5LMUE

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmuE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuE02
5IT9C 4DXLA 1HNWI 2Q2EB 1RR9A 2VF3A 2VQFI 3B82A 1D6TA 1VISA 4KHPI 2N3GA 4DR2I 1XNRE 4LF4E 2HKJA 2LUQA 2KHXA 4FWGA 4DR4E 4LFBE 1I94I 4JYAE 4X62I 4DUZI 5LL6R 1GQEA 4LF9I 4YY3E 2RTXA 2V8PA 1BKNA 3ZKDA 3WU5A 1Z0VA 4DR1I 3B78A 4JI3I 1ELOA 3F0NA 1RQ0A 1ZBTA 5IWAE 1T4LB 3HULA 4HXZA 2EFGA 3VYYA 2E5LE 1IBKI 4LF8I 1N36I 2V34A 3WU6A 4URLA 3HTXA 1KIJA 2OI2A 1XHKA 1IBLE 4X62E 4DV1E 3ZKBA 3LTOA 4JI5I 5FLXC 4B3SI 4DV6I 3QT5A 4B3MI 2L3JA 4JI7E 4JI2I 3VYXA 3PYFA 2L33A 3JAMQ 2RS6A 3JAMC 4FWHA 1EA6A 1X48A 3PYGA 2E1RA 4DV3E 2L3CA 1YYOA 2JY9A 4JV5I 2NA2A 2MDRA 1N0UA 2ZITA 4HACB 3C4TA 2B7VA 2DMYA 5BR8I 1MU5A 4DV4E 4ED4A 4DV1I 4JI6E 2HHHE 4B3SE 4LFCI 4UTGA 2A2DA 3LLHA 2F4VI 3J7Yp 5CFFE 4AQYE 3ADIA 1K47A 3ZZUA 4DV0I 4DPYA 1ZXNA 1O0WA 4B3TE 4YHHE 1UHZA 4X66I 1FJGE 4YY3I 1YYWA 3WU3A 2HKEA 2NUFA 2GS8A 4GKJI 4RPFA 2UUAI 1KTVA 2HFSA 3J80Q 4UT4A 1ZXMA 3H4LA 4FW9A 2E5LI 1I94E 4DR4I 4LFBI 4DR7E 1HR0E 4M1KA 3T1HE 2DB2A 4JI8E 4JI4E 4NXNI 1FKAE 2JVAA 1KVKA 4P7AA 1HNZE 4JG4A 3QT6A 1N33I 1HNXI 5LMNE 1XMQE 2DEIA 4B3ME 1STUA 4M30A 4JI2E 4JI7I 1MX0A 3P1XA 2LRSA 1N32I 4WUBA 4JI1I 4DV5E 1H73A 2EZ6A 1FWKA 2HFUA 2BM0A 5FLXQ 4GKJE 1Z59A 2UXBE 4DPTA 2UUAE 4LF7E 3WU4A 1N36E 4LF6E 3PYDA 2X7IA 4KQVA 2VQEE 1PIEA 2V2QA 1KKHA 4WYQB 1HR0I 4LFAI 2CPNA 3QT7A 1U2RA 3T1YI 1WUUA 3PYEA 4OX9I 2V2VA 1RREA 4JI6I 4EMDA 2B7TA 1N33E 4DPWA 2L2NA 2XEXA 2RS7A 1XMQI 4USMA 2F4VE 4X65I 1X47A 4AQYI 2ZBKB 4DUZE 1N34I 1N32E 3V2UC 4JI1E 2UXDI 4MYUA 2R42A 4B3TI 4FWDA 2LUPB 2LTSA 1NHJA 2ZM6I 1FNMA 4Z7CA 1FJGI 4X64E 3QT8A 2VQEI 4LF5I 2J7KA 1B63A 4DV4I 4JI0E 4DV7E 5IWAI 4WUDA 4MYTA 4OOGC 3OTOI 4LF8E 4PRVA 4DV2E 1Z5AA 1MG7A 4XTJA 5LMUI 1IBLI 4DUYE 2HK2A 1Z0WA 1NHIA 4NXNE 4DV6E 2YT4A 1YZ9A 1NZ0A 2IHR1 2UXDE 2B3TB 3J7AG 1XNQE 3GONA 2UU9I 4FN5A 2ZM6E 1HNXE 1Z0BA 1A6FA 4LF5E 4ZVIA 2NPFA 3OTOE 2NUGA 2UXBI 4KHPE 4JI8I 5A2QQ 4JI4I 4GKKI 3ZZTA 1H7UA 1T4OA 2UUBE 4DR3I 3ADJA 1H72C 1ZM2A 4DUYI 3LPSA 2LBSB 4HY1A 1XNQI 2UU9E 4B3RI 1XMOE 2CZ9A 2UUCI 4WFTA 4X65E 2DIXA 4Z7YA 1NHHA 3J81Q 4LF6I 3J81C 3J80C 2DEJA 4PU9A 4K0KE 1EI1A 1WHQA 2L2MA 2N3HA 1HNWE 2UXCI 3T1YE 1S4EA 1DI2A 4JI0I 3J7AM 1Z0GA 1X49A 4DR7I 4X8WA 1Z0CA 1XNRI 3ADGA 4DV2I 1N34E 1UEKA 3K17A 5IT9Q 2LJHA 2A2CA 1HNZI 4M2ZA 2V2ZA 3M6AA 4DR5I 4NXMI 2L2KB 1WHNA 1DARA 3B8HA 1FWLA 2RSMA 1J26A 4X64I 3Q1QA 2LJPA 1Z5BA 1ZM3A 3CWVA 4DV5I 3LNUA 4DV7I 2HK3A 4HYMA 4DR6I 4JI3E 4LF7I 2UXCE 3ZZ0A 4LF4I 4PRXA 1S16A 4DPXA 1H74A 2NUEA 2HHHI 1QU6A 1IBME 4LFAE 1FI4A 4I3HA 1Z0EA 4LF9E 1N0VC 2BV3A 1UILA 4OX9E 4WUCA 3V5RA 4DR5E 4JI5E 4NXME 3D4JA 4R1FA 2X36A 1ZM4A 1Z5CA 4X66E 4DR1E 5A2QC 4YHHI 5GMDA 1J5EI 4B3RE 5GMEA 1XMOI 1EKZA 5L3JA 4DR6E 1IBKE 4HACA 1T4NA 1OJ4A 4GKKE 4P52A 2LTRA 2BM1A 4K0KI 4DR3E 4JV5E 2UUBI 1ZM9A 1IBMI 3T1HI 2VQFE 3ADLA 4DKKA 1PKPA 5BR8E 2WW4A 4DR2E 1RC7A 4DU8A 3C4BA 3K1JA 3ZM7A 5LMUE 2UUCE 4DPUA 4LFCE 5LMNI 4JYAI 2R3VA 1QZRA 1PVGA 1B62A 1H7SA 1J5EE 1YYKA 4DV0E 4DU7A 4DV3I 1Z0TA 4USKA 2AJ4A
chains in the Genus database with same CATH superfamily
5TSEA 1MEYC 5IT9C 1JK2A 4DXLA 1WRJA 2V85A 1HNWI 2EOSA 2Q2EB 3IWDA 4LTYA 4BA1A 2EN6A 1RR9A 2DLKA 2C38B 3P3CA 2YTIA 2EOFA 1T39A 2VF3A 2N8XA 2VQFI 3K6QA 4IZKB 3B82A 1D6TA 1VISA 5ELWA 2GQ0A 4O4KA 3EQ1A 4KHPI 2N3GA 2EMCA 4DR2I 4F9BB 1XNRE 4LF4E 4WSGA 2LUQA 2HKJA 3HPZA 2YTJA 2EMWA 1MGTA 2KHXA 3EPKA 2L8TA 3KZZA 3LMLA 2AE8A 4FWGA 4DR4E 4LFBE 2DMIA 2E1MA 4IZJD 4JYAE 2PO0B 3U1YA 1IMUA 4WSPA 4X62I 1YUJA 5JEAB 2WNRA 2EMYA 5LLQA 4DUZI 5LL6R 1GQEA 4P7DA 2BR2B 3GMEA 4I8OA 2EOJA 4LF9I 2F8BA 5A69A 4YY3E 2C38A 2JOXA 5KL6A 2MC6A 2RTXA 3KWRA 2V8PA 3NZKA 5A6BD 1DGCA 1BKNA 3ZKDA 1NEIA 1TF3A 3WU5A 1Z0VA 2EMGA 2HGHA 4DR1I 5K36B 2JYAA 3B78A 4JI3I 2EPLX 4BMJA 5ADZA 1ZAAC 3P3GA 1WXRA 4AIMA 1B69A 2EL6A 1ELOA 2EQ1A 3F0NA 1RQ0A 1ZBTA 1EH7A 5IWAE 1T4LB 3HULA 4HXZA 2EM4A 2EFGA 3VYYA 2E5LE 1YSAC 1IBKI 2V8QB 4IFDC 5DNLA 4BC9A 4LF8I 1N36I 2C39A 2PO1A 1YH8A 2V34A 3WU6A 4F6MA 2L6MA 2JPAA 2GO3A 4LCHA 4URLA 2EORA 3HTXA 1KIJA 2OI2A 2YTEA 4FW5A 2DSYA 1XHKA 1IBLE 4X62E 4DV1E 4MU1A 1ZU1A 3LTOA 3ZKBA 4JI5I 1T38A 5FLXC 1YHCA 4B3SI 4DV6I 3QG5C 3QT5A 2V83A 4B3MI 4BA1B 2L3JA 4JI7E 4JI2I 2WBUA 3VYXA 3PYFA 5AE3A 2BA1G 