5LMUE

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5lmuE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmuE02
1HNZI 4HACB 1DI2A 2VF3A 3WU5A 4NXNE 4DV6I 2CPNA 1ZM2A 2BM1A 4DPUA 4GKJE 1Z0VA 4NXME 1WHNA 2V2ZA 1RC7A 4FWHA 3T1YI 2UUBI 4DUYI 2UU9I 2L3JA 2UUCI 3Q1QA 3LLHA 4DV7I 4DR5E 1Z0BA 3PYGA 4DR6E 2LJHA 1EI1A 4B3MI 4JI6I 1T4OA 2L2MA 4LF6E 4WYQB 1FI4A 4DU7A 4LF7I 4DV3E 4M2ZA 2L2NA 4KQVA 3VYYA 1EA6A 3QT8A 5A2QQ 3LNUA 2L3CA 1ZM4A 3K17A 2VQEE 2VQFE 3LTOA 4DR7E 1XNRE 4B3SE 4JV5E 1IBME 4JI3I 4JI0E 2F4VI 1N0VC 1H7UA 3HTXA 1DARA 2X7IA 5LMNE 4K0KI 1Z0GA 2UXCI 3ADIA 1N36E 3H4LA 2J7KA 3OTOI 4JI1E 3K1JA 1HR0E 1Z0EA 2DB2A 4DV5I 5FLXC 4DV1E 4X65I 1FJGE 1KIJA 3JAMQ 1PKPA 2OI2A 5IWAI 4PRVA 1J5EE 4LF9I 2N3HA 2E5LE 4B3RI 2B7TA 2HKEA 1FKAE 2NA2A 1A6FA 1HNXE 4JI8I 1Z5CA 3QT7A 3J81Q 2R42A 2RS7A 2X36A 1ZM3A 3B8HA 1WUUA 2V8PA 1FWLA 1FWKA 4X66E 3D4JA 2DEJA 2L33A 4DR4E 1Z0TA 2N3GA 2NUFA 4UT4A 1UEKA 4NXNI 4LF8E 2DEIA 3GONA 4M1KA 1XMOE 4OOGC 4PRXA 4GKJI 3ADLA 2LTSA 4MYTA 3C4TA 4ZVIA 4DR5I 2ZITA 1RR9A 4DR6I 1H73A 4LF6I 4DUZE 1RREA 4DR3E 4JI2E 4OX9I 1K47A 1XNQI 3ZKBA 2EFGA 4JI7E 1N0UA 1MX0A 4YHHE 4HXZA 2VQEI 1UILA 2VQFI 3ZZTA 4DR7I 2V2QA 1XNRI 3C4BA 4B3SI 1IBLE 2LTRA 2RS6A 4DV4E 2V34A 2LRSA 1NHJA 1IBMI 4FWDA 2HK2A 1S4EA 4DPWA 1NZ0A 3J7AM 1Z5AA 1N33E 5LMNI 1H7SA 2HHHE 3ADJA 3LPSA 4JI5E 4DKKA 4P52A 4JI1I 1FNMA 1HR0I 1I94E 4DPYA 3J80C 2BM0A 1FJGI 1ZXMA 1KVKA 3HULA 1J5EI 1U2RA 4HY1A 1EKZA 1NHIA 3V5RA 1ZM9A 1HNXI 4WFTA 2HFUA 2NPFA 4DR2E 2NUEA 1N34E 3WU6A 5FLXQ 4X66I 2JVAA 4X62E 3B78A 1O0WA 1QU6A 4X64E 4DPXA 3ZM7A 1OJ4A 4DR4I 2UXDI 4LF8I 4LFCE 1YYKA 2JY9A 1MU5A 2V2VA 3PYFA 1YYWA 4DR1E 1PVGA 2GS8A 3CWVA 2Q2EB 3ZZUA 4B3TE 4LFAE 4UTGA 4DV2E 4LF5E 1HNWE 4K0KE 5LMUE 4DV0E 4KHPE 3F0NA 5L3JA 2DMYA 3PYDA 5IT9C 2UXBE 1ELOA 4M30A 1T4LB 4DR3I 1BKNA 1KKHA 4JI2I 1IBKE 2ZM6E 4NXMI 2RSMA 1ZXNA 4R1FA 4PU9A 1ZBTA 3J7Yp 3T1HE 1GQEA 4ED4A 4JI7I 4YHHI 4WUBA 1IBLI 1XMQE 4DV4I 4URLA 2ZBKB 3B82A 4WUCA 4B3RE 2LJPA 2CZ9A 1VISA 4HYMA 4YY3E 1N33I 4JYAE 4DV3I 2RTXA 1STUA 4FWGA 4Z7YA 4GKKE 2HHHI 4JI5I 1N32E 2A2CA 2A2DA 2MDRA 4DPTA 2LBSB 2UUAE 2EZ6A 1NHHA 4WUDA 1I94I 4JV5I 4JI0I 4I3HA 1X48A 5BR8E 4JI4E 4LF4E 3ZKDA 1WHQA 1N36I 1T4NA 4AQYE 4LFBE 1HNZE 4DR2I 1N34I 3M6AA 2IHR1 2B7VA 5LL6R 1Z0WA 4DU8A 2HFSA 4DV1I 4X62I 3J80Q 4DV6E 4RPFA 1J26A 3ZZ0A 4X8WA 4X64I 4OX9E 4Z7CA 1XNQE 5A2QC 3QT6A 2E5LI 3T1YE 2UUBE 3VYXA 1QZRA 4LFCI 4DUYE 4EMDA 2UU9E 1S16A 2UUCE 2WW4A 2KHXA 4DV7E 1KTVA 4MYUA 3J7AG 4DR1I 4B3ME 4JI6E 2R3VA 2HKJA 4LF7E 4B3TI 4LFAI 1X49A 4DV2I 4LF5I 1HNWI 5LMUI 4DV0I 4KHPI 1MG7A 4XTJA 2LUPB 2UXBI 1XMOI 4USMA 1IBKI 2ZM6I 4JG4A 2E1RA 5CFFE 4P7AA 1D6TA 3JAMC 3T1HI 4JI3E 2F4VE 1Z59A 5GMDA 5GMEA 1H72C 3WU3A 1XMQI 2UXCE 1B63A 4DXLA 2DIXA 2BV3A 4DUZI 3OTOE 2NUGA 4YY3I 1YZ9A 5IT9Q 4JYAI 2AJ4A 2HK3A 3J81C 2XEXA 1YYOA 1X47A 4GKKI 1Z5BA 3QT5A 4DV5E 2LUQA 2L2KB 2B3TB 1N32I 4X65E 1UHZA 1H74A 3V2UC 2UUAI 5IWAE 1B62A 3ADGA 4LF9E 2UXDE 3P1XA 1Z0CA 2YT4A 1PIEA 4JI8E 1XHKA 5BR8I 4HACA 4JI4I 3PYEA 4LF4I 4AQYI 4FW9A 1RQ0A 3WU4A 4FN5A 4LFBI 4USKA
chains in the Genus database with same CATH superfamily
1HNZI 2WNRA 2WBUA 1OYSA 4HACB 1N3GA 2EQ3A 1DI2A 5IV8B 1T39A 2EOHA 2VF3A 2VRDA 3DJWA 4QNJA 3WU5A 2M1SA 4R2QA 2L92A 2JE6A 1UBDC 3UHMA 2EPCA 2VE7C 2WP8A 1ZBQA 4MDTA 4NXNE 3JTZA 5C0XC 4DV6I 4BHCA 3PS2A 1NCSA 2CPNA 1ZM2A 2BM1A 4DPUA 2WNRB 4TUIA 2PO1A 4GKJE 1Z0VA 5KL7A 4X9JA 4NXME 2LT7A 1WHNA 2EM4A 2EQ1A 3H1CA 2MC5A 2V2ZA 1RC7A 4FWHA 3T1YI 2UUBI 4WSPA 4DUYI 2JE6B 4L5NC 2EOYA 2WP8B 2L3JA 2UU9I 4WXCA 2UUCI 3Q1QA 3LLHA 4IZKB 3KZYA 2O3ZA 2DRPA 4DV7I 4DR5E 1Z0BA 5JEAE 4FK5C 4DR6E 4GZNC 2LJHA 4WX9A 2JP9A 1EI1A 3PYGA 4B3MI 2PO1B 4ZYEA 4JI6I 1T4OA 4GQUA 2L2MA 4LF6E 3HPZA 4WYQB 4MU1A 1FI4A 4DU7A 1Y4UA 4LF7I 4DV3E 1GZ6A 4M2ZA 2L2NA 4KQVA 1A1JA 3VYYA 1EA6A 1R6LA 3PRYA 3PS3A 3QT8A 2JEAB 4F6MA 4F54A 5A2QQ 1PDAA 3LNUA 4Q28A 4WPYA 2L3CA 3MHHC 1ZM4A 2ODRD 1YPNA 2EOFA 3K17A 2VQEE 4M0VA 5AE3A 2RSIA 2VQFE 2EN8A 4DR7E 3LTOA 3ECRA 4J8ZA 3DF6A 1XNRE 4B3SE 4BHBA 4JV5E 1IBME 2L6MA 4JI3I 3EPKA 4JI0E 2BA1D 2F4VI 1N0VC 5K36D 1H7UA 3HTXA 2GHFA 1DARA 2C38A 2X7IA 5LMNE 4RH8A 1YSAC 2EQ0A 4LOMA 1Z0GA 4K0KI 2UXCI 2EMLA 2YRMA 2BR2A 3ADIA 1EH8A 2I9IA 1N36E 3H4LA 2J7KA 3OTOI 3DD6A 2EM7A 4JI1E 2F1DA 2YPNA 2L8TA 