6ZA 1YSAC 1OYSA 1B69A 1MGTA 1NHJA 4U3BA 3U1YA 1HNZI 2EMKA 4P7DA 5A6BD 1EH7A 5C0XA 1Z0TA 3GCMA 2YTQA 4HTGA 2MKNA 1Z5AA 5DRQA 5IV8B 2ZM6E 2G7HA 1MEYC 2EOYA 1FI4A 2O3ZA 4DV6I 4IFDE 3ADIA 4R8OA 2DGCA 4OO1E 4BMJA 1I94E 1ZU1A 2EM7A 4GQUA 2EOHA 1YUIA 1S4EA 3AV0A 1DARA 2YSPA 1WUUA 2C37B 1HK7A 1TF3A 2GS8A 2IOQA 2PNMA 1ZXNA 2C39A 2O1UA 2JWOA 3PS1A 3KZYA 4M9VC 3DD6A 5FWKA 2JPAA 5KL4A 1IMUA 4DR1I 2Q2EB 3OMLA 2JYAA 3KRNA 2EOZA 2N3GA 2EMXA 1Z5BA 2JE6A 4JI6E 4L8NA 1I94I 2L2NA 1X3CA 4JI3E 5GMDA 4XTJA 4KQVA 4B3RE 2MC5A 2YZTA 2CVEA 1A1LA 2LUPB 2GQ0A 4O4KA 1KKHA 4R2AA 4WUDA 3VYYA 1U2RA 1DQ3A 2V34A 1RR9A 2EPMX 4BS9A 3WU5A 1P42A 5TSEA 2LVHA 1H72C 5KL6A 1VI7A 2V8PA 4LFCE 2CPNA 3C6MA 3VYXA 2EPUA 4F9AB 3HULA 2A2DA 4R2RA 4JV5E 4B3RI 2WW4A 2YTEA 5LL6R 2X7IA 4K0KE 2EM6A 2JY9A 4LCFA 5K36C 4MLVA 1A1FA 5K36B 2WBUA 1Y60A 4FWGA 2RSIA 1H7UA 4L5NC 4HACA 2EOIA 1N0UA 1IBME 2NA2A 2ODRC 4R2PA 5DROA 2ADRA 3P06A 2BR2B 3EPHA 2HKJA 2EMBA 1Z59A 3HKMA 4HXZA 1PVGA 5A2QQ 3QT7A 4JV5I 2EMLA 2LE2A 2EWLA 2EOSA 1A1KA 2EOQA 2Z5BB 3K85A 1J5EE 5K36D 3P3GA 3ZKDA 2YTDA 4K0KI 3H09A 3THNA 2V88A 5K36F 4USKA 2Z5CA 1X6FA 2EMHA 1UBDC 2ODRD 2NUFA 1IBMI 4X66I 5IXMB 4LOMA 1X5WA 2V2QA 3L7ZB 1T4NA 4JG4A 2PO1A 4RH8A 5A6KA 2EPXA 4KHPI 3C4TA 4MU1A 2O1TA 1XMQE 5DRRA 1MU5A 4DV0I 1J5EI 4BA2A 2EN2A 1RC7A 2F4VE 4X64I 2ENCA 3AUZA 4J3DA 1FKAE 1AH5A 2WBTA 3C4BA 2B3TB 2CZ9A 4WXDA 4MDTA 4DUZI 4X62I 4WSGA 1X47A 2V87A 3WU4A 3F0NA 4FK5C 1GTKA 1A1GA 1WXRA 2RSMA 1DI2A 5C0XB 2LUQA 2LBSB 2BA0G 3JU0A 3P3EA 1YZ9A 2VF3A 5A6AA 4DPUA 4LF7I 2DB2A 4WYQB 3HPSA 1HNWE 2BA1G 2YRHA 2JEBA 1OYRA 3M85G 2RTXA 3L00A 2EPKX 3Q6NA 1DGCA 1G2FC 4R2QA 2C39B 2R42A 2WP8A 4MU0A 2JOBA 2V8QB 3MHSC 4QNJA 5LLQA 3NZKA 5L3JA 1X6EA 2IOPA 4IS9A 4LCGA 2BV3A 4JI5E 2JE6B 1L4SA 1HNWI 1UN6B 3ECRA 3V2UC 1KYQA 1TN9A 2LTSA 2K4VA 5AE3A 4LF5E 2CTDA 2PO2A 4YY3I 4DV1E 3RMPA 1HNZE
chains in the Genus database with same CATH topology
4DKKA 1MX0A 3VK6A 4WFTA 4DV6E 3ADGA 2H36X 4JI5I 1ZM3A 2LJPA 4BC9A 4WSPA 4LF5I 1XMOI 3J7AG 2NUEA 2VE7C 2UXCE 2L33A 4DV1I 4DR1E 2DEJA 1S16A 2UXBE 2UXDE 4LTYA 1N0VC 1WHNA 1ZM9A 4HACB 4P7AA 3K1JA 1N34E 2V89A 2Z5EA 4GKJI 1STUA 1RREA 3Q6MA 2UXCI 2DMYA 2RS7A 1QZRA 2B7TA 5IT9Q 2UXBI 2UXDI 1IBLI 2O1VA 1H73A 4UT4A 1FWKA 2FTXB 2IHR1 2Z5CB 3J80Q 3T1YI 1Z0WA 1XNQE 1Z0CA 1N34I 3HPZA 4X65E 3ZZUA 1ELOA 4KZSA 2L8TA 2LMZA 4DXLA 1EA6A 4B3TI 4F9CB 2LTRA 4WUBA 3GONA 1ZBTA 5BR8I 1XNQI 2B9DA 4X65I 2UUAI 2RS6A 3PRYA 5IWAI 2NUGA 4M2ZA 3CWVA 2F8BA 4B3SE 3PYEA 4IZKA 4DPXA 3JAMQ 4HY1A 2KONA 1FJGE 4P52A 2HHHI 5LMUE 4X66E 1UEKA 4DPTA 3ZM7A 2FGGA 3F6HA 3PYGA 1ZM2A 4DPYA 4JYAE 1FWLA 3J81Q 4LF9I 1Z0GA 4KHPE 2HK2A 4DV0E 1BKNA 1ZBQA 4MYTA 4X64E 5FLXQ 3WU3A 4B3SI 3DF6A 5A2QC 1FJGI 5LMUI 1X48A 1EI1A 4X62E 4DUZE 4LF6E 5T6JA 2ZBKB 4JI1I 2L2KB 1J26A 4JYAI 4NXNE 4DR5E 1UHZA 3QT5A 2PNLA 1QU6A 1YYOA 2LRSA 2B7VA 3KWRA 3F6GA 4LF7E 4LF4E 1KTVA 3LPSA 4WUCA 2UU9I 1Y4SA 4TUGA 3V5RA 4DV4I 4DR3I 4DU8A 4DUYI 1D6TA 1NHHA 4LF6I 4JI4I 2DEIA 4GKKE 4ZVIA 4NXNI 4JI2I 4MYUA 2V2ZA 1GZ6A 4UTGA 4DR5I 4LF4I 4AQYE 3PYDA 4P78A 2HFSA 4YY3E 4DR2E 2KOUA 3DJWA 2L3CA 1XNRI 2UUBE 1Z5CA 2O1WA 4GKKI 4FWDA 3LNUA 2DSYA 3ADJA 1X49A 1Z0VA 1T4LB 2OI2A 4IZJA 4DV5E 4AQYI 4OOGC 1XMOE 4DR2I 4GEQB 2ZITA 1N32E 1YYKA 2UUBI 2EZ6A 2JOXA 2L6MA 3T1HE 