2L33A 2JEAB 2EM2A 3JAMQ 2EM5A 2PO2A 2RS6A 4OO1C 3JAMC 1YFHA 4FWHA 2R1FA 1GZ6A 3AUZA 1X48A 2JOBA 1EA6A 4BCAA 3PYGA 1LLMC 2E1RA 4DV3E 2L3CA 4N4RB 3IWCA 2M7QA 1YYOA 3UHMA 4R2AA 4FW4A 1RHYA 2JY9A 4JV5I 2NA2A 2MKNA 2MDRA 1NCSA 1N0UA 1X6FA 3IWBA 2ZITA 4HACB 5C0XA 2KOUA 3C4TA 4QNJA 4IFDA 2ELYA 2B7VA 5K36C 2DMYA 2V87A 5BR8I 2PNLA 2DLQA 2Z5BB 1MU5A 4DV4E 4BHCA 4ED4A 1A1IA 2HC5A 2RQLA 3THNA 2ENAA 5K36A 4U3BA 4FW7A 2PNZA 4DV1I 3H1CA 4JI6E 3KRNA 2HHHE 2EOZA 4B3SE 4UTGA 2A2DA 4LFCI 4OO1B 3LLHA 3B4TA 5KL4A 3J7Yp 2F4VI 2A25A 5CFFE 4AQYE 3ADIA 3L7ZB 1K47A 3ZZUA 4DV0I 4DPYA 1ZXNA 4IZJA 5DRPA 2EM3A 1O0WA 1JK1A 2F1DA 2EPAA 1GTKA 4B3TE 1X3CA 4BA2B 2EPMX 4YHHE 1UHZA 4X66I 2BA1D 2EOQA 1FJGE 1VI7A 2WP8A 4YY3I 1I94I 3M7NG 1A1LA 3PRYA 5DNXA 1YYWA 2I13A 3PS3A 2B9DA 2JE6A 3WU3A 2HKEA 2NUFA 2CG9A 2GS8A 4GKJI 2FTXB 2RPCA 3AV0A 4RPFA 4NZVA 1HK7A 2UUAI 3THOB 3GCMA 1KTVA 2HFSA 3J80Q 2EOXA 4IZJB 1YUIA 4UT4A 4F6NA 5KL2A 1ZXMA 4R2EA 1TN9A 3H4LA 4FW9A 2E5LI 1UDQA 1I94E 1P47A 4DR4I 4DR7E 2LV2A 4J8ZA 1HR0E 4M1KA 4LFBI 3T1HE 2GPIA 2EM0A 2YTPA 2DB2A 4JI8E 4JI4E 4NXNI 2EOMA 2IESA 1FKAE 2JVAA 2EN4A 1KVKA 4P7AA 1A1KA 1HNZE 1TF6A 5KL3A 1A1FA 2GHFA 2J65A 4JG4A 3H09A 3DD6A 4GEQB 4MLQA 5AASA 4BHBA 2O1TA 3QT6A 4ISAA 2EN1A 4WX9A 1N33I 1HNXI 5LMNE 4F9AB 1XMQE 2DEIA 2EN8A 4B3ME 1STUA 4M30A 2V86A 3DJWA 4JI2E 1MX0A 4JI7I 3P1XA 2LRSA 2V88A 5C0XD 1N32I 4WUBA 3BF2A 4JI1I 4DV5E 5DROA 5K36F 1H73A 2EZ6A 1FWKA 2O1WA 2HFUA 4RHBB 2BM0A 5FLXQ 4GKJE 4F9CB 2YRKA 5FWKA 3M7ND 1Z59A 2UXBE 3L7ZA 4AIDA 2UUAE 4DPTA 4ZYDA 4LF7E 3WU4A 1N36E 4LF6E 3PYDA 2EMFA 1BBGA 2EOIA 3BIDA 2X7IA 4KQVA 2VQEE 1X6HA 2EN3A 4X9JA 1PIEA 2WBTA 3UK3C 4F2JC 2V2QA 1KKHA 4WYQB 4L5NC 1P42A 1HR0I 2Z5CA 5C0XE 4LFAI 4IFDD 2YSOA 2CPNA 2EPNA 2O3ZA 3PS2A 3QT7A 2NN6C 1U2RA 3T1YI 2JE6B 2ENHA 1WUUA 5KL5A 4OO1F 3PYEA 4OX9I 2V2VA 2EPKX 3P3EA 1RREA 4JI6I 2YWQA 4EMDA 2NN6B 2B7TA 1N33E 4DPWA 1A1GA 2L2NA 2XEXA 2RS7A 1XMQI 4M0VA 4USMA 2F4VE 4X65I 2JWOA 1X47A 5IXMB 2PRTA 4DUZE 2ZBKB 3PS1A 4AQYI 1A1HA 1UBDC 1N32E 1KJKA 2JP9A 4JI1E 3V2UC 4IFDE 4DMIA 2EM9A 2EMKA 2JEAA 2UXDI 5A6KA 4MYUA 5EL9A 2JEBA 2R42A 4O43A 4FWDA 2LUPB 2LTSA 3EPJA 2YU5A 3M85D 1NHJA 4B3TI 2ZM6I 3MHHC 3FIGA 1FNMA 4Z7CA 1FJGI 3TQMA 4X64E 3QT8A 2VE7C 2VQEI 4LF5I 2J7KA 1B63A 2NN6A 4DV4I 2HJJA 4JI0E 4DV7E 2EPRA 5IWAI 2J7JA 5K36E 4WUDA 3BGHA 2EPXA 4HTGA 4MYTA 4OOGC 3OTOI 2O1UA 2L92A 3VHTB 4LF8E 2PNMA 4LCFA 4PRVA 1WJPA 4DV2E 1Z5AA 3HJCA 2YZTA 1F2IG 1BBOA 1MG7A 1A1JA 2BA0G 4XTJA 2YTOA 5LMUI 5KL7A 1IBLI 4DUYE 1USVA 2V89A 2HK2A 1Z0WA 1NHIA 4NXNE 2JR1A 4DV6E 2YT4A 5K36D 1YZ9A 5F3WA 1NZ0A 2YRHA 2O1VA 3Q6MA 4KZSA 2IHR1 2K4VA 2UXDE 1BB8A 2C37B 2B3TB 3J7AG 5AE1A 1XNQE 2Z5CB 5JEAD 1Y4SA 3GONA 2RSIA 4FN5A 2UU9I 4MU4A 2ZM6E 1HNXE 2EM8A 2EMXA 2MDGA 1KYQA 2R76A 4R2CA 1Z0BA 4LOMA 3HQ1A 1SFEA 5DRQA 4FW6A 4HEIA 4LF5E 1A6FA 2YTNA 3GLLA 4KWYA 2GO4A 4ZVIA 3M85G 2EPZA 2M9AA 2NPFA 5C0XB 1Y6ZA 4R2DA 4MU3A 3OTOE 2NUGA 1IQSA 2UXBI 2K7IA 4R2QA 4KHPE 2EN2A 5JEAE 4JI8I 2C37A 5A2QQ 4JI4I 3F6GA 4IS1C 4GKKI 3ZOQB 3ZZTA 1H7UA 2MKDA 3RMPA 1T4OA 2EMLA 2UUBE 2JEBB 4DR3I 3ADJA 2ODRC 1G2FC 1H72C 1ZM2A 4OO1A 4DUYI 4TUGA 4IFDF 2EMHA 3LPSA 3KZYA 2LBSB 4LU9A 4BC7A 4HY1A 4P78A 2BA0D 4GZNC 3BBGA 4Q28A 1XNQI 2UU9E 4B3RI 1XMOE 4R03A 2CZ9A 2UUCI 4WFTA 1AH5A 2I9IA 4U3DA 2DIXA 2Q8UA 3HXLA 4X65E 2WP8B 1Y60A 3CDJA 4J3DA 4Z7YA 4AM3A 2WCC3 1NHHA 3J81Q 3C6MA 4LF6I 2EN7A 2ENCA 2YSPA 2VRDA 3J81C 3C6KA 3J80C 2EOEA 4O24A 2DEJA 2GLIA 4PU9A 2EM6A 4K0KE 4MLVA 1EI1A 1EH6A 2LJUA 1YPNA 2LVHA 2EL4A 1WHQA 2L2MA 2EQ0A 2EMZA 4R2RA 2N3HA 1ZBQA 4QNKA 1HNWE 5IV8B 4IZKA 2NN6F 1ZR9A 4WXDA 1QNTA 2KONA 2UXCI 2C39B 2PO1B 4LPFA 3T1YE 5AE2A 2NN6D 1PJTA 5A6AA 1DI2A 1S4EA 5DRRA 4JI0I 3J7AM 4ZYGA 2WZOA 2EJ4A 1Z0GA 1X49A 4OZEA 2EPUA 2M4IA 4DR7I 4X8WA 1Z0CA 2CTDA 2YTGA 3ECRA 4WPYA 1XNRI 3ADGA 4DV2I 2LE2A 1N34E 1UEKA 3K17A 5IT9Q 1OYPA 2LJHA 1Y5YA 2A2CA 2BR2A 3CDIA 1HNZI 4N3OA 2CVEA 2EOHA 1L4SA 4IS9A 1PJQA 4M2ZA 2BB8A 2DRPA 2V2ZA 3M6AA 4DR5I 4NXMI 2EMBA 2EMIA 2NN6E 2L2KB 2E72A 1WHNA 1DARA 1X5WA 3B8HA 1XXEA 1FWLA 1N3GA 1DQ3A 2RSMA 2EE8A 4IJDA 4M9VC 1J26A 4X64I 5C0XC 3Q1QA 2LJPA 1Z5BA 1ZM3A 2NABA 2YRMA 4NHRA 3CWVA 4DV5I 4O5GA 2EWLA 5JEAF 3LNUA 4DV7I 3JU0A 2HK3A 4HYMA 4DR6I 3VK6A 2D9HA 4JI3E 4MQYA 2BBGA 1IQOA 2H36X 4ZYEA 4LF7I 2VESA 