4EMDA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
299
Chain Sequence
GAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 299
sequence length 299
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4emdA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4emdA01
2Q2EB 4DR3I 4GKKI 4DV3I 1K47A 2V34A 5FLXC 4NXNI 1N0VC 3J80Q 2UUBI 4WUBA 4MYUA 4P7AA 5LMUI 2NPFA 2BM1A 2EFGA 4JI7I 2AJ4A 4HACB 1HNWI 4JI8E 4LF7I 4HACA 1ZM2A 5IT9C 1J5EI 1OJ4A 4DV5E 1WUUA 4DPYA 1Z0VA 4JI6I 3B82A 4YHHE 4DR6I 4B3RE 2UXBE 1XNRE 1Z0GA 3QT7A 4AQYI 1H73A 4FN5A 4JI3I 4UTGA 1N36E 4B3ME 3JAMC 4K0KE 1FI4A 3LPSA 1PIEA 1Z5BA 1PVGA 1Z0WA 5BR8I 4DR1I 4GKJI 3ZZTA 4B3TE 3K1JA 2GS8A 4DPUA 4X64I 4DR5I 4DXLA 1ZXNA 4URLA 4LF4E 4JI2I 4XTJA 4DPXA 1Z5CA 3J7AG 4USMA 1D6TA 4DR3E 4X66I 4GKKE 4DV3E 2HK2A 3HULA 4NXNE 2UUBE 4JV5I 2UXBI 5LMUE 1HNXE 5LMNI 4YY3E 4B3SE 2BV3A 1XNRI 4JI7E 1ZM3A 1HNWE 4LF7E 3T1HI 1J5EE 1H72C 2BM0A 4JI6E 2OI2A 1EI1A 5L3JA 2R3VA 1IBKI 4DR6E 3ZKDA 5IWAI 1MG7A 4PU9A 4JYAI 2ZM6I 2E1RA 4AQYE 1FJGI 5FLXQ 4JI3E 2UXDI 4X62I 1B63A 1IBMI 4HYMA 4OX9I 2V8PA 4LFCI 5BR8E 4DR1E 4GKJE 3H4LA 2V2ZA 4UT4A 2J7KA 1DARA 5A2QC 2XEXA 4X64E 4PRVA 3T1YI 4FW9A 4DR5E 1HNXI 3ZM7A 4B3SI 4YY3I 1N0UA 2VF3A 4P52A 3D4JA 4JI2E 4PRXA 4RPFA 1H7UA 2HHHI 4X66E 4JI0I 1IBLI 4DV4I 3JAMQ 3Q1QA 4JV5E 4R1FA 5LMNE 3F0NA 4USKA 2CZ9A 1HNZE 3B78A 3T1HE 3B8HA 3LTOA 1RREA 2VQFI 4ZVIA 1Z0EA 1IBKE 1FWLA 3QT5A 1MU5A 1QZRA 5IWAE 3PYDA 4JYAE 4DV0I 2ZM6E 1FJGE 4DPTA 2UXDE 4X62E 1IBME 4DUYI 2HFUA 4OX9E 4JI1E 3LNUA 2HFSA 4DPWA 4I3HA 2UXCI 4LFCE 2UU9E 1HR0I 3QT8A 4LFBI 4FWDA 1FKAE 4LF8I 2F4VI 1S4EA 2VQEI 3T1YE 1XMQI 2WW4A 4EMDA 1N33I 1HNZI 2HHHE 3V5RA 3J7AM 2ZBKB 2UUCI 1XNQI 4JI0E 1XMOI 1IBLE 1B62A 4DV4E 1EA6A 2HK3A 4DR7I 1UEKA 1RR9A 1I94I 1Z0BA 4DV2E 2X36A 1H7SA 4DUZE 3J81C 4DR4I 5A2QQ 4JI1I 4LF6I 4DU7A 2UUAI 4JI4I 1KVKA 4JI5I 2UU9I 2VQFE 3K17A 4DU8A 1NHHA 4DV7I 3ZZUA 1XHKA 4FWGA 1Z0CA 2A2CA 2HKJA 5IT9Q 4DV0E 4DV6E 2DEIA 4M1KA 3ZZ0A 3PYFA 4DUYE 2UXCE 2R42A 4LF5E 4HXZA 1ELOA 4LF9I 5LL6R 1HR0E 4KHPE 1FNMA 4DV1I 4LFBE 5GMDA 2A2DA 4LF8E 2F4VE 1KIJA 2VQEE 4DR2I 1XMQE 3V2UC 1N34I 4DV2I 3ZKBA 3WU3A 1Z59A 2DEJA 4DUZI 3J80C 1N33E 3M6AA 2UUCE 4X65I 3WU6A 1XNQE 4MYTA 2E5LE 1XMOE 1FWKA 4WUCA 2V2QA 4DR7E 1I94E 4LFAI 4DV6I 3OTOI 2V2VA 3WU4A 5GMEA 4DR4E 4NXME 4WUDA 4LF6E 2UUAE 4JI4E 4JI5E 1KKHA 3PYEA 4DV7E 4LF5I 1Z5AA 4Z7YA 4KHPI 1NHJA 2ZITA 2X7IA 3GONA 1N32E 4HY1A 1S16A 1U2RA 4ED4A 1NZ0A 3WU5A 1A6FA 4JI8I 2LJPA 4DV5I 1H74A 1ZXMA 4LF9E 2E5LI 3CWVA 3J81Q 4YHHI 4DV1E 4B3RI 1KTVA 4DR2E 4FWHA 1N34E 1ZM9A 4JG4A 4B3MI 1N36I 4K0KI 1NHIA 4NXMI 4Z7CA 1Z0TA 4X65E 1ZM4A 4B3TI 1BKNA 1MX0A 2HKEA 4KQVA 4LFAE 3QT6A 3OTOE 1N32I 3PYGA 1PKPA 4LF4I 1VISA
chains in the Genus database with same CATH superfamily
4ZVHA 4CNZA 1WHXA 3J80Y 4BDPA 5KTQA 5A0YB 4DF8A 2LP4A 4JI2J 6AT1B 2C39B 1MROB 3NBPA 4C2MA 2CPZA 4ILLA 3R7SB 5E7OB 2VUGA 1XMQJ 2AJ4A 3D6FB 3NCRA 5KFYA 2HHHF 1ICEB 3T5LA 3EZOA 2RUGA 2M88A 3C6UA 3CCWA 1K44A 2K2PA 1O6XA 1R27B 4NCGB 2KM8B 3CSKA 4B3ME 3MAHA 3ZZOA 3DLLQ 3ISND 2YQ3A 1Z5BA 4ZCKA 3P96A 1JXLA 1S57A 3DGPA 2Y3YA 4FNHA 3MAAB 4DPUA 1VC0A 1TV6B 1ZAVA 3P3GA 4LF4E 2GVZB 1X60A 1FRXA 4LCFA 2EKYA 1A9NB 3CNQP 4H4KC 4KHPF 2R7XA 3MMAA 1TAQA 3EX7B 4LF8F 2KYXA 4O0NA 2BA1D 1YZ6A 1Q81T 1NLKL 9ATCB 3MFHA 1XNQF 4CIOA 3RBDA 1NK9A 4NE9C 2DTJA 3ILOA 4BWJA 3D0HE 2YWGA 2IA6A 4PU9A 1VGYA 2OH2A 2HZCA 4CRJA 2X1AA 4U6PA 4DR4F 4K0KF 2JRSA 2E5IA 3FCWA 3F41A 2V2ZA 1U8SA 3JSMA 2MZJA 3Q0AA 4LJMA 4ES2A 2OPQA 1YHCA 3H5SA 4ERDA 2MSTA 1YJ7A 1R8HA 2KYZA 1EKSA 2YNHB 1U1KA 1N6QB 1NZAA 2RB7A 2BOPA 4FPIA 3HT0A 1KR4A 3P3CA 4OO1A 3JAMQ 3Q86A 1LWFB 3G8TA 1TL4A 1IM4A 4YHHJ 1M5VC 5H9FJ 2RKIB 4H4MA 2CZ9A 3G2XA 2NN6B 3KMQA 3Q8YA 3POTB 3FCHA 2WNRB 1KQSR 1TFWA 4B3TJ 4PYAA 4DV0I 2QLXA 3AA9A 4I2QA 5KOXA 4UZBA 3C16A 4DUYI 2QT7A 3R8YA 4ZJQA 5BR8F 4I3HA 2FC9A 3SQOP 4OHZA 4LF9J 2HWHA 2VQEI 1YRXA 4RO0A 2KKHA 1LXNA 1WC6A 4LQ3A 2XS2A 4K50A 1Y4ZB 5CH7B 2F9JA 5JEAB 4NX9A 1S9GA 1RR9A 1OWXA 1FWPA 4EU0A 2LQJA 1X7VA 4Z37A 1CG2A 2FDNA 5E41A 3BGFA 5K8NA 3SI8A 2AJ2A 1YGYA 4DU8A 1HQEA 4I6AA 4WBFA 2DH8A 5G0RB 2YX4A 2DB1A 3OTDA 2GA7A 3P5TL 1I51B 2BMBA 2XNRA 4C98A 3R5DA 2RF2B 3M85G 4CLKA 2WTFA 5L1LA 2JH3A 3I0SA 3M32B 2DVIA 2QA2A 4K5RA 4V19J 1O8BA 1WELA 3BGUA 2MQLA 4ZCMA 2AMCB 4BC7A 2FLLA 3VAFA 1VQPS 1WOSA 3OFEA 2XYPB 3OR2B 1UJ5A 3OL7A 4XTTA 2HRYA 2B43A 3RAQA 2KU7A 1U1OA 1RTIB 1CJTA 1RWXB 3JXOA 2VICA 2DGTA 4F02A 4WE1A 1R0CB 4Q7AA 2MQQA 1BQMB 3LPYA 4CH7A 3UI3A 4Z7YA 4A8QA 3QSYB 1C0TB 2RHQB 1S6PB 2RDDA 4LRDA 3CMES 2BQUA 2EVZA 3SFUA 2V5HG 4L3KA 3KLHB 3GIJA 5CAAA 1IN0A 2NZ4A 1CULB 1X8DA 2OFGX 4CLUA 3FUYA 3OTBA 4ENOA 3W2VA 2LEPA 1HWJA 2WVFA 4FYYB 5A6WA 2M52A 2O5DA 2UUCF 4J3DA 1T11A 3GIRA 1D09B 3FC9A 5GVQA 4BA1B 2PO1B 7FDRA 1Q0NA 4LFAE 3B6BA 5FJ4A 3J7Z5 4KHMA 3DFEA 1TL1A 4JI1F 5KFIA 1H0HB 5AJ3F 1TUWA 5IM0A 4DV3I 1CC7A 4OLOA 3BSAA 1RYRA 5HVHA 2UVUA 4MYUA 2NPFA 1FRLA 5JUMA 2BM1A 2LA6A 4LF7I 2GGPB 4KPYA 2VA2A 5GAEU 4E0DA 4KKOB 4YS2A 2UV8A 3ULHA 4DL3A 3D68A 3HP6A 3HI9A 3HXMA 1U24A 1N36E 5KFSA 1C0UB 4ZVQB 1S9EB 1SJ4P 1FDAA 4RW7A 4JBCA 4DV0F 3GPAA 5LJ5Y 2IHR1 1NK7A 1G7CB 2MHNA 2AEFA 5KAKA 3A4TA 4L74A 3PX4A 3BGRA 3G6XA 4DUYF 4C0BA 2C2ZB 2L9WA 1HI1A 1D6TA 2CJQA 3PJXA 3FFIB 2VQEF 4JV5I 1SIWB 1IBLJ 3CIMA 1XNRI 2F1DA 2O66A 4ZPWR 2BE2B 3FVYA 1SC6A 4OYAA 1MMDA 1X9WA 3GSDA 2VPZB 4PYDA 1MG7A 2WB1D 5IQ6A 2DR6A 3R97A 4B3OA 2AWZA 4H4OA 3CCVS 2ZNZA 4HTIA 3AD8C 1GH8A 2I8EA 5CCLA 2OELA 2MEWA 1NU4A 4EUVA 1IUJA 1XIQA 5KFKA 4YR0A 4OZEA 3PHTA 5KFDA 1IR1A 3UDEA 4PRXA 1H2VZ 3JAMY 3FK4A 3MM8B 2QN6B 4I64A 1CJUB 4JI0I 1JQGA 1AT1B 1REVA 5A76A 3ENVA 2E5LJ 2ZOMA 5GADU 1YJNS 1Q8BA 2MGZB 4XIUA 4F7VA 5FD1A 3HHEA 4DQIA 4KGKA 3HHLB 4J9OA 4LT6A 3OSPA 1TKXA 2O3DA 1RTJA 3S8SA 2ZM6E 5L1JA 3DGVA 1FKPB 4KSEB 1NXIA 1IBME 4OX9E 2HW3A 4ZITA 5K20B 2UXCI 2UU9E 4B08A 3Q23A 4DPOA 1H2UX 3QYYA 2Y8WA 3WDOA 1O5JA 3D6HB 4ECYA 5LMUJ 4PPDA 4IFDB 1DTQB 1J27A 2ZUGA 1HNZI 4WFXA 1AFIA 2DNOA 3CDUA 4ZJLA 4DV4E 4WXOA 2IMWP 4EFAC 1IVZA 5DDRC 2FZKB 4LIRA 4I2PB 1UEKA 4U7UD 1ZYQA 1P27B 4DUZE 1H38A 5A2QQ 2UUAI 4TN2A 3MM6A 5D8HB 1FRKA 3Q8QB 4RZRA 1X4DA 3BH6B 4U9RA 1X4AA 5FDLA 2FJBB 5J1EA 1S6OA 1UZDA 3HVWA 2GQ2A 4X84A 2UXDF 2ZH1A 4ECZA 2XMWA 1YZ7A 2AX0A 2KVQE 2HGLA 3L7OA 1RT4B 2BA9A 2H3EB 2WVBA 1U6ZA 2DR5A 4DEZA 4DQPA 5C7PA 1NSQA 2BR2A 5LL6R 4DV5J 2AT1B 2CQBA 2W9BA 3U1YA 1XMQE 3GJTB 1ZTTA 1Z59A 4LF7F 4IG0A 3Q83A 2FJAB 4USTA 3MR5A 2YKMB 3DI6A 2ASDA 4MK7A 5L39A 4DR7E 1C4CA 2KJWA 4P7TA 1IR0A 5K8MA 2HAIA 2V67A 3F44A 1Y3JA 1ZAWA 4DV7E 2ZZNA 2RU9A 1RQ0A 2XO6A 2D41A 1CPZA 3W9HA 2R8HA 3HHNB 1R6LA 4RWWA 1R0AA 1O51A 1JLQB 4X4OA 3MFIA 4O3SA 1N8RT 2EFVA 1D1UA 1HNWJ 