3K1JA 1HR0E 2ADRA 1Z0EA 2DB2A 2C38B 4DV5I 1X3CA 2E1MA 2DGCA 5FLXC 4DV1E 5C0XD 2BR2B 2V88A 4X65I 1P47A 2GQ0A 1FJGE 1KIJA 3RMPA 3JAMQ 2VESA 1PKPA 3AV0A 2OI2A 1E3HA 3K85A 5IWAI 4PRVA 1KJKA 3M7ND 2JYAA 1J5EE 4LF9I 2HC5A 2N3HA 2E5LE 1BBOA 4R8OA 4B3RI 2B7TA 2HKEA 2CT1A 4F9AB 1FKAE 2NA2A 1A6FA 1HNXE 2EPUA 4JI8I 1Z5CA 1BBGA 3QT7A 3EPLA 3J81Q 1PJQA 4BBYA 5KL6A 1X5WA 2R42A 2RS7A 2X36A 1ZM3A 2EL5A 3VK6A 3B8HA 4LCGA 1A1GA 1WUUA 2ENCA 1FWLA 2JEBA 2V8PA 1FWKA 4X66E 2Z5BA 2YTFA 2PNLA 3D4JA 2DEJA 2NN6D 2R1FA 2L33A 2ELZA 1X6HA 3P3GA 2GLIA 4DR4E 1Z0TA 2N3GA 1WRJA 1X6EA 2NUFA 4UT4A 1MEYC 3THNA 1UEKA 3KWRA 4NXNI 4LF8E 2JEBB 2DEIA 3GONA 2O1VA 1XMOE 2Z5BB 4M1KA 4OOGC 4PRXA 3BF2A 4F9CB 4GKJI 5K36C 3ADLA 2EPXA 4QNKA 4Q35B 1WXRA 1UDSA 2LTSA 3HJCA 5AC5A 5JEAF 4KZSA 4MYTA 3GMEA 3IWBA 3C4TA 2YTGA 4ZVIA 4DR5I 4JI7I 4P7DA 4IJDA 2ZITA 4DR2I 5A6KA 3UK3C 1RR9A 5ELWA 4DR6I 2EMZA 2V8QB 3EPHA 1H73A 4HTGA 2YTNA 2YTJA 4LF6I 2D9HA 4IZJA 4DUZE 1RREA 4U3BA 4IZKA 1UDQA 4RHBB 4DR3E 4JI2E 4OX9I 1K47A 1XNQI 1SR9A 3ZKBA 2EFGA 4MQYA 2BB8A 3C6KA 3B4TA 4IZJB 4JI7E 1N0UA 1YUJA 3GLLA 1MX0A 4OO1F 4YHHE 1A1FA 1TN9A 2MKNA 2Z5EA 2YRKA 3P3EA 1UILA 4HXZA 2VQEI 2VQFI 3TQMA 4BS9A 3ZZTA 2EWLA 2WCC3 2V2QA 3C4BA 1XNRI 4DR7I 4B3SI 1IBLE 2JEAA 2FV4B 2LTRA 2RS6A 4DV4E 2LRSA 2IOQA 1NHJA 2V34A 4FWDA 1IBMI 2HK2A 1S4EA 4R2SA 2EM2A 4DPWA 3THOB 4GEQB 1NZ0A 3J7AM 2V85A 1Z5AA 1N33E 2PO2A 2EPOA 2NN6C 5DNXA 3EQ1A 5LMNI 1ZR9A 1ZU1A 1H7SA 2PO0A 1DQ3A 2M9AA 2HHHE 3ADJA 2PRTA 4JI5E 3LPSA 2YTIA 1A1LA 2GO3A 2CVEA 4DKKA 2A25A 4P52A 5KL3A 2V87A 3HPSA 1FNMA 4JI1I 2LCEA 1HR0I 2EP3A 5K36E 5JEAA 3BBGA 4R2EA 2PO2B 4LCHA 4IFDF 1I94E 5FWKA 2YSOA 2EOIA 2PO0B 4DPYA 3J80C 2BM0A 1FJGI 3L7ZA 4AIMA 5DNLA 4ZYGA 3KZZA 1ZXMA 3HKMA 2MKDA 1HK7A 2EM8A 1KVKA 3HULA 1G2DC 3P3CA 5JEAB 1YH8A 5DROA 2YTDA 5AC4A 2EL6A 1J5EI 2R76A 1U2RA 4HY1A 1EKZA 4U3DA 5C0XE 4IS1C 2FTXB 1NHIA 3V5RA 4F9BB 1A1KA 1ZM9A 1HNXI 2EM5A 4WFTA 2HFUA 3L7ZB 4O4KA 5KL4A 4OO1A 2NPFA 4DR2E 1YFHA 2NUEA 1N34E 3GCMA 1SFEA 3WU6A 2EL4A 2EMAA 5FLXQ 4X66I 2JVAA 4X62E 3B78A 1O0WA 1QU6A 2V89A 4X64E 4ZYHA 1A1IA 3HXLA 2JPAA 3IWCA 4TUGA 4DPXA 4OO1B 3P06A 1OJ4A 3MHSC 3ZM7A 4DR4I 2H36X 2EORA 2UXDI 4NZVA 1G2FC 1P42A 4LF8I 4LFCE 2NN6E 1EH7A 2J7JA 1IMUA 4I8OA 2EN2A 1YYKA 2JY9A 4WSGA 3CDIA 1MU5A 2V2VA 3PYFA 4IFDA 3EPJA 1YYWA 4DR1E 1PVGA 2GS8A 2I13A 3CWVA 3M7NG 2Q2EB 3ZZUA 2EMWA 4BA2A 4B3TE 2WBTA 4BMJA 5A6AA 4LFAE 4UTGA 2KOUA 1GTKA 2ENHA 4DV2E 2EMKA 4LF5E 1HNWE 4K0KE 1T38A 2LE2A 3P76A 5LMUE 4DV0E 4KHPE 2LMZA 2BA0G 3F0NA 5L3JA 4IFDB 2DMYA 3PYDA 5IT9C 3L00A 2EPKX 2UXBE 2YTEA 1ELOA 4M30A 2EMCA 1T4LB 4LPFA 4DR3I 1X6FA 1BKNA 1E3PA 1IBKE 2JOXA 1KKHA 4JI2I 4BA2B 2ZM6E 4NXMI 2RSMA 1B69A 2LV2A 1ZXNA 1XXEA 4R1FA 3M85G 1MGTA 4O43A 5A6JA 4PU9A 1ZBTA 5T6JA 2NABA 3J7Yp 3T1HE 1GQEA 1UN6B 1TF6A 2IESA 2EE8A 5DRQA 5EKWA 4ED4A 4YHHI 1A1HA 4WUBA 2YU8A 2PNZA 4OZEA 5A69A 1KYQA 1IBLI 4O5GA 2EM3A 1XMQE 4BC7A 4DV4I 4URLA 2EMHA 2ZBKB 3Q6MA 3B82A 4R2PA 4WUCA 4B3RE 2LJPA 2EJ4A 3F6HA 2CZ9A 1VISA 2YU5A 4HYMA 2EMIA 1USVA 4YY3E 2GPIA 5IXMB 2WBSA 1N33I 2Q8UA 4JYAE 4DV3I 4FW3A 2EOJA 1STUA 2RTXA 3PS1A 2VF1A 4FWGA 2CGEA 4Z7YA 2PNZB 4GKKE 2HHHI 2RPCA 4OO1C 4JI5I 1OYRA 4MU4A 1N32E 2A2CA 1DGCA 5K36F 1WJPA 2A2DA 2CSHA 4IZJD 1JK2A 2EPRA 2MDRA 1OYPA 4WXDA 2JOBA 4AIDA 4DPTA 3VHTB 2LBSB 2UUAE 2EZ6A 1NHHA 2YTPA 4WUDA 3M99B 1I94I 3BIDA 3U1KA 4JV5I 3CDJA 5LLQA 2JWOA 2JR1A 2K7IA 4NHRA 4JI0I 4FW4A 3H09A 1X48A 5BR8E 5F3WA 4JI4E 4I3HA 5C0XF 2EMYA 2BBGA 2DLQA 5TSEA 1EH6A 1YHCA 2EN6A 4N4RB 4LF4E 3ZKDA 1WHQA 1N36I 1T4NA 4N3OA 4AQYE 2C39A 2C37A 2WZOA 4LFBE 4IFDC 1AAYA 4R2CA 1UDOA 3QG5C 1HNZE 4FW5A 2EMGA 5AE2A 2EPMX 3IWDA 2LJUA 2DLKA 2EPNA 1LLMC 2IHR1 1RHYA 2B7VA 2AE8A 3M6AA 1N34I 5LL6R 1Z0WA 2EN7A 2YTOA 4ISAA 4MU3A 4DU8A 2E72A 2YSPA 2HFSA 4BA1A 4DV1I 2EOOA 2DSYA 4X62I 3J80Q 4DV6E 2EMXA 2EN3A 2LO3A 2C39B 2C37B 2RQLA 4RPFA 1J26A 3ZZ0A 4F6NA 2EPLX 4X8WA 4X64I 1PJSA 4BC9A 4OX9E 1XNQE 4Z7CA 5JEAD 3BGHA 5A2QC 2NN6F 2IERA 4LTYA 3QT6A 2E5LI 3T1YE 2JXPA 2EN4A 2UUBE 3VYXA 1QZRA 4DUYE 4LFCI 4BA1B 4EMDA 2UU9E 5K36A 1S16A 2UUCE 2FGGA 1L4SA 1BB8A 2WW4A 2KHXA 4DV7E 1KTVA 3J7AG 2BA1G 4MYUA 3KRNA 4OO1E 5A6BA 1F2IG 4DR1I 2HJJA 4B3ME 2CTDA 1USUA 4JI6E 4AM3A 2R3VA 2EOXA 2HKJA 2YWQA 3JU0A 4F2JC 2YRHA 3MSWA 5K36B 4LF7E 2EMBA 