2UXCE 5AC5A 2EPOA 2YU8A 1E3PA 3ZZ0A 4LF4I 4PRXA 4Q35B 2YPNA 4WXCA 2Z5BA 4RH8A 3HKMA 2EOYA 4MDTA 2FV4B 1S16A 4DPXA 3HPSA 1H74A 2NUEA 2YTFA 2WBSA 1QU6A 1UDSA 4MU0A 2HHHI 1IBME 4LFAE 3EPHA 4R2SA 1E3HA 4R2PA 1PDAA 2EMAA 5DNYA 1FI4A 4I3HA 1X6EA 1Z0EA 2ADRA 4LF9E 1N0VC 2BV3A 2Z5EA 1UILA 4TUIA 2EOOA 4OX9E 3P76A 4WUCA 3V5RA 4DR5E 4JI5E 4NXME 1Y4UA 3D4JA 4R1FA 2X36A 1ZM4A 2EPCA 1Z5CA 2G7HA 2LO3A 4X66E 5A2QC 4DR1E 5C0XF 4YHHI 1N34I 5GMDA 2PO2B 4ZYHA 2EPPA 2LT7A 1OYRA 1G2DC 2EL5A 1J5EI 1EH8A 5A6JA 2ELZA 3M99B 4B3RE 1UN6B 5GMEA 1XMOI 4GQUA 1EKZA 5L3JA 3EPLA 1Z1BA 3L00A 4DR6E 1OYSA 2JT2A 1IBKE 2VF1A 4BS9A 2YTDA 1PJSA 2ODRD 4HACA 2LMZA 4IFDB 5JEAA 5A6BA 1T4NA 4FK5C 1OJ4A 2WNRB 4GKKE 1RMDA 3K85A 2EM7A 4P52A 2LTRA 2BM1A 1R6MA 4K0KI 2CSHA 4DR3E 2DGCA 4JV5E 1ZM9A 2UUBI 1IBMI 3T1HI 4OO1E 2IOPA 2CGEA 2VQFE 3ADLA 2EP3A 2PNZB 4R8OA 1PKPA 4DKKA 5BR8E 3MSWA 2WW4A 5EKWA 3P06A 4DR2E 1RC7A 1R6LA 4DU8A 4OKGA 3C4BA 4L8NA 1SR9A 2YTQA 4FW3A 3MHSC 3K1JA 3ZM7A 4F54A 2IERA 1USUA 5LMUE 4NBQA 2UUCE 2IOQA 4LFCE 4DPUA 5LMNI 4JYAI 4LCGA 2R3VA 1QZRA 2EQ3A 1PVGA 5JEAC 3U1KA 1B62A 1H7SA 4BA2A 1J5EE 2CT1A 2M1SA 1YYKA 4OO1D 3F6HA 2FGGA 2JXPA 3DF6A 5AC4A 4DV0E 4DU7A 4DV3I 1Z0TA 4BBYA 1AAYA 3Q6NA 2LCEA 2MC5A 4USKA 3JTZA 1UDOA 5T6JA 1UDNA 3OMLA 2PO0A 2AJ4A
chains in the Genus database with same CATH topology
5IT9C 4DXLA 2V85A 1HNWI 2Q2EB 3IWDA 4LTYA 1RR9A 2VF3A 2VQFI 3K6QA 4IZKB 3B82A 1D6TA 1VISA 2GQ0A 4KHPI 2N3GA 4DR2I 4F9BB 1XNRE 4LF4E 2HKJA 2LUQA 3HPZA 2KHXA 2L8TA 3LMLA 4FWGA 4IZJD 4DR4E 4LFBE 2E1MA 1I94I 4JYAE 4WSPA 4X62I 4DUZI 5LL6R 1GQEA 4P7DA 4I8OA 4LF9I 2F8BA 4YY3E 2JOXA 2MC6A 2RTXA 3KWRA 2V8PA 1BKNA 3ZKDA 3WU5A 1Z0VA 4DR1I 3B78A 4JI3I 4BMJA 5ADZA 1WXRA 1ELOA 3F0NA 1RQ0A 1ZBTA 5IWAE 1T4LB 3HULA 4HXZA 2EFGA 3VYYA 2E5LE 1IBKI 2V8QB 4BC9A 4LF8I 1N36I 2V34A 3WU6A 2L6MA 4URLA 3HTXA 1KIJA 2OI2A 2DSYA 1XHKA 1IBLE 4X62E 4DV1E 3ZKBA 3LTOA 4JI5I 5FLXC 4B3SI 4DV6I 3QT5A 2V83A 4B3MI 2L3JA 4JI7E 4JI2I 3VYXA 3PYFA 5AE3A 2L33A 3JAMQ 2RS6A 3JAMC 4FWHA 1GZ6A 3AUZA 1X48A 2JOBA 1EA6A 4BCAA 3PYGA 2E1RA 4DV3E 2L3CA 3IWCA 2M7QA 1YYOA 2JY9A 4JV5I 2NA2A 2MDRA 1N0UA 3IWBA 2ZITA 4HACB 2KOUA 3C4TA 2B7VA 2V87A 2DMYA 5BR8I 2PNLA 2Z5BB 1MU5A 4DV4E 4ED4A 4DV1I 4JI6E 2HHHE 4B3SE 4UTGA 2A2DA 4LFCI 3LLHA 2F4VI 3J7Yp 5CFFE 4AQYE 3ADIA 1K47A 3ZZUA 4DV0I 4DPYA 1ZXNA 4IZJA 1O0WA 4B3TE 4YHHE 1UHZA 4X66I 1FJGE 4YY3I 3PRYA 1YYWA 2B9DA 3WU3A 2HKEA 2NUFA 2CG9A 2GS8A 4GKJI 2FTXB 3AV0A 4RPFA 1HK7A 2UUAI 1KTVA 2HFSA 3J80Q 4IZJB 4UT4A 1ZXMA 3H4LA 4FW9A 2E5LI 1I94E 4DR4I 4LFBI 4DR7E 4J8ZA 1HR0E 4M1KA 3T1HE 2DB2A 4JI8E 4JI4E 4NXNI 1FKAE 2JVAA 1KVKA 4P7AA 1HNZE 4JG4A 3H09A 4GEQB 5AASA 2O1TA 3QT6A 1N33I 1HNXI 5LMNE 4F9AB 1XMQE 2DEIA 4B3ME 1STUA 4M30A 2V86A 3DJWA 4JI2E 1MX0A 4JI7I 3P1XA 2LRSA 2V88A 1N32I 4WUBA 4JI1I 4DV5E 1H73A 2EZ6A 1FWKA 2O1WA 2HFUA 2BM0A 5FLXQ 4GKJE 4F9CB 5FWKA 1Z59A 2UXBE 4DPTA 2UUAE 4LF7E 3WU4A 1N36E 4LF6E 3PYDA 2X7IA 4KQVA 2VQEE 1PIEA 2V2QA 1KKHA 4WYQB 4L5NC 1HR0I 2Z5CA 4LFAI 2CPNA 3QT7A 1U2RA 3T1YI 1WUUA 3PYEA 4OX9I 2V2VA 1RREA 4JI6I 4EMDA 2B7TA 1N33E 4DPWA 2L2NA 2XEXA 2RS7A 1XMQI 4M0VA 4USMA 2F4VE 4X65I 2JWOA 1X47A 4AQYI 2ZBKB 4DUZE 1N34I 1N32E 3V2UC 4JI1E 4DMIA 2UXDI 4MYUA 2R42A 4B3TI 4FWDA 2LUPB 2LTSA 1NHJA 2ZM6I 1FNMA 3FIGA 4Z7CA 1FJGI 4X64E 3QT8A 2VE7C 2VQEI 4LF5I 2J7KA 1B63A 4DV4I 4JI0E 4DV7E 5IWAI 4WUDA 4MYTA 4OOGC 3OTOI 2O1UA 2L92A 4LF8E 2PNMA 4PRVA 4DV2E 1Z5AA 3HJCA 2YZTA 1MG7A 4XTJA 5LMUI 1IBLI 4DUYE 1USVA 2V89A 2HK2A 1Z0WA 1NHIA 4NXNE 2JR1A 4DV6E 2YT4A 1YZ9A 5F3WA 1NZ0A 3Q6MA 2O1VA 4KZSA 2IHR1 2K4VA 2UXDE 2B3TB 3J7AG 5AE1A 1XNQE 2Z5CB 1Y4SA 3GONA 4FN5A 2UU9I 2ZM6E 1HNXE 1Z0BA 3HQ1A 1A6FA 4LF5E 4ZVIA 2NPFA 1Y6ZA 3OTOE 2NUGA 2UXBI 4KHPE 4JI8I 5A2QQ 4JI4I 3F6GA 4GKKI 3ZOQB 3ZZTA 1H7UA 3RMPA 1T4OA 2UUBE 4DR3I 3ADJA 2ODRC 1H72C 1ZM2A 4DUYI 4TUGA 3LPSA 2LBSB 4HY1A 4LU9A 4BC7A 4P78A 4Q28A 1XNQI 2UU9E 4B3RI 1XMOE 4R03A 2CZ9A 2UUCI 4WFTA 2DIXA 3HXLA 4X65E 4Z7YA 1NHHA 3J81Q 4LF6I 3J81C 3J80C 2DEJA 4PU9A 4K0KE 1EI1A 1WHQA 2L2MA 2N3HA 1ZBQA 1HNWE 4IZKA 2KONA 2UXCI 3T1YE 5AE2A 1S4EA 1DI2A 4JI0I 3J7AM 2WZOA 1Z0GA 1X49A 2M4IA 4DR7I 4X8WA 1Z0CA 4WPYA 1XNRI 3ADGA 4DV2I 2LE2A 1N34E 1UEKA 3K17A 5IT9Q 2LJHA 2A2CA 1HNZI 4N3OA 4M2ZA 2V2ZA 3M6AA 4DR5I 4NXMI 2L2KB 1WHNA 