5LMUE

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmuE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuE02
1ELOA 5A2QQ 3VYYA 1NHHA 1N0VC 4B3TI 5IT9Q 4JI4E 2ZM6E 3ADIA 4DR1E 4DR4E 4ZVIA 2HKJA 4UTGA 2L2MA 1I94E 2LJHA 4JI8I 4JV5I 4X66E 2ZBKB 4JI1E 1WUUA 4DR7I 1D6TA 2UU9E 1Z0EA 3B82A 2HK2A 1U2RA 4WFTA 2XEXA 2LTRA 4DV3E 4HXZA 1MG7A 4B3SI 2V2QA 2F4VI 2L33A 5LMNE 3ZKBA 2A2DA 2RTXA 4JI7E 4DV5I 3C4BA 3WU5A 4DUYE 4JI3E 4B3ME 2L3JA 2L3CA 4DR3I 4PRXA 4P7AA 3LTOA 3B8HA 1N33I 1HNWE 1RREA 4DV1I 4LFBI 4P52A 2EZ6A 1RQ0A 1YZ9A 3F0NA 1A6FA 2LUQA 4JI0E 3T1HE 3ZM7A 5GMEA 3P1XA 1B63A 3PYDA 4DR5I 2KHXA 3M6AA 4X65I 3J7Yp 3T1YI 3PYGA 1HNZE 4LF7E 4DPWA 3QT6A 3OTOI 2UUAI 4YHHE 1FJGE 4JYAI 1HR0I 1BKNA 2BM0A 2N3GA 1EA6A 2NUEA 1UHZA 4DV7I 4FWHA 1IBKI 3J7AM 1IBMI 4LFCI 3HULA 4YY3I 1DARA 4DUZE 4LF6I 2MDRA 4LF5I 1N34E 2UUCI 1N36E 2V34A 4EMDA 5IWAI 3ADGA 2VQEI 2E5LI 1YYWA 4DV6I 2UXBI 4USKA 1H7UA 4FWGA 4Z7YA 2V8PA 1Z0VA 1YYOA 3LLHA 2UXCI 2R3VA 4DPUA 5BR8I 2JVAA 1YYKA 4B3RE 5LMUI 4JI6E 2UUBE 4DPTA 4USMA 1X48A 1NHJA 2L2NA 4X62I 3ADJA 1S4EA 4OX9E 1XHKA 2DMYA 1MU5A 1Z5CA 3C4TA 1XNQE 1K47A 1J5EI 1XMOI 4R1FA 2VQFE 1KVKA 3J80C 4DV0E 4DV4E 1ZXNA 2DEJA 3J81Q 1Z0WA 2HFUA 2WW4A 3PYFA 1XMQE 4AQYI 2ZITA 4KQVA 2X36A 4X64I 2L2KB 2UXDI 4DPYA 2X7IA 4XTJA 3JAMQ 2HK3A 2E1RA 4DPXA 4LF8I 2LJPA 1RC7A 3WU6A 4JI2E 1PIEA 4NXNI 4JI5E 1ZM9A 4GKJE 1ZM4A 4DR6E 2R42A 2V2VA 1Z5BA 2VF3A 4JI4I 2ZM6I 2B7VA 1B62A 4HY1A 1Z0BA 2YT4A 3QT7A 3ZZUA 4DR1I 4DR4I 1RR9A 1X49A 1HNXE 4NXME 4KHPE 1H73A 1N32E 1I94I 2B7TA 2J7KA 4X66I 4JI1I 1VISA 1NZ0A 4HACA 1FI4A 1QZRA 4GKKE 2UUAE 1Z0GA 3ZZ0A 2UU9I 4LFAE 1XNRE 4DV3I 3QT8A 2CZ9A 2V2ZA 3ADLA 2UUCE 4LF9E 1N0UA 4DR2E 4LF4E 2HFSA 4DU7A 5LMNI 4I3HA 2GS8A 2A2CA 5GMDA 5IT9C 4JI7I 4K0KE 1STUA 4DUYI 1IBLE 4DV2E 4JI3I 2UXCE 3HTXA 4B3MI 2RSMA 2DB2A 3PYEA 3H4LA 4RPFA 4WUDA 1PKPA 1Z0TA 3VYXA 1WHNA 4M30A 4B3TE 1HNWI 4ED4A 1Z5AA 1KKHA 2Q2EB 2NUFA 4JI0I 2LTSA 3T1HI 4JI8E 4JV5E 3ZZTA 2LUPB 1QU6A 1T4LB 1EI1A 4URLA 4DR7E 1O0WA 1H72C 1HNZI 4LF7I 4X8WA 4YHHI 2HHHI 2DIXA 1FJGI 4B3SE 4Z7CA 5CFFE 2F4VE 4DUZI 1N34I 2NPFA 1H7SA 1N36I 4FN5A 3K1JA 4WYQB 4DV5E 1S16A 2RS6A 1MX0A 3B78A 4DR3E 1ZBTA 4B3RI 2CPNA 1N33E 2UUBI 4JI6I 2BV3A 4DV1E 4LFBE 4MYUA 1WHQA 4UT4A 1UEKA 3K17A 4PRVA 2RS7A 1FKAE 4FWDA 4OX9I 5FLXC 4DR5E 2JY9A 4X65E 1XNQI 3CWVA 3J7AG 3T1YE 2LBSB 3D4JA 2VQFI 1GQEA 4WUCA 3OTOE 4DU8A 4DV0I 4DV4I 5L3JA 4JYAE 1HR0E 4WUBA 4M2ZA 4HYMA 1XMQI 4DV7E 4DKKA 1IBKE 1IBME 4LFCE 3LNUA 4YY3E 4LF6E 4LF5E 5A2QC 1OJ4A 2IHR1 4FW9A 4JI2I 5IWAE 4JI5I 2VQEE 2E5LE 2HKEA 4DV6E 2UXBE 2NA2A 2BM1A 2N3HA 4PU9A 4GKJI 3QT5A 3J80Q 4OOGC 1ZM3A 1EKZA 4DR6I 3WU4A 1NHIA 2LRSA 1ZM2A 5BR8E 1T4OA 2DEIA 3WU3A 1PVGA 2NUGA 1HNXI 5LMUE 4NXMI 1Z0CA 4KHPI 1N32I 1J26A 2AJ4A 2B3TB 3Q1QA 4DXLA 3V5RA 1KIJA 1T4NA 1Z59A 3J81C 4X62E 1H74A 1KTVA 1UILA 2EFGA 4MYTA 4GKKI 2HHHE 3JAMC 1X47A 1FWKA 1FWLA 5LL6R 3ZKDA 4LFAI 1XNRI 4HACB 4M1KA 1J5EE 1XMOE 5FLXQ 4LF9I 1DI2A 3GONA 4DR2I 4LF4I 3LPSA 2OI2A 4JG4A 4AQYE 1ZXMA 4X64E 3V2UC 2UXDE 4K0KI 1IBLI 4DV2I 4LF8E 4NXNE 1FNMA
chains in the Genus database with same CATH superfamily
1ELOA 2V86A 2YTEA 2YTIA 1YHCA 2DRPA 5A2QQ 3VYYA 1NHHA 4R8OA 1WXRA 1N0VC 2F8BA 3JU0A 4FW4A 4B3TI 2NN6F 5IT9Q 1R6LA 2PNMA 4JI4E 2ZM6E 3ADIA 3P06A 4DR1E 4DR4E 4ZVIA 2HKJA 2NN6E 3AUZA 4P7DA 4UTGA 5C0XF 2L2MA 1I94E 4LCFA 2LJHA 4BS9A 4JI8I 4JV5I 5DRRA 4R2AA 1GTKA 2EPMX 5KL6A 4X66E 2Z5CA 2ZBKB 5C0XE 2DSYA 4JI1E 4NBQA 1YPNA 4BA2A 1XXEA 2J65A 1X6HA 2Z5BB 1WUUA 2PNLA 4DR7I 1D6TA 2UU9E 1Z0EA 3B82A 2HK2A 2EWLA 4IJDA 1U2RA 4WFTA 2EN3A 4RHBB 2XEXA 5LLQA 2LTRA 4DV3E 3PRYA 1BBGA 4O5GA 4WPYA 4HXZA 1MG7A 1DQ3A 4B3SI 2JEAA 4GZNC 5AE3A 4N4RB 2V2QA 5K36C 2EOQA 2F4VI 2GO3A 3PS1A 1UDNA 2L33A 5LMNE 2EMHA 2A2DA 2JT2A 3ZKBA 2RTXA 2EMXA 3M7ND 2ENCA 2EMAA 4JI7E 4DV5I 3C4BA 2EPRA 3HXLA 4BHCA 4HTGA 1T39A 3UK3C 4DUYE 2HC5A 2YU5A 3WU5A 2V89A 4JI3E 4R2PA 4B3ME 2HJJA 2LCEA 2L3JA 3C6MA 1YFHA 4F9CB 2EMCA 2L3CA 4KWYA 2D9HA 2YU8A 4DR3I 5A6AA 2JR1A 2EN8A 4ZYGA 4PRXA 4P7AA 4F6NA 3LTOA 4AIMA 2BA0G 2KONA 3B8HA 1N33I 1HNWE 4U3DA 4AIDA 1RREA 4MLVA 2JEBB 2WNRA 4DV1I 2EPLX 2I9IA 4LFBI 4L8NA 4P52A 2EOJA 2EZ6A 3PS3A 1RQ0A 1YZ9A 3F0NA 1A6FA 2PO0B 2LUQA 2I13A 4JI0E 5K36A 3T1HE 3ZM7A 2G7HA 5GMEA 4FW6A 1ZBQA 2DMIA 2NN6C 