4EMDA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
299
Chain Sequence
GAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 299
sequence length 299
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4emdA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4emdA01
4DR7I 4JI1I 4FWHA 2UXBI 4B3TE 4WUCA 5LL6R 3J80C 4DV3E 3PYEA 1KVKA 1WUUA 1ZM3A 2WW4A 3K1JA 3HULA 4DR2E 4B3RE 1HR0E 3LPSA 4LF6I 4DV6I 1NZ0A 2UXBE 3QT7A 2LJPA 1HNWE 4DV1E 4JI3I 2AJ4A 1FWLA 1IBKI 2HK2A 2E1RA 2XEXA 2X7IA 3J81C 4JI7E 4DV5E 4DV6E 1ZM2A 1N32E 2NPFA 4GKJI 4ZVIA 4JI4I 4LFBE 4PRVA 3WU4A 1BKNA 1N0VC 1Z0CA 1IBKE 2UXCE 3Q1QA 1H7UA 4YHHI 1Z0WA 3D4JA 4DR5E 3T1YI 2R42A 4DPYA 1FJGI 4GKJE 1IBME 3V2UC 1OJ4A 2UUAI 2UXDI 4X62I 4DV7E 4LFCE 4DPWA 1FJGE 4LF4I 4JI6I 2UUAE 1IBLI 4X62E 4HACB 4M1KA 2HFUA 1A6FA 4FN5A 3JAMC 1IBLE 1HNXI 4DR4E 4P7AA 4XTJA 1FI4A 4DV0I 4HXZA 1RREA 2BV3A 1NHJA 4JI0I 1Z0BA 4JYAE 4LF7E 4X66I 1FKAE 2V2QA 4USMA 4PU9A 4JI2I 3WU3A 1XMQE 2UUCI 1H7SA 4DR3I 5LMUI 4DPTA 3J7AM 4HACA 1J5EE 3ZKDA 4AQYI 3J81Q 4DUYE 4JI2E 5LMNI 4LF8I 2UUCE 4Z7YA 1XNQE 1Z5AA 2VQEE 2A2CA 4DR3E 4JV5E 4JI5I 1KIJA 2E5LE 5A2QC 1S4EA 2A2DA 3GONA 4AQYE 1VISA 1H74A 1I94E 5LMNE 4DR7E 3J7AG 4JI1E 4JI5E 3OTOI 4USKA 4NXMI 3K17A 5BR8I 4HYMA 3CWVA 1NHHA 3OTOE 4LF6E 4NXME 5GMDA 1HNZI 2HK3A 1B63A 2VF3A 1XHKA 5GMEA 1D6TA 4LFAI 1NHIA 5BR8E 4JI3E 4P52A 3PYFA 4DPXA 1ELOA 4FWDA 3JAMQ 3F0NA 4JI4E 2X36A 2HKEA 3ZZ0A 4LFAE 4X64I 1Z0GA 2J7KA 3ZZTA 4DUZI 4Z7CA 4YHHE 3T1YE 1N36I 4LF9I 2V2ZA 3WU5A 1N34I 3T1HI 2UXDE 4DUZE 2UU9I 2HKJA 4LF9E 3B78A 4LF4E 4ED4A 1UEKA 4JI6E 5A2QQ 5IWAI 3ZKBA 1ZM4A 1FWKA 4HY1A 1HNXE 4X65I 1ZXMA 5IWAE 4DV0E 2HFSA 1Z0VA 4JI0E 2Q2EB 4GKKI 2OI2A 4X66E 3V5RA 3ZZUA 1XMOI 1PIEA 4DU8A 5LMUE 2F4VI 1RR9A 4JG4A 4B3MI 2UUBI 4DR6I 1Z0TA 2V2VA 3LNUA 1EA6A 2BM1A 4KQVA 4LF8E 1H73A 4PRXA 4RPFA 2ZM6I 2HHHI 4DR2I 4B3ME 4B3RI 1HR0I 2GS8A 3B82A 3PYGA 1MX0A 2UUBE 4DR6E 2DEJA 1XNRI 1QZRA 4FW9A 4YY3I 1KTVA 4NXNI 4JI8I 2ZM6E 2HHHE 4WUDA 1HNWI 4DV1I 2CZ9A 1Z5CA 4JI7I 4DV5I 1XNRE 3ZM7A 4YY3E 1N32I 4NXNE 4JI8E 4LF5I 4B3SI 1S16A 3QT8A 4LFBI 2DEIA 1HNZE 1U2RA 3LTOA 2UXCI 1H72C 4DR5I 1EI1A 4LF5E 1FNMA 3H4LA 4B3SE 3M6AA 4KHPI 1IBMI 1PVGA 1N0UA 3QT6A 1Z0EA 3QT5A 4DV2I 4UTGA 3WU6A 4MYUA 4DV7I 1Z59A 4LFCI 4DU7A 1MG7A 2EFGA 4X64E 5IT9Q 4I3HA 4KHPE 1Z5BA 1N36E 4DV2E 2V34A 1N34E 3T1HE 1PKPA 1N33I 1KKHA 4FWGA 2UU9E 1ZXNA 2ZBKB 3PYDA 4DR4I 5FLXQ 4DXLA 4OX9I 4K0KI 1N33E 3B8HA 2R3VA 4JYAI 4DR1I 1B62A 4URLA 5IT9C 4LF7I 1ZM9A 4UT4A 4OX9E 4K0KE 4EMDA 1XMQI 4X65E 5L3JA 3J80Q 2ZITA 1DARA 1MU5A 4DR1E 2BM0A 2V8PA 4DV4I 1J5EI 2VQFI 4GKKE 4DUYI 4DPUA 4MYTA 1XNQI 5FLXC 2VQEI 4JV5I 4R1FA 2E5LI 1XMOE 4B3TI 4DV4E 4DV3I 2VQFE 4WUBA 2F4VE 1I94I 1K47A
chains in the Genus database with same CATH superfamily
2NSBA 3TUPA 4DR7I 3JSYA 2FHMA 1UDQA 2DTJA 4IG0A 4ECSA 4OHYA 2HGMA 3MHYA 3M8RA 3BH7B 5J1EB 1FJGJ 2UXBE 2AX0A 4HVZA 2BJ7A 5ETQA 2BKPA 2DXDA 3QIDA 1OQ3A 3EMTA 3QGPA 3OJUA 2HAFA 2ZKUA 5EGYA 2BMBA 3OV7A 1G4CA 1S9EA 2P8IA 3KNGA 5JEAB 4JV2A 5BR8F 1WORA 2VFSA 2ZH9A 1M5PC 3W3SA 2RT3A 3BB5A 4ETXA 2MY8A 3AQOA 5KG0A 2Y1IA 3IM8A 4JI6I 2HIYA 2ASJA 3OTDA 4M1KA 2KM8C 4DFKA 4JV5J 3LP1B 1NNDA 3W9HA 1HK7A 1R3NA 2W25A 1LWCB 1AZSA 4DS4A 3JSMB 3RZAA 1BMQB 1FT8A 2O3ZA 1DLOA 2XMTA 2K8GA 1FTCA 4QWEA 4LF7E 2G4BA 4WBFA 1I1GA 2VBXA 3VV2B 5LMUI 2GAGC 4HACA 1RTDA 1NZ8A 2UVVA 5I42B 5DDQC 1L3UA 2JFKA 3BR8A 5M2UA 4JI5I 3DU5A 2MJUA 3L7PA 3M7VA 1RKJA 1HI8A 3GONA 4BHQA 5CABA 3RB0A 4DUTA 1VK8A 4YN3B 4EBDA 2FDNA 3FRYA 3K17A 4JBCA 4ZP7A 3CT9A 2XULA 1JLCB 2FTRA 5BYRA 1KFSA 2CGEA 1TP7A 3NOCA 3AJDA 3PYFA 3OFEA 1C4CA 2ZZTA 1AFIA 1FWPA 1ELOA 2KL8A 1TUVA 2D3ZA 1XNRF 4QOTA 2YKMA 1HNXJ 3ZZ0A 1X4CA 2V69A 2WP8A 3H5YA 2C3UA 3V6KA 2HGNA 2UUWA 2YNGA 5KFLA 4ED5A 2VOOA 1M1GA 3I56S 5ETPA 4ZJOA 1FJCA 1LEOA 3FMBA 2QFJA 4LF5F 3R1HA 1KQSR 3M6WA 5CA5A 4W4MA 3RBXA 1OWXA 4NCGA 1ITPA 4K4TA 2Z58B 4K4YA 1YJTA 2PNZB 4B9LA 1L5UA 5T7LA 5K8MA 3K0JA 4OJGA 3N9UC 3AH6A 4CO0A 3DOMB 4CT9A 1RCXB 2PO2B 2K3IA 1EZZB 3GFHA 2MLZA 3CB4A 4B02A 2IBKA 2ZM6J 2XWYA 3P3CA 3RG6A 2UUTA 2JSXA 2R2SA 3K8VA 4ZVSB 1JXLA 5B08A 3BN4A 2C1EB 1KOHA 4X65F 2BANB 4JG4A 1RT7B 1LK7A 2CNOB 3DU6A 2VJVA 4AD6A 4DR2I 3PYGA 2YKQA 3OSNA 5DLGA 2BQUA 1NSKL 4ECWA 2B8QA 1HPZB 2LXFA 1HW8A 1YJ9S 3JB9k 1N34J 4JI7I 3L9ZA 3QLHB 5E3PA 1N32I 1LFWA 2MTLA 2NSCA 2IC3A 4B3RF 3NGRA 1H3DA 2LEBA 3FBBA 4U3DA 2CQBA 2HVZA 3PW4A 2O67A 4DV1F 2DIVA 3TARA 5D78A 1YLXA 5KG6A 1NK9A 1AA1B 1IVZA 3PS1A 1IJFB 3DLEB 4DN9A 2FJWA 2XLKA 3NBPA 1NM2A 3R7SB 2J0SD 3BF4A 1S77D 3H2VE 2RRBA 5KT2A 2DK2A 2VQFJ 3OUYA 2FD2A 2G0JA 1RAOA 3P3DA 1ZAVA 4ITSA 4M5DB 1ZZFA 3QGGA 3OFHA 1WSRA 4LRDA 4OX9E 1M5KC 1QVFR 3NP5A 4NRUA 3DDIA 1O8BA 1I51B 4KO0B 3F73A 1RWMB 4IQMA 4DV4I 2V5HG 3CDEA 4OZ2A 1XNQI 5F3TA 1NHUA 2M8DB 2AWZA 2BVZA 1XMOE 1HQEA 4KH0B 4FW3A 5HATA 3FZ2A 3TYTA 1RYSA 2DB1A 2NN6C 3PS2A 1RAHB 2FVSA 2W2OP 2FGCA 3QBCA 3HULA 5L1IA 1RWVB 1GTHA 4NLQA 2BRKA 5EDWA 3T41A 4AQYF 2I5JA 3MR3A 2CPIA 1VR6A 2EBGA 2HMIA 4DV5E 5HAOA 3T19A 3H5SA 1GMWD 1E3PA 3KLEA 2OPPA 4QWBA 1CULA 1WC6A 3A8EA 4DOZA 3D4JA 1Y3KA 2PGCA 4GKJE 3Q8RB 1NPPA 4IH6A 2UXDI 4DSLA 3VGUA 1TVRB 1N48A 4HTIA 1O0PA 4LFAF 1B0TA 1IBLI 2JEAA 1SJRA 5KFIA 3DRPB 2OLWA 2RKIA 5HMXA 4XDCA 4UOHA 2W7PA 3QO9B 1RU1A 4NMXA 4MK7A 5KT5A 1X31C 5KFEA 3CJQA 4QU6A 3U27A 3U02A 5D0GA 1TTHB 2EPIA 3RAQA 4O0IA 4USMA 4KKOB 2LU2A 3DLGA 3CSKA 1JKHA 3HKWA 3W5ZA 1WKKA 3HM9A 5IWAF 4QZVB 4DUYE 4JI2E 2DO4A 2IY5B 1S6PB 4PQUA 2HHPA 4PEOA 2DNZA 1ZYQA 4TNOA 5GMKa 1VISA 1I5OB 1I94E 5D3GB 5HSPA 1FX2A 3UWTA 1D9AA 4G6VB 3NAIA 1OYEA 3GMGA 2F65A 1HWLA 2LMIA 1Q8IA 4DL4A 1VRUA 2ROEA 1HBOA 4OYZA 2YTCA 3U1KA 1HW9A 1R0CB 2UUBF 4DR6F 2OTJS 1J5OA 2V67A 1NDLA 1KEKA 4J90A 3FEYB 1P8GA 3I4PA 5HP1B 4ZLNA 3PKYA 2UZAA 2NN6E 3N0VA 2DNHA 4CLFA 1EETB 4EK2A 4DUZI 4C11B 3T1YE 3SQOP 2AGOA 4CH0S 4RW7A 4TKTA 3CJ2A 2MKIA 1FD8A 2BE9B 1WDDA 2CJQA 4CNYA 2CJXB 4H4KA 2E1CA 2JT2A 1DBDA 7FD1A 2GQ0A 4QIGA 2B7BB 3WC0A 5KG4A 1HQUB 4EWTA 3AXKA 2OH2A 4LSZB 4DV2F 5JEAA 3H2LA 2R8KA 2ZKTA 1SI9A 2D74B 3HK2A 3G87A 1HA1A 2CQIA 3MM6B 4FKYA 1EP4B 2B4OA 3R1LA 5HROA 4XIUA 2LA4A 1WI6A 3C14B 2HFSA 2ZHBA 2AP6A 1N33F 1N5QA 4DF8A 2OPSB 5EKWA 4X66E 2BABA 5HANA 1B70B 2CWKA 3TA0A 2IMWP 2I8EA 4YEAA 3CEDA 5CYMB 2OTLS 3GYGA 3ENWA 1K1QA 1H2TZ 1BLUA 4S0MA 1QY7A 2QSWA 3JSMA 3BQ2A 4LF7F 1AYEA 4B3SJ 2Z5EA 2ZJPQ 2FJBB 4PRXA 2V8DA 2KJVA 3QPIA 2L9DA 2XSJB 3A12A 2CRLA 2GS8A 3MPVA 4TN2A 1U26A 1QZRA 1SC4B 2F4VF 4NXNI 4USHA 4FDFA 4F26A 5I42A 4ZPVR 4DV3F 4YY3E 2FVCA 3LAKA 2UU9J 3KLFA 5KFTA 1HR0F 4LMZA 5CZVA 2CQ4A 3IN5A 1U2RA 4MMOA 4O3NA 3CNQP 3S01A 4K4WA 3H4LA 1YKWA 2VASA 3MMAB 1Y10A 2HGLA 3G4SS 2C3PA 2IDEA 4DV6F 4IQXA 3OL9A 4FF1A 