4JV5F 4AIMA 1RTDA 1HW8A 3SEOA 3T9NA 3PKMA 4IFVB 5KFCA 2ZZTA 4RUCA 2LXIA 2YKPA 2VOPA 2BA1G 1Q5YA 3JYTB 4HLBA 1MX0A 2JT2A 2ZH8A 3KLGA 3PXGa 1HNIB 4DR5J 1GMVA 1VBZA 1JK9B 2MQOA 3G4SS 5A0YA 5D0RA 5K9FA 3D1HA 4WUBA 1VQYA 2L08A 1FEHA 4ZOSA 3MMCB 4BA2B 2YQ0A 3DHWC 2HSEB 4NCBA 4KV8B 1OJ4A 4JI0F 3NY0A 1OO0B 1NK5A 1WORA 2Z30B 3EE3A 4YHHE 1X4GA 1A7GE 1Z0GA 3VAHA 2HMIB 2VKRA 1I94J 1DFDA 4X62J 2LCWA 4B3TE 1NBEB 1ZZFA 3OV7A 1XQIA 1IWAA 4LFCJ 1TKTA 4NZ6A 4M5NA 3MAAA 4X64I 4IG3A 2AEJA 3P6YC 3C46A 1JJHA 1VQ6S 2CZ4A 1Q79A 2UXCF 3HMJG 4U7UK 1NDCA 4X4SA 1UZHA 4QR0A 4NA1A 4CI0B 3M30B 2KRRA 2GIRA 1Q16B 3D1OA 4FS1A 4B3SE 2N3LA 1SI9A 4IFYA 1HHQA 1IKYA 4JI6E 3MOJB 4LR8A 1NAQA 2LFVA 2AW0A 3ZKDA 5CZVA 2KH9A 5DG8A 4Q44A 3H2UB 5FLXQ 4DV6J 3R5BA 3CO9A 1S79A 4HYMA 4NA2A 2UUAF 4PQUB 5IT9Y 4GKJE 4JP8A 2ABYA 1D8YA 4TQRA 5KFEA 4TXSA 5A8WA 2ROPA 2MKCA 4DQSA 3W8GA 2JEGA 3WZ0A 1JWWA 3CW2C 4CZCA 2C3MA 2D3UA 4ALZA 3D4JA 1OQ6A 3K8WA 4IRCA 3PDNA 5E5NA 3BGOP 1CBKA 3MCNA 4PABA 2RKIA 3F0NA 3V6JA 3ENAA 5ETTA 2GHVC 3B8HA 1Q4RA 4NYOA 4J9SA 4X4TA 2Q1LA 3T6JA 3POTA 2M70A 4F2SA 4JI5J 2BW7A 4X4VA 2WNRA 2IJRA 4V1Ak 3QGPA 4P7VA 4DL6A 2V8HA 5J1PA 2HFUA 3LNUA 1VBXA 2W2PP 2E44A 4K5SA 1RTHB 1WTBA 5D4LA 1B64A 3PKYA 1HLWA 1F9EB 2V6AA 4RW4A 3R5GA 1J2VA 3FMWA 3Q6MA 2JHEA 4A8OA 1DZ5A 2XMUA 2MKKA 3TQ1A 2VG6A 4FYVB 1OPIA 3M1VA 2UXBF 1D8ZA 4MT1A 2BBEA 2IA0A 5A2QY 4DV2E 4C0OC 4OO1E 1IKXB 3QSIA 3CMAS 1NMEB 1UJ4A 2A1BA 2VG7B 4DX7A 3WIUA 3G8SA 1V6HA 4ZIWA 5EL9A 5IC4B 3PFEA 2Z5CA 1JIHA 2W7PA 4J9VA 4DL0C 3I9V9 4HHUA 3W5ZA 1HNVA 3QO9B 3W7BA 4HXZA 2RF2A 3ITHB 5J2PB 4DV1I 1AROP 3TUPA 2IVMA 4B3RJ 5DDQC 4M5GA 3ONQA 4EBDA 1PYSB 3TJ9A 2YKQA 2AJ0A 3OR2A 3UDCA 4MYTA 2XSFA 3T3FA 1Q5VA 1XMOE 2AJQA 2EI5A 5J1NA 4ZLNA 2DNQA 1UETA 2NREA 2OSRA 3DM2B 1HBMB 3W3SA 1RTIA 2GFFA 4CT9A 2DIUA 1PBUA 2MZQA 4FVMA 3C3LA 1C0TA 4X64F 1F5BA 4DN0A 1S6PA 1FXDA 2L48A 4CP5A 2UUBJ 2PO2B 8AT1B 2QMWA 2CNKB 4JI8I 2LJPA 3M8YA 3KLHA 3LH2S 3SV3A 2F8EX 1HQUB 2XHWA 4ZVSB 3RW7A 2DGUA 4PQAA 3VGUA 1X0PA 5ETQA 5EGYA 1JLEB 1I6JA 3EZUA 1M5KC 3JAMU 4CT8A 4XPCA 1UEVA 1VIXA 4DFMA 5T41A 3VAIA 4ER8A 1ZA2B 3QATA 1F0XA 4DR1J 2JEAA 2PO1A 3ISNC 1VJQA 3CJKB 2PFDA 1WNEA 3LP1B 1YIJS 1N32I 4QIVA 3PYGA 3GJRB 3OXGA 4MDTA 3MCMA 3GV5B 2OPPA 4DR3I 3N5BA 4CH1A 1O0PA 2ATCB 4DG1B 4NMLA 2ZH9A 1N54B 2HFVA 4J9NA 5DS7A 4UOHA 1S9FA 3M9OB 4CH0S 3FBBA 1JXEA 1RTZA 2P5VA 3ELHA 5LMNJ 4Y2AA 1KTQA 1VI7A 3KLFB 1K8AT 2CQ1A 5D4PA 5AE3A 4KKOA 3QRPA 4AXIA 2D3ZA 1FJEB 4OI0A 5KG6A 4JYAJ 3DRRB 3CD7A 2DXFA 3CDWA 1KWMA 1RWOB 4YDDB 4OJ3A 2QMUB 2VBYA 2CQGA 2FB0A 4OZ2A 2HS4A 4A8MP 3VQTA 1FX4A 3M6XA 1WHYA 1L5UA 3OHAA 1VQLS 1AB8A 4QIFA 1N48A 4JI2I 5THWA 2H4WB 4QNJA 2WBMA 3CCQS 3GJQB 4ED5A 3PO4A 2CQ0A 2RT3A 3AHPA 2HGMA 3HK2A 1KONA 5LMUE 1HNXE 4QBUA 4YY3E 2BV3A 3W5XA 2BABA 1E6VB 4C7QA 4MKVA 1GXUA 3MM7B 3A3OB 3SBMA 2BE2A 2BQRA 2Y1JA 2PMWA 1F2HA 3LF0A 1KEKA 2HQIA 3MUTP 5FLXY 4YB5A 2IVFB 5SZTA 1KOOA 3EMTA 2E7XA 1RT3B 3DDIA 3UW1A 3IM8A 4R8UB 2R2TA 2ZH3A 5C5JA 3PM9A 3OTOJ 3IWNC 1RSCA 2Q6CA 4RW8B 2CQ2A 2ZE2B 3FZ2A 4KTQA 1HKAA 4FW9A 5B0EA 2DGQA 4ZA1A 2C3OA 1TVRA 2K06A 2AP6A 4X66E 4OYWA 1D9FA 4KH1B 1JXVA 5EWEA 1CJUA 4DV1F 2BJDA 1KBRA 2EWHA 5D0HA 4O4RA 2RQ4A 3LA0A 4KJIA 2MGZA 1OY9A 4ZCLA 1RREA 1YITS 1SC1B 3TUIC 2WW8A 4ZVIA 2EK6A 5HSPA 4OZ0A 4TY9A 2YX1A 4ZN3A 4NEZA 3GFYA 3TI0A 2ZH6A 1S49A 3OXLA 4M63A 1FKPA 5KG3A 2RNEA 1CLFA 4P75A 3NP5A 3MZIA 1YKWA 3W64A 5DLGA 3CPWR 1X31C 3OPKA 4J9LA 1UL3A 4OO1D 4ETZA 3AOBA 1IR2A 4JI8F 1N56A 3SXLA 3OLAA 4GRSA 5HBMB 3JQMA 3QIPB 2F1FA 1FTRA 2V50A 2OUGA 4X65J 2MYFA 3KWMA 1GMWA 2CNLB 4I2PA 1PC4A 4ED8A 4I1TA 4J90A 1JB0C 1LK5A 2E9ZA 1LXJA 2ZNYA 3CC4S 3IG1B 5HLFB 3N6MA 1Q86T 2DNGA 3R5JB 1SC3B 2NXCA 4KB7A 2ZM6F 3CJ2A 3P45B 4N76A 3OR1B 2XLJA 1GX5A 2YTCA 1S1VB 4USIA 2MHEA 1USVA 3BS9A 4DR3F 1LOUA 3RB6A 4DBQA 4LF9I 4DZ6A 3BGLA 1IWGA 3OLBA 3A8JA 5IT0A 3R1LA 1Q7LB 2DRBA 1N5QA 3DLJA 2HS3A 3C14B 2PO0A 4ECTA 3DLBA 3HFZB 2DO4A 5EHHA 1S12A 5HMZA 4DV4F 2VDIA 2KB2A 3O1LA 2B4OA 4B17A 1NNDA 4O3NA 4LR9A 3J7AN 2XO7A 3IR5B 1I94E 3M8WA 2W2OP 3IFEA 2D9OA 2V2VA 3A8EA 2W9CB 2CPIA 3R3TA 4WU2A 3FSYA 4NXME 1C1BB 4LF6E 4A8YA 2HQ3A 2DCLA 2XHCA 3RW6A 3TOQA 4LF5I 3R5AA 5KG0A 4K4XA 3GE9A 3NNAA 5K36B 2DGVA 2DNNA 4NXNJ 5IT4A 4QWAA 2XZDB 1UMJA 4JI2F 5IT9U 1JLQA 1H74A 4UF4A 2KFYA 3R1HA 1WC3A 1J5EJ 3CWVA 5F8MA 1UW4A 3M8ZA 3VALA 2ZWOA 3FSXA 1XMQF 1KTVA 4DR6J 1S0NA 4O4GB 4LSNB 5AXKA 3THPA 4QWEA 4U67Q 1V3ZA 3UPFA 3UN3A 5CQGA 3U27A 5KT3A 4YEAA 5KT4A 3JYTA 4KQVA 3IBWA 1X5TA 1XR6A 4FVCA 1VISA 2VIHA 1EKRA 3QFWA 2ZZMA 1SBRA 4YOEA 3E2EA 4PKDB 2C38A 3UD5A 2MQMA 3MMCA 2EFGA 3PJ9A 5F8JA 2WVCA 1A6LA 3GCMA 3QGIA 3M6VA 2VG5A 2W1BA 3T1HJ 4PXDA 1Q7YT 2BJ3A 3JTOA 4DQRA 2POKA 1H73A 4LIWA 1KLMB 3D66A 1MU2B 1SV5B 2RQCA 3VAKA 3ISZA 1CQNA 1RISA 2M9KA 3CMQA 6FDRA 1ZTWA 3C2PA 1T94A 2IYIA 2PMZD 2YWFA 3HFVA 2D7SA 1LV5A 3UDLA 2R9LA 1L3KA 3KG0A 1PJ5A 5EKWA 4DL4A 3KNGA 1SUQA 2PNLA 3RU0A 3D9BA 1RT1B 2FVRA 3LOUA 3M30A 4OI2A 1ZM3A 3SFGA 1HL6A 2G9OA 5EX3A 1UVKA 2HG4A 5L3JA 4YHHF 4URQU 3CCES 4I68A 4NYZA 4EO6A 1Z2LA 2U2FA 4KBIA 1QSLA 3V4IB 2MY8A 4DN9A 2QLBB 5A8KA 1VK8A 2YNFB 4RJVA 2V8PA 4PQUA 4B3TF 3HDSA 1WD6A 1XR5A 1TKZB 2ZKUA 3WBZA 3SMZA 4UT4A 1SH2A 4UQGA 3JSYA 3AD9C 2MJUA 4PRVA 2K1RB 4LFBJ 1S1WB 1E3HA 4GMKA 5AE2A 3TARA 4ECSA 4LF9F 3NWGA 5K8OA 5DQHA 3QPIA 1IBLI 3OUYB 2F65A 3FMBA 1VRTB 4EBCA 3RRGA 2JFDA 4Q0BA 3LTOA 3N6LA 2GVDB 2XMVA 4JI4J 3VAJA 2WHOA 3BJYA 5DDOC 2QZ8A 4NLUA 1VQ8S 1URRA 1RWWB 1DURA 4DPTA 2GZOA 4O44B 4DMZA 4RBTA 1HARA 2MLYA 3R7BB 1RT6A 2V94A 3P76A 3DLGB 1S4EA 4C11B 4I7FB 1NH7A 2DR9A 4PWDB 4GQUA 3TW0A 3PG9A 3MI7X 2HHHE 3M8QA 3CD5A 2VJUA 4OFZA 3TAMB 1SJRA 1HPZA 1UW9A 6FD1A 2IYGA 3BM7A 2BEFA 4MJKA 4GO5X 4BLGA 1Y3KA 1KC8T 1P8GA 5IFMA 2DHSA 2YKOA 1DJ0A 4HEA9 4U96A 4ZVGA 2IJFA 2O1WA 3ZZUA 4PG5A 4R0EA 5DNLA 4DL7A 2WAQD 2HKJA 2J9EA 3I32A 3OFFA 1RUSA 3NZKA 2E5GA 2CYYA 3IR6B 2NXNA 1G2EA 3NAIA 5FIIA 2QLJB 1SB6A 1YX2A 1APSA 2ZC3A 2HBRB 2W8KA 2AKWB 1FNXH 2HHTA 3QO9A 1JLFB 4KHPE 3ITHA 4LCHA 5J2PA 4LF8E 3Q89A 2QSWA 1RBLA 5E3RA 2C2KB 2EW9A 3VAMA 1XNRJ 1UVMA 3H42A 2HHQA 1XNQE 3MMJA 5MAOA 3GFXA 4WUCA 3P49B 2AYEA 2COLA 3O6QA 2G0IA 2MY7A 3HT3A 2C2RA 1HBMA 2E9RX 4DR4E 2BA0D 4IZJD 2H5IB 2WP8B 5FLXU 1Z5AA 4LRBA 2JNJA 4GKKJ 1PO6A 1LWCA 4ZMMA 2HYIB 4WYLA 2VZ9A 2X7IA 1UDSA 1S16A 1NZ0A 3WU5A 2PO2A 1S6UA 5B0CA 3HD1A 4DV5I 3CDIA 1R8BA 5KFAA 3VWSA 1HQUA 1W25A 4J9QA 4WWSA 4O3OA 3RYLA 1HWIA 4FWHA 1RHKB 2ACYA 2XLKA 1JLEA 5IOLA 2CRLA 4UQTA 5CA5A 3NGRA 2XI2A 4EEYA 3HVRA 2FY8A 4KR0B 1FRHA 5GAGI 2K8GA 3AA8A 5HQMA 3RG6A 5KFNA 3FCVA 3TZWA 2F9DA 3QT6A 1TL7B 2J5AA 2LVWA 2H48B 3OTOE 2PE8A 2X1FA 1ZA1B 1MSWD 1X4FA 2Q2EB 3IMQJ 1SVDA 1K47A 2P9EA 1R7IA 4DG1A 