1VI7A 4B3TI 4LFAI 1X49A 4DMIA 4R2AA 4OKGA 5EL9A 4DV2I 4LF5I 1HNWI 2PNMA 4OO1D 2EPPA 5C0XA 2EMFA 5LMUI 4DV0I 4KHPI 2EOEA 5A6BD 1MG7A 2IOPA 4MLVA 4O24A 4XTJA 2V83A 2LUPB 2UXBI 1XMOI 4USMA 2DMIA 2EM9A 1YUIA 2EOMA 2YTQA 5ADZA 4R2DA 2O1UA 1IBKI 2O1WA 2CG9A 2ZM6I 3OMLA 5C0XB 4JG4A 2EN1A 2EPZA 2E1RA 1NEIA 5CFFE 4P7AA 2MC6A 3NZKA 3JAMC 4IFDE 1D6TA 3T1HI 1Z1BA 4JI3E 4MLQA 4BCAA 1RMDA 2N8XA 2F4VE 1Z59A 5GMDA 5GMEA 5KL2A 2EM6A 2KONA 2EOSA 4KWYA 1H72C 3Q6NA 3WU3A 1XMQI 2UXCE 1B63A 1PJTA 4DXLA 2DIXA 2BV3A 2NN6A 4IFDD 4DUZI 3LMLA 3OTOE 2NUGA 2B9DA 1QNTA 4YY3I 1YZ9A 5IT9Q 4L8NA 1Y60A 4JYAI 2AJ4A 3J81C 2ELYA 2HK3A 2JT2A 2XEXA 4FW6A 4R03A 4J3DA 1YYOA 1X47A 2M4IA 5KL5A 1ZAAC 1Z5BA 2BA0D 4DV5E 3QT5A 2LUQA 4GKKI 2L2KB 5JEAC 2B3TB 2V86A 1N32I 4FW7A 4M9VC 4X65E 1UHZA 2G7HA 3K6QA 2Z5CA 2NN6B 2LVHA 4HEIA 4IS9A 1H74A 1AH5A 3V2UC 1R6MA 3C6MA 2ODRC 2F8BA 5AE1A 5IWAE 5DNYA 1B62A 2UUAI 4NBQA 3M85D 2M7QA 5DRRA 3ADGA 2EM0A 2HGHA 4R2RA 4LF9E 2EPAA 3P1XA 4P78A 2UXDE 1UDNA 4MU0A 1Z0CA 1JK1A 2MDGA 2YT4A 1PIEA 2Z5CB 4JI8E 1XHKA 2GO4A 4LU9A 5AASA 4HACA 3U1YA 2EOZA 1IQSA 5BR8I 1Y4SA 3PYEA 4JI4I 2YZTA 3FIGA 3F6GA 3ZOQB 1IQOA 2EOQA 3AUZA 4LF4I 3HQ1A 2J65A 2O1TA 1Y5YA 1Y6ZA 4AQYI 4FW9A 2ENAA 1RQ0A 3WU4A 4FN5A 4ZYDA 5DRPA 4LFBI 1TF3A 2K4VA 4LCFA 4USKA
chains in the Genus database with same CATH topology
1HNZI 4HACB 1DI2A 2VF3A 3DJWA 3WU5A 2M1SA 2L92A 2VE7C 1ZBQA 4NXNE 3JTZA 4DV6I 2CPNA 1ZM2A 2BM1A 4DPUA 4TUIA 4GKJE 1Z0VA 4NXME 1WHNA 2MC5A 2V2ZA 1RC7A 4FWHA 3T1YI 2UUBI 4WSPA 4DUYI 4L5NC 2UU9I 2L3JA 2UUCI 3Q1QA 3LLHA 4IZKB 4DV7I 4DR5E 1Z0BA 3PYGA 4DR6E 2LJHA 1EI1A 4B3MI 4JI6I 1T4OA 2L2MA 4LF6E 3HPZA 4WYQB 1FI4A 4DU7A 1Y4UA 4LF7I 4DV3E 1GZ6A 4M2ZA 2L2NA 4KQVA 3VYYA 1EA6A 3PRYA 3QT8A 5A2QQ 4F54A 3LNUA 4Q28A 4WPYA 2L3CA 1ZM4A 2ODRD 3K17A 2VQEE 4M0VA 5AE3A 2VQFE 3LTOA 4DR7E 1XNRE 4J8ZA 3DF6A 4B3SE 4JV5E 1IBME 2L6MA 4JI3I 4JI0E 2F4VI 1N0VC 1H7UA 3HTXA 1DARA 2X7IA 5LMNE 4K0KI 1Z0GA 2UXCI 3ADIA 1N36E 3H4LA 2J7KA 3OTOI 4JI1E 2L8TA 3K1JA 1HR0E 1Z0EA 2DB2A 4DV5I 2E1MA 5FLXC 4DV1E 4X65I 2V88A 2GQ0A 1FJGE 1KIJA 3RMPA 3JAMQ 1PKPA 3AV0A 2OI2A 3K85A 5IWAI 4PRVA 1J5EE 4LF9I 2N3HA 2E5LE 4R8OA 4B3RI 2B7TA 2HKEA 4F9AB 1FKAE 2NA2A 1A6FA 1HNXE 4JI8I 1Z5CA 3QT7A 3J81Q 4BBYA 2R42A 2RS7A 2X36A 1ZM3A 3B8HA 3VK6A 1WUUA 1FWLA 2V8PA 1FWKA 4X66E 2Z5BA 2PNLA 3D4JA 2DEJA 2L33A 4DR4E 1Z0TA 2N3GA 2NUFA 4UT4A 1UEKA 4NXNI 3KWRA 4LF8E 2DEIA 3GONA 2O1VA 1XMOE 2Z5BB 4M1KA 4OOGC 4PRXA 4F9CB 4GKJI 3ADLA 1WXRA 2LTSA 3HJCA 4KZSA 4MYTA 3IWBA 3C4TA 4ZVIA 4DR5I 4P7DA 2ZITA 1RR9A 4DR6I 2V8QB 1H73A 4LF6I 4IZJA 4DUZE 1RREA 4IZKA 4DR3E 4JI2E 4OX9I 1K47A 1XNQI 1SR9A 3ZKBA 2EFGA 4IZJB 4JI7E 1N0UA 1MX0A 4YHHE 2Z5EA 4HXZA 2VQEI 1UILA 2VQFI 4BS9A 3ZZTA 2EWLA 2V2QA 1XNRI 3C4BA 4DR7I 4B3SI 1IBLE 2FV4B 2LTRA 2RS6A 4DV4E 2LRSA 2IOQA 1NHJA 2V34A 4FWDA 1IBMI 2HK2A 1S4EA 4DPWA 4GEQB 1NZ0A 3J7AM 2V85A 1Z5AA 1N33E 5LMNI 1H7SA 1DQ3A 2HHHE 3ADJA 3LPSA 4JI5E 4DKKA 4P52A 2V87A 3HPSA 1FNMA 4JI1I 1HR0I 1I94E 5FWKA 4DPYA 3J80C 2BM0A 1FJGI 1ZXMA 1KVKA 1HK7A 3HULA 1J5EI 1U2RA 4HY1A 1EKZA 2FTXB 1NHIA 3V5RA 4F9BB 1ZM9A 1HNXI 4WFTA 2HFUA 2NPFA 4DR2E 2NUEA 1N34E 3WU6A 5FLXQ 4X66I 2JVAA 4X62E 3B78A 1O0WA 1QU6A 2V89A 4X64E 3HXLA 3IWCA 4TUGA 4DPXA 3P06A 1OJ4A 3ZM7A 4DR4I 2H36X 2UXDI 4LF8I 4LFCE 4I8OA 1YYKA 2JY9A 1MU5A 2V2VA 3PYFA 1YYWA 4DR1E 1PVGA 2GS8A 3CWVA 2Q2EB 3ZZUA 4B3TE 4BMJA 4LFAE 4UTGA 2KOUA 4DV2E 4LF5E 1HNWE 4K0KE 2LE2A 5LMUE 4DV0E 4KHPE 2LMZA 3F0NA 5L3JA 2DMYA 3PYDA 5IT9C 2UXBE 1ELOA 4M30A 1T4LB 4DR3I 1BKNA 1KKHA 4JI2I 1IBKE 2JOXA 2ZM6E 4NXMI 2RSMA 1ZXNA 4R1FA 4PU9A 1ZBTA 5T6JA 3J7Yp 3T1HE 1GQEA 4ED4A 4JI7I 4YHHI 4WUBA 1IBLI 1XMQE 4BC7A 4DV4I 4URLA 2ZBKB 3Q6MA 3B82A 4WUCA 4B3RE 2LJPA 3F6HA 2CZ9A 1VISA 4HYMA 1USVA 4YY3E 1N33I 4JYAE 4DV3I 2RTXA 1STUA 2VF1A 4FWGA 2CGEA 4Z7YA 4GKKE 2HHHI 4JI5I 1N32E 2A2CA 2A2DA 4IZJD 2MDRA 2JOBA 4DPTA 2LBSB 2UUAE 2EZ6A 1NHHA 4WUDA 1I94I 4JV5I 2JWOA 2JR1A 4JI0I 3H09A 1X48A 5BR8E 5F3WA 4JI4E 4I3HA 4LF4E 3ZKDA 1WHQA 1N36I 1T4NA 4N3OA 4AQYE 2WZOA 4LFBE 1HNZE 5AE2A 4DR2I 3IWDA 1N34I 3M6AA 2IHR1 2B7VA 5LL6R 1Z0WA 4DU8A 2HFSA 4DV1I 2DSYA 4X62I 3J80Q 4DV6E 4RPFA 1J26A 3ZZ0A 4X8WA 4X64I 4BC9A 4OX9E 1XNQE 4Z7CA 5A2QC 4LTYA 3QT6A 2E5LI 3T1YE 2UUBE 3VYXA 1QZRA 4LFCI 4DUYE 4EMDA 2UU9E 