5LMUE

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmuE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuE02
2ZBKB 4LF5E 3HULA 4WYQB 1XMOE 4Z7CA 2GS8A 4HXZA 4FWDA 1N36E 3PYEA 4JI8I 2ZM6I 3B8HA 4X62I 2HKEA 4JI3E 1Z0CA 4DV1E 4JI7I 1S16A 2VQEE 3JAMQ 2UXBE 4OOGC 4I3HA 1HNXI 4DR6E 2R42A 4X65I 2VQFI 4DV4E 1O0WA 3LPSA 4NXMI 2UUBE 4YHHI 2B7TA 2JVAA 4LF7E 1ZM4A 2V2ZA 4M1KA 4DR3E 2L3CA 1RC7A 4B3SI 4JG4A 4HACB 4JI4E 3B82A 2DB2A 4DUZE 1BKNA 4DR7I 5FLXQ 1T4OA 1IBKI 4YY3E 5CFFE 4X65E 2DIXA 1NHIA 1YZ9A 3LLHA 5L3JA 3ADLA 4GKKI 2HK3A 4DR1I 4AQYE 1T4LB 1UHZA 3J7AG 1J5EE 4DV5I 1MX0A 1HNWE 3PYDA 3M6AA 2DMYA 1IBKE 3V5RA 2LTSA 4X64E 4JI5E 4P52A 1HNZE 4OX9E 4UTGA 4Z7YA 4LF6E 4LFBE 4DPXA 4DUYI 4DV6E 1A6FA 2UUCI 4JI0E 3GONA 3ZZ0A 1Z0VA 3T1YI 2NPFA 4LF4I 1ZXMA 5GMDA 2E5LI 5IWAI 2V2QA 5LMUI 1YYOA 1H7UA 4B3TI 2UXCE 1IBME 5IT9C 2E5LE 2UUAE 4DR2E 1Z0BA 1XNRE 1HR0E 5IWAE 2LUPB 2DEJA 4DV3E 3T1HE 4FWHA 2BM0A 2KHXA 2V2VA 2ZM6E 4R1FA 3B78A 2HHHE 1B63A 1ZM3A 5BR8E 2MDRA 4DKKA 4B3MI 1PVGA 4JI3I 4LF8E 1EA6A 3T1HI 2CPNA 4MYUA 2HHHI 2VQEI 4FWGA 4WUDA 4LF9I 1MG7A 2VQFE 1Z0GA 1HNZI 3C4TA 1Z5AA 4B3RI 2AJ4A 4JI4I 1YYWA 3WU6A 1N33E 1T4NA 2ZITA 2N3HA 4KQVA 4LF8I 1KKHA 2NUFA 4USMA 4GKJE 2RS7A 2LBSB 1RQ0A 1VISA 3WU3A 2F4VI 2A2CA 2LTRA 1UILA 2X7IA 4JI2I 3OTOI 4DR1E 4DV7I 4AQYI 1N32E 1N0UA 1ZBTA 4NXNI 1XNQE 2HK2A 3WU5A 4RPFA 4LF5I 4DU8A 3J80C 2NUGA 1ZXNA 2LRSA 3QT6A 3F0NA 4DR2I 3J81C 4EMDA 4B3TE 1N34I 1OJ4A 1IBMI 1DI2A 2UUAI 4DR5E 4LF6I 4LFBI 4DPUA 4JI2E 1PIEA 4JI1E 4DV7E 4JV5E 3P1XA 2CZ9A 1X49A 2IHR1 4LF4E 1IBLI 4DU7A 4JI0I 3ZKDA 4K0KI 3ZZUA 4B3ME 3QT8A 3CWVA 2V34A 4WUBA 2XEXA 2UXCI 5A2QQ 2L2MA 2UXDI 1H73A 1XNRI 3ADIA 4X66E 2R3VA 4DUZI 4DPYA 2RTXA 4GKKE 4JI6I 2B7VA 3D4JA 1X48A 2N3GA 4DV3I 1WUUA 1J5EI 1QZRA 4DV5E 4B3RE 4JI7E 1Z5CA 2HKJA 4NXME 2UUBI 4DR4I 1Z0WA 2DEIA 2A2DA 1FKAE 3PYGA 4DR6I 2Q2EB 4DR3I 1FJGI 5LMNE 4NXNE 1ELOA 1XNQI 2BM1A 3C4BA 4LFCE 1Z0EA 1U2RA 4DPTA 4JI6E 2WW4A 2L3JA 4DR4E 1NHHA 1XMQE 2B3TB 4B3SE 3T1YE 1H72C 3QT7A 4HYMA 4JYAI 4KHPI 4DPWA 2OI2A 3J81Q 1J26A 4UT4A 2JY9A 1FWKA 2L2NA 1YYKA 3JAMC 1XMQI 1QU6A 4PRVA 2EZ6A 2LUQA 1Z0TA 3ZKBA 4FW9A 1N33I 3VYXA 3OTOE 1FWLA 5FLXC 2X36A 4URLA 1HNWI 1XMOI 2F4VE 1FNMA 2UU9I 1RR9A 5LL6R 3HTXA 4DV6I 4ZVIA 2UXDE 4XTJA 4LFAI 3K1JA 4X8WA 3ADJA 4WFTA 1KVKA 4P7AA 2VF3A 5GMEA 1Z59A 1EKZA 2V8PA 3K17A 3V2UC 3ZZTA 1GQEA 2L33A 1I94E 1KTVA 1K47A 1NHJA 1FI4A 3QT5A 2LJPA 1S4EA 2EFGA 4DR5I 4YHHE 4M2ZA 1H7SA 2UU9E 1ZM2A 3Q1QA 4ED4A 3LTOA 4JV5I 1WHQA 4DR7E 5IT9Q 4LFAE 1XHKA 3J80Q 4K0KE 1FJGE 1IBLE 3VYYA 4HY1A 3ZM7A 2E1RA 4YY3I 2UXBI 4WUCA 4X62E 3ADGA 1WHNA 1HNXE 1MU5A 4DV0I 2LJHA 1UEKA 4DV1I 4DV4I 1B62A 5BR8I 2J7KA 4LF7I 4JYAE 4KHPE 2BV3A 4X64I 1N32I 4X66I 4JI5I 1EI1A 1STUA 4DV0E 3J7AM 4OX9I 4MYTA 4FN5A 2UUCE 3H4LA 4LF9E 1DARA 3LNUA 3J7Yp 3PYFA 2NUEA 4DV2E 4HACA 1D6TA 1RREA 5LMNI 1N34E 2RSMA 5A2QC 5LMUE 4LFCI 3WU4A 2NA2A 4JI1I 1X47A 1NZ0A 4PRXA 2L2KB 1Z5BA 4DXLA 4M30A 4JI8E 1N36I 2YT4A 1N0VC 4GKJI 2HFUA 1I94I 4USKA 1ZM9A 1PKPA 2RS6A 1H74A 4PU9A 2HFSA 4DUYE 4DV2I 1HR0I 1KIJA
chains in the Genus database with same CATH superfamily
4O43A 2ZBKB 4M9VC 2PO0A 2EOEA 4LF5E 3HKMA 3HULA 2EMWA 4WYQB 2M1SA 5AE1A 2EQ0A 1XMOE 4Z7CA 3HQ1A 4HTGA 2GS8A 4HXZA 2H36X 4FWDA 5A6KA 1N36E 3PYEA 3HJCA 4JI8I 4NBQA 3M7NG 2ZM6I 2YU8A 3B8HA 2WCC3 4X62I 5ELWA 2HKEA 4OO1E 4JI3E 1Z0CA 1Y60A 4DV1E 4NHRA 4DMIA 5DNLA 1R6LA 4JI7I 1S16A 5K36C 1TN9A 2VQEE 5DRPA 2UXBE 3HPZA 3JAMQ 1QNTA 4OOGC 2JOXA 3K85A 4I3HA 4ZYDA 4F9AB 5LLQA 1HNXI 4DR6E 4FK5C 2R42A 3CDJA 4LCGA 4X65I 2G7HA 5AE2A 4TUIA 2Z5EA 4DV4E 4FW7A 2VQFI 4R8OA 1O0WA 1MEYC 3LPSA 4NXMI 2UUBE 2O1TA 5A6BD 4GZNC 4YHHI 1GTKA 2B7TA 2FTXB 2JVAA 4LF7E 1ZM4A 2BA0D 2V2ZA 4M1KA 5K36A 4DR3E 2L3CA 3VHTB 1RC7A 4B3SI 3L7ZA 4JG4A 4HACB 4BS9A 4JI4E 3B82A 2LCEA 2ODRC 1ZU1A 2DB2A 4AIDA 4DUZE 1BKNA 1KJKA 4DR7I 2EPXA 1T4OA 2V86A 1Y4UA 2DLQA 3GMEA 5FLXQ 2EMKA 2IERA 2PNLA 1IBKI 4YY3E 5CFFE 2EOOA 2DIXA 4X65E 1NHIA 1YZ9A 5K36F 2ELYA 3LLHA 5L3JA 1Y5YA 3ADLA 5AC5A 1RHYA 1F2IG 1JK1A 2WP8A 3M85D 2EOFA 1Y4SA 4GKKI 2HK3A 4Q28A 3RMPA 2EPZA 2EPPA 4DR1I 4AQYE 1YUJA 2PNZB 1T4LB 1UHZA 5A6BA 3J7AG 2LO3A 2NN6F 4BA1B 1RMDA 1XXEA 4R2PA 1J5EE 4GQUA 1N3GA 4DV5I 1MX0A 2MDGA 1HNWE 2RSIA 3PYDA 3M6AA 2DMYA 4FW5A 4BA2B 1IBKE 