2KZZA 2CPHA 3DLEA 2CJBA 3SSSA 2OIHA 4HACB 1HNWI 1XK8A 1VQ9S 3RR7A 1I3OB 1FDNA 2DGXA 3K5PA 3KLFA 1HNZJ 1IBLF 2WONB 3RZAA 4DWIA 2QC3A 3IGVA 1RCXB 4ECQA 1MW7A 4ZS6A 2HBQB 5IWAJ 1R0BG 2LMIA 2JDJA 1FJGJ 4ZPAA 4U95A 5IS2A 1Z0WA 2IESA 2BDPA 2CIMA 3UQSA 4KHRA 1EJ7L 4U8YA 2GS8A 2ZWPA 2QYGA 3KJFB 4RNNA 4ZPTR 1OPZA 3NS5A 5DRRA 4DR5I 1KHVA 5IV4A 3T1YJ 1U1PA 2KHCA 5KG4A 4XAKA 3MXHP 2JE6A 1UKUA 2CQIA 4A8XA 2HK2A 2PA8D 1VLYA 1DBDA 1RT5B 3CEDA 3U1NA 4XPEA 3VGSA 4RNMA 3QGHA 1G3OA 1Y5IB 2JVRA 4QOTA 1E6VA 4Y2KA 3CCMS 3FZBA 3MM7A 4WJBA 2X1GA 1B0TA 2E5LF 1EI1A 4NEYA 3KLEA 5JXSA 2FLPA 2BJ1A 4K7QA 4OZ3A 1RT3A 2HBYB 1RAJA 1WKLA 4X62I 4UOFA 4LFCI 4PEOA 3SZ2A 2N3OA 3FBFA 2OEMA 4N8OA 2B0GA 3BN4A 1FO1A 1U4BA 4RW8A 4DQQA 4E2FB 1BY9A 2F4VJ 5LM7E 2Y0SD 4CO0A 2ASYA 5J2NA 3HHDA 1R8AA 1S6QA 1UWBB 4LRCA 9RUBA 2HZVA 3DLKB 2BE7D 2DNPA 5LMUF 1S72S 1EARA 2CFXA 4O3PA 3MEEB 4PWUA 2JWNA 2DD8S 5I3PA 5KFJA 4P6QA 2JEBA 3K2YA 3M8PA 3Q8UA 2CG8A 2MPUA 2H65B 3RBZA 1PAEX 4LUBA 2MKYA 1NK6A 2I9SA 2YH1A 3CCLS 3PX0A 4JI1E 2CNNB 4USVA 2NQPA 1T8EA 1N4LA 2ATLA 2Z5BB 4A46A 3BQ2A 5DLFA 2ZH4A 2MSSA 1V3SA 4FBUA 4DR2J 4DV5F 3I5BA 3TJAA 5I3UB 4WXWA 3M7NG 3AY0A 1EETB 3MAQA 2O1PA 3D3CJ 4NLPA 2P6TA 2QV6A 4X4QA 3IG1A 5HLFA 2LU2A 2BUNA 1CQMA 4JI5I 2BVZA 3I4PA 3UCZP 2UU9I 2OTLS 1FHTA 1XERA 2VPXB 4ZVEA 2VFVA 1QUPA 1K1SA 1EIYB 4DV0E 1C1CB 3OBIA 1SL0A 1S1VA 4DUYE 1K73T 1RP5A 4PRFA 1IM6A 4JV1A 2E66A 3HPOA 4L72B 4OHWA 2ZC4A 4OJHA 2MZ1A 2VQEE 2VPYB 1S4FA 1X4EA 1HW9A 4ES1A 4Q2LA 1QAYA 2BZ2A 3C19A 1HNWF 1OSDA 1JLBA 3C14A 2DEJA 4DUZI 5JEAD 3SDEA 5HROA 3CCUS 1M1GA 1V5IB 3KJVB 4UOGA 5A6PA 3DOLA 2W8LA 4J5OA 3DU5A 2W9CA 2DGWA 4WUDA 4PZVA 1C1BA 3DRSB 3LWLA 3PYEA 3J7ZT 2HVHA 4KH0B 4PCQA 3CDBA 1TL3B 2M8HA 1S1TB 1XN9A 1S0MA 4DR5F 3GONA 4NASA 2BJ8A 5D0GA 4DL2A 3UVJB 4LSZB 3NXZA 3OL8A 2FJEB 2HURA 1JJCB 1UWAA 2RMLA 3J81Q 4RW9B 4MH8A 4B3RI 2IBKA 3IN5A 1UFKA 3PFOA 5ETKA 3OQ2A 5KT2A 1K1QA 3G82B 1V5VA 3I9ZA 4ELUA 4O4GA 5C0XF 2F63A 1NSAA 3GCWP 1I94F 4K4ZA 2HHUA 1VMBA 4X62F 1GXLA 3DRPB 5IV3A 2VFUA 3NGSA 5LSOA 3V81B 4LFCF 1NUEA 2ADCA 4UY8T 2KO1A 2JX2A 2FZGB 4RW6B 4HKQA 4LRFA 2DCUB 2UUBI 3ZTQA 2DNLA 4W90B 2JOQA 2VH7A 4NLGA 3ZFVA 1BWEA 3W63A 3CJ4A 3TJ8A 3GG1A 3AODA 4OX7A 5KFUA 3MR3A 2HVIA 4N3OA 2IVYA 3LAKA 4F3OA 3B82A 3KHRA 4MU4A 3RB3A 1HI8A 3ZZRA 1ZBTA 2UUWA 2D1CA 4JI3I 1AZSB 1VJWA 4RBVA 4OHVA 5ETPA 2BRKA 5C42B 3BKUA 4CLYA 4Y2IA 4DR1I 2ZH2A 3ZZTA 1RKJA 3AB2B 3QRRA 3GIIA 3MMBB 2VV5A 4DV6F 4IO1A 3SQGA 1UJ6A 2J9DA 4USMA 2NXEA 3Q2SC 1XBWA 2YNGB 3QLHB 4DV3E 3T5JA 5C25B 3HULA 1U02A 1LW0A 5C0XB 3EVMA 4HHHA 4DSIA 3QJLA 4I6WA 5LMNI 1M0SA 3NGKA 2UVRA 3L7ZB 1G1XA 4LF7E 4ATNA 5A8RB 2PIIA 2BM0A 2PNMA 4FP9A 3NS7B 2JLFA 4EYHB 2VQFJ 4JYAI 5HVFA 1BQNB 3VZHA 1NSKL 1CEZA 3M2VA 1UFLA 1D9AA 1U7LA 2RE1A 1TTHB 3PZPA 4ANEA 4DF4A 2YNFA 1KN6A 4JI5F 1K0VA 5HAOA 2C3PA 3TEGA 1HD0A 2GO3A 4CWBA 1MMNA 2FJXA 1BWVA 3CT9A 5ETLA 4Y34A 4DSJA 2Q3PA 1RWUA 1CVJA 2K1RA 4B3SI 1NPKA 4FW3A 4U7CA 4F4ZA 4NBQA 2C28A 1VQMS 2A6MA 3VGTA 4RX6A 1N33J 2W4DA 3M2UB 3BZQA 1HBOA 2FY1A 1HBUA 3BYPA 4JV5E 3W1YC 3ZTOA 2HHXA 2XY5A 2HBZB 1UAWA 1U09A 2EG1A 1VRTA 4DFJA 3CD0A 4HI2A 1VS3A 2Q6BA 3W5YA 3GG0A 2GVDA 3W62A 3CJTA 2KDOA 4FYXB 3ZNUA 2ZJRQ 2ASLA 1KNZA 2O3ZA 1RWMB 1HBNA 2E1CA 1N32J 4URGA 4C8MA 4PXEA 3QZ8A 4LBHA 1LNQA 2HQDA 2FZCB 1P1TA 4J9PA 3DLGA 4WKYA 3TVYA 5M2UA 4F2RA 5HQ8A 1SJQA 4EMDA 4QR1A 4C11A 4I7FA 2BA0G 1USUA 3UN5A 2GMHA 1N34J 4ILRA 4WK3A 1BLUA 2BXJA 3T41A 2Z4PA 4JI0E 2GV1A 4CCHA 4KGVB 4B3RF 3CF5Q 3NG8A 1FD2A 2WOMA 1JMTA 1NJWA 2R2RA 3KK2A 3VGVA 4ED0A 2CQCA 3HHLD 3CDAA 4N41A 4OZNA 1RBAA 4DU7A 2E7VA 4JOUA 1WF1A 3TA2A 2I38A 2ZHAA 4PPZA 4FWGA 4YB6A 3R7NB 1FNOA 2D3O1 3PRBA 3BBCA 1CS4B 1RLCL 2HPUA 4IH7A 2UXCE 3UCGA 1OYPA 2R8GA 3WX4A 2UUBF 5J2MB 1T3OA 1JLFA 3HSDA 3SCIE 4B9UA 3OL6A 1T05B 2DITA 4DV2I 2HNDB 1GMWD 3J80C 1YQHA 2LQ5A 4X65I 5B7WA 4AUKA 5HVGA 3LW5C 2V2QA 1RB0A 4K4UA 5L9XA 3G86A 1MLAA 2QFJA 2G13A 3PW5A 3H2VE 2DNKA 2V4QA 4OI3A 1RT2B 2UUAE 4DR1F 2I2YA 4QW9A 4M5LA 4DJBA 1RHUB 1Y60A 4NI2A 2DY1A 3D7SB 5C24B 2NN6F 4TQSA 3MPWA 3LGHA 1SPBP 1HYSB 4HHJA 2M0GB 2VFTA 3I0RB 4DDFA 2FUG9 2GW8A 3J81Y 4JI7J 3LP0B 5D3GB 2KI2A 2GHPA 2ZKTA 3MM5A 5EN1A 3G9CA 3BH7B 5LMNF 2KN4A 1VYAA 4KO0B 2WRMA 2NPIA 1U1LA 4AQYJ 1E6YB 4O3RA 4IQMA 3M9NB 5CD4A 4S0MA 1IJEB 1WSRA 4JYAF 1OQ3A 1URNA 1N5SA 4ELTA 4MK9A 4D3GA 5KFZA 2YWKA 1T9YA 3OXFA 1U0HA 4R25A 2LYVA 2YWEA 5M2RA 5JEAF 4PXBA 3WC0A 4MKBA 3VR1A 5KT6A 2R7VA 3FQKA 1FRJA 2LDYA 5F41A 1F5CA 4NXNI 1NRKA 2B9EA 2B5JB 1KFDA 4NLDA 1FD8A 3TZXA 4HACA 1ZM2A 2RHSB 1J5EI 1SCJB 2WBRA 3OL9A 2BKNA 1JLAB 3QWUA 1WI6A 4ES3A 2WONA 4DR6I 4J9RA 2UXBE 1U1MA 1S0VA 1S7IA 3MWBA 1IBKJ 4ZP6A 1Q53A 3MM9A 4DCPB 2WVEA 3SV4A 2KT2A 4IH6A 2C37B 1Q8IA 3OTOF 4CM2A 1Q95G 2ZDPA 3QWPA 3KG4A 4XDDA 2W2MP 2VBWA 2IC3B 2GIQA 4KYZA 1YRUA 1YBAA 3VQSA 4Y3CA 4ZN1A 1M5SA 2QX0A 1UFWA 1FF2A 1XTZA 4M5DB 1RT5A 2XNQA 1U47A 3NNHA 1S76D 2CPYA 3DOMB 3T1HI 1TL5A 3KK3B 2QA4S 1YVFA 3BBBA 1FVQA 4A8FA 2OI2A 5B0GA 2YNIA 4QNKA 2WB4A 4A8SA 3MR2A 4K59A 2B9WA 1BHNA 1JLCA 3OFHA 3W2WB 4CLLA 3DYAB 2W2NP 4F4XA 3JTPA 2E1PA 3H20A 3RBEA 4WFZA 3CJ8A 2WSFC 4KFBA 2RRNA 4FXWA 3AD7C 4BWMA 2HVDA 4EZ6A 5DQGA 4LF5J 3N5FA 4X64E 2MMYA 2G2ZA 1HR0J 1FFSB 1HNXI 3RAXA 4YY3I 3IP0A 4ICLA 1UVNA 2HWTA 3GSIA 2J7WA 4TYBA 1BUXA 3HLUA 3DLKA 1YJUA 3ILIA 1SL2A 1EHWA 3W9JA 2QFIA 2V4JB 4USKA 3MEEA 1VOMA 2I5JB 4F25A 4X65F 1DQ8A 1BGXT 4PG4A 2QMXA 3IO1A 1TK8A 1TFYA 1P9QC 3OJUA 1OS5A 5C2CA 1AFJA 1NKBA 3HCXA 4LCGA 2AJFE 3O8WA 3MDFA 1BMQB 1TR0A 1TP7A 2F4FA 4LFBI 1YRTA 2HWIA 1SXLA 2HVZA 1OYSA 1W2IA 3W66A 5EUHA 3GQCA 3NGTA 5DZ7A 3KJNB 3ZZPA 5F3TA 4PG7A 3BKTA 2HK3A 5ITHA 2R7RA 2M7SA 5KG7A 3D2WA 3L9ZA 4FYDA 4TY8A 3E01A 4OI4A 4JI4I 5F9LA 3I87A 2UZAA 3JSMB 3HSGA 1R3NA 2OPQB 3A1YG 2VBZA 2A0FB 4M1KA 3PYFA 4BC9A 3F73A 3DXBA 4OO1B 5F0WA 3N4WA 4NXNF 2JC0A 2A2DA 2Q43A 5I4MA 1KIJA 3V2UC 3TAQA 2JFKA 4FZVA 4ZLPA 3MEDB 2FVSA 4WP8A 2FJWA 1PYTA 5I42A 1J5EF 1H98A 4EYIB 2IIHA 4B3MJ 2GX8A 4DR6F 4F26A 1RHYA 2VHGA 3JTNA 4I2QB 2HNYA 5L9NA 2EFQA 3C16B 1HHSA 2B4UA 4IO9Q 4P2XA 3FEXB 4LF4J 1X0FA 1GNKA 2QSFA 1YJTA 4OYPA 2FHMA 1HFEL 1QSYA 2R7SA 4UY85 4Y0FA 3ETOA 2RVJA 3CE8A 4IRDA 1RK8A 2KT5A 1XXEA 4LVNP 3TX0A 2XYGB 4DV1E 1GX6A 4RW9A 2J6SA 1S9GB 4ZJOA 4OZ1A 4N8NA 2C2NA 2CVIA 1ZM9A 3G82A 3T1HF 4BCAA 4RUBA 1UPPA 4NXMI 2CNOB 2BJ9A 5EWFA 4NYPA 1HQEB 5B0BA 1MNEA 4MQYA 4I4BA 2ZD1A 2W7OA 4IFDF 2U1AA 2ZVSA 5D4NA 3K85A 2IDLA 3CCTA 3P4UB 4AM3A 2ZOGA 3DMJA 2CQDA 3EGWB 1N52B 4FKYA 1QVFR 4J91A 2C2DA 3V81A 2VKZG 4X2BA 3H40A 4GKKI 1GT8A 1LW2A 4RW6A 3TZZA 2Z0GA 4JI8E 4WZQA 3Q2TC 1SQFA 5CYQB 3QAEA 2OFHX 2OP5A 4Q5VA 3MUMP 2OGUA 2W7AA 5B0FA 1I1GA 4RR5A 2BE9B 1N88A 2Z2LA 5E0OA 1CJTB 1S1XA 