3OMLA 1AH5A 1TF3A 2IOPA 3KWRA 5DNXA 3P1XA 5AASA 2GPIA 4NHRA 2BA1G 1B63A 3PYDA 3QG5C 4DR5I 2KHXA 2PO2A 3M6AA 2YSOA 4X65I 3ZOQB 3J7Yp 2R76A 3T1YI 5C0XC 4BC9A 2BR2A 4MLQA 4O4KA 1UDSA 3PYGA 1HNZE 1TN9A 4LF7E 4R03A 4DPWA 2EM5A 3QT6A 3OTOI 2EN1A 2UUAI 4YHHE 1E3HA 1X5WA 2CTDA 1OYRA 1FJGE 5K36F 3H09A 4JYAI 1HR0I 2EOMA 1BKNA 2EM0A 2BM0A 2N3GA 2NUEA 1UHZA 1EA6A 1OYSA 4DV7I 2LT7A 4FWHA 5LMNI 1IBKI 3DF6A 1IBMI 2EM4A 2EQ0A 3HULA 4LFCI 4YY3I 1DARA 4DUZE 2WP8A 4LF6I 2MDRA 2C39B 1N34E 2YTNA 4LF5I 2UUCI 2PNZA 2JE6A 1N36E 2EMFA 3P3GA 2V34A 1YUIA 1GZ6A 2EJ4A 4EMDA 5IWAI 3ADGA 2VQEI 2JOBA 2E5LI 4ZYEA 5KL2A 1YYWA 5DRPA 4DV6I 2UXBI 4USKA 1H7UA 4FWGA 2NN6A 4Z7YA 2EE8A 2EOZA 2BA0D 3MHHC 2V8PA 1Z0VA 2EM2A 2Q8UA 3HQ1A 5ELWA 4M0VA 3TQMA 1YYOA 1TF6A 3LLHA 5AE1A 4LCGA 3F6HA 2UXCI 3L7ZA 2WBTA 2ODRC 4R2SA 1JK1A 2R3VA 4DPUA 2EOEA 1G2DC 3VK6A 5C0XA 1IQSA 2EMYA 3BGHA 2JVAA 1YYKA 3UHMA 4B3RE 5LMUI 4JI6E 2UUBE 4DPTA 1F2IG 4USMA 2EPXA 1X48A 2RSIA 4F9BB 1NHJA 2L2NA 5ADZA 5DROA 2YRHA 2FGGA 2BA1D 4X62I 4N3OA 1IQOA 5JEAB 2YTDA 3M85D 2YTFA 3ADJA 3RMPA 1A1KA 5JEAD 4R2EA 1AAYA 1S4EA 2EMLA 4OX9E 2NABA 2EOYA 3IWDA 1XHKA 4MU0A 4J8ZA 2DMYA 2HGHA 1Y4UA 1MU5A 5AC5A 1Z5CA 2ELYA 3C4TA 1XNQE 2N8XA 4P78A 3Q6NA 4U3BA 1K47A 1J5EI 1XMOI 4R1FA 2VQFE 4MU4A 3B4TA 3BF2A 1KVKA 4BHBA 1YUJA 2C37B 3J80C 4FK5C 5KL7A 4DV0E 4DV4E 4ZYHA 1ZXNA 2DEJA 3THOB 3J81Q 4IFDB 1RHYA 4MQYA 3BIDA 1Z0WA 2HFUA 4OZEA 2WW4A 3PYFA 1XMQE 4AQYI 4OO1B 2L6MA 2WZOA 2X36A 2ZITA 3DD6A 4KQVA 2L2KB 4X64I 2UXDI 2AE8A 3U1KA 4DPYA 2X7IA 4XTJA 3JAMQ 4OO1D 4LPFA 2YZTA 2F1DA 2HK3A 2E1RA 4DPXA 4LF8I 4BA1A 2KOUA 2LJPA 1RC7A 4L5NC 3WU6A 2LJUA 2EL6A 1YSAC 4JI2E 1HK7A 1PIEA 3MHSC 4NXNI 4JI5E 2EP3A 3CDIA 3P76A 1EH7A 1ZM9A 4QNKA 4ZYDA 4GKJE 2VE7C 2EMKA 5A6JA 1ZM4A 4DMIA 4F54A 2M1SA 4DR6E 2R42A 2V2VA 4MDTA 2EPCA 1Z5BA 2VF3A 2V85A 4JI4I 2ZM6I 2B7VA 1B62A 4HY1A 1Z0BA 2YT4A 3QT7A 1A1IA 3ZZUA 4DR1I 2O1UA 1RR9A 4DR4I 1WJPA 1X49A 2LV2A 1HNXE 5AC4A 4F9AB 4R2RA 3EPKA 4NXME 1N32E 4KHPE 1H73A 3K85A 3PS2A 4IZKA 1I94I 2B7TA 3HPSA 4IZJA 4IS1C 1Y5YA 4R2DA 2ENAA 2J7KA 2M9AA 4X66I 4ISAA 5IXMB 4JI1I 1VISA 1NZ0A 4HACA 1FI4A 2C38A 1QZRA 4GKKE 2UUAE 3GCMA 1Z0GA 5EL9A 3ZZ0A 2UU9I 2EMWA 1P47A 1X6EA 2Z5CB 4BA2B 2ADRA 4LFAE 2PRTA 1XNRE 4DV3I 2EMGA 4KZSA 3QT8A 2CZ9A 5KL4A 2V2ZA 2CGEA 3ADLA 2UUCE 4LF9E 2FTXB 1N0UA 4MU1A 4DR2E 3M85G 4LF4E 2HFSA 2PO1A 4F6MA 4I8OA 2EOIA 2EPAA 4I3HA 2EN2A 2GS8A 3L00A 2A2CA 4FW5A 2YSPA 5GMDA 2MKDA 5IT9C 3P3EA 3KZZA 4JI7I 3EPJA 2V87A 2JEAB 4K0KE 1STUA 4DUYI 2EQ3A 4BCAA 4DV2E 1IBLE 4JI3I 2UXCE 2CG9A 1LLMC 3HTXA 4B3MI 2EOFA 4FW7A 2VF1A 2K7IA 2RSMA 2E1MA 1UN6B 2DB2A 4R2QA 3PYEA 4LCHA 1T38A 3H4LA 2JOXA 4O43A 4RPFA 2L8TA 4WUDA 4R2CA 1PKPA 2DGCA 1Z0TA 2M7QA 3VYXA 1WHNA 4M30A 3C6KA 3THNA 1A1GA 1Y4SA 4AM3A 4B3TE 1HNWI 2YTQA 2A25A 4QNJA 2EOSA 4J3DA 4ED4A 5KL5A 2EMBA 1Z5AA 2C37A 1KKHA 2GO4A 2Z5BA 2Q2EB 2NUFA 4JI0I 5JEAF 1VI7A 3AV0A 2LTSA 3T1HI 4JI8E 2YTGA 4JV5E 3ZZTA 1A1JA 2EM8A 2R1FA 2YTPA 3EPHA 1NEIA 2LUPB 1QU6A 2YTJA 3IWCA 2WNRB 5JEAE 1PJSA 1T4LB 2WBSA 4WXCA 1PJQA 1EI1A 1YH8A 5K36B 4URLA 4DR7E 2H36X 1O0WA 1H72C 5IV8B 1HNZI 4LF7I 5KL3A 2EPOA 1UDQA 4X8WA 2JP9A 5DNLA 4Q35B 2EORA 4X9JA 4YHHI 2MKNA 2HHHI 2CVEA 2DIXA 4WSPA 2PO2B 1FJGI 1B69A 5AE2A 1A1FA 3Q6MA 4B3SE 4Z7CA 2BR2B 1X3CA 5CFFE 4OO1F 2F4VE 2EOOA 4NZVA 4IFDE 2LMZA 4DUZI 2IERA 2E72A 1USUA 1N34I 2EMZA 3J7AM 2EOHA 2NPFA 4OO1E 1H7SA 2O1WA 1N36I 4FN5A 5DRQA 2LO3A 3K1JA 4O24A 2LVHA 3FIGA 4WYQB 4BBYA 4DV5E 1S16A 4GEQB 1Z1BA 2RS6A 1MX0A 1MGTA 2DLKA 4IFDD 2VESA 2WP8B 1PDAA 3IWBA 1L4SA 2PNZB 2JE6B 1KYQA 2JEBA 1EH6A 2EQ1A 2MC6A 4TUIA 4DR3E 3B78A 3GLLA 3HKMA 1G2FC 1ZBTA 2PO0A 5A6BD 4Q28A 2GQ0A 2DLQA 2EM9A 2NN6B 4B3RI 2CPNA 1N33E 2UUBI 4JI6I 1A1LA 2BBGA 2NN6D 2BV3A 2V8QB 4LU9A 4DV1E 2O3ZA 4LFBE 4OKGA 4GQUA 2EM6A 1WHQA 3L7ZB 4MYUA 4UT4A 5C0XB 1UEKA 1E3PA 3K17A 4PRVA 2RS7A 1FKAE 2O1TA 1Y6ZA 5C0XD 2JYAA 1EH8A 3HPZA 2B9DA 4M9VC 4FWDA 4OX9I 1DGCA 1BB8A 3VHTB 5FLXC 4WXDA 4F2JC 1BBOA 1USVA 3LMLA 1JK2A 4DR5E 2JY9A 1QNTA 4X65E 2RPCA 3CWVA 1X6FA 1XNQI 5A6KA 3J7AG 5T6JA 3T1YE 2LBSB 5JEAC 1N3GA 5TSEA 5A69A 3D4JA 2VQFI 1ZR9A 3EPLA 1GQEA 2EPZA 2EOXA 4WUCA 3K6QA 2CT1A 2C39A 3OTOE 2VRDA 4DU8A 2CSHA 4DV0I 4DV4I 5L3JA 4JYAE 4BC7A 1HR0E 3HJCA 4WUBA 4M2ZA 4HYMA 1XMQI 2YPNA 4DV7E 1UBDC 