4EMDA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
299
Chain Sequence
b'GAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVIQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 299
sequence length 299
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4emdA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4emdA01
4LFCE 5LL6R 4B3RI 4NXNI 1Z0CA 5FLXQ 4JI0E 4FWGA 4LF5I 2HFUA 1HNZE 4DV6I 4JI8E 3T1YI 4DUYI 1N32E 2UXDI 4LFBI 3WU5A 2HHHI 1N33E 2BM1A 1PVGA 1RREA 1FI4A 1XNQI 4X66I 3J81Q 2DEIA 3WU4A 4JG4A 4I3HA 1ELOA 1Z0EA 2HK2A 4LF8I 2X36A 5LMNE 5LMUI 4DV3I 1HNWI 4DPYA 2WW4A 4LF4E 4R1FA 1PKPA 2HFSA 2V8PA 4DXLA 1Z0GA 4DR3I 1H74A 4B3RE 1NZ0A 1ZM2A 1ZM4A 1QZRA 1PIEA 4LF5E 4B3SI 3ZKBA 4DV6E 4KHPI 3T1YE 2UUAI 2UU9I 1IBLI 3QT7A 2CZ9A 4DPTA 4LFBE 3T1HI 3D4JA 1MG7A 1K47A 4NXMI 4DPUA 4JV5I 5IT9Q 1OJ4A 4DV4E 1Z0WA 4ZVIA 3PYFA 3J80Q 4LF8E 4DR4I 3J7AG 4JI3I 4JI0I 3PYDA 4LFAE 4JYAE 1HNZI 1HR0E 1J5EE 4PRXA 3ZZ0A 4GKJE 1Z0BA 4DR3E 1N32I 3WU3A 4YY3I 3LTOA 4HXZA 4KQVA 1UEKA 4DR5I 4KHPE 2ZM6E 3F0NA 1XMOI 3JAMQ 1Z59A 3J7AM 2DEJA 1ZM3A 1FWKA 3M6AA 4Z7CA 4WUBA 4NXME 4LF6I 4FWDA 4LF4I 4JV5E 4X65E 4X64I 4DUZE 4DR4E 4JI3E 1FWLA 1ZXMA 5A2QC 1XMQE 3WU6A 1BKNA 4DV0I 4HYMA 2R42A 1A6FA 1H7UA 1KIJA 2ZBKB 2F4VI 4YY3E 2Q2EB 2XEXA 4JI5E 4DR5E 4USMA 2NPFA 4RPFA 1XMOE 2A2CA 4DR7I 4JI1I 2V2ZA 2A2DA 4DV4I 3QT8A 1MX0A 3GONA 4HACA 3PYGA 4MYTA 4P52A 4LF6E 4LFAI 4JYAI 1HR0I 1J5EI 4X64E 4GKJI 5IWAI 4JI4I 1IBKE 4DV0E 4DV1E 2ZM6I 1XHKA 2V34A 1Z5BA 1KTVA 2F4VE 2VQEI 3B82A 4B3MI 1EI1A 4DR7E 3LNUA 4PRVA 4X65I 4JI1E 4DU8A 2ZITA 4DUZI 4GKKE 4HY1A 2HKEA 2X7IA 3QT5A 4DV7E 1XMQI 2UUCI 1N34I 4B3TE 2AJ4A 4LF7E 4DPWA 2J7KA 3ZKDA 1EA6A 1IBMI 5IWAE 1FNMA 2VQFI 5GMEA 4X62E 4JI4E 3ZM7A 4JI5I 4JI2I 4HACB 4DU7A 1Z5CA 1N0VC 1DARA 2VQEE 4MYUA 1KVKA 2BV3A 5A2QQ 4B3ME 2LJPA 1S16A 4XTJA 4YHHI 1N36E 3B8HA 4LF9E 3B78A 2UUCE 1N34E 1IBKI 1NHIA 4DV1I 3OTOE 4DR2I 1RR9A 2UUBE 4K0KE 2V2VA 1IBME 1HNXE 2VQFE 1Z5AA 3PYEA 4JI2E 4JI6E 1NHHA 1FKAE 4OX9E 2UXBE 4DV2E 4JI7E 4ED4A 1B63A 2GS8A 4DR6I 4GKKI 4Z7YA 4USKA 3HULA 1NHJA 4DV7I 4YHHE 4B3TI 4LF7I 1B62A 2E1RA 4DR1I 5FLXC 5BR8E 4PU9A 3Q1QA 2BM0A 2V2QA 1XNRI 1N0UA 3V2UC 4X62I 3QT6A 1H72C 2HKJA 4DR2E 4WUCA 4DPXA 3ZZUA 3J81C 4M1KA 4UT4A 4UTGA 2OI2A 2UXCI 1S4EA 3LPSA 1WUUA 3ZZTA 4NXNE 1I94I 3K17A 1N36I 1VISA 4DR6E 4DUYE 4LF9I 2UXDE 2HHHE 4AQYI 2EFGA 1FJGI 3OTOI 3CWVA 2UUBI 4DV5I 4DR1E 1XNQE 1D6TA 4K0KI 4X66E 2E5LI 5GMDA 1HNXI 1XNRE 1ZM9A 1ZXNA 4FWHA 1H73A 4JI6I 4LFCI 2R3VA 5LMUE 4DV3E 1HNWE 4OX9I 2UXBI 1U2RA 5L3JA 4DV2I 4JI7I 4JI8I 5IT9C 2UXCE 1Z0TA 4URLA 1N33I 3J80C 1I94E 3H4LA 1MU5A 4B3SE 2UUAE 5BR8I 2UU9E 4FN5A 4WUDA 1IBLE 1KKHA 3T1HE 2VF3A 4AQYE 1Z0VA 1FJGE 5LMNI 4DV5E 3V5RA 4P7AA 2E5LE 4FW9A 4EMDA 1H7SA 3JAMC 2HK3A 3K1JA
chains in the Genus database with same CATH superfamily
4H4OA 3CJ8A 2I38A 2IERA 3MEEB 1Z0CA 3T1YI 2KHCA 2YNFA 4HR2A 3NGUA 2HS3A 2D3ZA 1S57A 3FMBA 3KG1A 4L76A 4EYIB 1PVGA 1RLCL 2XMMA 2NS1B 2XZWA 2DH7A 2B51A 3IR5B 5FLXU 5AXMA 3NKYA 2VBYA 5LMNE 2D1CA 1NXIA 3RB6A 3MOZA 2V8PA 2EFOA 1FXLA 5HBMA 3G6VA 4DR3I 3MM8B 4YHHJ 2ZH7A 1UDOA 8AT1B 1S4FA 2C2RA 1BXNA 1A6LA 4RW4B 3N0VA 1FNXH 2PNZB 4F36A 4IFVA 2R2UA 1B7YB 3OFHA 2EI5A 4WKYA 5BYQA 4DR2J 2A0FB 1N5YB 1NDPA 4X4PA 1XN9A 4DV4E 2JT2A 2N3OA 2MPUA 3PR4A 1Z1ZA 2DGVA 4DFMA 1PCAA 1D3WA 1X4EA 3OD2A 4IFDA 3BBFA 3H5UA 4HH0A 5ETNA 4LF7J 1F9HA 2CPJA 3MR5A 1FHTA 1NBEB 2RU9A 3HVTB 1XIQA 1X4HA 5ETQA 4RX6A 1TKTB 4NI2A 2ZFHA 4AUKA 1NSQA 1X31C 2XYGB 3D6HB 2UV8A 2YQ0A 4U8YA 1HL6A 1WORA 5D4NA 2KB2A 3NAIA 3M8SA 1CPZA 1E6YB 4ZPVR 4X65E 4BWMA 3KUGA 1VDHA 1V3SA 3GIIA 3DLHA 4ISAA 1Q79A 3NAHA 4LBHA 3W65A 4PXCA 4OX8A 3IS9B 4LREA 2M4MA 3UN3A 2RSQA 1DTTA 2LEBA 1S1UA 3WBZA 4J9UE 1TK5A 4KH1B 3ILOA 3I4PA 2M88A 4Y2IA 1MX0A 5B0EA 3K8WA 3QRRA 1TZ0A 2PFDA 3Q8VA 3RG6A 4LFAI 4ZVTB 1J5EI 4OZJA 1RT5B 5KFLA 1FK9B 2R8IA 2BW2A 4FF1A 1D8YA 2DR6A 1PGZA 1JLAA 5LJ3Y 3GLLA 1Y5IB 2CNOB 2I2YA 1QE1B 3JTNA 4UY8T 4DR7E 5BYSA 2A3JA 2X7IA 3SYZA 2WVCA 4DV6J 2ZD1B 4DUYJ 2ZOMA 2CFXA 4A8WA 3W2VA 3FBBA 4EZ6A 2AYGA 2VQFI 5GMEA 1S1VA 4X62E 3MPWA 1JJHA 4XAKA 1OIAA 3EMTA 1FKAF 4ZLPA 4ZVQB 1RA7A 3R27A 1DARA 2J0SD 4P9SA 1NK0A 4TXSA 2WNRB 3ISZA 4IH7A 5T7LA 4TQSA 3F73A 5EHHA 4NZ6A 3IBWA 3TYTA 3SV3A 1RWMB 5ETKA 1BHNA 1LQ9A 1S1XA 2HHSA 2YTCA 2N82B 3CCRS 1XWLA 4V19X 1AW0A 3V4MA 1Q0NA 4ED4A 2O1WA 4OZ1A 1FTCA 3TOQA 2XC9A 1Y0HA 1VC0A 1XNQF 2OSRA 2YNGB 2DNMA 3Q1QA 4ZPBA 1OSCA 1U8SA 1NJYA 3RZAA 4LF8F 1RUSA 3TARA 3LQVA 5D3GA 4OI2A 2BACA 2EW9A 5HQMA 4YDDB 3TAQA 4UTGA 2B6AA 2ZBPA 4OFZA 4LF4J 1H2TZ 2VFVA 4G3IA 1T05B 4KHRA 2G1HA 1IKXA 5DQHA 1NSKL 