1DARA 3B8HA 1FWLA 1DQ3A 2RSMA 1J26A 4X64I 3Q1QA 2LJPA 1Z5BA 1ZM3A 3CWVA 4DV5I 2EWLA 3LNUA 4DV7I 3JU0A 2HK3A 4HYMA 4DR6I 3VK6A 4JI3E 2H36X 4LF7I 2UXCE 3ZZ0A 4LF4I 4PRXA 2Z5BA 2FV4B 1S16A 4DPXA 3HPSA 1H74A 2NUEA 2HHHI 1QU6A 1IBME 4LFAE 5DNYA 1FI4A 4I3HA 1Z0EA 4LF9E 1N0VC 2BV3A 2Z5EA 1UILA 4TUIA 4OX9E 4WUCA 3V5RA 4DR5E 4JI5E 4NXME 1Y4UA 3D4JA 4R1FA 2X36A 1ZM4A 1Z5CA 2G7HA 4X66E 5A2QC 4DR1E 4YHHI 5GMDA 1J5EI 4B3RE 5GMEA 1XMOI 1EKZA 5L3JA 4DR6E 1IBKE 2VF1A 4BS9A 2ODRD 4HACA 2LMZA 1T4NA 1OJ4A 4GKKE 3K85A 4P52A 2LTRA 2BM1A 4K0KI 4DR3E 4JV5E 2UUBI 1ZM9A 1IBMI 3T1HI 2IOPA 2CGEA 2VQFE 3ADLA 4R8OA 1PKPA 4DKKA 5BR8E 3MSWA 2WW4A 3P06A 4DR2E 1RC7A 4DU8A 3C4BA 4L8NA 1SR9A 3K1JA 3ZM7A 4F54A 1USUA 5LMUE 2UUCE 2IOQA 4LFCE 4DPUA 5LMNI 4JYAI 2R3VA 1QZRA 1PVGA 1B62A 1H7SA 1J5EE 2M1SA 1YYKA 3F6HA 2FGGA 4DV0E 3DF6A 4DU7A 4DV3I 1Z0TA 4BBYA 3Q6NA 2MC5A 4USKA 3JTZA 5T6JA 3OMLA 2AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 C;  4DXL A;  1HNW I;  2Q2E B;  1RR9 A;  2VF3 A;  2VQF I;  3B82 A;  1D6T A;  1VIS A;  4KHP I;  2N3G A;  4DR2 I;  1XNR E;  4LF4 E;  2HKJ A;  2LUQ A;  2KHX A;  4FWG A;  4DR4 E;  4LFB E;  1I94 I;  4JYA E;  4X62 I;  4DUZ I;  5LL6 R;  1GQE A;  4LF9 I;  4YY3 E;  2RTX A;  2V8P A;  1BKN A;  3ZKD A;  3WU5 A;  1Z0V A;  4DR1 I;  3B78 A;  4JI3 I;  1ELO A;  3F0N A;  1RQ0 A;  1ZBT A;  5IWA E;  1T4L B;  3HUL A;  4HXZ A;  2EFG A;  3VYY A;  2E5L E;  1IBK I;  4LF8 I;  1N36 I;  2V34 A;  3WU6 A;  4URL A;  3HTX A;  1KIJ A;  2OI2 A;  1XHK A;  1IBL E;  4X62 E;  4DV1 E;  3ZKB A;  3LTO A;  4JI5 I;  5FLX C;  4B3S I;  4DV6 I;  3QT5 A;  4B3M I;  2L3J A;  4JI7 E;  4JI2 I;  3VYX A;  3PYF A;  2L33 A;  3JAM Q;  2RS6 A;  3JAM C;  4FWH A;  1EA6 A;  1X48 A;  3PYG A;  2E1R A;  4DV3 E;  2L3C A;  1YYO A;  2JY9 A;  4JV5 I;  2NA2 A;  2MDR A;  1N0U A;  2ZIT A;  4HAC B;  3C4T A;  2B7V A;  2DMY A;  5BR8 I;  1MU5 A;  4DV4 E;  4ED4 A;  4DV1 I;  4JI6 E;  2HHH E;  4B3S E;  4LFC I;  4UTG A;  2A2D A;  3LLH A;  2F4V I;  3J7Y p;  5CFF E;  4AQY E;  3ADI A;  1K47 A;  3ZZU A;  4DV0 I;  4DPY A;  1ZXN A;  1O0W A;  4B3T E;  4YHH E;  1UHZ A;  4X66 I;  1FJG E;  4YY3 I;  1YYW A;  3WU3 A;  2HKE A;  2NUF A;  2GS8 A;  4GKJ I;  4RPF A;  2UUA I;  1KTV A;  2HFS A;  3J80 Q;  4UT4 A;  1ZXM A;  3H4L A;  4FW9 A;  2E5L I;  1I94 E;  4DR4 I;  4LFB I;  4DR7 E;  1HR0 E;  4M1K A;  3T1H E;  2DB2 A;  4JI8 E;  4JI4 E;  4NXN I;  1FKA E;  2JVA A;  1KVK A;  4P7A A;  1HNZ E;  4JG4 A;  3QT6 A;  1N33 I;  1HNX I;  5LMN E;  1XMQ E;  2DEI A;  4B3M E;  1STU A;  4M30 A;  4JI2 E;  4JI7 I;  1MX0 A;  3P1X A;  2LRS A;  1N32 I;  4WUB A;  4JI1 I;  4DV5 E;  1H73 A;  2EZ6 A;  1FWK A;  2HFU A;  2BM0 A;  5FLX Q;  4GKJ E;  1Z59 A;  2UXB E;  4DPT A;  2UUA E;  4LF7 E;  3WU4 A;  1N36 E;  4LF6 E;  3PYD A;  2X7I A;  4KQV A;  2VQE E;  1PIE A;  2V2Q A;  1KKH A;  4WYQ B;  1HR0 I;  4LFA I;  2CPN A;  3QT7 A;  1U2R A;  3T1Y I;  1WUU A;  3PYE A;  4OX9 I;  2V2V A;  1RRE A;  4JI6 I;  4EMD A;  2B7T A;  1N33 E;  4DPW A;  2L2N A;  2XEX A;  2RS7 A;  1XMQ I;  4USM A;  2F4V E;  4X65 I;  1X47 A;  4AQY I;  2ZBK B;  4DUZ E;  1N34 I;  1N32 E;  3V2U C;  4JI1 E;  2UXD I;  4MYU A;  2R42 A;  4B3T I;  4FWD A;  2LUP B;  2LTS A;  1NHJ A;  2ZM6 I;  1FNM A;  4Z7C A;  1FJG I;  4X64 E;  3QT8 A;  2VQE I;  4LF5 I;  2J7K A;  1B63 A;  4DV4 I;  4JI0 E;  4DV7 E;  5IWA I;  4WUD A;  4MYT A;  4OOG C;  3OTO I;  4LF8 E;  4PRV A;  4DV2 E;  1Z5A A;  1MG7 A;  4XTJ A;  5LMU I;  1IBL I;  4DUY E;  2HK2 A;  1Z0W A;  1NHI A;  4NXN E;  4DV6 E;  2YT4 A;  1YZ9 A;  1NZ0 A;  2IHR 1;  2UXD E;  2B3T B;  3J7A G;  1XNQ E;  3GON A;  2UU9 I;  4FN5 A;  2ZM6 E;  1HNX E;  1Z0B A;  1A6F A;  4LF5 E;  4ZVI A;  2NPF A;  3OTO E;  2NUG A;  2UXB I;  4KHP E;  4JI8 I;  5A2Q Q;  4JI4 I;  4GKK I;  3ZZT A;  1H7U A;  1T4O A;  2UUB E;  4DR3 I;  3ADJ A;  1H72 C;  1ZM2 A;  4DUY I;  3LPS A;  2LBS B;  4HY1 A;  1XNQ I;  2UU9 E;  4B3R I;  1XMO E;  2CZ9 A;  2UUC I;  4WFT A;  4X65 E;  2DIX A;  4Z7Y A;  1NHH A;  3J81 Q;  4LF6 I;  3J81 C;  3J80 C;  2DEJ A;  4PU9 A;  4K0K E;  1EI1 A;  1WHQ A;  2L2M A;  2N3H A;  1HNW E;  2UXC I;  3T1Y E;  1S4E A;  1DI2 A;  4JI0 I;  3J7A M;  1Z0G A;  1X49 A;  4DR7 I;  4X8W A;  1Z0C A;  1XNR I;  3ADG A;  4DV2 I;  1N34 E;  1UEK A;  3K17 A;  5IT9 Q;  