4EMDA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
299
Chain Sequence
GAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
total genus 97
structure length 299
sequence length 299
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4emdA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4emdA01
4X65E 5L3JA 4URLA 2UUBI 1Z0GA 1MG7A 5LMNI 5BR8I 2V2VA 4DR5I 1N0VC 2X36A 2X7IA 1IBLE 4I3HA 1IBKI 1H7UA 4DR4I 1Z0TA 4JI4E 4X64I 4EMDA 4WUBA 4HXZA 3D4JA 4FWDA 3K17A 5IWAE 1N33E 1XMQI 4LF6I 4X65I 1XNQE 1VISA 4LF9I 1OJ4A 2UUCE 4LF8E 2AJ4A 4JV5E 4USKA 4DPTA 1IBLI 4GKJI 1ZM9A 2BV3A 2F4VE 1ZM4A 2VQEE 4X62E 1MU5A 4DV2E 3CWVA 4B3RI 2GS8A 1Z0BA 1Z5BA 1N33I 2CZ9A 3F0NA 4JI3E 4WUCA 4JI2I 3Q1QA 2HKJA 4X66E 2UXCE 3J81C 2R3VA 3GONA 3J81Q 1MX0A 4HY1A 4DR7E 3WU5A 2EFGA 1H73A 4JI0E 4DUYI 2HHHI 2A2DA 1N34E 3T1HE 2VQEI 2V34A 2HFUA 5GMDA 4DR3E 1HNXE 1FKAE 1NHIA 4DR2E 3QT7A 1IBME 2V2QA 1XHKA 4MYUA 2V8PA 1N0UA 4DV0E 5IT9C 3M6AA 4DV5E 4DV7E 5IT9Q 1NZ0A 4DV4E 4LF5E 4AQYE 5FLXC 5FLXQ 3WU6A 1KVKA 3T1HI 2VF3A 1EI1A 3ZKBA 4JI8E 4DPXA 1IBMI 4YY3E 2XEXA 4DU7A 4FW9A 3LTOA 1HR0E 4DR6I 4HACA 3B78A 4NXME 4DV7I 2DEJA 4DXLA 2UU9E 4PRVA 4LF5I 4GKKI 4XTJA 1S4EA 4LFAE 4JI6I 2UUAE 5GMEA 4OX9E 2E5LI 4P52A 4M1KA 2V2ZA 3QT8A 3H4LA 4YHHE 4DPUA 4HACB 3WU3A 4UT4A 4LFBE 2Q2EB 4YY3I 3ZZTA 4DV6E 1Z0CA 3PYEA 1Z0WA 4USMA 2HKEA 2UU9I 1FWLA 1KIJA 2UUAI 1Z59A 5A2QC 1EA6A 4JI4I 2OI2A 5A2QQ 1N32E 4ZVIA 5IWAI 4LFCE 4PU9A 3PYFA 4DV3E 4JI5E 1ZXNA 1NHHA 1FJGE 4DV6I 3OTOE 1XNQI 2UUCI 4LF8I 4JV5I 1XMOE 3JAMC 2F4VI 3JAMQ 4X62I 4DV2I 3ZKDA 3LPSA 4DR1E 4DUZE 4JYAE 4FN5A 1N32I 3ZZ0A 1XNRE 3J7AM 4MYTA 4B3ME 4JI3I 4P7AA 4NXNE 4X66I 2UXCI 1DARA 1Z0VA 4B3SE 4JI7E 3OTOI 3T1YE 2DEIA 4DR7I 1ELOA 1RR9A 3B82A 1ZM3A 4JI0I 3K1JA 1I94E 1H74A 1N34I 1D6TA 4B3TE 3V2UC 3ZZUA 5BR8E 4DR3I 1HNXI 3LNUA 4LF7E 4DPYA 4DR2I 1IBKE 1S16A 1J5EE 2BM0A 1Z5CA 4X64E 4DV0I 1H72C 2BM1A 4DV5I 4JI7I 1N36E 4FWHA 3T1YI 2ZM6E 4DV4I 4LF4E 4Z7YA 1I94I 4LF6E 3QT5A 4DV1E 4AQYI 4JI1E 4DU8A 4LF9E 4B3TI 1B62A 5LMUE 4KHPE 4LF7I 1PIEA 1HNWE 4JI8I 4GKJE 1ZXMA 2UXBE 1J5EI 4Z7CA 1HR0I 1B63A 4B3RE 1Z5AA 3V5RA 4NXMI 1N36I 1HNZE 2ZM6I 2R42A 2UXDE 4JI2E 4LF4I 4LFAI 4OX9I 4DV1I 2HFSA 1U2RA 4JI1I 2LJPA 4FWGA 1NHJA 4HYMA 1Z0EA 4YHHI 2WW4A 4RPFA 5LMUI 4DUYE 4KHPI 1H7SA 2HHHE 2E1RA 2J7KA 1HNWI 4LFBI 2A2CA 2UXBI 1FNMA 1UEKA 2VQFE 1FI4A 1PKPA 1K47A 4DPWA 4PRXA 4ED4A 1HNZI 2UXDI 5LL6R 2HK2A 4UTGA 3WU4A 4LFCI 4DV3I 3HULA 1WUUA 4JI5I 1FWKA 1FJGI 2ZBKB 3PYGA 4K0KE 4R1FA 3ZM7A 2VQFI 1XMOI 2NPFA 1A6FA 4WUDA 3PYDA 1ZM2A 2UUBE 3B8HA 1KKHA 1PVGA 4DR6E 5LMNE 4DR5E 4DR1I 3QT6A 4DUZI 4JYAI 1RREA 1KTVA 2ZITA 4GKKE 1XNRI 1BKNA 4KQVA 4JI6E 4DR4E 4B3MI 1QZRA 2E5LE 4NXNI 2HK3A 3J7AG 4B3SI 3J80C 3J80Q 4K0KI 4JG4A 1XMQE
chains in the Genus database with same CATH superfamily
1RT6B 4C3KA 2AJ0A 2ATLA 2WBMA 4NYPA 2KT3A 4UOHA 1PJ7A 1HW9A 2B4PA 1VIXA 1RAGB 1JLEA 5ETTA 4MIAA 1TL1B 4PXBA 3NXZA 3VHQA 4V19J 4JI7J 3M7ND 4YP3A 2XHCA 3CDAA 2IRXA 5KG0A 4DMZA 2JFKA 3M2UB 3D0HE 4TN2A 3NGRA 3ZTQA 3H5UA 5KT6A 1RAIB 1NJWA 4DFMA 4ZVTB 2V67A 4GKJI 1YGYA 3LAKA 4KKOA 2IC3A 1FK9B 3MM9B 4OHVA 2C2MB 4Q5VA 1XMBA 1SC4B 3F44A 4NLSA 3MAHA 4WBFA 1RYRA 3BR9A 3U1NA 2DGUA 2OUGA 2KRBA 3BDPA 3J81C 1S9GB 4HY1A 5LMUJ 1G1XA 1XMQF 4P2XA 2Z58B 4X65F 2CQPA 4IG3A 2NN6D 2HHHI 2IYGA 1HBMB 1RWNB 3G87A 2QMXA 5A8KB 1CVJA 5FD1A 3GG0A 1EETB 3CJ0A 3HSDA 1V3RA 4EWTA 1JIHA 3WBZA 4DV4E 4LF5E 1BQMB 2HG4A 3GIIA 1WELA 3H2UB 1JLBB 1RT5A 5D3GB 5ETMA 1LKZA 3KLIA 2PO4A 5KFLA 2WONB 2XI2A 3IR6B 4MK9A 2KVIA 3K8VA 1E3HA 1RISA 4QU7A 4JI8E 2WOMB 2DISA 4OZNA 2MEWA 2XEXA 1BLUA 1UPPA 3MMJA 3AH6A 1HR0E 4L76A 1VFJA 4EO6A 1RT2A 3SSRA 3K5LA 3SMZA 5ETOA 2BANB 5J2PB 2OPSA 3W9JA 2ZUAA 4X4NA 3FNNA 4YHHE 2DNHA 2W9AA 3R2DJ 4B3OA 2JEAA 1BWVA 5F9NA 2APOA 4RUHA 1VQ9S 2R8IA 3ZZTA 4WFBQ 5JVGQ 3B4DA 1TV6A 3T5HA 4M5LA 2VB6A 3H59A 1P6TA 1G4CA 1RI7A 5F8MA 1H2VZ 1NDKA 4R0EA 4TY8B 1RTJA 4ED7A 4OIXA 3TZXA 4K5SA 5KOXA 1SIWB 4HYKA 3SSSA 2CQ1A 2HRTA 2EBEA 4EO8A 1NB2A 4A8MP 3PX0A 3PHEA 4PWDB 2V8GA 5K8MA 3I0RB 3ET6B 2XSFA 4PXDA 4B9TA 3W1YC 3DU6A 4DV6I 4D3GA 3GP9A 3ILOA 3Q83A 1WWHA 4CO2A 4K4TA 1IJEB 4TNOA 3OL7A 2L41A 1BE4A 2WVBA 1CC8A 3DOMA 3O44A 1JNZB 2BA0G 4DUZE 4ED6A 3TQ1A 4I2PA 2YQ0A 4NLTA 4KY3A 4LVOP 3KLEA 1S97A 1VRUA 4M5DB 4OJ3A 4E8UA 2VFTA 2FLPA 1ZM3A 1HI8A 2CGEA 3HVTB 3T6BA 2F63A 3UO0A 2DH8A 3V2UC 3KMQA 3C6TB 2G0IA 1IR0A 1QSLA 4DPYA 3H40A 2DXFA 1J5EE 2QLFB 1B99A 2KG0A 5DQIA 4DV0I 2CNOB 1H72C 3EYZA 1IKXB 2R7XA 4JI7I 4F04B 4FWHA 2MJUA 1OYSA 1RWVB 2IVYA 3M32A 2LQBA 4RU9A 5L1LA 3S1TA 1PC4A 3FSYA 3C3LA 1YJVA 2EK1A 1N34F 4FXWA 3QZ7A 3G4SS 3OVSA 3W60A 4OI4A 2KXFA 5GMKa 2ATCB 3W7BA 3I5AA 3W2VA 1VBXA 3DC2A 3CCJS 1XNRF 2IIHA 3OLBA 4B3MF 3UNGC 2GVDB 4LFAI 1YKWA 4OX9I 1DRZA 1NSKL 3RRHA 4N5SA 3OFFA 2NLWA 5LMUI 4C0HA 3W63A 5E3CA 2QIFA 4HVZA 1FDBA 5EWGA 2HQGA 1SC1B 4PRXA 3VZHA 4DLEA 4WP8A 4IG0B 3KK1A 2BQ3A 4ILLA 2HHSA 1CQMA 4Q0BB 5IT0A 2ZM6F 2F7VA 1VQ4S 4CI0B 3GR0A 4LFCI 3DU5A 2QL5B 2YX4A 2BUNA 2ZBKB 4CNZA 2P9CA 2C2RA 4KHPF 1BQMA 4J9QA 2RF2B 4JBCA 4DSKA 5D3GA 2O5DA 3PYDA 5JXSA 4ANEA 1S7HA 1RAJA 1V3ZA 3R5BA 3KJQB 4KHMA 2DH9A 1FXLA 1WOOA 3CCSS 2WVDA 2WOMA 4ZPBA 1KTVA 3DOKB 1J5OA 3VAHA 3NBPA 1EARA 1Z4UA 3NWRA 2XS2A 2ZOGA 1HLWA 3MD3A 2X51A 1N0VC 2GAGC 3OUYB 4DX6A 4DI6A 2D1CA 3OV7A 3CVKA 3ZO7A 4PEOA 4QZVB 5KG2A 1R27B 3D9BA 3K17A 5IWAE 3SCIE 1E6YA 2MB0B 2PMWA 1R8CA 4UUXA 2GJFA 2HVZA 4LPFA 1MMNA 1TTHB 4X4PA 2AKWB 4ED5A 3M8QB 2OPQB 4QNJA 2FJEB 3PS2A 4X64J 1JLCB 4ZVPB 3PR4A 3H25A 2DK2A 4ZVFA 3CE8A 3GLLA 2E5LF 2AJ2A 1NBEB 4P73A 4DX7A 5K5MA 2V4JB 4DCPB 2ZOFA 2C39B 4HDHA 2MQOA 2QFJA 1RHJB 4M5DA 5IT9Y 3KLHA 4L73A 3UD5A 4ANDA 1FKAE 1Q82T 4H4MA 3RB0A 1KFDA 1IBLF 1NHIA 3QT7A 1YVFA 5IV3A 1FCAA 3PVXA 2KJVA 4J9SA 4IFVA 3NG8A 3MCOA 4NRTA 5CYJA 4UY8T 2ZZTA 2X3DA 3U1MA 4PZVA 3QPIA 3VGSA 1FKPB 1IKXA 1WG4A 2Z5EA 1F3FA 5JEAB 1WI6A 1AUDA 1EI1A 3CCTA 2BX6A 3TEGA 3R7BB 2CJKA 2AJFE 4F0MA 2MZRA 5EX0A 1LK7A 2P9GA 3G6ES 3D3CJ 2KM8B 3AFGA 4ETXA 4F36A 1U1RA 4ES3A 2YNHB 1NRKA 2HBZB 3UW1A 1YBUA 2XMWA 4XTTA 1CS4B 3WU3A 4RWWA 1SI9A 3PW5A 3PDNA 3P5TL 4DV6E 1HQUB 2IFXA 3LP1A 4ENOA 2DRAA 3O1LA 1K0VA 2XMUA 3TAQA 4Y2IA 4IOBA 2CAJA 5KFSA 4FYXB 4I2QA 2C2DA 1SQEA 1XMQJ 1CJTB 2YNIA 4R0JA 4X65J 1C1CB 4IOAQ 3I56S 1H7WA 4LF8I 2Q6CA 2JLFA 1CULA 1HQ2A 4P2FA 3CDIA 2F4VI 4ECRA 2E7XA 1T11A 3J81j 4I0WA 4NYOA 2WBRA 5C0XE 3RBDA 4B9SA 1M0SA 1KQFB 1DARA 3CJ5A 3TJ9A 3W62A 2Z2MA 4JI7E 1A0OB 4DR7I 1RR9A 2CPYA 4RNHA 1VQ6S 4IZKA 5A8WB 2LXFA 5K36C 1H74A 1VC5A 2C37B 2DPJA 5BR8E 1FNXH 2W4CA 4FYVB 5DNXA 1X5SA 3H4DA 2OGUA 5HQMA 3R1HA 1RWXB 3BN7A 2C2KB 2HS3A 2MGZB 4M5MA 2VPWB 1Y4ZB 3BSNA 2YQ3A 4QW8A 5L9XA 1VBYA 2BR0A 5EWFA 