2DGOA 4LF9I 4OO1B 4C98A 3T1HF 4DV1J 1VRUB 3TZZA 3MD3A 5J1EA 1VIOA 5AJ3F 3BSNA 4ILMA 4K0KI 2OD4A 5F8MA 4ECYA 4JI0F 3DRSB 3M8ZA 1HBMA 3OXLA 3QLHA 2XY5A 4WF9Q 3QQCD 1S59A 3FK4A 2KJWA 1SUQA 1Z0TA 4J9VA 2AEFA 4DQQA 3MFIA 4DR5F 3QNWB 4L72B 2X1AA 2JEAA 1MU2B 3DLEB 3GCMA 3OHAA 1TAUA 2RDDA 2QLXA 1S9FA 4GQUA 1Q86T 1JLBB 1FVSA 2UVRA 1EETB 3HJVA 4YQWA 1FRLA 4K4SA 4OYWA 2YPYA 3QGGA 3K8VA 2L9DA 2BYCA 2EKYA 5GMKa 4LFCE 4NLTA 5KT6A 2BABA 5LL6R 2VPWB 2GVZA 3LW5C 4FPRA 4DUZJ 1HBOA 3Q8UA 1GAOA 4K7QA 2PNMA 3KLGB 2MY7A 3RR7A 4F3OA 3K5NA 1FRHA 3H2LA 4DCJB 2W8LA 4F02A 4ECUA 1TFYA 2LYVA 2DNKA 3NG8A 2V9KA 1YDLA 3JTOA 4EFAC 2WW4A 2AJ2A 3JYTA 4WE1A 2F63A 3KJQB 4NASA 3FUYA 3EDQB 4NEYA 5B0BA 3ZKBA 4GO5X 2UUAI 2MLXA 3LP0A 2P5VA 3TX8A 5IT0A 3NNCA 5DG8A 1JNZB 1Q95G 1WKJA 1OJ4A 1VQSA 2IRXA 4UQGA 3PYFA 4JI3I 5DS7A 2E5JA 1HQEB 3UDVA 1CULB 2NN6D 1SQEA 3BB5A 3QWUA 3WU3A 4YY3I 5BJRA 3BO2A 3J7YU 1BQNB 1UEKA 1JLGB 1UW4A 1R27B 3CDUA 4ZS6A 1XNRJ 3J7AM 3MHYA 2FVQA 3HHLD 1D9FA 1M1HA 2MGZA 2MKCA 2GVDA 2WVEA 5CH7B 1SKWA 2LEAA 3T41A 4ZLNA 4DL5A 2XMAA 2QTWA 4M8LA 1FJGJ 1AA1B 2N3LA 5C7PA 1H2VZ 2BA1G 2KVQE 5ELWA 2F65A 1X7VA 1U0SA 1PG5B 2LA4A 1U6FA 2WSEC 3HCXA 2J0QD 3UD5A 1N33J 2O66A 2JEGA 5CYMA 4Y2KA 3NWRA 1LK5A 2Z5CB 2CXEA 4MK8A 4B3MI 2OPRB 3U1MA 2J76E 3RB0A 1SJQA 1JIHA 1O5JA 3LNUA 2WZ1A 1TK0A 3ILIA 5MAOA 3CDBA 3NS5A 1FKOB 2Z2YB 1IQZA 4P2XA 4ZVEA 1XMQI 1TL3B 2GIRA 2XMKA 2RQCA 3C16A 2MJNA 2VUGA 2OEJA 3DRPB 3JSMA 2NN6E 4USVA 1PC4A 2CPXA 3CCLS 4X66J 3RBDA 2XZDB 1UEUA 2UXBF 1UWBB 2D3OR 3MWBA 4ZCKA 1P9YA 3QPIA 4OO1C 2BJDA 2DNNA 4MYUA 5D0RA 1HNWJ 1RKIA 4K4XA 1RWUA 3V4IB 1VQ8S 1R0AB 1FJEB 3D1QA 2I0XA 5EX3A 1RT2B 1NB2A 1GH8A 4KHPJ 4QYZK 1NHIA 5A2QU 1NCLA 2DBBA 4P2FA 1RHUB 1RHMB 4YS2A 1IBME 3SBMA 2HNYB 2DGWA 4QU6A 4JI2E 4JI6E 3M8QB 5DQGA 3LWLA 1UDSA 5DRQA 4OX9E 1CQMA 1OYSA 4DR4J 3DLGB 2HHHF 5EDWA 1SKRA 3PRDA 3U1KA 1N5VA 3QGIA 3H98A 1QAXA 2V0NA 4DSJA 3UD4P 4FVMA 1CVJA 3QT6A 3N5FA 3Q8SB 3P49B 2ALYB 5KFXA 4DPXA 4CTAA 4M1KA 3AXKA 3T1AA 4UT4A 2LFVA 3OSPA 4F2RA 2KTQA 4OYMA 4O4RA 1DLOB 4CLTA 2NZ4A 3PIPQ 1QUVA 2R8JA 4C7QA 3NY0A 4U8VA 1HI1A 1ZBTA 1WKKA 2MXYA 4DV5I 4DR1E 1R6MA 4NLRA 2F4VJ 2ZH4A 1RWOB 3SQOP 4IQXA 4N56A 5FDLA 2PA3A 2QLFB 4NX9A 2BKOA 4Q0BB 1HNZF 5A0YB 4JI8I 5KFSA 1RBAA 3W2WA 4YB6A 4Q8EA 3D7SB 3HSGA 4WUDA 4JI4J 2D3O1 5IQQA 5HJYA 1S7IA 3ET6B 2D41A 4A4JA 3KMQA 2FZKB 2ZBIA 3FRZA 1U6ZA 2D9PA 3DLBA 4IG3B 1MWZA 1HK7A 1V3ZA 2KT5A 4A8SA 5JXSA 2HFVA 3MEDB 2HFUA 2ZH5A 2XMUA 2IVMA 3ENVA 4DX5A 5DDPC 2YBVA 3WHIA 2IOQA 4K0KJ 3TJ9A 5KFWA 1RE1B 4JI5J 4UY85 1DBDA 3MM5B 4KRWA 3DMJA 5LMUI 4DV3I 1IXKA 3H1CA 3G6ES 4DPYA 2HNDB 5H9FK 4ZMMA 2GNKA 3BGLA 4LR7A 1D8ZA 4B3RE 4CYUA 2HLTA 2GAHC 2HHTA 1YHCA 4NEZA 5KFGA 1JJCB 2VC1A 3D4JA 2FVPA 2GX8A 2IDEA 4DQPA 2Q3PA 3FEXB 4MTPA 4LBPA 2BE2B 3BGFA 4JV5I 4G1PA 1PBAA 5HP1B 1VC5A 3VAMA 1WG4A 5I3UB 2BANA 2DRAA 3TZXA 3G8TA 3PYDA 4JYAE 4IUFA 3ZTRA 2FGOA 1QDUB 2HMIB 5A8WA 3D6TB 2HHXA 2R7XA 1Q8BA 4KQVA 3IRWP 4URGA 2QFJA 1B70B 1WG1A 2C2MB 1K44A 4Z2XA 2GO4A 2ACYA 4QW9A 1CSJA 1SKSA 5DETA 4F0HA 2VPZB 2XBPA 2CQPA 1VBZA 4MT1A 2UXCJ 2XHWA 5K8PA 5HMXA 1FCAA 4KY3A 3D9BA 4LSLA 1NSPA 2CPYA 3EJMA 2XEXA 3UDLA 2E5LJ 4QJVA 4JI1F 2YWEA 2DIVA 4YR0A 4YMEA 4MIAA 5G0RB 2A2DA 2H5IB 3S1TA 4C0BA 2CPHA 2E5IA 4CI0B 4HACA 3HVTA 5DNLA 5K8NA 1S6QA 3CSKA 2MDAA 4GO7X 5IWAI 2H4YB 4YUDA 2V94A 4OZLA 1IR2A 1SQGA 1R6YA 3P6YC 5LL6d 4I67A 5IOLA 3ZTPA 4WP3A 3SSQA 1L3UA 2MQPA 3CCZA 3B6BA 2X1BA 1SCJB 4IKAA 2HNZB 3GQCA 2B4OA 1U1PA 2X3GA 2ZITA 3P3GA 4J9PA 2JLEA 5L1KA 2KXHA 4NXNJ 4ZPTR 4DSKA 4DLEA 2CDQA 4LF7E 3OTEA 3FSXA 3HMJG 1X9WA 2UXDJ 3K85A 2DCLA 2B9XA 3GCWP 3IRXA 2VG7A 1T94A 4DV2F 3CWJA 2IC3A 3AA8A 1Y7PA 4A8KA 1N0VC 1FK9A 4KSEB 2B56A 2MQMA 1TVRB 3MDFA 3H0PA 4OYBA 1FFWB 2P6TA 3I9V9 2M7SA 4A46A 3MM7A 2Z2LA 1S72S 2G13A 2HFZA 4DR2F 2UU9J 4QU7A 4IZJD 4C8OA 3VGVA 1IBLJ 1WTFA 1RT4A 3OVAA 4ANCA 4F8RA 2VB6A 4M5NA 1MROA 1REGX 5JJBA 4FW3A 2J9DA 4LCGA 4GKKI 2FGCA 2V50A 1VOMA 3P45B 5IV3A 1HMVB 1XMQJ 2FY1A 2BR2B 4NMXA 2HSEB 4EBEA 1RAGB 4WFYA 4OV6A 1H2UX 2YX7A 3GTYX 4WZQA 2WNRA 2X51A 5A8RA 2XMTA 2VU5A 2VKZG 4ECRA 3Q23A 2BEFA 4S0MA 2J6UA 2KI2A 1S6PA 2Y9HA 2VJUA 3R5GA 4LF6J 2HG4A 3LPSA 4X64J 2WP8B 1M0SA 4AD6A 1JXVA 4DUYE 4M5JA 1C1CB 2RS2A 2B9EA 2CVIA 4QYRA 4DV0J 2HZCA 4J9MA 4K4YA 2UVWA 2PO2B 2HGNA 1B7FA 3E2EA 1WD6A 1IKYA 1WF2A 2KYZA 1HNXI 1WHWA 2P9EA 3R5JB 1S6UA 2YNGA 1HHTP 2RDJA 2LECA 3R5CA 3GU0A 4URLA 1GXUA 2ZC4A 2D7SA 2DVIA 2RQMA 3WZ0A 1RTZA 2VV5A 2FHJD 4X4SA 3P06A 4OYOA 1F5BA 4G1QA 4MQYA 2QLJB 5F0WA 3OR1B 4OHWA 3UN2A 4CLPA 2E7WA 3I0SA 2WCXA 5J2QB 5IV4A 2XCAA 2CZ4A 4FWGA 2WOMA 5IC4B 3TEHB 2BE9B 