3LMLA 1PKPA 2L2MA 2N3HA 4DV5I 1ZXMA 1HR0I 1OJ4A 4GKJE 1WHQA 1N32I 1XHKA 4R1FA 4LFAE 2HK3A 1IBLE 2NPFA 3IWCA 2E1RA 4IZKB 4JI7E 1B63A 3T1HI 3T1YE 4JI0E 2FV4B 4LF8E 1GQEA 3ZZTA 4LFBE 1HNXE 1FNMA 3WU6A 3JTZA 4YHHE 3HQ1A 2MC6A 3B8HA 3D4JA 4LFAI 2L92A 4J8ZA 4B3TE 4JI7I 4JI0I 4M30A 4LF8I 3ZOQB 4JI8E 5BR8E 4B3ME 2AJ4A 1UILA 2V2VA 4NXME 1IBKE 2VQFE 2UUAE 1H74A 4DPWA 4LFBI 5CFFE 5IT9C 1HNXI 4DR7E 4ED4A 5IWAE 4YHHI 3QT8A 4F9BB 3J80C 2E5LI 1T4OA 2M1SA 4URLA 3Q1QA 2X36A 3B78A 2HHHE 2V83A 4HYMA 2WZOA 4JI8I 3IWDA 2V85A 3LLHA 1NHIA 2ZM6I 2DIXA 1O0WA 4LF9E 4B3MI 3J7Yp 2VQFI 1IBKI 4NXMI 5AE1A 4DR7I 4M0VA 3HTXA 4RPFA 1RQ0A 4BCAA 4Z7YA 4EMDA 1USVA 4Q28A 5LMNE 2BM1A 1ZM4A 2JR1A 1H7SA 3ZKBA 4JI1E 2J7KA 2E1MA 4F54A 1VISA 3JAMC 1USUA 4JI6I 3HXLA 1KVKA 4JI3I 3OTOE 3QT6A 2R3VA 2UUCE 4LU9A 2UU9E 2VQEE 4DV2E 3J81C 1B62A 4DV4E 2EFGA 4IZJB 4DR3E 5LMNI 4DUYE 4PRXA 4JI4E 4M1KA 4FN5A 1MG7A 5FLXC 4DMIA 4JI2E 4DR4E 1K47A 4I3HA 2M4IA 2BM0A 4LFCI 3OTOI 2UUCI 4FW9A 4IZJD 2VQEI 4DV2I 3K6QA 4BBYA 2YT4A 1XNRE 2LJHA 4DU7A 1A6FA 4Z7CA 4DR4I 4N3OA 5ADZA 3B82A 3H4LA 5DNYA 2HFUA 2MDRA 3ADLA 2CGEA 3PYFA 1N33E 4DR6E 4I8OA 4WPYA 2M7QA 4PRVA 3FIGA 4X8WA 3K17A 3MSWA 3ZZ0A 4BC7A 1HR0E 3J7AM 4TUIA 1XMQI 2F4VI 2V86A 4DV3E 4OX9E 3HJCA 4USMA 1PIEA 1Y4UA 1Z0BA 5GMEA 4FWHA 1N33I 4DR6I 2KHXA 1EKZA 1YYWA 2Z5BA 4DV7E 3P1XA 1N36E 5F3WA 4DV3I 2HKEA 4OX9I 4PU9A 3IWBA 1KIJA 3M6AA 2L3JA 2JVAA 5AASA 5AE2A 3LTOA 2XEXA 2CG9A 1NZ0A 4DV7I 4R03A 1N36I 2E5LE 2A2CA 2VF1A 1SR9A 1Z0EA 1Y6ZA 1NHJA 1HNZI 4P7DA 1Z0TA 1Z5AA 2ZM6E 2G7HA 1FI4A 4DV6I 3ADIA 4R8OA 4BMJA 1I94E 1S4EA 3AV0A 1DARA 2IOQA 1WUUA 2PNMA 1HK7A 2GS8A 1ZXNA 2O1UA 2JWOA 5FWKA 4DR1I 2Q2EB 3OMLA 2N3GA 1Z5BA 4JI6E 4L8NA 1I94I 2L2NA 4JI3E 5GMDA 4XTJA 4KQVA 4B3RE 2MC5A 2YZTA 2LUPB 2GQ0A 1KKHA 4WUDA 3VYYA 1U2RA 1DQ3A 2V34A 1RR9A 4BS9A 3WU5A 1H72C 2V8PA 4LFCE 2CPNA 3VYXA 4F9AB 3HULA 2A2DA 4JV5E 4B3RI 2WW4A 5LL6R 2X7IA 4K0KE 2JY9A 4FWGA 1H7UA 4L5NC 4HACA 1N0UA 1IBME 2NA2A 2ODRC 3P06A 2HKJA 1Z59A 4HXZA 5A2QQ 1PVGA 4JV5I 3QT7A 2LE2A 2EWLA 2Z5BB 3K85A 1J5EE 3ZKDA 4K0KI 3H09A 2V88A 4USKA 2Z5CA 2ODRD 2NUFA 1IBMI 4X66I 4JG4A 2V2QA 1T4NA 4KHPI 3C4TA 2O1TA 1XMQE 1MU5A 4DV0I 1J5EI 1RC7A 2F4VE 4X64I 3AUZA 1FKAE 3C4BA 2B3TB 2CZ9A 4DUZI 4X62I 1X47A 2V87A 3WU4A 3F0NA 1WXRA 2RSMA 1DI2A 2LUQA 2LBSB 3JU0A 1YZ9A 2VF3A 4DPUA 4LF7I 2DB2A 4WYQB 3HPSA 1HNWE 2RTXA 3Q6NA 2R42A 2JOBA 2V8QB 5L3JA 2IOPA 2BV3A 4JI5E 1HNWI 3V2UC 2LTSA 2K4VA 5AE3A 4LF5E 4YY3I 4DV1E 3RMPA 1HNZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKK A;  1MX0 A;  4WFT A;  4DV6 E;  3ADG A;  4JI5 I;  1ZM3 A;  2LJP A;  4LF5 I;  1XMO I;  3J7A G;  2NUE A;  4DV1 I;  2UXC E;  2L33 A;  4DR1 E;  2DEJ A;  1S16 A;  2UXB E;  2UXD E;  1N0V C;  1WHN A;  1ZM9 A;  4HAC B;  4P7A A;  3K1J A;  1N34 E;  4GKJ I;  1STU A;  1RRE A;  2UXC I;  2DMY A;  2RS7 A;  1QZR A;  2B7T A;  5IT9 Q;  2UXB I;  2UXD I;  1IBL I;  1H73 A;  4UT4 A;  1FWK A;  2IHR 1;  3T1Y I;  3J80 Q;  1Z0W A;  1XNQ E;  1Z0C A;  1N34 I;  4X65 E;  3ZZU A;  1ELO A;  4DXL A;  1EA6 A;  4B3T I;  2LTR A;  4WUB A;  3GON A;  1ZBT A;  5BR8 I;  1XNQ I;  4X65 I;  2UUA I;  2RS6 A;  5IWA I;  2NUG A;  4M2Z A;  3CWV A;  4B3S E;  3PYE A;  4DPX A;  3JAM Q;  4HY1 A;  1FJG E;  4P52 A;  2HHH I;  5LMU E;  4X66 E;  