4NI2A 2CG4A 5I42B 3HP6A 5LMUE 2GQQA 1HW8A 5DG7A 2PEHA 4ILRA 2E9RX 4OKGA 1SJFA 1QAIA 1MROA 1T94A 3R1LA 2RU9A 1VLOA 4OI3A 2XMAA 1PKUA 2QSWA 1KP6A 4ZPCA 2KI2A 3T1YF 2W7PA 1REVB 5AXMA 1SJQA 1H7SA 1WHVA 2P9EA 2YKMA 3DXBA 2QFIA 3WQPA 1K47A 4TKTA 2HHXA 3VAKA 2JEFA 4DPWA 4PWWA 2MMYA 3HPOA 1EIYB 3I9ZA 4AFFA 3TA2A 3CT9A 4FF4A 3BGLA 5B0EA 2AQ4A 3AOAA 5K8OA 3V6KA 4FW3A 3RYLA 4AXJA 3GR1A 3DD6A 3JSYA 5E2QA 2JVRA 1OYPA 4NLDA 1YJ7A 2Y1RI 4DV2J 3ZTOA 4NCAA 3PX4A 5F3ZA 3KHGA 4J3DA 1F2GA 4ID8A 1TQLA 1B0VA 1BKNA 2C2OB 1NZ8A 2LQ9A 1UW4A 2BR2A 3MM7A 2O1UA 1N34J 1QUVA 1S1XA 4CT9A 3KK2A 2E5GA 3NY0A 1KBRA 1XNRJ 1F5CA 2G0CA 5J2QB 4B3MJ 1HQUA 3NAHA 3BGRB 4WUBA 3SCKE 2JE6B 3M6WA 1XMQI 1WF0A 4U95A 3K89A 4X65I 2ABYA 2PT0A 3L7OA 1HARA 3UHMA 3EZ5A 2OPRB 3NNHA 3JXOA 4OQJA 3IAS9 1ZM9A 2NZCA 4DR5F 1D0EA 2OO4A 4OI2A 1EP4A 2ZM6J 2CQBA 5K36D 1U6ZA 4PR6A 3X3UA 1WDDA 4OO1A 5FDLB 2LDIA 5DM7Q 4KHPJ 4D3HA 4ER8A 1RT3A 3DLEA 3F73A 3MAAB 4PYDA 1NZAA 1RTDB 3A12A 3KG4A 3R7NB 2A6MA 4OMFG 2HWIA 2L48A 5IT9U 2DGWA 1U1QA 2YQ1A 2C37A 4JP8A 1IN0A 2DGSA 3C16B 4K4UA 2HRUA 2XZDB 1RQ0A 4HKQA 3QJLA 1N33F 5KFUA 2FUG9 1FJCA 3NGUA 2CJBA 3LWMA 2GO8A 2KJWA 3GMGA 1FJGJ 3T9NA 3DGPB 3DXSX 2OKQA 1HI1A 4ECYA 4USUA 5C0XB 2RUGA 1RT1B 2YH1A 4A8QA 3EVWA 1TUGB 4RX6A 2W1BA 1Q7LB 4B9UA 1HWIA 4JI3F 5DDQC 1WKKA 1VJWA 2GCFA 3ITHA 2IVFB 1FO1A 1XJWB 2CWXA 4JI0F 1UDOA 1NK8A 2XQCA 4DQQA 1F1BB 1NM2A 3Q8YA 4NWBA 2W7AA 3BQ1A 4P6QA 1RHRB 1WSRA 3RBZA 4B17A 2BOPA 3BBFA 5A8RA 2E5LJ 1NDPA 2OHDA 1C0UA 2B6AB 3O6QA 5HSPA 2B8PA 2HNYA 2RJZA 3TAMB 4LRFA 2N7CA 2BBEA 3IBWA 4CLWA 2XULA 5CYMA 4IFDE 3NNAA 1IBLJ 4C0BA 2YWEA 4EGLA 5B0DA 2W9CA 3THTA 2UUWA 3LF0A 1REGX 5M2RA 4X62I 4DV2I 4K2XA 5E7OB 2BJ8A 3MM6B 2B5JA 3U1LA 1LV5A 1HWKA 1MU2B 2IBKA 2UXCI 2MKJA 4QCLA 3W5YA 3MMCB 3K59A 4O4GA 2BJ9A 1RWUA 3RW7A 2XI3A 1N34I 2YKPA 1VRTB 4F3OA 1R7IA 4FW7A 1RK8A 3QYYA 4UOCA 4NEZA 2BJEA 2I9SA 1LWFB 1YZ7A 1N54B 2BEFA 2OIHA 3BF4A 4A8FA 3FMBA 2BM0A 4P74A 1QDUB 3POTA 4X64E 3JQMA 4DV5I 4EUVA 4F8RA 1GQEA 2A10A 3PW7A 3K5MA 2ZKUA 4Q44A 2N3LA 5KTQA 1NO8A 4DL6A 1B62A 1M1KT 7AT1B 1XXEA 2QN6B 4LRCA 5HAOA 3UR0A 3R5AA 1Z5AA 4TU7A 2DNPA 2P6SA 4NXMI 3HMJG 2GO4A 2AF6A 2ZM6I 2DR5A 1TK0A 2K3IA 3EGVA 1MLAA 4DQIA 4ZP9A 4ED3A 4C0OC 3I31A 4FWGA 4OHYA 4Y2CA 3E8OA 4KHPI 3QATA 1DZ5A 2RRAA 4B3TF 1EKRA 4CLZA 3VVUA 4J9MA 3MMBA 1UDNA 4ECZA 2XB2D 4DPOA 3MAAA 2HQFA 1GMUA 5KG6A 3BB5A 2E5HA 4MJKA 1U1KA 2GAHC 3HHKA 1USUA 5BXIA 3C16A 4JI1F 5K14B 4LF9F 1FJGI 1F2HA 2J9DE 1Q0NA 2AV5A 2C38B 3MTKA 2DXEA 3S6EA 2UXBF 4LSNB 2FHJA 1NUEA 1TR0A 4XK8C 1RT1A 4ZJQA 1FDNA 2AWZA 3NCQA 2EFNA 1PSDA 3QNWB 2YXLA 2DH7A 4Y2MA 1L3VA 2CVIA 2OMOA 3PFEA 3GYGA 4C3LA 3TUZC 3I55S 4JG4A 4DUYF 1XMQE 3TX8A 1YHCA 2W8KA 4X65E 4PG7A 1HNXJ 1M90T 4NA2A 4OL8A 1XMOF 2GO9A 1YJRA 4NZ7A 2KHDA 4CLPA 3J7YI 1H7UA 3M2RA 2DO0A 3GIJA 3T1YJ 3SCLE 4FBTA 2OMLA 1VQKS 1FFWB 2R8GA 2G2ZA 1Q1KA 5F9LA 1DQAA 2B6AA 1JXLA 5EDWA 1IBLI 5LJ3Y 1B4SA 3P8BB 3CWVA 1P8GA 1X9MA 1C1BA 3UDEA 5L1IA 4KGKA 3J7AN 3KG0A 2DNNA 3D28A 4DR4F 3UN5A 3UD3P 3MM6A 5IC4B 2MXYA 3A13A 1X4EA 3HT3A 1MU2A 3LP0A 2YTCA 3G8QA 4NX9A 4RBUA 3LW5C 3MMCA 3O2IA 2C22A 4WKYA 3ENVA 4K59A 2IOQA 3NKYA 3OFHA 1AFIA 1TAUA 1ITPA 4DLGA 3TX0A 4IFDB 2NXUA 4MYUA 2XLKA 1RCOB 2PMZD 3TQEA 1AFJA 1PYSB 3N9UC 4WXWA 5FLXQ 2ZC3A 1A6LA 3C6UB 1NPKA 2VPXB 5T14A 2BQRA 1UFWA 1U2FA 3ZKBA 4DPXA 4YS2A 3D0GE 3TARA 1QTNB 1CJVA 4FW9A 1N52B 3KOAA 2E9TA 1VYAA 2J0QD 2K06A 2EW9A 1KR4A 2HHVA 2XHWA 1KTQA 2XGQA 3HVWA 4RZRA 4NBQA 2CQHA 2IM3A 2NPIA 3QZ8A 4DR5J 4DS4A 4HTIA 3H42A 2L08A 4ZP7A 2F40A 4FF1A 1Y00A 3HM9A 1GMWA 1YI2S 5A2QC 2NUHA 3FBBA 2W2PP 3GCXP 4DX5A 2VBZA 3JAMY 3PJWA 1B3TA 2MSSA 3QLHA 3PW4A 4U67Q 2M8HA 2JEBA 2GHWA 2LU1A 3JSMA 2MKHA 5K14A 4YOEA 2JRSA 5ETRA 2VU5A 2ZBIA 1D8YA 3DFEA 3LPSA 1Q7YT 1HPZB 1N33J 2WP8B 3ZZ0A 1XNRE 4LSNA 4B3ME 5DZ6A 4YR2A 2WSEC 3EDRB 3CCLS 5D4PA 3GIMA 2DEIA 3CD6S 3P06A 3KK3B 3MWBA 2G1HA 5HROB 4WYWA 1HNXI 4NZ6A 4LRBA 3D6FB 4PG4A 1X7VA 1W26A 4IH7A 2FLNA 4JI3J 4NLPA 4J37A 2HFNA 2W7OA 1W25A 2YPZA 2RT3A 3T1YI 4JI0J 1HHSA 2ZM6E 3OBIA 3QFWA 3G2XA 4Z7YA 4IZJB 1HBNB 5KFQA 4MQYA 1MWQA 2NZ4A 1TK8A 2K8GA 2FD2A 4WZMA 4CM2A 2ZH9A 4KHPE 1EB0A 4AL6A 3L7PA 1F0XA 2HMIB 1XR5A 1F9EB 1B63A 1FDDA 3N6LA 3DLKA 2GVZB 1RT7B 3IP0A 1U1OA 4LF2A 4CP5A 1IUJA 2OSQA 4C3MA 3G96A 2LQ8A 3GB0A 5HQLA 4QR1A 4EYIB 1RE1B 2XMJA 3BH6B 2LDYA 3NMRA 4X4SA 3GWCA 1VQYA 2J6TA 3GYNA 1O0PA 2JOQA 2ZJPQ 3TP2A 2JVOA 4RW7B 4A8XA 1VQNS 5KFVA 1QE1A 1W2BR 1NHKL 3P49B 2BDPA 4PABA 2UUCJ 3JB9k 4ECWA 3UDLA 1IKVA 1EZZB 5ETKA 4CM0A 5E3AA 4YB6A 1JKHB 4KR0B 1ZM2A 2XYGB 1G7CB 4N8NA 1S48A 2UXDF 4ZVGA 5F8HA 2E5LE 3BYPA 4XDCA 3WZ0A 3PS1A 2UVWA 5KG4A 3DDKA 3ILJA 2Y1LB 1IJFB 5IS2A 3QWUA 4UUWA 1MG7A 2CNLB 2V2VA 4DR5I 4HTJA 5C42A 1XBWA 1IBLE 4WFYA 2YNFA 3ILIA 2BRLA 1BQXA 1CJUB 2CPEA 4ES1A 3DKDA 4WP9A 3GE9A 2IMWP 4FWDA 2I5JA 3EVOA 4DSJA 2DCLA 1X8DA 1SV5B 3HFKA 1O51A 4B3TJ 2O67A 4O4RA 1N8RT 4GO7X 3BEGB 4K0KF 3P5BP 1PBUA 3C19A 1URNA 1H2TZ 4KFBA 4FYYB 1JJCB 1ZM4A 2BYCA 3J81Y 4URQU 4YB7A 4B3RI 1S6UA 1Z0BA 3IAM9 3AD7C 1N33I 2AJQA 1YIJS 5BJRA 1IKWB 2KYXA 4JI1J 2HQDA 2KM8C 3GONA 1OPIA 2WP8A 5A6PA 3KKFA 1XQIA 2QX0A 2CQ0A 1ACMB 5FJ4A 2UXBJ 4F26A 2V9WA 2Z0GA 2XMVA 3AB2B 2KVQE 4DEZA 3AA9A 1KSPA 1KOOA 2JEGA 4FVMA 4KRWA 4RW8B 1U48A 2N3OA 4KPYA 2XSJB 4JI4F 5L8RC 4FXDA 1WF1A 2MKYA 2DR7A 1NZ0A 3D1QA 1T9VA 4DUYJ 2WRMA 3CJ4A 3PJXA 4X4OA 4ED0A 5ETNA 5HANA 5IQQA 2H5EA 3SFUA 3CULA 1X0FA 1NPPA 3OD2A 1XMOJ 4IZJA 1HBNA 4CYUB 4LSZB 1EQMA 3KJNB 4QYZK 4DHVA 4HACA 3KLVA 3G8SA 1IQZA 2H5JB 2GQCA 5L46A 4AM3A 1I1GA 3TUPA 2G4BA 2BKPA 2HMIA 4EBEA 4GVBA 3IR7B 1RACB 2FB0A 2OSRA 3N5BA 2GVZA 4IR9A 1GXTA 1J2VA 3K2YA 2NQPA 4IFYB 5J2NB 2CQGA 2ACMA 2VFSA 2Z2ZA 3ZXWA 2NR0A 1AYEA 3IBCB 3KHHA 2IJRA 5J2MB 4ZS6A 4DR4J 5HLFB 3ZTRA 1UVIA 1BHNA 5J1NA 2GQ0A 3AXKA 3M1VA 4AQYF 4PU9A 2VZ9A 2NUUG 3BJYA 4CLTA 3DRRA 3JAMU 3IGNA 1DQ8A 2UUCI 3A1YG 1O6XA 4O0IA 4LRDA 2MY8A 2FHOB 5I3UB 5F8GA 1RTIB 4MYTA 1C0TA 3QJPA 2RDJA 4QU6A 1EQ0A 2PE8A 3T1YE 4F4ZA 2GMJA 3MEGB 1FE0A 4ZVHA 3K5NA 1XN9A 3MFIA 1Q8BA 3RU0A 3ICLA 1BD6A 1S1VA 5KFIA 2DD8S 5DNLA 3VWSA 2P2CB 5KFXA 3GG1A 4ZIWA 1E6VB 1LNQA 5IM0B 3UFCX 4LQ9A 2FLOA 4IRKA 3GFXA 5KFWA 1PILA 1TKZB 5CZVA 1S77D 3A8KA 1RKJA 1CJUA 4OO1F 3US5A 5KG1A 3OTOF 1JK9B 2YX7A 3RJMB 4B3TI 1OYEA 4OV1A 2Z5BA 4BA2B 3TZWA 2MDAA 3HFVA 1ZXMA 2QC3A 1PYTA 3NS6A 4IRDA 4GKKJ 3VTIA 4E2FB 4ZA1A 5C25B 3P6YC 3TZYA 4NXNF 1HWJA 2GHVC 5KT2A 2O3ZA 4JI1I 3GIKA 1NJYA 1IVZA 3KYLA 3C46A 2D69A 2HHQA 2UXBI 2E7VA 2ZNZA 1UEKA 4HI1A 1FI4A 2PN6A 4F7VA 1A7GE 2WVCA 3ONQA 4EEYA 2DHHA 4ANCA 4P10A 4OZEA 3T1AA 3FC9A 3OT9A 4K5RA 4RW8A 2FGOA 4FXVA 1HNVB 2CZ4A 1WTBA 5KFCA 4NPOA 5D15A 2V68A 1HNWF 3ZM7A 3ETMA 4GKJF 