4DKKA 1P42A 1IBKE 2YWQA 1IBME 4LFCE 3EQ1A 3LNUA 4WSGA 4YY3E 4LF6E 2EPKX 4LF5E 2EM7A 5A2QC 1ZU1A 1OJ4A 4IFDC 2IHR1 4FW9A 4JI2I 3MSWA 2IOQA 5IWAE 4JI5I 2YRMA 2VQEE 4MU3A 2MC5A 3F6GA 2E5LE 1Y60A 2ELZA 1MEYC 2HKEA 4OO1C 2ODRD 4DV6E 2UXBE 2EN4A 2EPNA 2N3HA 2NA2A 2BM1A 4PU9A 4GKJI 2YRKA 3QT5A 3J80Q 2EMIA 4BA1B 3NZKA 4OOGC 1ZM3A 1EKZA 5BR8I 2YTOA 3WU4A 1NHIA 1IMUA 1OYPA 4DU7A 4DR6I 5FWKA 2LE2A 2LRSA 1ZM2A 5BR8E 1T4OA 2DEIA 2GLIA 2V83A 5JEAA 3GMEA 3WU3A 1PVGA 2JPAA 4LTYA 4RH8A 2NUGA 1HNXI 5LMUE 4NXMI 1Z0CA 4KHPI 1N32I 3M99B 1J26A 2AJ4A 2B3TB 3Q1QA 3ECRA 4DXLA 3U1YA 5F3WA 1KIJA 3V5RA 2EN7A 1NCSA 1T4NA 1Z59A 3J81C 2IESA 4FW3A 4X62E 2EPUA 1H74A 1KTVA 4LOMA 1UDOA 1UILA 3P3CA 4HEIA 2EFGA 2RQLA 4MYTA 4WX9A 4GKKI 3JTZA 2HHHE 4BMJA 2ENHA 1SR9A 3JAMC 4IZKB 1X47A 5LL6R 1FWKA 1FWLA 2WCC3 4IZJB 4IFDA 3ZKDA 3H1CA 4IZJD 3DJWA 4LFAI 3KRNA 4TUGA 1XNRI 5K36E 2JWOA 2FV4B 4HACB 4M1KA 1J5EE 4OO1A 1XMOE 5FLXQ 1R6MA 2C38B 2K4VA 5EKWA 4IS9A 2EN6A 2EPPA 4LF9I 1WRJA 1DI2A 1PJTA 2V88A 3GONA 1SFEA 4DR2I 1A1HA 5A6BA 4LF4I 3LPSA 2GHFA 2EM3A 2J7JA 2OI2A 2BB8A 5K36D 4JG4A 4AQYE 1ZXMA 5DNYA 2EL4A 4X64E 3V2UC 2JXPA 2UXDE 3BBGA 2O1VA 4K0KI 2L92A 3KZYA 1ZAAC 4IFDF 1IBLI 4DV2I 4LF8E 1KJKA 3CDJA 2Z5EA 2PO1B 2WBUA 2M4IA 2MDGA 4NXNE 3M7NG 2EL5A 1FNMA 1RMDA
chains in the Genus database with same CATH topology
1ELOA 2V86A 5A2QQ 3VYYA 1NHHA 4R8OA 1WXRA 1N0VC 2F8BA 3JU0A 4B3TI 5IT9Q 2PNMA 4JI4E 2ZM6E 3ADIA 3P06A 4DR1E 4DR4E 4ZVIA 2HKJA 3AUZA 4P7DA 4UTGA 2L2MA 1I94E 2LJHA 4BS9A 4JI8I 4JV5I 4X66E 2Z5CA 2ZBKB 2DSYA 4JI1E 2Z5BB 1WUUA 2PNLA 4DR7I 1D6TA 2UU9E 1Z0EA 3B82A 2HK2A 2EWLA 1U2RA 4WFTA 2XEXA 2LTRA 4DV3E 3PRYA 4WPYA 4HXZA 1MG7A 1DQ3A 4B3SI 5AE3A 2V2QA 2F4VI 2L33A 5LMNE 3ZKBA 2A2DA 2RTXA 4JI7E 4DV5I 3C4BA 3HXLA 3WU5A 4DUYE 2V89A 4JI3E 4B3ME 2L3JA 4F9CB 2L3CA 4DR3I 2JR1A 4PRXA 4P7AA 3LTOA 2KONA 3B8HA 1N33I 1HNWE 1RREA 4DV1I 4LFBI 4L8NA 4P52A 2EZ6A 1RQ0A 1YZ9A 3F0NA 1A6FA 2LUQA 4JI0E 3T1HE 3ZM7A 2G7HA 5GMEA 1ZBQA 3OMLA 2IOPA 3KWRA 3P1XA 5AASA 1B63A 3PYDA 4DR5I 2KHXA 3M6AA 4X65I 3ZOQB 3J7Yp 3T1YI 4BC9A 3PYGA 1HNZE 4LF7E 4R03A 4DPWA 3QT6A 3OTOI 2UUAI 4YHHE 1FJGE 3H09A 4JYAI 1HR0I 1BKNA 2BM0A 2N3GA 1EA6A 2NUEA 1UHZA 4DV7I 4FWHA 1IBKI 3J7AM 3DF6A 1IBMI 4LFCI 3HULA 4YY3I 1DARA 4DUZE 4LF6I 2MDRA 4LF5I 1N34E 2UUCI 1N36E 2V34A 1GZ6A 4EMDA 5IWAI 3ADGA 2VQEI 2JOBA 2E5LI 1YYWA 4DV6I 2UXBI 4USKA 1H7UA 4FWGA 4Z7YA 2V8PA 1Z0VA 3HQ1A 4M0VA 1YYOA 3LLHA 5AE1A 3F6HA 2UXCI 2R3VA 2ODRC 4DPUA 5BR8I 3VK6A 2JVAA 1YYKA 4B3RE 5LMUI 4JI6E 2UUBE 4DPTA 4USMA 1X48A 1NHJA 4F9BB 2L2NA 5ADZA 2FGGA 4X62I 4N3OA 3ADJA 3RMPA 1S4EA 4OX9E 3IWDA 1XHKA 4J8ZA 2DMYA 1Y4UA 1MU5A 1Z5CA 3C4TA 1XNQE 4P78A 3Q6NA 1K47A 1J5EI 1XMOI 4R1FA 2VQFE 1KVKA 3J80C 4DV0E 4DV4E 1ZXNA 2DEJA 3J81Q 1Z0WA 2HFUA 2WW4A 3PYFA 1XMQE 4AQYI 2L6MA 2WZOA 2X36A 2ZITA 4KQVA 4X64I 2L2KB 2UXDI 4DPYA 2X7IA 4XTJA 3JAMQ 2YZTA 2HK3A 2E1RA 4DPXA 4LF8I 2KOUA 2LJPA 1RC7A 4L5NC 3WU6A 1HK7A 4JI2E 1PIEA 4NXNI 4JI5E 1ZM9A 4GKJE 2VE7C 1ZM4A 4DMIA 4F54A 2M1SA 4DR6E 2R42A 2V2VA 1Z5BA 2VF3A 2V85A 4JI4I 2ZM6I 2B7VA 1B62A 4HY1A 1Z0BA 2YT4A 3QT7A 3ZZUA 4DR1I 4DR4I 2O1UA 1RR9A 1X49A 1HNXE 4NXME 4KHPE 4F9AB 1N32E 1H73A 3K85A 1I94I 4IZKA 2B7TA 3HPSA 4IZJA 2J7KA 4X66I 4JI1I 1VISA 1NZ0A 4HACA 1FI4A 1QZRA 4GKKE 2UUAE 1Z0GA 3ZZ0A 2UU9I 2Z5CB 4LFAE 1XNRE 4DV3I 4KZSA 3QT8A 2CZ9A 2V2ZA 2CGEA 3ADLA 2UUCE 4LF9E 2FTXB 1N0UA 4DR2E 4LF4E 2HFSA 4I8OA 4DU7A 5LMNI 4I3HA 2GS8A 2A2CA 5GMDA 5IT9C 4JI7I 2V87A 4K0KE 1STUA 4DUYI 1IBLE 4BCAA 4DV2E 4JI3I 2UXCE 2CG9A 3HTXA 4B3MI 2VF1A 2RSMA 2E1MA 2DB2A 3PYEA 3H4LA 4RPFA 2JOXA 4WUDA 2L8TA 1PKPA 1Z0TA 2M7QA 3VYXA 1WHNA 4M30A 1Y4SA 4B3TE 1HNWI 4ED4A 1Z5AA 1KKHA 2Z5BA 2Q2EB 2NUFA 4JI0I 3AV0A 2LTSA 3T1HI 4JI8E 4JV5E 3ZZTA 2LUPB 1QU6A 3IWCA 1T4LB 1EI1A 4URLA 4DR7E 2H36X 1O0WA 1H72C 1HNZI 4LF7I 4X8WA 4YHHI 2HHHI 2DIXA 4WSPA 1FJGI 5AE2A 3Q6MA 4B3SE 4Z7CA 5CFFE 2F4VE 2LMZA 4DUZI 1N34I 1USUA 2NPFA 1H7SA 2O1WA 1N36I 4FN5A 3K1JA 3FIGA 4WYQB 4BBYA 4DV5E 1S16A 4GEQB 2RS6A 1MX0A 3IWBA 2MC6A 4TUIA 4DR3E 3B78A 1ZBTA 4Q28A 2GQ0A 4B3RI 2CPNA 1N33E 2UUBI 4JI6I 2BV3A 2V8QB 4LU9A 4DV1E 4LFBE 4MYUA 1WHQA 4UT4A 1UEKA 3K17A 4PRVA 2RS7A 1FKAE 2O1TA 1Y6ZA 3HPZA 2B9DA 4FWDA 4OX9I 5FLXC 1USVA 3LMLA 4DR5E 2JY9A 4X65E 1XNQI 3CWVA 3J7AG 5T6JA 