4IZJA 4LFCI 5B0GA 4O3OA 5A0YB 2M8HA 4P2FA 2K06A 2HQCA 1VI7A 1BQMB 5KFKA 2NUHA 4OHWA 4IG3B 1TKXA 1F9HA 3MAAB 1ZXNA 1N56A 4QW9A 1HLWA 1Q53A 1S0OA 2ZZNA 3I9ZA 2AV5A 1LW2B 3K5PA 1FJGF 1HFEL 4HHJA 3RW7A 8RUCA 2M3DA 4C9DA 2IA6A 3ZZYA 1FFWB 2RIJA 3QGIA 4Y2CA 5K9FA 3UO0A 4UT4A 2U2FA 4K0KE 4MK9A 4NA2A 2KB2A 5GAEI 1WF2A 2BM0A 4DG1B 1L3VA 4C8LA 4MYTA 2ZD1A 3TVYA 3NEKA 3DOMA 1OSDA 1FE0A 3RB4A 1SQFA 2E7XA 2YWWA 4KGMA 1U1OA 2IMOA 1MNEA 4EUVA 3J80C 2KM8B 3EE3A 4KY3A 4R0EA 4Q2LA 2MKSA 4JV5F 2HVIA 2DHGA 1Y4ZB 3KRNA 5DRQA 2VFRA 5IS2A 2VA2A 4NI2B 3HDSA 2Y3YA 2ALZA 4Y28C 1RT7A 3Q22A 1O51A 3KLIA 4WXOA 4DL0C 5IM0B 4DLGA 4X4QA 2YH1A 4ZVIA 4JI4I 2MQMA 1RAGB 4DR5E 3GZ7A 3BGRB 3KHGA 4OJHA 2EFNA 1XMQJ 4C0OC 4ZP9A 3E51A 3QQCD 1TUWA 5CAAA 2F7VA 3GIIA 5ETOA 4ZPBA 4F02A 1EARA 3M2RA 1JLGB 4M95A 4ELUA 3ET6B 3N5FA 2M88A 4P72A 4EU0A 2R2UA 4ZPAA 1TK0A 4JI5J 5CD4H 3F44A 2XZDB 1QD1A 4QIVA 2ZVSA 4PRFA 3CJ0A 4AIMA 1NJIT 3W5XA 3LWMA 4Y2MA 1YGYA 1ZTWA 1H7SA 1HNXF 4MK8A 4DFPA 3OJSA 3LA0A 1FK9B 3OTEA 5DG8A 3CCVS 2VONA 2OAUA 1EQ0A 2CPXA 2AEMA 2ZOGA 1YVFA 2IM1A 3VHQA 3ZFVA 2F8MA 1RP5A 2YXLA 3IAS9 5A2QC 3HZEA 3BS9A 3PIPQ 4LSLA 2GVZA 1H74A 1FE4A 4DR7E 1Q4RA 1PCAA 2IYIA 1T8EA 4KO0A 3H42A 3OTOI 2APOA 5F41A 3UFCX 4DX7A 1RLCL 2Z0GA 1N52B 1WHVA 3ZC4A 1CJVA 4EO6A 3THTA 5B0BA 3FBEA 1FDNA 1XHKA 1F3VA 4ZVFA 4G1QA 1PGZA 2ZM6F 4CLLA 4A48A 3S8SA 2H5IB 2YVSA 4QU7A 3K5MA 3M2UA 2RDIA 4DBQA 4HI2A 3TZZA 4ED8A 2PO0A 2IBOA 1CJKB 4MKBA 3ILIA 5ETVA 2J76E 4ED4A 1VK3A 4C48A 1ZS6A 4JI6E 2ZEJA 3HHLD 3LF0A 3G86A 3QJLA 2BJ3A 1R6MA 5DGAA 1Y00A 3D1HA 1N34F 5A2QQ 4OO1D 4OJ3A 5B09A 2YWEA 3V81B 3P4UB 2AYGA 3TAPA 2PIIA 1S9FA 2ZH2A 3KK1A 1BUXA 3TQ1A 1JLAB 3H4DA 3OD2A 3V5RA 4YQWA 4J9LA 4L72B 1PIEA 1HNZJ 4IZKA 5LMUE 4DSFA 2V8HA 4USUA 3P6YC 3NY0A 3SSRA 1EA6A 3SQGB 4KQVA 2O1VA 3T5HA 1IKWB 1RWXB 3Q2SC 2VQFF 3L09A 1RA7A 1BQNB 1UVMA 1JLBB 4EO8A 2FC8A 2M9KA 4YB5A 3U1NA 4I67A 2MJNA 1JJ2R 1K44A 5A8KA 3LAMA 3GCWP 2XC9A 5KFQA 1P9QC 4LFBI 1NJWA 4LQ3A 2QL9B 1CQMA 2KVQE 5GAHI 1NK8A 3ZTQA 1NJYA 1HD1A 1PC5A 2W4DA 1OQ6A 3EZOA 4DV7I 3W64A 3PR4A 2EFGA 3NS6A 2KG1A 3DLKB 2OKQA 1CBKA 2C2DA 2NN6B 1D9DA 3TEHB 2NN6F 2ASDA 5LSOA 1W2IA 3MM7B 1S1VA 4DV4J 4U7CA 3ISND 2V50A 5FLXQ 4IR1A 5DRRA 4BCAA 2LCWA 2IPOB 2P2CB 1SC6A 3HSJA 2CPDA 3BYPA 4I6YA 4OFZA 4C11A 3G96A 2RF2A 1BHNA 2CQ2A 1I3OB 2ADCA 2C2KB 3S6EA 4ID5A 2XWXA 3CCUS 2ERRA 2ZITA 4X4UA 1P9YA 5AJ3J 4XAKA 3OT9A 3ILLA 3JSRA 3GJRB 2OPRB 3TVZA 1C0UA 2DJWA 5DQGA 4DPUA 2DH9A 1T95A 2LECA 2YWHA 1NDKA 3UI3A 5SZTA 1JJHA 2AGQA 3L3CA 4WUBA 2AT1B 3JQMA 4B17A 2YH0A 3ITHB 3I31A 3K2YA 2YY3A 2W24A 5GADU 1QSYA 3K1JA 4DR2E 2JWNA 5K20B 3QRPA 3O3LA 1NZ0A 1IR0A 2BA1G 1HL6A 3W2WB 2F5GA 2W9BB 1AW0A 4JI7E 4L6V3 4LCHA 3PR5B 1N32E 2NXEA 5A76A 3M6VA 1IBLJ 1SBRA 3BGUA 5E0OA 2XSJA 4HL9A 5DM7Q 4QYRA 3KJFB 3PM9A 4ANEA 4ZN3A 4PG4A 2GHWA 2V8GA 2V68A 3PX0A 1OY8A 4ZLPA 1T9XA 5ETLA 2ZBPA 4J37A 1SL2A 1FA0A 2JC0A 4ES3A 1XQIA 3VVTA 3B4DA 3CJ4A 4RW8A 4NA3A 2FYXA 1Q82T 4QYZJ 3FGVA 3HJVA 2XYPB 2LVWA 2E5LJ 1C1BB 4YB7A 4OLPA 4OZNA 4P7AA 3LGMA 3BO4A 1GXUA 2VKZG 2O66A 4ZVGA 5A0YA 2C28A 2CUYA 5AE3A 3D66A 3J81j 3CDJA 4O3QA 3MCOA 5KT4A 1BQMA 1FKAE 2V2QA 4CH7A 1NB2A 4UUXA 2XZWA 1YBTA 5KFFA 2QMUB 4IG3A 3OXGA 3G82A 2NXJA 3PRVA 3MEGA 2NS1B 1UW4A 1RHYA 4LRCA 2LQ8A 1XNQE 3W2VB 1MU2B 1FRKA 1H7WA 1TU0B 1NMEB 2JEBA 3C3LA 4F4XA 5LOQA 5F8HA 1F5BA 1QVGR 5DO2A 1V9OA 5AE2A 3J7YU 2HURA 3D28A 5A8RB 1HMVB 5JMNA 4DUZJ 1WG1A 1C0TA 2OMLA 1TV6B 2Y9HA 2VF3A 3FQKA 1VDHA 5GMEA 1YHQS 4MFBB 5KFRA 2CJYB 3IMQJ 2YQ0A 2BW2A 3ZZPA 2HKEA 2YKAA 5HO4A 4OMFG 2IAJB 2E66A 4P2SA 2GVDA 2QA4G 1FVQA 3Q8QB 2Q66A 3AD8C 3FUYA 3EVWA 3IP0A 5HLFB 4LIWA 2J9CA 1AUSL 4B3SF 4Q8FA 2UXDE 3M32A 5IM0A 1RT4B 1QSSA 2VFVA 8ATCB 1QE1B 5C0XD 3BGFA 3JS9A 2A1BA 4MKAA 4TVAB 2WTFA 3BKTA 2JHEA 4KV8A 4LF8J 2RU3A 3MM5A 1N5TA 2FVQA 4G3IA 3MPWA 3R5GA 1QAYA 3BGRA 3R9LA 4X4RA 4X65I 4USTA 2UU9F 3IWXA 2M7SA 2HZCA 2PNLA 4ICLA 3CUNA 3OVAA 2G1HA 1U24A 4NXNJ 1F3FA 5J2MB 3ET6A 2KU7A 3POTA 4NLSA 3W7BA 3B6BA 3IWLA 4O3SA 1WDTA 4I6WA 4NLWA 4ETZA 3IS9A 4F67A 5F9LA 5KT6A 5F0WA 6FD1A 1VQPS 3HD1A 3IBWA 4J3DA 4B3RI 2ZBIA 4A46A 2MXYA 1JJ4A 4X64J 4X2BA 2YNIA 4EBCA 2XI2A 1SV5A 3LOUA 4KHRA 1BXNA 2GZOA 4JI8I 4CWBA 4DV1I 1S10A 2PC6A 4QWAA 1JLEB 4Y00A 3KLHA 3L7OA 3V4IB 2VJUA 2FC9A 4K2XA 2C2ZB 2PA8D 2RVJA 4TY8B 4AXIA 3GQCA 3FDSA 2F4FA 1EI1A 2D69A 2F1DA 3IGNA 2MZQA 5L38A 1B4SA 5L1JA 5L9XA 3QT6A 1IKYA 2XMJA 1VRTB 3UD5A 3QMQA 1D8YA 1EAYC 2CDRB 3FMWA 2IIHA 2MSSA 2KRBA 1OYDA 3SDEB 3WQPA 3VVUA 5HBMB 2OO4A 2P9CA 4GKKJ 2HHXA 1RHRB 2WVFA 1TK5A 1TZ0A 3PW7A 2Z5BB 3PYDA 2EFQA 3DMJB 1VRQC 1VQ7S 5CYQB 1NK7A 3RU0A 3PDNA 1P1TA 4DR1I 5IT9C 5E5NA 5AT1B 1RHJB 2BQ3A 5JVGQ 2QLWA 1JWWA 2E9ZA 1HIYA 4TXSA 4OLOA 1Q86T 4RNNA 1XERA 1TL5A 3KUEA 1A7GE 2HHSA 2BUNA 3QATA 3R5BA 3A1YG 1XMQF 3HP6A 1TL1A 4Q45A 3CC7S 3KXDA 1GX6A 1SJ4P 4ZVQB 4KT0C 4WP8A 4UY8T 4LRFA 4B3TE 1ZPWX 3HZGA 1XC9A 2KYXA 2QYGA 4NE9C 2ADBA 1RT1B 2AJ4A 5KFCA 4JI5F 2Q79A 4USVA 1IKWA 1FXDA 2F63A 4TY9A 4PRVA 3HVRA 1BKNA 1W26A 2N3OA 1IBKE 1S5ZA 2G2YA 4PCQA 3PCOB 1Z0WA 4J5OA 3EGVA 4F4ZA 2COLA 2GMJA 3OL7A 3R5DA 4ES2A 1YZ6A 1Y5LB 1B64A 4LFCE 2BA1D 3T6BA 1UTAA 5K36C 5K14B 4IFDD 4RW4A 1J5EJ 2UUAE 5JJBA 4B9SA 1F5AA 5DLFA 2PFFB 4X62E 3DLJA 2J65A 2DHSA 2FHJD 3TANA 2HVDA 3GMEA 3BGLA 1VC5A 3KUGA 3J80U 2MGZB 3EZUA 4HLBA 4M5HA 2WONB 2GQ2A 1FFSB 3CPWR 1W25A 3BSCA 3OXLA 2W4CA 3NOGA 5KOXA 1RKIA 2CZVC 2VG7A 2IM3A 1FEHA 2W1BA 1P27B 3UE2A 3OTOJ 4HKQA 1OIAA 4CQ1A 2DYAA 4QIFA 3CCZA 2F8HA 4MQYA 2JEIA 1VBXA 5E2QA 2CA9A 4DR3E 1R31A 3C15B 4CO5A 3M30A 1U02A 1O5JA 3NLCA 1EX8A 2O1TA 1RTJB 3O8WA 3J7A1 1U6FA 3HHLC 2GV1A 1ZTTA 1TFWA 1FKOA 1AROP 3C6TA 4LF4J 5A6WA 1BD6A 4B9MA 2D9OA 5K8OA 4OO1C 1WC0A 2IHR1 5ETKA 1WC1A 5H9EK 2H3EB 1RWKB 4LRBA 2B5JA 3BH6B 2OIHA 1JLQB 4RJVA 1RAEB 4JI4E 2B3TB 5F8MA 3PIOQ 2LDIA 1HNZF 2PDAA 3PJ9A 3ZZOA 1S1WB 5I3UB 3EGWB 3EVMA 3B78A 2GO8A 4R25A 5A2QU 2Q6CA 4PAAA 4ED3A 3EUNA 4NBQA 4Z2XA 2IFXA 3NG8A 3HKZD 2CAJA 1UL3A 3GIRA 2FLLA 1RCOB 4BA2B 1RT2A 2HWHA 2HEKA 1L3TA 5IT0A 1U1NA 2Y1LB 4KIAA 2O1WA 1EJ7L 1K0VA 4X4OA 2VA3A 2Q2EB 3DDNA 2R2TA 4ZVUB 4CIOA 3LP2B 2BKNA 3FC9A 4CRJA 4CH1A 2F4VI 1M5SA 3R5CA 5IQ6A 4I56A 2AMCB 1FKAF 4MU4A 3Q24A 1GTEA 2GJ2A 4UQGA 1RWOB 4B3ME 1HR0I 1VQMS 3MTJA 4ZIWA 4DV4F 4F50A 4MU3A 1KTVA 1RT3B 3JTNA 3QIPA 2CJ9A 3QRRA 4JB8B 5DNXA 2HQFA 2MLYA 3MD1A 4DS5A 4EI2A 1O6XA 1RTZA 4WCEQ 4H4OA 2DEIA 3IGVA 3FZBA 3CMQA 2HZVA 5AJ3F 3MEDB 2AW0A 1OY9A 4TYAA 3I5BA 1ZOTA 2DH7A 1URNA 4ILMA 4ZJLA 3J7AN 1D09B 2DH8A 4KBIA 1HMVA 1Q1KA 5DM6Q 3D6MB 4EZ9A 3VZHA 1RT5B 3TAQA 2KN4A 3D2WA 3CC4S 3TJAA 1WSVA 3MUVP 4PQAA 3EPIA 1RTHA 3M1VB 2J6TA 2CG8A 1UA1A 2MQQA 1RWPB 2MKYA 2FLOA 2IAJA 3DKDA 2W7AA 