2K4VA 2N8XA 4R2CA 3V5RA 2C38B 2LTSA 2YTEA 5AE3A 4X64E 4ZYGA 2GO3A 4JI5E 3L00A 4P52A 1HNZE 4R03A 4OX9E 2BA1D 4UTGA 4Z7YA 4IJDA 4LF6E 4LFBE 4DPXA 4IFDC 2JT2A 2PNMA 5C0XA 4DUYI 1UDOA 1UBDC 4DV6E 2YSPA 1A6FA 3EPLA 2UUCI 4JI0E 3GONA 2Q8UA 3ZZ0A 1Z0VA 3P3CA 4ZYEA 3T1YI 2EM7A 4IS1C 2R76A 2K7IA 2NPFA 4LF4I 1ZXMA 4J3DA 5GMDA 3DF6A 1LLMC 2E5LI 2KONA 2EPCA 2NN6C 3U1KA 2EM4A 2M4IA 2BA0G 2IESA 4OZEA 5C0XE 1UDNA 4OO1B 2DGCA 5IWAI 2V2QA 4FW3A 5LMUI 2VRDA 1YYOA 1H7UA 2IOQA 4B3TI 4R2QA 2UXCE 5IT9C 1IBME 2EL4A 4BHCA 4WX9A 2E5LE 1SR9A 2UUAE 5A6JA 4DR2E 1A1HA 1Z0BA 2EP3A 5DRRA 1XNRE 2EOJA 3AUZA 1HR0E 1UN6B 4N4RB 5IWAE 2LUPB 3M85G 2DEJA 2PO0B 4DV3E 1KYQA 2NN6D 2DLKA 4GEQB 2EMAA 2Z5BB 3T1HE 3F6HA 4FWHA 3IWDA 2C37B 2V85A 2BM0A 4L5NC 2EORA 3VK6A 1B69A 3H1CA 1UDQA 2NN6E 2EN2A 4IZJD 2JE6A 2KHXA 2LJUA 2MC6A 2V2VA 2LE2A 2ZM6E 2LT7A 1X6FA 1ZR9A 2JXPA 2ODRD 1USVA 2JEBA 4MU0A 4R1FA 3B78A 2Z5CB 2HHHE 1B63A 4O5GA 1ZM3A 5BR8E 3THOB 2CSHA 2GO4A 3P06A 2MDRA 4HEIA 3PRYA 4DKKA 2JYAA 2FGGA 2EQ3A 1USUA 2Z5CA 5JEAB 1PVGA 4B3MI 4JI3I 1WJPA 5F3WA 4LF8E 3EPJA 2NABA 5TSEA 1ZAAC 2CG9A 1EA6A 2JEBB 2YRMA 3T1HI 2CPNA 1X6HA 2EMLA 4MYUA 2HHHI 3BGHA 2VQEI 2EQ1A 3IWBA 4FWGA 5A69A 4WUDA 2LMZA 2EN7A 2MKNA 2MC5A 4LF9I 1MG7A 1L4SA 1X3CA 2VQFE 4X9JA 1Z0GA 2EPMX 3AV0A 1HNZI 2EPRA 3C4TA 5DROA 1Z5AA 4B3RI 2AJ4A 4JI4I 2EN4A 1YYWA 3WU6A 2C39A 2PNZA 1WXRA 1DGCA 1T4NA 1N33E 2ZITA 2N3HA 4KQVA 4LF8I 1KKHA 2VE7C 2NUFA 4USMA 4GKJE 2RS7A 2LBSB 1RQ0A 3OMLA 1VISA 2YPNA 4OO1A 2IOPA 3WU3A 2F4VI 2A2CA 2LTRA 1OYSA 4R2EA 2EL6A 1UILA 2EM6A 4QNJA 2X7IA 2YWQA 3OTOI 4DR1E 4JI2I 4DV7I 4AQYI 1N32E 1N0UA 2PRTA 1ZBTA 1A1LA 2ENHA 2EM2A 2WBSA 4FW6A 4NXNI 4F6MA 1XNQE 3EQ1A 4BMJA 2HK2A 3WU5A 4RPFA 4LF5I 1EH7A 4FW4A 3J80C 4DU8A 2NUGA 4OO1F 2BB8A 4F2JC 2LRSA 1ZXNA 3BIDA 3QT6A 2JEAA 5DNYA 1EH6A 3F0NA 4DR2I 2AE8A 4Q35B 3J81C 1OYRA 4EMDA 4B3TE 1N34I 1DQ3A 1OJ4A 1IBMI 1DI2A 1Y6ZA 2DRPA 4WPYA 2EM0A 2EPUA 2YU5A 4DR5E 1OYPA 2UUAI 4ZYHA 4DPUA 4LF6I 2B9DA 4LFBI 4JI2E 1PIEA 4JI1E 4DV7E 1PJTA 3P1XA 4JV5E 3Q6NA 2ENCA 3KZZA 4BC9A 4LPFA 3F6GA 4IFDE 3H09A 3TQMA 3MHSC 2CZ9A 1X49A 2IHR1 4LF4E 2GQ0A 2VESA 5IXMB 2V88A 1IBLI 4DU7A 5A6AA 4JI0I 3GCMA 4KZSA 2EPAA 2EPNA 3K6QA 2YTGA 2C39B 3ZKDA 2VF1A 5KL7A 4K0KI 3ZZUA 4B3ME 3B4TA 3CWVA 3DD6A 1PJSA 4LU9A 3QT8A 2V34A 4IFDA 4WUBA 2F1DA 2XEXA 2EOSA 1A1KA 2PO2B 5C0XC 2UXCI 4F6NA 1TF6A 5A2QQ 2EMZA 2NN6B 2L2MA 2RPCA 1A1FA 5JEAE 2UXDI 1H73A 2EM3A 3LMLA 2GPIA 1G2FC 4OO1C 1XNRI 4WSPA 3ADIA 2FV4B 4X66E 2CGEA 1AAYA 1YHCA 2EL5A 2R3VA 3L7ZB 4DUZI 3P76A 4DPYA 2RTXA 5JEAA 2EPKX 4IZKA 4GKKE 5DRQA 4JI6I 2B7VA 2JEAB 3D4JA 2O1VA 1X48A 2N3GA 4DV3I 5EL9A 1R6MA 2YTQA 1WUUA 1J5EI 2ENAA 1QZRA 4DV5E 3MHHC 4JI7E 4B3RE 2EE8A 1Z5CA 2HKJA 1YPNA 4NXME 2UUBI 3EPKA 4LOMA 4BA2A 2EN1A 2RQLA 4DR4I 1Z0WA 2Z5BA 5IV8B 2DEIA 2ELZA 1P47A 2A2DA 2E1MA 1FKAE 2O1WA 3PYGA 2C37A 4DR6I 2JWOA 4TUGA 2Q2EB 2HC5A 2BBGA 2CTDA 5AASA 5LMNE 4DR3I 1FJGI 3BBGA 4P78A 4NXNE 1AH5A 1ELOA 1XNQI 2BM1A 4IFDB 2V83A 3C4BA 4LFCE 2DMIA 1Z0EA 1U2RA 3M7ND 4DPTA 2EMIA 1PDAA 4JI6E 2WW4A 2L3JA 2L6MA 2LV2A 3THNA 4DR4E 1NHHA 1XMQE 2B3TB 1T39A 4B3SE 2YSOA 2M9AA 3T1YE 1H72C 3QT7A 4HYMA 4IFDF 4JYAI 4F9CB 4KHPI 2DSYA 2YTFA 4L8NA 4DPWA 4BHBA 2YTDA 2WBUA 2OI2A 2EOQA 3J81Q 1J26A 4UT4A 2WNRA 2JY9A 5AC4A 3UHMA 2EMHA 1FWKA 4MDTA 2L2NA 1X5WA 1YYKA 3JAMC 1XMQI 2JOBA 1BBGA 3KZYA 1QU6A 4PRVA 1PJQA 2F8BA 2GLIA 4IZKB 2EZ6A 4IS9A 2LUQA 1Z0TA 2MKDA 2EOHA 3Q6MA 3ZKBA 4FW9A 1N33I 3VYXA 3M99B 2A25A 3OTOE 2EOIA 1FWLA 5FLXC 2YTIA 2HGHA 2ADRA 4WXCA 2X36A 4URLA 1HNWI 1ZBQA 2HJJA 2JE6B 2F4VE 1XMOI 2EM5A 2C38A 2WBTA 1FNMA 2CVEA 4BCAA 2UU9I 1A1GA 2NN6A 4LCFA 2EN6A 1RR9A 5LL6R 3HTXA 4DV6I 4ZVIA 5KL6A 2UXDE 4XTJA 5K36E 2WNRB 2WZOA 4R2DA 4LFAI 2PO2A 3MSWA 3QG5C 4X8WA 1JK2A 3ADJA 2O3ZA 3K1JA 1T38A 2YTOA 1WRJA 2EOXA 4WFTA 4R2SA 4BA1A 2PO1B 1KVKA 1P42A 4P7AA 2I9IA 2VF3A 5GMEA 5K36D 1HK7A 1Z59A 3DJWA 1EKZA 5JEAC 2PO1A 2V8PA 3K17A 3V2UC 3ZZTA 2EMFA 1GQEA 2L33A 1I94E 5T6JA 1K47A 1KTVA 1FI4A 1NHJA 2LJPA 2BR2B 3QT5A 4MU1A 2WP8B 3HXLA 1S4EA 2EFGA 4DR5I 4YHHE 1A1JA 4M2ZA 2UU9E 2EN8A 1H7SA 1ZM2A 2YRKA 5FWKA 3Q1QA 5KL5A 4F54A 1UDSA 3LTOA 4ED4A 4JV5I 1WHQA 4IZJB 4LTYA 4DR7E 3PS2A 3KWRA 5KL3A 4MU4A 5IT9Q 4LFAE 1XHKA 1NCSA 3UK3C 3J80Q 4K0KE 4AM3A 1FJGE 2BA1G 4AIMA 2EMGA 2EMBA 