3K2YA 1YG0A 1K0TA 1AFIA 1WEXA 2RS8A 2LXUA 3GIRA 1J5OA 3OUYB 1XTZA 2DT9A 4U95A 4YR3A 3P96A 4HEA9 3MAAB 4IFDF 1Z4UA 1RGVA 3OV7A 4LF4E 4N77A 4CO4A 1T7PA 1VI7A 2UZAA 1RWXB 3RRHA 4B3SI 2ROPA 3NOGA 3DOMA 3QRPA 1N54B 4XDDA 4CM2A 2VBWA 2L48A 5T14A 4DPUA 1RHYA 1S77D 4NLSA 5M2UA 4OHYA 4CH7A 3ELHA 1T0TV 3KLGA 2B0GA 1Y3KA 4LF8E 3HXMA 4HH1A 4RNFA 1KVIA 3H5XA 1Z0BA 3DOLB 3U27A 2K7KA 5EGYA 2FJWA 3PEHA 3N6LA 4V19J 4HYKA 4FW4A 4PPZA 5CCLA 5GAHI 1FT8A 3MECA 1TKXA 2VJVA 1T9WA 3TRGA 1QTNB 4Z7CA 2R8GA 1JJ4A 2AJQA 3TZWA 3HI9A 5C2CA 3GJTB 4IFYA 3R6GB 3I55S 2O01C 1U2FA 4DUZE 4ZCMA 3IR6B 1IBKF 1I94J 1TTHB 4DV1F 1IWGA 5J1NA 1L3VA 1RHQB 2RRAA 3GFZA 1CJKB 3BN7A 3F44A 4BWJA 4KO0B 3PW5A 4DR5E 3EXCX 4PKDB 2GQCA 1EX8A 4LIWA 1HI0P 4DV4I 2FHOB 3CJRA 1JLGA 5F8IA 3M1VB 5DDOC 3PYGA 4KPYA 4DSIA 2POKA 5B0FA 4ZN1A 2HBZB 2NN6B 4NPOA 2QMUB 4HKQA 5IT4A 1S0MA 2HVIA 1YH8A 2H54B 4MAKA 4PQUB 3AJ2A 5JEAD 3DYAA 2HQ3A 2V34A 4TY8A 5IZHA 4RW9A 5HAOA 3HFKA 3HHLB 5EX0A 4KV8A 3EVMA 3K7RA 5L9XA 4X65I 2EBGA 1WHVA 5HJXA 2OFHX 4K4ZA 1LOUA 2FJVA 1WC3A 4EGLA 1KHWA 1S49A 3PZPA 2CNLB 2XLJA 4ANEA 2W9AA 3OTOF 3IAM9 1FE0A 1YI2S 1X4BA 3NWGA 4EWTA 3F41A 3I9ZA 4X4QA 2RKIB 1OWXA 1YBUA 2F5GA 3C6UA 3H2UB 1KVKA 2XGPA 1R8CA 3L9ZA 3OBIA 5A76A 3TUZC 4XTJA 5L9NA 1C4AA 3OFEA 2XWYA 2Z5CA 4PXEA 1LW2A 2XGQA 3M8RA 1T3NA 2V8GA 3H90A 3MM9B 3OSNA 4FS2A 4ECZA 2J7UA 2KFYA 3M4XA 3NGSA 2ABYA 1FX2A 2H5EA 3DRYA 2M8DB 3PHEA 5DM6Q 2R7RA 3W63A 3M6WA 1UWBA 2ATLA 1WEYA 1QM9A 2V2QA 5DRRA 4X62I 1D0EA 1KC8T 3V4IA 2HKJA 2ZZNA 1R0AA 6FDRA 4ZIWA 1OY8A 2R2TA 3L7UA 4QPXA 1RT2A 1S0NA 4BLGA 2QLBB 3ZZPA 5JEAE 3ZZUA 2AJ0A 4DR3F 3G96A 4DX8H 2XI3A 1RZMA 3LWMA 2GO9A 1N6QA 1S4EA 4C8KA 3ZZTA 1F2GA 4ZVPB 2HNYA 4RR5A 1GMVA 4L6V3 1YGYA 3NL0A 4FW7A 4USJC 2HHUA 5MLCV 2KH9A 5KFIA 2ZHBA 2VZ9A 4TU7A 3NMAA 1D6TA 4X66E 2VBZA 2CPEA 3SEOA 2FZGB 5SZTA 1N56A 3QYYA 7AT1B 1R6LA 1RTHB 1GMWD 4F2SA 4CO0A 1HNWE 3AY0A 4CZCA 3U1YA 4KJIA 2PO0A 5FLXY 2A18A 2IAJA 4C97A 3GB0A 3W3SA 6FD1A 3U02A 2XCPA 2FJEB 1U1KA 1I1GA 4DL3A 3HHEA 3MUMP 2DNYA 4M5KA 4NYOA 4FNHA 1HWLA 4DL4A 4FF4A 2CQ3A 3I5AA 3OFGA 2H65B 3BKFA 3AQPA 1DLOA 1WKLA 2E1MC 3JAMC 1UDQA 3E3XA 5EN1A 3THTA 4ZPAA 3NMRA 3DOKA 2Y3YA 4HT7A 3O3LA 3J7A1 1V3RA 1PJ6A 4U7UD 1VQ9S 4LVNP 3AOCA 3RBZA 2CNNB 4QNJA 2GCFA 4B08A 1ZA1B 1N34J 4LFBI 1HNVA 4UW2A 4ED7A 2LXFA 5A0YA 5C24B 5D15A 1HWUA 1NSAA 2FLOA 3ZC4A 2X36A 4LFAF 2YKMB 1J5EF 1U09A 1W2IA 1Z0GA 4PPDA 5L1IA 4KBIA 3PS2A 1LFWA 1Y5NB 2MYFA 2GGPA 3MR7A 3UR0A 4FYYB 5K36D 4KHPF 2R7VA 2VG5A 3EGVA 4WBFA 3HT3A 1T9UA 3MEKA 4CLLA 2CZ9A 5E33A 5DGAA 1UWAA 2QZ8A 1CG2A 3MEDA 1Y3JA 3CDIA 4Q44A 4RW7B 3AH6A 2OHDA 4ID5B 2GIQA 2IYGA 5D4PA 2NN6C 3IBFB 3BZQA 3J7ZT 3CVKA 1REVB 4K2JA 1YBTA 1YWXA 3MCOA 1GQEA 2WVBA 1U02A 4CLSA 2HHPA 2VQFF 3HHLC 3FQKA 3MM5A 3CXCR 3QIPA 2DXFA 2KT2A 1EKRA 4DF4A 2HNDA 1TUVA 5KFCA 2OEKA 2VA3A 3VF0B 3D1HA 3SCKE 1HQUB 1MNEA 2EXUA 2DJWA 2A10A 9ATCB 1RWVB 3CD5A 4IQMA 1N5TA 1WOPA 3RBEA 4QW8A 1QAYA 4DPOA 1UJ4A 3T6JA 1UETA 1RSCA 4NLQA 1OQ3A 1JXEA 1LXJA 3TQEA 5C0XA 3M8PA 4C8LA 5HP1A 2XNQA 4DLGA 1LWEA 2LU2A 3EZOA 5IM0A 4AQYJ 3M2VB 3G2XA 4JI5E 4A8FA 2GHVC 4QPTA 4DZDA 2YH0A 3M9MB 1UFLA 2JEIA 3EUNA 1KN6A 5IC6B 2C38A 3US5A 2DK2A 4KKOA 2MZRA 1UCNA 4WXOA 1TP7A 1QJHA 3S8SA 1BLUA 5C25A 2OTJS 4H4MA 3VVUA 2KDOA 3R8YA 4N5SA 4F4XA 4J9NA 5K36E 1XHKA 4ELUA 2M8HA 1UA1A 1RTJB 3B82A 5LMNJ 3NS7B 1C0TA 4USUA 2PEBA 4W98A 2G2OA 3HM9A 4LF9F 2E5GA 1U1LA 5HLFB 4LBIA 4CLYA 1R89A 3KWMA 2M70A 2UUCI 1PILA 3OHBA 1RK8A 2I6WA 1VQ6S 4K0KF 1IKVB 2JLGA 3VAIA 3L95X 2YPZA 4ZVRB 1NHKL 2SXLA 3VTIA 3EE3A 5LXRA 3BS9A 1HW8A 2AZ1A 1SC6A 4LMZA 3W9HA 2P6SA 1WF1A 2IRYA 3PFEA 3BDPA 1XC9A 1UZDA 4NLWA 3CEDA 1FXRA 3BH7B 4OJGA 4RW6B 4WWSA 4EBCA 3KLVA 4I2PA 2MQQA 3M05A 4OI4A 3C14B 2IBOA 2J6TA 2BRLA 1B63A 5F9NA 2XNRA 3GV5B 2JVOA 3BSAA 3TJ8A 1N32J 1RA6A 4RBTA 2NUHA 2LDYA 3V2UC 5KFOA 3UVJB 3QJPA 3OL7A 5HVGA 4BS2A 2AYEA 1JLEB 1B3TA 3G8QA 1N5SA 4UOCA 2UXCF 2JNJA 1T9YA 1RYRA 4NXNE 2UUAF 4DCPB 2MEWA 2ILZA 5A8KA 1F9EB 3T5KA 4DR6E 3G4SS 4AL6A 4DFKA 3AA9A 2YVSA 1PYSB 3KG0A 4BHQA 2UXDE 1FERA 2MSTA 3PR5B 2KG1A 3ZTQA 4IZJB 3ITHA 4O44B 4WXWA 1U1QA 4ZK7M 3RTVA 1NJZA 3DDKA 3HLUA 2BR2A 2AYBA 4JI6I 4JI3F 4DR7J 2WW8A 1Q7YT 4OX9I 2HQFA 1X4GA 2GQ2A 2VFRA 2Q1LA 2OTLS 3UQSA 4I7FB 3DLKB 2W7OA 4E8UA 4P73A 2CA9A 5DJBA 3K0JA 2UU9E 1KEKA 1IBLE 2VIHA 4ED3A 2COLA 4PXBA 1V9OA 1S10A 2WP8A 2OKQA 4P7AA 3VCDA 2W9CA 1EB0A 5ETTA 4EMDA 1RT1B 3AODA 3FMWA 4KPCA 3FFIA 1JMTA 3HX9A 4RUCA 5FLXQ 5GAGI 2F4FA 2RHQB 2JDJA 3MEGB 4K5SA 5GAHU 4TNOA 2BM1A 2KZZA 2LKZA 2RJZA 2VOPA 3NGRA 4J9KA 1P42A 2KRRA 3DFEA 4JOUA 4C3KA 3UE2A 3BYRA 1UEVA 2HWHA 5DGBA 2BJ8A 