2XYGB 3C66A 3P5BP 1NB7A 1NSPA 4U95A 1UA0A 2LP4A 4B9NA 5C42B 2ZE2A 5KFSA 1IBLF 3KYLA 1SUQA 1HNWJ 4YP3A 1TKDA 2H48B 2B4PA 4MIAA 2QYCA 4JV5I 4F4AA 4J9OA 5BYSA 1U45A 1VJQA 4HEA9 2DHAA 4M63A 2UXCJ 1B99A 1K47A 3AD7C 2DPJA 3WZ0A 1HYSB 4ZCIA 2C2MB 4F8RA 2JLFA 2W2PP 1X4HA 2ZBRA 2RSQA 2B9WA 2HWIA 5DQIA 4WZMA 5KG5A 2AJQA 2E5LF 4ILLA 3KLGB 1M5VC 1X4FA 4F3OA 3E01B 2B0GA 2CQPA 2I9SA 2I6WA 4F2RA 2E1RA 2OELA 2X7IA 4KPCA 2C22A 3PJXA 4LFBE 1IKVA 1F0XA 3UN3A 3K57A 1Z0CA 3C16A 4LBHA 2VBWA 1HNIB 1R0AB 1T9TA 2QLXA 1YIJS 3IWNC 2WSCC 2EWHA 1OJ4A 2CNLB 1JLEA 3G6XA 1VCTA 4AFFA 1YHCA 3W61A 2HVEA 4CO1A 4DV7E 5J2PB 2L48A 2YKOA 2VPXB 4PXCA 2K7KA 3R2DJ 1RHUB 4ED1A 3KG1A 3R6GB 1DTQB 3DYAA 2HNYB 4DUZF 1HNXI 3QJPA 3R7BB 2FQQB 4JI1J 5J2QB 4RWWA 5HBMA 1NO8A 2ILYA 3OFFA 4NCBA 4QCLA 3MM9B 5D0HA 1YJWS 3CDUA 4LF6J 2UUCI 3PEHA 1DAXA 1F2HA 2J8AA 3I4HX 3M8QA 3RRGA 3KFWX 1LWFB 2JOQA 1HBNA 2OD4A 3PW0A 1L3SA 5LMNI 2QZ8A 4DHVA 2E1PA 5JUMA 4WF9Q 5J2NA 4WP9A 3SV3A 4FYWB 1TMJA 1CQNA 2F40A 2HS0A 1C1CB 1YBUA 2CPHA 1M1HA 4NXMI 3K85A 3D6HB 3FCWA 4CM0A 4CYUA 1RJJA 4LF8F 3Q8SB 3J7Z5 1NH7A 4PYAA 1RT6A 4FBUA 3T6JA 1NHIA 5BR8E 2WB1D 1S0NA 3PRDA 2RS8A 3CW2C 4Y0FA 3PFEA 2CQ0A 2Z2MA 2HRYA 4OZ0A 4NXNF 1SH0A 2G0IA 4Z7CA 1V6HA 1KFDA 1NHVA 3IA0A 2ZDPA 1N34I 2POKA 1RT1A 2HHVA 3VWSA 2K7JA 2DR6A 2KVIA 3Q6MA 1TL4A 4I1TA 4KHMA 5LJ5Y 2YX1A 1USVA 2CIMA 3CCJS 3BKFA 2YQ1A 3Q8YA 4X64F 5DDRC 4K50A 1KQGB 4CNZA 3JYTB 5CYJA 4LIRA 2VIHA 4OHXA 1EKSA 3TAMA 2KZZA 1VYAA 1FRXA 2PEBA 4RLEA 3W9IA 3VZIA 2SXLA 4J9UE 1CS4B 4QYZK 2IJRA 4KAIA 1V3ZA 1JIHA 2OI2A 1U8SA 3Q8UA 3ZZUA 4JI8J 1GXLA 3AJ1A 3JQKA 2AYBA 3HD2A 2FLNA 1WHYA 1RWUA 4WFNQ 3D7SB 1N4LA 4GKKF 2EFOA 4OI1A 5DZ6A 2GQQA 2W9CB 1AB8A 3CCSS 2YWFA 4OX6A 1NSAA 2BJ8A 1X9SA 4RW9A 3V6DA 5E33A 4PWUA 1EB0A 3FSIA 2FB0A 1RI7A 2W2MP 2NYHA 2FY1A 4GQUA 1XNRE 3TX0A 4LOMA 4IDKA 4DQRA 1QJHA 5DETA 3L7UA 1KNZA 4GVBA 5JEAD 1H72C 4OYPA 3BO3A 1RAAB 1VGYA 4LF5E 1P6TA 5HMWA 1KR4A 4AIDA 4UTGA 4PXDA 2UV8A 4K4VA 1FCAA 2B4UA 2X3DA 4Q7AA 4DR1J 1GMUA 2MQNA 4RNMA 1WKLA 2W2NP 3K7RA 1ZA2B 4NLUA 1ACMB 2OD6A 3KNAA 3TZWA 1CC7A 2JDJA 4JI4F 5LXRA 1SPBP 2XYHB 4C8NA 4FWGA 4PG6A 3GLLA 4EZ6A 4KGZB 1CLFA 5I3PA 2P6SA 2DBBA 1QAJA 4WIIA 2HRUA 3VAFA 3SI8A 4Q0BB 3EYZA 2RDJA 1MMLA 1TMMA 4X65E 3TWZA 1XR5A 5I3UA 2C39B 3RRKA 3HT0A 4FVCA 3Q0AA 1SH2A 3VQTA 4C4WA 4ZP6A 1DURA 2DNMA 3LP0A 1UWBA 3PFOA 3RTVA 4ER8A 5DRKA 5C0XA 2ZVIA 5L1LA 1S1XB 1LQ9A 2AJ1A 2E7VA 5K36B 5K36F 4W98A 1J5EF 2VICA 2ZH7A 2FY8A 4ZHRB 1KVKA 2DRBA 2ALYB 4IFDC 1HBUB 1WOPA 4HHUA 1VOMA 4B3RE 4CLWA 2LA6A 4EEYA 4NYPA 4KFBA 1A6LA 4HDGA 3AQPA 2X1GA 1T9WA 3H25A 4DV1E 3I55S 4ZP8A 1EIYB 1RU2A 2Q3PA 3BN7A 3GR0A 5HL7Q 1YSJA 1AT1B 3NNAA 3OTOF 3PRYA 3N4WA 2H5EA 4N41A 1RT3A 1WG5A 4C98A 1RAFB 1TL3A 2ZOFA 4JYAJ 3EICA 1G3OA 3PG9A 2LXUA 3UN5A 1HBMB 4OYAA 4BDPA 3I0RB 2AZ3A 3CO9A 3OSPA 4TLRA 2C2RA 3TZYA 2DR5A 4RNOA 2B51A 1T0TV 2HYIB 2ASYA 2Z30B 2XM3A 2HFUA 5C25B 1GX5A 1FKPB 4O3PA 4N47A 2XMVA 4OO1B 2MDAA 4LF4F 2QLJB 1RT5A 2BV3A 4OO1F 3UDLA 2BEFA 4ECTA 3HHDA 1MWYA 3CMES 2B6AA 3PJWA 4CT8A 5KFXA 3H5XA 1T03A 2XLIA 2BOPA 3GP9A 4JI3J 4PYDA 2OHDA 4ZK7M 3TJ9A 3UVJB 1RGVA 2GGPB 3MCNA 2A2CA 3GYXB 3S7RA 4YR3A 2OUGA 2Z56B 4AQYE 3MMBA 1UPPA 2YPZA 4B9UA 1DTTB 4ZLJA 2MQPA 1MWZA 4RBUA 2AF6A 3P49B 4HT7A 3PKMA 3ETMA 3N6LA 4OV1A 3EJMA 3KJVB 1Y5YA 1YJRA 4R0JA 2CXEA 3BSNA 1S1UB 2ZZMA 4LFAE 2X36A 3DOKB 2QA2A 3SFGA 3R8YA 2XMWA 1Y9OA 2NXUA 3CJ8A 2R4FA 1OYPA 4ZPCA 4LF9I 3AAWB 2Z2LA 5A2QY 3SSSA 3HFVA 1S0VA 2JLGA 3QWPA 1R27B 1E6YB 1S49A 1QTMA 4DL2A 3HJCA 1NEEA 2UU9I 3DLHA 1NKCA 2WRMA 4GC7A 2MY7A 1K73T 4P7TA 3FFIA 1QUPA 3EWGA 3KLVA 4DL6A 3VQSA 2YX4A 1FWKA 4HY1A 3MXHP 5KFMA 4MKYA 4LREA 4BWJA 5IWAE 2OFGX 1Q5YA 5M2PA 2EG1A 1H2VZ 1WEZA 1F5CA 3NKYA 5C24B 3CXCR 2HNYA 1CJUB 1S97A 4U67Q 4QPTA 4CI0B 4TQSA 2LQ9A 4H4MB 2W7OA 1YJVA 1C2PA 2VKRA 4RX6A 1V3RA 5J2QA 2FHJA 1Y60A 4ED0A 2HHHI 3CJ3A 3MM9A 2MQOA 1JQGA 2UUBE 4DR6E 3DI6B 4QQBA 5D0EA 2VG6B 2P9EA 3CDIA 4WUDA 3T1HJ 1LWFA 2NXNA 2VG5B 1NK0A 4O44B 3DXBA 2YKNA 2MKJA 4J9VA 2VPWB 3IAM9 3MR2A 1OY6A 4IO9Q 1FDDA 2R7VA 5FDLA 1HNWF 4KHPI 1IBMI 2XLJA 3W60A 4K4SA 3TP2A 1ZH5A 4MYUA 2C37B 3LGHA 2D9PA 3BEGB 4OYMA 5FLXY 3T9ZA 5G0RB 1GQEA 4XPCA 2UXCF 1D8ZA 4DV2E 1FJEB 1RHQB 4OZJA 4PG5A 3ZNJ1 4FXDA 2JE6B 3DRSA 1FRIA 3RJMB 3A8KA 1N8RT 1YX2A 2QSFA 5E3CA 1JMTA 5GAHU 1N33E 3SCIE 3H90A 1RZMA 2WBRA 1BWEA 4M5IA 4F0KA 1HNVB 1X0PA 2KKHA 2QEXS 2YNFA 4WFBQ 1XMQI 5J1NA 2HHTA 2KXFA 5KFNA 1Q5VA 4WKRA 4PWWA 2MPUA 1KOOA 3M6UA 4CLPA 5EUHA 1H38A 1FO1A 5DGBA 3UNYA 2BR2B 1QLNA 2PO1B 1T94A 2F4VE 2CNNB 3TA1A 4AL7A 2UXBI 2E7WA 1IQZA 4DV3E 4BA1A 1ZM3A 2WW4A 1J2VA 1PKUA 2V4JB 1HR0E 5HMYA 4CO2A 4WP3A 4CM2A 4F36A 2HNDB 1MROB 2PEHA 1X5PA 4LSNB 4YR0A 4JI1F 1X4EA 5B0AA 2H1YA 3OR1B 3EDRB 4A47A 3HSGA 4DV6E 3GV5B 4CP5A 3MOZA 4TQRA 3FQLA 3HX9A 4IOBA 5A6PA 2XSFA 3DCAA 4LF6F 5KG2A 2J7UA 2HS4A 1WF0A 1YK9A 2V63A 4J9KA 4UY85 2AYEA 1REVB 4LVNP 2G0CA 3I9V9 4O3RA 5EHHA 4NL5A 1FJGE 2CFXA 5LJ3Y 2XS5A 3ZTSA 2WB4A 2UUCJ 1S1TB 1OO0B 2VQEJ 4X4VA 3QAUA 4C2MA 1H98A 1WOSA 4OI4A 5C0XF 2L08A 3O5TB 1A6FA 4WWSA 2V2KA 5LMNJ 2A0FB 4V1Ak 1PBUA 2Y8YA 3Q23A 4YOEA 2PFDA 1F6TA 4NLOA 5F3ZA 3DOLB 3A8JA 5KT7A 4NXMJ 1LW0A 4UW2A 3PV8A 5CH7B 2XMKA 3IM9A 2L9NA 1CJTA 3HVWA 1N5YB 3MM8A 4JV5E 5L46A 1NH8A 2MB0B 2LKZA 2V9KA 3ONQA 1KONA 1TL7A 2Y0SD 3BKUA 2KRRA 1E3HA 4USKA 5A8WA 1ZETA 4ZCMA 1TQLA 2GMLA 1K1SA 1WEYA 2J0QD 1HNZI 4B3OB 9ATCB 4NLYA 1PJ7A 5F9NA 4YB1P 3UDVA 2R7WA 3HJFA 3CJKA 2J9DA 1S4FA 4ZHRA 1Q0NA 4F0MA 4DL7A 3F0NA 5L1KA 3RW6A 2FLPA 4JI8F 2LDYA 4IH5A 3VAIA 2J7KA 2MLXA 1WHXA 3FJ2A 4JI0J 3HVAA 1JLFA 1SKSA 1K9MT 3WU5A 4KR0B 1USUA 2WZ1A 2VODA 4O4GA 2FZKB 3FRZA 3GWCA 3EDQB 5BXIA 3G9CA 1TKZB 4NYOA 1I6JA 1T11A 4IOAQ 1NU4A 4NLVA 2HVHA 3GJTB 4PWDB 1HNXE 1DY3A 2HBRB 3I0RA 2GJFA 4RW6B 4H4KC 3GCMA 2NUUG 3A4TA 3GE9A 2E29A 3MFIA 1TUGB 3P5TL 1LWEB 3ZZZA 1NHKL 4WE1B 5JEAC 4QNJA 4IYQA 4OI2A 3DN9A 3DGPB 3I0SB 2RHQB 2DIUA 2Z2ZA 3V6JA 4DR1F 1UJ4A 2BACA 2OFHX 2CDQA 1KQKA 4C3LA 1PO6A 3CCTA 5ETRA 4DJBA 4DL5A 4UOGA 1VC6A 4M5JA 2BDPA 2WVDA 2N4DA 3BDEA 1N36J 4RUAA 2ZM6E 5IV4A 1VQKS 2BE2A 2QL5B 3DRRB 2C38A 1XR7A 3C6UA 4UZBA 4KH1B 2NREA 2QGFB 5JXSA 4N8NA 4PUOB 1FNMA 3M6AA 5KFBA 3DRYA 1DTTA 4U96A 4DU7A 2WSFC 1CSJA 2JNJA 3OHBA 1N34E 4R8UA 2O3DA 4I4BA 4DL3A 4IFDB 1PJ5A 1UCNA 1JX4A 2DXEA 2MKKA 3L7ZA 1C4AA 4IFDF 3MZIA 3T1AA 2ABYA 4V19X 2E9TA 3M7NG 4OX9I 3R2CJ 3RRHA 4G65A 5HQ8A 2PSZA 2R3VA 2QL7B 1IR2A 1BY9A 4ECZA 2RH3A 3H40A 1FRHA 4PPZA 3MR7A 1E6YA 2EEYA 3M9OB 3W8GA 3FK4A 2R8JA 4URSA 3MI7X 2MZTA 1Q78A 4J9SA 1U1KA 3BSOA 4JYAF 2QA1A 2OGUA 5C2GA 2E5LI 5CZXA 2YNHA 2VQFE 2C2EA 5KFGA 2MKHA 2BQRA 1S9EB 1VQSA 4A8QA 3U1MA 3QSIA 1U2FA 2XS7A 5LL6d 3SXLA 2IOQA 