1UEK A;  4DPT A;  3ZM7 A;  3PYG A;  1ZM2 A;  4DPY A;  4JYA E;  1FWL A;  3J81 Q;  4LF9 I;  1Z0G A;  4KHP E;  2HK2 A;  4DV0 E;  1BKN A;  4MYT A;  4X64 E;  5FLX Q;  3WU3 A;  4B3S I;  1FJG I;  5A2Q C;  5LMU I;  1X48 A;  4DUZ E;  4X62 E;  1EI1 A;  4LF6 E;  2ZBK B;  4JI1 I;  2L2K B;  1J26 A;  4JYA I;  4NXN E;  4DR5 E;  1UHZ A;  3QT5 A;  1QU6 A;  1YYO A;  2LRS A;  2B7V A;  4LF7 E;  4LF4 E;  1KTV A;  3LPS A;  4WUC A;  2UU9 I;  3V5R A;  4DV4 I;  4DR3 I;  4DU8 A;  4DUY I;  1D6T A;  1NHH A;  4LF6 I;  4JI4 I;  2DEI A;  4GKK E;  4ZVI A;  4NXN I;  4JI2 I;  4MYU A;  2V2Z A;  4UTG A;  4DR5 I;  4LF4 I;  4AQY E;  3PYD A;  2HFS A;  4YY3 E;  4DR2 E;  2L3C A;  1XNR I;  2UUB E;  1Z5C A;  4GKK I;  4FWD A;  3LNU A;  3ADJ A;  1X49 A;  1Z0V A;  1T4L B;  2OI2 A;  4DV5 E;  4AQY I;  4OOG C;  1XMO E;  4DR2 I;  2ZIT A;  1N32 E;  1YYK A;  2UUB I;  2EZ6 A;  3T1H E;  1PKP A;  2L2M A;  2N3H A;  4DV5 I;  1ZXM A;  1HR0 I;  1OJ4 A;  4GKJ E;  1WHQ A;  1N32 I;  1XHK A;  4R1F A;  4LFA E;  2HK3 A;  1IBL E;  2NPF A;  2E1R A;  3T1H I;  4JI7 E;  1B63 A;  3T1Y E;  4JI0 E;  4LF8 E;  1GQE A;  3ZZT A;  4LFB E;  1HNX E;  1FNM A;  3WU6 A;  4YHH E;  3B8H A;  3D4J A;  4LFA I;  4B3T E;  4JI7 I;  4JI0 I;  4M30 A;  4LF8 I;  4JI8 E;  5BR8 E;  4B3M E;  2AJ4 A;  1UIL A;  2V2V A;  4NXM E;  1IBK E;  2VQF E;  2UUA E;  1H74 A;  4DPW A;  4LFB I;  5CFF E;  5IT9 C;  1HNX I;  4DR7 E;  4ED4 A;  5IWA E;  4YHH I;  3QT8 A;  3J80 C;  2E5L I;  1T4O A;  4URL A;  3Q1Q A;  2X36 A;  3B78 A;  2HHH E;  4HYM A;  4JI8 I;  3LLH A;  4B3M I;  1NHI A;  2ZM6 I;  2DIX A;  1O0W A;  4LF9 E;  4NXM I;  3J7Y p;  2VQF I;  1IBK I;  4DR7 I;  3HTX A;  4RPF A;  1RQ0 A;  4Z7Y A;  4EMD A;  5LMN E;  2BM1 A;  1ZM4 A;  1H7S A;  3ZKB A;  4JI1 E;  2J7K A;  1VIS A;  3JAM C;  4JI6 I;  1KVK A;  4JI3 I;  3OTO E;  3QT6 A;  2R3V A;  2UUC E;  2UU9 E;  2VQE E;  4DV2 E;  1B62 A;  3J81 C;  4DV4 E;  2EFG A;  4DR3 E;  5LMN I;  4DUY E;  4PRX A;  4JI4 E;  4M1K A;  4FN5 A;  1MG7 A;  5FLX C;  4JI2 E;  4DR4 E;  1K47 A;  4I3H A;  2BM0 A;  4LFC I;  3OTO I;  2UUC I;  4FW9 A;  2VQE I;  4DV2 I;  2YT4 A;  1XNR E;  2LJH A;  4DU7 A;  1A6F A;  4Z7C A;  4DR4 I;  3B82 A;  3H4L A;  2HFU A;  2MDR A;  3ADL A;  3PYF A;  1N33 E;  4DR6 E;  4PRV A;  4X8W A;  3K17 A;  3ZZ0 A;  3J7A M;  1HR0 E;  1XMQ I;  2F4V I;  4DV3 E;  4OX9 E;  4USM A;  1PIE A;  1Z0B A;  5GME A;  4FWH A;  1N33 I;  4DR6 I;  2KHX A;  1EKZ A;  1YYW A;  4DV7 E;  3P1X A;  1N36 E;  4DV3 I;  2HKE A;  4OX9 I;  4PU9 A;  1KIJ A;  3M6A A;  2L3J A;  2JVA A;  3LTO A;  2XEX A;  1NZ0 A;  4DV7 I;  1N36 I;  2E5L E;  2A2C A;  1Z0E A;  1NHJ A;  1HNZ I;  1Z0T A;  1Z5A A;  2ZM6 E;  1FI4 A;  4DV6 I;  3ADI A;  1I94 E;  1S4E A;  1DAR A;  1WUU A;  2GS8 A;  1ZXN A;  4DR1 I;  2Q2E B;  2N3G A;  1Z5B A;  4JI6 E;  1I94 I;  2L2N A;  4JI3 E;  5GMD A;  4XTJ A;  4KQV A;  4B3R E;  2LUP B;  1KKH A;  4WUD A;  3VYY A;  1U2R A;  2V34 A;  1RR9 A;  3WU5 A;  1H72 C;  2V8P A;  4LFC E;  2CPN A;  3VYX A;  3HUL A;  2A2D A;  4JV5 E;  4B3R I;  2WW4 A;  5LL6 R;  2X7I A;  4K0K E;  2JY9 A;  4FWG A;  1H7U A;  4HAC A;  1N0U A;  1IBM E;  2NA2 A;  2HKJ A;  1Z59 A;  4HXZ A;  5A2Q Q;  1PVG A;  4JV5 I;  3QT7 A;  1J5E E;  3ZKD A;  4K0K I;  4USK A;  2NUF A;  1IBM I;  4X66 I;  4JG4 A;  2V2Q A;  1T4N A;  4KHP I;  3C4T A;  1XMQ E;  1MU5 A;  4DV0 I;  1J5E I;  1RC7 A;  2F4V E;  4X64 I;  1FKA E;  3C4B A;  2B3T B;  2CZ9 A;  4DUZ I;  4X62 I;  1X47 A;  3WU4 A;  3F0N A;  2RSM A;  1DI2 A;  2LUQ A;  2LBS B;  1YZ9 A;  2VF3 A;  4DPU A;  4LF7 I;  2DB2 A;  4WYQ B;  1HNW E;  2RTX A;  2R42 A;  5L3J A;  2BV3 A;  4JI5 E;  1HNW I;  3V2U C;  2LTS A;  4LF5 E;  4YY3 I;  4DV1 E;  1HNZ E; 