1S16A 2UUCE 2FGGA 2WW4A 2KHXA 4DV7E 1KTVA 3J7AG 4MYUA 4DR1I 4B3ME 1USUA 4JI6E 2R3VA 2HKJA 3JU0A 3MSWA 4LF7E 4B3TI 4LFAI 1X49A 4DMIA 4DV2I 4LF5I 1HNWI 2PNMA 5LMUI 4DV0I 4KHPI 1MG7A 2IOPA 4XTJA 2V83A 2LUPB 2UXBI 1XMOI 4USMA 5ADZA 2O1UA 1IBKI 2O1WA 2CG9A 2ZM6I 3OMLA 4JG4A 2E1RA 5CFFE 4P7AA 2MC6A 1D6TA 3JAMC 3T1HI 4JI3E 4BCAA 2F4VE 1Z59A 5GMDA 5GMEA 2KONA 1H72C 3Q6NA 3WU3A 1XMQI 2UXCE 1B63A 4DXLA 2DIXA 2BV3A 4DUZI 3LMLA 3OTOE 2NUGA 2B9DA 4YY3I 1YZ9A 5IT9Q 4L8NA 4JYAI 2AJ4A 3J81C 2HK3A 2XEXA 4R03A 1YYOA 1X47A 2M4IA 1Z5BA 4GKKI 3QT5A 4DV5E 2LUQA 2L2KB 2B3TB 2V86A 1N32I 4X65E 1UHZA 2G7HA 3K6QA 2Z5CA 1H74A 3V2UC 2ODRC 2F8BA 5AE1A 5IWAE 5DNYA 1B62A 2UUAI 2M7QA 3ADGA 4LF9E 2UXDE 3P1XA 4P78A 1Z0CA 2YT4A 1PIEA 2Z5CB 4JI8E 1XHKA 5BR8I 4LU9A 5AASA 4HACA 4JI4I 1Y4SA 3PYEA 2YZTA 3FIGA 3F6GA 3ZOQB 3AUZA 4LF4I 3HQ1A 2O1TA 1Y6ZA 4AQYI 4FW9A 1RQ0A 3WU4A 4FN5A 4LFBI 2K4VA 4USKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ I;  4HAC B;  1DI2 A;  2VF3 A;  3WU5 A;  4NXN E;  4DV6 I;  2CPN A;  1ZM2 A;  2BM1 A;  4DPU A;  4GKJ E;  1Z0V A;  4NXM E;  1WHN A;  2V2Z A;  1RC7 A;  4FWH A;  3T1Y I;  2UUB I;  4DUY I;  2UU9 I;  2L3J A;  2UUC I;  3Q1Q A;  3LLH A;  4DV7 I;  4DR5 E;  1Z0B A;  3PYG A;  4DR6 E;  2LJH A;  1EI1 A;  4B3M I;  4JI6 I;  1T4O A;  2L2M A;  4LF6 E;  4WYQ B;  1FI4 A;  4DU7 A;  4LF7 I;  4DV3 E;  4M2Z A;  2L2N A;  4KQV A;  3VYY A;  1EA6 A;  3QT8 A;  5A2Q Q;  3LNU A;  2L3C A;  1ZM4 A;  3K17 A;  2VQE E;  2VQF E;  3LTO A;  4DR7 E;  1XNR E;  4B3S E;  4JV5 E;  1IBM E;  4JI3 I;  4JI0 E;  2F4V I;  1N0V C;  1H7U A;  3HTX A;  1DAR A;  2X7I A;  5LMN E;  4K0K I;  1Z0G A;  2UXC I;  3ADI A;  1N36 E;  3H4L A;  2J7K A;  3OTO I;  4JI1 E;  3K1J A;  1HR0 E;  1Z0E A;  2DB2 A;  4DV5 I;  5FLX C;  4DV1 E;  4X65 I;  1FJG E;  1KIJ A;  3JAM Q;  1PKP A;  2OI2 A;  5IWA I;  4PRV A;  1J5E E;  4LF9 I;  2N3H A;  2E5L E;  4B3R I;  2B7T A;  2HKE A;  1FKA E;  2NA2 A;  1A6F A;  1HNX E;  4JI8 I;  1Z5C A;  3QT7 A;  3J81 Q;  2R42 A;  2RS7 A;  2X36 A;  1ZM3 A;  3B8H A;  1WUU A;  2V8P A;  1FWL A;  1FWK A;  4X66 E;  3D4J A;  2DEJ A;  2L33 A;  4DR4 E;  1Z0T A;  2N3G A;  2NUF A;  4UT4 A;  1UEK A;  4NXN I;  4LF8 E;  2DEI A;  3GON A;  4M1K A;  1XMO E;  4OOG C;  4PRX A;  4GKJ I;  3ADL A;  2LTS A;  4MYT A;  3C4T A;  4ZVI A;  4DR5 I;  2ZIT A;  1RR9 A;  4DR6 I;  1H73 A;  4LF6 I;  4DUZ E;  1RRE A;  4DR3 E;  4JI2 E;  4OX9 I;  1K47 A;  1XNQ I;  3ZKB A;  2EFG A;  4JI7 E;  1N0U A;  1MX0 A;  4YHH E;  4HXZ A;  2VQE I;  1UIL A;  2VQF I;  3ZZT A;  4DR7 I;  2V2Q A;  1XNR I;  3C4B A;  4B3S I;  1IBL E;  2LTR A;  2RS6 A;  4DV4 E;  2V34 A;  2LRS A;  1NHJ A;  1IBM I;  4FWD A;  2HK2 A;  1S4E A;  4DPW A;  1NZ0 A;  3J7A M;  1Z5A A;  1N33 E;  5LMN I;  1H7S A;  2HHH E;  3ADJ A;  3LPS A;  4JI5 E;  4DKK A;  4P52 A;  4JI1 I;  1FNM A;  1HR0 I;  1I94 E;  4DPY A;  3J80 C;  2BM0 A;  1FJG I;  1ZXM A;  1KVK A;  3HUL A;  1J5E I;  1U2R A;  4HY1 A;  1EKZ A;  1NHI A;  3V5R A;  1ZM9 A;  1HNX I;  4WFT A;  2HFU A;  2NPF A;  4DR2 E;  2NUE A;  1N34 E;  3WU6 A;  5FLX Q;  4X66 I;  2JVA A;  4X62 E;  3B78 A;  1O0W A;  1QU6 A;  4X64 E;  4DPX A;  3ZM7 A;  1OJ4 A;  4DR4 I;  2UXD I;  4LF8 I;  4LFC E;  1YYK A;  2JY9 A;  1MU5 A;  2V2V A;  3PYF A;  1YYW A;  4DR1 E;  1PVG A;  2GS8 A;  3CWV A;  2Q2E B;  3ZZU A;  4B3T E;  4LFA E;  4UTG A;  4DV2 E;  4LF5 E;  1HNW E;  4K0K E;  5LMU E;  4DV0 E;  4KHP E;  3F0N A;  5L3J A;  2DMY A;  3PYD A;  5IT9 C;  2UXB E;  1ELO A;  4M30 A;  1T4L B;  4DR3 I;  1BKN A;  1KKH A;  4JI2 I;  1IBK E;  2ZM6 E;  4NXM I;  2RSM A;  1ZXN A;  4R1F A;  4PU9 A;  1ZBT A;  3J7Y p;  3T1H E;  1GQE A;  4ED4 A;  4JI7 I;  4YHH I;  4WUB A;  1IBL I;  1XMQ E;  4DV4 I;  4URL A;  2ZBK B;  3B82 A;  4WUC A;  4B3R E;  2LJP A;  2CZ9 A;  1VIS A;  4HYM A;  4YY3 E;  1N33 I;  4JYA E;  4DV3 I;  2RTX A;  1STU A;  4FWG A;  4Z7Y A;  4GKK E;  2HHH I;  4JI5 I;  1N32 E;  2A2C A;  2A2D A;  2MDR A;  4DPT A;  2LBS B;  2UUA E;  2EZ6 A;  1NHH A;  4WUD A;  1I94 I;  4JV5 I;  4JI0 I;  4I3H A;  1X48 A;  5BR8 E;  4JI4 E;  4LF4 E;  3ZKD A;  1WHQ A;  1N36 I;  1T4N A;  4AQY E;  4LFB E;  1HNZ E;  4DR2 I;  1N34 I;  3M6A A;  2IHR 1;  2B7V A;  5LL6 R;  1Z0W A;  4DU8 A;  2HFS A;  4DV1 I;  4X62 I;  3J80 Q;  4DV6 E;  4RPF A;  1J26 A;  