3LPSA 4I2QA 1Y5IB 2OPQB 2DNPA 3KK3B 3QT7A 2IJNA 1IR1A 5K5MA 1HD0A 5HMZA 1F2GA 4I2PA 1Q7YT 5F8IA 3OHAA 2E5GA 1KC8T 2O5DA 5ETSA 4GKJI 4ZCLA 3OTCA 5I3QA 4DR4J 5FIIA 5KFVA 4DZ6A 2KT3A 4PPDA 1A0OB 5D6GA 1AZSB 1TAUA 5IQQA 2ZOMA 3M8WA 4DPYA 4JI3F 2PE8A 1WD6A 4RUHA 5J1EA 2VG5A 3D1OA 2HBQB 4O44A 2PMHA 2PN6A 4OZLA 3MPUB 4ZKAA 4NLGA 4HACB 1RTDB 3AOCA 2KJWA 4Y2KA 5FWKA 1MWQA 3CWJA 1FERA 4FN5A 3AXMA 3ISZA 5HJYA 2GAHC 4WIQA 5KAKA 4U3BA 7AT1B 1HWIA 5C7PA 3PRBA 5L9NA 3FCVA 1NHJA 4H54A 3OXFA 4OZEA 5DDPC 4PU9A 4WK1A 1YJ7A 3R5AA 4JI2I 2ZBQA 3WU3A 4K4XA 4F0HA 4L3NA 1B0PA 3RGIA 1DQ8A 1S7IA 4V19J 3LP1A 4LF8I 2RQ4A 3PS3A 2H65B 2VV5A 1LWCA 1GXTA 3TZXA 2QO3A 4L74A 2YKMB 3MEEB 3KJNB 3H8YA 3OL6A 4ECYA 1PSDA 1V3SA 4PXBA 2YNGB 2AIRB 4M5GA 5SUHA 2XHCA 3SIPB 1B0VA 2XY5A 1RSCA 5IOLA 3D54A 4LF9J 4LF2A 2BR2A 2PO1A 2MMYA 2YKPA 4NCGB 3LWLA 4YDDB 1IM4A 5T7LB 1UAWA 4Q5VA 2DGQA 4DQSA 3OVBA 5F0UA 1GEHA 4DI6A 5ETMA 4X64I 5B0DA 4WFZA 3Q2TC 4DQPA 2NN6D 4C8MA 2HNDA 3CIMA 1IXKA 3CJ5A 3GFYA 3MCSA 1JLCA 3NS7B 1Y7PA 3OR1A 4F3QA 1FXRA 3VR1A 4NZ6A 2QT7A 2Y8WA 3W65A 3AODA 1UEKA 2HWTA 1HWJA 3WIVA 2NPIA 3EX7B 2R9LA 2R7OA 5ITHA 3T1HF 2Z57B 2X51A 2L9WA 3I32A 3RUBL 4IRCA 1KLMB 3SZ2A 4PZVA 2LXIA 4C3KA 2HHHJ 3WHIA 1U6ZA 1W7WA 4GKKI 2Q6BA 3HHKA 4K4ZA 4IRKA 2QFIA 1BC6A 1PILA 4OHZA 1AUDA 2LEAA 1MSWD 3BBBA 3BM7A 2YX7A 2PNZA 3FEXB 2EKNA 3K58A 4FZVA 4RBVA 1G2EA 2MQ8A 3VAMA 2PO2A 1VQ5S 3CD7A 1R8CA 2B43A 4FP9A 3QWUA 4ECUA 4ZCKA 2PI4A 2M4MA 4P7VA 1MX0A 1YRUA 1T9VA 1UDNA 2DHXA 5H9EJ 1RA6A 2H54B 1IBMJ 4KHPJ 4YY3I 3KMSA 3NNHA 2HRTA 3TA2A 3CJSA 5CHCB 3PX4A 1JJCB 3NBPB 2B9XA 2ZH8A 5MAOA 4K8RA 4K5RA 3QT8A 4FYXB 2BANA 4EYIB 2M52A 2M0GB 1VHFA 1FHTA 1PAUB 4B3SE 1RUSA 1N0UA 3A3PB 1HPZA 5KFYA 2BJ1A 3T5JA 2LYVA 1M90T 2V34A 2FJAB 3QLHA 4AYBD 3OPKA 3Q8VA 4NASA 4HYKA 2A6MA 3T5LA 3ETOA 3OTBA 2G2OA 2BJEA 2UU9E 3US5A 3JQJA 2ZBKB 2CKWA 1HQEB 4F04B 4GC6A 4K0KI 3WX8A 4E98A 2GA7A 2B7CB 4RUCA 5F8JA 2DR9A 2HFOA 1ZM9A 2QG9B 3CD0A 3DLEA 2UV8G 2N3LA 5IZHA 3J80Q 2UXBJ 2X1FA 2PT0A 3J7ZT 1S7HA 1D3WA 2V8PA 5KFUA 1TKZA 1J5EI 2I5JB 3NZKA 2HMIB 3EXYA 2IYGA 3M7ND 4TU8A 4JV0A 4DSIA 1RBOB 4M5DA 4WFXA 3KLEB 2OPPB 4RW6A 1CULB 1GAOA 4NLRA 2ATLA 1T3OA 2M70A 5HN0A 4ED6A 1SL0A 1WHWA 2UUCF 3MAHA 2VQEF 3AB4B 3GILA 4ED2A 2MHNA 5U47A 3VGTA 3RAXA 5KT3A 3V6HA 5LMNF 3NGUA 3DGPA 3SBMA 4RBTA 2Z8QA 5D4LA 3T3FA 1RDRA 2JEAB 2OSQA 3J81C 3CC2S 2GFFA 2KZMA 4OZ5A 5AXKA 4NXMF 4OI6A 5DG9A 5RUBA 5IT4A 1LK5A 3I6PA 2FPHX 1IBME 1R6VA 4LF7J 5IC4B 1UVNA 1X5OA 3IC1A 1F60B 1WTBA 4A8SA 4LF4I 1A9NB 4RL1A 3NGDA 1JKHB 1U4BA 4FF3A 3A3NB 2EFVA 2C2NA 1KBRA 3CDAA 2E1MC 4PQUB 1JB0C 5D8HB 1XWLA 3MEKA 2G13A 4ZITA 1YBAA 2BA9A 1OYRA 1RREA 2V4QA 1KVJA 1Z0BA 2J0XA 2IRUA 4O0NA 1PG5B 1TVRA 4XPEA 4P2XA 3LPYA 1VRUB 1XMQE 3L4BC 1OMSA 4QR2A 5HQLA 3EGZA 3I87A 1W2BR 2OJ3A 3K89A 3M6XA 2C42A 1TKTB 3J81Q 3DRPA 4JI0F 3MWBA 3ZXWA 1QAXA 1UMJA 3KDNA 3EPGA 5FD1A 3U1LA 1S4EA 3QO9A 2ILZA 2RHSB 4NLPA 3D0GE 2X1BA 2W9AA 4DN0A 2VD3A 4LBPA 5CXTA 4JI5E 1NK5A 2LEPA 4OYOA 2ZJQQ 4KKOA 4ZDNA 4RW7B 4QR1A 2J5AA 3VALA 3E8OA 3Q89A 1NHHA 3HSDA 3CDBA 4QIEA 2DHHA 1RYRA 2AJ2A 2LU1A 1S6PA 3ZTRA 3M9NB 1YG0A 5D3GA 1D1UA 5JEAF 3ZNUA 2DGOA 1IBCB 2GW8A 4I0WA 4NA1A 3ULHA 5HROB 4X4TA 1J27A 2OPQA 3KK3A 4KYZA 1SH3A 2Y1JA 1Z1ZA 2ZFHA 4HR2A 1DQ9A 1SKWA 1WF1A 3D0HE 3KUHA 4NYZA 2H4WB 4MU0A 3D3BJ 3M85G 1N36F 1R89A 5HP1A 2FIUA 2CG4A 2RD5C 3GJSB 4WFYA 3MUTP 2WHOA 1EETA 2EK6A 5GAGI 5AXMA 4J9NA 3IRWP 2GMHA 1DHMA 1Z0VA 3M8ZA 4M8LA 4RNFA 3THVA 2KH9A 2F3JA 5KG7A 2HLUA 3GFZA 1N88A 2ZUGA 2DCUB 4DCOB 3KLFB 4DZDA 5I4MA 1HQUA 4QBUA 1RR9A 2RS2A 3D67A 1WEXA 5E41A 4XTTA 3GIMA 1FJ7A 1VLOA 4CO3A 3LUYA 3MM6A 1EP4A 1FEEA 3TUJC 3C14A 4IZJB 2QIFA 2AZ1A 3D6TB 1UKUA 2OPSA 3PNIA 1NBEB 1HNWI 4KGXB 4PG8A 2CZ9A 2NR0A 1SKUB 2DRAA 5CYMA 5D4NA 1S16A 3NGTA 3M8YA 1N5VA 1TKXB 2W4PA 1HNZE 2UXCI 3MEEA 4U8YA 4N3OA 3TOQA 1VJWA 1Y11A 1DJ0A 2VBZA 4P74A 1XR6A 4FNIA 3UN2A 2GC8A 2RUGA 4OX9J 2EBEA 2EVZA 4OQJA 1UW9A 2ZHOA 1WOOA 2EI5A 2ZH1A 2MZJA 2AX1A 1VQ8S 2NZ4A 4MU1A 1CVJA 4MAKA 3PO4A 2ZD1B 2ZDOA 1VQ4S 1XMOJ 4RR5A 2W2QP 1UFKA 4DFJA 5D4OA 1LFPA 3OBIA 3SCLE 3MMAA 2ZH5A 4J9QA 1IQTA 5F8GA 2BW7A 3I5CA 1RBLA 3GCXP 4DR4F 4Y3CA 3H59A 3UHMA 2CYYA 1PBAA 2WW8A 4DV5J 3MAAA 5HJXA 3BBCA 2CPEA 3KLIB 1YJUA 3AHPA 3DM2B 1D9FA 1MMNA 4DV4E 1LW2A 3R5JB 4AT1B 1KLMA 3VAHA 2M5YA 4JI1I 1VQ6S 4GKJJ 2D7SA 3AOAA 3K8WA 1SIWB 1K0TA 5DZ7A 3IR7B 1NLKL 3MF5A 5HVGA 4LF6I 4FXVA 5DROA 1SCJB 5E7OB 4DG1A 4LPFA 1M0SA 4A8OA 3GIKA 4C8ZA 1DFDA 1ULRA 3R27A 2HK2A 1S6QB 1R8AA 1NDPA 4AUKA 4YR2A 4NLDA 3D9BA 3M2RB 3CVKA 3N6MA 2GCFA 2ZH3A 4YMEA 3BBFA 4W92B 4ES1A 1H7UA 4YHHI 4YB6A 2AYMA 4OYBA 4FNHA 2CZ4A 2DNYA 1ZA1B 5EX0A 2PI5A 4NI2A 3DRXA 4CLYA 3QFWA 3KWMA 3PHTA 2D3O1 1IWGA 2WSEC 4DUYJ 4JI2J 3NMRA 3UW1A 1JK9B 3AFGA 1RWWB 3GTYX 1T3NA 4N5SA 1IBLE 1TAQA 1I94J 3G2XA 5DRPA 4LSLB 8AT1B 4LF9F 2GVZB 2CNKB 1FI4A 4HXZA 3D5MA 1OS5A 2GQCA 4CLKA 4KC5A 3NL0A 3CTRA 1PJ6A 4P71A 2G9OA 1X4BA 3V4MA 1X60A 2RNEA 2DNOA 3NWRA 1CJVB 4AL6A 2ZNYA 3J7AM 1KHVA 2KT2A 4WU2A 1LKZA 1MMDA 3ZKDA 1F9FA 2VHGA 1JLGA 4G1QB 2HHWA 1KD1T 1U09A 2W8KA 3LQVA 3RYLA 1GFWB 2E5LE 2EKYA 1S59A 1M5HA 4M5KA 3HPOA 3T1YJ 1Q7LB 2ZNZA 4Y65A 3FEZA 3M2UB 3VAKA 3AT1B 2ASLA 3A8IA 1QUVA 1GMVA 3VTIA 2ZUAA 2PO0B 1U1RA 3TUIC 1SKRA 4EFAC 4KPYA 1FK9A 4NEYA 4L3KA 2AU0A 1U49A 1FFGB 1PYOB 3HFZB 5KFZA 2HHHF 1T02A 1VBZA 4FWDA 3UCGA 1CC8A 1Y5NB 1NPKA 5HVHA 4PR6A 5AE1A 4U7UD 3I5AA 3DDKA 2V9WA 1Q8KA 2QLFB 3BZQA 1SXLA 3BPDA 3KK1B 3UD3P 4ISAA 4X66J 3CD5A 5CD4A 2J9EA 1KQFB 3PXGa 2GNKA 3H1CA 4DUZE 1XK8A 4IZKB 1ZBTA 1WJ9A 4I6AA 1IBMF 4KHPF 2Y1RI 4B9VA 2DKOB 4USWA 2EXUA 1U25A 4N7TA 1S0MA 3TJ8A 1G7CB 1ZM4A 2J8SA 3OLBA 3C8YA 1VS3A 2BOAA 2PO4A 4NX9A 3CULA 4FW5A 5BJRA 1VIOA 4L73A 2B56A 2CPZA 4QNKA 3D1QA 4YY3J 1CJKA 5BYQA 4RKUC 3BQ1A 5A8KB 4P9SA 1FX4A 3M85D 1BWVA 1S57A 2MEWA 4ERDA 3GYNA 5H9FK 1T05B 3Q83A 4LRAA 2BE7D 1SC1B 3H4BA 4LF8E 4PKDB 3CGIA 4LR8A 1RB0A 2HPUA 3V81A 4FW6A 1TK8A 4Y2AA 2D41A 1JLAA 2YWGA 1T7PA 2HQIA 1S6UA 4IR9A 4RU2A 1VQNS 1TKTA 1VQYA 1UETA 4ANCA 4NXNE 2DNLA 4DX8H 4G1PA 1S1VB 4DWIA 4ZVPB 3LPEA 2UXBF 3WBZA 4FS2A 3SQGA 4M5MA 1U1QA 3DFEA 1HWUA 1X5SA 2RF2B 4PABA 4K0KJ 3G6YA 4X64E 3UD4P 1BQNA 5IT9Q 4ID5B 1JLBA 1Z5BA 2JVRA 2CVEA 5GVQA 5IXUA 4AXJA 3NNCA 1SB6A 5KFOA 2R7UA 3ICLA 1X8DA 2E1AA 1C0UB 2GO3A 2UVWA 1HI1A 2KFYA 2CQHA 1LWXA 3QAEA 1Q8BA 2QJ3A 1CPZA 3GG1A 2JEFA 2IVFB 4JYAI 5C5JA 4LT6A 1WG4A 5EX3A 3QJJA 3DLKA 2WAQD 4FKXA 2F1FA 1Y4UA 1WACA 2O1PA 3MAQA 2NN6A 4DPOA 2DCLA 3PHEA 4GKKE 1U0HB 5LSRA 3MM7A 4WZQA 4YS2A 1XBWA 3KKFA 2QE5A 3P06A 3N6NA 2VDIA 2IRYA 4B3TI 4LCFA 2DR7A 2HHQA 1NPRA 3VAJA 3W62A 5ETTA 1UDSA 4EGLA 4DR5J 1NDCA 4OKGA 1WNEA 4I7FB 4WU3A 4WUCA 1WUUA 1SC3B 