#chains in the Genus database with same CATH topology
 4DKK A;  1MX0 A;  1SFE A;  3VK6 A;  2JXP A;  2EQ1 A;  4IFD C;  4OO1 C;  2EOJ A;  3UK3 C;  4WFT A;  4DV6 E;  1UDS A;  4O24 A;  3ADG A;  2BA1 D;  2H36 X;  4JI5 I;  2ELZ A;  1ZM3 A;  2LJP A;  2YRK A;  4BC9 A;  1EH6 A;  4WSP A;  4LF5 I;  1XMO I;  1PDA A;  3J7A G;  2NUE A;  2GLI A;  2VE7 C;  2UXC E;  2L33 A;  2LJU A;  2EMY A;  4WXC A;  3CDJ A;  4DV1 I;  4DR1 E;  1YH8 A;  4IFD D;  1YUJ A;  2DEJ A;  4OO1 D;  3PS3 A;  1S16 A;  3BBG A;  2UXB E;  2UXD E;  4LTY A;  4MLQ A;  1KJK A;  1N0V C;  4IFD F;  1WHN A;  4OO1 F;  1T39 A;  1A1H A;  1UDO A;  1ZM9 A;  4HAC B;  4P7A A;  3K1J A;  1N34 E;  4O43 A;  2V89 A;  2YU8 A;  2Z5E A;  1N3G A;  1STU A;  1RRE A;  3Q6M A;  4GKJ I;  2UXC I;  2EL6 A;  1Z1B A;  2DMY A;  1PJQ A;  2GPI A;  2RS7 A;  1QZR A;  2B7T A;  5IT9 Q;  4ZYH A;  2UXB I;  2UXD I;  1IBL I;  2O1V A;  1H73 A;  4UT4 A;  3GLL A;  1FWK A;  2FTX B;  2R1F A;  2IHR 1;  2C38 A;  2Z5C B;  3J80 Q;  3T1Y I;  1Z0W A;  1XNQ E;  1Z0C A;  1N34 I;  3HPZ A;  4X65 E;  2CT1 A;  2YTN A;  3ZZU A;  2PO1 B;  1ELO A;  4ZYG A;  5KL3 A;  2YTO A;  4IFD A;  2EPC A;  4OO1 A;  4BA2 B;  4KZS A;  2L8T A;  2LMZ A;  2EMC A;  5DRP A;  4DXL A;  1R6L A;  1EA6 A;  1G2D C;  2EM5 A;  4B3T I;  4NHR A;  4F9C B;  5A6J A;  2I13 A;  2RQL A;  2LTR A;  3B4T A;  2EPL X;  1E3H A;  1PJS A;  1ZBT A;  3GON A;  4WUB A;  5BR8 I;  5KL2 A;  4F6M A;  1XNQ I;  2EPA A;  2B9D A;  1YFH A;  4X65 I;  2UUA I;  2RS6 A;  3PRY A;  5IWA I;  1TF6 A;  2NUG A;  4M2Z A;  3CWV A;  2F8B A;  4B3S E;  3PYE A;  4IZK A;  4DPX A;  3JAM Q;  4HY1 A;  2KON A;  2YTG A;  1FJG E;  2JEB B;  4P52 A;  2HHH I;  5LMU E;  4X66 E;  1UEK A;  4DPT A;  3ZM7 A;  2FGG A;  3F6H A;  3PYG A;  1ZM2 A;  4DPY A;  4JYA E;  1FWL A;  2EOF A;  4R2C A;  3J81 Q;  4LF9 I;  1Z0G A;  4KHP E;  2EL5 A;  2YTP A;  2EE8 A;  2YTJ A;  2HK2 A;  2WP8 B;  4MQY A;  2EOM A;  1EH8 A;  4DV0 E;  1BKN A;  1ZBQ A;  2PO0 A;  4X64 E;  4MYT A;  5FLX Q;  3WU3 A;  4B3S I;  5EKW A;  3DF6 A;  5A2Q C;  1FJG I;  5LMU I;  2EPO A;  1X48 A;  4DUZ E;  4X62 E;  1EI1 A;  3QG5 C;  4LF6 E;  2PO2 B;  2A25 A;  5T6J A;  2HGH A;  2ZBK B;  2L2K B;  4JI1 I;  1J26 A;  4JYA I;  4NXN E;  2EN4 A;  2J7J A;  1XXE A;  4DR5 E;  1UHZ A;  2EN1 A;  2PNL A;  3QT5 A;  1QU6 A;  1YYO A;  2LRS A;  2B7V A;  3KWR A;  3F6G A;  2EPN A;  4LF7 E;  3P76 A;  3WU6 A;  4LF4 E;  1KTV A;  3LPS A;  4WUC A;  2UU9 I;  4NZV A;  4TUG A;  1Y4S A;  3V5R A;  4DV4 I;  3VHT B;  4DU8 A;  1WJP A;  4DR3 I;  4DUY I;  4R2E A;  1D6T A;  1NHH A;  4IJD A;  4LF6 I;  4JI4 I;  2DEI A;  1LLM C;  1RHY A;  4MU4 A;  4GKK E;  2EM0 A;  4ZVI A;  4NXN I;  2EMA A;  2EMZ A;  2YU5 A;  4MYU A;  4JI2 I;  2JT2 A;  3TQM A;  2V2Z A;  1GZ6 A;  4UTG A;  4DR5 I;  2F1D A;  4IS1 C;  2JEA A;  2EN7 A;  4LF4 I;  2EM4 A;  4AQY E;  3PYD A;  4P78 A;  5AC5 A;  2HFS A;  