3ZZ0 A;  4X8W A;  4X64 I;  4OX9 E;  4Z7C A;  1XNQ E;  5A2Q C;  3QT6 A;  2E5L I;  3T1Y E;  2UUB E;  3VYX A;  1QZR A;  4LFC I;  4DUY E;  4EMD A;  2UU9 E;  1S16 A;  2UUC E;  2WW4 A;  2KHX A;  4DV7 E;  1KTV A;  4MYU A;  3J7A G;  4DR1 I;  4B3M E;  4JI6 E;  2R3V A;  2HKJ A;  4LF7 E;  4B3T I;  4LFA I;  1X49 A;  4DV2 I;  4LF5 I;  1HNW I;  5LMU I;  4DV0 I;  4KHP I;  1MG7 A;  4XTJ A;  2LUP B;  2UXB I;  1XMO I;  4USM A;  1IBK I;  2ZM6 I;  4JG4 A;  2E1R A;  5CFF E;  4P7A A;  1D6T A;  3JAM C;  3T1H I;  4JI3 E;  2F4V E;  1Z59 A;  5GMD A;  5GME A;  1H72 C;  3WU3 A;  1XMQ I;  2UXC E;  1B63 A;  4DXL A;  2DIX A;  2BV3 A;  4DUZ I;  3OTO E;  2NUG A;  4YY3 I;  1YZ9 A;  5IT9 Q;  4JYA I;  2AJ4 A;  2HK3 A;  3J81 C;  2XEX A;  1YYO A;  1X47 A;  4GKK I;  1Z5B A;  3QT5 A;  4DV5 E;  2LUQ A;  2L2K B;  2B3T B;  1N32 I;  4X65 E;  1UHZ A;  1H74 A;  3V2U C;  2UUA I;  5IWA E;  1B62 A;  3ADG A;  4LF9 E;  2UXD E;  3P1X A;  1Z0C A;  2YT4 A;  1PIE A;  4JI8 E;  1XHK A;  5BR8 I;  4HAC A;  4JI4 I;  3PYE A;  4LF4 I;  4AQY I;  4FW9 A;  1RQ0 A;  3WU4 A;  4FN5 A;  4LFB I;  4USK A; 
#chains in the Genus database with same CATH topology
 1HNZ I;  2WNR A;  2WBU A;  1OYS A;  4HAC B;  1N3G A;  2EQ3 A;  1DI2 A;  5IV8 B;  1T39 A;  2EOH A;  2VF3 A;  2VRD A;  3DJW A;  4QNJ A;  3WU5 A;  2M1S A;  4R2Q A;  2L92 A;  2JE6 A;  1UBD C;  3UHM A;  2EPC A;  2VE7 C;  2WP8 A;  1ZBQ A;  4MDT A;  4NXN E;  3JTZ A;  5C0X C;  4DV6 I;  4BHC A;  3PS2 A;  1NCS A;  2CPN A;  1ZM2 A;  2BM1 A;  4DPU A;  2WNR B;  4TUI A;  2PO1 A;  4GKJ E;  1Z0V A;  5KL7 A;  4X9J A;  4NXM E;  2LT7 A;  1WHN A;  2EM4 A;  2EQ1 A;  3H1C A;  2MC5 A;  2V2Z A;  1RC7 A;  4FWH A;  3T1Y I;  2UUB I;  4WSP A;  4DUY I;  2JE6 B;  4L5N C;  2EOY A;  2WP8 B;  2L3J A;  2UU9 I;  4WXC A;  2UUC I;  3Q1Q A;  3LLH A;  4IZK B;  3KZY A;  2O3Z A;  2DRP A;  4DV7 I;  4DR5 E;  1Z0B A;  5JEA E;  4FK5 C;  4DR6 E;  4GZN C;  2LJH A;  4WX9 A;  2JP9 A;  1EI1 A;  3PYG A;  4B3M I;  2PO1 B;  4ZYE A;  4JI6 I;  1T4O A;  4GQU A;  2L2M A;  4LF6 E;  3HPZ A;  4WYQ B;  4MU1 A;  1FI4 A;  4DU7 A;  1Y4U A;  4LF7 I;  4DV3 E;  1GZ6 A;  4M2Z A;  2L2N A;  4KQV A;  1A1J A;  3VYY A;  1EA6 A;  1R6L A;  3PRY A;  3PS3 A;  3QT8 A;  2JEA B;  4F6M A;  4F54 A;  5A2Q Q;  1PDA A;  3LNU A;  4Q28 A;  4WPY A;  2L3C A;  3MHH C;  1ZM4 A;  2ODR D;  1YPN A;  2EOF A;  3K17 A;  2VQE E;  4M0V A;  5AE3 A;  2RSI A;  2VQF E;  2EN8 A;  4DR7 E;  3LTO A;  3ECR A;  4J8Z A;  3DF6 A;  1XNR E;  4B3S E;  4BHB A;  4JV5 E;  1IBM E;  2L6M A;  4JI3 I;  3EPK A;  4JI0 E;  2BA1 D;  2F4V I;  1N0V C;  5K36 D;  1H7U A;  3HTX A;  2GHF A;  1DAR A;  2C38 A;  2X7I A;  5LMN E;  4RH8 A;  1YSA C;  2EQ0 A;  4LOM A;  1Z0G A;  4K0K I;  2UXC I;  2EML A;  2YRM A;  2BR2 A;  3ADI A;  1EH8 A;  2I9I A;  1N36 E;  3H4L A;  2J7K A;  3OTO I;  3DD6 A;  2EM7 A;  4JI1 E;  2F1D A;  2YPN A;  2L8T A;  3K1J A;  1HR0 E;  2ADR A;  1Z0E A;  2DB2 A;  2C38 B;  4DV5 I;  1X3C A;  2E1M A;  2DGC A;  5FLX C;  4DV1 E;  5C0X D;  2BR2 B;  2V88 A;  4X65 I;  1P47 A;  2GQ0 A;  1FJG E;  1KIJ A;  3RMP A;  3JAM Q;  2VES A;  1PKP A;  3AV0 A;  2OI2 A;  1E3H A;  3K85 A;  5IWA I;  4PRV A;  1KJK A;  3M7N D;  2JYA A;  1J5E E;  4LF9 I;  2HC5 A;  2N3H A;  2E5L E;  1BBO A;  4R8O A;  4B3R I;  2B7T A;  2HKE A;  2CT1 A;  4F9A B;  1FKA E;  2NA2 A;  1A6F A;  1HNX E;  2EPU A;  4JI8 I;  1Z5C A;  1BBG A;  3QT7 A;  3EPL A;  3J81 Q;  1PJQ A;  4BBY A;  5KL6 A;  1X5W A;  2R42 A;  2RS7 A;  2X36 A;  1ZM3 A;  2EL5 A;  3VK6 A;  3B8H A;  4LCG A;  1A1G A;  1WUU A;  2ENC A;  1FWL A;  2JEB A;  2V8P A;  1FWK A;  4X66 E;  2Z5B A;  2YTF A;  2PNL A;  3D4J A;  2DEJ A;  2NN6 D;  2R1F A;  2L33 A;  2ELZ A;  1X6H A;  3P3G A;  2GLI A;  4DR4 E;  1Z0T A;  2N3G A;  1WRJ A;  1X6E A;  2NUF A;  4UT4 A;  1MEY C;  3THN A;  1UEK A;  3KWR A;  4NXN I;  4LF8 E;  2JEB B;  2DEI A;  3GON A;  2O1V A;  1XMO E;  2Z5B B;  4M1K A;  4OOG C;  4PRX A;  3BF2 A;  4F9C B;  4GKJ I;  5K36 C;  3ADL A;  2EPX A;  4QNK A;  4Q35 B;  1WXR A;  1UDS A;  2LTS A;  3HJC A;  5AC5 A;  5JEA F;  4KZS A;  4MYT A;  3GME A;  3IWB A;  3C4T A;  2YTG A;  4ZVI A;  4DR5 I;  4JI7 I;  4P7D A;  4IJD A;  2ZIT A;  4DR2 I;  5A6K A;  3UK3 C;  1RR9 A;  5ELW A;  4DR6 I;  2EMZ A;  2V8Q B;  3EPH A;  1H73 A;  4HTG A;  2YTN A;  2YTJ A;  4LF6 I;  2D9H A;  4IZJ A;  4DUZ E;  1RRE A;  4U3B A;  4IZK A;  1UDQ A;  4RHB B;  4DR3 E;  4JI2 E;  4OX9 I;  1K47 A;  1XNQ I;  1SR9 A;  3ZKB A;  2EFG A;  4MQY A;  2BB8 A;  3C6K A;  3B4T A;  4IZJ B;  4JI7 E;  1N0U A;  1YUJ A;  3GLL A;  1MX0 A;  4OO1 F;  4YHH E;  1A1F A;  1TN9 A;  2MKN A;  2Z5E A;  2YRK A;  3P3E A;  1UIL A;  4HXZ A;  2VQE I;  2VQF I;  3TQM A;  4BS9 A;  3ZZT A;  2EWL A;  2WCC 3;  2V2Q A;  3C4B A;  1XNR I;  4DR7 I;  4B3S I;  1IBL E;  2JEA A;  2FV4 B;  2LTR A;  2RS6 A;  4DV4 E;  2LRS A;  2IOQ A;  1NHJ A;  2V34 A;  4FWD A;  1IBM I;  2HK2 A;  1S4E A;  4R2S A;  2EM2 A;  4DPW A;  3THO B;  4GEQ B;  1NZ0 A;  3J7A M;  2V85 A;  1Z5A A;  1N33 E;  2PO2 A;  2EPO A;  2NN6 C;  5DNX A;  3EQ1 A;  5LMN I;  1ZR9 A;  1ZU1 A;  1H7S A;  2PO0 A;  1DQ3 A;  2M9A A;  2HHH E;  3ADJ A;  2PRT A;  4JI5 E;  3LPS A;  2YTI A;  1A1L A;  2GO3 A;  2CVE A;  4DKK A;  2A25 A;  4P52 A;  5KL3 A;  2V87 A;  3HPS A;  1FNM A;  4JI1 I;  2LCE A;  1HR0 I;  2EP3 A;  5K36 E;  5JEA A;  3BBG A;  4R2E A;  2PO2 B;  4LCH A;  4IFD F;  1I94 E;  5FWK A;  2YSO A;  2EOI A;  2PO0 B;  4DPY A;  3J80 C;  2BM0 A;  1FJG I;  3L7Z A;  4AIM A;  5DNL A;  4ZYG A;  3KZZ A;  1ZXM A;  3HKM A;  2MKD A;  1HK7 A;  2EM8 A;  1KVK A;  3HUL A;  1G2D C;  3P3C A;  5JEA B;  1YH8 A;  5DRO A;  2YTD A;  5AC4 A;  2EL6 A;  1J5E I;  2R76 A;  1U2R A;  4HY1 A;  1EKZ A;  4U3D A;  5C0X E;  4IS1 C;  2FTX B;  1NHI A;  3V5R A;  4F9B B;  1A1K A;  1ZM9 A;  1HNX I;  2EM5 A;  4WFT A;  2HFU A;  3L7Z B;  4O4K A;  5KL4 A;  4OO1 A;  2NPF A;  4DR2 E;  1YFH A;  2NUE A;  1N34 E;  3GCM A;  1SFE A;  3WU6 A;  2EL4 A;  2EMA A;  5FLX Q;  4X66 I;  2JVA A;  4X62 E;  3B78 A;  1O0W A;  1QU6 A;  2V89 A;  4X64 E;  4ZYH A;  1A1I A;  3HXL A;  2JPA A;  3IWC A;  4TUG A;  4DPX A;  4OO1 B;  3P06 A;  1OJ4 A;  3MHS C;  3ZM7 A;  4DR4 I;  2H36 X;  2EOR A;  2UXD I;  4NZV A;  1G2F C;  1P42 A;  4LF8 I;  4LFC E;  2NN6 E;  1EH7 A;  2J7J A;  1IMU A;  4I8O A;  2EN2 A;  1YYK A;  2JY9 A;  4WSG A;  3CDI A;  1MU5 A;  2V2V A;  3PYF A;  4IFD A;  3EPJ A;  1YYW A;  4DR1 E;  1PVG A;  2GS8 A;  2I13 A;  3CWV A;  3M7N G;  2Q2E B;  3ZZU A;  2EMW A;  4BA2 A;  4B3T E;  2WBT A;  4BMJ A;  5A6A A;  4LFA E;  4UTG A;  2KOU A;  1GTK A;  2ENH A;  4DV2 E;  2EMK A;  4LF5 E;  1HNW E;  4K0K E;  1T38 A;  2LE2 A;  3P76 A;  5LMU E;  4DV0 E;  4KHP E;  2LMZ A;  2BA0 G;  3F0N A;  5L3J A;  4IFD B;  2DMY A;  3PYD A;  5IT9 C;  3L00 A;  2EPK X;  2UXB E;  2YTE A;  1ELO A;  4M30 A;  2EMC A;  1T4L B;  4LPF A;  4DR3 I;  1X6F A;  1BKN A;  1E3P A;  1IBK E;  2JOX A;  1KKH A;  4JI2 I;  4BA2 B;  2ZM6 E;  4NXM I;  2RSM A;  1B69 A;  2LV2 A;  1ZXN A;  1XXE A;  4R1F A;  3M85 G;  1MGT A;  4O43 A;  5A6J A;  4PU9 A;  1ZBT A;  5T6J A;  2NAB A;  3J7Y p;  3T1H E;  1GQE A;  1UN6 B;  1TF6 A;  2IES A;  2EE8 A;  5DRQ A;  5EKW A;  4ED4 A;  4YHH I;  1A1H A;  4WUB A;  2YU8 A;  2PNZ A;  4OZE A;  5A69 A;  1KYQ A;  1IBL I;  4O5G A;  2EM3 A;  1XMQ E;  4BC7 A;  4DV4 I;  4URL A;  2EMH A;  2ZBK B;  3Q6M A;  3B82 A;  4R2P A;  4WUC A;  4B3R E;  2LJP A;  2EJ4 A;  3F6H A;  2CZ9 A;  1VIS A;  2YU5 A;  4HYM A;  2EMI A;  1USV A;  4YY3 E;  2GPI A;  5IXM B;  2WBS A;  1N33 I;  2Q8U A;  4JYA E;  4DV3 I;  4FW3 A;  2EOJ A;  1STU A;  2RTX A;  3PS1 A;  2VF1 A;  4FWG A;  2CGE A;  4Z7Y A;  2PNZ B;  4GKK E;  2HHH I;  2RPC A;  4OO1 C;  4JI5 I;  1OYR A;  4MU4 A;  1N32 E;  2A2C A;  1DGC A;  5K36 F;  1WJP A;  2A2D A;  2CSH A;  4IZJ D;  1JK2 A;  2EPR A;  2MDR A;  1OYP A;  4WXD A;  2JOB A;  4AID A;  4DPT A;  3VHT B;  2LBS B;  2UUA E;  2EZ6 A;  1NHH A;  2YTP A;  4WUD A;  3M99 B;  1I94 I;  3BID A;  3U1K A;  4JV5 I;  3CDJ A;  5LLQ A;  2JWO A;  2JR1 A;  2K7I A;  4NHR A;  4JI0 I;  4FW4 A;  3H09 A;  1X48 A;  5BR8 E;  5F3W A;  4JI4 E;  4I3H A;  5C0X F;  2EMY A;  2BBG A;  2DLQ A;  5TSE A;  1EH6 A;  1YHC A;  2EN6 A;  4N4R B;  4LF4 E;  3ZKD A;  1WHQ A;  1N36 I;  1T4N A;  4N3O A;  4AQY E;  2C39 A;  2C37 A;  2WZO A;  4LFB E;  4IFD C;  1AAY A;  4R2C A;  1UDO A;  3QG5 C;  1HNZ E;  4FW5 A;  2EMG A;  5AE2 A;  2EPM X;  3IWD A;  2LJU A;  2DLK A;  2EPN A;  1LLM C;  2IHR 1;  1RHY A;  2B7V A;  2AE8 A;  3M6A A;  1N34 I;  5LL6 R;  1Z0W A;  2EN7 A;  2YTO A;  4ISA A;  4MU3 A;  4DU8 A;  2E72 A;  2YSP A;  2HFS A;  4BA1 A;  