1MN7A 1U48A 4MIBA 2OPRA 4J7CA 2XCPA 3CCWA 4JI3I 3QRQA 4RW8B 1IBKI 3GSIA 1KDNA 4HDHA 1ZM2A 4URQU 4HH0A 3HXMA 1WELA 4WKYA 4P73A 4IUFA 2BJDA 3ITHA 4JV1A 3NRBA 4USJC 2VOPA 1RAIB 3MMCB 2UUAI 5D0RA 4X62I 3W2WA 1U1PA 4DPWA 2W9BA 4OYWA 3G82B 3VGSA 2AGPA 1ICEB 2FJEB 3DLLQ 3MEGB 1SIZA 4K7QA 3M4XA 4FYYB 3KK2B 4ZVTB 5T14A 3JAMC 4RO0A 4GO5X 3PACA 2JEBB 1XEZA 3F41A 4DR7J 2FVRA 2KXHA 2QV6A 4DV0I 3S1TA 1RXOB 4CDIA 4TU7A 2JFDA 3N79A 4TU9A 2DNNA 1VQLS 3J81U 3UQSA 5G4DA 3X3UA 4HT5A 3MPYA 4DR3I 4DPTA 4ECQA 1C0TB 4A8KA 2ZC3A 4DMZA 5K36E 1J5EE 2XZTB 2CG9A 4Z7YA 1C1BA 3CDWA 2WOMB 1R0BG 1FDBA 2JX2A 4DCPB 1S99A 2NZCA 1X4AA 2GVDB 2FGOA 3QZ7A 5DG7A 2WVEA 4FVMA 3CE8A 3OTOE 2BYCA 1NJZA 3DM2A 4FPRA 3M32B 3ISNC 4HHHA 3RB6A 4RU9A 4JI6J 2ATCB 3LALA 4P52A 3W2VA 3CCLS 1MU2A 2DGVA 4KV8B 2DVIA 3WIUA 3JXOA 3MM5B 3JAMQ 3MTKA 1JNRB 3TW0A 4Y2IA 4ZS6A 4X4SA 3RR8A 5B0FA 4QJVA 2KO1A 3BO2A 4LR9A 1R8PA 1VIXA 4KJIA 1IM6A 2V2ZA 5A8RA 3T1HI 4ICLB 5LT5A 1S6QA 1YI2S 2BKOA 1EHWA 1TV6A 1KHWA 5LMUJ 1G6BA 3POTB 4LCGA 4LF4E 2VL1A 3ZO7A 2WBMA 2CPFA 4MFBA 4OO1E 4WK3A 4OYXA 4DSEA 3IS9B 2QLBB 1SJ1A 2MZ1A 2DO0A 4FPIA 4C8KA 4ED7A 4KRWA 4ZVHA 2QMXA 4WYLA 2YNIB 5HLFA 1SV5B 1BGXT 3MMJA 1QM9A 3PX6A 3GPAA 2XNQA 2HQGA 2HQDA 3KLHB 1RT4A 1QE1A 1YWXA 1KSPA 4OX9F 2MZSA 5K36D 1FRMA 1XJWB 2ZHAA 4B3MI 3R3TA 7FDRA 2I38A 3KJQB 4RPFA 2B9EA 4NOHA 1IKYB 2JH3A 2VFTA 1XMOF 4A8FA 2GIQA 2W8LA 2WCXA 2C3MA 1RABB 4DX6A 2HFZA 5D15A 3SCKE 2LQBA 4QR0A 4IKAA 2VUGA 5J2MA 2QN6B 3W5YA 4OIXA 3RBEA 5KG3A 3N01A 3QNWB 4X84A 5C2CA 2DNRA 3TR5A 4OI3A 4FW4A 2BRLA 3GV8B 2R7QA 5ETNA 3QT5A 4DV5F 1VHIA 5KFJA 1UJ5A 2HLTA 1SVDA 1DRZA 2HIQA 3WX4A 3AB2B 4QWCA 3AY0A 3CF5Q 3V4IA 1PKPA 4IFYB 3UR0A 4GKJF 4IO1A 4WYWA 1RBAA 4OX7A 1NK4A 4TY8A 4DCJB 3QGHA 3T5KA 4NZ7A 1ZPVA 2RRNA 1TL1B 1VMBA 2XO7A 5T41A 1VRTA 3BR9A 2PNMA 2RE1A 1RADB 4DR2J 2GX8A 2J6UA 2F8EX 2JVOA 1FNXH 3K5OA 3SDEA 2IERA 1KTQA 3GB0A 1CEZA 3SV4A 4DEZA 3EZ5A 4JI7J 4M5NA 4PG7A 2HQ3A 3P45B 4WPAA 1N32J 2XB2D 5FLXC 2VQEI 2KFZA 2Z5BA 3OFGA 4CCHA 3DMJA 4DDFA 2A18A 5ELWA 3KDOA 4N56A 1SJQA 2Z4PA 5CYQA 3U1YA 1KWMA 3PEJA 3NS5A 1QDUB 4UOCA 4CLTA 3D3CJ 3KG4A 4FWHA 4JI2F 4DUYF 3KMQA 3PYEA 2N7YA 3UNGC 4YHHJ 4DSJA 3B4MA 1UWAA 1NK6A 5C0XC 1I94F 2DGTA 2CQGA 3QZ8A 1HNWE 5F8LA 4RW4B 2XEXA 1U2CA 4ECVA 1T05A 2DGXA 3O6QA 2NPFA 1UZHA 1VBYA 3WU4A 4MIWA 1LXNA 2UXCE 3Q1QA 3UCUP 1YITS 2H9ZA 1S79A 4WXWA 1R6YA 1FRJA 2VG7B 4ZMMA 2ROGA 3EXCX 5DQHA 3CCMS 2B9YA 3B4TA 2J7WA 4OHVA 4A4JA 2NQPA 3T1YF 1XNQJ 1NJXA 3MFHA 1X0FA 3OQ2A 4L76A 3M30B 3THPA 4U9RA 1UVKA 3D0IE 4JI0I 4ZOSA 3JTPA 2YBVA 1BE4A 4NZ0A 3R6LB 2NLWA 3N28A 3P96A 5K14A 4WJBA 3L95X 3G71S 1FKOB 4BWMA 2BX6A 3C6TB 1JXVA 1R8BA 4W90B 1BQXA 2RILA 1SJ3P 2IRXA 2J0WA 2XHWA 3HO1A 5L39A 2MGZA 2B5JB 2FJVA 4X66F 2LQJA 2WONA 4FF2A 4MTPA 4X4PA 2A3JA 2EK1A 4CTAB 2EG2A 1YQHA 2HBZB 3NXZA 4J9MA 2DNKA 2YPYA 1UP1A 4JI1E 3K5NA 4K2JA 2I1RA 3ILOA 4F4YA 3TX8A 4P75A 1U0HA 1HI0P 3D6FB 2FJXA 2UXDJ 5BR8I 2CVIA 1OPIA 1H6KX 2XTJP 4LF6E 4N76A 2HK3A 2UP1A 1Y0HA 2KXNB 2RB7A 2AE8A 2MZRA 3BJYA 5JVHQ 2Z2YB 4I7FA 2XMAA 2HS3A 3C15A 1MLAA 2XGQA 2D3OR 4YY3F 1RE1B 4OZ1A 2DD8S 1Z0GA 1RT2B 3CO0P 4YHHE 1RTJA 1N36I 1KVIA 4B9TA 3OL8A 4F3MA 2QA4S 5C0XE 1VQOS 4LJMA 1FD2A 3GSDA 1APSA 2H5JB 2YWKA 2N4CA 2VH7A 3UCZP 2GJIA 2IDLA 3OR2B 2Q43A 1JLQA 1WC3A 3MMCA 2RQCA 2IESA 2PMZD 1JNZB 4C97A 1FESA 2HNZB 3QIPB 2VC1A 1S1WA 1WWHA 2C3OA 4NMLA 4GO7X 3MR5A 2DRDA 1R43A 3DLBA 3KK2A 1H0HB 1SQGA 4J9RA 4K0KF 3OVSA 1NAQA 4OYIA 3EM1A 4H4OB 4ID8A 1F1BB 2MKCA 3IBCB 4UF4A 2GIFA 2R8IA 4I64A 1UJ6A 1OYSA 4HI1A 4BA2A 1L3KA 4RNHA 3TUZC 4D3HA 1XNRI 4EBEA 1Z2ZA 2K1RB 1QAIA 2UVUA 1V5IB 1U8WA 3KHRA 1KLNA 1Z5CA 3NCQA 3LP2A 1XXEA 1LNQA 4JI8E 3IRXB 4LF5I 4CZCA 4C8YA 2WOMA 2IM2A 3LTOA 1RTHB 4FXWA 3IO1A 3GFXA 3HVTB 1VLYA 5IT9U 3G6ES 4IRDA 1MW7A 1S76D 2VFUA 1E6VB 2ZE2B 4TYBA 4DR5F 4MKVA 2F9JA 1SUQB 2RQKA 2OEMA 3N5BA 4F7VA 3J80Y 3HI9A 1Q95G 3DNCA 4DR4I 3MEDA 3PW2A 1GMWA 3NCRA 5B0CA 4DXLA 1YH8A 3HHLB 1FF2A 4B3TJ 3CCRS 4D3GA 2FUG9 2OMOA 6FDRA 3M9MB 4DR1E 1UFWA 3CJRA 1S72S 4UUWA 3SMZA 3VCDA 4ELTA 1QTNB 2V6AA 3M1VA 3C46A 4R1FA 3MPDA 2PD1A 3W1YC 2VESA 1IBKJ 4A8XA 2FJDB 1IKVB 3C16B 2JEGA 3UR3C 2OEKA 1KRPA 2V94A 1PC4A 5KOWA 2O1UA 5C42A 3C19A 3RBZA 4LFCJ 2R7XA 1XTZA 4DQQA 4LF1A 1M1KT 5IC6B 2UUAJ 4O23A 4DR7F 2KFNA 3NGSA 4X62J 5K8NA 1FWLA 2PA3A 3MGJA 1HKAA 2MHEA 3T9NA 1IKXB 2WK4A 2NXCA 3P8BB 4WTYA 4USIA 3X1LB 2GIRA 3DYAB 1YZ7A 2CPJA 5FJ4A 1HYSA 2V4RA 1R8HA 1Y6ZA 3FNNA 1UVJA 2XMUA 3KHHA 1WC5A 2DGUA 1X9WA 3HLUA 4IFDE 4DV0J 1X5TA 3O1LA 3TVKA 3D68A 3KLGA 3H5UA 3G8QA 3E01A 4LQ9A 4ENOA 4J9PA 2WVCA 2VBYA 4HH1A 1HWKA 3IXQA 3M8QB 3MDFA 5EWEA 2VDHA 3BGOP 1HBNB 4A8WA 4RWXA 4DR3J 4OJ1A 4B08A 5J2NB 3M8PB 4NWBA 4MH8A 3H98A 1HNIA 1R0AA 1Z2LA 4XTJA 3J81Y 3ZZRA 3Q86A 4K59A 4UZCA 4JI6F 1NKBA 3BDPA 4JYAE 4IFYA 5J2PA 4CYUB 3P3EA 1RHKB 2FZCB 3MD3A 3IR6B 1RT6B 1FDAA 4LBIA 3KHLA 1DTQA 2Y0BB 4AQYI 3RBDA 3DXSX 5IV3A 1KIJA 4N77A 1KN6A 2P5VA 2BR0A 4JI4J 3K5LA 3R97A 5KFHA 5LMUF 4Y34A 2QX0A 4HYMA 2K3KA 1RISA 4FYDA 4MDTA 5GMDA 1B63A 3HMJG 3GR1A 2ZWPA 3JAMU 3UDEA 3TNVA 4LFAI 4JI3E 3DC2A 4ZVEA 2G2ZA 2U1AA 4DPXA 2R7SA 3NCPA 1VBKA 1Y3JA 4FW7A 1RTIB 4ZPTR 1C1CA 3TAMB 4C6AA 2GO9A 1Q81T 2E5JA 2BA0G 2JRSA 1FNOA 1Q16B 3MECB 4ZJQA 2HKJA 3H7HB 5MLCV 2CQ3A 2G1DA 1GNKA 2XGPA 5KFAA 1V5VA 2DXFA 4L75A 5IWAI 2FHOB 3ZKBA 4C3MA 4B3MJ 4U8VA 1X7VA 5B7WA 4E0DA 4C8OA 1PYSB 2Q1LA 1WC4A 5EWFA 1ZZNA 4RW9B 2Z5CB 4DV0E 3V6DB 4TLQA 3IG1B 4BC9A 2IVMA 2DITA 3PO5A 1N6QB 5CCMA 4IDKB 4DU8A 2DR8A 2XY6A 3JYTA 2UUBI 4DR6I 1Z0TA 4GVBB 1WKJA 3LNUA 2BM1A 1D0EA 2RU9A 4Q8EA 3TI0A 4QPXA 5GAGU 2HBYB 3K59A 1HHQA 4KGVB 4KQZA 3DHXA 2X1AA 3E2EA 3A13A 1CS4A 3FSYA 3C2PA 3W63A 1H7XA 3FBFA 4R5PB 3BPSP 3AOBA 1UEUA 1PAEX 4DR2F 2VB6A 2CADA 4CTAA 4ZIVA 3BREA 2VZ9A 2W9CA 3SEOA 3HSZA 2ZH6A 4OV6A 4DV2I 4JI7F 2ACYA 1N32F 3KTQA 4FS1A 1FXLA 2P6TA 1N54B 3AJ2A 2P9GA 4ILRA 3T1HE 1Q79A 3TEGA 3CD6S 1N33I 5IFMA 4Q44A 3FSXA 5J1PA 4IS9A 3LP0B 4O4RA 1UWBB 5EN1A 3HFKA 4YHHF 2RUSA 3CCQS 3A3OB 5C0XB 5HVFA 5THWA 1S9GB 2IA0A 2F9DA 2AJ0A 2DT9A 2RJZA 3VGVA 1N5SA 1NRKA 2QRRA 4LF7I 2KHCA 1HHSA 4LVOP 2XNRA 4NLTA 2J9DE 1DARA 2CQ1A 3HCXA 4KFBB 1IJEB 5F8NA 1KS2A 3OR2A 4KTQA 4XK8C 5M2RA 1EKRA 3O44A 4LFBJ 3PW5A 1F9EB 4DV3I 2QTWA 2GO4A 2EC0A 2UVRA 2DNGA 1IN0A 3QFHA 1VC0A 4Q0BA 1QSLA 2HNZA 5LL6R 1TL3B 1XNQF 4DV7J 2LQ5A 4NCAA 4ZLLA 2C39A 4DV6I 2D1CA 2C2OB 2H51B 5KFWA 1DZ5A 4ALZA 2LJPA 1T9UA 4Y6IA 4ANDA 4ELVA 5HI7A 3M8SA 5KFDA 2HFNA 3P3GA 1S1XA 4KGKA 4UOFA 5K36A 1N0VC 4NEZA 1P42A 1RWNB 2NCKL 2ZBCA 3TO8A 2K1RA 3PVXA 1FJGI 4ZPWR 1HBUA 4IFVB 2AKWB 3V2UC 5LM7E 4XO0A 4ZPDA 4URGA 2N7CA 5FLXU 2B6AB 3IRXA 2R7RA 1REGX 3DHWC 2D3UA 1FRLA 4IH7A 1T03B 3CMAS 1RAJA 3HVTA 