4YY3 E;  4DR2 E;  2EMF A;  2KOU A;  2LV2 A;  3DJW A;  2L3C A;  1XNR I;  3BF2 A;  2GHF A;  2UUB E;  2MDG A;  1Z5C A;  2O1W A;  4GKK I;  4FWD A;  3LNU A;  2DSY A;  3ADJ A;  3M99 B;  4ISA A;  2EPZ A;  1X49 A;  1Z0V A;  1T4L B;  1P47 A;  2ENH A;  2OI2 A;  4IZJ A;  4DV5 E;  2C38 B;  2DLQ A;  2YTI A;  4AQY I;  4WX9 A;  4OOG C;  5EL9 A;  1XMO E;  4DR2 I;  2EP3 A;  4GEQ B;  2ZIT A;  1N32 E;  1JK1 A;  1YYK A;  2PRT A;  2UUB I;  2EZ6 A;  2JOX A;  1YPN A;  4IFD B;  4OO1 B;  4HEI A;  2L6M A;  3M7N D;  3T1H E;  3LML A;  1PKP A;  5DNL A;  4FW5 A;  2VES A;  2EOX A;  5JEA C;  3EPK A;  2L2M A;  2N3H A;  2EN6 A;  2CSH A;  3EQ1 A;  4DV5 I;  1IQO A;  1ZXM A;  1HR0 I;  5ELW A;  1OJ4 A;  2EQ3 A;  2DMI A;  4GKJ E;  5C0X E;  1WHQ A;  2JP9 A;  2NN6 C;  1A1I A;  1N32 I;  4ZYE A;  1XHK A;  2LT7 A;  4R1F A;  4LFB I;  2VRD A;  4LFA E;  4U3D A;  4FW7 A;  2YPN A;  2HK3 A;  1IBL E;  2NPF A;  3IWC A;  2E1R A;  4R2S A;  4JI7 E;  1B63 A;  2IER A;  4IZK B;  5JEA D;  3T1Y E;  4JI0 E;  2FV4 B;  4LF8 E;  2DRP A;  1GQE A;  2PNZ A;  3ZZT A;  3T1H I;  2I9I A;  5KL7 A;  1R6M A;  5JEA E;  4LFB E;  1HNX E;  1FNM A;  2NN6 D;  1BBG A;  3JTZ A;  3MHH C;  3HQ1 A;  2HJJ A;  4YHH E;  1E3P A;  2ENA A;  2MC6 A;  3B8H A;  3D4J A;  2EOR A;  3GME A;  2NN6 E;  2J65 A;  2PO0 B;  2L92 A;  4LFA I;  4J8Z A;  3CDI A;  1UDN A;  2EPR A;  1X6H A;  4B3T E;  5A69 A;  4JI7 I;  4JI0 I;  4M30 A;  4BHB A;  1F2I G;  4LF8 I;  3ZOQ B;  4JI8 E;  5BR8 E;  4B3M E;  2AJ4 A;  1UIL A;  2V2V A;  4NXM E;  4FW3 A;  1IBK E;  2VQF E;  2RPC A;  2UUA E;  1H74 A;  2WNR A;  4DPW A;  5CFF E;  1BB8 A;  5IT9 C;  1HNX I;  4DR7 E;  2EM9 A;  2YWQ A;  4ED4 A;  4F2J C;  1ZR9 A;  5IWA E;  2WBS A;  1IQS A;  4YHH I;  3QT8 A;  4F9B B;  3J80 C;  4BA1 A;  4Q35 B;  2E5L I;  1T4O A;  2BBG A;  4OZE A;  2EQ0 A;  2EN3 A;  2M1S A;  4URL A;  2NAB A;  3Q1Q A;  2X36 A;  3B78 A;  2HHH E;  5JEA A;  2V83 A;  4HYM A;  1WRJ A;  2WZO A;  3C6K A;  4ZYD A;  2K7I A;  3LLH A;  2V85 A;  3IWD A;  1NHI A;  4JI8 I;  2DIX A;  1O0W A;  4LF9 E;  2ZM6 I;  3J7Y p;  4MU3 A;  2VQF I;  1IBK I;  4NXM I;  5AE1 A;  2NN6 A;  2YSO A;  2LO3 A;  5DNX A;  4DR7 I;  4M0V A;  3HTX A;  4RPF A;  1RQ0 A;  4BCA A;  4BHC A;  1A1J A;  4LPF A;  4Z7Y A;  4EMD A;  2EM3 A;  1USV A;  3PS2 A;  4FW4 A;  2JEA B;  1BBO A;  4Q28 A;  5LMN E;  2BM1 A;  1PJT A;  1ZM4 A;  5A6B A;  2JR1 A;  5KL5 A;  1H7S A;  3ZKB A;  1JK2 A;  4JI1 E;  4AIM A;  2J7K A;  2E1M A;  4F54 A;  2Q8U A;  1VIS A;  3JAM C;  1USU A;  4AM3 A;  4JI6 I;  2N8X A;  3HXL A;  1KVK A;  4JI3 I;  3OTO E;  3QT6 A;  2R3V A;  2UUC E;  4LU9 A;  2UU9 E;  4FW6 A;  2VQE E;  4DV2 E;  3J81 C;  2E72 A;  4DV4 E;  1B62 A;  2EFG A;  4IZJ B;  4OKG A;  4DR3 E;  5LMN I;  4DUY E;  2GO3 A;  4PRX A;  4JI4 E;  4M1K A;  4FN5 A;  1NEI A;  1MG7 A;  5FLX C;  4DMI A;  4JI2 E;  4X9J A;  1OYP A;  4DR4 E;  1K47 A;  4I3H A;  2M4I A;  2BM0 A;  4NBQ A;  4LFC I;  2R76 A;  3EPL A;  2C37 A;  3OTO I;  3P3C A;  2UUC I;  4FW9 A;  4IZJ D;  2VQE I;  4DV2 I;  3K6Q A;  4BBY A;  4N4R B;  2YT4 A;  1XNR E;  4KWY A;  2EL4 A;  2LJH A;  4DU7 A;  5K36 E;  1A6F A;  1NCS A;  1Y5Y A;  4Z7C A;  4DR4 I;  4N3O A;  5ADZ A;  3B82 A;  3M7N G;  3H4L A;  5DNY A;  2EMI A;  3U1K A;  2PNZ B;  2D9H A;  1QNT A;  4F6N A;  3BID A;  