5KOWA 2EFNA 3JQKA 4EK2A 2KM8C 4O3QA 3IWLA 2W4CA 3JAMC 2YXLA 1WKJA 5C42A 1PVGA 5JJBA 2ASJA 4O23A 3VV2B 3CJ5A 4UOCA 4Q2MA 3EJMA 2BQ3A 3DOKA 5HI7A 1OYRA 4OKGA 1VQSA 1CJVA 1HA1A 3HSJA 2ZBIA 3NKYA 1JLGB 3MPYA 4DR3E 1FFWB 1Y4SA 2YNGA 2NXUA 2ADBA 3N01A 3TNVA 4LFBF 1PCAA 5C25A 2V63A 4WFNQ 3W2VB 5C0XA 1WC5A 2BJ7A 3K0JA 4PUOA 3J80U 1TELA 4C9DA 4P9SA 3L7ZA 5A8RA 2J8SA 3KYLA 4QYZK 2YWHA 1RWKB 5IWAI 5DROA 1BQNA 1FJGI 3U1KA 1VQOS 3EPGA 2V0NA 2IAJB 2QTWA 2OD4A 2VONA 4JI4F 1L3VA 1DLOA 1PYOB 3GIKA 2KZMA 4ZVUB 3HVTA 2MKIA 2XEXA 3V6DA 1S97A 1NDPA 2J0QD 3T1YI 1UVJA 4IZJA 4AL7A 1BC6A 3CGIA 4P52A 3WX8A 4JI2E 4G1QA 4P10A 2E5JA 4DV3F 4DFPA 2J9DE 3LUYA 3PJWA 1N5YA 4ZPBA 4DHVA 3J81U 3GFHA 5SUHA 2V69A 3X1LB 4PG6A 5HMYA 5KFQA 4C8KA 1SJ1A 2NN6C 1KFSA 1U0SA 1YH8A 4OQJA 1FWLA 3LGMA 3MEGA 3LAMA 3PYDA 2Z8QA 8RUCA 1ZPWX 3DN9A 3TR5A 3BO3A 3ENQA 1SKSA 2CUYA 2XSJA 2CADA 5CCMA 2F4VI 2HGNA 3KDOA 3R27A 4USUA 3V5RA 3J7AM 4QCLA 3UWTA 3KHGA 3ADAC 3HHKA 2X3GA 3PIPQ 3O2IA 5JEAC 3DLHA 4B3OB 4H4OB 1XNRF 2X36A 3WHIA 3ZTRA 3BSNA 4LQ9A 4LFAJ 3CO0P 2XMTA 4CO1A 4LBPA 4MU0A 4I69A 4CTAB 3KXDA 5DGAA 2F5GA 2H51B 1NK8A 3RB0A 1DHMA 2ZBCA 4DSLA 2L9DA 1L3TA 1NCLA 3GILA 2VFRA 4GKKF 3AQOA 1WEZA 2C39A 2RIJA 1XEZA 1NM2A 1MROA 5ETMA 4X4UA 3TVZA 2DNHA 1KS2A 2MTLA 2O01C 1IQTA 3LWMA 4DR2I 3EXYA 1VQNS 5GAGU 3TO8A 1S5ZA 3EXCX 1NKCA 2XB2D 5K5MA 1R89A 1N36J 4NZ7A 5L1IA 1TKDA 3J7A1 5HMXA 1A0OB 2GHWA 3D0GE 4NRUA 4DX6A 4B02A 3BO2A 3ZTSA 4NCGA 3Q8RB 1K0TA 1I5OB 2L41A 2ZBQA 5GMEA 5ETNA 2PC6A 1RT2A 4DLGA 2X3DA 3UE2A 2ILZA 4ETXA 3EWGA 1RBOB 3R6GB 4KHPI 2AQ4A 3I5AA 4K4VA 4TLQA 5C24A 1TMJA 1U26A 1TV6A 2KT3A 1U2RA 5LT5A 1X4CA 1NHUA 2GVZA 3I0RA 3F56A 3ZTPA 4LF9E 4TKTA 5HP1B 5M2PA 3LP0A 1WF0A 2O1VA 1QAIA 1R6VA 4KY3A 5KFPA 1V9OA 4MK8A 4ITSA 3BR9A 4KO0A 3MCOA 4HVZA 1HNZF 4K0KI 4HH1A 3V6HA 1E6YA 1Y9OA 4ZLLA 1Z0TA 5F8NA 3K5NA 2AE8A 3DXSX 3TRGA 5IWAF 2GO4A 5FDLB 5J1EB 1FJGF 2IRUA 1EZZB 7AT1B 4DZDA 2ZFHA 2CPXA 5K36D 5KFHA 1RADB 2P6SA 4MMOA 5KFVA 1RT7B 1FKAF 2HFNA 2DH7A 3T1YF 1FTCA 2B5JA 4TU8A 3H98A 4EGLA 2YKAA 3MECB 2YPZA 2C1EB 2YNHA 5IT9C 4LREA 2DH9A 1N6QA 4I67A 1SQEA 1JLAA 1LWFA 2RAQA 5BYQA 3HX9A 3KKFA 2FTRA 4FN5A 3M6WA 2ZM6J 3DDNA 3ILJA 4L3NA 3IRWP 2NN6A 4Q8FA 5BR8I 1IBMJ 4OX9J 1S48A 2F8HA 2Q79A 2UU9J 5DZ6A 5RUBA 3CIZA 1PBAA 3IR7B 2XBPA 3DHXA 1RYSA 1R0AB 2V8VA 4URLA 1TZ0A 4BS2A 1RE1B 2IC3A 1GFWB 2L3MA 4HH0A 1IKVB 3MPDA 2J0SD 4AFFA 1CJKB 2EXUA 1HI0P 2APOA 1RTDB 2F4VF 3TX8A 4QW8A 4DV4J 3FBCA 2GNKA 3MPUB 4M5DA 1OMSA 4OMFG 4K4YA 4L6V3 3DOMA 4FF3A 2UVWA 4DUZJ 3KK3A 2IFXA 3MTKA 1P1LA 3IA0A 2M3DA 2O67A 2R7WA 1KDNA 2QG9B 2BX6A 2Z2YB 1HWUA 2D69A 1K9MT 5JEAA 2E1RA 3AJDA 3K5LA 3KLGB 3V4MA 3DYAA 3S6EA 4M8LA 4NLVA 2SXLA 4F0MA 2VL1A 1S99A 4NLOA 1EQMA 5G0RA 5A2QC 3OD2A 3PW0A 3PW2A 3VAGA 3A8IA 3NMRA 4CLTA 2QE5A 2VC1A 3Q22A 1RHJB 3FEYB 4P72A 2F3JA 2NUUG 2AYGA 2PO4A 1ZAXA 2I1RA 5B09A 1X5SA 3M32A 4DR2F 2RQMA 4DR7J 3L4BC 4GVLA 2V4JA 2HAFA 2I5JA 2W4PA 2VQFI 1TKTB 2PDAA 1E3PA 1MU5A 1GAOA 1PSDA 3HHLC 2OPRB 1FRMA 3PCOB 3I4HX 2K3KA 4IG3B 4DV7J 3MGJA 2IY5B 2J65A 5I3QA 4F4YA 1LK7A 1F3VA 2AIRB 4MKYA 3M2RB 4FF1A 1BQMA 1RWVB 2NSBA 1HIYA 3J7YI 2RS2A 3IAS9 2GQCA 4OHXA 1KSPA 4CYUB 2B56A 4IFYB 3E3XA 1VFJA 2XCAA 2VJVA 5F8LA 4IFDC 1LWEB 4ISAA 1F60B 1AUDA 1N33I 1IKYB 2DYAA 2UUCI 1CULA 1RWPB 1IBLE 4KGMA 5L38A 2ALYB 1SKWA 2B4VA 3LALA 3TAPA 1T9WA 3Q24A 1WJ9A 4I0WA 1RAIB 1B99A 3I31A 2PA3A 3H5XA 4ELVA 2XULA 3GR0A 5HO4A 4JI1I 3P3EA 4JI3J 4OX6A 3QQCD 2JEIA 3NGDA 5KFFA 3K17A 2LEBA 4BA1A 3HM9A 5A8WB 4NRTA 4ZHRB 5ETSA 4ECVA 3GYXB 2HIQA 2IMOA 2KXNB 3KHHA 1GMUA 2FLNA 1EX8A 5HL7Q 1RAGB 4C97A 3IWXA 1FX2A 3CJ0A 1QE1B 1N34I 3PRYA 2IDEA 3AJ1A 3V6KA 2N7YA 3MEDA 5F3ZA 4A48A 2MKHA 2GGPA 1X5PA 5ETRA 3QMQA 1U25A 1XR7A 2CGEA 4AIDA 2E5LE 2DO0A 2ZJQQ 2AGPA 3D0IE 2H5JB 5DRKA 4K2XA 1ZETA 2LQ8A 3MD3A 3U1MA 3H90A 3KTQA 2DHXA 2E9TA 4FW4A 5KG2A 2JC1A 4D3HA 1C0UA 1S9EA 2B9XA 3N6NA 1KKHA 3KUGA 1UTAA 5LSLA 1UA1A 3E8OA 2X1BA 4QWDA 3OHBA 4ZVFA 4RW4B 1YHQS 4B3SJ 3MR7A 2BKPA 2VG6B 5B0AA 5LXYA 1R31A 4ILMA 3M1VB 1WOPA 4JI6J 3FFIA 1FKOB 1WC4A 4ZLJA 4C3KA 1NDLA 2F40A 3CUNA 1OYEA 3VF0B 2PI5A 4LOMA 1R6YA 4YFUA 1YSJA 1UP1A 4GKJJ 5DJBA 4OYMA 4YR2A 1UDOA 3SCJE 2Z5CB 4QU6A 1C2PA 2M2BA 4U3DA 4A8WA 2VDHA 1HNVB 1BQXA 4OI6A 5FLXC 2AZ1A 3WQPA 2MDAA 3QNWB 3IGNA 4DI6A 5J2QB 1KRPA 3MUVP 4JI7I 1F6TA 3R6LB 2DT9A 2RQKA 4DV5E 4NZ0A 1UDQA 2R2UA 3MM8A 2FVPA 2D74B 5CYQA 4L73A 3GWCA 1RU2A 4NCAA 3GB0A 2XCPA 4TYAA 4DSFA 4AQYI 4GC7A 4UTGA 4ZDNA 1GTEA 1PIEA 2VQFF 2O1UA 2CQ3A 2FQQB 3D54A 5D78A 2JSXA 2GJFA 3HHLA 1FDDA 4NA3A 3CCJS 2BYCA 4N47A 1RDRA 1QTMA 1VRUB 3M9MB 5F0UA 4RWXA 4XTJA 3J7AG 1IJFB 2R7QA 4H4KA 1JLGA 3BF4A 5HANA 1FDBA 2CWKA 2AD9A 4LPFA 1TUGB 1HNWE 1N33F 4WKRA 4DV2J 4IFDA 1DTQA 1VR6A 5K36F 5BYRA 4QPTA 2C2EA 1IBKI 2JEAB 3N79A 5L1KA 3MD1A 4NLTA 4ZP8A 3W60A 5H9FK 2HHPA 4FW5A 1OY8A 2DBBA 2WVDA 1MWYA 2NUHA 2IAJA 2UXDI 3IBFB 4C8ZA 4ZK7M 2OPPB 1TAUA 3CCZA 2ZH7A 2M8DB 3OW2R 3MPVA 3ZO7A 1NJZA 3QRQA 1QAJA 1WG4A 1N32F 1YDLA 4DR5E 2AYMA 1M5PC 1Y11A 3MTJA 1RT4A 3BDEA 1WWHA 2CDQA 2NYIA 1LWXA 2KFZA 1XMOJ 5GAHI 1N34F 2M5YA 4EBEA 2XGPA 1YJRA 1PC5A 1RZMA 3A8KA 2P9CA 3KLIB 5C0XE 3PRDA 2YKMA 1F3FA 3OVSA 3HSZA 2OMOA 2CPJA 3PX6A 1VC6A 1B7FA 3TUJC 1X4BA 3AT1B 2G1HA 5H9EJ 1H3DA 2EEYA 4X62E 2XQCA 4F04B 4Z2XA 4PXCA 4LFCE 2AV5A 2DRAA 2DR8A 3AOAA 2V4RA 5LL6d 1HR0I 3PO5A 1X4HA 5AT1B 3M7ND 1DQ9A 1PILA 2WSEC 2LECA 5JVHQ 2VFSA 1S59A 2K7KA 2YWWA 4QIEA 4CO4A 4ED6A 1D3WA 2HHWA 2PGCA 1ROFA 3OVBA 1MN9A 2ZBRA 3KMSA 4RU9A 4RUAA 2AF6A 4I56A 4HTJA 1Z0BA 3H1CA 3PR4A 4IFVA 1Q1KA 1QLNA 4ZPVR 4MAKA 1BD6A 4P71A 1NHHA 2FHJA 4XK8C 1T0TV 4CTAA 3B4MA 3ZZZA 4J9MA 2JEFA 5IT9Q 4DV6E 3AQPA 3UNYA 1TVRB 1HNIA 2G2YA 5E3PA 3T5HA 2G0CA 1F9FA 1NJXA 4J37A 4IKAA 4F4KA 1YG0A 1EP4B 3US5A 4HDHA 4BA2A 4JI7F 3ZKBA 2LQ9A 5CD4H 2IJNA 3LO3A 4RNOA 4QU7A 1WACA 4CLPA 4KV8A 4RUHA 2B6AB 3B4TA 2VOOA 3H59A 2B4PA 2MKSA 4AQYF 2H1YA 3CJQA 2HMIA 1U48A 4GO7X 4LMZA 2HFZA 2R7UA 3UNGC 3LP2B 4J9KA 3FKBA 1T9UA 4JI5E 2B7CB 3BBFA 3R5CA 1HD1A 5A2QU 3QAUA 3DRXA 2ZITA 4FXVA 2IM3A 1P42A 2QEXS 2JZ5A 4QQBA 4ED4A 1HNXJ 4YY3J 4CLZA 4NOHA 2OPSB 2XWXA 3C66A 7FD1A 2LKZA 5HP1A 1WDTA 3HF5A 4K4SA 3MOZA 2HFOA 2DK2A 4JG4A 4B3MI 3OTCA 3Q8VA 4OV1A 3IXQA 3ZNJ1 2CAJA 1NHIA 3G8QA 1T9TA 2GMJA 1IBKF 3NNCA 2KHDA 2V2KA 3RGIA 4KGZB 2FHOB 2B8QA 2QRRA 1J5OB 1QD1A 1WI8A 3GR1A 2CA9A 4LF4I 5JMNA 3EM1A 1V3RA 4B9LA 1W26A 1UDNA 2ERRA 4WTOB 3CJRA 3D28A 4O0IA 4X66J 1RT7A 3SSQA 4EZ9A 2HHSA 2PO0B 2R8KA 2QA4G 2HHVA 4IOAQ 3HKWA 3MECA 1WSVA 1T02A 1WUUA 3VZIA 2GJIA 3PEJA 1NHVA 4XO0A 4B3RE 2MZTA 3H5UA 1ACMB 1NK0A 2Z56B 5KFWA 1GXTA 3C6TB 3SCLE 2YQ1A 2GC8A 1NPPA 2GAHC 4USWA 1JNRB 1B70B 3LANA 3K1JA 1WKKA 3BQ0A 5FWKA 