2EPOA 2YZTA 1BBOA 4OKGA 4KWYA 1IBLE 2GHFA 4M0VA 4P7DA 2EPLX 5KL4A 3VYYA 4MLVA 4HY1A 3ZM7A 3ECRA 2E1RA 4YY3I 1Z1BA 4WUCA 2UXBI 1YH8A 3C6MA 3ADGA 1WHNA 4X62E 1YSAC 3NZKA 1HNXE 2JPAA 1MU5A 4DV0I 2EWLA 2LJHA 1UEKA 2EOMA 4N3OA 1IQOA 2JP9A 4DV1I 2YTNA 4RHBB 4DV4I 1A1IA 4IZJA 2JR1A 1B62A 5BR8I 2EOYA 4IFDD 4BBYA 3CDIA 4OO1D 2J7KA 4LF7I 2O1UA 4JYAE 4KHPE 2EM9A 2BV3A 4X64I 1N32I 4X66I 4F9BB 3GLLA 4JI5I 3IWCA 1STUA 4DV0E 1EI1A 5C0XD 5JEAD 4OX9I 3J7AM 1X6EA 2EM8A 2D9HA 5DNXA 4MU3A 4I8OA 1TF3A 4MYTA 3C6KA 4LCHA 4FN5A 2J65A 4J8ZA 2UUCE 4R2AA 1NEIA 1MGTA 3H4LA 4MLQA 2L8TA 3ZOQB 2EMCA 4LF9E 1DARA 1YFHA 3LNUA 3HPSA 2YRHA 3J7Yp 3PYFA 4NZVA 1G2DC 4BC7A 2L92A 2NUEA 3PS3A 1E3HA 2LVHA 5EKWA 2EJ4A 5ADZA 2CT1A 2V89A 4DV2E 2M7QA 4HACA 1GZ6A 4WXDA 1RREA 4RH8A 1VI7A 1N34E 5C0XF 5LMNI 1SFEA 1D6TA 2RSMA 5A2QC 5LMUE 4ISAA 4QNKA 4LFCI 5JEAF 4U3DA 3WU4A 2NA2A 5KL2A 3KRNA 3U1YA 4JI1I 1X47A 5C0XB 1NZ0A 4PRXA 2V87A 4R2RA 5K36B 2L2KB 3EPHA 3FIGA 2R1FA 3P3GA 1Z5BA 4DXLA 4WSGA 1YUIA 4M30A 4JI8E 1N36I 4U3BA 2YT4A 1N0VC 2V8QB 1EH8A 4O24A 4GKJI 1BB8A 2HFUA 1I94I 4MQYA 3BF2A 2EN3A 2KOUA 2J7JA 2YTJA 3JTZA 1IQSA 3JU0A 3PS1A 2I13A 4USKA 1ZM9A 1PKPA 2RS6A 1H74A 4PU9A 2HFSA 2EMYA 1IMUA 1E3PA 2E72A 3P3EA 4DUYE 4DV2I 2EOZA 1HR0I 2YTPA 1KIJA 4O4KA 2EMXA 2BR2A
chains in the Genus database with same CATH topology
2ZBKB 4LF5E 3HULA 4WYQB 5AE1A 2M1SA 1XMOE 4Z7CA 3HQ1A 2GS8A 4HXZA 2H36X 4FWDA 1N36E 3PYEA 3HJCA 4JI8I 2ZM6I 3B8HA 4X62I 2HKEA 4JI3E 1Z0CA 4DV1E 4DMIA 4JI7I 1S16A 2VQEE 3JAMQ 2UXBE 3HPZA 4OOGC 4I3HA 2JOXA 3K85A 4F9AB 1HNXI 4DR6E 2R42A 4X65I 2G7HA 5AE2A 4TUIA 2Z5EA 4DV4E 2VQFI 4R8OA 1O0WA 3LPSA 4NXMI 2UUBE 2O1TA 4YHHI 2B7TA 2FTXB 2JVAA 4LF7E 1ZM4A 2V2ZA 4M1KA 4DR3E 2L3CA 1RC7A 4B3SI 4JG4A 4HACB 4BS9A 4JI4E 3B82A 2ODRC 2DB2A 4DUZE 1BKNA 4DR7I 2V86A 1T4OA 1Y4UA 5FLXQ 1IBKI 2PNLA 4YY3E 5CFFE 4X65E 2DIXA 1NHIA 1YZ9A 3LLHA 5L3JA 3ADLA 1Y4SA 4GKKI 2HK3A 4Q28A 3RMPA 4DR1I 4AQYE 1T4LB 1UHZA 3J7AG 1J5EE 4DV5I 1MX0A 1HNWE 3PYDA 3M6AA 2DMYA 1IBKE 2K4VA 3V5RA 2LTSA 5AE3A 4X64E 4JI5E 4P52A 1HNZE 4R03A 4OX9E 4UTGA 4Z7YA 4LF6E 4LFBE 4DPXA 2PNMA 4DUYI 4DV6E 1A6FA 2UUCI 4JI0E 3GONA 3ZZ0A 1Z0VA 3T1YI 2NPFA 4LF4I 1ZXMA 5GMDA 3DF6A 2E5LI 2KONA 2M4IA 5IWAI 2V2QA 5LMUI 1YYOA 1H7UA 2IOQA 4B3TI 2UXCE 5IT9C 1IBME 2E5LE 1SR9A 2UUAE 4DR2E 1Z0BA 1XNRE 3AUZA 1HR0E 5IWAE 2LUPB 2DEJA 4DV3E 4GEQB 2Z5BB 3T1HE 3F6HA 4FWHA 3IWDA 2V85A 2BM0A 4L5NC 3VK6A 4IZJD 2MC6A 2KHXA 2V2VA 2LE2A 2ZM6E 2ODRD 1USVA 4R1FA 3B78A 2Z5CB 2HHHE 1B63A 1ZM3A 5BR8E 3P06A 2MDRA 3PRYA 4DKKA 2FGGA 1USUA 2Z5CA 4B3MI 1PVGA 4JI3I 5F3WA 4LF8E 2CG9A 1EA6A 3T1HI 2CPNA 4MYUA 2HHHI 2VQEI 3IWBA 4FWGA 4WUDA 2LMZA 4LF9I 2MC5A 1MG7A 2VQFE 1Z0GA 3AV0A 1HNZI 3C4TA 1Z5AA 4B3RI 2AJ4A 4JI4I 1YYWA 3WU6A 1WXRA 1N33E 1T4NA 2ZITA 2N3HA 4KQVA 4LF8I 1KKHA 2VE7C 2NUFA 4USMA 4GKJE 2RS7A 2LBSB 1RQ0A 3OMLA 1VISA 3WU3A 2IOPA 2F4VI 2A2CA 2LTRA 1UILA 2X7IA 4JI2I 3OTOI 4DR1E 4DV7I 4AQYI 1N32E 1N0UA 1ZBTA 4NXNI 1XNQE 4BMJA 2HK2A 3WU5A 4RPFA 4LF5I 3J80C 4DU8A 2NUGA 1ZXNA 2LRSA 3QT6A 5DNYA 3F0NA 4DR2I 3J81C 4EMDA 4B3TE 1N34I 1DQ3A 1OJ4A 1IBMI 1DI2A 1Y6ZA 4WPYA 2UUAI 4DR5E 4LF6I 4LFBI 4DPUA 2B9DA 4JI2E 1PIEA 4JI1E 4DV7E 4JV5E 3P1XA 3Q6NA 4BC9A 3F6GA 3H09A 2CZ9A 1X49A 2IHR1 4LF4E 2GQ0A 2V88A 1IBLI 4DU7A 4JI0I 4KZSA 3K6QA 3ZKDA 2VF1A 4K0KI 3ZZUA 4B3ME 3CWVA 3QT8A 4LU9A 2V34A 4WUBA 2XEXA 2UXCI 5A2QQ 2L2MA 2UXDI 1H73A 3LMLA 1XNRI 4WSPA 3ADIA 2FV4B 4X66E 2CGEA 2R3VA 4DUZI 4DPYA 2RTXA 4IZKA 4GKKE 4JI6I 2B7VA 3D4JA 2O1VA 1X48A 2N3GA 4DV3I 1WUUA 1J5EI 1QZRA 4DV5E 4B3RE 4JI7E 1Z5CA 2HKJA 4NXME 2UUBI 4DR4I 1Z0WA 2Z5BA 2DEIA 2A2DA 2E1MA 1FKAE 2O1WA 3PYGA 4DR6I 2JWOA 4TUGA 2Q2EB 4DR3I 1FJGI 5AASA 5LMNE 4P78A 4NXNE 1ELOA 1XNQI 2BM1A 2V83A 3C4BA 4LFCE 1Z0EA 1U2RA 4DPTA 4JI6E 2WW4A 2L3JA 2L6MA 4DR4E 1NHHA 1XMQE 2B3TB 4B3SE 3T1YE 1H72C 3QT7A 4HYMA 4JYAI 4KHPI 4F9CB 2DSYA 4L8NA 4DPWA 2OI2A 3J81Q 1J26A 4UT4A 2JY9A 1FWKA 2L2NA 1YYKA 3JAMC 1XMQI 2JOBA 1QU6A 4PRVA 2F8BA 4IZKB 2EZ6A 2LUQA 1Z0TA 3ZKBA 3Q6MA 4FW9A 1N33I 3VYXA 3OTOE 1FWLA 5FLXC 2X36A 4URLA 1HNWI 1ZBQA 1XMOI 2F4VE 1FNMA 2UU9I 4BCAA 1RR9A 5LL6R 3HTXA 4DV6I 4ZVIA 2UXDE 4XTJA 2WZOA 4LFAI 3K1JA 3MSWA 4X8WA 3ADJA 4WFTA 1KVKA 4P7AA 2VF3A 5GMEA 1HK7A 1Z59A 3DJWA 1EKZA 2V8PA 3K17A 3V2UC 3ZZTA 1GQEA 