2HFU A;  2WCC 3;  2EN8 A;  2MDR A;  3ADL A;  2LCE A;  2EMW A;  2CGE A;  3PYF A;  1YHC A;  2EM8 A;  1N33 E;  4DR6 E;  4I8O A;  4R2D A;  4WPY A;  2M7Q A;  4PRV A;  4B3M I;  1AAY A;  2IES A;  3FIG A;  4X8W A;  3K17 A;  3KZZ A;  5C0X C;  3MSW A;  2AE8 A;  3BGH A;  3ZZ0 A;  5K36 A;  4BC7 A;  1HR0 E;  3J7A M;  4TUI A;  3EPJ A;  1XMQ I;  2WNR B;  2F4V I;  2V86 A;  4O5G A;  1UDQ A;  4DV3 E;  4OX9 E;  3THO B;  2MKD A;  3HJC A;  4USM A;  4QNK A;  2YTF A;  1PIE A;  1Y4U A;  1ZAA C;  1Z0B A;  5GME A;  4BA1 B;  4FWH A;  2BR2 A;  1N33 I;  2YRM A;  4DR6 I;  1RMD A;  4GZN C;  2KHX A;  5JEA B;  2HC5 A;  5C0X D;  4RHB B;  1EKZ A;  2EOO A;  1YYW A;  2Z5B A;  4LCH A;  4DV7 E;  2GO4 A;  3P1X A;  1N36 E;  1T38 A;  5F3W A;  5C0X F;  2EPP A;  4AID A;  2NN6 B;  4DV3 I;  2HKE A;  4OX9 I;  4PU9 A;  5AC4 A;  3IWB A;  2DLK A;  1KIJ A;  3M6A A;  2BB8 A;  2L3J A;  3L7Z A;  2JVA A;  5AAS A;  5AE2 A;  3H1C A;  2XEX A;  3LTO A;  2CG9 A;  2ELY A;  5JEA F;  1NZ0 A;  2BA0 D;  2EM2 A;  4DV7 I;  4R03 A;  1N36 I;  2EOE A;  2EJ4 A;  2M9A A;  2EMG A;  3UHM A;  2E5L E;  3M85 D;  2A2C A;  2VF1 A;  2NN6 F;  1SR9 A;  1Z0E A;  1Y6Z A;  1YSA C;  1OYS A;  1B69 A;  1MGT A;  1NHJ A;  4U3B A;  3U1Y A;  1HNZ I;  2EMK A;  4P7D A;  5A6B D;  1EH7 A;  5C0X A;  1Z0T A;  3GCM A;  2YTQ A;  4HTG A;  2MKN A;  1Z5A A;  5DRQ A;  5IV8 B;  2ZM6 E;  2G7H A;  1MEY C;  2EOY A;  1FI4 A;  2O3Z A;  4DV6 I;  4IFD E;  3ADI A;  4R8O A;  2DGC A;  4OO1 E;  4BMJ A;  1I94 E;  1ZU1 A;  2EM7 A;  4GQU A;  2EOH A;  1YUI A;  1S4E A;  3AV0 A;  1DAR A;  2YSP A;  1WUU A;  2C37 B;  1HK7 A;  1TF3 A;  2GS8 A;  2IOQ A;  2PNM A;  1ZXN A;  2C39 A;  2O1U A;  2JWO A;  3PS1 A;  3KZY A;  4M9V C;  3DD6 A;  5FWK A;  2JPA A;  5KL4 A;  1IMU A;  4DR1 I;  2Q2E B;  3OML A;  2JYA A;  3KRN A;  2EOZ A;  2N3G A;  2EMX A;  1Z5B A;  2JE6 A;  4JI6 E;  4L8N A;  1I94 I;  2L2N A;  1X3C A;  4JI3 E;  5GMD A;  4XTJ A;  4KQV A;  4B3R E;  2MC5 A;  2YZT A;  2CVE A;  1A1L A;  2LUP B;  2GQ0 A;  4O4K A;  1KKH A;  4R2A A;  4WUD A;  3VYY A;  1U2R A;  1DQ3 A;  2V34 A;  1RR9 A;  2EPM X;  4BS9 A;  3WU5 A;  1P42 A;  5TSE A;  2LVH A;  1H72 C;  5KL6 A;  1VI7 A;  2V8P A;  4LFC E;  2CPN A;  3C6M A;  3VYX A;  2EPU A;  4F9A B;  3HUL A;  2A2D A;  4R2R A;  4JV5 E;  4B3R I;  2WW4 A;  2YTE A;  5LL6 R;  2X7I A;  4K0K E;  2EM6 A;  2JY9 A;  4LCF A;  5K36 C;  4MLV A;  1A1F A;  5K36 B;  2WBU A;  1Y60 A;  4FWG A;  2RSI A;  1H7U A;  4L5N C;  4HAC A;  2EOI A;  1N0U A;  1IBM E;  2NA2 A;  2ODR C;  4R2P A;  5DRO A;  2ADR A;  3P06 A;  2BR2 B;  3EPH A;  2HKJ A;  2EMB A;  1Z59 A;  3HKM A;  4HXZ A;  1PVG A;  5A2Q Q;  3QT7 A;  4JV5 I;  2EML A;  2LE2 A;  2EWL A;  2EOS A;  1A1K A;  2EOQ A;  2Z5B B;  3K85 A;  1J5E E;  5K36 D;  3P3G A;  3ZKD A;  2YTD A;  4K0K I;  3H09 A;  3THN A;  2V88 A;  5K36 F;  4USK A;  2Z5C A;  1X6F A;  2EMH A;  1UBD C;  2ODR D;  2NUF A;  1IBM I;  4X66 I;  5IXM B;  4LOM A;  1X5W A;  2V2Q A;  3L7Z B;  1T4N A;  4JG4 A;  2PO1 A;  4RH8 A;  5A6K A;  2EPX A;  4KHP I;  3C4T A;  4MU1 A;  2O1T A;  1XMQ E;  5DRR A;  1MU5 A;  4DV0 I;  1J5E I;  4BA2 A;  2EN2 A;  1RC7 A;  2F4V E;  4X64 I;  2ENC A;  3AUZ A;  4J3D A;  1FKA E;  1AH5 A;  2WBT A;  3C4B A;  2B3T B;  2CZ9 A;  4WXD A;  4MDT A;  4DUZ I;  4X62 I;  4WSG