3T1YE 2LBSB 3D4JA 2VQFI 1GQEA 4WUCA 3K6QA 3OTOE 4DU8A 4DV0I 4DV4I 5L3JA 4JYAE 4BC7A 1HR0E 3HJCA 4WUBA 4M2ZA 4HYMA 1XMQI 4DV7E 4DKKA 1IBKE 1IBME 4LFCE 3LNUA 4YY3E 4LF6E 4LF5E 5A2QC 1OJ4A 2IHR1 4FW9A 4JI2I 3MSWA 2IOQA 5IWAE 4JI5I 2VQEE 2MC5A 3F6GA 2E5LE 2HKEA 2ODRD 4DV6E 2UXBE 2NA2A 2BM1A 2N3HA 4PU9A 4GKJI 3QT5A 3J80Q 4OOGC 1ZM3A 1EKZA 4DR6I 3WU4A 1NHIA 5FWKA 2LRSA 2LE2A 1ZM2A 5BR8E 1T4OA 2DEIA 2V83A 3WU3A 1PVGA 2NUGA 4LTYA 1HNXI 5LMUE 4NXMI 1Z0CA 4KHPI 1N32I 1J26A 2AJ4A 2B3TB 3Q1QA 4DXLA 3V5RA 5F3WA 1KIJA 1T4NA 1Z59A 3J81C 4X62E 1H74A 1KTVA 1UILA 2EFGA 4MYTA 4GKKI 3JTZA 2HHHE 4BMJA 3JAMC 1SR9A 4IZKB 1X47A 5LL6R 1FWKA 1FWLA 4IZJB 3ZKDA 4IZJD 3DJWA 4LFAI 1XNRI 4TUGA 2JWOA 2FV4B 4HACB 4M1KA 1J5EE 1XMOE 5FLXQ 2K4VA 4LF9I 1DI2A 2V88A 3GONA 4DR2I 4LF4I 3LPSA 2OI2A 4JG4A 4AQYE 1ZXMA 5DNYA 4X64E 3V2UC 2UXDE 2O1VA 4K0KI 2L92A 1IBLI 4DV2I 4LF8E 2Z5EA 2M4IA 4NXNE 1FNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELO A;  5A2Q Q;  3VYY A;  1NHH A;  1N0V C;  4B3T I;  5IT9 Q;  4JI4 E;  2ZM6 E;  3ADI A;  4DR1 E;  4DR4 E;  4ZVI A;  2HKJ A;  4UTG A;  2L2M A;  1I94 E;  2LJH A;  4JI8 I;  4JV5 I;  4X66 E;  2ZBK B;  4JI1 E;  1WUU A;  4DR7 I;  1D6T A;  2UU9 E;  1Z0E A;  3B82 A;  2HK2 A;  1U2R A;  4WFT A;  2XEX A;  2LTR A;  4DV3 E;  4HXZ A;  1MG7 A;  4B3S I;  2V2Q A;  2F4V I;  2L33 A;  5LMN E;  3ZKB A;  2A2D A;  2RTX A;  4JI7 E;  4DV5 I;  3C4B A;  3WU5 A;  4DUY E;  4JI3 E;  4B3M E;  2L3J A;  2L3C A;  4DR3 I;  4PRX A;  4P7A A;  3LTO A;  3B8H A;  1N33 I;  1HNW E;  1RRE A;  4DV1 I;  4LFB I;  4P52 A;  2EZ6 A;  1RQ0 A;  1YZ9 A;  3F0N A;  1A6F A;  2LUQ A;  4JI0 E;  3T1H E;  3ZM7 A;  5GME A;  3P1X A;  1B63 A;  3PYD A;  4DR5 I;  2KHX A;  3M6A A;  4X65 I;  3J7Y p;  3T1Y I;  3PYG A;  1HNZ E;  4LF7 E;  4DPW A;  3QT6 A;  3OTO I;  2UUA I;  4YHH E;  1FJG E;  4JYA I;  1HR0 I;  1BKN A;  2BM0 A;  2N3G A;  1EA6 A;  2NUE A;  1UHZ A;  4DV7 I;  4FWH A;  1IBK I;  3J7A M;  1IBM I;  4LFC I;  3HUL A;  4YY3 I;  1DAR A;  4DUZ E;  4LF6 I;  2MDR A;  4LF5 I;  1N34 E;  2UUC I;  1N36 E;  2V34 A;  4EMD A;  5IWA I;  3ADG A;  2VQE I;  2E5L I;  1YYW A;  4DV6 I;  2UXB I;  4USK A;  1H7U A;  4FWG A;  4Z7Y A;  2V8P A;  1Z0V A;  1YYO A;  3LLH A;  2UXC I;  2R3V A;  4DPU A;  5BR8 I;  2JVA A;  1YYK A;  4B3R E;  5LMU I;  4JI6 E;  2UUB E;  4DPT A;  4USM A;  1X48 A;  1NHJ A;  2L2N A;  4X62 I;  3ADJ A;  1S4E A;  4OX9 E;  1XHK A;  2DMY A;  1MU5 A;  1Z5C A;  3C4T A;  1XNQ E;  1K47 A;  1J5E I;  1XMO I;  4R1F A;  2VQF E;  1KVK A;  3J80 C;  4DV0 E;  4DV4 E;  1ZXN A;  2DEJ A;  3J81 Q;  1Z0W A;  2HFU A;  2WW4 A;  3PYF A;  1XMQ E;  4AQY I;  2ZIT A;  4KQV A;  2X36 A;  4X64 I;  2L2K B;  2UXD I;  4DPY A;  2X7I A;  4XTJ A;  3JAM Q;  2HK3 A;  2E1R A;  4DPX A;  4LF8 I;  2LJP A;  1RC7 A;  3WU6 A;  4JI2 E;  1PIE A;  4NXN I;  4JI5 E;  1ZM9 A;  4GKJ E;  1ZM4 A;  4DR6 E;  2R42 A;  2V2V A;  1Z5B A;  2VF3 A;  4JI4 I;  2ZM6 I;  2B7V A;  1B62 A;  4HY1 A;  1Z0B A;  2YT4 A;  3QT7 A;  3ZZU A;  4DR1 I;  4DR4 I;  1RR9 A;  1X49 A;  1HNX E;  4NXM E;  4KHP E;  1H73 A;  1N32 E;  1I94 I;  2B7T A;  2J7K A;  4X66 I;  4JI1 I;  1VIS A;  1NZ0 A;  4HAC A;  1FI4 A;  1QZR A;  4GKK E;  2UUA E;  1Z0G A;  3ZZ0 A;  2UU9 I;  4LFA E;  1XNR E;  4DV3 I;  3QT8 A;  2CZ9 A;  2V2Z A;  3ADL A;  2UUC E;  4LF9 E;  1N0U A;  4DR2 E;  4LF4 E;  2HFS A;  4DU7 A;  5LMN I;  4I3H A;  2GS8 A;  2A2C A;  5GMD A;  5IT9 C;  4JI7 I;  4K0K E;  1STU A;  4DUY I;  1IBL E;  4DV2 E;  4JI3 I;  2UXC E;  3HTX A;  4B3M I;  2RSM A;  2DB2 A;  3PYE A;  3H4L A;  4RPF A;  4WUD A;  1PKP A;  1Z0T A;  3VYX A;  1WHN A;  4M30 A;  4B3T E;  1HNW I;  4ED4 A;  1Z5A A;  1KKH A;  2Q2E B;  2NUF A;  4JI0 I;  2LTS A;  3T1H I;  4JI8 E;  4JV5 E;  3ZZT A;  2LUP B;  1QU6 A;  1T4L B;  1EI1 A;  4URL A;  4DR7 E;  1O0W A;  1H72 C;  1HNZ I;  4LF7 I;  4X8W A;  4YHH I;  2HHH I;  2DIX A;  1FJG I;  4B3S E;  4Z7C A;  5CFF E;  2F4V E;  4DUZ I;  1N34 I;  2NPF A;  1H7S A;  1N36 I;  4FN5 A;  3K1J A;  4WYQ B;  4DV5 E;  1S16 A;  2RS6 A;  1MX0 A;  3B78 A;  4DR3 E;  1ZBT A;  4B3R I;  2CPN A;  1N33 E;  2UUB I;  4JI6 I;  2BV3 A;  4DV1 E;  4LFB E;  4MYU A;  1WHQ A;  4UT4 A;  1UEK A;  3K17 A;  4PRV A;  2RS7 A;  1FKA E;  4FWD A;  4OX9 I;  5FLX C;  4DR5 E;  2JY9 A;  4X65 E;  1XNQ I;  