1NB7A 4DXLA 3G87A 4HDGA 4DPXA 4LF5F 2CQPA 5HK4A 3DRYA 1RTHA 1HR0F 1IKVA 4IR1A 4RKUC 5LXRA 2MB0B 2UUBE 1CJKA 4YQWA 3TWZA 2UXBI 2LU1A 1SKRA 5U47A 1Z4UA 3UO0A 4G1IA 1AXQA 2OEKA 4F4AA 1ZS6A 2O1TA 1H72C 3CDJA 3PS1A 1U45A 4C3LA 2R3VA 3H0PA 4USJC 1IXKA 4C3MA 4JI3E 1IKXA 2HEKA 2DHHA 3KHLA 5G4DA 1B63A 3AFGA 1Y00A 2PN6A 2J7UA 4B9SA 4M95A 4DR1E 1S7HA 2VG7A 2C38B 2J7KA 5L46A 4MIAA 2NN6E 4G3IA 2MZRA 4AL6A 1D9DA 2V8DA 3ZM7A 4TVAB 1JNZB 1WHVA 5HQLA 3MEKA 5C0XD 4WYWA 2VG5B 3PW4A 3BV8A 3QIDA 3O44A 3E51A 4DSEA 5DRQA 4ZKAA 1HWKA 1WHWA 5LMNE 2B7BB 4CQ1A 3NCPA 3KRNA 4NXMJ 4RNFA 4LF6J 5T7LB 1Y4UA 2R2SA 4JYAE 3DC2A 2OPRA 3ILLA 3DM2A 3TA1A 3I82A 5JEAE 1SH3A 3ENWA 4KAIA 1QSSA 5F8IA 3M2RA 4DFKA 4IRKA 1SUQB 4PAAA 2PEHA 2Z5EA 3GTYX 4M5KA 2XZTB 4QJVA 3GV8B 5HATA 3NGUA 2XY7A 4CYUA 2IRXA 2PSZA 4ECRA 3MHYA 1LWEA 4OYIA 3TQEA 2LXFA 4DS5A 1ZH5A 4FYWB 5L8RC 1B4SA 3NWRA 1UEUA 5IQQA 3C8YA 1H7SA 5A8KB 1B0VA 4B3MF 3H5YA 2EBGA 1S10A 2BOAA 3AOCA 1MWQA 2MLZA 4DOZA 2K3IA 1G6BA 3GLJA 2A2CA 4C8YA 3CJKA 4ZHRA 3LP1A 2OO4A 4QIWD 4LF4F 4Q8EA 4QYRA 2MXYA 2QIFA 4GVBB 1FCAA 2BKOA 2AYBA 1F5AA 2PEBA 2ZUAA 4LRAA 1ELOA 4OHYA 2FVQA 1FNMA 1KP6A 1NH8A 2R7OA 1UA0A 3QFHA 3AJ2A 1QE1A 1RI7A 1UCNA 4Q0BB 5KFBA 3TEHB 5B0DA 2UVVA 3M6AA 1DAXA 4P2MA 1L3UA 2IM2A 2WCXA 5KFOA 2VC0A 4LFAI 2KVIA 3OVAA 4EI2A 1VHFA 2AHOB 3DRRA 1NEEA 1Z2ZA 1RXOB 1RT6B 3ZZYA 2KJVA 2KRBA 5K36C 2CJKA 3B4DA 1HQ2A 2FYXA 3M8QB 4HT5A 1KQGB 1Q8LA 1HPZB 1FA0A 4CLSA 1FKOA 4CNYA 4NL5A 3PS3A 4HL9A 5BXIA 4K4WA 1N36I 3BQ1A 2EFOA 3UN2A 4ECUA 4X65E 2PMHA 1QJHA 4JV0A 1U1RA 1U2CA 4IDKB 4IZKB 2BJEA 3MURP 3U7JA 4I6YA 5DO2A 4R8UA 5ADZA 3H4DA 2XI3A 2JL9A 5DQIA 4OYXA 1H6KX 4TU9A 1IBCB 1ZPVA 2CJ9A 2DXDA 5K14B 5IXUA 2YPYA 4Y6IA 4P7AA 2KXHA 4DUTA 2ZE2A 2A6OA 1SQGA 5J2QA 2DIVA 5KFGA 3PS2A 5T14A 3UFCX 5K8PA 1KHWA 5MLCV 4DCJB 2CXEA 4UZCA 4BBYA 3PR5B 1YBUA 1Y5LB 1GQEA 4WIIA 2G2OA 4IR9A 3RUBL 4WFYA 5E3AA 5E3CA 4LR7A 3A12A 3PHEA 3ET6B 4CO5A 5DNXA 1UVIA 4UUXA 1S1UB 1WG5A 3WC2A 3GLLA 4YMEA 4IS9A 3LQVA 2OJ3A 3TUZC 2Y0BB 3ETMA 1LWCB 5LOQA 1JJ4A 2J9CA 4ZIVA 2J6TA 5H1SV 2EPIA 1VRUA 4RL1A 1Z5CA 2B9YA 3HKMA 4OLPA 1XC9A 4DX5A 5E33A 2NZCA 2EBEA 1PJ7A 4DCOB 2HHHJ 3CWJA 4NXNE 1RA7A 2RRBA 5JVGQ 5HJYA 2B8PA 3RB4A 2HLUA 3IM9A 4L75A 4LVOP 4FF2A 1J5EE 5KT5A 3PW7A 5HBMA 3PEHA 3QIPA 2MQNA 2ZOFA 2XG8A 1SJ3P 4WZMA 4DR6E 1T3NA 2BRLA 3EUNA 2NN6D 4QPXA 2ZH5A 2GO8A 2ZM6I 3SYZA 2HS0A 1ZZNA 1IBMI 4OX9I 2OLWA 1RGVA 3HZEA 1YTYA 3D3BJ 4MU1A 1LFPA 4DL5A 2BW2A 2IM1A 2OSQA 4KE5A 4MIWA 1Y5YA 2ROGA 4F3MA 3DLEB 4LF1A 4KHPJ 4LF2A 2E7WA 3OR1A 1N0UA 4LF8J 1QAXA 2OKQA 1NHKL 4RPFA 5KFMA 4OYBA 2CPDA 4Y2CA 4DV4I 3TANA 4YR3A 5F8HA 5BJRA 1XNQJ 5CYMB 1FE4A 4R1FA 4ZVPB 3CDEA 1D0EA 5DRPA 2RS8A 2IBOA 3I5CA 5CYJA 3B78A 3TP2A 3T1HE 4NLWA 1WEXA 2FC8A 3KLIA 1GEHA 4DR4J 4K0KJ 4MTPA 3TZYA 4C48A 4IFDE 3QT5A 4U3BA 4R5PB 4LFAF 3R9LA 4B9TA 3IC1A 2BANB 2CPEA 3FQLA 4QR2A 3KUHA 1CSJA 2HFSA 2JE6B 4DPWA 3CTRA 1TU0B 5F8GA 3CCSS 1DQAA 2R7TA 2ZEJA 5K36A 1XMQI 1SJFA 4OV6A 1S0OA 1NB2A 2AGOA 1M5HA 1DTTB 3LGNA 4OZJA 4M94A 5AXMA 1RHQB 1R43A 1VCTA 3KLEB 4DR7I 1RHMB 1YJWS 1U6FA 1U8WA 1NK4A 3DCAA 4G6VB 2WZ1A 1N36F 1RAAB 4G1PA 4LSNA 3JSBA 3EGVA 4WFBQ 4V19X 1Q8KA 4NLXA 2FPHX 4DV7I 5BR8J 3K7RA 5AXLA 4QWCA 2XYHB 4FBTA 4IQXA 1LQ9A 4IUFA 4CLFA 1VDHA 5J2NB 4FW7A 1S6QB 1N5TA 3G6ES 4ECXA 4K2JA 4LFBE 5GMDA 1KLNA 2Y8YA 1EP4A 2VBXA 1WG1A 4J7CA 2HRUA 2JEBB 4Y28C 3M8PB 1AW0A 3K89A 1RHRB 3BB5A 4MKAA 2B6AA 1F1BB 2XLIA 2QJ3A 3AAWB 1M1KT 3FRZA 3FEZA 2NLWA 4M5MA 2FJDB 3WU4A 1KLMA 1YI2S 2NCKL 2OAUA 3LP2A 4JI4E 1MU2A 1SV5A 1PJ6A 2CPFA 2N4CA 3K5MA 4ZPDA 1RLDA 1AUSL 4GC6A 4RBUA 4P73A 1FRIA 3GIMA 2DGOA 3M8SA 2KFNA 1C4AA 3RBXA 4QZVB 3HD2A 3C15B 1W7WA 2OPSA 3RJMB 4YHHI 2DNRA 1RT1A 2ZHOA 2C42A 4IYQA 2FGCA 1RABB 2R8IA 5DM6Q 4WCEQ 1G4CA 2GAGC 1ZM4A 3QBCA 4B3TI 2CQHA 2HQGA 4NWBA 2NYHA 3NEKA 4WFAQ 2AX1A 3H4BA 2CDRB 3HKZD 4P2SA 2PNZB 3V4IA 4OJGA 2H4YB 5IZHA 3RTVA 1J5OA 1IBMF 4OX9F 2IM0A 2WSCC 3N9UC 2UU9F 3I6PA 1F2GA 4OYOA 4L76A 1TKZA 2DXEA 4TU7A 1PG5B 1SC4B 1TMMA 2C3YA 4NLYA 4OJ1A 4MFBB 1OY6A 2XS7A 3NL0A 3BN7A 2JJ4D 1JLBB 3GYGA 2QLWA 4URSA 1S1WA 2HRTA 3SDEB 5HROB 2AJ1A 3T9ZA 4JI6I 2DGSA 5LSRA 2UUCJ 2YKNB 4C6AA 1FERA 2HNZB 3DOLB 1XNRE 3QT7A 3OUYA 1U2FA 4DUZF 1TK5A 2HIYA 3ZXWA 1H7WA 4CO2A 3LPSA 3C6TA 4CLWA 4KC5A 4GKJI 1RAEB 4JI1J 3NS6A 5AJ3J 5F9NA 4X4PA 4NPOA 2LLZA 2QLFB 4B9MA 3Q8SB 3JB9k 3KDNA 2KXFA 2JEJA 2V9KA 3DNCA 4DLEA 2W01A 1ZXNA 4YDXA 1T03B 4KIAA 2HVEA 4O44A 3BPDA 2MLXA 4LSLB 3WIVA 2RU3A 2BACA 4GKKE 4WU3A 2A3JA 1S77D 3BSOA 3TA0A 2ZBPA 3EDQB 4PWDA 2ROEA 2XGQA 1M5OC 1UVLA 3CJSA 1ULRA 3ICLA 4PG8A 4B9VA 3TAMA 2DISA 3T5KA 4DR7F 3N28A 1VHIA 5GAEI 5KFLA 4DV0J 1JKHB 3J7YU 3LPEA 2Y1LB 2VU5A 4DUYJ 4DV7F 1R8PA 1UPMB 1F9HA 2Z57B 3G96A 4XDCA 1T95A 4N5SA 2VQEJ 1R6MA 5ETVA 3W61A 2W9AA 1GK8A 3AXKA 3UD4P 2FD2A 3G71S 3EGZA 4IFDD 1VQ5S 4C0HA 2E5HA 3AXMA 2C2OB 1P9YA 5KG1A 1HWLA 2YY3A 3IBCB 2FIUA 4ED7A 3BEGB 1HMVB 4ZCIA 3MCSA 1HNZE 1MWZA 1RCOB 1FESA 3KJQB 2CG4A 3HJFA 3G6VA 1YWXA 2VA3A 4AXJA 2V68A 5T7LA 4OX8A 5IWAE 3I55S 5HMWA 5EX0A 1FK9B 1X9MA 2VD3A 3SQGB 1FJGE 2Z2ZA 4JI3F 1RA6A 3DKDA 1IKWB 4C8LA 2NXJA 2XMAA 3GZ7A 2WP8A 2XMMA 1PKUA 4AYBD 1LW0B 5AE1A 4CO3A 1FKAE 3Q6NA 3KK1B 3T1YE 4KQZA 2VASA 5CABA 3GV7B 4CDIA 2AZ3A 3QGGA 1FFGB 2IERA 2XM3A 2OHDA 2XTJP 4YP3A 2K7JA 3OT9A 1XMOI 2C22A 3EVOA 2H54B 3A3PB 4KPCA 4AL5A 1LFWA 3M2VB 1VQ7S 5EWGA 1JX4A 1QUVA 3J81C 2PD1A 3TYTA 1Y7PA 3RAMA 4AE5A 5GADI 1XHKA 2QYCA 3H2LA 2LA4A 1U1QA 3M8RA 3L7UA 1TL7A 4ID5B 5H9EK 4YB1P 2XY6A 3HJVA 3UCUP 4GVBA 3T1AA 4JB8B 1HBOB 1HBUB 1NDKA 2HQFA 2F4VE 3HVAA 5KFRA 4B3SF 2EK1A 2ALZA 3GFZA 3EGNA 3HJCA 3I96A 1JJ2R 1CC8A 4JI6F 1FWKA 2VODA 1RU1A 3PVXA 2XWYA 3H7HB 2RDJA 4ZP7A 2FHJD 5CXTA 3UR0A 2D3OR 1WTFA 1HBNB 4G65A 3M6UA 4ZPCA 4QIGA 2KG1A 2UXDJ 4GKJF 1QVGR 3VVUA 1NHJA 4DV3J 2Q66A 2XMJA 3G6YA 1VQ4S 1RWNB 4WP9A 4YB7A 2QL9B 3W65A 4OZ5A 1ZXMA 3Q8PB 3R2CJ 4LF7J 2B51A 2E5LI 4IH5A 2N82B 4F8RA 4CM0A 1RJJA 4F67A 1RAOA 3IRXB 2WOMB 1WDDA 4DR2E 2VB6A 3KK2B 2GQ0A 1T9VA 3VHQA 1Y0HA 3J81j 1Y6ZA 4FDFA 4Z7CA 2CQ4A 3IS9B 1TQLA 2HKEA 4IDKA 5D6GA 1SL1A 4IZKA 1WC1A 4A47A 2R4FA 4PWWA 4FF4A 2J6UA 3ZC4A 1R8CA 2Y1RI 4OYZA 4F36A 3NBPB 2LEAA 5K14A 1N0VC 3H25A 5LMUI 3W9IA 4JV5J 1M90T 4IOBA 3O5TB 1Z0VA 5D77A 1UWBA 1VC5A 2FHKA 5KFTA 3C6UB 5DG7A 3H8YA 3K59A 4DV2F 4OO1F 3L09A 1WC0A 2G1DA 3L3CA 4RU2A 4K0KE 1FI4A 1WF2A 3ET6A 4W98A 3NOGA 2YX7A 2QO3A 1S1UA 3FRYA 4HYKA 3DGPB 2DR7A 1AA1B 4NI2B 3FJ2A 3JS9A 3KLVA 2DPIA 1SKUB 3P06A 1Y5NB 4WIQA 5E2QA 5GAHU 1ZOTA 3NRBA 2DPJA 1T9XA 4YN3B 3NAHA 2Z5BA 4X66I 3MMAB 3MM5B 3EZ5A 5HJXA 1OIAA 2A18A 4JI0J 5C0XC 1GTHA 1H2TZ 1Y10A 1XMBA 2NR0A 3S01A 2PFFB 3PV8A 4ECWA 5I3UA 5LJ3Y 1XMOF 3OFGA 1HHTP 4WPAA 