2L33A 1I94E 5T6JA 1K47A 1KTVA 1FI4A 1NHJA 2LJPA 3QT5A 3HXLA 1S4EA 2EFGA 4DR5I 4YHHE 4M2ZA 1H7SA 2UU9E 1ZM2A 3Q1QA 5FWKA 4ED4A 4F54A 3LTOA 4JV5I 1WHQA 4IZJB 4LTYA 4DR7E 3KWRA 5IT9Q 4LFAE 1XHKA 3J80Q 4K0KE 1FJGE 2YZTA 1IBLE 4P7DA 4M0VA 3VYYA 4HY1A 3ZM7A 2E1RA 4YY3I 2UXBI 4WUCA 4X62E 3ADGA 1WHNA 1HNXE 1MU5A 4DV0I 2EWLA 2LJHA 1UEKA 4N3OA 4DV1I 4DV4I 4IZJA 2JR1A 1B62A 5BR8I 4BBYA 2J7KA 4LF7I 2O1UA 4JYAE 4KHPE 2BV3A 4X64I 1N32I 4X66I 4F9BB 4JI5I 3IWCA 1STUA 4DV0E 1EI1A 3J7AM 4OX9I 4I8OA 4MYTA 4FN5A 4J8ZA 2UUCE 3H4LA 2L8TA 3ZOQB 4LF9E 1DARA 3LNUA 3HPSA 3J7Yp 3PYFA 4BC7A 2L92A 2NUEA 5ADZA 2V89A 4DV2E 2M7QA 4HACA 1GZ6A 1RREA 5LMNI 1D6TA 1N34E 2RSMA 5A2QC 5LMUE 4LFCI 3WU4A 2NA2A 4JI1I 1X47A 1NZ0A 4PRXA 2V87A 2L2KB 3FIGA 1Z5BA 4DXLA 4M30A 4JI8E 1N36I 2YT4A 1N0VC 2V8QB 4GKJI 2HFUA 1I94I 2KOUA 3JTZA 4USKA 3JU0A 1ZM9A 1PKPA 2RS6A 1H74A 4PU9A 2HFSA 4DUYE 4DV2I 1HR0I 1KIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZBK B;  4LF5 E;  3HUL A;  4WYQ B;  1XMO E;  4Z7C A;  2GS8 A;  4HXZ A;  4FWD A;  1N36 E;  3PYE A;  4JI8 I;  2ZM6 I;  3B8H A;  4X62 I;  2HKE A;  4JI3 E;  1Z0C A;  4DV1 E;  4JI7 I;  1S16 A;  2VQE E;  3JAM Q;  2UXB E;  4OOG C;  4I3H A;  1HNX I;  4DR6 E;  2R42 A;  4X65 I;  2VQF I;  4DV4 E;  1O0W A;  3LPS A;  4NXM I;  2UUB E;  4YHH I;  2B7T A;  2JVA A;  4LF7 E;  1ZM4 A;  2V2Z A;  4M1K A;  4DR3 E;  2L3C A;  1RC7 A;  4B3S I;  4JG4 A;  4HAC B;  4JI4 E;  3B82 A;  2DB2 A;  4DUZ E;  1BKN A;  4DR7 I;  5FLX Q;  1T4O A;  1IBK I;  4YY3 E;  5CFF E;  4X65 E;  2DIX A;  1NHI A;  1YZ9 A;  3LLH A;  5L3J A;  3ADL A;  4GKK I;  2HK3 A;  4DR1 I;  4AQY E;  1T4L B;  1UHZ A;  3J7A G;  1J5E E;  4DV5 I;  1MX0 A;  1HNW E;  3PYD A;  3M6A A;  2DMY A;  1IBK E;  3V5R A;  2LTS A;  4X64 E;  4JI5 E;  4P52 A;  1HNZ E;  4OX9 E;  4UTG A;  4Z7Y A;  4LF6 E;  4LFB E;  4DPX A;  4DUY I;  4DV6 E;  1A6F A;  2UUC I;  4JI0 E;  3GON A;  3ZZ0 A;  1Z0V A;  3T1Y I;  2NPF A;  4LF4 I;  1ZXM A;  5GMD A;  2E5L I;  5IWA I;  2V2Q A;  5LMU I;  1YYO A;  1H7U A;  4B3T I;  2UXC E;  1IBM E;  5IT9 C;  2E5L E;  2UUA E;  4DR2 E;  1Z0B A;  1XNR E;  1HR0 E;  5IWA E;  2LUP B;  2DEJ A;  4DV3 E;  3T1H E;  4FWH A;  2BM0 A;  2KHX A;  2V2V A;  2ZM6 E;  4R1F A;  3B78 A;  2HHH E;  1B63 A;  1ZM3 A;  5BR8 E;  2MDR A;  4DKK A;  4B3M I;  1PVG A;  4JI3 I;  4LF8 E;  1EA6 A;  3T1H I;  2CPN A;  4MYU A;  2HHH I;  2VQE I;  4FWG A;  4WUD A;  4LF9 I;  1MG7 A;  2VQF E;  1Z0G A;  1HNZ I;  3C4T A;  1Z5A A;  4B3R I;  2AJ4 A;  4JI4 I;  1YYW A;  3WU6 A;  1N33 E;  1T4N A;  2ZIT A;  2N3H A;  4KQV A;  4LF8 I;  1KKH A;  2NUF A;  4USM A;  4GKJ E;  2RS7 A;  2LBS B;  1RQ0 A;  1VIS A;  3WU3 A;  2F4V I;  2A2C A;  2LTR A;  1UIL A;  2X7I A;  4JI2 I;  3OTO I;  4DR1 E;  4DV7 I;  4AQY I;  1N32 E;  1N0U A;  1ZBT A;  4NXN I;  1XNQ E;  2HK2 A;  3WU5 A;  4RPF A;  4LF5 I;  4DU8 A;  3J80 C;  2NUG A;  1ZXN A;  2LRS A;  3QT6 A;  3F0N A;  4DR2 I;  3J81 C;  4EMD A;  4B3T E;  1N34 I;  1OJ4 A;  1IBM I;  1DI2 A;  2UUA I;  4DR5 E;  4LF6 I;  4LFB I;  4DPU A;  4JI2 E;  1PIE A;  4JI1 E;  4DV7 E;  4JV5 E;  3P1X A;  2CZ9 A;  1X49 A;  2IHR 1;  4LF4 E;  1IBL I;  4DU7 A;  4JI0 I;  3ZKD A;  4K0K I;  3ZZU A;  4B3M E;  3QT8 A;  3CWV A;  2V34 A;  4WUB A;  2XEX A;  2UXC I;  5A2Q Q;  2L2M A;  2UXD I;  1H73 A;  1XNR I;  3ADI A;  4X66 E;  2R3V A;  4DUZ I;  4DPY A;  2RTX A;  4GKK E;  4JI6 I;  2B7V A;  3D4J A;  1X48 A;  2N3G A;  4DV3 I;  1WUU A;  1J5E I;  1QZR A;  4DV5 E;  4B3R E;  4JI7 E;  1Z5C A;  2HKJ A;  4NXM E;  2UUB I;  4DR4 I;  1Z0W A;  2DEI A;  2A2D A;  1FKA E;  3PYG A;  4DR6 I;  2Q2E B;  4DR3 I;  1FJG I;  5LMN E;  4NXN E;  1ELO A;  1XNQ I;  2BM1 A;  3C4B A;  4LFC E;  1Z0E A;  1U2R A;  4DPT A;  4JI6 E;  2WW4 A;  2L3J A;  4DR4 E;  1NHH A;  1XMQ E;  2B3T B;  4B3S E;  3T1Y E;  1H72 C;  3QT7 A;  4HYM A;  4JYA I;  4KHP I;  4DPW A;  2OI2 A;  3J81 Q;  1J26 A;  4UT4 A;  2JY9 A;  1FWK A;  2L2N A;  1YYK A;  3JAM C;  1XMQ I;  1QU6 A;  4PRV A;  2EZ6 A;  2LUQ A;  1Z0T A;  3ZKB A;  4FW9 A;  1N33 I;  3VYX A;  3OTO E;  1FWL A;  5FLX C;  2X36 A;  4URL A;  1HNW I;  1XMO I;  2F4V E;  1FNM A;  2UU9 I;  1RR9 A;  5LL6 R;  3HTX A;  4DV6 I;  4ZVI A;  2UXD E;  4XTJ A;  4LFA I;  3K1J A;  4X8W A;  3ADJ A;  4WFT A;  1KVK A;  4P7A A;  2VF3 A;  5GME A;  