1XMOI 3W2WA 5EWEA 1RTHB 4DR5E 2XO7A 2LYVA 1JJHA 1U45A 4LCGA 4NLWA 4R8UB 3ELHA 2M5YA 1EHWA 1Q8KA 1N5YA 1YHQS 1GXLA 1PGZA 3M7NG 1N4LA 2HHHF 1NK0A 2OJ3A 1G3OA 2DVIA 1VQSA 3GSIA 2X36A 3AOCA 4IFYA 5J2NA 1ZZFA 4DR4I 1Z2LA 2QLJB 4YR3A 4GO5X 3HJVA 3ZC4A 1NDCA 1N33E 2CPDA 4AT1B 5D0GA 4ZK7M 4DX8H 3IS9B 5GAGI 2FTRA 4B3SF 1FT8A 2VICA 3MZIA 2ZEJA 2IDLA 1YWXA 4MFBA 1HWUA 2C3YA 2PO1A 3A3NB 4TVAB 4A4JA 3MUTP 1WC5A 1I3OB 3H5SA 3UCUP 5CABA 2QYCA 5LMNF 5C0XC 4OYAA 3J81U 3H2LA 2M70A 3DHWC 1X5TA 2MTLA 2AGQA 4JI3E 4MU1A 2RIJA 2VC1A 3IG1A 2R3VA 4MU3A 1Y9OA 2XZWA 2W9BB 1QSYA 3LO3A 4JI0E 3OFEA 3CCES 4ECQA 2IM0A 1HIYA 3B4TA 1Y3KA 3DHXA 2OD4A 2Z5CB 2VFRA 1HBOB 4C8ZA 1RB0A 2UXDJ 2JDJA 5IXUA 1UVLA 2Q43A 1FERA 1ZYQA 3BS9A 3M6AA 2FVPA 1MWYA 4RW4B 4C98A 1E6VA 5C24B 3H90A 3MURP 1ZTTA 5IM0A 1VMBA 3N5FA 1KNZA 3G82B 1DTTB 4DG1A 1ZBTA 5U47A 1FHTA 3Q2TC 4LF1A 1QVFR 2VDHA 3G6XA 1SKUB 4Q7AA 2GW8A 1K73T 2V50A 2ZBQA 4GKKI 1NLKL 4PYAA 1U0HB 1M5SA 2UV8G 4K0KJ 2R2RA 1NNDA 1NEEA 4ED8A 4I1TA 2PC6A 4QWAA 2WHOA 2L9DA 2D3UA 3FJ2A 2WZ1A 3C14A 2PNZB 1SPBP 2HBRB 1LW2B 3GV8B 4DR6F 3SQGA 2DNRA 4DV0F 5LOQA 4DV7F 4YB5A 8ATCB 2FJBB 4ZDNA 2CG9A 2Z2YB 2YWHA 4LF6J 3I9V9 1JLAB 7FDRA 1T03B 2JT2A 4H54A 1HD1A 3THPA 1GT8A 2XWYA 3HHLA 2LA6A 6AT1B 4ID5A 2H65B 2ZE2B 2KO1A 3F56A 4I67A 3ZKDA 2KHCA 4CLYA 1AW0A 4JI4J 4F25A 2J9EA 5G0RA 3UCZP 4F4XA 3BYRA 4LFAF 4N56A 5F8LA 4OX9F 1RTHA 3VGVA 1U7LA 1S6PA 2MZ1A 2J6UA 5HBMA 1FRJA 4KSEB 3CW2C 2XLIA 2HGMA 4CLSA 3CJ8A 4RKUC 3N79A 1XNQF 3LUYA 5L1KA 4B3TE 1Y3JA 2VBWA 3DLGB 3V6DA 4QWEA 3HVRA 4DR2I 2HRYA 4RW6B 4G3IA 1S1UA 2HZCA 2AEMA 2HNZB 4CWBA 1PO6A 1P9YA 4XAKA 2YVSA 3KMSA 4LFCF 1ZOTA 2YWWA 5J1EB 2XYPB 4BBYA 4LREA 2FHJD 3EPGA 4JI1E 4WK1A 4LF9E 2LP4A 3SV4A 1T3NA 3ZTSA 1YRUA 3FBCA 3BM7A 2Y1JA 5DLFA 2UXBE 3FDSA 2E5JA 1XC9A 2KU7A 5KFJA 3NOGA 4K4SA 4AQYJ 2PO0B 5IQ6A 1RU1A 3QAEA 4RPFA 1Y60A 1IWGA 3BV8A 3EVMA 4PPDA 4DUYE 4QYRA 4LFBI 3VGTA 5KFOA 2AP6A 2KKHA 2QT7A 1S1WB 4M63A 3ULHA 1UJ6A 2UXDI 1RUSA 1Q5YA 1Y10A 2B9YA 2XG8A 1JMTA 1WC6A 3SSQA 4QQBA 4DQRA 1XERA 4OJHA 4TYBA 2RRNA 3QGIA 3PYGA 2RDDA 1X5PA 5C24A 4G1QB 4LR7A 5H9EK 4USHA 3S01A 3M85D 3ISZA 5GAHU 3HKZD 3G82A 5HVHA 4USJC 5F0UA 3DRSB 3I0SA 2VKZG 3IRXA 4EZ9A 1BXNA 3LALA 2YNGA 4ZPAA 3NGKA 4DR1I 1VCTA 1U2CA 1RADB 3QIDA 3B54A 3Q6NA 4QPTA 4DR4E 1MMLA 2V94A 3V4IB 3OTOJ 3JSRA 5B0BA 1RAHB 5LSLA 4K0KI 4WPAA 3FMWA 1U0HA 4ZJOA 1UL3A 2WVEA 4C11A 3QJJA 2YH0A 4ECXA 2WNRB 1V9OA 3B6BA 3KLGB 2X7IA 3CJKB 3ZFVA 1J27A 1U6FA 3EWGA 1D9FA 1F3VA 1JNRB 4NXNJ 1FDAA 1H6KX 3PEJA 2ADBA 4O3SA 4J9NA 1LW2A 5A6WA 4IFDC 1R8BA 4F4WA 4LF6I 2B3TB 1JLEB 3MPDA 2QL9B 3MEDB 2IVMA 1TKTA 4H4OB 3FFIA 3J7ZT 1G6BA 1G2EA 2B43A 3L95X 2YBVA 1HYSA 1R8AA 3R2CJ 4EZ6A 2DRDA 1KS2A 2Z56B 4AE5A 2GS8A 2ZE2A 2BJDA 1Z5BA 1YBTA 3QQCD 1NSQA 2KRRA 2F9DA 4Y65A 5GADU 3HO1A 2FC9A 4KKOB 3WU5A 4ZCMA 1L3UA 1HNWJ 1GMWD 3ZZPA 3MEKA 4GKJJ 2GMHA 2J9CA 3R5CA 1RP5A 4X4TA 2HAFA 3EM1A 3TNVA 4MKBA 2HQCA 1H98A 1QTMA 4WE1A 1F9HA 1RBOB 3DRPA 4IG3B 3DLGA 3MR3A 3MXHP 4ZVQB 4LBHA 4OX6A 4ZMMA 2HHHJ 3DOLA 2VUGA 3A3PB 3NS7B 1YX2A 2ACYA 3MECB 4IUFA 4LF8F 1T8EA 3LPEA 5J1EA 4PWUA 2F4VF 2VQEF 1GX5A 1UAWA 1ZTWA 3K5PA 3KLIB 2DHSA 3MAQA 4J9RA 4B3SJ 3IA0A 1H38A 9ATCB 4GVLA 4DR7F 1RAOA 4YQWA 1YJNS 3RBEA 1AZSB 2MQ8A 2LCWA 3MM5A 4ERDA 3OXGA 1RT2B 3CJTA 3VZIA 2E9ZA 1KWMA 5KFEA 5LMNJ 3L7ZA 4X4RA 4CO1A 2OPSB 3FCHA 1DAXA 1U25A 4KIAA 2CQ3A 4Z37A 3CCUS 3R3TA 2NS1B 5B0CA 2PO2A 4B3OB 2IA6A 1S1WA 2QE5A 4WXOA 1TV6B 3KUGA 4WK3A 2CPFA 5E41A 1T95A 1YJUA 4PG8A 2BRKA 2HBQB 1ZXNA 2CNNB 3M9NB 1RTJB 1M5OC 2RQMA 4JV5I 3AOBA 4FYWB 4G1QA 1M5KC 2D9PA 4OZJA 3BPDA 4RW9A 1YRXA 1UP1A 4Q8FA 3DRYA 3M30A 3OTOI 3GFYA 3DOMB 2QMUB 4DWIA 1YRTA 3JQJA 1NPRA 2RHQB 4I2PB 4R25A 4QNKA 3V4IA 1D1UA 1D6TA 1T7PA 2MKCA 3KLEB 1VRUB 4DSFA 5HATA 1Y7PA 3NZKA 2Y8YA 3M8PA 3R27A 1N32F 1RGVA 4NLGA 4IO1A 2BE9B 4S0MA 4Y3CA 5DRKA 1VC0A 4OJGA 1ZA2B 1TELA 4W90B 4FW6A 3Q2SC 4B02A 3D2WA 3CJSA 2MLXA 4J9KA 3SBMA 3MEDA 3BBCA 3M32B 2DR6A 4KGVB 5CCLA 4DR6J 2ASJA 3EUNA 4DV0J 1HMVA 4H4OA 2R8JA 4DV7J 4ECUA 2UP1A 2NYIA 4LBPA 3BZQA 3V5RA 1RWKB 2MZJA 8AT1B 4FF2A 4KTQA 2NN6A 3DMJA 2UXDE 4CT8A 4WKRA 3NEKA 5KFBA 4IR1A 4B9NA 1Z0EA 2M0GB 1KHVA 2YKQA 5I4MA 2CQ2A 2ZBPA 3W2VB 3GU0A 1HNWI 1Y6ZA 1KDNA 2LXUA 3OL8A 2A2CA 4OYMA 1UVKA 3V81B 1WSVA 2V2KA 3KXDA 4LFAJ 3EGNA 4OX9J 1XTZA 1QAYA 1N36F 4X4VA 1F6TA 5C5JA 1S5ZA 3MR7A 1P1LA 3GCWP 3QGGA 2QG9B 1XNQJ 2GJ2A 2W2QP 4YHHF 1U09A 4I4BA 2PD1A 2QGFB 3E2EA 4K0KE 1SJ4P 3KK1B 4L3NA 2EXUA 4UQGA 1SJRA 1GXUA 2HS0A 3MECA 2N4CA 3CCZA 4LR9A 2RRBA 4J5OA 3M9MB 2J65A 5DDOC 2ZDOA 4LFCJ 5ADZA 5IZHA 3EMTA 3PKYA 2CJQA 4B3SI 4K50A 1ZH5A 3OL6A 4YFUA 3S8SA 3J80Q 1TMJA 3OW2R 4HH1A 3VAMA 1VDHA 4QW9A 1J5OB 3CWJA 4NE9C 4KGMA 2LVWA 3RTVA 4DR3J 3NBPB 1AZSA 5D4LA 5LMNI 5DLGA 3RAQA 1F5BA 1R6YA 4DFPA 3W9IA 5F8IA 3NMAA 3CO9A 3MTJA 1IBKI 1N48A 1VIOA 2BA1D 3SFGA 4MKYA 2KZMA 4HHUA 4DUZF 5KFGA 4U3DA 4JI4E 5F8JA 3NP5A 1VQMS 4QJVA 5CA5A 4CLUA 4IZJD 1TU0B 4HH0A 5JEAF 4TQRA 2W2OP 5LXYA 3N6MA 4ZJLA 3I32A 4NASA 1WG5A 1GMVA 3DI6B 2MQPA 2CRLA 1ROFA 4O23A 1D9DA 1MU5A 1L3TA 5FWKA 1E6YB 3MR6A 3QRQA 5HMXA 1CEZA 1PJ5A 4KB7A 4L72B 2PSZA 1USVA 5KAKA 2HHWA 1LWCA 2V6AA 3MEEA 1RU2A 2JNJA 4QIVA 2QL7B 2LEBA 1NK7A 3T5KA 2GIQA 4AUKA 3HJFA 2WB4A 2ZHAA 2L9WA 4NLRA 1S0VA 1NHVA 3O5TB 1T0TV 1IWAA 3OTDA 3KLHB 1GAOA 2VC0A 4H4MB 2J76E 4C8KA 4JI5J 2O1TA 1Q8IA 3R9LA 4R5PA 4AQYE 5FLXC 4OJ1A 4IQMA 1KVKA 5CQGA 4QYZJ 4IFVB 1UW9A 3VQSA 5DG8A 4X84A 5AXLA 2VHGA 3G9CA 2DCUB 4X62F 4DV2F 2ZBRA 4B9MA 3NNCA 4DR6I 4FS1A 3AODA 3BSOA 4MK7A 1URRA 4FYDA 4DV7I 1S9EA 4RR5A 3MHYA 3M6VA 2UXCF 4M5GA 2BVZA 4P52A 3MM8A 1R0AA 3LANA 3CNQP 2JC1A 3TZZA 5F8NA 3Q23A 4LBIA 1GEHA 2B56A 1U1MA 4F0KA 3GV5B 4EU0A 3T1HF 3TYTA 3IWLA 2CVEA 5A2QY 4FPIA 1ZS6A 1YJTA 3NGTA 1TFWA 1AXQA 5CCMA 1V6HA 1GK8A 1NMEB 2B8QA 1NSAA 4A8WA 2D74B 3IBFB 3Q0AA 4DV5F 4A46A 3V81A 3VCDA 3LP1B 3OQ2A 1FX2A 4ZVOB 1MN7A 3W66A 4M5IA 3K85A 2HHUA 3MCSA 2R7VA 2MHNA 2KZZA 4OO1E 2DXDA 3OTOE 1XNQI 1Y0HA 4I2QB 2LU2A 1SBRA 4YY3F 2YNIB 4OYIA 5DGAA 2DO4A 1WNEA 1FKOA 5DQHA 4NXMF 3FCVA 4OZLA 2BKOA 3J7AM 5D6GA 4NXNE 4X66I 1CULB 2V5HG 3B4MA 4J9VA 1NDLA 2QA1A 4M5KA 3AD9C 4ZPWR 2QA4S 4LF8J 5B0AA 2F4VJ 2VQEJ 2MLYA 1MMDA 3BKUA 3ZTPA 8RUCA 1EAYC 1LXJA 3OR2A 3PX6A 4DR3I 4N77A 5DZ7A 1DFDA 4IZKB 3PIPQ 1PAUB 1UJ4A 3CDUA 5JVHQ 4DR7J 4U96A 3OXFA 5D77A 2YPYA 4C9DA 4CO5A 3QT5A 1FJGF 4ECSA 2EFQA 2Z30B 1KLMB 2BKNA 4TY9A 3RR8A 3HDSA 2ZH4A 4O0NA 4CLKA 2ZH7A 4QR2A 1SKWA 1HNWE 4OI1A 4GKJE 3DI6A 4MU4A 3DNCA 3W5XA 4NCGA 3TW0A 1H0HB 4NI2B 3FEZA 4RBVA 2HFSA 3EXYA 2VASA 3OSNA 1MROB 2WCXA 1YJWS 3Q6MA 1KLNA 1U6BA 2H54B 1I94F 5DGBA 3AXMA 3H20A 1VBKA 2HHHE 1K0TA 2J7KA 2HPUA 3QO9B 4AD6A 1B0TA 1Q16B 2DNZA 