4DV1 I;  2EOO A;  2DSY A;  4X62 I;  3J80 Q;  4DV6 E;  2EMX A;  2EN3 A;  2LO3 A;  2C39 B;  2C37 B;  2RQL A;  4RPF A;  1J26 A;  3ZZ0 A;  4F6N A;  2EPL X;  4X8W A;  4X64 I;  1PJS A;  4BC9 A;  4OX9 E;  1XNQ E;  4Z7C A;  5JEA D;  3BGH A;  5A2Q C;  2NN6 F;  2IER A;  4LTY A;  3QT6 A;  2E5L I;  3T1Y E;  2JXP A;  2EN4 A;  2UUB E;  3VYX A;  1QZR A;  4DUY E;  4LFC I;  4BA1 B;  4EMD A;  2UU9 E;  5K36 A;  1S16 A;  2UUC E;  2FGG A;  1L4S A;  1BB8 A;  2WW4 A;  2KHX A;  4DV7 E;  1KTV A;  3J7A G;  2BA1 G;  4MYU A;  3KRN A;  4OO1 E;  5A6B A;  1F2I G;  4DR1 I;  2HJJ A;  4B3M E;  2CTD A;  1USU A;  4JI6 E;  4AM3 A;  2R3V A;  2EOX A;  2HKJ A;  2YWQ A;  3JU0 A;  4F2J C;  2YRH A;  3MSW A;  5K36 B;  4LF7 E;  2EMB A;  1VI7 A;  4B3T I;  4LFA I;  1X49 A;  4DMI A;  4R2A A;  4OKG A;  5EL9 A;  4DV2 I;  4LF5 I;  1HNW I;  2PNM A;  4OO1 D;  2EPP A;  5C0X A;  2EMF A;  5LMU I;  4DV0 I;  4KHP I;  2EOE A;  5A6B D;  1MG7 A;  2IOP A;  4MLV A;  4O24 A;  4XTJ A;  2V83 A;  2LUP B;  2UXB I;  1XMO I;  4USM A;  2DMI A;  2EM9 A;  1YUI A;  2EOM A;  2YTQ A;  5ADZ A;  4R2D A;  2O1U A;  1IBK I;  2O1W A;  2CG9 A;  2ZM6 I;  3OML A;  5C0X B;  4JG4 A;  2EN1 A;  2EPZ A;  2E1R A;  1NEI A;  5CFF E;  4P7A A;  2MC6 A;  3NZK A;  3JAM C;  4IFD E;  1D6T A;  3T1H I;  1Z1B A;  4JI3 E;  4MLQ A;  4BCA A;  1RMD A;  2N8X A;  2F4V E;  1Z59 A;  5GMD A;  5GME A;  5KL2 A;  2EM6 A;  2KON A;  2EOS A;  4KWY A;  1H72 C;  3Q6N A;  3WU3 A;  1XMQ I;  2UXC E;  1B63 A;  1PJT A;  4DXL A;  2DIX A;  2BV3 A;  2NN6 A;  4IFD D;  4DUZ I;  3LML A;  3OTO E;  2NUG A;  2B9D A;  1QNT A;  4YY3 I;  1YZ9 A;  5IT9 Q;  4L8N A;  1Y60 A;  4JYA I;  2AJ4 A;  3J81 C;  2ELY A;  2HK3 A;  2JT2 A;  2XEX A;  4FW6 A;  4R03 A;  4J3D A;  1YYO A;  1X47 A;  2M4I A;  5KL5 A;  1ZAA C;  1Z5B A;  2BA0 D;  4DV5 E;  3QT5 A;  2LUQ A;  4GKK I;  2L2K B;  5JEA C;  2B3T B;  2V86 A;  1N32 I;  4FW7 A;  4M9V C;  4X65 E;  1UHZ A;  2G7H A;  3K6Q A;  2Z5C A;  2NN6 B;  2LVH A;  4HEI A;  4IS9 A;  1H74 A;  1AH5 A;  3V2U C;  1R6M A;  3C6M A;  2ODR C;  2F8B A;  5AE1 A;  5IWA E;  5DNY A;  1B62 A;  2UUA I;  4NBQ A;  3M85 D;  2M7Q A;  5DRR A;  3ADG A;  2EM0 A;  2HGH A;  4R2R A;  4LF9 E;  2EPA A;  3P1X A;  4P78 A;  2UXD E;  1UDN A;  4MU0 A;  1Z0C A;  1JK1 A;  2MDG A;  2YT4 A;  1PIE A;  2Z5C B;  4JI8 E;  1XHK A;  2GO4 A;  4LU9 A;  5AAS A;  4HAC A;  3U1Y A;  2EOZ A;  1IQS A;  5BR8 I;  1Y4S A;  3PYE A;  4JI4 I;  2YZT A;  3FIG A;  3F6G A;  3ZOQ B;  1IQO A;  2EOQ A;  3AUZ A;  4LF4 I;  3HQ1 A;  2J65 A;  2O1T A;  1Y5Y A;  1Y6Z A;  4AQY I;  4FW9 A;  2ENA A;  1RQ0 A;  3WU4 A;  4FN5 A;  4ZYD A;  5DRP A;  4LFB I;  1TF3 A;  2K4V A;  4LCF A;  4USK A; 
#chains in the Genus database with same CATH homology
 1HNZ I;  4HAC B;  1DI2 A;  2VF3 A;  3DJW A;  3WU5 A;  2M1S A;  2L92 A;  2VE7 C;  1ZBQ A;  4NXN E;  3JTZ A;  4DV6 I;  2CPN A;  1ZM2 A;  2BM1 A;  4DPU A;  4TUI A;  4GKJ E;  1Z0V A;  4NXM E;  1WHN A;  2MC5 A;  2V2Z A;  1RC7 A;  4FWH A;  3T1Y I;  2UUB I;  4WSP A;  4DUY I;  4L5N C;  2UU9 I;  2L3J A;  2UUC I;  3Q1Q A;  3LLH A;  4IZK B;  4DV7 I;  4DR5 E;  1Z0B A;  3PYG A;  4DR6 E;  2LJH A;  1EI1 A;  4B3M I;  4JI6 I;  1T4O A;  2L2M A;  4LF6 E;  3HPZ A;  4WYQ B;  1FI4 A;  4DU7 A;  1Y4U A;  4LF7 I;  4DV3 E;  1GZ6 A;  4M2Z A;  2L2N A;  4KQV A;  3VYY A;  1EA6 A;  3PRY A;  3QT8 A;  5A2Q Q;  4F54 A;  3LNU A;  4Q28 A;  4WPY A;  2L3C A;  1ZM4 A;  2ODR D;  3K17 A;  2VQE E;  4M0V A;  5AE3 A;  2VQF E;  3LTO A;  4DR7 E;  1XNR E;  4J8Z A;  3DF6 A;  4B3S E;  4JV5 E;  1IBM E;  2L6M A;  4JI3 I;  4JI0 E;  2F4V I;  1N0V C;  1H7U A;  3HTX A;  1DAR A;  2X7I A;  5LMN E;  4K0K I;  1Z0G A;  2UXC I;  3ADI A;  1N36 E;  3H4L A;  2J7K A;  3OTO I;  4JI1 E;  2L8T A;  3K1J A;  1HR0 E;  1Z0E A;  2DB2 A;  4DV5 I;  2E1M A;  5FLX C;  4DV1 E;  4X65 I;  2V88 A;  2GQ0 A;  1FJG E;  1KIJ A;  3RMP A;  3JAM Q;  1PKP A;  3AV0 A;  2OI2 A;  3K85 A;  5IWA I;  4PRV A;  1J5E E;  4LF9 I;  2N3H A;  2E5L E;  4R8O A;  4B3R I;  2B7T A;  2HKE A;  4F9A B;  1FKA E;  2NA2 A;  1A6F A;  1HNX E;  4JI8 I;  1Z5C A;  3QT7 A;  3J81 Q;  4BBY A;  2R42 A;  2RS7 A;  2X36 A;  1ZM3 A;  3B8H A;  3VK6 A;  1WUU A;  1FWL A;  2V8P A;  1FWK A;  4X66 E;  2Z5B A;  2PNL A;  3D4J A;  2DEJ A;  2L33 A;  4DR4 E;  1Z0T A;  2N3G