1Z59 A;  1EKZ A;  2V8P A;  3K17 A;  3V2U C;  3ZZT A;  1GQE A;  2L33 A;  1I94 E;  1KTV A;  1K47 A;  1NHJ A;  1FI4 A;  3QT5 A;  2LJP A;  1S4E A;  2EFG A;  4DR5 I;  4YHH E;  4M2Z A;  1H7S A;  2UU9 E;  1ZM2 A;  3Q1Q A;  4ED4 A;  3LTO A;  4JV5 I;  1WHQ A;  4DR7 E;  5IT9 Q;  4LFA E;  1XHK A;  3J80 Q;  4K0K E;  1FJG E;  1IBL E;  3VYY A;  4HY1 A;  3ZM7 A;  2E1R A;  4YY3 I;  2UXB I;  4WUC A;  4X62 E;  3ADG A;  1WHN A;  1HNX E;  1MU5 A;  4DV0 I;  2LJH A;  1UEK A;  4DV1 I;  4DV4 I;  1B62 A;  5BR8 I;  2J7K A;  4LF7 I;  4JYA E;  4KHP E;  2BV3 A;  4X64 I;  1N32 I;  4X66 I;  4JI5 I;  1EI1 A;  1STU A;  4DV0 E;  3J7A M;  4OX9 I;  4MYT A;  4FN5 A;  2UUC E;  3H4L A;  4LF9 E;  1DAR A;  3LNU A;  3J7Y p;  3PYF A;  2NUE A;  4DV2 E;  4HAC A;  1D6T A;  1RRE A;  5LMN I;  1N34 E;  2RSM A;  5A2Q C;  5LMU E;  4LFC I;  3WU4 A;  2NA2 A;  4JI1 I;  1X47 A;  1NZ0 A;  4PRX A;  2L2K B;  1Z5B A;  4DXL A;  4M30 A;  4JI8 E;  1N36 I;  2YT4 A;  1N0V C;  4GKJ I;  2HFU A;  1I94 I;  4USK A;  1ZM9 A;  1PKP A;  2RS6 A;  1H74 A;  4PU9 A;  2HFS A;  4DUY E;  4DV2 I;  1HR0 I;  1KIJ A; 
#chains in the Genus database with same CATH topology
 4O43 A;  2ZBK B;  4M9V C;  2PO0 A;  2EOE A;  4LF5 E;  3HKM A;  3HUL A;  2EMW A;  4WYQ B;  2M1S A;  5AE1 A;  2EQ0 A;  1XMO E;  4Z7C A;  3HQ1 A;  4HTG A;  2GS8 A;  4HXZ A;  2H36 X;  4FWD A;  5A6K A;  1N36 E;  3PYE A;  3HJC A;  4JI8 I;  4NBQ A;  3M7N G;  2ZM6 I;  2YU8 A;  3B8H A;  2WCC 3;  4X62 I;  5ELW A;  2HKE A;  4OO1 E;  4JI3 E;  1Z0C A;  1Y60 A;  4DV1 E;  4NHR A;  4DMI A;  5DNL A;  1R6L A;  4JI7 I;  1S16 A;  5K36 C;  1TN9 A;  2VQE E;  5DRP A;  2UXB E;  3HPZ A;  3JAM Q;  1QNT A;  4OOG C;  2JOX A;  3K85 A;  4I3H A;  4ZYD A;  4F9A B;  5LLQ A;  1HNX I;  4DR6 E;  4FK5 C;  2R42 A;  3CDJ A;  4LCG A;  4X65 I;  2G7H A;  5AE2 A;  4TUI A;  2Z5E A;  4DV4 E;  4FW7 A;  2VQF I;  4R8O A;  1O0W A;  1MEY C;  3LPS A;  4NXM I;  2UUB E;  2O1T A;  5A6B D;  4GZN C;  4YHH I;  1GTK A;  2B7T A;  2FTX B;  2JVA A;  4LF7 E;  1ZM4 A;  2BA0 D;  2V2Z A;  4M1K A;  5K36 A;  4DR3 E;  2L3C A;  3VHT B;  1RC7 A;  4B3S I;  3L7Z A;  4JG4 A;  4HAC B;  4BS9 A;  4JI4 E;  3B82 A;  2LCE A;  2ODR C;  1ZU1 A;  2DB2 A;  4AID A;  4DUZ E;  1BKN A;  1KJK A;  4DR7 I;  2EPX A;  1T4O A;  2V86 A;  1Y4U A;  2DLQ A;  3GME A;  5FLX Q;  2EMK A;  2IER A;  2PNL A;  1IBK I;  4YY3 E;  5CFF E;  2EOO A;  2DIX A;  4X65 E;  1NHI A;  1YZ9 A;  5K36 F;  2ELY A;  3LLH A;  5L3J A;  1Y5Y A;  3ADL A;  5AC5 A;  1RHY A;  1F2I G;  1JK1 A;  2WP8 A;  3M85 D;  2EOF A;  1Y4S A;  4GKK I;  2HK3 A;  4Q28 A;  3RMP A;  2EPZ A;  2EPP A;  4DR1 I;  4AQY E;  1YUJ A;  2PNZ B;  1T4L B;  1UHZ A;  5A6B A;  3J7A G;  2LO3 A;  2NN6 F;  4BA1 B;  1RMD A;  1XXE A;  4R2P A;  1J5E E;  4GQU A;  1N3G A;  4DV5 I;  1MX0 A;  2MDG A;  1HNW E;  2RSI A;  3PYD A;  3M6A A;  2DMY A;  4FW5 A;  4BA2 B;  1IBK E;  2K4V A;  2N8X A;  4R2C A;  3V5R A;  2C38 B;  2LTS A;  2YTE A;  5AE3 A;  4X64 E;  4ZYG A;  2GO3 A;  4JI5 E;  3L00 A;  4P52 A;  1HNZ E;  4R03 A;  4OX9 E;  2BA1 D;  4UTG A;  4Z7Y A;  4IJD A;  4LF6 E;  4LFB E;  4DPX A;  4IFD C;  2JT2 A;  2PNM A;  5C0X A;  4DUY I;  1UDO A;  1UBD C;  4DV6 E;  2YSP A;  1A6F A;  3EPL A;  2UUC I;  4JI0 E;  3GON A;  2Q8U A;  3ZZ0 A;  1Z0V A;  3P3C A;  4ZYE A;  3T1Y I;  2EM7 A;  4IS1 C;  2R76 A;  2K7I A;  2NPF A;  4LF4 I;  1ZXM A;  4J3D A;  5GMD A;  3DF6 A;  1LLM C;  2E5L I;  2KON A;  2EPC A;  2NN6 C;  3U1K A;  2EM4 A;  2M4I A;  2BA0 G;  2IES A;  4OZE A;  5C0X E;  1UDN A;  4OO1 B;  2DGC A;  5IWA I;  2V2Q A;  4FW3 A;  5LMU I;  2VRD A;  1YYO A;  1H7U A;  2IOQ A;  4B3T I;  4R2Q A;  2UXC E;  5IT9 C;  1IBM E;  2EL4 A;  4BHC A;  4WX9 A;  2E5L E;  1SR9 A;  2UUA E;  5A6J A;  4DR2 E;  1A1H A;  1Z0B A;  2EP3 A;  5DRR A;  1XNR E;  2EOJ A;  3AUZ A;  1HR0 E;  1UN6 B;  4N4R B;  5IWA E;  2LUP B;  3M85 G;  2DEJ A;  2PO0 B;  4DV3 E;  1KYQ A;  2NN6 D;  2DLK A;  4GEQ B;  2EMA A;  2Z5B B;  3T1H E;  3F6H A;  4FWH A;  3IWD A;  2C37 B;  2V85 A;  2BM0 A;  4L5N C;  2EOR A;  3VK6 A;  1B69 A;  3H1C A;  1UDQ A;  2NN6 E;  2EN2 A;  4IZJ D;  2JE6 A;  2KHX A;  2LJU A;  2MC6 A;  2V2V A;  2LE2 A;  2ZM6 E;  2LT7 A;  1X6F A;  1ZR9 A;  2JXP A;  2ODR D;  1USV A;  2JEB A;  4MU0 A;  4R1F A;  3B78 A;  2Z5C B;  2HHH E;  1B63 A;  