4K2JA 4KO0A 2AX0A 1SJ1A 2HZVA 3Q8VA 4ZVRB 5KOWA 1K44A 2PFDA 3QIPB 4K7QA 2YKMB 1IKYB 4MTPA 2N7YA 4DV3I 4JI5I 1SUQB 4ES2A 4EBCA 1WEZA 2A3JA 3U02A 5K8PA 1F60B 5LMNE 4DCJB 1N32J 4JYAI 2RDIA 1UTAA 4QIWD 2O3DA 2KFYA 2FPHX 4QBUA 2BE7D 4F50A 2DYAA 3J7AG 2CQ4A 3CJRA 2DNQA 3CC7S 1VQLS 3LH2S 3DGVA 4URLA 4KHRA 2VQFF 4UQTA 4DCOB 2V8DA 3IMQJ 1RSCA 3C15A 2BR2B 3MM7B 2HVHA 2D3ZA 1OIAA 1HHTP 2WVFA 1P9QC 1ZZNA 3K7RA 2ZH6A 1S1XB 3T5LA 4F2SA 3D4JA 2UZAA 1KONA 3KK2B 3IXQA 2CPZA 4ZCKA 1F9FA 4JB8B 2DHXA 4CLFA 2MKKA 3RAMA 3DLLQ 1FRKA 2KT2A 2IJFA 4DFJA 3NRBA 4QOTA 2ZUGA 3OJSA 5D4NA 2VG7A 3K58A 2A18A 9RUBA 1N36J 3F0NA 4JI2I 2FHMA 3T6JA 1X5OA 4YHHJ 1MX0A 5LXRA 5M2UA 1VK3A 1QAXA 1YTYA 4HLBA 1EP4B 1NJXA 4DDFA 1UFKA 2VQEI 2OEKA 5GMDA 4ZVEA 4WU2A 3OVBA 4Q45A 3VAFA 1N5VA 4OO1B 4WTYA 2YWKA 1RT3B 1N0UA 3DLEB 3G86A 2DB1A 4DV0E 4DV7E 1S76D 3OR1B 1LFPA 2J6SA 1Y5IB 3SI8A 1TL7B 3JQKA 1S1TA 4DSIA 2ZNYA 4DU7A 1WHYA 1KLMA 3D6TB 4ELUA 3LTOA 4C8OA 2F8EX 2KL8A 4DUZJ 1UDSA 3B78A 4B08A 3CO0P 4LFAE 4JI6I 4O3NA 4OX9E 2C2ZB 3MGJA 3SQOP 2V2ZA 2PI4A 2O1VA 4J9PA 2Q2EB 2VG6A 1HNXF 3PYEA 3ITHB 2XMMA 4USMA 5A2QU 1UZDA 3MI7X 1C4AA 3QO9A 2FVQA 2DNOA 5E33A 2ZFHA 2IY5B 2OEJA 4EFAC 2D3OR 3TJAA 2CPXA 4LFCE 1K1QA 3PACA 2UUTA 4QIFA 2VIHA 4OHZA 1QVGR 4J9LA 2VG5A 5A8RB 4OYWA 3QIPA 1F5AA 2C28A 1IKYA 3W5ZA 1LW0B 2ERRA 5AE3A 1EX8A 1OMSA 1C0UB 3H5XA 5AJ3F 4RU2A 4CCHA 2HNYB 4CDIA 1KFSA 1SUQA 4ZITA 1YG0A 2CDRB 5A0YA 2RU3A 3CD7A 1N32I 1UA0A 2UU9F 5CYMB 4DL5A 4CTAA 4V19X 3TVKA 2W9CB 2DHAA 3K0JA 1LWEA 4KV8A 4HT5A 1VBZA 2RUSA 2WTFA 5IOLA 4OI6A 4F0HA 2QTWA 4C8YA 2B5JB 2LEPA 4X62J 5HMWA 3MMAA 2WB1D 4DZ6A 2E29A 4QIGA 4GQUA 4ATNA 3WX4A 5HQ8A 1RDRA 4O4GB 4CO4A 2RSQA 1SVDA 3Q22A 2UXCJ 4NZ0A 2D7SA 4DV4I 3OFGA 2HWTA 1RHYA 1QSSA 3NCRA 5HVFA 2JWNA 4N8OA 3T1HJ 1KVIA 3DM2A 2DGTA 3POTB 3PM9A 4CLLA 1ZPWX 4JI8I 5K36A 1R6MA 4L75A 1HR0I 4DV5J 4K4ZA 3BBBA 3P76A 2RNEA 4I56A 2NXJA 1N36I 4BHQA 5KFDA 3RG6A 4DF4A 4C7QA 2VONA 3PXGa 4L6V3 1U2RA 4GC7A 5EX3A 2P6TA 4IQXA 4HL9A 4ZPDA 4YHHI 4WFZA 3OHBA 1JLQA 1SIZA 4YY3J 1WJ9A 4AIDA 1R3NA 2HFZA 2ZWPA 5H9FK 2AGPA 4LF7F 4NXMJ 2FZCB 5M2PA 3RZAA 3GFZA 1VC6A 5T7LA 4PG6A 3Q8QB 3PNIA 3LOUA 3MMBB 5KFYA 2PEBA 5CH7B 2O1PA 4DL0C 2VESA 1FWKA 3UVJA 1TKDA 1VI7A 2M8DB 4BA1A 1D8ZA 3OR1A 1FEHA 3PTWA 4YN3B 1TL3B 1FD8A 4ZCLA 2EC0A 4BC7A 2NPFA 2VL1A 2OP5A 1RBAA 3MPWA 4B3RF 4DUZI 2FJAB 1TL7A 1M5HA 1HNZF 4PQUA 2LECA 5ETSA 1IR1A 3TA1A 3RUBL 2UVVA 3KTQA 4NL5A 3PEHA 3HSJA 1AROP 3QSIA 2GIRA 2VPYB 2PDAA 1B0PA 3PIOQ 3OPKA 1IR2A 3AQPA 4RNNA 3HXMA 2UVUA 1TKXB 1WC4A 2U2FA 3AHPA 6FD1A 4HXZA 2KXHA 1I94J 1Y4UA 3ENWA 4B9VA 3CJ2A 4E98A 1O8BA 3M2RB 4LF8E 2AJ4A 4USKA 1M1GA 2K1RA 3R6LB 2ZKTA 3P3GA 4WTOB 2GIFA 2F4VE 4P72A 2VQEE 2V4RA 5MLCV 1LW0A 1DLOA 2R2SA 1TFYA 4N47A 2AX1A 1TVRA 3EGZA 4NLOA 1RWPB 5GAEU 1NU4A 2G2YA 5E5NA 4OFZA 4DR7E 1C1BB 1PJ6A 1Y5YA 4TQSA 1S0MA 1BY9A 1RT4A 1HFEL 2MPUA 3OSPA 2YKOA 2H5IB 2YWFA 2MLZA 1AUSL 3LP0B 3HHEA 5HL7Q 2R9LA 4OLPA 2RD5C 2C3OA 1AT1B 5IT9Q 2GMLA 2NN6F 5D0RA 2CZVC 4OLOA 1PAEX 5K9FA 3HF5A 3V4MA 3BN4A 4BLGA 3MD1A 3T1HI 2ROPA 2UUCF 2ZHBA 2VQFJ 2CJYB 3LGNA 1H7XA 3VF0B 3CCWA 2IRUA 2W2NP 5ETPA 2DKOB 3BGOP 2DEJA 1PCAA 1X4BA 2V9KA 3Q24A 3HLUA 2HIQA 2RS8A 3GTYX 2L9NA 1CJVB 1NH8A 5DRPA 4U9RA 4B9LA 1WKLA 2ZD1A 2VA2A 4I6WA 4YY3I 5DS7A 1Z0CA 5BR8J 5DQGA 2GQ2A 1R89A 4KPCA 3CC4S 1L3KA 2X1AA 2PNMA 4TLQA 1HA1A 1DTQA 4IRCA 1N32E 3CMAS 3PRDA 5IWAI 3PFOA 3PYFA 2C42A 2GGPA 4OHXA 3IWNC 1X4AA 1OQ3A 6FDRA 5E3PA 1WG1A 3M2VA 2FJVA 2AYEA 4XIUA 3QLHB 3W8GA 1S59A 1SB6A 1TL3A 4RLEA 5IFMA 1Q8LA 4FN5A 4W4MA 4ZP6A 2JEBB 3CD5A 2JC0A 2UUAF 5L9NA 1XR6A 5DO2A 2XMTA 3RRGA 1RHUB 3JSMB 3L3CA 1UA1A 2EWHA 1YDLA 2LFVA 1ELOA 3B82A 3ZZOA 2V8VA 1NKCA 2RAQA 1U0SA 4MAKA 5DRRA 3AT1B 2BZ2A 2QLXA 3KHRA 2OELA 4UOGA 3I5BA 1TL4A 1TKXA 3G71S 3KWMA 1N36E 4AL5A 4NLXA 1I94I 2AIRB 4FP9A 1FRLA 4ED1A 3TA0A 2C3UA 3PR5B 2MZQA 2F3JA 4ZIVA 3ISNC 2GO3A 1X9SA 2R4FA 3CEDA 1YK9A 2JLEA 5HVGA 5B7WA 4J9OA 2AYBA 1D3WA 1NK6A 2QSFA 2FVRA 1OY9A 4QIEA 1Q95G 2PNLA 5B0GA 3D6MB 5AJ3J 3DLKB 4O3RA 3D1OA 3IM8A 1U47A 2RVJA 1Q5VA 2UU9J 3PW0A 1N5QA 1NXIA 3AJDA 1WHWA 3DCAA 1TZ0A 3TAPA 5HJYA 2LLZA 5JEAE 3I4HX 3WU4A 5KT5A 4DV1F 1U49A 3O8WA 3HD1A 3NAIA 3JYTA 3RBXA 1BUXA 2HHTA 2VQFI 2FIUA 2RQKA 3SCJE 1NK4A 5L39A 1AB8A 1T3OA 4C6AA 1QE1B 4ZVSB 4P9SA 3QT6A 1RT6A 3MPYA 2B7BB 1M1HA 3WIVA 1IKVB 4YUDA 2HK3A 5I3PA 1ZA1B 5EN1A 1TL5A 2XY6A 2JX2A 1TL1A 2FDNA 2ZH2A 2MQQA 2VKRA 5BR8I 3NWGA 3M2UA 1SL1A 4I3HA 4YMEA 2YY3A 3FBFA 1S72S 4DN9A 2VD3A 2LQ5A 2GFFA 3TRGA 1QM9A 2JH3A 2CYYA 1FK9A 3MM9A 5C42B 1WC0A 2BE2B 2YNFB 3TJ8A 2QLWA 4ED2A 3BQ0A 1NJZA 2XS5A 2AEFA 2FQQB 4LF7J 1PG5B 2I5JB 4X62E 1S9GA 4DV2E 3WIUA 2VODA 5G4DA 2DGQA 2J5AA 3IC1A 3KJFB 4GKKF 3H4BA 1HBMA 4WUCA 2M7SA 2UXCE 4KFBB 1HL6A 2EFGA 5A8KA 1Y5NB 1EETA 2A2DA 1OY6A 3TEHB 1N34E 3T1HE 1MN9A 1CQNA 2I0XA 4B3RJ 5F3TA 4MMOA 4DSLA 2R7WA 1JLBA 4NRUA 1FA0A 1HNZJ 5SUHA 4H4KA 3PRYA 4PRFA 5KFAA 3SZ2A 4U7CA 2WONA 2M52A 4DV5E 3FRZA 3ISND 4G65A 4CQ1A 4M5HA 2HHPA 1H2UX 2IMOA 1SC6A 2HGNA 2XTJP 2BANA 5J2PA 3JTOA 4YY3E 3HJCA 3EDQB 2FZKB 2R8KA 4HEA9 2MJNA 4NXME 3L4BC 3W65A 4DXLA 4M8LA 1UDQA 2IM2A 3KHLA 2XO6A 4IOCQ 1K1SA 3FEXB 4CRJA 4DPUA 1SCJB 1KEKA 4HACB 4TY8A 2NXEA 4EYHB 3P4UB 4UT4A 4A48A 5RUBA 4U7UD 1HD0A 4NEYA 3OVAA 3M8SA 2I1RA 2QRRA 4GVBB 4DR2F 4PWDA 2P8IA 3D67A 1D9AA 4HR2A 3Q8SB 3I0RA 1U1LA 3ET6A 1S0NA 4P75A 2UU9I 1HHQA 4HT7A 2IOPA 2W8LA 5LSRA 2C1EB 2OI2A 1E3PA 1OS5A 1O5JA 3BPSP 5HMZA 1FJGE 2E1CA 3MCNA 1WC1A 2NSBA 2OH2A 1WHXA 2AZ1A 3HZGA 4U6PA 2FLLA 3M1VB 2EFVA 3R7SB 5EL9A 3FUYA 2AU0A 3DRRB 5KFTA 5DM6Q 3HVTA 2CPHA 4FDFA 3M8RA 3C6TA 4P7AA 3T41A 2F4FA 3V6HA 1M5PC 3DLJA 2B4VA 4NOHA 1YQHA 4DJBA 3TUJC 4LFBF 1I94E 3JTNA 2ZJRQ 2CADA 3GIRA 1X4CA 3ZZUA 1CBKA 1YITS 1C0TB 1VS3A 4BCAA 4AL7A 3FSXA 4DFKA 3BO3A 4K4XA 3PKMA 4OV6A 3HZEA 3ZNJ1 1HNIB 4F67A 3FQKA 1Z5CA 4DSEA 4KE5A 2BM1A 1S1VB 5BYQA 2M88A 5D4OA 3GCMA 1YSJA 2J7WA 2CPIA 1C4CA 5K8NA 3LPYA 3AA8A 4CO3A 1RHQB 1B7YB 2GVDA 2HVIA 2RQ4A 4LF7I 4O3OA 2BE2A 2IHR1 3RR7A 1VK8A 5CYQB 3D7SB 1QD1A 4DR1F 5ETQA 3DYAB 3IR5B 2DNMA 3UE2A 5F41A 3D5MA 1S99A 1OYDA 1FTCA 2FY1A 1TAQA 2Z5BB 3MCMA 2ALZA 2N4DA 2ZZNA 3MF5A 2B7CB 4HYMA 2WW4A 5DDRC 4IG0A 4P7VA 3LGMA 2RILA 4Q0BA 2H1YA 3ZNUA 2VJUA 2HSEB 2HZAA 2VQFE 4L3KA 5LM7E 2VFUA 4MKVA 3M85G 1HNZI 1N56A 2UUAJ 2W4PA 4WF9Q 2RF2A 2CJ9A 5B0FA 3D0IE 2R7SA 4RUCA 2LQJA 1RABB 5DRQA 4LF4F 3P45B 4LF6F 2XS7A 3CSKA 2R2TA 3HULA 5KFKA 4Q43A 4ECVA 2FC8A 3Q8RB 3M8WA 4F4YA 3DOKA 2IPOB 3QBCA 1T9XA 2Y0SD 4J9UE 5BYSA 3U7JA 1S9FA 3MOJB 5K20B 1FFSB 2NYHA 3OL9A 3NCPA 4URGA 4F4AA 2M4MA 3W2WB 3OUYA 3J80C 2X1FA 1YH8A 1U8SA 3QWPA 2K7KA 1X4GA 4KT0C 3HD2A 2N82B 3BREA 2ASLA 4WYLA 1KN6A 1L5UA 