3CWV A;  3J7A G;  3T1Y E;  2LBS B;  3D4J A;  2VQF I;  1GQE A;  4WUC A;  3OTO E;  4DU8 A;  4DV0 I;  4DV4 I;  5L3J A;  4JYA E;  1HR0 E;  4WUB A;  4M2Z A;  4HYM A;  1XMQ I;  4DV7 E;  4DKK A;  1IBK E;  1IBM E;  4LFC E;  3LNU A;  4YY3 E;  4LF6 E;  4LF5 E;  5A2Q C;  1OJ4 A;  2IHR 1;  4FW9 A;  4JI2 I;  5IWA E;  4JI5 I;  2VQE E;  2E5L E;  2HKE A;  4DV6 E;  2UXB E;  2NA2 A;  2BM1 A;  2N3H A;  4PU9 A;  4GKJ I;  3QT5 A;  3J80 Q;  4OOG C;  1ZM3 A;  1EKZ A;  4DR6 I;  3WU4 A;  1NHI A;  2LRS A;  1ZM2 A;  5BR8 E;  1T4O A;  2DEI A;  3WU3 A;  1PVG A;  2NUG A;  1HNX I;  5LMU E;  4NXM I;  1Z0C A;  4KHP I;  1N32 I;  1J26 A;  2AJ4 A;  2B3T B;  3Q1Q A;  4DXL A;  3V5R A;  1KIJ A;  1T4N A;  1Z59 A;  3J81 C;  4X62 E;  1H74 A;  1KTV A;  1UIL A;  2EFG A;  4MYT A;  4GKK I;  2HHH E;  3JAM C;  1X47 A;  1FWK A;  1FWL A;  5LL6 R;  3ZKD A;  4LFA I;  1XNR I;  4HAC B;  4M1K A;  1J5E E;  1XMO E;  5FLX Q;  4LF9 I;  1DI2 A;  3GON A;  4DR2 I;  4LF4 I;  3LPS A;  2OI2 A;  4JG4 A;  4AQY E;  1ZXM A;  4X64 E;  3V2U C;  2UXD E;  4K0K I;  1IBL I;  4DV2 I;  4LF8 E;  4NXN E;  1FNM A; 
#chains in the Genus database with same CATH topology
 1ELO A;  2V86 A;  2YTE A;  2YTI A;  1YHC A;  2DRP A;  5A2Q Q;  3VYY A;  1NHH A;  4R8O A;  1WXR A;  1N0V C;  2F8B A;  3JU0 A;  4FW4 A;  4B3T I;  2NN6 F;  5IT9 Q;  1R6L A;  2PNM A;  4JI4 E;  2ZM6 E;  3ADI A;  3P06 A;  4DR1 E;  4DR4 E;  4ZVI A;  2HKJ A;  2NN6 E;  3AUZ A;  4P7D A;  4UTG A;  5C0X F;  2L2M A;  1I94 E;  4LCF A;  2LJH A;  4BS9 A;  4JI8 I;  4JV5 I;  5DRR A;  4R2A A;  1GTK A;  2EPM X;  5KL6 A;  4X66 E;  2Z5C A;  2ZBK B;  5C0X E;  2DSY A;  4JI1 E;  4NBQ A;  1YPN A;  4BA2 A;  1XXE A;  2J65 A;  1X6H A;  2Z5B B;  1WUU A;  2PNL A;  4DR7 I;  1D6T A;  2UU9 E;  1Z0E A;  3B82 A;  2HK2 A;  2EWL A;  4IJD A;  1U2R A;  4WFT A;  2EN3 A;  4RHB B;  2XEX A;  5LLQ A;  2LTR A;  4DV3 E;  3PRY A;  1BBG A;  4O5G A;  4WPY A;  4HXZ A;  1MG7 A;  1DQ3 A;  4B3S I;  2JEA A;  4GZN C;  5AE3 A;  4N4R B;  2V2Q A;  5K36 C;  2EOQ A;  2F4V I;  2GO3 A;  3PS1 A;  1UDN A;  2L33 A;  5LMN E;  2EMH A;  2A2D A;  2JT2 A;  3ZKB A;  2RTX A;  2EMX A;  3M7N D;  2ENC A;  2EMA A;  4JI7 E;  4DV5 I;  3C4B A;  2EPR A;  3HXL A;  4BHC A;  4HTG A;  1T39 A;  3UK3 C;  4DUY E;  2HC5 A;  2YU5 A;  3WU5 A;  2V89 A;  4JI3 E;  4R2P A;  4B3M E;  2HJJ A;  2LCE A;  2L3J A;  3C6M A;  1YFH A;  4F9C B;  2EMC A;  2L3C A;  4KWY A;  2D9H A;  2YU8 A;  4DR3 I;  5A6A A;  2JR1 A;  2EN8 A;  4ZYG A;  4PRX A;  4P7A A;  4F6N A;  3LTO A;  4AIM A;  2BA0 G;  2KON A;  3B8H A;  1N33 I;  1HNW E;  4U3D A;  4AID A;  1RRE A;  4MLV A;  2JEB B;  2WNR A;  4DV1 I;  2EPL X;  2I9I A;  4LFB I;  4L8N A;  4P52 A;  2EOJ A;  2EZ6 A;  3PS3 A;  1RQ0 A;  1YZ9 A;  3F0N A;  1A6F A;  2PO0 B;  2LUQ A;  2I13 A;  4JI0 E;  5K36 A;  3T1H E;  3ZM7 A;  2G7H A;  5GME A;  4FW6 A;  1ZBQ A;  2DMI A;  2NN6 C;  3OML A;  1AH5 A;  1TF3 A;  2IOP A;  3KWR A;  5DNX A;  3P1X A;  5AAS A;  2GPI A;  4NHR A;  2BA1 G;  1B63 A;  3PYD A;  3QG5 C;  4DR5 I;  2KHX A;  2PO2 A;  3M6A A;  2YSO A;  4X65 I;  3ZOQ B;  3J7Y p;  2R76 A;  3T1Y I;  5C0X C;  4BC9 A;  2BR2 A;  4MLQ A;  4O4K A;  1UDS A;  3PYG A;  1HNZ E;  1TN9 A;  4LF7 E;  4R03 A;  4DPW A;  2EM5 A;  3QT6 A;  3OTO I;  2EN1 A;  2UUA I;  4YHH E;  1E3H A;  1X5W A;  2CTD A;  1OYR A;  1FJG E;  5K36 F;  3H09 A;  4JYA I;  1HR0 I;  2EOM A;  1BKN A;  2EM0 A;  2BM0 A;  2N3G A;  2NUE A;  1UHZ A;  1EA6 A;  1OYS A;  4DV7 I;  2LT7 A;  4FWH A;  5LMN I;  1IBK I;  3DF6 A;  1IBM I;  2EM4 A;  2EQ0 A;  3HUL A;  4LFC I;  4YY3 I;  1DAR A;  4DUZ E;  2WP8 A;  4LF6 I;  2MDR A;  2C39 B;  1N34 E;  2YTN A;  4LF5 I;  2UUC I;  2PNZ A;  2JE6 A;  1N36 E;  2EMF A;  3P3G A;  2V34 A;  1YUI A;  1GZ6 A;  2EJ4 A;  4EMD A;  5IWA I;  3ADG A;  2VQE I;  2JOB A;  2E5L I;  4ZYE A;  5KL2 A;  1YYW A;  5DRP A;  4DV6 I;  2UXB I;  4USK A;  1H7U A;  4FWG A;  2NN6 A;  4Z7Y A;  2EE8 A;  2EOZ A;  2BA0 D;  3MHH C;  2V8P A;  1Z0V A;  2EM2 A;  2Q8U A;  3HQ1 A;  5ELW A;  4M0V A;  3TQM A;  1YYO A;  1TF6 A;  3LLH A;  5AE1 A;  4LCG A;  3F6H A;  2UXC I;  3L7Z A;  2WBT A;  2ODR C;  4R2S A;  1JK1 A;  2R3V A;  4DPU A;  2EOE A;  1G2D C;  3VK6 A;  5C0X A;  1IQS A;  2EMY A;  3BGH A;  2JVA A;  1YYK A;  3UHM A;  4B3R E;  5LMU I;  4JI6 E;  2UUB E;  