4O5G A;  1ZM3 A;  5BR8 E;  3THO B;  2CSH A;  2GO4 A;  3P06 A;  2MDR A;  4HEI A;  3PRY A;  4DKK A;  2JYA A;  2FGG A;  2EQ3 A;  1USU A;  2Z5C A;  5JEA B;  1PVG A;  4B3M I;  4JI3 I;  1WJP A;  5F3W A;  4LF8 E;  3EPJ A;  2NAB A;  5TSE A;  1ZAA C;  2CG9 A;  1EA6 A;  2JEB B;  2YRM A;  3T1H I;  2CPN A;  1X6H A;  2EML A;  4MYU A;  2HHH I;  3BGH A;  2VQE I;  2EQ1 A;  3IWB A;  4FWG A;  5A69 A;  4WUD A;  2LMZ A;  2EN7 A;  2MKN A;  2MC5 A;  4LF9 I;  1MG7 A;  1L4S A;  1X3C A;  2VQF E;  4X9J A;  1Z0G A;  2EPM X;  3AV0 A;  1HNZ I;  2EPR A;  3C4T A;  5DRO A;  1Z5A A;  4B3R I;  2AJ4 A;  4JI4 I;  2EN4 A;  1YYW A;  3WU6 A;  2C39 A;  2PNZ A;  1WXR A;  1DGC A;  1T4N A;  1N33 E;  2ZIT A;  2N3H A;  4KQV A;  4LF8 I;  1KKH A;  2VE7 C;  2NUF A;  4USM A;  4GKJ E;  2RS7 A;  2LBS B;  1RQ0 A;  3OML A;  1VIS A;  2YPN A;  4OO1 A;  2IOP A;  3WU3 A;  2F4V I;  2A2C A;  2LTR A;  1OYS A;  4R2E A;  2EL6 A;  1UIL A;  2EM6 A;  4QNJ A;  2X7I A;  2YWQ A;  3OTO I;  4DR1 E;  4JI2 I;  4DV7 I;  4AQY I;  1N32 E;  1N0U A;  2PRT A;  1ZBT A;  1A1L A;  2ENH A;  2EM2 A;  2WBS A;  4FW6 A;  4NXN I;  4F6M A;  1XNQ E;  3EQ1 A;  4BMJ A;  2HK2 A;  3WU5 A;  4RPF A;  4LF5 I;  1EH7 A;  4FW4 A;  3J80 C;  4DU8 A;  2NUG A;  4OO1 F;  2BB8 A;  4F2J C;  2LRS A;  1ZXN A;  3BID A;  3QT6 A;  2JEA A;  5DNY A;  1EH6 A;  3F0N A;  4DR2 I;  2AE8 A;  4Q35 B;  3J81 C;  1OYR A;  4EMD A;  4B3T E;  1N34 I;  1DQ3 A;  1OJ4 A;  1IBM I;  1DI2 A;  1Y6Z A;  2DRP A;  4WPY A;  2EM0 A;  2EPU A;  2YU5 A;  4DR5 E;  1OYP A;  2UUA I;  4ZYH A;  4DPU A;  4LF6 I;  2B9D A;  4LFB I;  4JI2 E;  1PIE A;  4JI1 E;  4DV7 E;  1PJT A;  3P1X A;  4JV5 E;  3Q6N A;  2ENC A;  3KZZ A;  4BC9 A;  4LPF A;  3F6G A;  4IFD E;  3H09 A;  3TQM A;  3MHS C;  2CZ9 A;  1X49 A;  2IHR 1;  4LF4 E;  2GQ0 A;  2VES A;  5IXM B;  2V88 A;  1IBL I;  4DU7 A;  5A6A A;  4JI0 I;  3GCM A;  4KZS A;  2EPA A;  2EPN A;  3K6Q A;  2YTG A;  2C39 B;  3ZKD A;  2VF1 A;  5KL7 A;  4K0K I;  3ZZU A;  4B3M E;  3B4T A;  3CWV A;  3DD6 A;  1PJS A;  4LU9 A;  3QT8 A;  2V34 A;  4IFD A;  4WUB A;  2F1D A;  2XEX A;  2EOS A;  1A1K A;  2PO2 B;  5C0X C;  2UXC I;  4F6N A;  1TF6 A;  5A2Q Q;  2EMZ A;  2NN6 B;  2L2M A;  2RPC A;  1A1F A;  5JEA E;  2UXD I;  1H73 A;  2EM3 A;  3LML A;  2GPI A;  1G2F C;  4OO1 C;  1XNR I;  4WSP A;  3ADI A;  2FV4 B;  4X66 E;  2CGE A;  1AAY A;  1YHC A;  2EL5 A;  2R3V A;  3L7Z B;  4DUZ I;  3P76 A;  4DPY A;  2RTX A;  5JEA A;  2EPK X;  4IZK A;  4GKK E;  5DRQ A;  4JI6 I;  2B7V A;  2JEA B;  3D4J A;  2O1V A;  1X48 A;  2N3G A;  4DV3 I;  5EL9 A;  1R6M A;  2YTQ A;  1WUU A;  1J5E I;  2ENA A;  1QZR A;  4DV5 E;  3MHH C;  4JI7 E;  4B3R E;  2EE8 A;  1Z5C A;  2HKJ A;  1YPN A;  4NXM E;  2UUB I;  3EPK A;  4LOM A;  4BA2 A;  2EN1 A;  2RQL A;  4DR4 I;  1Z0W A;  2Z5B A;  5IV8 B;  2DEI A;  2ELZ A;  1P47 A;  2A2D A;  2E1M A;  1FKA E;  2O1W A;  3PYG A;  2C37 A;  4DR6 I;  2JWO A;  4TUG A;  2Q2E B;  2HC5 A;  2BBG A;  2CTD A;  5AAS A;  5LMN E;  4DR3 I;  1FJG I;  3BBG A;  4P78 A;  4NXN E;  1AH5 A;  1ELO A;  1XNQ I;  2BM1 A;  4IFD B;  2V83 A;  3C4B A;  4LFC E;  2DMI A;  1Z0E A;  1U2R A;  3M7N D;  4DPT A;  2EMI A;  1PDA A;  4JI6 E;  2WW4 A;  2L3J A;  2L6M A;  2LV2 A;  3THN A;  4DR4 E;  1NHH A;  1XMQ E;  2B3T B;  1T39 A;  4B3S E;  2YSO A;  2M9A A;  3T1Y E;  1H72 C;  3QT7 A;  4HYM A;  4IFD F;  4JYA I;  4F9C B;  4KHP I;  2DSY A;  2YTF A;  4L8N A;  4DPW A;  4BHB A;  2YTD A;  2WBU A;  2OI2 A;  2EOQ A;  3J81 Q;  1J26 A;  4UT4 A;  2WNR A;  2JY9 A;  5AC4 A;  3UHM A;  2EMH A;  1FWK A;  4MDT A;  2L2N A;  1X5W A;  1YYK A;  3JAM C;  1XMQ I;  2JOB A;  1BBG A;  3KZY A;  1QU6 A;  4PRV A;  1PJQ A;  2F8B A;  2GLI A;  4IZK B;  2EZ6 A;  4IS9 A;  2LUQ A;  1Z0T A;  2MKD A;  2EOH A;  3Q6M A;  3ZKB A;  4FW9 A;  1N33 I;  3VYX A;  3M99 B;  2A25 A;  3OTO E;  2EOI A;  1FWL A;  5FLX C;  2YTI A;  2HGH A;  2ADR A;  4WXC A;  2X36 A;  4URL A;  1HNW I;  1ZBQ A;  2HJJ A;  2JE6 B;  2F4V E;  1XMO I;  2EM5 A;  2C38 A;  2WBT A;  1FNM A;  2CVE A;  4BCA A;  2UU9 I;  1A1G A;  2NN6 A;  4LCF A;  2EN6 A;  1RR9 A;  5LL6 R;  3HTX A;  4DV6 I;  4ZVI A;  5KL6 A;  2UXD E;  4XTJ A;  5K36 E;  2WNR B;  2WZO A;  4R2D A;  4LFA I;  2PO2 A;  3MSW A;  3QG5 C;  4X8W A;  1JK2 A;  3ADJ A;  2O3Z A;  3K1J A;  1T38 A;  2YTO A;  