1R6LA 3JSBA 2IJFA 4DSKA 2UXDF 3NMAA 2EW9A 3R7NB 3MMBB 1E6VA 5DJBA 2HHUA 3ZTOA 2AD9A 4I69A 2RAQA 1HBMA 2VPZB 2YQ3A 3QYYA 1GT8A 2XG8A 4QWDA 4CLUA 4FF4A 3SFUA 3W66A 3HT3A 1P1LA 2CWXA 4QW8A 1X4DA 5BR8J 3FKBA 2HW3A 4CLZA 4FBTA 2JC1A 1LV5A 1URRA 4QIWD 1IWAA 2ROPA 3W8PA 5C25A 3HHLA 2UUCE 1Z5AA 2MQLA 2VQEE 3F56A 5B0EA 3AA8A 3MUMP 1CG2A 1FKPA 2C3YA 4F25A 2ZWOA 4I68A 4OO1A 3ADAC 3HKMA 1KP6A 2FHKA 3LO3A 2WNRB 2MSTA 5LMNE 3J7AG 2GHPA 2IVYA 2KI2A 4JOUA 4DX5A 3TRGA 5K8PA 4NXME 4C0HA 1B3TA 2HG4A 2LLZA 5HK4A 3OW2R 2FVPA 3UVJA 3CIZA 2GGPA 1UVIA 1S12A 1TELA 3FFIB 1NKEA 4OL8A 3MR6A 2ACMA 4JUZA 2JEJA 1LXJA 3ZZTA 3JTOA 3W9JA 5E3RA 1OPZA 3H2UB 2K2PA 2DPIA 2KG0A 2V0NA 4A8YA 1IKXA 4OX8A 1X4GA 3KJVA 1U47A 3GJQB 2BXJA 5CQGA 4F2SA 2RQMA 3M2VB 2XI3A 1S1UA 2GHVC 1UFLA 3I96A 3DOKA 4AL5A 4RUBA 1WI8A 1ZXMA 2BA0D 2JLEA 3UDCA 4JI0E 4IG0B 3LGNA 1FVSA 2J6SA 1XNRJ 1VQ9S 4LR7A 1XMOI 2YKNB 3M8PA 3UPFA 2JJ4D 1Q8LA 2V2VA 2ZH4A 4LF5J 4ZVOB 3VAGA 1PYTA 3GU0A 2L41A 5FDLB 2ZM6I 1AFJA 4ZA1A 1RACB 2E44A 9RUBA 2DY9A 4FW9A 2QMWA 2VC0A 3PZPA 4PXEA 5C24A 4DQIA 1YJNS 5AXLA 2JL9A 4NRTA 4U7UK 4DV5I 4B3TF 3Q8PB 2R8HA 5JEAE 1CJUA 3ZTPA 5AXNA 5EL9A 5IT9Y 2OSRA 1SJFA 4H4MA 1ROFA 2AEJA 3DRSB 1UDOA 3FBCA 5KFPA 3AA9A 5LXYA 1XIQA 2DISA 1PVGA 2IOPA 1Z0EA 1YDLA 5DDOC 3DI6A 4X65J 1LOUA 1Z59A 3GG0A 1MG7A 4ATNA 2VG6A 2YNFB 5D4PA 1DLOB 1WTFA 1IBKF 5E3QA 1N36E 4BLGA 1UPMB 3MOJB 3G8SA 2A6OA 1KKHA 4AM3A 5KTQA 3BQ0A 3IR5B 2IM0A 1RTIA 2VPYB 3PTWA 1JXEA 4LFCF 1SL1A 2CJAA 2XY7A 2HZAA 4CO4A 3G8TA 3B8HA 2UUAF 1EQMA 4X62F 1B62A 2NYIA 2C37A 4C0BA 5GADI 4B3RJ 1TFYA 4BA1B 5G0RA 4EMDA 2AEFA 4P10A 5H9FJ 3WDOA 3MECA 4BBYA 2MYFA 2E5HA 3FVYA 4WFAQ 2CPYA 4DV1J 4HTJA 4BC7A 2VQFI 3E3XA 4MT1A 4DUYI 2E5IA 4A8MP 2JE6A 2FZGB 2BZ2A 3GLJA 2QC3A 3HF5A 4DV0F 3G6VA 1I94I 4ZVRB 2Z5CA 1HNVA 2AQ4A 3BYRA 3IG1A 2ZJRQ 1K8AT 1NCLA 4DR3F 1S6OA 2XQCA 3AD9C 2WP8B 3ENAA 4Q2MA 1OSCA 1N6QA 3TQEA 5LSLA 1MN9A 4YUDA 4N8OA 2HAIA 1VFJA 3I82A 2CJKA 1XMBA 1XN9A 4ZN1A 1B7YB 2XCAA 2AHOB 3DD6A 3M05A 2CQCA 4M5LA 3T1YI 4DFMA 2R42A 1Z4UA 4Q43A 2H4YB 4UQTA 4IOCQ 2V4JA 4M94A 1HHTP 4R5PA 4YFUA 2E9RX 1MROA 4LSNA 1LW0B 3SYZA 3HHEA 4K5SA 2EC2A 2XS2A 2KHDA 1CJTB 3MM8B 1X9MA 4GVLA 4AQYJ 4DR4E 1B7FA 1U1MA 1TL7B 1S48A 1REVA 3J7YI 3KOAA 5A8WB 4X66I 2DNQA 1UZDA 1Y4SA 5E3AA 3DGVA 1T9YA 1U7LA 1UEVA 3VF0B 1S1TA 3BV8A 1NUEA 3LANA 5CCLA 2OEJA 2DGWA 1S9GA 3CJKB 4RZRA 1NZAA 3Q6NA 2IC3B 5DS7A 4LFAJ 2A2DA 4IZJD 1H2UX 2X3GA 2KTQA 2DY1A 3HHNB 1R7IA 2PMWA 3FCHA 5GAEU 3H20A 1RQ0A 1HQ2A 4C7QA 1JLFB 3JAMY 3DOLA 5D77A 3CWVA 4O4GB 4DF4A 3H0PA 4B3MF 2M2BA 2L3MA 1M5OC 4AE5A 2O01C 2CJBA 1NXIA 1D6TA 1N5YA 3MCMA 4E8UA 4P6QA 1U6BA 2KT5A 3OUYB 2RMLA 2VU5A 1SQEA 2EFPA 2XMMA 1RLDA 3OLAA 5L8RC 3ENVA 4KB7A 4ECRA 5IWAJ 1G1XA 4LUBA 2HFVA 3GV7B 4U6PA 4GRSA 3CJTA 4CLSA 4B3OA 4LF9E 4E2FB 3RR7A 3NAHA 2LFVA 4BS2A 3LW5C 4EYHB 4FYVB 3NWGA 4IFVA 1IUJA 1YRTA 3BSAA 3PY8A 4F4WA 2UUBJ 4DR6J 1UVLA 3LH2S 2BBEA 3U7JA 4MJKA 4Z37A 4YDXA 2ZC4A 3WC2A 2I2YA 3ELHA 4WTOB 2BE2B 3EGNA 4XDDA 2XBPA 2C38B 3C6UB 2HSEB 4P2MA 4DLEA 2CQDA 2XO6A 1YTYA 4PWDA 1H73A 1U0SA 1DQAA 4F4KA 3EVOA 4JP8A 4OI0A 3B82A 2R7TA 2DEJA 3IFEA 3NGKA 4X4NA 5ADZA 4DV2J 3QSYB 1LWEA 2HHHE 4WE1A 2B8PA 3MURP 2RDDA 3SSQA 3P76A 3ZM7A 4R8UB 3IBFB 2KDOA 2N82B 4B3SI 3I0SA 2I0XA 2B4VA 3O2IA 3L7ZB 2W01A 1N33J 2WNRA 3GIJA 1AXQA 4NPOA 4DR5I 1GH8A 2V8VA 3RB3A 2RKIB 2R8GA 1RK8A 2KYZA 3WU6A 4ECXA 2WVBA 4LFBF 4I3HA 4KHPE 3B54A 4NLXA 1ZAXA 3DRRA 3RAMA 5EWGA 2BJ9A 3DLGB 2A10A 2DGSA 4DV7F 2F4VJ 3SCJE 2YNHB 1TR0A 4PUOA 4KSEB 1RHMB 2OP5A 1NSQA 4KE5A 1GK8A 5DNLA 4DV3J 2JZ5A 4URLA 6AT1B 4J91A 1ZAWA 2RRAA 1HR0J 5KG1A 4GMKA 5L3JA 5HQMA 2AJFE 5H1SV 1MU5A 1YRXA 4I2QB 3ILJA 4IFDA 1HARA 4DV6J 1HBOB 4I2PB 3M2VA 1U1LA 3ENQA 4G1IA 2R2RA 1FTRA 4K4UA 4OZ3A 3CCES 1J5OB 3KG0A
chains in the Genus database with same CATH topology
4DR7I 4JI1I 2Z5CA 4FWHA 2UXBI 4B3TE 4WUCA 5LL6R 3J80C 4DV3E 3PYEA 1KVKA 1WUUA 1ZM3A 2WW4A 2O1UA 3K1JA 3HULA 4DR2E 4B3RE 1HR0E 2IOQA 3LPSA 4LF6I 4DV6I 1NZ0A 2UXBE 3QT7A 2LJPA 1HNWE 4DV1E 4JI3I 2AJ4A 1FWLA 1IBKI 2HK2A 2E1RA 2XEXA 2X7IA 3J81C 4JI7E 4DV5E 4DV6E 1ZM2A 1N32E 2NPFA 4GKJI 4ZVIA 4JI4I 4LFBE 4PRVA 3WU4A 1BKNA 1N0VC 1Z0CA 1IBKE 3PRYA 2UXCE 3Q1QA 1H7UA 4YHHI 1Y6ZA 1Z0WA 3D4JA 4DR5E 3T1YI 2R42A 4DPYA 1FJGI 4GKJE 1IBME 3V2UC 1OJ4A 2UUAI 2UXDI 4X62I 4DV7E 4LFCE 4DPWA 1FJGE 4LF4I 4JI6I 2UUAE 1IBLI 4X62E 4HACB 4M1KA 2HFUA 1HK7A 5FWKA 1A6FA 4FN5A 3JAMC 1IBLE 1HNXI 4DR4E 4P7AA 4XTJA 1FI4A 4DV0I 4HXZA 1RREA 2BV3A 1NHJA 4JI0I 1Z0BA 4JYAE 4LF7E 4X66I 1FKAE 2V2QA 4USMA 4PU9A 1Y4SA 4JI2I 3WU3A 1XMQE 2UUCI 1H7SA 4DR3I 5LMUI 4DPTA 3J7AM 4HACA 1J5EE 3ZKDA 4AQYI 3J81Q 4DUYE 4JI2E 2CG9A 5LMNI 4LF8I 2UUCE 4Z7YA 1XNQE 1Z5AA 2VQEE 2A2CA 4DR3E 4JV5E 4JI5I 3Q6NA 1KIJA 2E5LE 5A2QC 1S4EA 2A2DA 4IZJD 3GONA 4AQYE 1VISA 1H74A 1I94E 5LMNE 4DR7E 3J7AG 4JI1E 4JI5E 3OTOI 2O1TA 4USKA 4NXMI 3K85A 3K17A 5BR8I 4HYMA 3CWVA 1NHHA 3OTOE 4LF6E 4NXME 5GMDA 2CGEA 1HNZI 2HK3A 1B63A 2VF3A 1XHKA 5GMEA 1D6TA 4LFAI 1NHIA 5BR8E 4JI3E 4P52A 3PYFA 4DPXA 1ELOA 4FWDA 3JAMQ 3F0NA 4JI4E 2X36A 2HKEA 3ZZ0A 4LFAE 4X64I 1Z0GA 2J7KA 3ZZTA 4DUZI 4Z7CA 4YHHE 3T1YE 1N36I 4LF9I 2V2ZA 3WU5A 1N34I 3T1HI 1USUA 2UXDE 4DUZE 3HJCA 3Q6MA 2UU9I 2HKJA 4LF9E 1USVA 3B78A 4LF4E 4ED4A 2GQ0A 1UEKA 4JI6E 4IZKB 5A2QQ 5IWAI 3ZKBA 1ZM4A 1FWKA 4HY1A 1HNXE 4X65I 1ZXMA 2Z5CB 5IWAE 4DV0E 2PNLA 2HFSA 1Z0VA 4JI0E 2O1WA 2Q2EB 4GKKI 2OI2A 4X66E 3V5RA 3ZZUA 1XMOI 1PIEA 4IZKA 4DU8A 5LMUE 2F4VI 1RR9A 4JG4A 4B3MI 2UUBI 4DR6I 1Z0TA 2V2VA 3LNUA 1EA6A 2BM1A 2Z5EA 4KQVA 4LF8E 2O1VA 1H73A 4PRXA 4RPFA 2ZM6I 2HHHI 4DR2I 4B3ME 4B3RI 1HR0I 2GS8A 3B82A 3PYGA 1MX0A 2UUBE 4DR6E 2DEJA 1XNRI 1QZRA 4FW9A 4IZJB 4YY3I 1KTVA 4NXNI 4JI8I 2ZM6E 2HHHE 4WUDA 1HNWI 4DV1I 2CZ9A 1Z5CA 4JI7I 4DV5I 1XNRE 3ZM7A 4YY3E 1N32I 4NXNE 4JI8E 4LF5I 4B3SI 1S16A 3QT8A 4LFBI 2DEIA 1HNZE 1U2RA 3LTOA 2UXCI 1H72C 4DR5I 1EI1A 4N3OA 4LF5E 1FNMA 3H4LA 4B3SE 3M6AA 4KHPI 1IBMI 1PVGA 1N0UA 2IOPA 3QT6A 1Z0EA 3QT5A 4DV2I 4UTGA 3WU6A 4MYUA 4DV7I 4IZJA 1Z59A 4LFCI 4DU7A 1MG7A 2EFGA 4X64E 5IT9Q 4I3HA 4KHPE 1Z5BA 1N36E 4DV2E 2V34A 1N34E 3T1HE 1PKPA 1N33I 1KKHA 4FWGA 2UU9E 1ZXNA 2ZBKB 2Z5BB 3PYDA 4DR4I 5FLXQ 4DXLA 4OX9I 4K0KI 1N33E 3B8HA 2R3VA 4JYAI 4DR1I 2PNMA 1B62A 4URLA 5IT9C 4LF7I 1ZM9A 4UT4A 4OX9E 4K0KE 4EMDA 1XMQI 4X65E 5L3JA 1Y4UA 3J80Q 2ZITA 1DARA 1MU5A 4DR1E 2BM0A 2V8PA 4DV4I 1J5EI 2VQFI 4GKKE 4DUYI 4DPUA 4MYTA 1XNQI 3P06A 5FLXC 2VQEI 4JV5I 2Z5BA 4R1FA 2E5LI 1XMOE 4B3TI 4DV4E 4DV3I 2VQFE 4WUBA 2F4VE 1I94I 1K47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 I;  4JI1 I;  4FWH A;  2UXB I;  4B3T E;  4WUC A;  5LL6 R;  3J80 C;  4DV3 E;  3PYE A;  1KVK A;  1WUU A;  