A;  1X47 A;  2V87 A;  3WU4 A;  3F0N A;  4FK5 C;  1GTK A;  1A1G A;  1WXR A;  2RSM A;  1DI2 A;  5C0X B;  2LUQ A;  2LBS B;  2BA0 G;  3JU0 A;  3P3E A;  1YZ9 A;  2VF3 A;  5A6A A;  4DPU A;  4LF7 I;  2DB2 A;  4WYQ B;  3HPS A;  1HNW E;  2BA1 G;  2YRH A;  2JEB A;  1OYR A;  3M85 G;  2RTX A;  3L00 A;  2EPK X;  3Q6N A;  1DGC A;  1G2F C;  4R2Q A;  2C39 B;  2R42 A;  2WP8 A;  4MU0 A;  2JOB A;  2V8Q B;  3MHS C;  4QNJ A;  5LLQ A;  3NZK A;  5L3J A;  1X6E A;  2IOP A;  4IS9 A;  4LCG A;  2BV3 A;  4JI5 E;  2JE6 B;  1L4S A;  1HNW I;  1UN6 B;  3ECR A;  3V2U C;  1KYQ A;  1TN9 A;  2LTS A;  2K4V A;  5AE3 A;  4LF5 E;  2CTD A;  2PO2 A;  4YY3 I;  4DV1 E;  3RMP A;  1HNZ E; 
#chains in the Genus database with same CATH homology
 4DKK A;  1MX0 A;  3VK6 A;  4WFT A;  4DV6 E;  3ADG A;  2H36 X;  4JI5 I;  1ZM3 A;  2LJP A;  4BC9 A;  4WSP A;  4LF5 I;  1XMO I;  3J7A G;  2NUE A;  2VE7 C;  2UXC E;  2L33 A;  4DV1 I;  4DR1 E;  2DEJ A;  1S16 A;  2UXB E;  2UXD E;  4LTY A;  1N0V C;  1WHN A;  1ZM9 A;  4HAC B;  4P7A A;  3K1J A;  1N34 E;  2V89 A;  2Z5E A;  4GKJ I;  1STU A;  1RRE A;  3Q6M A;  2UXC I;  2DMY A;  2RS7 A;  1QZR A;  2B7T A;  5IT9 Q;  2UXB I;  2UXD I;  1IBL I;  2O1V A;  1H73 A;  4UT4 A;  1FWK A;  2FTX B;  2IHR 1;  2Z5C B;  3J80 Q;  3T1Y I;  1Z0W A;  1XNQ E;  1Z0C A;  1N34 I;  3HPZ A;  4X65 E;  3ZZU A;  1ELO A;  4KZS A;  2L8T A;  2LMZ A;  4DXL A;  1EA6 A;  4B3T I;  4F9C B;  2LTR A;  4WUB A;  3GON A;  1ZBT A;  5BR8 I;  1XNQ I;  2B9D A;  4X65 I;  2UUA I;  2RS6 A;  3PRY A;  5IWA I;  2NUG A;  4M2Z A;  3CWV A;  2F8B A;  4B3S E;  3PYE A;  4IZK A;  4DPX A;  3JAM Q;  4HY1 A;  2KON A;  1FJG E;  4P52 A;  2HHH I;  5LMU E;  4X66 E;  1UEK A;  4DPT A;  3ZM7 A;  2FGG A;  3F6H A;  3PYG A;  1ZM2 A;  4DPY A;  4JYA E;  1FWL A;  3J81 Q;  4LF9 I;  1Z0G A;  4KHP E;  2HK2 A;  4DV0 E;  1BKN A;  1ZBQ A;  4MYT A;  4X64 E;  5FLX Q;  3WU3 A;  4B3S I;  3DF6 A;  5A2Q C;  1FJG I;  5LMU I;  1X48 A;  1EI1 A;  4X62 E;  4DUZ E;  4LF6 E;  5T6J A;  2ZBK B;  4JI1 I;  2L2K B;  1J26 A;  4JYA I;  4NXN E;  4DR5 E;  1UHZ A;  3QT5 A;  2PNL A;  1QU6 A;  1YYO A;  2LRS A;  2B7V A;  3KWR A;  3F6G A;  4LF7 E;  4LF4 E;  1KTV A;  3LPS A;  4WUC A;  2UU9 I;  1Y4S A;  4TUG A;  3V5R A;  4DV4 I;  4DR3 I;  4DU8 A;  4DUY I;  1D6T A;  1NHH A;  4LF6 I;  4JI4 I;  2DEI A;  4GKK E;  4ZVI A;  4NXN I;  4JI2 I;  4MYU A;  2V2Z A;  1GZ6 A;  4UTG A;  4DR5 I;  4LF4 I;  4AQY E;  3PYD A;  4P78 A;  2HFS A;  4YY3 E;  4DR2 E;  2KOU A;  3DJW A;  2L3C A;  1XNR I;  2UUB E;  1Z5C A;  2O1W A;  4GKK I;  4FWD A;  3LNU A;  2DSY A;  3ADJ A;  1X49 A;  1Z0V A;  1T4L B;  2OI2 A;  4IZJ A;  4DV5 E;  4AQY I;  4OOG C;  1XMO E;  4DR2 I;  4GEQ B;  2ZIT A;  1N32 E;  1YYK A;  2UUB I;  2EZ6 A;  2JOX A;  2L6M A;  3T1H E;  3LML A;  1PKP A;  2L2M A;  2N3H A;  4DV5 I;  1ZXM A;  1HR0 I;  1OJ4 A;  4GKJ E;  1WHQ A;  1N32 I;  1XHK A;  4R1F A;  4LFA E;  2HK3 A;  1IBL E;  2NPF A;  3IWC A;  2E1R A;  4IZK B;  4JI7 E;  1B63 A;  3T1H I;  3T1Y E;  4JI0 E;  2FV4 B;  4LF8 E;  1GQE A;  3ZZT A;  4LFB E;  1HNX E;  1FNM A;  3WU6 A;  3JTZ A;  4YHH E;  3HQ1 A;  2MC6 A;  3B8H A;  3D4J A;  4LFA I;  2L92 A;  4J8Z A;  4B3T E;  4JI7 I;  4JI0 I;  4M30 A;  4LF8 I;  3ZOQ B;  4JI8 E;  5BR8 E;  4B3M E;  2AJ4 A;  1UIL A;  2V2V A;  