5EDWA 4M5IA 4Q43A 3FDSA 4OL8A 3PY8A 2E1MC 1KVIA 3BYRA 1EETA 2V9WA 1U0HB 1YBTA 2I6WA 2IRYA 1RAHB 3QJJA 3CCRS 2GCFA 8ATCB 5BR8E 3H4LA 2JLEA 3MR6A 3KNAA 5KT7A 2UXCJ 1W2BR 1DARA 2PT0A 2YH0A 1B0PA 1QTNB 1C1CA 2DNMA 2YVSA 4P2FA 1Q78A 4NLQA 1KOHA 4ZVRB 3B54A 1LKZA 3U02A 2GIFA 5DDPC 3S1TA 1BE4A 4QYZJ 3Q1QA 4Q45A 4N56A 5CYMA 4WTYA 4QWBA 4H4MB 2RD5C 1VK3A 3CC2S 2UP1A 3EDRB 2C2MB 3GMGA 2DNZA 5ELWA 3MM9B 3CULA 2IOPA 4BHQA 3GYNA 1FE0A 3A13A 1Z0EA 4PR6A 3MF5A 2UUAJ 5CZXA 4N7TA 4C8NA 3KJVA 2RH3A 4R5PA 3THTA 2ZVIA 2RRAA 4ANCA 2BANA 1XJWB 1Z1ZA 4DS4A 5AXNA 3DRSA 2Z58B 4HI1A 1TUVA 2H5EA 4FW6A 4W4MA 3D6MB 3QT8A 3UDVA 5GMKa 4FWDA 1TL3A 1U6BA 1QM9A 1S1TA 1WOOA 4ZVTB 2WW4A 3L95X 2RSQA 2JVOA 1DRZA 3L7PA 2CJYB 2G4BA 1YLXA 3UVJA 1DTTA 4NMXA 2YNIB 2MZSA 3P8BB 1EAYC 3BREA 2OD6A 1JLCB 2XMKA 1I94I 3HFKA 1VRQC 1VQKS 4OZLA 4LF6I 4KFBB 3AB4B 5ETOA 2VQFE 1Q82T 1QY7A 2W25A 1B7YB 4ZP9A 3BPSP 1REGX 2DEIA 4ICLB 3P3DA 2DHAA 4ED3A 3DRPA 2EFPA 3OJSA 1H7XA 2OMLA 3D1QA 3BSCA 2R42A 2R8JA 3I0SB 4X4RA 4J9UE 3KFWX 1HNXF 4YY3F 2UXBJ 4MIBA 3NOCA 3WU3A 4RNHA 4ANDA 3VTIA 1N33E 1BXNA 5K36E 3OTEA 4AT1B 2UUCE 2J8AA 3WU6A 2CZVC 1P6TA 3SCKE 3CVKA 1EB0A 3AH6A 1M1HA 4DV6I 3D5MA 2CG9A 1AZSA 4WE1B 1RAFB 2N7CA 1WEYA 1MMLA 4IOCQ 3GCXP 5BYSA 2FJVA 2JLGA 4KT0C 3MMBA 3W8PA 3FGVA 5E3QA 1N32E 4HY1A 5DM7Q 4P74A 2P8IA 1A6FA 4DX8H 2QL7B 4ED2A 3GU0A 3UR3C 1TK0A 4X66F 1FXLA 3QLHA 4K8RA 3C15A 3EVWA 1NO8A 2DHGA 3NCQA 1KQKA 1N34E 2L9NA 3CJ3A 4Y00A 2MJNA 4TY8B 3E01B 4FXDA 4USHA 3S7RA 2LDIA 3RRHA 1SIZA 2I0XA 3M85D 3BKFA 2PNZA 5B08A 2IPOB 1TL1B 3P5BP 3CC7S 1VIOA 4X64J 3SIPB 2GMLA 2GO9A 2QGFB 5IM0B 4HT7A 4C4WA 2AGQA 2AEMA 1FT8A 2V34A 4MU3A 3J80Q 2MQ8A 2NS1B 1PAUB 3NLCA 2YBVA 2MKJA 4MFBA 3DDKA 3TVKA 4ED1A 5I42B 3UHMA 3N0VA 3U1LA 4DPYA 3M2UA 1YJ9S 4WK1A 4OI1A 2YKNA 2UUTA 4TLRA 2HNYB 2HNZA 2ACMA 2LXUA 2DJWA 2H9ZA 4X4NA 3GMEA 1OSCA 3FSIA 4ZVOB 3QJPA 4U8VA 4M5JA 4RW7B 2P9GA 4WP3A 5DETA 3K5OA 2IOQA 5D15A 4FS2A 3BGRB 3M7VA 4WF9Q 2Y9HA 1FXRA 3JSRA 2FVCA 2X51A 1YK9A 3D6TB 5DG9A 1T03A 2QL5B 2W24A 3GJSB 4LSLA 1U49A 4KGXB 1DY3A 3PIOQ 3BDPA 3D67A 4NLSA 2OEJA 5KFXA 4JI7E 2KL8A 3UD3P 2E29A 2VESA 3FBEA 2ZD1B 4NLRA 4RLEA 1NSPA 1T7PA 2N4DA 2XZWA 3HZGA 2UV8G 4AQYE 3DMJB 1FJCA 3T6BA 1PGZA 5HN0A 4JV2A 4NXMF 1JKHA 4LF6F 2D9PA 3FNNA 5IC6B 1LW2B 3K58A 3A3NB 1NZ8A 4HR2A 3EPIA 2Y1IA 1N5VA 5KG5A 3KG1A 1CS4A 2VF3A 3I56S 3THVA 3KOAA 2RDIA 1H7UA 2J76E 2HHHI 3K57A 2LQBA 1REVB 5J2MA 3VCDA 2QA1A 1FVSA 1T05A 1S1XB 3PRVA 2HNDA 3QZ7A 1HMVA 3IAM9 2AU0A 4TNOA 2XC9A 2CVEA 1U1NA 2CJAA 4Y65A 1IBKE 1XWLA 1TKXB 2DRDA 1QZRA 1RTJB 2B3TB 3O3LA 2RUSA 5C2GA 1NJIT 3DOKB 1KVJA 4E8UA 1FK9A 1OYDA 3EYZA 3R2DJ 1CJVB 2UXDE 4EO8A 2DNYA 2Z2MA 4E98A 1IKWA 4UUWA 1RKIA 2XS5A 3T19A 3PACA 1VBYA 4F0HA 4LBIA 4LF8I 1FEEA 4DV1J 3KK1A 4N77A 4PUOB 1HYSA 2EG2A 4B9NA 1QDUB 2KTQA 2ILYA 4R0JA 1EQ0A 3CD6S 5CHCB 2ZBKB 4FPRA 1XNQI 1B62A 5D3GA 1VBKA 1EA6A 2F8MA 2GJ2A 3EICA 3VVTA 1AYEA 4Y2MA 1FJ7A 2WK4A 3OSNA 4DR4I 2A10A 2DY9A 1IQZA 1NPRA 2J0XA 1KVKA 3MM6B 1DLOB 3HVTB 4JUZA 1YJVA 3RRKA 1Z0CA 3V6DB 4FNIA 2EC0A 4OIXA 4IZJB 3ZZ0A 1NJYA 4G1QB 1B3TA 5DGBA 1KD1T 4ID5A 2BR0A 2J0WA 2NSCA 4AD6A 4LF5E 4JI8J 2BR2B 4OO1C 1HR0E 2W9BB 1X5OA 2GQQA 1VLOA 1N5YB 3M4XA 2DKOB 2HLTA 4IG0B 3GP9A 2ZJPQ 3DD6A 2VPWB 3K8VA 3DI6B 3NMAA 2W2QP 2ZDOA 2RILA 1LEOA 2V8GA 3MEGB 1L3SA 2F7VA 2EKNA 1NKEA 3CB4A 3CXCR 1SH0A 3OTOI 4W92B 1ITPA 4M5HA 1HK7A 2RJZA 1X9SA 4F50A 4A4JA 2G0JA 4DSKA 1MN7A 3PTWA 2MQPA 2XSJB 3M05A 4DR3J 3X3UA 4K4TA 2C37A 2C3UA 2HZAA 3JQJA 4YUDA 3SSRA 2KG0A 2CJXB 2ZHBA 4F0KA 4H54A 2CKWA 4A8KA 3BO4A 2PI4A 2M4MA 3KUEA 5D4OA 2HQCA 4F4WA 3IRXA 3PNIA 4UW2A 3DU6A 4ID8A 3RR8A 3HO1A 2EC2A 2CWXA 4EWTA 4F3QA 3IS9A 2P2CB 1KQFB 4C8OA 1BKNA 1RACB 4FKXA 2FLOA 2FGOA 3BR8A 2E1AA 5D0EA 3W2WA 4KRWA 1PKPA 2OTJS
chains in the Genus database with same CATH topology
2Q2EB 4DR3I 4GKKI 4DV3I 1K47A 2V34A 5FLXC 4NXNI 1N0VC 3J80Q 2UUBI 4WUBA 4MYUA 4P7AA 5LMUI 2NPFA 2BM1A 2EFGA 4JI7I 2AJ4A 4HACB 1HNWI 4JI8E 4LF7I 4HACA 1ZM2A 5IT9C 1J5EI 1OJ4A 4DV5E 1WUUA 4DPYA 1Z0VA 4N3OA 4JI6I 3B82A 4YHHE 4DR6I 4B3RE 2UXBE 1XNRE 1Z0GA 3QT7A 4AQYI 1H73A 4FN5A 4JI3I 4UTGA 1N36E 4B3ME 3JAMC 4K0KE 1FI4A 3LPSA 1PIEA 1Z5BA 1PVGA 1Z0WA 2O1UA 5BR8I 4DR1I 4GKJI 3ZZTA 4B3TE 3K1JA 2GS8A 4DPUA 2IOQA 5FWKA 4X64I 3P06A 4DR5I 4DXLA 1ZXNA 4URLA 4LF4E 4JI2I 4XTJA 4DPXA 1Z5CA 3J7AG 4USMA 1D6TA 4DR3E 2Z5BA 4X66I 4GKKE 1Y4SA 4DV3E 2HK2A 3HULA 2PNLA 4NXNE 2UUBE 4JV5I 2UXBI 5LMUE 1HNXE 5LMNI 4YY3E 4B3SE 2BV3A 1XNRI 4JI7E 1ZM3A 1HNWE 4LF7E 3T1HI 2O1TA 1J5EE 1H72C 2BM0A 2PNMA 4JI6E 2OI2A 1EI1A 5L3JA 2R3VA 1IBKI 4DR6E 3ZKDA 5IWAI 1MG7A 4PU9A 4JYAI 2ZM6I 2E1RA 4AQYE 1FJGI 5FLXQ 4JI3E 2UXDI 4X62I 1B63A 1IBMI 4HYMA 4OX9I 2V8PA 4LFCI 5BR8E 4DR1E 4GKJE 3H4LA 2V2ZA 4UT4A 2J7KA 1DARA 5A2QC 2XEXA 4X64E 4PRVA 3T1YI 4FW9A 4IZJA 4DR5E 1HNXI 3ZM7A 4B3SI 4YY3I 1N0UA 2VF3A 4P52A 3D4JA 4JI2E 4PRXA 4RPFA 1H7UA 2HHHI 4X66E 4JI0I 1IBLI 4DV4I 3JAMQ 3Q1QA 4JV5E 4R1FA 5LMNE 3F0NA 4USKA 2CZ9A 2IOPA 1HNZE 3B78A 3T1HE 3B8HA 3LTOA 1RREA 2VQFI 4ZVIA 1Z0EA 1IBKE 1Y4UA 1FWLA 3QT5A 1MU5A 1QZRA 5IWAE 3PYDA 4JYAE 4DV0I 2ZM6E 1FJGE 4DPTA 2UXDE 4X62E 4DUYI 2HFUA 1IBME 4OX9E 4JI1E 3LNUA 2HFSA 4DPWA 4I3HA 2UXCI 4LFCE 2UU9E 2Z5BB 1HR0I 3QT8A 4LFBI 4FWDA 2Z5EA 1FKAE 4LF8I 2F4VI 1S4EA 2VQEI 3Q6NA 3T1YE 1XMQI 2WW4A 4EMDA 1USUA 3Q6MA 1N33I 1HNZI 2HHHE 3V5RA 3J7AM 2ZBKB 2UUCI 1XNQI 4JI0E 1XMOI 1IBLE 1B62A 4DV4E 1EA6A 2HK3A 4DR7I 1UEKA 1RR9A 1I94I 1Z0BA 4DV2E 2X36A 1H7SA 4DUZE 3J81C 4DR4I 5A2QQ 4JI1I 4LF6I 4DU7A 2UUAI 4JI4I 1KVKA 4JI5I 2UU9I 2VQFE 3K17A 4DU8A 1NHHA 2O1WA 4DV7I 3ZZUA 1XHKA 4FWGA 1Z0CA 2A2CA 2HKJA 5IT9Q 4DV0E 4IZJB 4DV6E 2DEIA 2Z5CA 4M1KA 3ZZ0A 1USVA 3PYFA 4DUYE 2UXCE 2R42A 4LF5E 4HXZA 1ELOA 4LF9I 5LL6R 1HR0E 4KHPE 1FNMA 4DV1I 4LFBE 5GMDA 2A2DA 4LF8E 2F4VE 1KIJA 2VQEE 4DR2I 1XMQE 3V2UC 1N34I 4DV2I 3ZKBA 3PRYA 3WU3A 1Z59A 2DEJA 4DUZI 3HJCA 3J80C 1N33E 3M6AA 2UUCE 4X65I 3WU6A 1XNQE 4MYTA 2CGEA 2E5LE 1XMOE 1FWKA 4WUCA 2V2QA 4DR7E 1I94E 4LFAI 4DV6I 3OTOI 2V2VA 2CG9A 3WU4A 5GMEA 4DR4E 4NXME 4WUDA 4LF6E 1HK7A 2UUAE 4JI4E 4IZJD 4JI5E 1KKHA 3PYEA 4DV7E 4LF5I 1Z5AA 4Z7YA 4KHPI 1NHJA 2ZITA 2X7IA 3GONA 1N32E 4HY1A 1S16A 1U2RA 4ED4A 1NZ0A 3WU5A 1A6FA 4JI8I 2LJPA 4DV5I 1H74A 1ZXMA 4LF9E 2E5LI 3CWVA 3J81Q 4YHHI 4DV1E 4B3RI 2O1VA 1KTVA 4DR2E 4FWHA 1N34E 1ZM9A 2GQ0A 4JG4A 4B3MI 1N36I 4K0KI 1Y6ZA 1NHIA 4NXMI 4Z7CA 1Z0TA 4X65E 1ZM4A 4B3TI 1BKNA 1MX0A 4IZKB 2HKEA 3K85A 4KQVA 4IZKA 4LFAE 2Z5CB 3QT6A 3OTOE 1N32I 3PYGA 1PKPA 4LF4I 1VISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E B;  4DR3 I;  4GKK I;  4DV3 I;  1K47 A;  2V34 A;  5FLX C;  4NXN I;  1N0V C;  3J80 Q;  2UUB I;  4WUB A;  