2LJH A;  2A2C A;  1HNZ I;  4M2Z A;  2V2Z A;  3M6A A;  4DR5 I;  4NXM I;  2L2K B;  1WHN A;  1DAR A;  3B8H A;  1FWL A;  2RSM A;  1J26 A;  4X64 I;  3Q1Q A;  2LJP A;  1Z5B A;  1ZM3 A;  3CWV A;  4DV5 I;  3LNU A;  4DV7 I;  2HK3 A;  4HYM A;  4DR6 I;  4JI3 E;  4LF7 I;  2UXC E;  3ZZ0 A;  4LF4 I;  4PRX A;  1S16 A;  4DPX A;  1H74 A;  2NUE A;  2HHH I;  1QU6 A;  1IBM E;  4LFA E;  1FI4 A;  4I3H A;  1Z0E A;  4LF9 E;  1N0V C;  2BV3 A;  1UIL A;  4OX9 E;  4WUC A;  3V5R A;  4DR5 E;  4JI5 E;  4NXM E;  3D4J A;  4R1F A;  2X36 A;  1ZM4 A;  1Z5C A;  4X66 E;  4DR1 E;  5A2Q C;  4YHH I;  5GMD A;  1J5E I;  4B3R E;  5GME A;  1XMO I;  1EKZ A;  5L3J A;  4DR6 E;  1IBK E;  4HAC A;  1T4N A;  1OJ4 A;  4GKK E;  4P52 A;  2LTR A;  2BM1 A;  4K0K I;  4DR3 E;  4JV5 E;  2UUB I;  1ZM9 A;  1IBM I;  3T1H I;  2VQF E;  3ADL A;  4DKK A;  1PKP A;  5BR8 E;  2WW4 A;  4DR2 E;  1RC7 A;  4DU8 A;  3C4B A;  3K1J A;  3ZM7 A;  5LMU E;  2UUC E;  4DPU A;  4LFC E;  5LMN I;  4JYA I;  2R3V A;  1QZR A;  1PVG A;  1B62 A;  1H7S A;  1J5E E;  1YYK A;  4DV0 E;  4DU7 A;  4DV3 I;  1Z0T A;  4USK A;  2AJ4 A; 
#chains in the Genus database with same CATH topology
 5TSE A;  1MEY C;  5IT9 C;  1JK2 A;  4DXL A;  1WRJ A;  2V85 A;  1HNW I;  2EOS A;  2Q2E B;  3IWD A;  4LTY A;  4BA1 A;  2EN6 A;  1RR9 A;  2DLK A;  2C38 B;  3P3C A;  2YTI A;  2EOF A;  1T39 A;  2VF3 A;  2N8X A;  2VQF I;  3K6Q A;  4IZK B;  3B82 A;  1D6T A;  1VIS A;  5ELW A;  2GQ0 A;  4O4K A;  3EQ1 A;  4KHP I;  2N3G A;  2EMC A;  4DR2 I;  4F9B B;  1XNR E;  4LF4 E;  4WSG A;  2LUQ A;  2HKJ A;  3HPZ A;  2YTJ A;  2EMW A;  1MGT A;  2KHX A;  3EPK A;  2L8T A;  3KZZ A;  3LML A;  2AE8 A;  4FWG A;  4DR4 E;  4LFB E;  2DMI A;  2E1M A;  4IZJ D;  4JYA E;  2PO0 B;  3U1Y A;  1IMU A;  4WSP A;  4X62 I;  1YUJ A;  5JEA B;  2WNR A;  2EMY A;  5LLQ A;  4DUZ I;  5LL6 R;  1GQE A;  4P7D A;  2BR2 B;  3GME A;  4I8O A;  2EOJ A;  4LF9 I;  2F8B A;  5A69 A;  4YY3 E;  2C38 A;  2JOX A;  5KL6 A;  2MC6 A;  2RTX A;  3KWR A;  2V8P A;  3NZK A;  5A6B D;  1DGC A;  1BKN A;  3ZKD A;  1NEI A;  1TF3 A;  3WU5 A;  1Z0V A;  2EMG A;  2HGH A;  4DR1 I;  5K36 B;  2JYA A;  3B78 A;  4JI3 I;  2EPL X;  4BMJ A;  5ADZ A;  1ZAA C;  3P3G A;  1WXR A;  4AIM A;  1B69 A;  2EL6 A;  1ELO A;  2EQ1 A;  3F0N A;  1RQ0 A;  1ZBT A;  1EH7 A;  5IWA E;  1T4L B;  3HUL A;  4HXZ A;  2EM4 A;  2EFG A;  3VYY A;  2E5L E;  1YSA C;  1IBK I;  2V8Q B;  4IFD C;  5DNL A;  4BC9 A;  4LF8 I;  1N36 I;  2C39 A;  2PO1 A;  1YH8 A;  2V34 A;  3WU6 A;  4F6M A;  2L6M A;  2JPA A;  2GO3 A;  4LCH A;  4URL A;  2EOR A;  3HTX A;  1KIJ A;  2OI2 A;  2YTE A;  4FW5 A;  2DSY A;  1XHK A;  1IBL E;  4X62 E;  4DV1 E;  4MU1 A;  1ZU1 A;  3LTO A;  3ZKB A;  4JI5 I;  1T38 A;  5FLX C;  1YHC A;  4B3S I;  4DV6 I;  3QG5 C;  3QT5 A;  2V83 A;  4B3M I;  4BA1 B;  2L3J A;  4JI7 E;  4JI2 I;  2WBU A;  3VYX A;  3PYF A;  5AE3 A;  2BA1 G;  2L33 A;  2JEA B;  2EM2 A;  3JAM Q;  2EM5 A;  2PO2 A;  2RS6 A;  4OO1 C;  3JAM C;  1YFH A;  4FWH A;  2R1F A;  1GZ6 A;  3AUZ A;  1X48 A;  2JOB A;  1EA6 A;  4BCA A;  3PYG A;  1LLM C;  2E1R A;  4DV3 E;  2L3C A;  4N4R B;  3IWC A;  2M7Q A;  1YYO A;  3UHM A;  4R2A A;  4FW4 A;  1RHY A;  2JY9 A;  4JV5 I;  2NA2 A;  2MKN A;  2MDR A;  1NCS A;  1N0U A;  1X6F A;  3IWB A;  2ZIT A;  4HAC B;  5C0X A;  2KOU A;  3C4T A;  4QNJ A;  4IFD A;  2ELY A;  2B7V A;  5K36 C;  2DMY A;  2V87 A;  5BR8 I;  2PNL A;  2DLQ A;  2Z5B B;  1MU5 A;  4DV4 E;  4BHC A;  4ED4 A;  1A1I A;  2HC5 A;  2RQL A;  3THN A;  2ENA A;  5K36 A;  4U3B A;  4FW7 A;  2PNZ A;  4DV1 I;  3H1C A;  4JI6 E;  3KRN A;  2HHH E;  2EOZ A;  4B3S E;  4UTG A;  2A2D A;  4LFC I;  4OO1 B;  3LLH A;  3B4T A;  5KL4 A;  3J7Y p;  2F4V I;  2A25 A;  5CFF E;  4AQY E;  3ADI A;  3L7Z B;  1K47 A;  3ZZU A;  4DV0 I;  4DPY A;  1ZXN A;  4IZJ A;  5DRP A;  2EM3 A;  1O0W A;  1JK1 A;  2F1D A;  2EPA A;  1GTK A;  4B3T E;  1X3C A;  4BA2 B;  2EPM X;  4YHH E;  1UHZ A;  4X66 I;  2BA1 D;  2EOQ A;  1FJG E;  1VI7 A;  2WP8 A;  4YY3 I;  1I94 I;  3M7N G;  1A1L A;  3PRY A;  5DNX A;  1YYW A;  2I13 A;  3PS3 A;  2B9D A;  2JE6 A;  3WU3 A;  2HKE A;  2NUF A;  2CG9 A;  2GS8 A;  4GKJ I;  2FTX B;  2RPC A;  3AV0 A;  4RPF A;  4NZV A;  1HK7 A;  2UUA I;  3THO B;  3GCM A;  1KTV A;  2HFS A;  3J80 Q;  2EOX A;  4IZJ B;  1YUI A;  4UT4 A;  