1ZM3 A;  2WW4 A;  3K1J A;  3HUL A;  4DR2 E;  4B3R E;  1HR0 E;  3LPS A;  4LF6 I;  4DV6 I;  1NZ0 A;  2UXB E;  3QT7 A;  2LJP A;  1HNW E;  4DV1 E;  4JI3 I;  2AJ4 A;  1FWL A;  1IBK I;  2HK2 A;  2E1R A;  2XEX A;  2X7I A;  3J81 C;  4JI7 E;  4DV5 E;  4DV6 E;  1ZM2 A;  1N32 E;  2NPF A;  4GKJ I;  4ZVI A;  4JI4 I;  4LFB E;  4PRV A;  3WU4 A;  1BKN A;  1N0V C;  1Z0C A;  1IBK E;  2UXC E;  3Q1Q A;  1H7U A;  4YHH I;  1Z0W A;  3D4J A;  4DR5 E;  3T1Y I;  2R42 A;  4DPY A;  1FJG I;  4GKJ E;  1IBM E;  3V2U C;  1OJ4 A;  2UUA I;  2UXD I;  4X62 I;  4DV7 E;  4LFC E;  4DPW A;  1FJG E;  4LF4 I;  4JI6 I;  2UUA E;  1IBL I;  4X62 E;  4HAC B;  4M1K A;  2HFU A;  1A6F A;  4FN5 A;  3JAM C;  1IBL E;  1HNX I;  4DR4 E;  4P7A A;  4XTJ A;  1FI4 A;  4DV0 I;  4HXZ A;  1RRE A;  2BV3 A;  1NHJ A;  4JI0 I;  1Z0B A;  4JYA E;  4LF7 E;  4X66 I;  1FKA E;  2V2Q A;  4USM A;  4PU9 A;  4JI2 I;  3WU3 A;  1XMQ E;  2UUC I;  1H7S A;  4DR3 I;  5LMU I;  4DPT A;  3J7A M;  4HAC A;  1J5E E;  3ZKD A;  4AQY I;  3J81 Q;  4DUY E;  4JI2 E;  5LMN I;  4LF8 I;  2UUC E;  4Z7Y A;  1XNQ E;  1Z5A A;  2VQE E;  2A2C A;  4DR3 E;  4JV5 E;  4JI5 I;  1KIJ A;  2E5L E;  5A2Q C;  1S4E A;  2A2D A;  3GON A;  4AQY E;  1VIS A;  1H74 A;  1I94 E;  5LMN E;  4DR7 E;  3J7A G;  4JI1 E;  4JI5 E;  3OTO I;  4USK A;  4NXM I;  3K17 A;  5BR8 I;  4HYM A;  3CWV A;  1NHH A;  3OTO E;  4LF6 E;  4NXM E;  5GMD A;  1HNZ I;  2HK3 A;  1B63 A;  2VF3 A;  1XHK A;  5GME A;  1D6T A;  4LFA I;  1NHI A;  5BR8 E;  4JI3 E;  4P52 A;  3PYF A;  4DPX A;  1ELO A;  4FWD A;  3JAM Q;  3F0N A;  4JI4 E;  2X36 A;  2HKE A;  3ZZ0 A;  4LFA E;  4X64 I;  1Z0G A;  2J7K A;  3ZZT A;  4DUZ I;  4Z7C A;  4YHH E;  3T1Y E;  1N36 I;  4LF9 I;  2V2Z A;  3WU5 A;  1N34 I;  3T1H I;  2UXD E;  4DUZ E;  2UU9 I;  2HKJ A;  4LF9 E;  3B78 A;  4LF4 E;  4ED4 A;  1UEK A;  4JI6 E;  5A2Q Q;  5IWA I;  3ZKB A;  1ZM4 A;  1FWK A;  4HY1 A;  1HNX E;  4X65 I;  1ZXM A;  5IWA E;  4DV0 E;  2HFS A;  1Z0V A;  4JI0 E;  2Q2E B;  4GKK I;  2OI2 A;  4X66 E;  3V5R A;  3ZZU A;  1XMO I;  1PIE A;  4DU8 A;  5LMU E;  2F4V I;  1RR9 A;  4JG4 A;  4B3M I;  2UUB I;  4DR6 I;  1Z0T A;  2V2V A;  3LNU A;  1EA6 A;  2BM1 A;  4KQV A;  4LF8 E;  1H73 A;  4PRX A;  4RPF A;  2ZM6 I;  2HHH I;  4DR2 I;  4B3M E;  4B3R I;  1HR0 I;  2GS8 A;  3B82 A;  3PYG A;  1MX0 A;  2UUB E;  4DR6 E;  2DEJ A;  1XNR I;  1QZR A;  4FW9 A;  4YY3 I;  1KTV A;  4NXN I;  4JI8 I;  2ZM6 E;  2HHH E;  4WUD A;  1HNW I;  4DV1 I;  2CZ9 A;  1Z5C A;  4JI7 I;  4DV5 I;  1XNR E;  3ZM7 A;  4YY3 E;  1N32 I;  4NXN E;  4JI8 E;  4LF5 I;  4B3S I;  1S16 A;  3QT8 A;  4LFB I;  2DEI A;  1HNZ E;  1U2R A;  3LTO A;  2UXC I;  1H72 C;  4DR5 I;  1EI1 A;  4LF5 E;  1FNM A;  3H4L A;  4B3S E;  3M6A A;  4KHP I;  1IBM I;  1PVG A;  1N0U A;  3QT6 A;  1Z0E A;  3QT5 A;  4DV2 I;  4UTG A;  3WU6 A;  4MYU A;  4DV7 I;  1Z59 A;  4LFC I;  4DU7 A;  1MG7 A;  2EFG A;  4X64 E;  5IT9 Q;  4I3H A;  4KHP E;  1Z5B A;  1N36 E;  4DV2 E;  2V34 A;  1N34 E;  3T1H E;  1PKP A;  1N33 I;  1KKH A;  4FWG A;  2UU9 E;  1ZXN A;  2ZBK B;  3PYD A;  4DR4 I;  5FLX Q;  4DXL A;  4OX9 I;  4K0K I;  1N33 E;  3B8H A;  2R3V A;  4JYA I;  4DR1 I;  1B62 A;  4URL A;  5IT9 C;  4LF7 I;  1ZM9 A;  4UT4 A;  4OX9 E;  4K0K E;  4EMD A;  1XMQ I;  4X65 E;  5L3J A;  3J80 Q;  2ZIT A;  1DAR A;  1MU5 A;  4DR1 E;  2BM0 A;  2V8P A;  4DV4 I;  1J5E I;  2VQF I;  4GKK E;  4DUY I;  4DPU A;  4MYT A;  1XNQ I;  5FLX C;  2VQE I;  4JV5 I;  4R1F A;  2E5L I;  1XMO E;  4B3T I;  4DV4 E;  4DV3 I;  2VQF E;  4WUB A;  2F4V E;  1I94 I;  1K47 A; 
#chains in the Genus database with same CATH topology
 2NSB A;  3TUP A;  4DR7 I;  3JSY A;  2FHM A;  1UDQ A;  2DTJ A;  4IG0 A;  4ECS A;  4OHY A;  2HGM A;  3MHY A;  3M8R A;  3BH7 B;  5J1E B;  1FJG J;  2UXB E;  2AX0 A;  4HVZ A;  2BJ7 A;  5ETQ A;  2BKP A;  2DXD A;  3QID A;  1OQ3 A;  3EMT A;  3QGP A;  3OJU A;  2HAF A;  2ZKU A;  5EGY A;  2BMB A;  3OV7 A;  1G4C A;  1S9E A;  2P8I A;  3KNG A;  5JEA B;  4JV2 A;  5BR8 F;  1WOR A;  2VFS A;  2ZH9 A;  1M5P C;  3W3S A;  2RT3 A;  3BB5 A;  4ETX A;  2MY8 A;  3AQO A;  5KG0 A;  2Y1I A;  3IM8 A;  4JI6 I;  2HIY A;  2ASJ A;  3OTD A;  4M1K A;  2KM8 C;  4DFK A;  4JV5 J;  3LP1 B;  1NND A;  3W9H A;  1HK7 A;  1R3N A;  2W25 A;  1LWC B;  1AZS A;  4DS4 A;  3JSM B;  3RZA A;  1BMQ B;  1FT8 A;  2O3Z A;  1DLO A;  2XMT A;  2K8G A;  1FTC A;  4QWE A;  4LF7 E;  2G4B A;  4WBF A;  1I1G A;  2VBX A;  3VV2 B;  5LMU I;  2GAG C;  4HAC A;  1RTD A;  1NZ8 A;  2UVV A;  5I42 B;  5DDQ C;  1L3U A;  2JFK A;  3BR8 A;  5M2U A;  4JI5 I;  3DU5 A;  2MJU A;  3L7P A;  3M7V A;  1RKJ A;  1HI8 A;  3GON A;  4BHQ A;  5CAB A;  3RB0 A;  4DUT A;  1VK8 A;  4YN3 B;  4EBD A;  2FDN A;  3FRY A;  3K17 A;  4JBC A;  4ZP7 A;  3CT9 A;  2XUL A;  1JLC B;  2FTR A;  5BYR A;  1KFS A;  2CGE A;  1TP7 A;  3NOC A;  3AJD A;  3PYF A;  3OFE A;  1C4C A;  2ZZT A;  1AFI A;  1FWP A;  1ELO A;  2KL8 A;  1TUV A;  2D3Z A;  1XNR F;  4QOT A;  2YKM A;  1HNX J;  3ZZ0 A;  1X4C A;  2V69 A;  2WP8 A;  3H5Y A;  2C3U A;  3V6K A;  2HGN A;  2UUW A;  2YNG A;  5KFL A;  4ED5 A;  2VOO A;  1M1G A;  3I56 S;  5ETP A;  4ZJO A;  1FJC A;  1LEO A;  3FMB A;  2QFJ A;  4LF5 F;  3R1H A;  1KQS R;  3M6W A;  5CA5 A;  4W4M A;  3RBX A;  1OWX A;  4NCG A;  1ITP A;  4K4T A;  2Z58 B;  4K4Y A;  1YJT A;  2PNZ B;  4B9L A;  1L5U A;  5T7L A;  5K8M A;  3K0J A;  4OJG A;  3N9U C;  3AH6 A;  4CO0 A;  3DOM B;  4CT9 A;  1RCX B;  2PO2 B;  2K3I A;  1EZZ B;  3GFH A;  2MLZ A;  3CB4 A;  4B02 A;  2IBK A;  2ZM6 J;  2XWY A;  3P3C A;  3RG6 A;  2UUT A;  2JSX A;  2R2S A;  3K8V A;  4ZVS B;  1JXL A;  5B08 A;  3BN4 A;  2C1E B;  1KOH A;  4X65 F;  2BAN B;  4JG4 A;  1RT7 B;  1LK7 A;  2CNO B;  3DU6 A;  2VJV A;  4AD6 A;  4DR2 I;  3PYG A;  2YKQ A;  3OSN A;  5DLG A;  2BQU A;  1NSK L;  4ECW A;  2B8Q A;  1HPZ B;  2LXF A;  1HW8 A;  1YJ9 S;  3JB9 k;  1N34 J;  4JI7 I;  3L9Z A;  3QLH B;  5E3P A;  1N32 I;  1LFW A;  2MTL A;  2NSC A;  2IC3 A;  4B3R F;  3NGR A;  1H3D A;  2LEB A;  3FBB A;  4U3D A;  2CQB A;  2HVZ A;  3PW4 A;  2O67 A;  4DV1 F;  2DIV A;  3TAR A;  5D78 A;  1YLX A;  5KG6 A;  1NK9 A;  1AA1 B;  1IVZ A;  3PS1 A;  1IJF B;  3DLE B;  4DN9 A;  2FJW A;  2XLK A;  3NBP A;  1NM2 A;  3R7S B;  2J0S D;  3BF4 A;  1S77 D;  3H2V E;  2RRB A;  5KT2 A;  2DK2 A;  2VQF J;  3OUY A;  2FD2 A;  2G0J A;  1RAO A;  3P3D A;  1ZAV A;  4ITS A;  4M5D B;  1ZZF A;  3QGG A;  3OFH A;  1WSR A;  4LRD A;  4OX9 E;  1M5K C;  1QVF R;  3NP5 A;  4NRU A;  3DDI A;  1O8B A;  1I51 B;  4KO0 B;  3F73 A;  1RWM B;  4IQM A;  4DV4 I;  2V5H G;  3CDE A;  4OZ2 A;  1XNQ I;  5F3T A;  1NHU A;  2M8D B;  2AWZ A;  2BVZ A;  1XMO E;  1HQE A;  4KH0 B;  4FW3 A;  5HAT A;  3FZ2 A;  3TYT A;  