4DPT A;  1F2I G;  4USM A;  2EPX A;  1X48 A;  2RSI A;  4F9B B;  1NHJ A;  2L2N A;  5ADZ A;  5DRO A;  2YRH A;  2FGG A;  2BA1 D;  4X62 I;  4N3O A;  1IQO A;  5JEA B;  2YTD A;  3M85 D;  2YTF A;  3ADJ A;  3RMP A;  1A1K A;  5JEA D;  4R2E A;  1AAY A;  1S4E A;  2EML A;  4OX9 E;  2NAB A;  2EOY A;  3IWD A;  1XHK A;  4MU0 A;  4J8Z A;  2DMY A;  2HGH A;  1Y4U A;  1MU5 A;  5AC5 A;  1Z5C A;  2ELY A;  3C4T A;  1XNQ E;  2N8X A;  4P78 A;  3Q6N A;  4U3B A;  1K47 A;  1J5E I;  1XMO I;  4R1F A;  2VQF E;  4MU4 A;  3B4T A;  3BF2 A;  1KVK A;  4BHB A;  1YUJ A;  2C37 B;  3J80 C;  4FK5 C;  5KL7 A;  4DV0 E;  4DV4 E;  4ZYH A;  1ZXN A;  2DEJ A;  3THO B;  3J81 Q;  4IFD B;  1RHY A;  4MQY A;  3BID A;  1Z0W A;  2HFU A;  4OZE A;  2WW4 A;  3PYF A;  1XMQ E;  4AQY I;  4OO1 B;  2L6M A;  2WZO A;  2X36 A;  2ZIT A;  3DD6 A;  4KQV A;  2L2K B;  4X64 I;  2UXD I;  2AE8 A;  3U1K A;  4DPY A;  2X7I A;  4XTJ A;  3JAM Q;  4OO1 D;  4LPF A;  2YZT A;  2F1D A;  2HK3 A;  2E1R A;  4DPX A;  4LF8 I;  4BA1 A;  2KOU A;  2LJP A;  1RC7 A;  4L5N C;  3WU6 A;  2LJU A;  2EL6 A;  1YSA C;  4JI2 E;  1HK7 A;  1PIE A;  3MHS C;  4NXN I;  4JI5 E;  2EP3 A;  3CDI A;  3P76 A;  1EH7 A;  1ZM9 A;  4QNK A;  4ZYD A;  4GKJ E;  2VE7 C;  2EMK A;  5A6J A;  1ZM4 A;  4DMI A;  4F54 A;  2M1S A;  4DR6 E;  2R42 A;  2V2V A;  4MDT A;  2EPC A;  1Z5B A;  2VF3 A;  2V85 A;  4JI4 I;  2ZM6 I;  2B7V A;  1B62 A;  4HY1 A;  1Z0B A;  2YT4 A;  3QT7 A;  1A1I A;  3ZZU A;  4DR1 I;  2O1U A;  1RR9 A;  4DR4 I;  1WJP A;  1X49 A;  2LV2 A;  1HNX E;  5AC4 A;  4F9A B;  4R2R A;  3EPK A;  4NXM E;  1N32 E;  4KHP E;  1H73 A;  3K85 A;  3PS2 A;  4IZK A;  1I94 I;  2B7T A;  3HPS A;  4IZJ A;  4IS1 C;  1Y5Y A;  4R2D A;  2ENA A;  2J7K A;  2M9A A;  4X66 I;  4ISA A;  5IXM B;  4JI1 I;  1VIS A;  1NZ0 A;  4HAC A;  1FI4 A;  2C38 A;  1QZR A;  4GKK E;  2UUA E;  3GCM A;  1Z0G A;  5EL9 A;  3ZZ0 A;  2UU9 I;  2EMW A;  1P47 A;  1X6E A;  2Z5C B;  4BA2 B;  2ADR A;  4LFA E;  2PRT A;  1XNR E;  4DV3 I;  2EMG A;  4KZS A;  3QT8 A;  2CZ9 A;  5KL4 A;  2V2Z A;  2CGE A;  3ADL A;  2UUC E;  4LF9 E;  2FTX B;  1N0U A;  4MU1 A;  4DR2 E;  3M85 G;  4LF4 E;  2HFS A;  2PO1 A;  4F6M A;  4I8O A;  2EOI A;  2EPA A;  4I3H A;  2EN2 A;  2GS8 A;  3L00 A;  2A2C A;  4FW5 A;  2YSP A;  5GMD A;  2MKD A;  5IT9 C;  3P3E A;  3KZZ A;  4JI7 I;  3EPJ A;  2V87 A;  2JEA B;  4K0K E;  1STU A;  4DUY I;  2EQ3 A;  4BCA A;  4DV2 E;  1IBL E;  4JI3 I;  2UXC E;  2CG9 A;  1LLM C;  3HTX A;  4B3M I;  2EOF A;  4FW7 A;  2VF1 A;  2K7I A;  2RSM A;  2E1M A;  1UN6 B;  2DB2 A;  4R2Q A;  3PYE A;  4LCH A;  1T38 A;  3H4L A;  2JOX A;  4O43 A;  4RPF A;  2L8T A;  4WUD A;  4R2C A;  1PKP A;  2DGC A;  1Z0T A;  2M7Q A;  3VYX A;  1WHN A;  4M30 A;  3C6K A;  3THN A;  1A1G A;  1Y4S A;  4AM3 A;  4B3T E;  1HNW I;  2YTQ A;  2A25 A;  4QNJ A;  2EOS A;  4J3D A;  4ED4 A;  5KL5 A;  2EMB A;  1Z5A A;  2C37 A;  1KKH A;  2GO4 A;  2Z5B A;  2Q2E B;  2NUF A;  4JI0 I;  5JEA F;  1VI7 A;  3AV0 A;  2LTS A;  3T1H I;  4JI8 E;  2YTG A;  4JV5 E;  3ZZT A;  1A1J A;  2EM8 A;  2R1F A;  2YTP A;  3EPH A;  1NEI A;  2LUP B;  1QU6 A;  2YTJ A;  3IWC A;  2WNR B;  5JEA E;  1PJS A;  1T4L B;  2WBS A;  4WXC A;  1PJQ A;  1EI1 A;  1YH8 A;  5K36 B;  4URL A;  4DR7 E;  2H36 X;  1O0W A;  1H72 C;  5IV8 B;  1HNZ I;  4LF7 I;  5KL3 A;  2EPO A;  1UDQ A;  4X8W A;  2JP9 A;  5DNL A;  4Q35 B;  2EOR A;  4X9J A;  4YHH I;  2MKN A;  2HHH I;  2CVE A;  2DIX A;  4WSP A;  2PO2 B;  1FJG I;  1B69 A;  5AE2 A;  1A1F A;  3Q6M A;  4B3S E;  4Z7C A;  2BR2 B;  1X3C A;  5CFF E;  4OO1 F;  2F4V E;  2EOO A;  4NZV A;  4IFD E;  2LMZ A;  4DUZ I;  2IER A;  2E72 A;  1USU A;  1N34 I;  2EMZ A;  3J7A M;  2EOH A;  2NPF A;  4OO1 E;  1H7S A;  2O1W A;  1N36 I;  4FN5 A;  5DRQ A;  2LO3 A;  3K1J A;  4O24 A;  2LVH A;  3FIG A;  4WYQ B;  4BBY A;  4DV5 E;  1S16 A;  4GEQ B;  1Z1B A;  2RS6 A;  1MX0 A;  1MGT A;  2DLK A;  4IFD D;  2VES A;  2WP8 B;  1PDA A;  3IWB A;  1L4S A;  2PNZ B;  2JE6 B;  1KYQ A;  2JEB A;  1EH6 A;  2EQ1 A;  2MC6 A;  4TUI A;  4DR3 E;  3B78 A;  3GLL A;  3HKM A;  1G2F C;  1ZBT A;  2PO0 A;  5A6B D;  4Q28 A;  2GQ0 A;  2DLQ A;  2EM9 A;  2NN6 B;  4B3R I;  2CPN A;  1N33 E;  2UUB I;  4JI6 I;  1A1L A;  2BBG A;  2NN6 D;  2BV3 A;  2V8Q B;  4LU9 A;  4DV1 E;  2O3Z A;  4LFB E;  4OKG A;  4GQU A;  