4MYU A;  4P7A A;  5LMU I;  2NPF A;  2BM1 A;  2EFG A;  4JI7 I;  2AJ4 A;  4HAC B;  1HNW I;  4JI8 E;  4LF7 I;  4HAC A;  1ZM2 A;  5IT9 C;  1J5E I;  1OJ4 A;  4DV5 E;  1WUU A;  4DPY A;  1Z0V A;  4JI6 I;  3B82 A;  4YHH E;  4DR6 I;  4B3R E;  2UXB E;  1XNR E;  1Z0G A;  3QT7 A;  4AQY I;  1H73 A;  4FN5 A;  4JI3 I;  4UTG A;  1N36 E;  4B3M E;  3JAM C;  4K0K E;  1FI4 A;  3LPS A;  1PIE A;  1Z5B A;  1PVG A;  1Z0W A;  5BR8 I;  4DR1 I;  4GKJ I;  3ZZT A;  4B3T E;  3K1J A;  2GS8 A;  4DPU A;  4X64 I;  4DR5 I;  4DXL A;  1ZXN A;  4URL A;  4LF4 E;  4JI2 I;  4XTJ A;  4DPX A;  1Z5C A;  3J7A G;  4USM A;  1D6T A;  4DR3 E;  4X66 I;  4GKK E;  4DV3 E;  2HK2 A;  3HUL A;  4NXN E;  2UUB E;  4JV5 I;  2UXB I;  5LMU E;  1HNX E;  5LMN I;  4YY3 E;  4B3S E;  2BV3 A;  1XNR I;  4JI7 E;  1ZM3 A;  1HNW E;  4LF7 E;  3T1H I;  1J5E E;  1H72 C;  2BM0 A;  4JI6 E;  2OI2 A;  1EI1 A;  5L3J A;  2R3V A;  1IBK I;  4DR6 E;  3ZKD A;  5IWA I;  1MG7 A;  4PU9 A;  4JYA I;  2ZM6 I;  2E1R A;  4AQY E;  1FJG I;  5FLX Q;  4JI3 E;  2UXD I;  4X62 I;  1B63 A;  1IBM I;  4HYM A;  4OX9 I;  2V8P A;  4LFC I;  5BR8 E;  4DR1 E;  4GKJ E;  3H4L A;  2V2Z A;  4UT4 A;  2J7K A;  1DAR A;  5A2Q C;  2XEX A;  4X64 E;  4PRV A;  3T1Y I;  4FW9 A;  4DR5 E;  1HNX I;  3ZM7 A;  4B3S I;  4YY3 I;  1N0U A;  2VF3 A;  4P52 A;  3D4J A;  4JI2 E;  4PRX A;  4RPF A;  1H7U A;  2HHH I;  4X66 E;  4JI0 I;  1IBL I;  4DV4 I;  3JAM Q;  3Q1Q A;  4JV5 E;  4R1F A;  5LMN E;  3F0N A;  4USK A;  2CZ9 A;  1HNZ E;  3B78 A;  3T1H E;  3B8H A;  3LTO A;  1RRE A;  2VQF I;  4ZVI A;  1Z0E A;  1IBK E;  1FWL A;  3QT5 A;  1MU5 A;  1QZR A;  5IWA E;  3PYD A;  4JYA E;  4DV0 I;  2ZM6 E;  1FJG E;  4DPT A;  2UXD E;  4X62 E;  1IBM E;  4DUY I;  2HFU A;  4OX9 E;  4JI1 E;  3LNU A;  2HFS A;  4DPW A;  4I3H A;  2UXC I;  4LFC E;  2UU9 E;  1HR0 I;  3QT8 A;  4LFB I;  4FWD A;  1FKA E;  4LF8 I;  2F4V I;  1S4E A;  2VQE I;  3T1Y E;  1XMQ I;  2WW4 A;  4EMD A;  1N33 I;  1HNZ I;  2HHH E;  3V5R A;  3J7A M;  2ZBK B;  2UUC I;  1XNQ I;  4JI0 E;  1XMO I;  1IBL E;  1B62 A;  4DV4 E;  1EA6 A;  2HK3 A;  4DR7 I;  1UEK A;  1RR9 A;  1I94 I;  1Z0B A;  4DV2 E;  2X36 A;  1H7S A;  4DUZ E;  3J81 C;  4DR4 I;  5A2Q Q;  4JI1 I;  4LF6 I;  4DU7 A;  2UUA I;  4JI4 I;  1KVK A;  4JI5 I;  2UU9 I;  2VQF E;  3K17 A;  4DU8 A;  1NHH A;  4DV7 I;  3ZZU A;  1XHK A;  4FWG A;  1Z0C A;  2A2C A;  2HKJ A;  5IT9 Q;  4DV0 E;  4DV6 E;  2DEI A;  4M1K A;  3ZZ0 A;  3PYF A;  4DUY E;  2UXC E;  2R42 A;  4LF5 E;  4HXZ A;  1ELO A;  4LF9 I;  5LL6 R;  1HR0 E;  4KHP E;  1FNM A;  4DV1 I;  4LFB E;  5GMD A;  2A2D A;  4LF8 E;  2F4V E;  1KIJ A;  2VQE E;  4DR2 I;  1XMQ E;  3V2U C;  1N34 I;  4DV2 I;  3ZKB A;  3WU3 A;  1Z59 A;  2DEJ A;  4DUZ I;  3J80 C;  1N33 E;  3M6A A;  2UUC E;  4X65 I;  3WU6 A;  1XNQ E;  4MYT A;  2E5L E;  1XMO E;  1FWK A;  4WUC A;  2V2Q A;  4DR7 E;  1I94 E;  4LFA I;  4DV6 I;  3OTO I;  2V2V A;  3WU4 A;  5GME A;  4DR4 E;  4NXM E;  4WUD A;  4LF6 E;  2UUA E;  4JI4 E;  4JI5 E;  1KKH A;  3PYE A;  4DV7 E;  4LF5 I;  1Z5A A;  4Z7Y A;  4KHP I;  1NHJ A;  2ZIT A;  2X7I A;  3GON A;  1N32 E;  4HY1 A;  1S16 A;  1U2R A;  4ED4 A;  1NZ0 A;  3WU5 A;  1A6F A;  4JI8 I;  2LJP A;  4DV5 I;  1H74 A;  1ZXM A;  4LF9 E;  2E5L I;  3CWV A;  3J81 Q;  4YHH I;  4DV1 E;  4B3R I;  1KTV A;  4DR2 E;  4FWH A;  1N34 E;  1ZM9 A;  4JG4 A;  4B3M I;  1N36 I;  4K0K I;  1NHI A;  4NXM I;  4Z7C A;  1Z0T A;  4X65 E;  1ZM4 A;  4B3T I;  1BKN A;  1MX0 A;  2HKE A;  4KQV A;  4LFA E;  3QT6 A;  3OTO E;  1N32 I;  3PYG A;  1PKP A;  4LF4 I;  1VIS A; 
#chains in the Genus database with same CATH topology
 4ZVH A;  4CNZ A;  1WHX A;  3J80 Y;  4BDP A;  5KTQ A;  5A0Y B;  4DF8 A;  2LP4 A;  4JI2 J;  6AT1 B;  2C39 B;  1MRO B;  3NBP A;  4C2M A;  2CPZ A;  4ILL A;  3R7S B;  5E7O B;  2VUG A;  1XMQ J;  2AJ4 A;  3D6F B;  3NCR A;  5KFY A;  2HHH F;  1ICE B;  3T5L A;  3EZO A;  2RUG A;  2M88 A;  3C6U A;  3CCW A;  1K44 A;  2K2P A;  1O6X A;  1R27 B;  4NCG B;  2KM8 B;  3CSK A;  4B3M E;  3MAH A;  3ZZO A;  3DLL Q;  3ISN D;  2YQ3 A;  1Z5B A;  4ZCK A;  3P96 A;  1JXL A;  1S57 A;  3DGP A;  2Y3Y A;  4FNH A;  3MAA B;  4DPU A;  1VC0 A;  1TV6 B;  1ZAV A;  3P3G A;  4LF4 E;  2GVZ B;  1X60 A;  1FRX A;  4LCF A;  2EKY A;  1A9N B;  3CNQ P;  4H4K C;  4KHP F;  2R7X A;  3MMA A;  1TAQ A;  3EX7 B;  4LF8 F;  2KYX A;  4O0N A;  2BA1 D;  1YZ6 A;  1Q81 T;  1NLK L;  9ATC B;  3MFH A;  1XNQ F;  4CIO A;  3RBD A;  1NK9 A;  4NE9 C;  2DTJ A;  3ILO A;  4BWJ A;  3D0H E;  2YWG A;  2IA6 A;  4PU9 A;  1VGY A;  2OH2 A;  2HZC A;  4CRJ A;  2X1A A;  4U6P A;  4DR4 F;  4K0K F;  2JRS A;  2E5I A;  3FCW A;  3F41 A;  2V2Z A;  1U8S A;  3JSM A;  2MZJ A;  3Q0A A;  4LJM A;  4ES2 A;  2OPQ A;  1YHC A;  3H5S A;  4ERD A;  2MST A;  1YJ7 A;  1R8H A;  2KYZ A;  1EKS A;  2YNH B;  1U1K A;  1N6Q B;  1NZA A;  2RB7 A;  2BOP A;  4FPI A;  3HT0 A;  1KR4 A;  3P3C A;  4OO1 A;  3JAM Q;  3Q86 A;  1LWF B;  3G8T A;  1TL4 A;  1IM4 A;  4YHH J;  1M5V C;  5H9F J;  2RKI B;  4H4M A;  2CZ9 A;  3G2X A;  2NN6 B;  3KMQ A;  3Q8Y A;  3POT B;  3FCH A;  2WNR B;  1KQS R;  1TFW A;  4B3T J;  4PYA A;  4DV0 I;  2QLX A;  3AA9 A;  4I2Q A;  5KOX A;  4UZB A;  3C16 A;  4DUY I;  2QT7 A;  3R8Y A;  4ZJQ A;  5BR8 F;  4I3H A;  2FC9 A;  3SQO P;  4OHZ A;  4LF9 J;  2HWH A;  2VQE I;  1YRX A;  4RO0 A;  2KKH A;  1LXN A;  1WC6 A;  4LQ3 A;  2XS2 A;  4K50 A;  1Y4Z B;  5CH7 B;  2F9J A;  5JEA B;  4NX9 A;  1S9G A;  1RR9 A;  1OWX A;  1FWP A;  4EU0 A;  2LQJ A;  1X7V A;  4Z37 A;  1CG2 A;  2FDN A;  5E41 A;  3BGF A;  5K8N A;  3SI8 A;  2AJ2 A;  1YGY A;  4DU8 A;  1HQE A;  4I6A A;  4WBF A;  2DH8 A;  5G0R B;  2YX4 A;  2DB1 A;  3OTD A;  2GA7 A;  3P5T L;  1I51 B;  2BMB A;  2XNR A;  4C98 A;  3R5D A;  2RF2 B;  3M85 G;  4CLK A;  2WTF A;  5L1L A;  2JH3 A;  3I0S A;  3M32 B;  2DVI A;  2QA2 A;  4K5R A;  4V19 J;  1O8B A;  1WEL A;  3BGU A;  2MQL A;  4ZCM A;  2AMC B;  4BC7 A;  2FLL A;  3VAF A;  1VQP S;  1WOS A;  3OFE A;  2XYP B;  3OR2 B;  1UJ5 A;  3OL7 A;  4XTT A;  2HRY A;  2B43 A;  3RAQ A;  2KU7 A;  1U1O A;  1RTI B;  1CJT A;  1RWX B;  3JXO A;  2VIC A;  2DGT A;  4F02 A;  4WE1 A;  1R0C B;  4Q7A A;  2MQQ A;  1BQM B;  3LPY A;  4CH7 A;  3UI3 A;  4Z7Y A;  4A8Q A;  3QSY B;  1C0T B;  2RHQ B;  1S6P B;  2RDD A;  4LRD A;  3CME S;  2BQU A;  2EVZ A;  3SFU A;  2V5H G;  4L3K A;  3KLH B;  3GIJ A;  5CAA A;  1IN0 A;  2NZ4 A;  1CUL B;  1X8D A;  2OFG X;  4CLU A;  3FUY A;  3OTB A;  4ENO A;  3W2V A;  2LEP A;  1HWJ A;  2WVF A;  4FYY B;  5A6W A;  2M52 A;  2O5D A;  2UUC F;  4J3D A;  1T11 A;  3GIR A;  1D09 B;  3FC9 A;  5GVQ A;  4BA1 B;  2PO1 B;  7FDR A;  1Q0N A;  4LFA E;  3B6B A;  5FJ4 A;  3J7Z 5;  4KHM A;  3DFE A;  1TL1 A;  4JI1 F;  