1AA1B 1N5YB 2G13A 2OTLS 1OO0B 2BQUA 3W61A 4K4VA 2GC8A 4X64I 4EMDA 4OO1C 4ELVA 2KT5A 3AQOA 3DDIA 3M8QA 2G0JA 1N5TA 2OPQA 1RJJA 3KFWX 2YX1A 1JLCA 3ZZRA 2DNKA 1CG2A 2ASDA 2D9OA 3CCQS 2ZJQQ 4U7UK 4DPTA 3UPFA 4JV2A 2UUBF 4MT1A 2EBGA 2E1AA 2V4JA 3GPAA 3K57A 4MFBB 2C39A 4JV0A 2PO1B 4WIIA 4CNYA 4OYXA 4DV1J 4DN0A 2HKJA 2QEXS 1WD6A 3THVA 2SXLA 5D8HB 4DL2A 2IM1A 1H73A 2F8HA 2EC2A 2G9OA 1KQGB 1HNXE 5HI7A 3IG1B 2EKYA 5K36F 4W98A 3IGVA 2V2QA 1FKPA 1RWOB 5HK4A 5FLXY 3VAJA 4G6VB 5JEAA 1SH3A 4C8MA 2Z8QA 2CJXB 2VBYA 1HWLA 1HNIA 4N41A 2H9ZA 4C97A 1DHMA 2HGLA 2GHPA 3EICA 4JV5F 2YNHA 1K9MT 5JMNA 4RBTA 1GFWB 1XWLA 1CS4A 2IDEA 4LSLB 4Q8EA 3JS9A 2EG1A 4UF4A 4DG1B 4X4QA 1JJ2R 2E7WA 5CYQA 1YBAA 2M3DA 1NCLA 1FF2A 2UU9E 3HSZA 5E0OA 3FGVA 1QJHA 3DYAA 4ELTA 3CCMS 3HKMA 2WW8A 4LOMA 1HI0P 5H1SV 3EXCX 3PCOB 1U26A 1GNKA 4WZQA 1CJTA 2J8SA 4KC5A 3WHIA 3N01A 4OX8A 5AXNA 1C1CA 2UUAI 1WOPA 3BDEA 3QFHA 1OWXA 1L3SA 1PBAA 1R6LA 1B70B 4ZVIA 5IV4A 3C14B 2VA3A 3D68A 4HDGA 4NLYA 3T9ZA 1OQ6A 1TUVA 4I6YA 1NHHA 3SQGB 2RHSB 3EX7B 3IN5A 1SXLA 5AE1A 4C2MA 1VHFA 2ZDPA 3FZBA 3JAMQ 1R6VA 3GZ7A 1DJ0A 5A8WA 3J7Z5 2DPIA 2B51A 3HHLB 2F1DA 1SH2A 4ID5B 1UWBB 2PA8D 1RXOB 3IWXA 4Y2KA 2DTJA 2XNQA 2VOPA 3EZUA 3CGIA 1NKBA 3UCGA 1RAAB 2HNDB 2H51B 5G0RB 4XDDA 2BA0D 4OO1D 1S6PB 4TU8A 5HBMB 3LNUA 1OY8A 4LF7E 1I5OB 3PS3A 2MGZA 2VDIA 1V3SA 2Z2LA 2EEYA 2D3O1 4U8VA 2BJ7A 4LJMA 1N88A 2FVSA 1Q4RA 1APSA 5I42A 4F02A 1S79A 1FXRA 3V6DB 3UN2A 4MIBA 4KJIA 1S1UB 1FRMA 3Q89A 4LCFA 4DR2J 3GYXB 1JX4A 1REVA 3OHAA 2CKWA 1LQ9A 2CFXA 2W4DA 4QR0A 4USVA 1Q78A 1S0OA 4B3RE 1RCXB 1SKRA 1HNZE 3T5JA 1FWPA 3DDNA 1U8WA 4E0DA 4DV1I 3CMQA 5H9FJ 3VALA 4FKYA 1GX6A 3HFZB 2ZBCA 2DY1A 1FFGB 3H2VE 3TANA 3BH7B 2P5VA 4I7FB 3OTCA 1IBKF 2XNRA 3L7UA 4ED4A 3ZZYA 3PJ9A 4KGZB 4PG5A 2IA0A 5LL6R 2HK2A 4LFBJ 4URSA 5LJ5Y 1TK5A 3CMES 5EGYA 4WWSA 4Y6IA 3QAUA 1OYRA 5SZTA 3FVYA 4IYQA 3CDJA 1RHKB 4ZPVR 2AEJA 5B08A 3N0VA 1QLNA 2FJWA 4Q2LA 2GX8A 1XNRI 2I2YA 4KQVA 4QWDA 4B3MI 4OZ0A 4LSLA 4WFXA 2BA1G 1RLDA 2AHOB 3I0SB 3IRXB 2YNGB 5J2QA 1Z2ZA 3C2PA 4RNOA 2JHEA 3G6VA 3BGRA 4F2RA 2JE6A 4DR1J 1Z0GA 3E01B 2B9EA 4ZP8A 3GMEA 5A76A 5EUHA 3BO4A 2OPRA 1Z0TA 3BR8A 1VLYA 4ZHRB 3E51A 3MPUB 2CUYA 1UETA 2Q79A 4C11B 2NN6E 2DIUA 2AW0A 1UWAA 2OLWA 1VISA 1NB7A 2UUCE 3PHTA 4OYOA 5MAOA 5KG3A 4HHJA 5FDLA 4NCBA 4LR8A 4KGXB 5IC6B 5C7PA 2JEIA 1TKTB 1RTDA 1XR7A 3FFIB 4LF4J 2CZ9A 3H7HB 4N76A 3Q1QA 3DLHA 2WSFC 3J81Q 1HYSB 3HX9A 4NLVA 1CLFA 4DL4A 3JTPA 2K2PA 2KH9A 2MQMA 4QPXA 1VQPS 3HT0A 1UWBA 3OJUA 3TVYA 2BMBA 2VJVA 2HFUA 3KDOA 1FVSA 2HNDA 3GFHA 1T9UA 2CA9A 4GC6A 4FW4A 2KDOA 3DGPA 2J0XA 2LA4A 5C0XA 3SIPB 2AYGA 5FLXU 2ILYA 3VV2B 3W8PA 4X4UA 1R31A 2DGVA 4WE1B 2DNYA 1N6QB 2JZ5A 3DRPB 2MZSA 4Y2AA 1VGYA 2CNKB 3R5GA 2X3GA 1TMMA 3RB6A 1WKJA 5BYRA 2IYIA 3DOLB 1QY7A 2M2BA 5HN0A 4O3PA 2XWXA 2GA7A 1NAQA 4CIOA 2I38A 4PRVA 4XTJA 4X66F 3K5OA 3WC0A 2UUAE 2QA2A 1VHIA 2E5LI 1S10A 4C48A 2JSXA 3OXLA 3RGIA 3O3LA 3MOZA 1VQOS 2UUBJ 1KHWA 2QYGA 4DR3F 1P42A 1CPZA 2RB7A 3TAMA 1IBMF 3L9ZA 4H4KC 4PCQA 2FHKA 4LQ3A 3FKBA 2ZZMA 5KT4A 3MM5B 2PA3A 1KIJA 5AT1B 3KRNA 3I96A 2AGOA 1S4FA 4I7FA 5GAHI 4AXIA 2K7JA 3L7ZB 3QRRA 4J7CA 4IO9Q 3CJ3A 4PXEA 4NMXA 2PO2B 3IM9A 3EJMA 2Z4PA 3J7YU 4G1PA 2MKSA 1XMOE 3I87A 1NK9A 4WU3A 2RMLA 4N7TA 4DF8A 1JLGB 1OSCA 1VRTA 1UMJA 1R8PA 1RAEB 1BWEA 3GJQB 2OFGX 4ZN3A 2W2MP 2I8EA 1LWFA 4JV5J 1BQNB 1FRIA 3CDBA 2ALYB 1UEUA 4RW9B 2Y9HA 1Q53A 3M30B 3UNYA 3R6GB 5KG5A 2YKAA 3S7RA 4ZKAA 3E01A 2F5GA 1A9NB 4CZCA 4A47A 2ZC4A 4NLUA 4DV3F 4JI5F 4DV1E 4RUBA 3E3XA 3D54A 4ZHRA 2F9JA 4ITSA 1S49A 3M8PB 1UCNA 2IESA 5GADI 3MR5A 3A4TA 3IFEA 2ZWOA 3BKFA 4EBDA 4JYAF 4MH8A 4DQPA 2CQIA 1SQGA 1I51B 3V6JA 4LF4I 4EI2A 1ZAVA 3CXCR 2BXJA 3T3FA 3NS5A 1S6OA 4RO0A 1HBUB 5DROA 1HMVB 1RZMA 3Q8PB 2NN6B 3DMJB 5E3QA 5LT5A 1RWMB 2PI5A 4Y00A 1FNMA 1ZAXA 4USTA 3M9OB 4K4WA 1Y5LB 5ELWA 3PZPA 2J7UA 4NLQA 1FD2A 2C38A 4OZ3A 2DY9A 1VRQC 2O01C 5AE2A 5FIIA 2IJNA 1WUUA 1CJKB 4OYPA 1IXKA 1VR6A 3MFHA 3LA0A 2DRBA 4R1FA 2IAJB 2GJIA 4A8SA 2U1AA 1K8AT 4J91A 3AD8C 1N6QA 4P71A 1R0CB 2ZITA 4GKKE 4JI2F 1DBDA 2E66A 1CSJA 2H3EB 3T19A 1SL2A 1Q79A 2BABA 2MQNA 1FJ7A 2UUBI 5D0EA 4Y28C 1MNEA 2EFPA 2JFDA 1NH7A 4DOZA 4CH1A 4ZPTR 3GILA 2VPZB 5AXKA 2DJWA 2NXCA 5IT4A 3MR2A 4FF3A 1SH0A 4WJBA 1YZ6A 5HMYA 4UW2A 2LEAA 3PRBA 4RNFA 1WORA 1OJ4A 5DDPC 2HIYA 3KNAA 2HW3A 1IBKJ 4CH0S 2MKIA 2OFHX 3WC2A 3QGHA 3X1LB 1WACA 4O3QA 1OPZA 1DURA 2E44A 4JI6F 1NSPA 1UJ5A 3KUEA 4O44B 4Q2MA 3R8YA 2J0SD 4TXSA 4FVCA 1JLGA 1WEXA 4FPRA 4IFDA 3CTRA 1ZPVA 3HSGA 2V34A 1UPMB 1BQNA 2V69A 4K4YA 1LWCB 4DR2E 4MKAA 4PUOB 3MEEB 3LGHA 5T41A 4W92B 2V8PA 3C6UA 1MWZA 1FNOA 3RB3A 2VOOA 1JJ4A 5IT9C 1X0PA 5D78A 4ZLPA 2DIVA 4MDTA 1Z1ZA 1FRHA 3VVTA 1VQ8S 3UQSA 4F4KA 2R2UA 4HHHA 3D1HA 1S57A 2ROEA 2UVRA 1Q81T 2J8AA 5CZXA 4R5PB 4DL7A 2MSTA 2H4YB 3MPVA 2XCPA 2QMWA 2X1GA 4A8YA 1NJIT 2CDQA 1S12A 2OAUA 4M1KA 2MQLA 3HKWA 4UY85 5D0HA 4LFBE 1S9EB 3DLBA 3ADAC 1TP7A 4KQZA 5L38A 3ILLA 1HBUA 3RRKA 2Y8WA 3MM8B 2FJDB 1R0AB 4RNMA 3J7A1 1U4BA 5JEAC 1Z59A 1EA6A 3N28A 3OTBA 3LP2B 2C3PA 4DV4F 4LF5F 3IRWP 2PFFB 5KG7A 5HP1B 3CB4A 4ALZA 1LFWA 4LF9J 1HPZA 4Y0FA 1V5IB 1B7FA 4ZVUB 1UZHA 4JI8F 1CJKA 2VH7A 5ITHA 3TI0A 1HR0F 3FK4A 2Z57B 2IAJA 4DR1E 3KK3A 2E1PA 4Z2XA 3F41A 3I4PA 3M7VA 4RL1A 1KQSR 3MUVP 4JI3I 5HROA 2J9DA 4P7TA 5C2CA 1FKOB 4JI0I 3KG1A 4KBIA 4A8OA 3EE3A 2XC9A 4CH7A 2ZH3A 3NLCA 2VBXA 1H3DA 1LWXA 2RE1A 5LSOA 1T02A 3HK2A 4WCEQ 1NHUA 1W7WA 1X4DA 2AT1B 1S6QB 2ADCA 4X66J 2XM3A 4JOUA 3RW6A 4KH0B 3WDOA 2B9WA 1UVJA 2OTJS 3OR2B 3VAIA 2XZTB 1PC5A 4LF4E 1LEOA 4LF6E 4P2SA 3UN3A 2ASYA 2UV8A 2XY7A 3H8YA 3SDEB 3SYZA 1RT7A 1IBMJ 1PIEA 2ZVSA 5HO4A 3U1KA 2B0GA 2FYXA 3I5CA 3HI9A 3AJ2A 4Z7CA 1LXNA 1FTRA 2R42A 1N5SA 2RQCA 2A1BA 2X1BA 2LJPA 3LWLA 2W01A 2HURA 4NCGB 1VQ7S 2GV1A 3EPIA 2O1WA 4O44A 2V4QA 2CJAA 1I6JA 5KFNA 2QZ8A 3CPWR 3UWTA 4ZCIA 2EFOA 4RW7A 1ZETA 3H5YA 1J5EF 3GJRB 1Y4SA 3VGUA 4PUOA 1JKHA 4KH1B 2RH3A 3SXLA 2E5IA 5KFZA 2KN4A 4KO0B 2EI5A 1P1TA 3IO1A 2DNGA 2ZH1A 2G2OA 2WSCC 4WFAQ 1RA6A 1HQEB 2NSCA 3RB4A 1KRPA 2ZH5A 2VFVA 2UUBE 2XYHB 2C3MA 1KKHA 1PVGA 1XEZA 1FXDA 1C2PA 4G1IA 4U8YA 3U1YA 4UZCA 4BWMA 2HAIA 4DV3J 4YR0A 1QZRA 3M6XA 2CQDA 1FESA 4C8NA 5JEAD 5L3JA 3QGPA 4YEAA 5EHHA 2HQIA 4BS2A 2Y3YA 2XGPA 4QWBA 4JYAJ 4X2BA 2XY5A 4LRAA 2R7QA 1SV5A 5KT7A 2XBPA 5K36E 4TLRA 1SJ3P 5ETLA 1U1NA 1JLFB 3L09A 3TO8A 2ZVIA 3ENAA 4NA1A 5EKWA 1RAFB 3C15B 3W64A 3LP2A 4LF9I 3ZZZA 1RWWB 1FEEA 5GVQA 4JV5E 1RKIA 3BQ2A 2A0FB 5HP1A 1IKWA 3P3EA 1LOUA 3TR5A 3CUNA 1IM4A 2MZTA 1QAJA 4ISAA 3GJTB 3GSDA 4UZBA 2FGCA 4AYBD 2I6WA 4C4WA 4LCHA 2NREA 2AE8A 2KXNB 1MW7A 2XCAA 1T9WA 3D66A 1X4FA 1KC8T 5JUMA 3H1CA 2VG7B 2XSJA 1BGXT 1VJQA 2IRYA 4DUYI 4NA3A 1GH8A 2QV6A 