2EM6 A;  1WHQ A;  3L7Z B;  4MYU A;  4UT4 A;  5C0X B;  1UEK A;  1E3P A;  3K17 A;  4PRV A;  2RS7 A;  1FKA E;  2O1T A;  1Y6Z A;  5C0X D;  2JYA A;  1EH8 A;  3HPZ A;  2B9D A;  4M9V C;  4FWD A;  4OX9 I;  1DGC A;  1BB8 A;  3VHT B;  5FLX C;  4WXD A;  4F2J C;  1BBO A;  1USV A;  3LML A;  1JK2 A;  4DR5 E;  2JY9 A;  1QNT A;  4X65 E;  2RPC A;  3CWV A;  1X6F A;  1XNQ I;  5A6K A;  3J7A G;  5T6J A;  3T1Y E;  2LBS B;  5JEA C;  1N3G A;  5TSE A;  5A69 A;  3D4J A;  2VQF I;  1ZR9 A;  3EPL A;  1GQE A;  2EPZ A;  2EOX A;  4WUC A;  3K6Q A;  2CT1 A;  2C39 A;  3OTO E;  2VRD A;  4DU8 A;  2CSH A;  4DV0 I;  4DV4 I;  5L3J A;  4JYA E;  4BC7 A;  1HR0 E;  3HJC A;  4WUB A;  4M2Z A;  4HYM A;  1XMQ I;  2YPN A;  4DV7 E;  1UBD C;  4DKK A;  1P42 A;  1IBK E;  2YWQ A;  1IBM E;  4LFC E;  3EQ1 A;  3LNU A;  4WSG A;  4YY3 E;  4LF6 E;  2EPK X;  4LF5 E;  2EM7 A;  5A2Q C;  1ZU1 A;  1OJ4 A;  4IFD C;  2IHR 1;  4FW9 A;  4JI2 I;  3MSW A;  2IOQ A;  5IWA E;  4JI5 I;  2YRM A;  2VQE E;  4MU3 A;  2MC5 A;  3F6G A;  2E5L E;  1Y60 A;  2ELZ A;  1MEY C;  2HKE A;  4OO1 C;  2ODR D;  4DV6 E;  2UXB E;  2EN4 A;  2EPN A;  2N3H A;  2NA2 A;  2BM1 A;  4PU9 A;  4GKJ I;  2YRK A;  3QT5 A;  3J80 Q;  2EMI A;  4BA1 B;  3NZK A;  4OOG C;  1ZM3 A;  1EKZ A;  5BR8 I;  2YTO A;  3WU4 A;  1NHI A;  1IMU A;  1OYP A;  4DU7 A;  4DR6 I;  5FWK A;  2LE2 A;  2LRS A;  1ZM2 A;  5BR8 E;  1T4O A;  2DEI A;  2GLI A;  2V83 A;  5JEA A;  3GME A;  3WU3 A;  1PVG A;  2JPA A;  4LTY A;  4RH8 A;  2NUG A;  1HNX I;  5LMU E;  4NXM I;  1Z0C A;  4KHP I;  1N32 I;  3M99 B;  1J26 A;  2AJ4 A;  2B3T B;  3Q1Q A;  3ECR A;  4DXL A;  3U1Y A;  5F3W A;  1KIJ A;  3V5R A;  2EN7 A;  1NCS A;  1T4N A;  1Z59 A;  3J81 C;  2IES A;  4FW3 A;  4X62 E;  2EPU A;  1H74 A;  1KTV A;  4LOM A;  1UDO A;  1UIL A;  3P3C A;  4HEI A;  2EFG A;  2RQL A;  4MYT A;  4WX9 A;  4GKK I;  3JTZ A;  2HHH E;  4BMJ A;  2ENH A;  1SR9 A;  3JAM C;  4IZK B;  1X47 A;  5LL6 R;  1FWK A;  1FWL A;  2WCC 3;  4IZJ B;  4IFD A;  3ZKD A;  3H1C A;  4IZJ D;  3DJW A;  4LFA I;  3KRN A;  4TUG A;  1XNR I;  5K36 E;  2JWO A;  2FV4 B;  4HAC B;  4M1K A;  1J5E E;  4OO1 A;  1XMO E;  5FLX Q;  1R6M A;  2C38 B;  2K4V A;  5EKW A;  4IS9 A;  2EN6 A;  2EPP A;  4LF9 I;  1WRJ A;  1DI2 A;  1PJT A;  2V88 A;  3GON A;  1SFE A;  4DR2 I;  1A1H A;  5A6B A;  4LF4 I;  3LPS A;  2GHF A;  2EM3 A;  2J7J A;  2OI2 A;  2BB8 A;  5K36 D;  4JG4 A;  4AQY E;  1ZXM A;  5DNY A;  2EL4 A;  4X64 E;  3V2U C;  2JXP A;  2UXD E;  3BBG A;  2O1V A;  4K0K I;  2L92 A;  3KZY A;  1ZAA C;  4IFD F;  1IBL I;  4DV2 I;  4LF8 E;  1KJK A;  3CDJ A;  2Z5E A;  2PO1 B;  2WBU A;  2M4I A;  2MDG A;  4NXN E;  3M7N G;  2EL5 A;  1FNM A;  1RMD A; 
#chains in the Genus database with same CATH homology
 1ELO A;  2V86 A;  5A2Q Q;  3VYY A;  1NHH A;  4R8O A;  1WXR A;  1N0V C;  2F8B A;  3JU0 A;  4B3T I;  5IT9 Q;  2PNM A;  4JI4 E;  2ZM6 E;  3ADI A;  3P06 A;  4DR1 E;  4DR4 E;  4ZVI A;  2HKJ A;  3AUZ A;  4P7D A;  4UTG A;  2L2M A;  1I94 E;  2LJH A;  4BS9 A;  4JI8 I;  4JV5 I;  4X66 E;  2Z5C A;  2ZBK B;  2DSY A;  4JI1 E;  2Z5B B;  1WUU A;  2PNL A;  4DR7 I;  1D6T A;  2UU9 E;  1Z0E A;  3B82 A;  2HK2 A;  2EWL A;  1U2R A;  4WFT A;  2XEX A;  2LTR A;  4DV3 E;  3PRY A;  4WPY A;  4HXZ A;  1MG7 A;  1DQ3 A;  4B3S I;  5AE3 A;  2V2Q A;  2F4V I;  2L33 A;  5LMN E;  3ZKB A;  2A2D A;  2RTX A;  4JI7 E;  4DV5 I;  3C4B A;  3HXL A;  3WU5 A;  4DUY E;  2V89 A;  4JI3 E;  4B3M E;  2L3J A;  4F9C B;  2L3C A;  4DR3 I;  2JR1 A;  4PRX A;  4P7A A;  3LTO A;  2KON A;  3B8H A;  1N33 I;  1HNW E;  1RRE A;  4DV1 I;  4LFB I;  4L8N A;  4P52 A;  2EZ6 A;  1RQ0 A;  1YZ9 A;  3F0N A;  1A6F A;  2LUQ A;  4JI0 E;  3T1H E;  3ZM7 A;  2G7H A;  5GME A;  1ZBQ A;  3OML A;  2IOP A;  3KWR A;  3P1X A;  5AAS A;  1B63 A;  3PYD A;  4DR5 I;  2KHX A;  3M6A A;  4X65 I;  3ZOQ B;  3J7Y p;  3T1Y I;  4BC9 A;  3PYG A;  1HNZ E;  4LF7 E;  4R03 A;  4DPW A;  3QT6 A;  3OTO I;  2UUA I;  4YHH E;  1FJG E;  3H09 A;  4JYA I;  1HR0 I;  1BKN A;  2BM0 A;  2N3G A;  1EA6 A;  2NUE A;  1UHZ A;  4DV7 I;  4FWH A;  1IBK I;  3J7A M;  3DF6 A;  1IBM I;  4LFC I;  3HUL A;  4YY3 I;  1DAR A;  4DUZ E;  4LF6 I;  2MDR A;  4LF5 I;  1N34 E;  2UUC I;  1N36 E;  2V34 A;  1GZ6 A;  4EMD A;  5IWA I;  3ADG A;  2VQE I;  2JOB A;  2E5L I;  1YYW A;  4DV6 