4AM3A 4U3BA 9RUBA 4QWAA 4FKXA 2QYCA 2NREA 1RBOB 4DXLA 1KNZA 2XM3A 3W5XA 2DO0A 1ZM2A 2C2ZB 4LF5E 3LUYA 2RQKA 4QWBA 4E2FB 1LWXA 3MR6A 1WTBA 2E1CA 1G3OA 4B3MF 3DNCA 1RWWB 1NK9A 1MG7A 4NXMI 2CPZA 1FRXA 2IHR1 4ECVA 3CDWA 1XMQF 4E0DA 3LH2S 1U25A 4F7VA 3ETOA 2XO7A 3SMZA 4IZKA 3ZNJ1 4DV7J 2JOQA 4OYPA 4DN9A 4AL5A 2MKJA 1ZA2B 2FTRA 4IH5A 2ZH9A 4OZ5A 2BOAA 3MR2A 2G1DA 5KFPA 1Z59A 1ZM3A 1FWKA 1WF0A 3D3CJ 3GFYA 4J9SA 3CT9A 3FEYB 4I0WA 2DCUB 3TUPA 4X64F 4Y2MA 4FXVA 4RO0A 4USHA 1YJVA 4N41A 2ZHAA 2RVJA 3CJ5A 4DV0F 1N36J 3WU6A 1EJ7L 3DU5A 1U49A 1X5PA 2Q79A 2B7CB 2UUBJ 3CDEA 2Q2EB 2JX2A 1SC3B 1VGYA 2NPFA 2J9EA 3BGOP 4RPFA 1XMOE 3LANA 4ICLB 3L09A 4JI1I 3PY8A 4CNYA 4LFCJ 1ZAXA 2HWIA 2M3DA 4B9MA 5DNXA 4NL5A 4JI7J 4JYAI 3GV7B 1XQIA 1HYSB 1LWCB 3OTCA 3VGSA 3UHMA 2PO4A 1MN7A 2VG6A 3LOUA 1JLCB 1KTVA 2VQEI 1NZAA 2GA7A 4LCHA 2HBRB 2PT0A 2OPSA 3Q83A 3BGUA 4C8MA 1O6XA 1CJKA 4A8OA 4DU8A 5DDQC 2UUTA 4ZJQA 4IFDE 5C5JA 3Q24A 4DV5F 2IJRA 4RNNA 2K8GA 5IXUA 1FNMA 3L7OA 3M1VA 1IN0A 2CQBA 1VQ5S 1EQ0A 2JH3A 1XR6A 3I5CA 2NN6A 4F50A 1LW0B 4CLWA 4JI8F 4DCOB 3GJRB 2BV3A 4F4YA 4A8XA 1UVIA 2LQ9A 4YHHI 3A8EA 1NNDA 2CIMA 3OLBA 3I31A 3KLFB 4WIQA 3UNGC 3WDOA 2WBMA 3B78A 1SL0A 5DLFA 4I69A 3OVSA 2MZTA 4DR2I 5DRKA 4FW5A 4EO6A 5JEAB 1FEHA 2FUG9 4NRUA 3QAEA 1F3VA 3FVYA 5E5NA 4O0IA 5J2MA 1RCOB 2BBEA 4ENOA 5ETRA 3MPYA 1VJWA 1NUEA 3CCTA 3DI6A 1RBLA 3LP2B 3BR8A 2RKIA 2MB0B 2GMHA 1BQMB 3P3DA 1NHJA 1IJEB 4LF7I 4XTTA 2DHAA 5D0EA 1B62A 1RT6B 4WYWA 2VESA 3JSYA 5BR8E 3KJVA 4PU9A 2BM0A 3EWGA 2J0WA 2ZH2A 2DD8S 4N8NA 5LMUF 4DV3F 5DDRC 2ASYA 4RUBA 5FJ4A 4ECXA 3BGRB 1ZYQA 3TEGA 3DHWC 1YVFA 1EP4A 1EZZB 1I94F 3MM9A 1HWIA 2A1BA 2XS5A 1B0TA 2O3DA 1NK4A 1X4FA 2AGOA 1P27B 3KLHB 4OO1F 1PJ7A 4K8RA 1MWQA 1HNIB 5EWEA 3CWVA 3GFHA 1E6VB 4JV5F 2YKNA 4BA2B 4KB7A 3TANA 2WB1D 2D74B 2I5JB 2GJIA 3BPDA 2AF6A 1U26A 3IO1A 2JE6B 3NNHA 2RRNA 1CBKA 1CJUB 2G2YA 4WFAQ 2IMWP 4DS5A 1EHWA 1HR0J 1X4CA 2Y1LB 3ZZZA 4GKJJ 2BJ9A 2HYIB 4QIGA 4FN5A 5IS2A 5KFVA 3MURP 1VRTB 3V5RA 2J0XA 2PA8D 3I0RB 4LUBA 4NE9C 2N4CA 5EL9A 3KK1B 2PO1A 5K20B 3FGVA 4CLZA 4PG4A 1GTHA 5ETPA 2R4FA 4DV6I 5B0GA 4DUYI 3GR0A 4H4KC 1UVMA 3NGDA 2IJNA 4X4UA 5D78A 3CJ3A 3M8WA 2JEBB 4QR1A 1IBMJ 1NH7A 3QGPA 1FJCA 3J81Q 1S9GB 4ZP7A 1MW7A 4JI2J 1I5OB 2Z0GA 1RTDB 2QG9B 2B5JB 3T5LA 4FNIA 2U1AA 4ZVHA 4R8UA 1CC8A 3GE9A 4KGMA 1G4CA 1Y10A 4OLOA 1WC4A 5K14B 3ENWA 2JJ4D 5IWAF 2CWXA 2IYIA 4FP9A 4CLKA 3C15B 3BBCA 3AQOA 5D0HA 3T1YE 4DWIA 1TKZB 1JB0C 1GTEA 1I6JA 1JK9B 5FD1A 4U7UK 5KFYA 2MQOA 3TAPA 1S5ZA 4ZVFA 1Z0WA 4ED6A 2DKOB 3KG4A 4L74A 2YKQA 3BO4A 3CD6S 2WBRA 4DR3E 2ZUAA 1VFJA 1AZSB 1CJTB 2WRMA 4HXZA 4DR1J 5B08A 2GMLA 4UF4A 1X60A 2NXCA 2ZM6E 3TA0A 1KS2A 2N7YA 3PHTA 3ZTOA 2CQ4A 4YDXA 2CAJA 3VWSA 2CJAA 2IM1A 3SCLE 4M5MA 4FWDA 4LF4I 3TAMA 1ICEB 2XSFA 4WZMA 2O1PA 2MQLA 3JAMU 4NBQA 5K36B 3CCSS 4FKYA 1REVA 3TVYA 4MFBA 1PKUA 1SVDA 2D9OA 1AUSL 2NSBA 2BA0D 2Q6CA 2MLZA 4GKKF 3M6XA 4IR1A 3WC0A 5LSRA 1QD1A 3FBEA 4K5RA 5E3AA 2YNIB 5JEAC 2XLIA 1TL1B 3A1YG 4DN0A 4MKYA 2ZKTA 3G6YA 2CPIA 4CLFA 4MJKA 4EYHB 4ITSA 3CULA 3D0IE 2OSQA 1PBUA 4HHUA 4CLUA 2P9CA 4DUZI 4B3RJ 4R5PA 2PDAA 2LLZA 4O3NA 5F0UA 3KLEB 3BYPA 2QLWA 3PX4A 1HNXF 2P2CB 3CJKB 1UVKA 1MSWD 3R2DJ 5I42B 2C37B 1PAEX 1L3TA 2HRYA 4TYAA 1Q8KA 4PWUA 2YNHB 1HARA 3DU6A 5A2QQ 1B99A 1TQLA 2OJ3A 4P72A 1RTJA 5I3PA 1FX4A 1RTIA 2KJVA 4DJBA 2CQHA 1R43A 3DM2B 5M2PA 3IA0A 1F0XA 2CUYA 2W9BA 1UAWA 4JV2A 3C6TB 3KK3B 5C42A 2OPQB 4M5DB 5HLFA 5DO2A 3I56S 1TL7A 2VQFE 4NCGB 1SXLA 4LF1A 5KFHA 1BWVA 1XMBA 2CQ1A 1DY3A 4J3DA 1NKEA 4IRDA 3JQKA 1RT7B 5ETMA 3MR3A 2AU0A 4G1IA 1T9XA 1AYEA 1FEEA 3KUHA 1XNRI 3ZZRA 2H51B 4Y28C 3WQPA 1KBRA 5GAGU 1WC5A 3LPYA 3SCIE 1HBUB 2V4JA 1EARA 3T6BA 4OX6A 3UD3P 4B3SF 4LR9A 5KFJA 4Q8FA 2EG1A 3MPDA 3HK2A 2ZZTA 1WOOA 4G6VB 2GMJA 4AQYF 3QO9B 4ED8A 3JS9A 1FJGI 3TA1A 3FBFA 4ILRA 3PTWA 2CWKA 1Y4SA 2LVWA 5RUBA 1ZXNA 5HROA 4O3RA 4RL1A 3V6KA 4O23A 2YX1A 2ZH6A 3MAQA 5L3JA 1HD0A 3UVJA 3NEKA 2LA6A 2JFKA 2NSCA 1H38A 2OAUA 2IFXA 1N33I 5E3CA 5KFTA 3H4LA 2WAQD 1UW9A 3UR3C 2FJAB 2MTLA 3JQMA 4IYQA 4R0JA 1KLNA 1Z0VA 2E1AA 5L39A 3UCZP 1SC1B 5GADI 2VBXA 1UZHA 4DG1B 4GVBA 4ES3A 1S1TB 4WFBQ 2DIUA 4LRDA 1C4CA 4CO5A 1N32E 3Q2SC 1U4BA 1AB8A 4WTYA 4DZ6A 4USWA 2MHNA 1USVA 2F1DA 4X66I 2HFNA 1RT3B 3DXSX 4BBYA 4JG4A 1ELOA 4DV4F 2RF2B 2N4DA 4E98A 3DLKA 2OEMA 4IS9A 2V63A 4AYBD 3B4DA 1HNWI 5K36C 3FCVA 1L5UA 3ZXWA 4PCQA 3NRBA 2H9ZA 2ADCA 1S9EA 1R8HA 5LOQA 2W8KA 2ZBCA 2QA2A 2ZVSA 1VHIA 2K1RB 4IH6A 3L7ZB 4KHPI 2I8EA 2F9JA 4MDTA 1HPZB 4C3MA 4DPTA 1ITPA 3LAKA 4ZJOA 2F8MA 2GJ2A 4XK8C 4X65F 2GFFA 3BKTA 3NCRA 5C0XF 3MM6B 2M9KA 2YNFB 4M5IA 3J80Q 4DR4I 3HZEA 