4FKXA 4M5NA 5C2GA 1TUWA 5ETVA 3AB4B 4KYZA 1UKUA 1RLCL 4V1Ak 4JI2J 4LT6A 2CG8A 4BDPA 4FNIA 1WI8A 3HVAA 2F1FA 5IWAF 4XO0A 4CYUA 1S6QA 2Q66A 2KYZA 3HHDA 3WU6A 1M5VC 2WK4A 3NGSA 4PAAA 1IBMI 1T05B 3GJSB 4AIMA 2DBBA 3PW2A 2DR8A 3SDEA 2POKA 2PMHA 1KOHA 3EGWB 2HWHA 2OD6A 1RBLA 2R7TA 5GMEA 1S1TB 3A8IA 3QT8A 4U3BA 2L3MA 5J2MA 3HHLC 3H0PA 5KFPA 2DR9A 3BGUA 5HLFA 3EZOA 1XIQA 3LQVA 2AJ1A 1FKAF 3AY0A 2MY7A 3A8JA 3DRXA 2HKEA 2EG2A 1KVJA 3U27A 4JI6J 5CHCB 1YJ9S 3CDWA 2B9XA 3KJVB 2KB2A 3UI3A 3VR1A 2VG6B 3QSYB 4HI2A 3KDNA 1IM6A 1LK5A 4MK8A 5I3UA 5I3QA 2FJXA 4I69A 3UD4P 2LXIA 1RTIA 5JJBA 1WTFA 2BW2A 5DETA 2WAQD 4K8RA 1RHMB 2YWGA 3MEGA 1U02A 2VG5B 5GAGU 4PQAA 3FRYA 5THWA 1HQEA 4I64A 3C8YA 1MSWD 1GTEA 3PRVA 4B3SE 2VV5A 4RJVA 1SQFA 1WC3A 2JJ4D 4LVNP 3M6UA 2JEJA 2IBOA 5A0YB 3K1JA 1R0BG 2O66A 2Y0BB 2MYFA 4DV6F 1HK7A 4CTAB 1LWEB 4KV8B 1TKZA 2R8HA 4OX7A 2Q3PA 3D3BJ 4ICLB 4F3MA 1D09B 3K8WA 1IBKE 3Q86A 4F3QA 2XMKA 4GRSA 4PXCA 2R7RA 3VAGA 3OLAA 4BA2A 1GTHA 4OYBA 1B64A 4OI0A 3MMAB 5DJBA 4DUTA 3R5DA 1JLFA 4BWJA 4DU8A 3C66A 5C25A 3H98A 1W2IA 4PPZA 4OZ5A 3UDCA 1JXEA 2BOAA 4QWCA 2HLUA 3AAWB 3HHNB 2CQCA 1RA7A 4I6AA 1BC6A 4DV4J 4LF5J 5J1PA 4XPEA 5CXTA 4A8KA 5C0XF 3DM2B 2RKIB 4USIA 2HS4A 2HVDA 3FSIA 5K36B 5E3RA 2Y1IA 4JI7F 3SV3A 3GQCA 1NHJA 3W9HA 3RAXA 2H4WB 4JI8J 4DS5A 4WP3A 2E1RA 3M8ZA 2OPPB 4FBUA 1HR0J 3A8EA 5BR8F 2EPIA 2QA4G 5KFHA 1HNVA 5L1JA 2CXEA 1EKSA 2CWKA 2ZOMA 1JLQB 1RTZA 2QLBB 5LL6d 3G8TA 3AJ1A 3CCRS 4C8LA 4UTGA 4IDKB 4FS2A 1JXVA 5LMUF 4FZVA 5KFRA 5T7LB 4ZN1A 2AYMA 2DGOA 4R8UA 3CF5Q 1FE4A 2KFNA 4USWA 4DR6E 3P3CA 3J80Y 3UVJB 3HHLD 4BA1B 1RREA 1T05A 2BJ3A 2JL9A 5CD4A 1IQTA 4LMZA 1Y11A 1R43A 4IH5A 2LMIA 4ECTA 4OZ1A 1SC3B 2EVZA 2DT9A 3M8YA 4PQUB 3BSCA 2DITA 5C0XD 1UFLA 1JB0C 3KLFB 3IS9A 1X4HA 2CPJA 1EJ7L 4ZOSA 3I82A 3HCXA 1KQKA 4FW5A 3PG9A 2HYIB 3M05A 1JQGA 4DZDA 3D6HB 3KUHA 4ZLJA 3KJVA 1XNQE 1WEYA 2ZHOA 1SKSA 1WDTA 1XK8A 2PIIA 2M9KA 3N4WA 1UVNA 3QRPA 1OSDA 2BV3A 2AMCB 1J5EJ 3CJQA 2BJ1A 2KG1A 2W9BA 1WOSA 4YDDB 3P96A 3CD0A 3TOQA 3R97A 1FX4A 2B4OA 2K1RB 3QMQA 1CC7A 4X66E 2COLA 1DY3A 3SEOA 2Z5CA 5HJXA 1X31C 1HBOA 3VQTA 4NMLA 4M94A 2H48B 1DLOB 7FD1A 3BO2A 3FEYB 2F8MA 1TVRB 2V0NA 4RW4A 3PY8A 2OEMA 2XLJA 3PO5A 4DR3E 3FZ2A 2K3KA 1VOMA 1IBME 3FBEA 1DTTA 1FRXA 1XHKA 3ETOA 2DNLA 2FVCA 1X9WA 4J90A 4ICLA 2W24A 1RT4B 5F0WA 3KNGA 2YKNB 3W3SA 3R5JB 1VQ5S 2QJ3A 2ZH8A 2VF3A 3I6PA 3CCVS 2CIMA 5B09A 5DG9A 2G1DA 3A3OB 4WFNQ 3CIMA 1ULRA 2HQ3A 1PYOB 1S7IA 1UEVA 4LF5I 2F65A 1UVMA 1S4EA 1FJEB 4DBQA 3P3DA 2BACA 2PNZA 2GNKA 3H4LA 2R7UA 4WIQA 4M5JA 4ZLLA 2RKIA 1ICEB 4LIWA 2NXNA 4ILMA 4TU9A 1X60A 3CIZA 1Z0WA 3GLJA 1JLAA 1T03A 2OPPA 4JV1A 1FWLA 2ZD1B 3TVZA 3NL0A 4BC9A 4JI4I 4YDXA 5A2QQ 3CC2S 2RS2A 3BSAA 3Q8UA 3TUIC 1DQ9A 4DV3E 2J0WA 2EKNA 4JI5E 4Y34A 4MU0A 2IC3B 1RYSA 2FY8A 4LIRA 3GV7B 2IERA 2JLGA 4PKDB 1HKAA 4IDKA 1DTQB 4YB1P 2KFZA 1IBCB 3JAMC 3FQLA 2BW7A 4IKAA 2EK6A 2DHGA 4P2MA 2GGPB 3FCWA 4JYAE 1JWWA 5IWAJ 5H9EJ 1U24A 2AZ3A 3M2VB 2A6OA 1Z0VA 2HFOA 5CD4H 3BGFA 4RW6A 2E1MC 1U1PA 4DL3A 4UOFA 2HNZA 3DN9A 3N6NA 1BMQB 2C2NA 3NOCA 4JUZA 2HVEA 3G6YA 1YLXA 1R8HA 1S16A 2NN6C 1T9YA 3KLFA 4RUAA 4EK2A 1RT5B 2HLTA 4DQSA 1FVQA 2V8HA 4OHWA 4ZLNA 2ROGA 4N3OA 4XPCA 3MUMP 4AQYI 4GMKA 3UDVA 3OTEA 4IFDF 1NK5A 1ZAWA 5GAEI 2D41A 4RWXA 3ENQA 2NCKL 2PO0A 1J5EI 4I68A 2AD9A 4IS9A 3JSBA 4JI2E 2MHEA 2JEAB 3LAMA 2DGXA 2ILZA 2R7OA 2HBYB 4LUBA 2B4UA 2V63A 3UR3C 2C2EA 1SL0A 3CDEA 3BKTA 4OZ2A 1WF2A 1PKPA 1KD1T 4FNHA 2GZOA 3M4XA 4NYZA 2LKZA 4X64F 1T9TA 2W25A 3MDFA 1NKEA 1P27B 3DRSA 4OYZA 2KTQA 2QO3A 2PGCA 5KFMA 4DV6J 4IH6A 4MIWA 3NGDA 3TWZA 5CAAA 2YKNA 5KT3A 1A6FA 4WUDA 1V5VA 2BA9A 4TYAA 3B8HA 3JYTB 2Q1LA 1Q86T 4IFDD 3WX8A 3J80U 3PO4A 4M95A 4JI6E 4L74A 2Q6BA 2HEKA 5KFFA 1QUPA 4NXNI 2WNRA 2FZGB 3KLGA 4CO0A 3PV8A 3CJKA 4ETZA 4KAIA 2HFVA
chains in the Genus database with same CATH topology
2O1UA 4X65E 5L3JA 4URLA 2UUBI 1Z0GA 1MG7A 5LMNI 5BR8I 2V2VA 4DR5I 1N0VC 2X36A 2X7IA 1IBLE 4I3HA 1IBKI 1H7UA 4DR4I 1Z0TA 4JI4E 4X64I 4EMDA 4WUBA 4HXZA 3D4JA 4IZJD 4FWDA 3K17A 5IWAE 1N33E 1XMQI 1Y4UA 4LF6I 4X65I 1XNQE 1VISA 4LF9I 1OJ4A 2UUCE 4LF8E 2AJ4A 4JV5E 4USKA 4DPTA 1IBLI 4GKJI 1ZM9A 2BV3A 2F4VE 1ZM4A 2VQEE 4X62E 1MU5A 4DV2E 3CWVA 5FWKA 4B3RI 2GS8A 1Z0BA 1Z5BA 1N33I 2CZ9A 3F0NA 4JI3E 4WUCA 4JI2I 3Q1QA 2HKJA 4X66E 1USVA 2UXCE 3J81C 2Z5CA 2R3VA 3GONA 3J81Q 1MX0A 4HY1A 4DR7E 3WU5A 2EFGA 1H73A 4JI0E 4DUYI 2HHHI 2A2DA 1N34E 3T1HE 2VQEI 2V34A 2HFUA 5GMDA 4DR3E 1HNXE 1FKAE 2IOQA 2Z5CB 1NHIA 4DR2E 3QT7A 1IBME 3PRYA 2V2QA 1XHKA 4MYUA 2V8PA 1N0UA 4DV0E 5IT9C 3M6AA 4DV5E 4DV7E 5IT9Q 1NZ0A 4DV4E 4LF5E 2O1TA 4AQYE 5FLXC 5FLXQ 3WU6A 1KVKA 3T1HI 2Z5EA 2VF3A 1EI1A 3ZKBA 4IZJA 4JI8E 4DPXA 1IBMI 4YY3E 2XEXA 4DU7A 3HJCA 4FW9A 3LTOA 1HR0E 4DR6I 4HACA 3B78A 4NXME 4DV7I 2DEJA 4DXLA 2UU9E 4PRVA 4LF5I 4GKKI 4XTJA 1S4EA 4LFAE 4JI6I 2UUAE 5GMEA 4OX9E 4P52A 2E5LI 4M1KA 2V2ZA 3QT8A 3H4LA 4YHHE 4DPUA 4HACB 2O1VA 3WU3A 4UT4A 4LFBE 2Q2EB 4YY3I 3ZZTA 4DV6E 1Z0CA 3PYEA 1Z0WA 4USMA 2HKEA 2UU9I 1FWLA 1KIJA 2IOPA 2UUAI 2PNMA 1Z59A 5A2QC 1EA6A 4JI4I 2OI2A 5A2QQ 2CG9A 1N32E 2GQ0A 4ZVIA 5IWAI 4LFCE 4PU9A 3PYFA 3K85A 4DV3E 4JI5E 1ZXNA 1NHHA 1FJGE 4DV6I 3OTOE 1XNQI 2UUCI 4LF8I 4JV5I 1XMOE 3JAMC 2F4VI 3JAMQ 4X62I 4DV2I 3ZKDA 3LPSA 4DR1E 4DUZE 4JYAE 4FN5A 1N32I 3ZZ0A 1XNRE 3J7AM 4MYTA 4B3ME 4JI3I 4P7AA 4NXNE 4X66I 2UXCI 1DARA 1Z0VA 4B3SE 4JI7E 3OTOI 3T1YE 2DEIA 4DR7I 1ELOA 1RR9A 3B82A 1ZM3A 3P06A 4IZKA 4JI0I 3K1JA 1I94E 2CGEA 1H74A 1N34I 1D6TA 1HK7A 4B3TE 3V2UC 3ZZUA 5BR8E 4DR3I 1HNXI 3LNUA 4LF7E 4DPYA 4DR2I 1IBKE 1S16A 4IZKB 1J5EE 2BM0A 1Z5CA 4X64E 4DV0I 1H72C 2BM1A 4DV5I 4JI7I 1N36E 4FWHA 3T1YI 2ZM6E 4DV4I 4N3OA 4LF4E 4Z7YA 4IZJB 1I94I 4LF6E 3QT5A 4DV1E 4AQYI 4JI1E 4DU8A 4LF9E 4B3TI 1B62A 5LMUE 2Z5BA 4KHPE 4LF7I 1PIEA 1HNWE 4JI8I 4GKJE 1ZXMA 2UXBE 1J5EI 4Z7CA 1HR0I 1B63A 4B3RE 1Z5AA 3V5RA 4NXMI 1N36I 1HNZE 2ZM6I 2R42A 2Z5BB 2UXDE 4JI2E 4LF4I 4LFAI 4OX9I 4DV1I 2HFSA 1U2RA 4JI1I 2LJPA 4FWGA 3Q6MA 1NHJA 2PNLA 4HYMA 1Z0EA 4YHHI 2WW4A 4RPFA 5LMUI 4DUYE 2O1WA 1H7SA 4KHPI 2HHHE 2E1RA 2J7KA 1HNWI 4LFBI 1Y6ZA 2A2CA 2UXBI 1FNMA 1UEKA 2VQFE 1FI4A 1PKPA 1K47A 4DPWA 4PRXA 4ED4A 1HNZI 2UXDI 1Y4SA 5LL6R 1USUA 2HK2A 4UTGA 3WU4A 4LFCI 4DV3I 3HULA 1WUUA 4JI5I 1FWKA 1FJGI 2ZBKB 3PYGA 4K0KE 4R1FA 3ZM7A 2VQFI 1XMOI 2NPFA 1A6FA 4WUDA 3PYDA 1ZM2A 2UUBE 3B8HA 1KKHA 1PVGA 4DR6E 5LMNE 4DR5E 4DR1I 3QT6A 4DUZI 4JYAI 1RREA 3Q6NA 1KTVA 2ZITA 4GKKE 1XNRI 1BKNA 4KQVA 4JI6E 4DR4E 4B3MI 1QZRA 2E5LE 4NXNI 2HK3A 3J7AG 4B3SI 3J80C 3J80Q 4K0KI 4JG4A 1XMQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 E;  5L3J A;  4URL A;  2UUB I;  1Z0G A;  1MG7 A;  5LMN I;  5BR8 I;  2V2V A;  4DR5 