4F6N A;  5KL2 A;  1ZXM A;  4R2E A;  1TN9 A;  3H4L A;  4FW9 A;  2E5L I;  1UDQ A;  1I94 E;  1P47 A;  4DR4 I;  4DR7 E;  2LV2 A;  4J8Z A;  1HR0 E;  4M1K A;  4LFB I;  3T1H E;  2GPI A;  2EM0 A;  2YTP A;  2DB2 A;  4JI8 E;  4JI4 E;  4NXN I;  2EOM A;  2IES A;  1FKA E;  2JVA A;  2EN4 A;  1KVK A;  4P7A A;  1A1K A;  1HNZ E;  1TF6 A;  5KL3 A;  1A1F A;  2GHF A;  2J65 A;  4JG4 A;  3H09 A;  3DD6 A;  4GEQ B;  4MLQ A;  5AAS A;  4BHB A;  2O1T A;  3QT6 A;  4ISA A;  2EN1 A;  4WX9 A;  1N33 I;  1HNX I;  5LMN E;  4F9A B;  1XMQ E;  2DEI A;  2EN8 A;  4B3M E;  1STU A;  4M30 A;  2V86 A;  3DJW A;  4JI2 E;  1MX0 A;  4JI7 I;  3P1X A;  2LRS A;  2V88 A;  5C0X D;  1N32 I;  4WUB A;  3BF2 A;  4JI1 I;  4DV5 E;  5DRO A;  5K36 F;  1H73 A;  2EZ6 A;  1FWK A;  2O1W A;  2HFU A;  4RHB B;  2BM0 A;  5FLX Q;  4GKJ E;  4F9C B;  2YRK A;  5FWK A;  3M7N D;  1Z59 A;  2UXB E;  3L7Z A;  4AID A;  2UUA E;  4DPT A;  4ZYD A;  4LF7 E;  3WU4 A;  1N36 E;  4LF6 E;  3PYD A;  2EMF A;  1BBG A;  2EOI A;  3BID A;  2X7I A;  4KQV A;  2VQE E;  1X6H A;  2EN3 A;  4X9J A;  1PIE A;  2WBT A;  3UK3 C;  4F2J C;  2V2Q A;  1KKH A;  4WYQ B;  4L5N C;  1P42 A;  1HR0 I;  2Z5C A;  5C0X E;  4LFA I;  4IFD D;  2YSO A;  2CPN A;  2EPN A;  2O3Z A;  3PS2 A;  3QT7 A;  2NN6 C;  1U2R A;  3T1Y I;  2JE6 B;  2ENH A;  1WUU A;  5KL5 A;  4OO1 F;  3PYE A;  4OX9 I;  2V2V A;  2EPK X;  3P3E A;  1RRE A;  4JI6 I;  2YWQ A;  4EMD A;  2NN6 B;  2B7T A;  1N33 E;  4DPW A;  1A1G A;  2L2N A;  2XEX A;  2RS7 A;  1XMQ I;  4M0V A;  4USM A;  2F4V E;  4X65 I;  2JWO A;  1X47 A;  5IXM B;  2PRT A;  4DUZ E;  2ZBK B;  3PS1 A;  4AQY I;  1A1H A;  1UBD C;  1N32 E;  1KJK A;  2JP9 A;  4JI1 E;  3V2U C;  4IFD E;  4DMI A;  2EM9 A;  2EMK A;  2JEA A;  2UXD I;  5A6K A;  4MYU A;  5EL9 A;  2JEB A;  2R42 A;  4O43 A;  4FWD A;  2LUP B;  2LTS A;  3EPJ A;  2YU5 A;  3M85 D;  1NHJ A;  4B3T I;  2ZM6 I;  3MHH C;  3FIG A;  1FNM A;  4Z7C A;  1FJG I;  3TQM A;  4X64 E;  3QT8 A;  2VE7 C;  2VQE I;  4LF5 I;  2J7K A;  1B63 A;  2NN6 A;  4DV4 I;  2HJJ A;  4JI0 E;  4DV7 E;  2EPR A;  5IWA I;  2J7J A;  5K36 E;  4WUD A;  3BGH A;  2EPX A;  4HTG A;  4MYT A;  4OOG C;  3OTO I;  2O1U A;  2L92 A;  3VHT B;  4LF8 E;  2PNM A;  4LCF A;  4PRV A;  1WJP A;  4DV2 E;  1Z5A A;  3HJC A;  2YZT A;  1F2I G;  1BBO A;  1MG7 A;  1A1J A;  2BA0 G;  4XTJ A;  2YTO A;  5LMU I;  5KL7 A;  1IBL I;  4DUY E;  1USV A;  2V89 A;  2HK2 A;  1Z0W A;  1NHI A;  4NXN E;  2JR1 A;  4DV6 E;  2YT4 A;  5K36 D;  1YZ9 A;  5F3W A;  1NZ0 A;  2YRH A;  2O1V A;  3Q6M A;  4KZS A;  2IHR 1;  2K4V A;  2UXD E;  1BB8 A;  2C37 B;  2B3T B;  3J7A G;  5AE1 A;  1XNQ E;  2Z5C B;  5JEA D;  1Y4S A;  3GON A;  2RSI A;  4FN5 A;  2UU9 I;  4MU4 A;  2ZM6 E;  1HNX E;  2EM8 A;  2EMX A;  2MDG A;  1KYQ A;  2R76 A;  4R2C A;  1Z0B A;  4LOM A;  3HQ1 A;  1SFE A;  5DRQ A;  4FW6 A;  4HEI A;  4LF5 E;  1A6F A;  2YTN A;  3GLL A;  4KWY A;  2GO4 A;  4ZVI A;  3M85 G;  2EPZ A;  2M9A A;  2NPF A;  5C0X B;  1Y6Z A;  4R2D A;  4MU3 A;  3OTO E;  2NUG A;  1IQS A;  2UXB I;  2K7I A;  4R2Q A;  4KHP E;  2EN2 A;  5JEA E;  4JI8 I;  2C37 A;  5A2Q Q;  4JI4 I;  3F6G A;  4IS1 C;  4GKK I;  3ZOQ B;  3ZZT A;  1H7U A;  2MKD A;  3RMP A;  1T4O A;  2EML A;  2UUB E;  2JEB B;  4DR3 I;  3ADJ A;  2ODR C;  1G2F C;  1H72 C;  1ZM2 A;  4OO1 A;  4DUY I;  4TUG A;  4IFD F;  2EMH A;  3LPS A;  3KZY A;  2LBS B;  4LU9 A;  4BC7 A;  4HY1 A;  4P78 A;  2BA0 D;  4GZN C;  3BBG A;  4Q28 A;  1XNQ I;  2UU9 E;  4B3R I;  1XMO E;  4R03 A;  2CZ9 A;  2UUC I;  4WFT A;  1AH5 A;  2I9I A;  4U3D A;  2DIX A;  2Q8U A;  3HXL A;  4X65 E;  2WP8 B;  1Y60 A;  3CDJ A;  4J3D A;  4Z7Y A;  4AM3 A;  2WCC 3;  1NHH A;  3J81 Q;  3C6M A;  4LF6 I;  2EN7 A;  2ENC A;  2YSP A;  2VRD A;  3J81 C;  3C6K A;  3J80 C;  2EOE A;  4O24 A;  2DEJ A;  2GLI A;  4PU9 A;  2EM6 A;  4K0K E;  4MLV A;  1EI1 A;  1EH6 A;  2LJU A;  1YPN A;  2LVH A;  2EL4 A;  1WHQ A;  2L2M A;  2EQ0 A;  2EMZ A;  4R2R A;  2N3H A;  1ZBQ A;  4QNK A;  1HNW E;  5IV8 B;  4IZK A;  2NN6 F;  1ZR9 A;  4WXD A;  1QNT A;  2KON A;  2UXC I;  2C39 B;  2PO1 B;  4LPF A;  3T1Y E;  5AE2 A;  2NN6 D;  1PJT A;  5A6A A;  1DI2 A;  1S4E A;  5DRR A;  4JI0 I;  3J7A M;  4ZYG A;  2WZO A;  2EJ4 A;  1Z0G A;  1X49 A;  4OZE A;  2EPU A;  2M4I A;  4DR7 I;  4X8W A;  1Z0C A;  2CTD A;  2YTG A;  