3TJAA 4QOTA 1PC5A 3MCMA 1B4SA 2Q66A 4MH8A 1LWFA 2CVEA 3JSRA 3M8YA 3OTDA 3GIJA 3B4MA 5J2PA 1N52B 2FJDB 4OKGA 4MIBA 4UZCA 2AEJA 3M85D 5F8HA 1Q5VA 5HBMB 4F04B 4IO1A 1OO0B 4ZDNA 2CQIA 3K89A 3A8JA 1UJ5A 2EPIA 2V8HA 4X4NA 4IFVB 4Y6IA 2FHJA 3HO1A 2HFOA 4JI3E 1OYEA 2E7VA 1BKNA 4TLRA 4HYMA 3W5YA 4TYBA 3GFXA 1T3OA 1B0PA 1U1OA 1SC4B 4KFBA 2ZBKB 1IR0A 2ACMA 2F4VI 4YY3E 3KTQA 4PG6A 2CQGA 5F8GA 1VQKS 5J2NA 4PXDA 3O5TB 1RAEB 4C11A 2A2CA 3ZZYA 1HHQA 4IFDB 3SZ2A 3K59A 1KWMA 4IOBA 3B54A 4B3OB 3AXMA 4PWWA 2Y0BB 4X62F 4NI2B 4JI4I 4YB1P 4P6QA 4X4OA 4CIOA 4OQJA 1A9NB 4NZ0A 2QA4G 1ZH5A 4DS4A 4ZPCA 3KK2A 3SDEA 1OPZA 2O1VA 1PO6A 3D6FB 3CJ4A 5F8JA 1DTTB 2VKRA 1S1UB 4OZ0A 4WK1A 4QR0A 2FB0A 1Y9OA 4DV7E 2M0GB 1JLQA 4B3TE 1YBAA 1NU4A 2KO1A 4ATNA 4IOAQ 4TY9A 1GXLA 1HI8A 1XNQJ 4JI5I 4WP8A 2E29A 1F1BB 1YRUA 3HKMA 3G82B 2QFIA 4RWWA 2BUNA 3GV8B 1AT1B 5HMZA 2D69A 2V4QA 4U6PA 4LF8J 4B3ME 2FVSA 4L73A 1URNA 2ROEA 3N28A 2IA6A 1Q1KA 3POTA 1N36E 1JLAB 1R0BG 2BW7A 3BREA 2UUBE 1C0UB 1HHSA 2V2VA 4Y3CA 1U0HA 3T1HJ 1FKPA 2B8QA 5LXYA 5AJ3J 1S1WA 4HHJA 1GEHA 4JI7E 3W2VB 4JI0J 4LFBF 4O3QA 1S1VB 3FKBA 3GLJA 2G2ZA 2BJ7A 2LMIA 4LT6A 4KAIA 3RB4A 2IDLA 1PAUB 2C39A 4F3MA 4DR5J 2DGQA 3NGKA 5KFZA 3NLCA 3M7NG 2RILA 3P5TL 5B0DA 3OXGA 3K58A 4PUOA 4PABA 2XMVA 3MXHP 2UXCI 3J81U 5JEAA 1UPMB 3DLLQ 1VMBA 3Q6NA 3LA0A 3R7SB 1AFJA 1FRJA 4DF8A 4B9VA 3HP6A 1UFKA 3IG1A 1KDNA 3LP2A 1T03A 2E5LI 1TFWA 4USTA 5GMDA 1RWKB 1BQMA 1FJ7A 2BX6A 4O3PA 3DCAA 1RT6A 5KG7A 1RADB 1S99A 3SCJE 1FRKA 4M5GA 3EVOA 1FFGB 5IT9C 1U47A 4C0OC 2QSWA 5FIIA 2OLWA 5HATA 2EBEA 3TNVA 3K5LA 2W4PA 5KT2A 3RRGA 4D3GA 1HIYA 2YKAA 4I1TA 3EICA 2B6AB 4DV5E 2KVIA 2ZBQA 4L3NA 4H54A 4WKRA 4TLQA 3NBPA 2QN6B 2J9DE 1D9AA 5BYRA 1YLXA 2FZCB 3H25A 3BPSP 4NXNI 1URRA 1WC0A 2C3YA 1N4LA 2CPDA 3AD8C 4JI8E 3BEGB 2I5JA 2R2RA 2UXDI 3HKWA 3UDCA 2DRDA 1SH3A 3HFZB 2MKIA 3DGVA 1HBMB 2CJXB 3QLHB 3V81B 3MAHA 3S7RA 1U24A 2YWKA 3F56A 2DRBA 1SUQB 4OI1A 4X2BA 3DLJA 4DBQA 2XI2A 2DNLA 3G86A 3HJCA 5KG0A 3HT0A 1SH2A 2K3KA 2ZE2B 1H74A 1VQYA 2H1YA 1YTYA 1Y5LB 1VRTA 4IR9A 2FQQB 2YQ3A 3W64A 1JJ2R 2UU9I 2ZDPA 5M2RA 4ETZA 4KC5A 1IBLI 1M1KT 3C66A 4IFDC 2K7JA 4W90B 2FLLA 3HHDA 3W9JA 4Z37A 1Y4ZB 2Y0SD 3CGIA 2BQUA 1A7GE 1GK8A 1HBOB 4DI6A 1Q4RA 2JEBA 5CD4A 4CT8A 2QRRA 2UUCF 1VQPS 4I2QA 2Z5EA 1GX5A 1HR0E 2CDRB 3PW0A 1RTDA 3EPGA 2GQQA 3ZZ0A 2B5JA 4GKJE 4ZHRB 1GMWA 3M2UA 1TV6A 5KTQA 4X4RA 1Y60A 1RHKB 4WE1B 1CJVA 3WX8A 2GO3A 4KT0C 1XERA 4LF6I 4JV5E 3GJQB 3LPEA 4X64I 2Z2ZA 1UA0A 3LP0B 2OO4A 1UVJA 4NLVA 3D0HE 3EPIA 1K0VA 4DV0I 3R3TA 2EWHA 2DY9A 5GAEI 1NPRA 4RUHA 2FC9A 2B43A 3AJ1A 2VC0A 1YJRA 1CJTA 1KOHA 1QSSA 1KP6A 2E7XA 1NJIT 2UXBJ 1WEZA 4ECWA 5L1LA 2VICA 4WCEQ 1NKBA 3SSSA 5L8RC 4C3LA 5BXIA 2DNZA 2NN6F 4LSNA 2EFNA 2DPJA 4WP9A 3VZIA 3KYLA 4QNKA 3SXLA 3ZNUA 1TUGB 2GZOA 2HQDA 3DRRA 1ULRA 3LP1B 3VGTA 2FLNA 1GFWB 2CG8A 2NQPA 2CG9A 4RLEA 2AX0A 1KFDA 2ZOFA 3QT5A 3MMCA 2CJYB 3NCQA 4OJ1A 5IWAE 4JI6F 2ZH3A 2HVDA 3OR2A 3ZTSA 1HWKA 4OX9F 2XB2D 1DURA 2G9OA 4MU0A 1KVJA 1FNOA 2DNGA 5CYMB 1R3NA 1R7IA 4F4AA 5L38A 4RU9A 3BSCA 1NZ8A 3PDNA 1OYRA 3OJSA 1C2PA 2C42A 5KT5A 1PYTA 3R6LB 2XZTB 1IR1A 1ZOTA 2XYPB 1BUXA 2XS7A 4F26A 4URQU 2MKSA 2MHEA 2JZ5A 4PWDA 3THPA 4LOMA 3C16B 1C1BA 5I42A 4Z7YA 2XQCA 2ZWOA 5CZVA 3IWNC 3JSMB 1HNZJ 2H3EB 4CT9A 4NLYA 1HWJA 2DXEA 4J5OA 5GADU 3UO0A 1J27A 3MFHA 4AIMA 4HTJA 3D5MA 1H72C 3NP5A 4LQ9A 4M5HA 1NDCA 2AGQA 4CWBA 1HBNA 3HSDA 2O5DA 4J9LA 1NEEA 1VLOA 2OPQA 4M5DA 2MQ8A 4ELTA 1I94I 1X9MA 2DNQA 3A3NB 1VISA 4DQSA 2HBYB 2QV6A 3WIUA 3MEEA 1WWHA 1OYDA 4NXMF 2QL7B 5HQLA 4ZPWR 4FWHA 2BA1D 3NS6A 4OHVA 1RT7A 4BC9A 2ZC3A 4USIA 3PXGa 3KDNA 3O6QA 3C19A 3OL8A 3G8SA 2BQ3A 2WB4A 2V9WA 2W2QP 2CQCA 3RYLA 4FF2A 3J80U 5BR8I 4LF2A 2LEPA 3CCVS 4CTAB 3MM8A 2YY3A 2ZH1A 3CC4S 4RW4A 2KL8A 2PNZA 1SI9A 2CG4A 1MN9A 2AJ1A 5D6GA 4B3RF 3ISND 5B0CA 4J7CA 1N5YA 1XR5A 3I5BA 1HW9A 3HHKA 5F3TA 2IVFB 1X9SA 2XYHB 4JV1A 2C2KB 3W8GA 3WU5A 4FYDA 5FDLB 3HD2A 2BA9A 4ZN3A 3CCQS 5THWA 4GC6A 2JFDA 3FCWA 3W61A 2O1UA 4JYAF 3W2WB 1OPIA 2KYXA 1LNQA 3L7PA 2HFSA 2IM2A 1TKTA 3MMBB 1VK8A 4BC7A 1PIEA 2V69A 1WSVA 4EUVA 1E6YA 4RZRA 2Q6BA 2VQEF 2PD1A 1JXLA 2Y8YA 3T9NA 3IS9A 3C8YA 1ROFA 1DHMA 5KFFA 3W8PA 2A6OA 2QL5B 4OJHA 3MZIA 2OGUA 4R0EA 5KAKA 3CD7A 1BD6A 3PJWA 4DR6J 2RF2A 3CC2S 4GMKA 3CC7S 3D0GE 3KFWX 3D54A 5G4DA 4CQ1A 3DMJB 5DROA 3F0NA 1GXTA 1RT5A 3IM9A 4I6WA 3AAWB 1K1SA 1SQFA 3CCJS 2H5JB 2VFSA 1NKCA 2LCWA 4YHHF 4CYUB 3GILA 3RUBL 4Q5VA 1HPZA 3GJSB 1BWEA 5KFRA 2DGXA 1OSDA 1RAAB 2HRUA 3CJSA 1QE1A 2DTJA 3MM6A 4N7TA 5KG3A 3KMSA 5HVFA 4O3SA 1ZPVA 2FYXA 2AD9A 2V6AA 3J7AN 2ZD1A 4WU2A 2BANB 2AV5A 1MMDA 1A0OB 3BN4A 2LQBA 3SFGA 2Z57B 4ER8A 3AHPA 3VAKA 5A8WB 4ZVOB 5F8LA 4LF7F 4DV2J 4GC7A 5E3PA 1U1NA 3TR5A 4ECSA 3MCSA 1GT8A 4I4BA 4Q2MA 2ZM6I 1ZTWA 3T3FA 3RJMB 1QY7A 3GYNA 3H40A 3D3BJ 2DR9A 2CZVC 1VYAA 2Z5BB 5KT4A 1FDDA 4PRVA 5L46A 1YJWS 4OYZA 1IVZA 2AW0A 4LSLB 5KFEA 3A3PB 1ZZFA 4LF5J 4KGKA 1N34I 2OPPB 2RRBA 4G65A 3FQLA 2J7KA 3ZKDA 1YJUA 1K73T 2E5HA 4ECTA 4HACB 1KOOA 3IMQJ 4B3OA 3BQ1A 1V5IB 2HS0A 3GYXB 5KT7A 1F2HA 1S6QB 1YJNS 2UVUA 2Z8QA 1R8AA 2EK1A 2IA0A 3KHLA 3L3CA 3PX6A 5DZ6A 2L3MA 3UCUP 5C0XE 1T05A 3OJUA 3O2IA 2RNEA 4OO1A 5FWKA 1IJFB 4HI1A 1VRUA 1YKWA 3MMAB 1UTAA 1FKAE 3OXFA 2C3UA 4DV6F 1VK3A 5A6WA 4DUYF 2QJ3A 2GS8A 4J9OA 3R1LA 5DQIA 3N4WA 3DRSA 3G82A 3IRXB 3CF5Q 2VG7B 1X4DA 5CYJA 3ILLA 2MQNA 4P7TA 3M6VA 3VVTA 3PW4A 2IC3B 1RLDA 4KIAA 2AGPA 1XMOJ 1MU2A 3DLEA 2CJKA 1RI7A 2HPUA 4TU8A 4LR8A 7FD1A 1JLBA 3MM7B 1C0UA 1XEZA 4HHHA 1EETA 5A6PA 1X5OA 2W7AA 1RT4B 3GP9A 2KFNA 4CH1A 2E66A 4OI0A 4AQYI 3RW6A 1MROB 2H4WB 1XNQE 2J5AA 1NK7A 4NMLA 1ZM9A 4JV0A 2FVCA 5ETVA 3G9CA 4DEZA 1F5AA 4YP3A 3QGHA 3FCHA 1LV5A 4MU1A 2GW8A 1ZETA 2D3UA 3EZUA 2CJBA 5AE1A 1WC1A 2HVZA 5A8RB 3GMEA 5AXKA 5DG9A 4HTIA 4FBUA 1S6PB 2PIIA 3T1HE 1XK8A 4U9RA 5LMNI 2Y8WA 1DTQB 5JUMA 4LF4F 2R7OA 5I4MA 4EZ9A 2HAFA 2AEMA 1DRZA 4Y0FA 3K1JA 1VQ7S 2WVFA 4JI0E 1Z2LA 2J8AA 1IKYB 3HHNB 1TMJA 2XMWA 3PM9A 4QIFA 1HQEA 3AB2B 1CULA 2WK4A 3ZFVA 1RISA 2QL9B 1K1QA 4RUAA 3EDRB 3QJJA 4LPFA 3OPKA 3WC2A 1Z0EA 1VBKA 3CDAA 4O0NA 1B0VA 1BQNA 4DUTA 3CJ0A 2MSSA 3CO9A 5GAEU 4QWCA 2B7BB 5CAAA 2PC6A 5KFNA 2DH9A 3RB3A 2HURA 4NYZA 4EO8A 5BR8J 4K4UA 4G1QB 3HJFA 5HMWA 4OI3A 3DGPB 3RR8A 4IRKA 4NCBA 1IBKJ 2AHOB 2VL1A 4LFBE 4Y2CA 3J81j 3I0SB 4PAAA 1YJ9S 3JAMY 1YRXA 1K47A 1S12A 3D66A 3RBXA 2YKPA 4WIIA 3N01A 2WOMB 4DUZF 4ED0A 4HT5A 2XMJA 2RE1A 1KONA 2FD2A 1M5SA 2PMZD 3C3LA 1RACB 3V81A 3M9NB 4C48A 1J5OB 4K59A 3PACA 1N32I 1ZAWA 5IT9U 2O1TA 2NYIA 2ZE2A 4ZLJA 1S6OA 3DKDA 2QGFB 4I64A 4X4TA 1I51B 2RB7A 3DOMB 3CIZA 2OPRA 3D68A 5EKWA 4NWBA 4FVCA 1KR4A 4K4TA 3HZGA 2ZJPQ 1FKOA 1K9MT 1KFSA 2HBQB 4P74A 3H7HB 1QAJA 5AXLA 3OTOJ 5KOXA 2PMHA 4Q7AA 1TL3A 4MIWA 1FF2A 5DZ7A 1TMMA 4ZHRA 4DR7I 2XSJB 2Z58B 3DRPA 3Q8YA 2U2FA 3S6EA 3KKFA 1NM2A 4TKTA 1XNRF 2HQGA 3R5DA 2QMXA 4FF3A 3Q22A 3MECB 1TKXB 2F8EX 3PEJA 2BE7D 3Q0AA 2ERRA 4IFYB 2PEHA 4OI6A 3K5MA 3TVZA 2DO4A 1CS4B 4FS1A 2EKNA 5F8NA 4DL2A 4FYXB 4PEOA 3VV2B 3P3CA 3KDOA 2V8DA 2FIUA 3M8QA 1FJGF 1NB7A 3T1YJ 2C3MA 4CM0A 3DLGA 1U1MA 1YQHA 4M63A 1RU2A 4LRFA 2DNHA 3RAMA 1NRKA 3IWLA 3R9LA 5J1PA 1FD2A 1FRMA 2JEJA 2EC2A 1N33F 7FDRA 3IGNA 2WONB 3FDSA 4RNOA 4DR3J 3DYAB 1UMJA 4TY8B 4RW9B 1GMUA 2Z56B 4KV8B 2UUCE 2ZM6J 3LP1A 1UPPA 4ANDA 4I56A 5JEAF 2MZJA 3W5ZA 4Y34A 1AXQA 1NHHA 4DL7A 3QWPA 2O3ZA 2APOA 2UXBE 3FJ2A 2JVRA 2M52A 3U7JA 2NPIA 1JWWA 2AZ3A 2AQ4A 4DV7I 4Q0BA 5KG2A 5B0AA 4B3TI 1D1UA 1CEZA 3VGUA 4X66F 3C6UB 4GRSA 4EEYA 3ULHA 1N0UA 1TAQA 3PJXA 1HNWF 3W9IA 2HHVA 1S76D 4DL0C 5CYQB 4CNZA 3ET6A 4JUZA 3KLIB 2LXIA 2PMWA 4M95A 2OD6A 1LW2B 3GSIA 1N36I 2HWTA 3CDJA 2OMLA 4IDKB 5LSLA 3BO3A 4ECQA 3R1HA 4RU2A 1G6BA 3DC2A 4IG3A 3AFGA 3OL9A 2HHHE 2YWHA 1UFWA 2UUBI 2KKHA 2W25A 4HLBA 4HL9A 1H73A 4QR2A 4DR4F 4LFCI 4DSEA 3D2WA 4QYZJ 1CQNA 4IG0B 2M5YA 3QRQA 3CTRA 1DJ0A 1Q16B 3BH6B 4JI7I 2HQCA 2W1BA 2J7WA 1HFEL 3P76A 2L41A 4JB8B 4LFAJ 1J5EJ 2ASLA 3BKUA 2N7CA 3T5HA 2FDNA 1TKDA 2J65A 2KN4A 1N6QB 1FDBA 1H7XA 2QIFA 3TZYA 4FW9A 3GIMA 4NLXA 2HZVA 2E1PA 4Y2AA 2C3PA 4UUXA 5I3QA 2BE2A 4LRBA 1HNZE 3ZO7A 1PJ5A 5E3QA 2F4VF 5I3UA 2AP6A 1S7HA 2R9LA 1KHVA 2AT1B 4Y65A 3UCGA 2VQFJ 2HMIA 6AT1B 4DDFA 3LO3A 3QBCA 2PO0B 1U1RA 1T95A 1VCTA 2IAJB 3IR7B 2OUGA 1KTQA 1RWNB 5CD4H 3KUEA 4JI4F 4R25A 3H5YA 3OFFA 2V68A 5DG7A 4A8YA 5KFKA 3EGWB 4HVZA 1QVFR 1LK7A 3R5BA 2RAQA 3DOKB 3QSIA 1DQ9A 4U67Q 1ZPWX 4RW8B 5HSPA 3CUNA 4LCFA 4WFNQ 5IFMA 1HNVB 3VR1A 2W2OP 5G0RA 1SB6A 1DZ5A 1H98A 4F0KA 3TUJC 2DITA 4JI5F 1IKWB 1KQGB 4OZ2A 1VQ4S 3UWTA 3JAMQ 3MMBA 4F0MA 2QA4S 1TK8A 3W66A 2PE8A 3HFVA 2ZNZA 5GVQA 3PFOA 4NXME 2OP5A 2GGPB 1NMEB 2NLWA 2JRSA 2ZJQQ 3HDSA 2VG5B 1RAOA 1L3SA 4LQ3A 2CJQA 1ZXMA 2HNZA 2VASA 5KFQA 1XR7A 5K36F 4LF9J 3LGHA 1A6FA 5H9FJ 1YZ7A 4RKUC 2V67A 4CO2A 3CCWA 2DISA 3EXYA 3EGNA 3IWXA 4B9SA 1MMLA 1RHJB 2GHPA 3GONA 4QWDA 3QIPB 1HR0I 2R8HA 2FJXA 2BKNA 3R2CJ 4ZPDA 4GKJI 3IXQA 1S97A 1TVRA 1KSPA 4IO9Q 5KG5A 2BDPA 1B64A 1BY9A 5F41A 2P8IA 1JX4A 8RUCA 2QO3A 2C22A 2K3IA 2DR5A 1VC6A 2ZHOA 3K5OA 2FY8A 2CNKB 5C0XB 4WFZA 4JI1E 1JKHB 3M8PB 1LWEB 3K57A 4RBUA 2HKEA 5IM0B 2LQJA 3I4HX 1ZTTA 4AL7A 2GIFA 3E8OA 2E5LF 1YRTA 2DHGA 3QIDA 1IBMI 3A8KA 4A48A 1HMVA 4DX7A 4FYWB 2X1FA 2E9TA 1BGXT 1YITS 3THVA 4JI2I 1FD8A 2NXNA 2ZZMA 2C38B 2ZJRQ 2YH1A 4KKOB 1EQMA 4AFFA 2VQEE 