5KFI A;  1H0H B;  5AJ3 F;  1TUW A;  5IM0 A;  4DV3 I;  1CC7 A;  4OLO A;  3BSA A;  1RYR A;  5HVH A;  2UVU A;  4MYU A;  2NPF A;  1FRL A;  5JUM A;  2BM1 A;  2LA6 A;  4LF7 I;  2GGP B;  4KPY A;  2VA2 A;  5GAE U;  4E0D A;  4KKO B;  4YS2 A;  2UV8 A;  3ULH A;  4DL3 A;  3D68 A;  3HP6 A;  3HI9 A;  3HXM A;  1U24 A;  1N36 E;  5KFS A;  1C0U B;  4ZVQ B;  1S9E B;  1SJ4 P;  1FDA A;  4RW7 A;  4JBC A;  4DV0 F;  3GPA A;  5LJ5 Y;  2IHR 1;  1NK7 A;  1G7C B;  2MHN A;  2AEF A;  5KAK A;  3A4T A;  4L74 A;  3PX4 A;  3BGR A;  3G6X A;  4DUY F;  4C0B A;  2C2Z B;  2L9W A;  1HI1 A;  1D6T A;  2CJQ A;  3PJX A;  3FFI B;  2VQE F;  4JV5 I;  1SIW B;  1IBL J;  3CIM A;  1XNR I;  2F1D A;  2O66 A;  4ZPW R;  2BE2 B;  3FVY A;  1SC6 A;  4OYA A;  1MMD A;  1X9W A;  3GSD A;  2VPZ B;  4PYD A;  1MG7 A;  2WB1 D;  5IQ6 A;  2DR6 A;  3R97 A;  4B3O A;  2AWZ A;  4H4O A;  3CCV S;  2ZNZ A;  4HTI A;  3AD8 C;  1GH8 A;  2I8E A;  5CCL A;  2OEL A;  2MEW A;  1NU4 A;  4EUV A;  1IUJ A;  1XIQ A;  5KFK A;  4YR0 A;  4OZE A;  3PHT A;  5KFD A;  1IR1 A;  3UDE A;  4PRX A;  1H2V Z;  3JAM Y;  3FK4 A;  3MM8 B;  2QN6 B;  4I64 A;  1CJU B;  4JI0 I;  1JQG A;  1AT1 B;  1REV A;  5A76 A;  3ENV A;  2E5L J;  2ZOM A;  5GAD U;  1YJN S;  1Q8B A;  2MGZ B;  4XIU A;  4F7V A;  5FD1 A;  3HHE A;  4DQI A;  4KGK A;  3HHL B;  4J9O A;  4LT6 A;  3OSP A;  1TKX A;  2O3D A;  1RTJ A;  3S8S A;  2ZM6 E;  5L1J A;  3DGV A;  1FKP B;  4KSE B;  1NXI A;  1IBM E;  4OX9 E;  2HW3 A;  4ZIT A;  5K20 B;  2UXC I;  2UU9 E;  4B08 A;  3Q23 A;  4DPO A;  1H2U X;  3QYY A;  2Y8W A;  3WDO A;  1O5J A;  3D6H B;  4ECY A;  5LMU J;  4PPD A;  4IFD B;  1DTQ B;  1J27 A;  2ZUG A;  1HNZ I;  4WFX A;  1AFI A;  2DNO A;  3CDU A;  4ZJL A;  4DV4 E;  4WXO A;  2IMW P;  4EFA C;  1IVZ A;  5DDR C;  2FZK B;  4LIR A;  4I2P B;  1UEK A;  4U7U D;  1ZYQ A;  1P27 B;  4DUZ E;  1H38 A;  5A2Q Q;  2UUA I;  4TN2 A;  3MM6 A;  5D8H B;  1FRK A;  3Q8Q B;  4RZR A;  1X4D A;  3BH6 B;  4U9R A;  1X4A A;  5FDL A;  2FJB B;  5J1E A;  1S6O A;  1UZD A;  3HVW A;  2GQ2 A;  4X84 A;  2UXD F;  2ZH1 A;  4ECZ A;  2XMW A;  1YZ7 A;  2AX0 A;  2KVQ E;  2HGL A;  3L7O A;  1RT4 B;  2BA9 A;  2H3E B;  2WVB A;  1U6Z A;  2DR5 A;  4DEZ A;  4DQP A;  5C7P A;  1NSQ A;  2BR2 A;  5LL6 R;  4DV5 J;  2AT1 B;  2CQB A;  2W9B A;  3U1Y A;  1XMQ E;  3GJT B;  1ZTT A;  1Z59 A;  4LF7 F;  4IG0 A;  3Q83 A;  2FJA B;  4UST A;  3MR5 A;  2YKM B;  3DI6 A;  2ASD A;  4MK7 A;  5L39 A;  4DR7 E;  1C4C A;  2KJW A;  4P7T A;  1IR0 A;  5K8M A;  2HAI A;  2V67 A;  3F44 A;  1Y3J A;  1ZAW A;  4DV7 E;  2ZZN A;  2RU9 A;  1RQ0 A;  2XO6 A;  2D41 A;  1CPZ A;  3W9H A;  2R8H A;  3HHN B;  1R6L A;  4RWW A;  1R0A A;  1O51 A;  1JLQ B;  4X4O A;  3MFI A;  4O3S A;  1N8R T;  2EFV A;  1D1U A;  1HNW J;  4JV5 F;  4AIM A;  1RTD A;  1HW8 A;  3SEO A;  3T9N A;  3PKM A;  4IFV B;  5KFC A;  2ZZT A;  4RUC A;  2LXI A;  2YKP A;  2VOP A;  2BA1 G;  1Q5Y A;  3JYT B;  4HLB A;  1MX0 A;  2JT2 A;  2ZH8 A;  3KLG A;  3PXG a;  1HNI B;  4DR5 J;  1GMV A;  1VBZ A;  1JK9 B;  2MQO A;  3G4S S;  5A0Y A;  5D0R A;  5K9F A;  3D1H A;  4WUB A;  1VQY A;  2L08 A;  1FEH A;  4ZOS A;  3MMC B;  4BA2 B;  2YQ0 A;  3DHW C;  2HSE B;  4NCB A;  4KV8 B;  1OJ4 A;  4JI0 F;  3NY0 A;  1OO0 B;  1NK5 A;  1WOR A;  2Z30 B;  3EE3 A;  4YHH E;  1X4G A;  1A7G E;  1Z0G A;  3VAH A;  2HMI B;  2VKR A;  1I94 J;  1DFD A;  4X62 J;  2LCW A;  4B3T E;  1NBE B;  1ZZF A;  3OV7 A;  1XQI A;  1IWA A;  4LFC J;  1TKT A;  4NZ6 A;  4M5N A;  3MAA A;  4X64 I;  4IG3 A;  2AEJ A;  3P6Y C;  3C46 A;  1JJH A;  1VQ6 S;  2CZ4 A;  1Q79 A;  2UXC F;  3HMJ G;  4U7U K;  1NDC A;  4X4S A;  1UZH A;  4QR0 A;  4NA1 A;  4CI0 B;  3M30 B;  2KRR A;  2GIR A;  1Q16 B;  3D1O A;  4FS1 A;  4B3S E;  2N3L A;  1SI9 A;  4IFY A;  1HHQ A;  1IKY A;  4JI6 E;  3MOJ B;  4LR8 A;  1NAQ A;  2LFV A;  2AW0 A;  3ZKD A;  5CZV A;  2KH9 A;  5DG8 A;  4Q44 A;  3H2U B;  5FLX Q;  4DV6 J;  3R5B A;  3CO9 A;  1S79 A;  4HYM A;  4NA2 A;  2UUA F;  4PQU B;  5IT9 Y;  4GKJ E;  4JP8 A;  2ABY A;  1D8Y A;  4TQR A;  5KFE A;  4TXS A;  5A8W A;  2ROP A;  2MKC A;  4DQS A;  3W8G A;  2JEG A;  3WZ0 A;  1JWW A;  3CW2 C;  4CZC A;  2C3M A;  2D3U A;  4ALZ A;  3D4J A;  1OQ6 A;  3K8W A;  4IRC A;  3PDN A;  5E5N A;  3BGO P;  1CBK A;  3MCN A;  4PAB A;  2RKI A;  3F0N A;  3V6J A;  3ENA A;  5ETT A;  2GHV C;  3B8H A;  1Q4R A;  4NYO A;  4J9S A;  4X4T A;  2Q1L A;  3T6J A;  3POT A;  2M70 A;  4F2S A;  4JI5 J;  2BW7 A;  4X4V A;  2WNR A;  2IJR A;  4V1A k;  3QGP A;  4P7V A;  4DL6 A;  2V8H A;  5J1P A;  2HFU A;  3LNU A;  1VBX A;  2W2P P;  2E44 A;  4K5S A;  1RTH B;  1WTB A;  5D4L A;  1B64 A;  3PKY A;  1HLW A;  1F9E B;  2V6A A;  4RW4 A;  3R5G A;  1J2V A;  3FMW A;  3Q6M A;  2JHE A;  4A8O A;  1DZ5 A;  2XMU A;  2MKK A;  3TQ1 A;  2VG6 A;  4FYV B;  1OPI A;  3M1V A;  2UXB F;  1D8Z A;  4MT1 A;  2BBE A;  2IA0 A;  5A2Q Y;  4DV2 E;  4C0O C;  4OO1 E;  1IKX B;  3QSI A;  3CMA S;  1NME B;  1UJ4 A;  2A1B A;  2VG7 B;  4DX7 A;  3WIU A;  3G8S A;  1V6H A;  4ZIW A;  5EL9 A;  5IC4 B;  3PFE A;  2Z5C A;  1JIH A;  2W7P A;  4J9V A;  4DL0 C;  3I9V 9;  4HHU A;  3W5Z A;  1HNV A;  3QO9 B;  3W7B A;  4HXZ A;  2RF2 A;  3ITH B;  5J2P B;  4DV1 I;  1ARO P;  3TUP A;  2IVM A;  4B3R J;  5DDQ C;  4M5G A;  3ONQ A;  4EBD A;  1PYS B;  3TJ9 A;  2YKQ A;  2AJ0 A;  3OR2 A;  3UDC A;  4MYT A;  2XSF A;  3T3F A;  1Q5V A;  1XMO E;  2AJQ A;  2EI5 A;  5J1N A;  4ZLN A;  2DNQ A;  1UET A;  2NRE A;  2OSR A;  3DM2 B;  1HBM B;  3W3S A;  1RTI A;  2GFF A;  4CT9 A;  2DIU A;  1PBU A;  2MZQ A;  4FVM A;  3C3L A;  1C0T A;  4X64 F;  1F5B A;  4DN0 A;  1S6P A;  1FXD A;  2L48 A;  4CP5 A;  2UUB J;  2PO2 B;  8AT1 B;  2QMW A;  2CNK B;  4JI8 I;  2LJP A;  3M8Y A;  3KLH A;  3LH2 S;  3SV3 A;  2F8E X;  1HQU B;  2XHW A;  4ZVS B;  3RW7 A;  2DGU A;  4PQA A;  3VGU A;  1X0P A;  5ETQ A;  5EGY A;  1JLE B;  1I6J A;  3EZU A;  1M5K C;  3JAM U;  4CT8 A;  4XPC A;  1UEV A;  1VIX A;  4DFM A;  5T41 A;  3VAI A;  4ER8 A;  1ZA2 B;  3QAT A;  1F0X A;  4DR1 J;  2JEA A;  2PO1 A;  3ISN C;  1VJQ A;  3CJK B;  2PFD A;  1WNE A;  3LP1 B;  1YIJ S;  1N32 I;  4QIV A;  3PYG A;  3GJR B;  3OXG A;  4MDT A;  3MCM A;  3GV5 B;  2OPP A;  4DR3 I;  3N5B A;  4CH1 A;  1O0P A;  2ATC B;  4DG1 B;  4NML A;  2ZH9 A;  1N54 B;  2HFV A;  4J9N A;  5DS7 A;  4UOH A;  1S9F A;  3M9O B;  4CH0 S;  3FBB A;  1JXE A;  1RTZ A;  2P5V A;  3ELH A;  5LMN J;  4Y2A A;  1KTQ A;  1VI7 A;  3KLF B;  1K8A T;  2CQ1 A;  5D4P A;  5AE3 A;  4KKO A;  3QRP A;  4AXI A;  2D3Z A;  1FJE B;  4OI0 A;  5KG6 A;  4JYA J;  3DRR B;  3CD7 A;  2DXF A;  3CDW A;  1KWM A;  1RWO B;  4YDD B;  4OJ3 A;  2QMU B;  2VBY A;  2CQG A;  2FB0 A;  4OZ2 A;  2HS4 A;  4A8M P;  3VQT A;  1FX4 A;  3M6X A