1RYS A;  2DB1 A;  2NN6 C;  3PS2 A;  1RAH B;  2FVS A;  2W2O P;  2FGC A;  3QBC A;  3HUL A;  5L1I A;  1RWV B;  1GTH A;  4NLQ A;  2BRK A;  5EDW A;  3T41 A;  4AQY F;  2I5J A;  3MR3 A;  2CPI A;  1VR6 A;  2EBG A;  2HMI A;  4DV5 E;  5HAO A;  3T19 A;  3H5S A;  1GMW D;  1E3P A;  3KLE A;  2OPP A;  4QWB A;  1CUL A;  1WC6 A;  3A8E A;  4DOZ A;  3D4J A;  1Y3K A;  2PGC A;  4GKJ E;  3Q8R B;  1NPP A;  4IH6 A;  2UXD I;  4DSL A;  3VGU A;  1TVR B;  1N48 A;  4HTI A;  1O0P A;  4LFA F;  1B0T A;  1IBL I;  2JEA A;  1SJR A;  5KFI A;  3DRP B;  2OLW A;  2RKI A;  5HMX A;  4XDC A;  4UOH A;  2W7P A;  3QO9 B;  1RU1 A;  4NMX A;  4MK7 A;  5KT5 A;  1X31 C;  5KFE A;  3CJQ A;  4QU6 A;  3U27 A;  3U02 A;  5D0G A;  1TTH B;  2EPI A;  3RAQ A;  4O0I A;  4USM A;  4KKO B;  2LU2 A;  3DLG A;  3CSK A;  1JKH A;  3HKW A;  3W5Z A;  1WKK A;  3HM9 A;  5IWA F;  4QZV B;  4DUY E;  4JI2 E;  2DO4 A;  2IY5 B;  1S6P B;  4PQU A;  2HHP A;  4PEO A;  2DNZ A;  1ZYQ A;  4TNO A;  5GMK a;  1VIS A;  1I5O B;  1I94 E;  5D3G B;  5HSP A;  1FX2 A;  3UWT A;  1D9A A;  4G6V B;  3NAI A;  1OYE A;  3GMG A;  2F65 A;  1HWL A;  2LMI A;  1Q8I A;  4DL4 A;  1VRU A;  2ROE A;  1HBO A;  4OYZ A;  2YTC A;  3U1K A;  1HW9 A;  1R0C B;  2UUB F;  4DR6 F;  2OTJ S;  1J5O A;  2V67 A;  1NDL A;  1KEK A;  4J90 A;  3FEY B;  1P8G A;  3I4P A;  5HP1 B;  4ZLN A;  3PKY A;  2UZA A;  2NN6 E;  3N0V A;  2DNH A;  4CLF A;  1EET B;  4EK2 A;  4DUZ I;  4C11 B;  3T1Y E;  3SQO P;  2AGO A;  4CH0 S;  4RW7 A;  4TKT A;  3CJ2 A;  2MKI A;  1FD8 A;  2BE9 B;  1WDD A;  2CJQ A;  4CNY A;  2CJX B;  4H4K A;  2E1C A;  2JT2 A;  1DBD A;  7FD1 A;  2GQ0 A;  4QIG A;  2B7B B;  3WC0 A;  5KG4 A;  1HQU B;  4EWT A;  3AXK A;  2OH2 A;  4LSZ B;  4DV2 F;  5JEA A;  3H2L A;  2R8K A;  2ZKT A;  1SI9 A;  2D74 B;  3HK2 A;  3G87 A;  1HA1 A;  2CQI A;  3MM6 B;  4FKY A;  1EP4 B;  2B4O A;  3R1L A;  5HRO A;  4XIU A;  2LA4 A;  1WI6 A;  3C14 B;  2HFS A;  2ZHB A;  2AP6 A;  1N33 F;  1N5Q A;  4DF8 A;  2OPS B;  5EKW A;  4X66 E;  2BAB A;  5HAN A;  1B70 B;  2CWK A;  3TA0 A;  2IMW P;  2I8E A;  4YEA A;  3CED A;  5CYM B;  2OTL S;  3GYG A;  3ENW A;  1K1Q A;  1H2T Z;  1BLU A;  4S0M A;  1QY7 A;  2QSW A;  3JSM A;  3BQ2 A;  4LF7 F;  1AYE A;  4B3S J;  2Z5E A;  2ZJP Q;  2FJB B;  4PRX A;  2V8D A;  2KJV A;  3QPI A;  2L9D A;  2XSJ B;  3A12 A;  2CRL A;  2GS8 A;  3MPV A;  4TN2 A;  1U26 A;  1QZR A;  1SC4 B;  2F4V F;  4NXN I;  4USH A;  4FDF A;  4F26 A;  5I42 A;  4ZPV R;  4DV3 F;  4YY3 E;  2FVC A;  3LAK A;  2UU9 J;  3KLF A;  5KFT A;  1HR0 F;  4LMZ A;  5CZV A;  2CQ4 A;  3IN5 A;  1U2R A;  4MMO A;  4O3N A;  3CNQ P;  3S01 A;  4K4W A;  3H4L A;  1YKW A;  2VAS A;  3MMA B;  1Y10 A;  2HGL A;  3G4S S;  2C3P A;  2IDE A;  4DV6 F;  4IQX A;  3OL9 A;  4FF1 A;  4IZJ A;  4LFC I;  5B0G A;  4O3O A;  5A0Y B;  2M8H A;  4P2F A;  2K06 A;  2HQC A;  1VI7 A;  1BQM B;  5KFK A;  2NUH A;  4OHW A;  4IG3 B;  1TKX A;  1F9H A;  3MAA B;  1ZXN A;  1N56 A;  4QW9 A;  1HLW A;  1Q53 A;  1S0O A;  2ZZN A;  3I9Z A;  2AV5 A;  1LW2 B;  3K5P A;  1FJG F;  1HFE L;  4HHJ A;  3RW7 A;  8RUC A;  2M3D A;  4C9D A;  2IA6 A;  3ZZY A;  1FFW B;  2RIJ A;  3QGI A;  4Y2C A;  5K9F A;  3UO0 A;  4UT4 A;  2U2F A;  4K0K E;  4MK9 A;  4NA2 A;  2KB2 A;  5GAE I;  1WF2 A;  2BM0 A;  4DG1 B;  1L3V A;  4C8L A;  4MYT A;  2ZD1 A;  3TVY A;  3NEK A;  3DOM A;  1OSD A;  1FE0 A;  3RB4 A;  1SQF A;  2E7X A;  2YWW A;  4KGM A;  1U1O A;  2IMO A;  1MNE A;  4EUV A;  3J80 C;  2KM8 B;  3EE3 A;  4KY3 A;  4R0E A;  4Q2L A;  2MKS A;  4JV5 F;  2HVI A;  2DHG A;  1Y4Z B;  3KRN A;  5DRQ A;  2VFR A;  5IS2 A;  2VA2 A;  4NI2 B;  3HDS A;  2Y3Y A;  2ALZ A;  4Y28 C;  1RT7 A;  3Q22 A;  1O51 A;  3KLI A;  4WXO A;  4DL0 C;  5IM0 B;  4DLG A;  4X4Q A;  2YH1 A;  4ZVI A;  4JI4 I;  2MQM A;  1RAG B;  4DR5 E;  3GZ7 A;  3BGR B;  3KHG A;  4OJH A;  2EFN A;  1XMQ J;  4C0O C;  4ZP9 A;  3E51 A;  3QQC D;  1TUW A;  5CAA A;  2F7V A;  3GII A;  5ETO A;  4ZPB A;  4F02 A;  1EAR A;  3M2R A;  1JLG B;  4M95 A;  4ELU A;  3ET6 B;  3N5F A;  2M88 A;  4P72 A;  4EU0 A;  2R2U A;  4ZPA A;  1TK0 A;  4JI5 J;  5CD4 H;  3F44 A;  2XZD B;  1QD1 A;  4QIV A;  2ZVS A;  4PRF A;  3CJ0 A;  4AIM A;  1NJI T;  3W5X A;  3LWM A;  4Y2M A;  1YGY A;  1ZTW A;  1H7S A;  1HNX F;  4MK8 A;  4DFP A;  3OJS A;  3LA0 A;  1FK9 B;  3OTE A;  5DG8 A;  3CCV S;  2VON A;  2OAU A;  1EQ0 A;  2CPX A;  2AEM A;  2ZOG A;  1YVF A;  2IM1 A;  3VHQ A;  3ZFV A;  2F8M A;  1RP5 A;  2YXL A;  3IAS 9;  5A2Q C;  3HZE A;  3BS9 A;  3PIP Q;  4LSL A;  2GVZ A;  1H74 A;  1FE4 A;  4DR7 E;  1Q4R A;  1PCA A;  2IYI A;  1T8E A;  4KO0 A;  3H42 A;  3OTO I;  2APO A;  5F41 A;  3UFC X;  4DX7 A;  1RLC L;  2Z0G A;  1N52 B;  1WHV A;  3ZC4 A;  1CJV A;  4EO6 A;  3THT A;  5B0B A;  3FBE A;  1FDN A;  1XHK A;  1F3V A;  4ZVF A;  4G1Q A;  1PGZ A;  2ZM6 F;  4CLL A;  4A48 A;  3S8S A;  2H5I B;  2YVS A;  4QU7 A;  3K5M A;  3M2U A;  2RDI A;  4DBQ A;  4HI2 A;  3TZZ A;  4ED8 A;  2PO0 A;  2IBO A;  1CJK B;  4MKB A;  3ILI A;  5ETV A;  2J76 E;  4ED4 A;  1VK3 A;  4C48 A;  1ZS6 A;  4JI6 E;  2ZEJ A;  3HHL D;  3LF0 A;  3G86 A;  3QJL A;  2BJ3 A;  1R6M A;  5DGA A;  1Y00 A;  3D1H A;  1N34 F;  5A2Q Q;  4OO1 D;  4OJ3 A;  5B09 A;  2YWE A;  3V81 B;  3P4U B;  2AYG A;  3TAP A;  2PII A;  1S9F A;  2ZH2 A;  3KK1 A;  1BUX A;  3TQ1 A;  1JLA B;  3H4D A;  3OD2 A;  3V5R A;  4YQW A;  4J9L A;  4L72 B;  1PIE A;  1HNZ J;  4IZK A;  5LMU E;  4DSF A;  2V8H A;  4USU A;  3P6Y C;  3NY0 A;  3SSR A;  1EA6 A;  3SQG B;  4KQV A;  2O1V A;  3T5H A;  1IKW B;  1RWX B;  3Q2S C;  2VQF F;  3L09 A;  1RA7 A;  1BQN B;  1UVM A;  1JLB B;  4EO8 A;  2FC8 A;  2M9K A;  4YB5 A;  3U1N A;  4I67 A;  2MJN A;  1JJ2 R;  1K44 A;  5A8K A;  3LAM A;  3GCW P;  2XC9 A;  5KFQ A;  1P9Q C;  4LFB I;  1NJW A;  4LQ3 A;  2QL9 B;  1CQM A;  2KVQ E;  5GAH I;  1NK8 A;  3ZTQ A;  1NJY A;  1HD1 A;  1PC5 A;  2W4D A;  1OQ6 A;  3EZO A;  4DV7 I;  3W64 A;  3PR4 A;  2EFG A;  3NS6 A;  2KG1 A;  3DLK B;  2OKQ A;  1CBK A;  2C2D A;  2NN6 B;  1D9D A;  3TEH B;  2NN6 F;  2ASD A;  5LSO A;  1W2I A;  3MM7 B;  1S1V A;  4DV4 J;  4U7C A;  3ISN D;  2V50 A;  5FLX Q;  4IR1 A;  5DRR A;  4BCA A;  2LCW A;  2IPO B;  2P2C B;  1SC6 A;  3HSJ A;  2CPD A;  3BYP A;  4I6Y A;  4OFZ A;  4C11 A;  3G96 A;  2RF2 A;  1BHN A;  2CQ2 A;  1I3O B;  2ADC A;  2C2K B;  3S6E A;  4ID5 A;  2XWX A;  3CCU S;  2ERR A;  2ZIT A;  4X4U A;  1P9Y A;  5AJ3 J;  4XAK A;  3OT9 A;  3ILL A;  3JSR A;  3GJR B;  2OPR B;  3TVZ A;  1C0U A;  2DJW A;  5DQG A;  4DPU A;  2DH9 A;  1T95 A;  2LEC A;  2YWH A;  1NDK A;  3UI3 A;  5SZT A;  1JJH A;  2AGQ A;  3L3C A;  4WUB A;  2AT1 B;  3JQM A;  4B17 A;  2YH0 A;  3ITH B;  3I31 A;  3K2Y A;  2YY3 A;  2W24 A;  5GAD U;  1QSY A