I;  1N0V C;  2X36 A;  2X7I A;  1IBL E;  4I3H A;  1IBK I;  1H7U A;  4DR4 I;  1Z0T A;  4JI4 E;  4X64 I;  4EMD A;  4WUB A;  4HXZ A;  3D4J A;  4FWD A;  3K17 A;  5IWA E;  1N33 E;  1XMQ I;  4LF6 I;  4X65 I;  1XNQ E;  1VIS A;  4LF9 I;  1OJ4 A;  2UUC E;  4LF8 E;  2AJ4 A;  4JV5 E;  4USK A;  4DPT A;  1IBL I;  4GKJ I;  1ZM9 A;  2BV3 A;  2F4V E;  1ZM4 A;  2VQE E;  4X62 E;  1MU5 A;  4DV2 E;  3CWV A;  4B3R I;  2GS8 A;  1Z0B A;  1Z5B A;  1N33 I;  2CZ9 A;  3F0N A;  4JI3 E;  4WUC A;  4JI2 I;  3Q1Q A;  2HKJ A;  4X66 E;  2UXC E;  3J81 C;  2R3V A;  3GON A;  3J81 Q;  1MX0 A;  4HY1 A;  4DR7 E;  3WU5 A;  2EFG A;  1H73 A;  4JI0 E;  4DUY I;  2HHH I;  2A2D A;  1N34 E;  3T1H E;  2VQE I;  2V34 A;  2HFU A;  5GMD A;  4DR3 E;  1HNX E;  1FKA E;  1NHI A;  4DR2 E;  3QT7 A;  1IBM E;  2V2Q A;  1XHK A;  4MYU A;  2V8P A;  1N0U A;  4DV0 E;  5IT9 C;  3M6A A;  4DV5 E;  4DV7 E;  5IT9 Q;  1NZ0 A;  4DV4 E;  4LF5 E;  4AQY E;  5FLX C;  5FLX Q;  3WU6 A;  1KVK A;  3T1H I;  2VF3 A;  1EI1 A;  3ZKB A;  4JI8 E;  4DPX A;  1IBM I;  4YY3 E;  2XEX A;  4DU7 A;  4FW9 A;  3LTO A;  1HR0 E;  4DR6 I;  4HAC A;  3B78 A;  4NXM E;  4DV7 I;  2DEJ A;  4DXL A;  2UU9 E;  4PRV A;  4LF5 I;  4GKK I;  4XTJ A;  1S4E A;  4LFA E;  4JI6 I;  2UUA E;  5GME A;  4OX9 E;  2E5L I;  4P52 A;  4M1K A;  2V2Z A;  3QT8 A;  3H4L A;  4YHH E;  4DPU A;  4HAC B;  3WU3 A;  4UT4 A;  4LFB E;  2Q2E B;  4YY3 I;  3ZZT A;  4DV6 E;  1Z0C A;  3PYE A;  1Z0W A;  4USM A;  2HKE A;  2UU9 I;  1FWL A;  1KIJ A;  2UUA I;  1Z59 A;  5A2Q C;  1EA6 A;  4JI4 I;  2OI2 A;  5A2Q Q;  1N32 E;  4ZVI A;  5IWA I;  4LFC E;  4PU9 A;  3PYF A;  4DV3 E;  4JI5 E;  1ZXN A;  1NHH A;  1FJG E;  4DV6 I;  3OTO E;  1XNQ I;  2UUC I;  4LF8 I;  4JV5 I;  1XMO E;  3JAM C;  2F4V I;  3JAM Q;  4X62 I;  4DV2 I;  3ZKD A;  3LPS A;  4DR1 E;  4DUZ E;  4JYA E;  4FN5 A;  1N32 I;  3ZZ0 A;  1XNR E;  3J7A M;  4MYT A;  4B3M E;  4JI3 I;  4P7A A;  4NXN E;  4X66 I;  2UXC I;  1DAR A;  1Z0V A;  4B3S E;  4JI7 E;  3OTO I;  3T1Y E;  2DEI A;  4DR7 I;  1ELO A;  1RR9 A;  3B82 A;  1ZM3 A;  4JI0 I;  3K1J A;  1I94 E;  1H74 A;  1N34 I;  1D6T A;  4B3T E;  3V2U C;  3ZZU A;  5BR8 E;  4DR3 I;  1HNX I;  3LNU A;  4LF7 E;  4DPY A;  4DR2 I;  1IBK E;  1S16 A;  1J5E E;  2BM0 A;  1Z5C A;  4X64 E;  4DV0 I;  1H72 C;  2BM1 A;  4DV5 I;  4JI7 I;  1N36 E;  4FWH A;  3T1Y I;  2ZM6 E;  4DV4 I;  4LF4 E;  4Z7Y A;  1I94 I;  4LF6 E;  3QT5 A;  4DV1 E;  4AQY I;  4JI1 E;  4DU8 A;  4LF9 E;  4B3T I;  1B62 A;  5LMU E;  4KHP E;  4LF7 I;  1PIE A;  1HNW E;  4JI8 I;  4GKJ E;  1ZXM A;  2UXB E;  1J5E I;  4Z7C A;  1HR0 I;  1B63 A;  4B3R E;  1Z5A A;  3V5R A;  4NXM I;  1N36 I;  1HNZ E;  2ZM6 I;  2R42 A;  2UXD E;  4JI2 E;  4LF4 I;  4LFA I;  4OX9 I;  4DV1 I;  2HFS A;  1U2R A;  4JI1 I;  2LJP A;  4FWG A;  1NHJ A;  4HYM A;  1Z0E A;  4YHH I;  2WW4 A;  4RPF A;  5LMU I;  4DUY E;  4KHP I;  1H7S A;  2HHH E;  2E1R A;  2J7K A;  1HNW I;  4LFB I;  2A2C A;  2UXB I;  1FNM A;  1UEK A;  2VQF E;  1FI4 A;  1PKP A;  1K47 A;  4DPW A;  4PRX A;  4ED4 A;  1HNZ I;  2UXD I;  5LL6 R;  2HK2 A;  4UTG A;  3WU4 A;  4LFC I;  4DV3 I;  3HUL A;  1WUU A;  4JI5 I;  1FWK A;  1FJG I;  2ZBK B;  3PYG A;  4K0K E;  4R1F A;  3ZM7 A;  2VQF I;  1XMO I;  2NPF A;  1A6F A;  4WUD A;  3PYD A;  1ZM2 A;  2UUB E;  3B8H A;  1KKH A;  1PVG A;  4DR6 E;  5LMN E;  4DR5 E;  4DR1 I;  3QT6 A;  4DUZ I;  4JYA I;  1RRE A;  1KTV A;  2ZIT A;  4GKK E;  1XNR I;  1BKN A;  4KQV A;  4JI6 E;  4DR4 E;  4B3M I;  1QZR A;  2E5L E;  4NXN I;  2HK3 A;  3J7A G;  4B3S I;  3J80 C;  3J80 Q;  4K0K I;  4JG4 A;  1XMQ E; 
#chains in the Genus database with same CATH topology
 1RT6 B;  4C3K A;  2AJ0 A;  2ATL A;  2WBM A;  4NYP A;  2KT3 A;  4UOH A;  1PJ7 A;  1HW9 A;  2B4P A;  1VIX A;  1RAG B;  1JLE A;  5ETT A;  4MIA A;  1TL1 B;  4PXB A;  3NXZ A;  3VHQ A;  4V19 J;  4JI7 J;  3M7N D;  4YP3 A;  2XHC A;  3CDA A;  2IRX A;  5KG0 A;  4DMZ A;  2JFK A;  3M2U B;  3D0H E;  4TN2 A;  3NGR A;  3ZTQ A;  3H5U A;  5KT6 A;  1RAI B;  1NJW A;  4DFM A;  4ZVT B;  2V67 A;  4GKJ I;  1YGY A;  3LAK A;  4KKO A;  2IC3 A;  1FK9 B;  3MM9 B;  4OHV A;  2C2M B;  4Q5V A;  1XMB A;  1SC4 B;  3F44 A;  4NLS A;  3MAH A;  4WBF A;  1RYR A;  3BR9 A;  3U1N A;  2DGU A;  2OUG A;  2KRB A;  3BDP A;  3J81 C;  1S9G B;  4HY1 A;  5LMU J;  1G1X A;  1XMQ F;  4P2X A;  2Z58 B;  4X65 F;  2CQP A;  4IG3 A;  2NN6 D;  2HHH I;  2IYG A;  1HBM B;  1RWN B;  3G87 A;  2QMX A;  5A8K B;  1CVJ A;  5FD1 A;  3GG0 A;  1EET B;  3CJ0 A;  3HSD A;  1V3R A;  4EWT A;  1JIH A;  3WBZ A;  4DV4 E;  4LF5 E;  1BQM B;  2HG4 A;  3GII A;  1WEL A;  3H2U B;  1JLB B;  1RT5 A;  5D3G B;  5ETM A;  1LKZ A;  3KLI A;  2PO4 A;  5KFL A;  2WON B;  2XI2 A;  3IR6 B;  4MK9 A;  2KVI A;  3K8V A;  1E3H A;  1RIS A;  4QU7 A;  4JI8 E;  2WOM B;  2DIS A;  4OZN A;  2MEW A;  2XEX A;  1BLU A;  1UPP A;  3MMJ A;  3AH6 A;  1HR0 E;  4L76 A;  1VFJ A;  4EO6 A;  1RT2 A;  3SSR A;  3K5L A;  3SMZ A;  5ETO A;  2BAN B;  5J2P B;  2OPS A;  3W9J A;  2ZUA A;  4X4N A;  3FNN A;  4YHH E;  2DNH A;  2W9A A;  3R2D J;  4B3O A;  2JEA A;  1BWV A;  5F9N A;  2APO A;  4RUH A;  1VQ9 S;  2R8I A;  3ZZT A;  4WFB Q;  5JVG Q;  3B4D A;  1TV6 A;  3T5H A;  4M5L A;  2VB6 A;  3H59 A;  1P6T A;  1G4C A;  1RI7 A;  5F8M A;  1H2V Z;  1NDK A;  4R0E A;  4TY8 B;  1RTJ A;  4ED7 A;  4OIX A;  3TZX A;  4K5S A;  5KOX A;  1SIW B;  4HYK A;  3SSS A;  2CQ1 A;  2HRT A;  2EBE A;  4EO8 A;  1NB2 A;  4A8M P;  3PX0 A;  3PHE A;  4PWD B;  2V8G A;  5K8M A;  3I0R B;  3ET6 B;  2XSF A;  4PXD A;  4B9T A;  3W1Y C;  3DU6 A;  4DV6 I;  4D3G A;  3GP9 A;  3ILO A;  3Q83 A;  1WWH A;  4CO2 A;  4K4T A;  1IJE B;  4TNO A;  3OL7 A;  2L41 A;  1BE4 A;  2WVB A;  1CC8 A;  3DOM A;  3O44 A;  1JNZ B;  2BA0 G;  4DUZ E;  4ED6 A;  3TQ1 A;  4I2P A;  2YQ0 A;  4NLT A;  4KY3 A;  4LVO P;  3KLE A;  1S97 A;  1VRU A;  4M5D B;  4OJ3 A;  4E8U A;  2VFT A;  2FLP A;  1ZM3 A;  1HI8 A;  2CGE A;  3HVT B;  3T6B A;  2F63 A;  3UO0 A;  2DH8 A;  3V2U C;  3KMQ A;  3C6T B;  2G0I A;  1IR0 A;  1QSL A;  4DPY A;  3H40 A;  2DXF A;  1J5E E;  2QLF B;  1B99 A;  2KG0 A;  5DQI A;  4DV0 I;  2CNO B;  1H72 C;  3EYZ A;  1IKX B;  2R7X A;  4JI7 I;  4F04 B;  4FWH A;  2MJU A;  1OYS A;  1RWV B;  2IVY A;  3M32 A;  2LQB A;  4RU9 A;  5L1L A;  3S1T A;  1PC4 A;  3FSY A;  3C3L A;  1YJV A;  2EK1 A;  1N34 F;  4FXW A;  3QZ7 A;  3G4S S;  3OVS A;  3W60 A;  4OI4 A;  2KXF A;  5GMK a;  2ATC B;  3W7B A;  3I5A A;  3W2V A;  1VBX A;  3DC2 A;  3CCJ S;  1XNR F;  2IIH A;  3OLB A;  4B3M F;  3UNG C;  2GVD B;  4LFA I;  1YKW A;  4OX9 I;  1DRZ A;  1NSK L;  3RRH A;  4N5S A;  3OFF A;  2NLW A;  5LMU I;  4C0H A;  3W63 A;  5E3C A;  2QIF A;  4HVZ A;  1FDB A;  5EWG A;  2HQG A;  1SC1 