A;  2NUF A;  4UT4 A;  1UEK A;  4NXN I;  3KWR A;  4LF8 E;  2DEI A;  3GON A;  2O1V A;  1XMO E;  2Z5B B;  4M1K A;  4OOG C;  4PRX A;  4F9C B;  4GKJ I;  3ADL A;  1WXR A;  2LTS A;  3HJC A;  4KZS A;  4MYT A;  3IWB A;  3C4T A;  4ZVI A;  4DR5 I;  4P7D A;  2ZIT A;  1RR9 A;  4DR6 I;  2V8Q B;  1H73 A;  4LF6 I;  4IZJ A;  4DUZ E;  1RRE A;  4IZK A;  4DR3 E;  4JI2 E;  4OX9 I;  1K47 A;  1XNQ I;  1SR9 A;  3ZKB A;  2EFG A;  4IZJ B;  4JI7 E;  1N0U A;  1MX0 A;  4YHH E;  2Z5E A;  4HXZ A;  2VQE I;  1UIL A;  2VQF I;  4BS9 A;  3ZZT A;  2EWL A;  2V2Q A;  1XNR I;  3C4B A;  4DR7 I;  4B3S I;  1IBL E;  2FV4 B;  2LTR A;  2RS6 A;  4DV4 E;  2LRS A;  2IOQ A;  1NHJ A;  2V34 A;  4FWD A;  1IBM I;  2HK2 A;  1S4E A;  4DPW A;  4GEQ B;  1NZ0 A;  3J7A M;  2V85 A;  1Z5A A;  1N33 E;  5LMN I;  1H7S A;  1DQ3 A;  2HHH E;  3ADJ A;  3LPS A;  4JI5 E;  4DKK A;  4P52 A;  2V87 A;  3HPS A;  1FNM A;  4JI1 I;  1HR0 I;  1I94 E;  5FWK A;  4DPY A;  3J80 C;  2BM0 A;  1FJG I;  1ZXM A;  1KVK A;  1HK7 A;  3HUL A;  1J5E I;  1U2R A;  4HY1 A;  1EKZ A;  2FTX B;  1NHI A;  3V5R A;  4F9B B;  1ZM9 A;  1HNX I;  4WFT A;  2HFU A;  2NPF A;  4DR2 E;  2NUE A;  1N34 E;  3WU6 A;  5FLX Q;  4X66 I;  2JVA A;  4X62 E;  3B78 A;  1O0W A;  1QU6 A;  2V89 A;  4X64 E;  3HXL A;  3IWC A;  4TUG A;  4DPX A;  3P06 A;  1OJ4 A;  3ZM7 A;  4DR4 I;  2H36 X;  2UXD I;  4LF8 I;  4LFC E;  4I8O A;  1YYK A;  2JY9 A;  1MU5 A;  2V2V A;  3PYF A;  1YYW A;  4DR1 E;  1PVG A;  2GS8 A;  3CWV A;  2Q2E B;  3ZZU A;  4B3T E;  4BMJ A;  4LFA E;  4UTG A;  2KOU A;  4DV2 E;  4LF5 E;  1HNW E;  4K0K E;  2LE2 A;  5LMU E;  4DV0 E;  4KHP E;  2LMZ A;  3F0N A;  5L3J A;  2DMY A;  3PYD A;  5IT9 C;  2UXB E;  1ELO A;  4M30 A;  1T4L B;  4DR3 I;  1BKN A;  1KKH A;  4JI2 I;  1IBK E;  2JOX A;  2ZM6 E;  4NXM I;  2RSM A;  1ZXN A;  4R1F A;  4PU9 A;  1ZBT A;  5T6J A;  3J7Y p;  3T1H E;  1GQE A;  4ED4 A;  4JI7 I;  4YHH I;  4WUB A;  1IBL I;  1XMQ E;  4BC7 A;  4DV4 I;  4URL A;  2ZBK B;  3Q6M A;  3B82 A;  4WUC A;  4B3R E;  2LJP A;  3F6H A;  2CZ9 A;  1VIS A;  4HYM A;  1USV A;  4YY3 E;  1N33 I;  4JYA E;  4DV3 I;  2RTX A;  1STU A;  2VF1 A;  4FWG A;  2CGE A;  4Z7Y A;  4GKK E;  2HHH I;  4JI5 I;  1N32 E;  2A2C A;  2A2D A;  4IZJ D;  2MDR A;  2JOB A;  4DPT A;  2LBS B;  2UUA E;  2EZ6 A;  1NHH A;  4WUD A;  1I94 I;  4JV5 I;  2JWO A;  2JR1 A;  4JI0 I;  3H09 A;  1X48 A;  5BR8 E;  5F3W A;  4JI4 E;  4I3H A;  4LF4 E;  3ZKD A;  1WHQ A;  1N36 I;  1T4N A;  4N3O A;  4AQY E;  2WZO A;  4LFB E;  1HNZ E;  5AE2 A;  4DR2 I;  3IWD A;  1N34 I;  3M6A A;  2IHR 1;  2B7V A;  5LL6 R;  1Z0W A;  4DU8 A;  2HFS A;  4DV1 I;  2DSY A;  4X62 I;  3J80 Q;  4DV6 E;  4RPF A;  1J26 A;  3ZZ0 A;  4X8W A;  4X64 I;  4BC9 A;  4OX9 E;  1XNQ E;  4Z7C A;  5A2Q C;  4LTY A;  3QT6 A;  2E5L I;  3T1Y E;  2UUB E;  3VYX A;  1QZR A;  4LFC I;  4DUY E;  4EMD A;  2UU9 E;  1S16 A;  2UUC E;  2FGG A;  2WW4 A;  2KHX A;  4DV7 E;  1KTV A;  3J7A G;  4MYU A;  4DR1 I;  4B3M E;  1USU A;  4JI6 E;  2R3V A;  2HKJ A;  3JU0 A;  3MSW A;  4LF7 E;  4B3T I;  4LFA I;  1X49 A;  4DMI A;  4DV2 I;  4LF5 I;  1HNW I;  2PNM A;  5LMU I;  4DV0 I;  4KHP I;  1MG7 A;  2IOP A;  4XTJ A;  2V83 A;  2LUP B;  2UXB I;  1XMO I;  4USM A;  5ADZ A;  2O1U A;  1IBK I;  2O1W A;  2CG9 A;  2ZM6 I;  3OML A;  4JG4 A;  2E1R A;  5CFF E;  4P7A A;  2MC6 A;  1D6T A;  3JAM C;  3T1H I;  4JI3 E;  4BCA A;  2F4V E;  1Z59 A;  5GMD A;  5GME A;  2KON A;  1H72 C;  3Q6N A;  3WU3 A;  1XMQ I;  2UXC E;  1B63 A;  4DXL A;  2DIX A;  2BV3 A;  4DUZ I;  3LML A;  3OTO E;  2NUG A;  2B9D A;  4YY3 I;  1YZ9 A;  5IT9 Q;  4L8N A;  4JYA I;  2AJ4 A;  3J81 C;  2HK3 A;  2XEX A;  4R03 A;  1YYO A;  1X47 A;  2M4I A;  1Z5B A;  4GKK I;  3QT5 A;  4DV5 E;  2LUQ A;  2L2K B;  2B3T B;  2V86 A;  1N32 I;  4X65 E;  1UHZ A;  2G7H A;  3K6Q A;  2Z5C A;  1H74 A;  3V2U C;  2ODR C;  2F8B A;  5AE1 A;  5IWA E;  5DNY A;  1B62 A;  2UUA I;  2M7Q A;  3ADG A;  4LF9 E;  2UXD E;  3P1X A;  4P78 A;  1Z0C A;  2YT4 A;  1PIE A;  2Z5C B;  4JI8 E;  1XHK A;  5BR8 I;  4LU9 A;  5AAS A;  4HAC A;  4JI4 I;  1Y4S A;  3PYE A;  2YZT A;  3FIG A;  3F6G A;  3ZOQ B;  3AUZ A;  4LF4 I;  3HQ1 A;  2O1T A;  1Y6Z A;  4AQY I;  4FW9 A;  1RQ0 A;  3WU4 A;  4FN5 A;  4LFB I;  2K4V A;  4USK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...