I;  2UXB I;  4USK A;  1H7U A;  4FWG A;  4Z7Y A;  2V8P A;  1Z0V A;  3HQ1 A;  4M0V A;  1YYO A;  3LLH A;  5AE1 A;  3F6H A;  2UXC I;  2R3V A;  2ODR C;  4DPU A;  5BR8 I;  3VK6 A;  2JVA A;  1YYK A;  4B3R E;  5LMU I;  4JI6 E;  2UUB E;  4DPT A;  4USM A;  1X48 A;  1NHJ A;  4F9B B;  2L2N A;  5ADZ A;  2FGG A;  4X62 I;  4N3O A;  3ADJ A;  3RMP A;  1S4E A;  4OX9 E;  3IWD A;  1XHK A;  4J8Z A;  2DMY A;  1Y4U A;  1MU5 A;  1Z5C A;  3C4T A;  1XNQ E;  4P78 A;  3Q6N A;  1K47 A;  1J5E I;  1XMO I;  4R1F A;  2VQF E;  1KVK A;  3J80 C;  4DV0 E;  4DV4 E;  1ZXN A;  2DEJ A;  3J81 Q;  1Z0W A;  2HFU A;  2WW4 A;  3PYF A;  1XMQ E;  4AQY I;  2L6M A;  2WZO A;  2X36 A;  2ZIT A;  4KQV A;  4X64 I;  2L2K B;  2UXD I;  4DPY A;  2X7I A;  4XTJ A;  3JAM Q;  2YZT A;  2HK3 A;  2E1R A;  4DPX A;  4LF8 I;  2KOU A;  2LJP A;  1RC7 A;  4L5N C;  3WU6 A;  1HK7 A;  4JI2 E;  1PIE A;  4NXN I;  4JI5 E;  1ZM9 A;  4GKJ E;  2VE7 C;  1ZM4 A;  4DMI A;  4F54 A;  2M1S A;  4DR6 E;  2R42 A;  2V2V A;  1Z5B A;  2VF3 A;  2V85 A;  4JI4 I;  2ZM6 I;  2B7V A;  1B62 A;  4HY1 A;  1Z0B A;  2YT4 A;  3QT7 A;  3ZZU A;  4DR1 I;  4DR4 I;  2O1U A;  1RR9 A;  1X49 A;  1HNX E;  4NXM E;  4KHP E;  4F9A B;  1N32 E;  1H73 A;  3K85 A;  1I94 I;  4IZK A;  2B7T A;  3HPS A;  4IZJ A;  2J7K A;  4X66 I;  4JI1 I;  1VIS A;  1NZ0 A;  4HAC A;  1FI4 A;  1QZR A;  4GKK E;  2UUA E;  1Z0G A;  3ZZ0 A;  2UU9 I;  2Z5C B;  4LFA E;  1XNR E;  4DV3 I;  4KZS A;  3QT8 A;  2CZ9 A;  2V2Z A;  2CGE A;  3ADL A;  2UUC E;  4LF9 E;  2FTX B;  1N0U A;  4DR2 E;  4LF4 E;  2HFS A;  4I8O A;  4DU7 A;  5LMN I;  4I3H A;  2GS8 A;  2A2C A;  5GMD A;  5IT9 C;  4JI7 I;  2V87 A;  4K0K E;  1STU A;  4DUY I;  1IBL E;  4BCA A;  4DV2 E;  4JI3 I;  2UXC E;  2CG9 A;  3HTX A;  4B3M I;  2VF1 A;  2RSM A;  2E1M A;  2DB2 A;  3PYE A;  3H4L A;  4RPF A;  2JOX A;  4WUD A;  2L8T A;  1PKP A;  1Z0T A;  2M7Q A;  3VYX A;  1WHN A;  4M30 A;  1Y4S A;  4B3T E;  1HNW I;  4ED4 A;  1Z5A A;  1KKH A;  2Z5B A;  2Q2E B;  2NUF A;  4JI0 I;  3AV0 A;  2LTS A;  3T1H I;  4JI8 E;  4JV5 E;  3ZZT A;  2LUP B;  1QU6 A;  3IWC A;  1T4L B;  1EI1 A;  4URL A;  4DR7 E;  2H36 X;  1O0W A;  1H72 C;  1HNZ I;  4LF7 I;  4X8W A;  4YHH I;  2HHH I;  2DIX A;  4WSP A;  1FJG I;  5AE2 A;  3Q6M A;  4B3S E;  4Z7C A;  5CFF E;  2F4V E;  2LMZ A;  4DUZ I;  1N34 I;  1USU A;  2NPF A;  1H7S A;  2O1W A;  1N36 I;  4FN5 A;  3K1J A;  3FIG A;  4WYQ B;  4BBY A;  4DV5 E;  1S16 A;  4GEQ B;  2RS6 A;  1MX0 A;  3IWB A;  2MC6 A;  4TUI A;  4DR3 E;  3B78 A;  1ZBT A;  4Q28 A;  2GQ0 A;  4B3R I;  2CPN A;  1N33 E;  2UUB I;  4JI6 I;  2BV3 A;  2V8Q B;  4LU9 A;  4DV1 E;  4LFB E;  4MYU A;  1WHQ A;  4UT4 A;  1UEK A;  3K17 A;  4PRV A;  2RS7 A;  1FKA E;  2O1T A;  1Y6Z A;  3HPZ A;  2B9D A;  4FWD A;  4OX9 I;  5FLX C;  1USV A;  3LML A;  4DR5 E;  2JY9 A;  4X65 E;  1XNQ I;  3CWV A;  3J7A G;  5T6J A;  3T1Y E;  2LBS B;  3D4J A;  2VQF I;  1GQE A;  4WUC A;  3K6Q A;  3OTO E;  4DU8 A;  4DV0 I;  4DV4 I;  5L3J A;  4JYA E;  4BC7 A;  1HR0 E;  3HJC A;  4WUB A;  4M2Z A;  4HYM A;  1XMQ I;  4DV7 E;  4DKK A;  1IBK E;  1IBM E;  4LFC E;  3LNU A;  4YY3 E;  4LF6 E;  4LF5 E;  5A2Q C;  1OJ4 A;  2IHR 1;  4FW9 A;  4JI2 I;  3MSW A;  2IOQ A;  5IWA E;  4JI5 I;  2VQE E;  2MC5 A;  3F6G A;  2E5L E;  2HKE A;  2ODR D;  4DV6 E;  2UXB E;  2NA2 A;  2BM1 A;  2N3H A;  4PU9 A;  4GKJ I;  3QT5 A;  3J80 Q;  4OOG C;  1ZM3 A;  1EKZ A;  4DR6 I;  3WU4 A;  1NHI A;  5FWK A;  2LRS A;  2LE2 A;  1ZM2 A;  5BR8 E;  1T4O A;  2DEI A;  2V83 A;  3WU3 A;  1PVG A;  2NUG A;  4LTY A;  1HNX I;  5LMU E;  4NXM I;  1Z0C A;  4KHP I;  1N32 I;  1J26 A;  2AJ4 A;  2B3T B;  3Q1Q A;  4DXL A;  3V5R A;  5F3W A;  1KIJ A;  1T4N A;  1Z59 A;  3J81 C;  4X62 E;  1H74 A;  1KTV A;  1UIL A;  2EFG A;  4MYT A;  4GKK I;  3JTZ A;  2HHH E;  4BMJ A;  3JAM C;  1SR9 A;  4IZK B;  1X47 A;  5LL6 R;  1FWK A;  1FWL A;  4IZJ B;  3ZKD A;  4IZJ D;  3DJW A;  4LFA I;  1XNR I;  4TUG A;  2JWO A;  2FV4 B;  4HAC B;  4M1K A;  1J5E E;  1XMO E;  5FLX Q;  2K4V A;  4LF9 I;  1DI2 A;  2V88 A;  3GON A;  4DR2 I;  4LF4 I;  3LPS A;  2OI2 A;  4JG4 A;  4AQY E;  1ZXM A;  5DNY A;  4X64 E;  3V2U C;  2UXD E;  2O1V A;  4K0K I;  2L92 A;  1IBL I;  4DV2 I;  4LF8 E;  2Z5E A;  2M4I A;  4NXN E;  1FNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...