B;  4PRX A;  3VZH A;  4DLE A;  4WP8 A;  4IG0 B;  3KK1 A;  2BQ3 A;  4ILL A;  2HHS A;  1CQM A;  4Q0B B;  5IT0 A;  2ZM6 F;  2F7V A;  1VQ4 S;  4CI0 B;  3GR0 A;  4LFC I;  3DU5 A;  2QL5 B;  2YX4 A;  2BUN A;  2ZBK B;  4CNZ A;  2P9C A;  2C2R A;  4KHP F;  1BQM A;  4J9Q A;  2RF2 B;  4JBC A;  4DSK A;  5D3G A;  2O5D A;  3PYD A;  5JXS A;  4ANE A;  1S7H A;  1RAJ A;  1V3Z A;  3R5B A;  3KJQ B;  4KHM A;  2DH9 A;  1FXL A;  1WOO A;  3CCS S;  2WVD A;  2WOM A;  4ZPB A;  1KTV A;  3DOK B;  1J5O A;  3VAH A;  3NBP A;  1EAR A;  1Z4U A;  3NWR A;  2XS2 A;  2ZOG A;  1HLW A;  3MD3 A;  2X51 A;  1N0V C;  2GAG C;  3OUY B;  4DX6 A;  4DI6 A;  2D1C A;  3OV7 A;  3CVK A;  3ZO7 A;  4PEO A;  4QZV B;  5KG2 A;  1R27 B;  3D9B A;  3K17 A;  5IWA E;  3SCI E;  1E6Y A;  2MB0 B;  2PMW A;  1R8C A;  4UUX A;  2GJF A;  2HVZ A;  4LPF A;  1MMN A;  1TTH B;  4X4P A;  2AKW B;  4ED5 A;  3M8Q B;  2OPQ B;  4QNJ A;  2FJE B;  3PS2 A;  4X64 J;  1JLC B;  4ZVP B;  3PR4 A;  3H25 A;  2DK2 A;  4ZVF A;  3CE8 A;  3GLL A;  2E5L F;  2AJ2 A;  1NBE B;  4P73 A;  4DX7 A;  5K5M A;  2V4J B;  4DCP B;  2ZOF A;  2C39 B;  4HDH A;  2MQO A;  2QFJ A;  1RHJ B;  4M5D A;  5IT9 Y;  3KLH A;  4L73 A;  3UD5 A;  4AND A;  1FKA E;  1Q82 T;  4H4M A;  3RB0 A;  1KFD A;  1IBL F;  1NHI A;  3QT7 A;  1YVF A;  5IV3 A;  1FCA A;  3PVX A;  2KJV A;  4J9S A;  4IFV A;  3NG8 A;  3MCO A;  4NRT A;  5CYJ A;  4UY8 T;  2ZZT A;  2X3D A;  3U1M A;  4PZV A;  3QPI A;  3VGS A;  1FKP B;  1IKX A;  1WG4 A;  2Z5E A;  1F3F A;  5JEA B;  1WI6 A;  1AUD A;  1EI1 A;  3CCT A;  2BX6 A;  3TEG A;  3R7B B;  2CJK A;  2AJF E;  4F0M A;  2MZR A;  5EX0 A;  1LK7 A;  2P9G A;  3G6E S;  3D3C J;  2KM8 B;  3AFG A;  4ETX A;  4F36 A;  1U1R A;  4ES3 A;  2YNH B;  1NRK A;  2HBZ B;  3UW1 A;  1YBU A;  2XMW A;  4XTT A;  1CS4 B;  3WU3 A;  4RWW A;  1SI9 A;  3PW5 A;  3PDN A;  3P5T L;  4DV6 E;  1HQU B;  2IFX A;  3LP1 A;  4ENO A;  2DRA A;  3O1L A;  1K0V A;  2XMU A;  3TAQ A;  4Y2I A;  4IOB A;  2CAJ A;  5KFS A;  4FYX B;  4I2Q A;  2C2D A;  1SQE A;  1XMQ J;  1CJT B;  2YNI A;  4R0J A;  4X65 J;  1C1C B;  4IOA Q;  3I56 S;  1H7W A;  4LF8 I;  2Q6C A;  2JLF A;  1CUL A;  1HQ2 A;  4P2F A;  3CDI A;  2F4V I;  4ECR A;  2E7X A;  1T11 A;  3J81 j;  4I0W A;  4NYO A;  2WBR A;  5C0X E;  3RBD A;  4B9S A;  1M0S A;  1KQF B;  1DAR A;  3CJ5 A;  3TJ9 A;  3W62 A;  2Z2M A;  4JI7 E;  1A0O B;  4DR7 I;  1RR9 A;  2CPY A;  4RNH A;  1VQ6 S;  4IZK A;  5A8W B;  2LXF A;  5K36 C;  1H74 A;  1VC5 A;  2C37 B;  2DPJ A;  5BR8 E;  1FNX H;  2W4C A;  4FYV B;  5DNX A;  1X5S A;  3H4D A;  2OGU A;  5HQM A;  3R1H A;  1RWX B;  3BN7 A;  2C2K B;  2HS3 A;  2MGZ B;  4M5M A;  2VPW B;  1Y4Z B;  3BSN A;  2YQ3 A;  4QW8 A;  5L9X A;  1VBY A;  2BR0 A;  5EWF A;  4NI2 A;  2CG4 A;  5I42 B;  3HP6 A;  5LMU E;  2GQQ A;  1HW8 A;  5DG7 A;  2PEH A;  4ILR A;  2E9R X;  4OKG A;  1SJF A;  1QAI A;  1MRO A;  1T94 A;  3R1L A;  2RU9 A;  1VLO A;  4OI3 A;  2XMA A;  1PKU A;  2QSW A;  1KP6 A;  4ZPC A;  2KI2 A;  3T1Y F;  2W7P A;  1REV B;  5AXM A;  1SJQ A;  1H7S A;  1WHV A;  2P9E A;  2YKM A;  3DXB A;  2QFI A;  3WQP A;  1K47 A;  4TKT A;  2HHX A;  3VAK A;  2JEF A;  4DPW A;  4PWW A;  2MMY A;  3HPO A;  1EIY B;  3I9Z A;  4AFF A;  3TA2 A;  3CT9 A;  4FF4 A;  3BGL A;  5B0E A;  2AQ4 A;  3AOA A;  5K8O A;  3V6K A;  4FW3 A;  3RYL A;  4AXJ A;  3GR1 A;  3DD6 A;  3JSY A;  5E2Q A;  2JVR A;  1OYP A;  4NLD A;  1YJ7 A;  2Y1R I;  4DV2 J;  3ZTO A;  4NCA A;  3PX4 A;  5F3Z A;  3KHG A;  4J3D A;  1F2G A;  4ID8 A;  1TQL A;  1B0V A;  1BKN A;  2C2O B;  1NZ8 A;  2LQ9 A;  1UW4 A;  2BR2 A;  3MM7 A;  2O1U A;  1N34 J;  1QUV A;  1S1X A;  4CT9 A;  3KK2 A;  2E5G A;  3NY0 A;  1KBR A;  1XNR J;  1F5C A;  2G0C A;  5J2Q B;  4B3M J;  1HQU A;  3NAH A;  3BGR B;  4WUB A;  3SCK E;  2JE6 B;  3M6W A;  1XMQ I;  1WF0 A;  4U95 A;  3K89 A;  4X65 I;  2ABY A;  2PT0 A;  3L7O A;  1HAR A;  3UHM A;  3EZ5 A;  2OPR B;  3NNH A;  3JXO A;  4OQJ A;  3IAS 9;  1ZM9 A;  2NZC A;  4DR5 F;  1D0E A;  2OO4 A;  4OI2 A;  1EP4 A;  2ZM6 J;  2CQB A;  5K36 D;  1U6Z A;  4PR6 A;  3X3U A;  1WDD A;  4OO1 A;  5FDL B;  2LDI A;  5DM7 Q;  4KHP J;  4D3H A;  4ER8 A;  1RT3 A;  3DLE A;  3F73 A;  3MAA B;  4PYD A;  1NZA A;  1RTD B;  3A12 A;  3KG4 A;  3R7N B;  2A6M A;  4OMF G;  2HWI A;  2L48 A;  5IT9 U;  2DGW A;  1U1Q A;  2YQ1 A;  2C37 A;  4JP8 A;  1IN0 A;  2DGS A;  3C16 B;  4K4U A;  2HRU A;  2XZD B;  1RQ0 A;  4HKQ A;  3QJL A;  1N33 F;  5KFU A;  2FUG 9;  1FJC A;  3NGU A;  2CJB A;  3LWM A;  2GO8 A;  2KJW A;  3GMG A;  1FJG J;  3T9N A;  3DGP B;  3DXS X;  2OKQ A;  1HI1 A;  4ECY A;  4USU A;  5C0X B;  2RUG A;  1RT1 B;  2YH1 A;  4A8Q A;  3EVW A;  1TUG B;  4RX6 A;  2W1B A;  1Q7L B;  4B9U A;  1HWI A;  4JI3 F;  5DDQ C;  1WKK A;  1VJW A;  2GCF A;  3ITH A;  2IVF B;  1FO1 A;  1XJW B;  2CWX A;  4JI0 F;  1UDO A;  1NK8 A;  2XQC A;  4DQQ A;  1F1B B;  1NM2 A;  3Q8Y A;  4NWB A;  2W7A A;  3BQ1 A;  4P6Q A;  1RHR B;  1WSR A;  3RBZ A;  4B17 A;  2BOP A;  3BBF A;  5A8R A;  2E5L J;  1NDP A;  2OHD A;  1C0U A;  2B6A B;  3O6Q A;  5HSP A;  2B8P A;  2HNY A;  2RJZ A;  3TAM B;  4LRF A;  2N7C A;  2BBE A;  3IBW A;  4CLW A;  2XUL A;  5CYM A;  4IFD E;  3NNA A;  1IBL J;  4C0B A;  2YWE A;  4EGL A;  5B0D A;  2W9C A;  3THT A;  2UUW A;  3LF0 A;  1REG X;  5M2R A;  4X62 I;  4DV2 I;  4K2X A;  5E7O B;  2BJ8 A;  3MM6 B;  2B5J A;  3U1L A;  1LV5 A;  1HWK A;  1MU2 B;  2IBK A;  2UXC I;  2MKJ A;  4QCL A;  3W5Y A;  3MMC B;  3K59 A;  4O4G A;  2BJ9 A;  1RWU A;  3RW7 A;  2XI3 A;  1N34 I;  2YKP A;  1VRT B;  4F3O A;  1R7I A;  4FW7 A;  1RK8 A;  3QYY A;  4UOC A;  4NEZ A;  2BJE A;  2I9S A;  1LWF B;  1YZ7 A;  1N54 B;  2BEF A;  2OIH A;  3BF4 A;  4A8F A;  3FMB A;  2BM0 A;  4P74 A;  1QDU B;  3POT A;  4X64 E;  3JQM A;  4DV5 I;  4EUV A;  4F8R A;  1GQE A;  2A10 A;  3PW7 A;  3K5M A;  2ZKU A;  4Q44 A;  2N3L A;  5KTQ A;  1NO8 A;  4DL6 A;  1B62 A;  1M1K T;  7AT1 B;  1XXE A;  2QN6 B;  4LRC A;  5HAO A;  3UR0 A;  3R5A A;  1Z5A A;  4TU7 A;  2DNP A;  2P6S A;  4NXM I;  3HMJ G;  2GO4 A;  2AF6 A;  2ZM6 I;  2DR5 A;  1TK0 A;  2K3I A;  3EGV A;  1MLA A;  4DQI A;  4ZP9 A;  4ED3 A;  4C0O C;  3I31 A;  4FWG A;  4OHY A;  4Y2C A;  3E8O A;  4KHP I;  3QAT A;  1DZ5 A;  2RRA A;  4B3T F;  1EKR A;  4CLZ A;  3VVU A;  4J9M A;  3MMB A;  1UDN A;  4ECZ A;  2XB2 D;  4DPO A;  3MAA A;  2HQF A;  1GMU A;  5KG6 A;  3BB5 A;  2E5H A;  4MJK A;  1U1K A;  2GAH C;  3HHK A;  1USU A;  5BXI A;  3C16 A;  4JI1 F;  5K14 B;  4LF9 F;  1FJG I;  1F2H A;  2J9D E;  1Q0N A;  2AV5 A;  2C38 B;  3MTK A;  2DXE A;  3S6E A;  2UXB F;  4LSN B;  2FHJ A;  1NUE A;  1TR0 A;  4XK8 C;  1RT1 A;  4ZJQ A;  1FDN A;  2AWZ A;  3NCQ A;  2EFN A;  1PSD A;  3QNW B;  2YXL A;  2DH7 A;  4Y2M A