4P10A 3TWZA 2GV1A 5C25B 1KLMB 4H4MB 3VAJA 4PR6A 1HA1A 3PCOB 4D3HA 2Z5BA 3EM1A 2LP4A 2UUAJ 3J81Y 3JQJA 2MLYA 4WPAA 1C0TB 4OIXA 1C1CA 1SIWB 2F3JA 4NYPA 1RU1A 3FEZA 2RU3A 2ZUGA 2OPPA 2PO2A 5HI7A 1RWPB 4NXNF 2UP1A 3PO4A 4DV2E 4DR6F 1WDTA 2AYMA 2W24A 2HRTA 2V4RA 1U48A 4JI3J 2FLPA 5SUHA 2UXDF 2MKHA 1APSA 1WG5A 5E0OA 4YHHE 2YQ1A 4DR1I 3NOCA 4YY3J 1RYSA 3BM7A 3Q2TC 2NR0A 2VONA 4DR2E 3NCPA 1Q81T 4CO1A 3I82A 3DRXA 4YEAA 2I9SA 1DQ8A 3MPUB 5CQGA 2H48B 3LGNA 3OR1A 1K8AT 4K4WA 3VHQA 2UU9F 1FVQA 1VBYA 1IBLF 3QJLA 3MMAA 1VRQC 3IC1A 5J2QA 1E3PA 4AT1B 4I2PB 3PO5A 4NZ7A 2Z30B 2KXFA 1Q78A 1TELA 2O67A 4TVAB 1EIYB 2YWGA 3BQ0A 3H2VE 1WSRA 2W4DA 4IFDD 1FWPA 3E51A 3W1YC 1U2RA 3OUYA 2F1FA 5KFDA 3TUIC 3MAAA 2XO6A 3HVRA 4B3TJ 4J9RA 1BC6A 2ZVIA 3HKZD 2HIQA 3JSBA 3ISNC 3PNIA 4DFPA 1RXOB 1VQLS 4LF6F 2R7SA 1AROP 1RB0A 3GG1A 3UFCX 5EWGA 4B3MJ 1RAFB 2KRBA 2HK3A 5A8KB 1IM4A 4B3RI 4LF5F 2DNRA 2IM0A 3ITHB 1MWYA 1UDNA 2W7PA 2VOOA 3U1NA 3DOLA 3PRVA 4CDIA 3CCMS 1NLKL 2Y1IA 5JVHQ 3VALA 1VQOS 4HDHA 5D4OA 4R1FA 2IBKA 1M5HA 2VDHA 4TU9A 1FA0A 1NZ0A 3AOBA 4GVLA 1DTQA 3CIMA 4ED2A 3M2RB 2BVZA 4ED1A 1TR0A 4DV6E 1T02A 3JB9k 2W9CB 1OMSA 1SL2A 2MZSA 2C3OA 1SIZA 2NZCA 2DGUA 3FFIB 3I87A 3EYZA 5KOWA 1Q5YA 1M5PC 2F8HA 5A2QY 3UI3A 2JEFA 4KHMA 3ETMA 4KO0A 2UUWA 2G0IA 4YR2A 3EZ5A 1RHRB 2PN6A 3CNQP 1G2EA 1F3FA 2L9NA 1Q8IA 2GQ0A 2DHXA 1XMOF 1TU0B 1KRPA 4Y00A 5C0XC 1YIJS 2XWXA 1VBXA 2QEXS 2DEJA 4EU0A 4OZ3A 3PKMA 4ZLLA 3M6AA 4WU3A 3GZ7A 1YZ6A 4PQUA 3DGPA 4CCHA 4KYZA 4MU4A 2IM3A 3HHLA 1FFSB 1T11A 3A4TA 3QZ8A 4NRTA 2VFTA 3GPAA 1Y00A 3AB4B 4OLPA 4WTOB 2R42A 1Q82T 4KGXB 1HQ2A 3R7BB 4DV5J 3OQ2A 4I68A 4USMA 4KQZA 2M2BA 2ADBA 1LEOA 2FVRA 3V6HA 1FE4A 2RQ4A 3OVBA 4IZKB 5E41A 3DDIA 1OY6A 4JI8J 1X0FA 4I6YA 3TI0A 5CABA 2XHCA 4AE5A 1RP5A 2RDIA 4XIUA 3AD9C 1P1TA 1IBKE 4DV1E 4OMFG 2LU1A 1Z5BA 4O4GB 5K5MA 1YSJA 2W2PP 3Q8RB 3UW1A 2ZNYA 1ACMB 4P71A 2RUGA 4W4MA 1O0PA 2EFVA 4C2MA 5D77A 3E01B 4NLPA 4BA1B 3LAMA 3PIOQ 1WNEA 1M1GA 2AJ4A 2XSJA 1U8WA 1Z2ZA 3HVWA 2KU7A 1USUA 2C2EA 3JTPA 1JLFB 2NXJA 3MGJA 1UVLA 4LRCA 4DU7A 3ZZOA 5LMUJ 4DV3J 3HVAA 4CRJA 2KFZA 1X5TA 3PRYA 2VDIA 1VJQA 5BR8F 3PS1A 2VG6B 3IFEA 2FHMA 1CS4A 4F4ZA 4W92B 4CP5A 3M30B 2X3DA 3OTOE 2OPSB 1X8DA 3VAHA 1FXDA 4OYIA 4ZP8A 5C2GA 3ILJA 3QMQA 1Q53A 4JV5J 1DFDA 1RTHA 4QBUA 2FJBB 3RRKA 3HULA 2MKKA 3Q8PB 1RKJA 3PKYA 3GCXP 2G0CA 4M5LA 5JVGQ 3Q86A 1L3KA 4ZCIA 4P2SA 2WONA 4B9LA 4C0HA 2CRLA 5ITHA 3CB4A 3J80Y 2VODA 1WUUA 4U96A 1SV5B 3KJFB 3QATA 4MK7A 4OL8A 4J37A 2E44A 2EFGA 1RCXB 3A3OB 5J2MB 2UVVA 2RMLA 1LKZA 3MUVP 3D28A 1XNRE 3DI6B 3UNYA 5D4LA 1HKAA 1FDNA 1S48A 1O8BA 2LDIA 5C24A 4WJBA 3PW7A 1LXNA 1Q7LB 3RAQA 1QSYA 2DHSA 4UQTA 2RH3A 4DQIA 3KJVB 1UVNA 4B9TA 3G6XA 1D09B 2YKMA 5CYQA 1E3HA 2WSFC 5H1SV 3N6NA 1W7WA 5IWAJ 3KHRA 5ETSA 2HVHA 3OT9A 3KLIA 1NK8A 1Y11A 1EP4B 1FJGE 4IDKA 3T19A 3M7VA 2DB1A 4C8ZA 2PI5A 2Z2MA 1NK6A 2CKWA 3HSJA 4RW7A 2B3TB 4ID5A 3T1YF 3MUTP 2YKNB 4P75A 4IG0A 1N33E 2DGSA 4DFJA 3CW2C 1XNQI 2B9WA 5CZXA 4A47A 4YOEA 3FZ2A 3RGIA 2EFQA 1H0HB 2C1EB 4LF8I 4NA3A 3TVKA 1HQUA 3K5PA 3IM8A 1T9TA 3MCNA 2NYHA 1ZM4A 1QZRA 2ZM6F 4MKAA 2MKYA 4Q43A 1V6HA 2J8SA 1IUJA 3T1HI 2PO1B 3H20A 4X84A 3UN5A 5AE3A 3SI8A 3QFHA 3MMJA 3FZBA 3M2VA 1XXEA 3FC9A 2K2PA 3CO0P 4M94A 4ES2A 2W2NP 4B02A 3W62A 4ZJLA 2W2MP 3J7AG 1N34F 4JI0I 4LFAE 3OL6A 3OW2R 1J5EE 2KHDA 4GKKJ 3BV8A 1PYOB 4J91A 3LTOA 1SJFA 4C4WA 2X1GA 4DR5I 4R8UB 4KHPE 1RAIB 3FSYA 4L3KA 4ES1A 4U7CA 1RAJA 4PQAA 2JSXA 4OJ3A 3I32A 5EWFA 5ETLA 3A13A 2JHEA 4XDCA 3LALA 3IN5A 3AD7C 2LQ5A 4DR4E 3DN9A 2R7WA 2CPFA 4PYAA 3GIKA 4UUWA 3PRBA 5HK4A 4RW8A 2HHQA 3H59A 2HLUA 3I96A 1O51A 5AT1B 3W60A 3DDNA 1KQKA 1IKVA 1HNXJ 3QZ7A 5H9EK 5HQ8A 2V2ZA 2MZQA 3DXBA 2IJFA 1IKWA 5E2QA 5JMNA 3H5SA 2YX4A 4NA2A 5K9FA 4YFUA 2WTFA 2BR0A 3R5AA 3GMGA 1PSDA 2GJFA 1I3OB 4Q2LA 2PI4A 3M9OB 3D6MB 1F5CA 2XS2A 3DHXA 5DM7Q 3D1OA 3TAMB 1W2BR 3NZKA 3BDEA 2F4VE 4HDGA 2I1RA 4P7VA 3V6DB 1GNKA 3CMQA 4RW6A 1WJ9A 2L08A 4HY1A 3C14A 4ZP9A 3BSOA 4DL6A 4MFBB 3PS3A 3BJYA 4DPWA 4LVOP 4ZKAA 2CQDA 3CJQA 2RUSA 4JI4E 2AIRB 1M90T 4NOHA 2G4BA 4LIRA 3CE8A 5KG1A 2C2OB 2JLFA 3CPWR 5F3ZA 1S16A 2VFUA 1NPKA 1JLEA 2EEYA 4V1Ak 1WELA 4NLOA 4LF9E 2FC8A 4B3SJ 2XG8A 5LMNF 4TN2A 2C2NA 1FTRA 1JKHA 5E7OB 3M32B 5D8HB 4K0KE 1QLNA 2EC0A 1Z5AA 5CHCB 3PYEA 3SQGB 4R5PB 4B9UA 1RABB 1V5VA 4IZJA 4YB7A 3P8BB 4O44A 5HANA 1YJ7A 1T9VA 3CJTA 2W4CA 4USKA 4FYVB 1LFPA 3VAFA 2IRUA 1P9QC 2DR7A 5FLXC 1ZAVA 2JC1A 3X3UA 4I7FA 2UV8G 1IQTA 3LGMA 1KLMA 2BJ3A 2OELA 4KE5A 4C6AA 1SPBP 2BQRA 2BRKA 4WUCA 2BJ1A 4J90A 2PNLA 3H4DA 1X4AA 1RTIB 5K8OA 1KQSR 3NNAA 3UDEA 2K06A 4YB5A 2W9BB 2QC3A 2R7QA 1WDDA 1RT1A 2ZOGA 