4NXM E;  1IBK E;  2VQF E;  2UUA E;  1H74 A;  4DPW A;  4LFB I;  5CFF E;  5IT9 C;  1HNX I;  4DR7 E;  4ED4 A;  5IWA E;  4YHH I;  3QT8 A;  4F9B B;  3J80 C;  2E5L I;  1T4O A;  2M1S A;  4URL A;  3Q1Q A;  2X36 A;  3B78 A;  2HHH E;  2V83 A;  4HYM A;  2WZO A;  4JI8 I;  3IWD A;  2V85 A;  3LLH A;  1NHI A;  2ZM6 I;  2DIX A;  1O0W A;  4LF9 E;  4B3M I;  3J7Y p;  2VQF I;  1IBK I;  4NXM I;  5AE1 A;  4DR7 I;  4M0V A;  3HTX A;  4RPF A;  1RQ0 A;  4BCA A;  4Z7Y A;  4EMD A;  1USV A;  4Q28 A;  5LMN E;  2BM1 A;  1ZM4 A;  2JR1 A;  1H7S A;  3ZKB A;  4JI1 E;  2J7K A;  2E1M A;  4F54 A;  1VIS A;  3JAM C;  1USU A;  4JI6 I;  3HXL A;  1KVK A;  4JI3 I;  3OTO E;  3QT6 A;  2R3V A;  2UUC E;  4LU9 A;  2UU9 E;  2VQE E;  4DV2 E;  3J81 C;  1B62 A;  4DV4 E;  2EFG A;  4IZJ B;  4DR3 E;  5LMN I;  4DUY E;  4PRX A;  4JI4 E;  4M1K A;  4FN5 A;  1MG7 A;  5FLX C;  4DMI A;  4JI2 E;  4DR4 E;  1K47 A;  4I3H A;  2M4I A;  2BM0 A;  4LFC I;  3OTO I;  2UUC I;  4FW9 A;  4IZJ D;  2VQE I;  4DV2 I;  3K6Q A;  4BBY A;  2YT4 A;  1XNR E;  2LJH A;  4DU7 A;  1A6F A;  4Z7C A;  4DR4 I;  4N3O A;  5ADZ A;  3B82 A;  3H4L A;  5DNY A;  2HFU A;  2MDR A;  3ADL A;  2CGE A;  3PYF A;  1N33 E;  4DR6 E;  4I8O A;  4WPY A;  2M7Q A;  4PRV A;  3FIG A;  4X8W A;  3K17 A;  3MSW A;  3ZZ0 A;  4BC7 A;  1HR0 E;  3J7A M;  4TUI A;  1XMQ I;  2F4V I;  2V86 A;  4DV3 E;  4OX9 E;  3HJC A;  4USM A;  1PIE A;  1Y4U A;  1Z0B A;  5GME A;  4FWH A;  1N33 I;  4DR6 I;  2KHX A;  1EKZ A;  1YYW A;  2Z5B A;  4DV7 E;  3P1X A;  1N36 E;  5F3W A;  4DV3 I;  2HKE A;  4OX9 I;  4PU9 A;  3IWB A;  1KIJ A;  3M6A A;  2L3J A;  2JVA A;  5AAS A;  5AE2 A;  3LTO A;  2XEX A;  2CG9 A;  1NZ0 A;  4DV7 I;  4R03 A;  1N36 I;  2E5L E;  2A2C A;  2VF1 A;  1SR9 A;  1Z0E A;  1Y6Z A;  1NHJ A;  1HNZ I;  4P7D A;  1Z0T A;  1Z5A A;  2ZM6 E;  2G7H A;  1FI4 A;  4DV6 I;  3ADI A;  4R8O A;  4BMJ A;  1I94 E;  1S4E A;  3AV0 A;  1DAR A;  2IOQ A;  1WUU A;  2PNM A;  1HK7 A;  2GS8 A;  1ZXN A;  2O1U A;  2JWO A;  5FWK A;  4DR1 I;  2Q2E B;  3OML A;  2N3G A;  1Z5B A;  4JI6 E;  4L8N A;  1I94 I;  2L2N A;  4JI3 E;  5GMD A;  4XTJ A;  4KQV A;  4B3R E;  2MC5 A;  2YZT A;  2LUP B;  2GQ0 A;  1KKH A;  4WUD A;  3VYY A;  1U2R A;  1DQ3 A;  2V34 A;  1RR9 A;  4BS9 A;  3WU5 A;  1H72 C;  2V8P A;  4LFC E;  2CPN A;  3VYX A;  4F9A B;  3HUL A;  2A2D A;  4JV5 E;  4B3R I;  2WW4 A;  5LL6 R;  2X7I A;  4K0K E;  2JY9 A;  4FWG A;  1H7U A;  4L5N C;  4HAC A;  1N0U A;  1IBM E;  2NA2 A;  2ODR C;  3P06 A;  2HKJ A;  1Z59 A;  4HXZ A;  5A2Q Q;  1PVG A;  4JV5 I;  3QT7 A;  2LE2 A;  2EWL A;  2Z5B B;  3K85 A;  1J5E E;  3ZKD A;  4K0K I;  3H09 A;  2V88 A;  4USK A;  2Z5C A;  2ODR D;  2NUF A;  1IBM I;  4X66 I;  4JG4 A;  2V2Q A;  1T4N A;  4KHP I;  3C4T A;  2O1T A;  1XMQ E;  1MU5 A;  4DV0 I;  1J5E I;  1RC7 A;  2F4V E;  4X64 I;  3AUZ A;  1FKA E;  3C4B A;  2B3T B;  2CZ9 A;  4DUZ I;  4X62 I;  1X47 A;  2V87 A;  3WU4 A;  3F0N A;  1WXR A;  2RSM A;  1DI2 A;  2LUQ A;  2LBS B;  3JU0 A;  1YZ9 A;  2VF3 A;  4DPU A;  4LF7 I;  2DB2 A;  4WYQ B;  3HPS A;  1HNW E;  2RTX A;  3Q6N A;  2R42 A;  2JOB A;  2V8Q B;  5L3J A;  2IOP A;  2BV3 A;  4JI5 E;  1HNW I;  3V2U C;  2LTS A;  2K4V A;  5AE3 A;  4LF5 E;  4YY3 I;  4DV1 E;  3RMP A;  1HNZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...