3ECR A;  4WPY A;  1XNR I;  3ADG A;  4DV2 I;  2LE2 A;  1N34 E;  1UEK A;  3K17 A;  5IT9 Q;  1OYP A;  2LJH A;  1Y5Y A;  2A2C A;  2BR2 A;  3CDI A;  1HNZ I;  4N3O A;  2CVE A;  2EOH A;  1L4S A;  4IS9 A;  1PJQ A;  4M2Z A;  2BB8 A;  2DRP A;  2V2Z A;  3M6A A;  4DR5 I;  4NXM I;  2EMB A;  2EMI A;  2NN6 E;  2L2K B;  2E72 A;  1WHN A;  1DAR A;  1X5W A;  3B8H A;  1XXE A;  1FWL A;  1N3G A;  1DQ3 A;  2RSM A;  2EE8 A;  4IJD A;  4M9V C;  1J26 A;  4X64 I;  5C0X C;  3Q1Q A;  2LJP A;  1Z5B A;  1ZM3 A;  2NAB A;  2YRM A;  4NHR A;  3CWV A;  4DV5 I;  4O5G A;  2EWL A;  5JEA F;  3LNU A;  4DV7 I;  3JU0 A;  2HK3 A;  4HYM A;  4DR6 I;  3VK6 A;  2D9H A;  4JI3 E;  4MQY A;  2BBG A;  1IQO A;  2H36 X;  4ZYE A;  4LF7 I;  2VES A;  2UXC E;  5AC5 A;  2EPO A;  2YU8 A;  1E3P A;  3ZZ0 A;  4LF4 I;  4PRX A;  4Q35 B;  2YPN A;  4WXC A;  2Z5B A;  4RH8 A;  3HKM A;  2EOY A;  4MDT A;  2FV4 B;  1S16 A;  4DPX A;  3HPS A;  1H74 A;  2NUE A;  2YTF A;  2WBS A;  1QU6 A;  1UDS A;  4MU0 A;  2HHH I;  1IBM E;  4LFA E;  3EPH A;  4R2S A;  1E3H A;  4R2P A;  1PDA A;  2EMA A;  5DNY A;  1FI4 A;  4I3H A;  1X6E A;  1Z0E A;  2ADR A;  4LF9 E;  1N0V C;  2BV3 A;  2Z5E A;  1UIL A;  4TUI A;  2EOO A;  4OX9 E;  3P76 A;  4WUC A;  3V5R A;  4DR5 E;  4JI5 E;  4NXM E;  1Y4U A;  3D4J A;  4R1F A;  2X36 A;  1ZM4 A;  2EPC A;  1Z5C A;  2G7H A;  2LO3 A;  4X66 E;  5A2Q C;  4DR1 E;  5C0X F;  4YHH I;  1N34 I;  5GMD A;  2PO2 B;  4ZYH A;  2EPP A;  2LT7 A;  1OYR A;  1G2D C;  2EL5 A;  1J5E I;  1EH8 A;  5A6J A;  2ELZ A;  3M99 B;  4B3R E;  1UN6 B;  5GME A;  1XMO I;  4GQU A;  1EKZ A;  5L3J A;  3EPL A;  1Z1B A;  3L00 A;  4DR6 E;  1OYS A;  2JT2 A;  1IBK E;  2VF1 A;  4BS9 A;  2YTD A;  1PJS A;  2ODR D;  4HAC A;  2LMZ A;  4IFD B;  5JEA A;  5A6B A;  1T4N A;  4FK5 C;  1OJ4 A;  2WNR B;  4GKK E;  1RMD A;  3K85 A;  2EM7 A;  4P52 A;  2LTR A;  2BM1 A;  1R6M A;  4K0K I;  2CSH A;  4DR3 E;  2DGC A;  4JV5 E;  1ZM9 A;  2UUB I;  1IBM I;  3T1H I;  4OO1 E;  2IOP A;  2CGE A;  2VQF E;  3ADL A;  2EP3 A;  2PNZ B;  4R8O A;  1PKP A;  4DKK A;  5BR8 E;  3MSW A;  2WW4 A;  5EKW A;  3P06 A;  4DR2 E;  1RC7 A;  1R6L A;  4DU8 A;  4OKG A;  3C4B A;  4L8N A;  1SR9 A;  2YTQ A;  4FW3 A;  3MHS C;  3K1J A;  3ZM7 A;  4F54 A;  2IER A;  1USU A;  5LMU E;  4NBQ A;  2UUC E;  2IOQ A;  4LFC E;  4DPU A;  5LMN I;  4JYA I;  4LCG A;  2R3V A;  1QZR A;  2EQ3 A;  1PVG A;  5JEA C;  3U1K A;  1B62 A;  1H7S A;  4BA2 A;  1J5E E;  2CT1 A;  2M1S A;  1YYK A;  4OO1 D;  3F6H A;  2FGG A;  2JXP A;  3DF6 A;  5AC4 A;  4DV0 E;  4DU7 A;  4DV3 I;  1Z0T A;  4BBY A;  1AAY A;  3Q6N A;  2LCE A;  2MC5 A;  4USK A;  3JTZ A;  1UDO A;  5T6J A;  1UDN A;  3OML A;  2PO0 A;  2AJ4 A; 
#chains in the Genus database with same CATH homology
 5IT9 C;  4DXL A;  2V85 A;  1HNW I;  2Q2E B;  3IWD A;  4LTY A;  1RR9 A;  2VF3 A;  2VQF I;  3K6Q A;  4IZK B;  3B82 A;  1D6T A;  1VIS A;  2GQ0 A;  4KHP I;  2N3G A;  4DR2 I;  4F9B B;  1XNR E;  4LF4 E;  2HKJ A;  2LUQ A;  3HPZ A;  2KHX A;  2L8T A;  3LML A;  4FWG A;  4IZJ D;  4DR4 E;  4LFB E;  2E1M A;  1I94 I;  4JYA E;  4WSP A;  4X62 I;  4DUZ I;  5LL6 R;  1GQE A;  4P7D A;  4I8O A;  4LF9 I;  2F8B A;  4YY3 E;  2JOX A;  2MC6 A;  2RTX A;  3KWR A;  2V8P A;  1BKN A;  3ZKD A;  3WU5 A;  1Z0V A;  4DR1 I;  3B78 A;  4JI3 I;  4BMJ A;  5ADZ A;  1WXR A;  1ELO A;  3F0N A;  1RQ0 A;  1ZBT A;  5IWA E;  1T4L B;  3HUL A;  4HXZ A;  2EFG A;  3VYY A;  2E5L E;  1IBK I;  2V8Q B;  4BC9 A;  4LF8 I;  1N36 I;  2V34 A;  3WU6 A;  2L6M A;  4URL A;  3HTX A;  1KIJ A;  2OI2 A;  2DSY A;  1XHK A;  1IBL E;  4X62 E;  4DV1 E;  3ZKB A;  3LTO A;  4JI5 I;  5FLX C;  4B3S I;  4DV6 I;  3QT5 A;  2V83 A;  4B3M I;  2L3J A;  4JI7 E;  4JI2 I;  3VYX A;  3PYF A;  5AE3 A;  2L33 A;  3JAM Q;  2RS6 A;  3JAM C;  4FWH A;  1GZ6 A;  3AUZ A;  1X48 A;  2JOB A;  1EA6 A;  4BCA A;  3PYG A;  2E1R A;  4DV3 E;  2L3C A;  3IWC A;  2M7Q A;  1YYO A;  2JY9 A;  4JV5 I;  2NA2 A;  2MDR A;  1N0U A;  3IWB A;  2ZIT A;  4HAC B;  2KOU A;  3C4T A;  2B7V A;  2V87 A;  2DMY A;  5BR8 I;  2PNL A;  2Z5B B;  1MU5 A;  4DV4 E;  4ED4 A;  4DV1 I;  4JI6 E;  2HHH E;  4B3S E;  4UTG A;  2A2D A;  4LFC I;  3LLH A;  2F4V I;  3J7Y p;  5CFF E;  4AQY E;  3ADI A;  1K47 A;  3ZZU A;  4DV0 I;  4DPY A;  1ZXN A;  4IZJ A;  1O0W A;  4B3T E;  4YHH E;  1UHZ A;  4X66 I;  1FJG E;  4YY3 I;  3PRY A;  1YYW A;  2B9D A;  3WU3 A;  2HKE A;  2NUF A;  2CG9 A;  2GS8 A;  4GKJ I;  2FTX B;  3AV0 A;  4RPF A;  1HK7 A;  2UUA I;  1KTV A;  2HFS A;  3J80 Q;  4IZJ B;  4UT4 A;  1ZXM A;  3H4L A;  4FW9 A;  2E5L I;  1I94 E;  4DR4 I;  4LFB I;  4DR7 E;  4J8Z A;  1HR0 E;  4M1K A;  3T1H E;  2DB2 A;  4JI8 E;  4JI4 E;  4NXN I;  1FKA E;  2JVA A;  1KVK A;  4P7A A;  1HNZ E;  4JG4 A;  3H09 A;  4GEQ B;  5AAS A;  2O1T A;  3QT6 A;  1N33 I;  1HNX I;  5LMN E;  4F9A B;  1XMQ E;  2DEI A;  4B3M E;  1STU A;  4M30 A;  2V86 A;  3DJW A;  4JI2 E;  1MX0 A;  4JI7 I;  3P1X A;  2LRS A;  2V88 A;  1N32 I;  4WUB A;  4JI1 I;  4DV5 E;  1H73 A;  2EZ6 A;  1FWK A;  2O1W A;  2HFU A;  2BM0 A;  5FLX Q;  4GKJ E;  4F9C B;  5FWK A;  1Z59 A;  2UXB E;  4DPT A;  2UUA E;  4LF7 E;  3WU4 A;  1N36 E;  4LF6 E;  3PYD A;  2X7I A;  4KQV A;  2VQE E;  1PIE A;  2V2Q A;  1KKH A;  4WYQ B;  4L5N C;  1HR0 I;  2Z5C A;  4LFA I;  2CPN A;  3QT7 A;  1U2R A;  3T1Y I;  1WUU A;  3PYE A;  4OX9 I;  2V2V A;  1RRE A;  4JI6 I;  4EMD A;  2B7T A;  1N33 E;  4DPW A;  2L2N A;  2XEX A;  2RS7 A;  1XMQ I;  4M0V A;  4USM A;  2F4V E;  4X65 I;  2JWO A;  1X47 A;  4AQY I;  2ZBK B;  4DUZ E;  1N34 I;  1N32 E;  3V2U C;  4JI1 E;  4DMI A;  2UXD I;  4MYU A;  2R42 A;  4B3T I;  4FWD A;  2LUP B;  2LTS A;  1NHJ A;  2ZM6 I;  1FNM A;  3FIG A;  4Z7C A;  1FJG I;  4X64 E;  3QT8 A;  2VE7 C;  2VQE I;  4LF5 I;  2J7K A;  1B63 A;  4DV4 I;  4JI0 E;  4DV7 E;  5IWA I;  4WUD A;  4MYT A;  4OOG C;  3OTO I;  2O1U A;  2L92 A;  4LF8 E;  2PNM A;  4PRV A;  4DV2 E;  1Z5A A;  3HJC A;  2YZT A;  1MG7 A;  4XTJ A;  5LMU I;  1IBL I;  4DUY E;  1USV A;  2V89 A;  2HK2 A;  1Z0W A;  1NHI A;  4NXN E;  2JR1 A;  4DV6 E;  2YT4 A;  1YZ9 A;  5F3W A;  1NZ0 A;  3Q6M A;  2O1V A;  4KZS A;  2IHR 1;  2K4V A;  2UXD E;  2B3T B;  3J7A G;  5AE1 A;  1XNQ E;  2Z5C B;  1Y4S A;  3GON A;  4FN5 A;  2UU9 I;  2ZM6 E;  1HNX E;  1Z0B A;  3HQ1 A;  1A6F A;  4LF5 E;  4ZVI A;  2NPF A;  1Y6Z A;  3OTO E;  2NUG A;  2UXB I;  4KHP E;  4JI8 I;  5A2Q Q;  4JI4 I;  3F6G A;  4GKK I;  3ZOQ B;  3ZZT A;  1H7U A;  3RMP A;  1T4O A;  2UUB E;  4DR3 I;  3ADJ A;  2ODR C;  1H72 C;  1ZM2 A;  4DUY I;  4TUG A;  3LPS A;  2LBS B;  4HY1 A;  4LU9 A;  4BC7 A;  4P78 A;  4Q28 A;  1XNQ I;  2UU9 E;  4B3R I;  1XMO E;  4R03 A;  2CZ9 A;  2UUC I;  4WFT A;  2DIX A;  3HXL A;  4X65 E;  4Z7Y A;  1NHH A;  3J81 Q;  4LF6 I;  3J81 C;  3J80 C;  2DEJ A;  4PU9 A;  4K0K E;  1EI1 A;  1WHQ A;  2L2M A;  2N3H A;  1ZBQ A;  1HNW E;  4IZK A;  2KON A;  2UXC I;  3T1Y E;  5AE2 A;  1S4E A;  1DI2 A;  4JI0 I;  3J7A M;  2WZO A;  1Z0G A;  1X49 A;  2M4I A;  4DR7 I;  4X8W A;  1Z0C A;  4WPY A;  1XNR I;  3ADG A;  4DV2 I;  2LE2 A;  1N34 E;  1UEK A;  3K17 A;  5IT9 Q;  2LJH A;  2A2C A;  1HNZ I;  4N3O A;  4M2Z A;  2V2Z A;  3M6A A;  4DR5 I;  4NXM I;  2L2K B;  1WHN A;  1DAR A;  3B8H A;  1FWL A;  1DQ3 A;  2RSM A;  1J26 A;  4X64 I;  3Q1Q A;  2LJP A;  1Z5B A;  1ZM3 A;  3CWV A;  4DV5 I;  2EWL A;  3LNU A;  4DV7 I;  3JU0 A;  2HK3 A;  4HYM A;  4DR6 I;  3VK6 A;  4JI3 E;  2H36 X;  4LF7 I;  2UXC E;  3ZZ0 A;  4LF4 I;  4PRX A;  2Z5B A;  2FV4 B;  1S16 A;  4DPX A;  3HPS A;  1H74 A;  2NUE A;  2HHH I;  1QU6 A;  1IBM E;  4LFA E;  5DNY A;  1FI4 A;  4I3H A;  1Z0E A;  4LF9 E;  1N0V C;  2BV3 A;  2Z5E A;  1UIL A;  4TUI A;  4OX9 E;  4WUC A;  3V5R A;  4DR5 E;  4JI5 E;  4NXM E;  1Y4U A;  3D4J A;  4R1F A;  2X36 A;  1ZM4 A;  1Z5C A;  2G7H A;  4X66 E;  5A2Q C;  4DR1 E;  4YHH I;  5GMD A;  1J5E I;  4B3R E;  5GME A;  1XMO I;  1EKZ A;  5L3J A;  4DR6 E;  1IBK E;  2VF1 A;  4BS9 A;  2ODR D;  4HAC A;  2LMZ A;  1T4N A;  1OJ4 A;  4GKK E;  3K85 A;  4P52 A;  2LTR A;  2BM1 A;  4K0K I;  4DR3 E;  4JV5 E;  2UUB I;  1ZM9 A;  1IBM I;  3T1H I;  2IOP A;  2CGE A;  2VQF E;  3ADL A;  4R8O A;  1PKP A;  4DKK A;  5BR8 E;  3MSW A;  2WW4 A;  3P06 A;  4DR2 E;  1RC7 A;  4DU8 A;  3C4B A;  4L8N A;  1SR9 A;  3K1J A;  3ZM7 A;  4F54 A;  1USU A;  5LMU E;  2UUC E;  2IOQ A;  4LFC E;  4DPU A;  5LMN I;  4JYA I;  2R3V A;  1QZR A;  1PVG A;  1B62 A;  1H7S A;  1J5E E;  2M1S A;  1YYK A;  3F6H A;  2FGG A;  4DV0 E;  3DF6 A;  4DU7 A;  4DV3 I;  1Z0T A;  4BBY A;  3Q6N A;  2MC5 A;  4USK A;  3JTZ A;  5T6J A;  3OML A;  2AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...