1WRJ A;  2EOX A;  4WFT A;  4R2S A;  4BA1 A;  2PO1 B;  1KVK A;  1P42 A;  4P7A A;  2I9I A;  2VF3 A;  5GME A;  5K36 D;  1HK7 A;  1Z59 A;  3DJW A;  1EKZ A;  5JEA C;  2PO1 A;  2V8P A;  3K17 A;  3V2U C;  3ZZT A;  2EMF A;  1GQE A;  2L33 A;  1I94 E;  5T6J A;  1K47 A;  1KTV A;  1FI4 A;  1NHJ A;  2LJP A;  2BR2 B;  3QT5 A;  4MU1 A;  2WP8 B;  3HXL A;  1S4E A;  2EFG A;  4DR5 I;  4YHH E;  1A1J A;  4M2Z A;  2UU9 E;  2EN8 A;  1H7S A;  1ZM2 A;  2YRK A;  5FWK A;  3Q1Q A;  5KL5 A;  4F54 A;  1UDS A;  3LTO A;  4ED4 A;  4JV5 I;  1WHQ A;  4IZJ B;  4LTY A;  4DR7 E;  3PS2 A;  3KWR A;  5KL3 A;  4MU4 A;  5IT9 Q;  4LFA E;  1XHK A;  1NCS A;  3UK3 C;  3J80 Q;  4K0K E;  4AM3 A;  1FJG E;  2BA1 G;  4AIM A;  2EMG A;  2EMB A;  2EPO A;  2YZT A;  1BBO A;  4OKG A;  4KWY A;  1IBL E;  2GHF A;  4M0V A;  4P7D A;  2EPL X;  5KL4 A;  3VYY A;  4MLV A;  4HY1 A;  3ZM7 A;  3ECR A;  2E1R A;  4YY3 I;  1Z1B A;  4WUC A;  2UXB I;  1YH8 A;  3C6M A;  3ADG A;  1WHN A;  4X62 E;  1YSA C;  3NZK A;  1HNX E;  2JPA A;  1MU5 A;  4DV0 I;  2EWL A;  2LJH A;  1UEK A;  2EOM A;  4N3O A;  1IQO A;  2JP9 A;  4DV1 I;  2YTN A;  4RHB B;  4DV4 I;  1A1I A;  4IZJ A;  2JR1 A;  1B62 A;  5BR8 I;  2EOY A;  4IFD D;  4BBY A;  3CDI A;  4OO1 D;  2J7K A;  4LF7 I;  2O1U A;  4JYA E;  4KHP E;  2EM9 A;  2BV3 A;  4X64 I;  1N32 I;  4X66 I;  4F9B B;  3GLL A;  4JI5 I;  3IWC A;  1STU A;  4DV0 E;  1EI1 A;  5C0X D;  5JEA D;  4OX9 I;  3J7A M;  1X6E A;  2EM8 A;  2D9H A;  5DNX A;  4MU3 A;  4I8O A;  1TF3 A;  4MYT A;  3C6K A;  4LCH A;  4FN5 A;  2J65 A;  4J8Z A;  2UUC E;  4R2A A;  1NEI A;  1MGT A;  3H4L A;  4MLQ A;  2L8T A;  3ZOQ B;  2EMC A;  4LF9 E;  1DAR A;  1YFH A;  3LNU A;  3HPS A;  2YRH A;  3J7Y p;  3PYF A;  4NZV A;  1G2D C;  4BC7 A;  2L92 A;  2NUE A;  3PS3 A;  1E3H A;  2LVH A;  5EKW A;  2EJ4 A;  5ADZ A;  2CT1 A;  2V89 A;  4DV2 E;  2M7Q A;  4HAC A;  1GZ6 A;  4WXD A;  1RRE A;  4RH8 A;  1VI7 A;  1N34 E;  5C0X F;  5LMN I;  1SFE A;  1D6T A;  2RSM A;  5A2Q C;  5LMU E;  4ISA A;  4QNK A;  4LFC I;  5JEA F;  4U3D A;  3WU4 A;  2NA2 A;  5KL2 A;  3KRN A;  3U1Y A;  4JI1 I;  1X47 A;  5C0X B;  1NZ0 A;  4PRX A;  2V87 A;  4R2R A;  5K36 B;  2L2K B;  3EPH A;  3FIG A;  2R1F A;  3P3G A;  1Z5B A;  4DXL A;  4WSG A;  1YUI A;  4M30 A;  4JI8 E;  1N36 I;  4U3B A;  2YT4 A;  1N0V C;  2V8Q B;  1EH8 A;  4O24 A;  4GKJ I;  1BB8 A;  2HFU A;  1I94 I;  4MQY A;  3BF2 A;  2EN3 A;  2KOU A;  2J7J A;  2YTJ A;  3JTZ A;  1IQS A;  3JU0 A;  3PS1 A;  2I13 A;  4USK A;  1ZM9 A;  1PKP A;  2RS6 A;  1H74 A;  4PU9 A;  2HFS A;  2EMY A;  1IMU A;  1E3P A;  2E72 A;  3P3E A;  4DUY E;  4DV2 I;  2EOZ A;  1HR0 I;  2YTP A;  1KIJ A;  4O4K A;  2EMX A;  2BR2 A; 
#chains in the Genus database with same CATH homology
 2ZBK B;  4LF5 E;  3HUL A;  4WYQ B;  5AE1 A;  2M1S A;  1XMO E;  4Z7C A;  3HQ1 A;  2GS8 A;  4HXZ A;  2H36 X;  4FWD A;  1N36 E;  3PYE A;  3HJC A;  4JI8 I;  2ZM6 I;  3B8H A;  4X62 I;  2HKE A;  4JI3 E;  1Z0C A;  4DV1 E;  4DMI A;  4JI7 I;  1S16 A;  2VQE E;  3JAM Q;  2UXB E;  3HPZ A;  4OOG C;  4I3H A;  2JOX A;  3K85 A;  4F9A B;  1HNX I;  4DR6 E;  2R42 A;  4X65 I;  2G7H A;  5AE2 A;  4TUI A;  2Z5E A;  4DV4 E;  2VQF I;  4R8O A;  1O0W A;  3LPS A;  4NXM I;  2UUB E;  2O1T A;  4YHH I;  2B7T A;  2FTX B;  2JVA A;  4LF7 E;  1ZM4 A;  2V2Z A;  4M1K A;  4DR3 E;  2L3C A;  1RC7 A;  4B3S I;  4JG4 A;  4HAC B;  4BS9 A;  4JI4 E;  3B82 A;  2ODR C;  2DB2 A;  4DUZ E;  1BKN A;  4DR7 I;  2V86 A;  1T4O A;  1Y4U A;  5FLX Q;  1IBK I;  2PNL A;  4YY3 E;  5CFF E;  4X65 E;  2DIX A;  1NHI A;  1YZ9 A;  3LLH A;  5L3J A;  3ADL A;  1Y4S A;  4GKK I;  2HK3 A;  4Q28 A;  3RMP A;  4DR1 I;  4AQY E;  1T4L B;  1UHZ A;  3J7A G;  1J5E E;  4DV5 I;  1MX0 A;  1HNW E;  3PYD A;  3M6A A;  2DMY A;  1IBK E;  2K4V A;  3V5R A;  2LTS A;  5AE3 A;  4X64 E;  4JI5 E;  4P52 A;  1HNZ E;  4R03 A;  4OX9 E;  4UTG A;  4Z7Y A;  4LF6 E;  4LFB E;  4DPX A;  2PNM A;  4DUY I;  4DV6 E;  1A6F A;  2UUC I;  4JI0 E;  3GON A;  3ZZ0 A;  1Z0V A;  3T1Y I;  2NPF A;  4LF4 I;  1ZXM A;  5GMD A;  3DF6 A;  2E5L I;  2KON A;  2M4I A;  5IWA I;  2V2Q A;  5LMU I;  1YYO A;  1H7U A;  2IOQ A;  4B3T I;  2UXC E;  5IT9 C;  1IBM E;  2E5L E;  1SR9 A;  2UUA E;  4DR2 E;  1Z0B A;  1XNR E;  3AUZ A;  1HR0 E;  5IWA E;  2LUP B;  2DEJ A;  4DV3 E;  4GEQ B;  2Z5B B;  3T1H E;  3F6H A;  4FWH A;  3IWD A;  2V85 A;  2BM0 A;  4L5N C;  3VK6 A;  4IZJ D;  2MC6 A;  2KHX A;  2V2V A;  2LE2 A;  2ZM6 E;  2ODR D;  1USV A;  4R1F A;  3B78 A;  2Z5C B;  2HHH E;  1B63 A;  1ZM3 A;  5BR8 E;  3P06 A;  2MDR A;  3PRY A;  4DKK A;  2FGG A;  1USU A;  2Z5C A;  4B3M I;  1PVG A;  4JI3 I;  5F3W A;  4LF8 E;  2CG9 A;  1EA6 A;  3T1H I;  2CPN A;  4MYU A;  2HHH I;  2VQE I;  3IWB A;  4FWG A;  4WUD A;  2LMZ A;  4LF9 I;  2MC5 A;  1MG7 A;  2VQF E;  1Z0G A;  3AV0 A;  1HNZ I;  3C4T A;  1Z5A A;  4B3R I;  2AJ4 A;  4JI4 I;  1YYW A;  3WU6 A;  1WXR A;  1N33 E;  1T4N A;  2ZIT A;  2N3H A;  4KQV A;  4LF8 I;  1KKH A;  2VE7 C;  2NUF A;  4USM A;  4GKJ E;  2RS7 A;  2LBS B;  1RQ0 A;  3OML A;  1VIS A;  3WU3 A;  2IOP A;  2F4V I;  2A2C A;  2LTR A;  1UIL A;  2X7I A;  4JI2 I;  3OTO I;  4DR1 E;  4DV7 I;  4AQY I;  1N32 E;  1N0U A;  1ZBT A;  4NXN I;  1XNQ E;  4BMJ A;  2HK2 A;  3WU5 A;  4RPF A;  4LF5 I;  3J80 C;  4DU8 A;  2NUG A;  1ZXN A;  2LRS A;  3QT6 A;  5DNY A;  3F0N A;  4DR2 I;  3J81 C;  4EMD A;  4B3T E;  1N34 I;  1DQ3 A;  1OJ4 A;  1IBM I;  1DI2 A;  1Y6Z A;  4WPY A;  2UUA I;  4DR5 E;  4LF6 I;  4LFB I;  4DPU A;  2B9D A;  4JI2 E;  1PIE A;  4JI1 E;  4DV7 E;  4JV5 E;  3P1X A;  3Q6N A;  4BC9 A;  3F6G A;  3H09 A;  2CZ9 A;  1X49 A;  2IHR 1;  4LF4 E;  2GQ0 A;  2V88 A;  1IBL I;  4DU7 A;  4JI0 I;  4KZS A;  3K6Q A;  3ZKD A;  2VF1 A;  4K0K I;  3ZZU A;  4B3M E;  3CWV A;  3QT8 A;  4LU9 A;  2V34 A;  4WUB A;  2XEX A;  2UXC I;  5A2Q Q;  2L2M A;  2UXD I;  1H73 A;  3LML A;  1XNR I;  4WSP A;  3ADI A;  2FV4 B;  4X66 E;  2CGE A;  2R3V A;  4DUZ I;  4DPY A;  2RTX A;  4IZK A;  4GKK E;  4JI6 I;  2B7V A;  3D4J A;  2O1V A;  1X48 A;  2N3G A;  4DV3 I;  1WUU A;  1J5E I;  1QZR A;  4DV5 E;  4B3R E;  4JI7 E;  1Z5C A;  2HKJ A;  4NXM E;  2UUB I;  4DR4 I;  1Z0W A;  2Z5B A;  2DEI A;  2A2D A;  2E1M A;  1FKA E;  2O1W A;  3PYG A;  4DR6 I;  2JWO A;  4TUG A;  2Q2E B;  4DR3 I;  1FJG I;  5AAS A;  5LMN E;  4P78 A;  4NXN E;  1ELO A;  1XNQ I;  2BM1 A;  2V83 A;  3C4B A;  4LFC E;  1Z0E A;  1U2R A;  4DPT A;  4JI6 E;  2WW4 A;  2L3J A;  2L6M A;  4DR4 E;  1NHH A;  1XMQ E;  2B3T B;  4B3S E;  3T1Y E;  1H72 C;  3QT7 A;  4HYM A;  4JYA I;  4KHP I;  4F9C B;  2DSY A;  4L8N A;  4DPW A;  2OI2 A;  3J81 Q;  1J26 A;  4UT4 A;  2JY9 A;  1FWK A;  2L2N A;  1YYK A;  3JAM C;  1XMQ I;  2JOB A;  1QU6 A;  4PRV A;  2F8B A;  4IZK B;  2EZ6 A;  2LUQ A;  1Z0T A;  3ZKB A;  3Q6M A;  4FW9 A;  1N33 I;  3VYX A;  3OTO E;  1FWL A;  5FLX C;  2X36 A;  4URL A;  1HNW I;  1ZBQ A;  1XMO I;  2F4V E;  1FNM A;  2UU9 I;  4BCA A;  1RR9 A;  5LL6 R;  3HTX A;  4DV6 I;  4ZVI A;  2UXD E;  4XTJ A;  2WZO A;  4LFA I;  3K1J A;  3MSW A;  4X8W A;  3ADJ A;  4WFT A;  1KVK A;  4P7A A;  2VF3 A;  5GME A;  1HK7 A;  1Z59 A;  3DJW A;  1EKZ A;  2V8P A;  3K17 A;  3V2U C;  3ZZT A;  1GQE A;  2L33 A;  1I94 E;  5T6J A;  1K47 A;  1KTV A;  1FI4 A;  1NHJ A;  2LJP A;  3QT5 A;  3HXL A;  1S4E A;  2EFG A;  4DR5 I;  4YHH E;  4M2Z A;  1H7S A;  2UU9 E;  1ZM2 A;  3Q1Q A;  5FWK A;  4ED4 A;  4F54 A;  3LTO A;  4JV5 I;  1WHQ A;  4IZJ B;  4LTY A;  4DR7 E;  3KWR A;  5IT9 Q;  4LFA E;  1XHK A;  3J80 Q;  4K0K E;  1FJG E;  2YZT A;  1IBL E;  4P7D A;  4M0V A;  3VYY A;  4HY1 A;  3ZM7 A;  2E1R A;  4YY3 I;  2UXB I;  4WUC A;  4X62 E;  3ADG A;  1WHN A;  1HNX E;  1MU5 A;  4DV0 I;  2EWL A;  2LJH A;  1UEK A;  4N3O A;  4DV1 I;  4DV4 I;  4IZJ A;  2JR1 A;  1B62 A;  5BR8 I;  4BBY A;  2J7K A;  4LF7 I;  2O1U A;  4JYA E;  4KHP E;  2BV3 A;  4X64 I;  1N32 I;  4X66 I;  4F9B B;  4JI5 I;  3IWC A;  1STU A;  4DV0 E;  1EI1 A;  3J7A M;  4OX9 I;  4I8O A;  4MYT A;  4FN5 A;  4J8Z A;  2UUC E;  3H4L A;  2L8T A;  3ZOQ B;  4LF9 E;  1DAR A;  3LNU A;  3HPS A;  3J7Y p;  3PYF A;  4BC7 A;  2L92 A;  2NUE A;  5ADZ A;  2V89 A;  4DV2 E;  2M7Q A;  4HAC A;  1GZ6 A;  1RRE A;  5LMN I;  1D6T A;  1N34 E;  2RSM A;  5A2Q C;  5LMU E;  4LFC I;  3WU4 A;  2NA2 A;  4JI1 I;  1X47 A;  1NZ0 A;  4PRX A;  2V87 A;  2L2K B;  3FIG A;  1Z5B A;  4DXL A;  4M30 A;  4JI8 E;  1N36 I;  2YT4 A;  1N0V C;  2V8Q B;  4GKJ I;  2HFU A;  1I94 I;  2KOU A;  3JTZ A;  4USK A;  3JU0 A;  1ZM9 A;  1PKP A;  2RS6 A;  1H74 A;  4PU9 A;  2HFS A;  4DUY E;  4DV2 I;  1HR0 I;  1KIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...