5C42B 1KD1T 3G87A 1ZS6A 4C9DA 2EG2A 4XPCA 1F6TA 1TL7B 4A8MP 1NJXA 3PX0A 1NK5A 4FPIA 4H4OB 5EUHA 3MEGA 2R7UA 3N79A 1Y6ZA 4DHVA 1VR6A 2GHWA 3O1LA 2R3VA 5U47A 5CA5A 1UKUA 2YWFA 4WFXA 2UXBI 4DV4J 4PRFA 3V6JA 3H8YA 2A6MA 2OMOA 1N32F 4I6AA 2UXCE 2WHOA 3QFWA 4RNMA 3DD6A 2KG0A 3MTJA 2UUAE 2AKWB 3VQTA 3BR9A 2NUUG 1H6KX 4DX6A 1RQ0A 2JWNA 2GAGC 2BMBA 2V4JB 3L4BC 2BOPA 2XLKA 4LRAA 2GO8A 4J9QA 2E5LE 2PSZA 1W25A 4WYLA 1SL1A 3KNGA 3GYGA 4X65J 3C2PA 1R6VA 1N88A 5HO4A 5HVHA 1UJ6A 5HROB 2HHHI 1RREA 1FI4A 4DR7F 4TQRA 3C46A 1Q8LA 4N76A 2DEIA 5KFMA 4I3HA 1EAYC 1M5KC 4B9NA 3ADAC 3T5JA 4ZVGA 4NLGA 5IT9Y 5LM7E 2JC0A 1R8PA 4H4KA 1M5VC 1TL5A 4JP8A 4QIVA 3MPVA 2B8PA 4CH0S 4ZITA 3N6MA 2QMWA 3GR1A 1QTMA 4FZVA 2HIYA 3TA2A 3QT7A 2DNPA 4GVBB 4DMZA 5KG4A 3TP2A 2CQ0A 3FBCA 4Q45A 4LJMA 1RAHB 3EGZA 4YN3B 4U3DA 4ICLA 1HNZI 2DYAA 2IPOB 3IAS9 4PRXA 1FRIA 4YY3F 3G71S 3PJ9A 4ZA1A 3RU0A 4FW6A 5CCMA 5F9LA 1HYSA 1H7WA 2EFPA 1LWCA 4X62J 4OHZA 4A8QA 2KZMA 3M2RA 1S9EB 3ONQA 2BJEA 2ROGA 4WUBA 4QIEA 4X4VA 5B09A 4XO0A 3BQ2A 1JLCA 3FNNA 1FWLA 1XMQE 2XY6A 3GWCA 1H7UA 1G1XA 2ALZA 2DY1A 3FRYA 4EBDA 4ZCLA 1VS3A 2B4VA 3OTBA 3B4TA 1H3DA 3PVXA 4B17A 2HAIA 2ZH8A 1R0CB 1LWFB 4F25A 3KXDA 1MMNA 4DV7F 4OYAA 1IM6A 3R7NB 4B3TF 5J2PB 4LF6E 3CJ2A 1LW0A 2LQ8A 2DR8A 4UZBA 2L9WA 4X64E 2YKOA 4DV0E 1YX2A 2F40A 4ERDA 1J2VA 3KLFA 4NLDA 4UOHA 2AE8A 5T7LB 2FPHX 5LJ5Y 2RIJA 2C28A 2VHGA 1YJTA 1N36F 3N5BA 4JBCA 1S1XB 2HGMA 4P2MA 1U6BA 3AOAA 4KFBB 4UOGA 1WOSA 3LF0A 2UUBF 5J2NB 2ASJA 1EA6A 4C11B 2QX0A 4LFBJ 2JL9A 2NXEA 1RDRA 4LFCF 3SV4A 1OY9A 4CO3A 3NGTA 4N3OA 3D67A 4JI7F 2CYYA 4F4KA 1Z5CA 3Q89A 1WI8A 3GSDA 2CGEA 3PG9A 1GX6A 2J9CA 2ZWPA 2LJPA 1SBRA 4FBTA 2BKPA 2GC8A 3BGRA 4O4GA 4BCAA 2C2DA 1NAQA 5D3GB 1YK9A 4OO1D 2KXNB 3KK2B 1SJRA 3SDEB 2B4PA 3AJDA 1SJ1A 3TO8A 1M5OC 3E01A 4BA1A 3CMAS 4PYDA 3EVWA 1AUDA 5B7WA 1IKXB 3KLHA 1QUPA 5KT3A 2MY8A 1HNIA 1JNRB 1SH0A 5L1JA 4PZVA 3HF5A 1E6VA 4K2XA 2HZAA 2RT3A 4KGZB 1JLQB 1NH8A 5J1EB 1VIXA 4BA2A 1P1LA 2F7VA 4DR6I 4NA1A 1JLFA 5ADZA 2DXDA 1W26A 4RNHA 2KT3A 2Z4PA 2JE6A 1OQ6A 2CADA 2ZBRA 1DAXA 2IIHA 4BDPA 1CJUA 3AT1B 1EKSA 1FESA 3X1LB 3MTKA 3POTB 3N9UC 2JEAB 3J81C 3ICLA 3M30A 2KM8B 1NPPA 3P4UB 1WI6A 3S01A 4EK2A 3I0RA 3K17A 1UP1A 4PG8A 2OIHA 3IGVA 5KG6A 3MI7X 4MMOA 5KFAA 1U0HB 2XULA 5LSOA 3KK1A 1FKPB 2CQ2A 2VH7A 1S1WB 4UOFA 2GVZB 3H4BA 3H42A 5DRPA 2DH8A 2QT7A 2B4UA 2HS4A 3ENAA 2BA0G 5LMUE 4DV3E 2Q43A 2AJFE 4OV1A 1S9GA 2AX1A 4DV2I 4F4WA 3KHHA 1BMQB 1SJ4P 4N47A 3O8WA 1JQGA 2IOPA 2C39B 1XBWA 1CC7A 1I94E 1OS5A 1MU5A 5K14A 2ZDOA 3VZHA 2RHSB 4PUOB 1NJWA 4OO1E 3JYTB 2DPIA 3C15A 3ENQA 3CCES 3TW0A 1SV5A 1U2CA 1TKZA 2QYGA 1G7CB 3IP0A 2ZKUA 3A8IA 4LF5I 3IG1B 1WACA 1T03B 3R97A 3RW7A 2VA2A 4ID8A 2UUCJ 1N5QA 2HQIA 4OZEA 1P8GA 3A12A 4DQRA 1TL4A 1NDLA 5LT5A 2QA1A 3VAGA 3WU4A 3SIPB 1ZZNA 1AZSA 4ZIVA 2HK2A 4URSA 1MLAA 3J7Z5 4WK3A 1SJ3P 3TX0A 1HR0F 2B9YA 1PKPA 4DOZA 4GKJF 1X5SA 4OX7A 2DNOA 3I6PA 2MGZB 2AWZA 4AXJA 3GG0A 3NBPB 2YWWA 5K36A 2GVDB 4FDFA 3MF5A 1HLWA 4ILLA 1NHVA 1U45A 2E9ZA 2J6SA 2IESA 5IT9Q 3KRNA 4OYXA 4DSLA 4ZVIA 4C8YA 3O44A 2IY5B 2XTJP 1F60B 3CMES 1IBMF 1UL3A 3QSYB 2NCKL 2HHHJ 3PW2A 4MU3A 4JI2F 4ZOSA 2YNIA 4IRCA 2AMCB 3M7ND 5HN0A 1XMOI 2V2KA 1U7LA 1TL1A 2HHWA 5T41A 4KR0B 4ETXA 1YHQS 5HL7Q 4ALZA 1FO1A 2MMYA 3QAUA 3MD1A 3CD0A 2EK6A 4ZVUB 4MKBA 2DGTA 5A2QC 4OHXA 2BZ2A 1IWAA 5IQ6A 2BXJA 1KIJA 2P9GA 1RJJA 1WHXA 1KQFB 1WC6A 3KLEA 4EI2A 1T8EA 4OZNA 2VPXB 4I2QB 2Y1JA 3CJKA 3IBCB 4JI6J 5CXTA 1D9DA 3OLAA 3QT8A 2DHHA 4PG7A 4OX9J 2C37A 1QSLA 4MYTA 2ILYA 3M2UB 1TV6B 3P3EA 4P52A 4NLUA 4DR1F 2QE5A 5DLGA 2YNHA 4NCAA 3SFUA 1CJVB 1BQXA 1TUWA 1FDAA 4DSFA 3SSRA 2VD3A 2V8VA 3MOJB 3DM2A 4RJVA 2V5HG 1VQMS 4QIWD 3TQ1A 3JXOA 5D0GA 3Q8QB 1EI1A 4IOCQ 3J7YI 3C6TA 3KK3A 1R8BA 1X0PA 5KFBA 3M6UA 4FXDA 4GKKE 1HD1A 4NCGA 4XPEA 4F3QA 2YXLA 1NDKA 4ELVA 4RWXA 2WVDA 1R31A 2KM8C 2PFFB 4LSZB 2QSFA 1VQNS 3ZM7A 3BBBA 3RAXA 2HEKA 5HMYA 3HSZA 2XY7A 4K50A 3KOAA 3HD1A 4LSNB 2ZEJA 3KJNB 3KNAA 3WX4A 3W7BA 3B8HA 1S0VA 4N8OA 2RD5C 1HBUA 1WHYA 4C8NA 4F67A 3V6DA 1N34E 1IBKI 4DV1I 1RR9A 1P6TA 4ED5A 2F9DA 3DRRB 1HNXE 5K8MA 3QO9A 1Y5YA 2EVZA 2WSCC 4NXMJ 5ETOA 3T9ZA 3MMCB 1SKUB 4QZVB 3P5BP 4PG5A 3Q6MA 1N8RT 1QVGR 4MK9A 2VPYB 4KTQA 4ZP6A 3OR2B 2HVEA 5AE2A 2E1RA 4ZVSB 2HGLA 3BF4A 1S79A 4K4VA 1CLFA 3EX7B 4O3OA 3M85G 4RBVA 4HI2A 4QQBA 2Y1RI 2PGCA 2R2SA 2OI2A 2R7TA 4AIDA 1OYPA 1XJWB 3M32A 2OH2A 5KFUA 4FXWA 4KH0B 2IMOA 2CJ9A 1NO8A 3SQGA 4DG1A 8ATCB 2MZ1A 5E3RA 1VLYA 3WIVA 4KGVB 4QWEA 2E9RX 1S1TA 2IVYA 3OTOI 5AXNA 1S0OA 1DQAA 3CCUS 4PWDB 3PV8A 1C1BB 1F9FA 4JI1J 4AXIA 1RT3A 4QCLA 1NHUA 4MKVA 4JYAJ 1QAIA 1N48A 2G0JA 3J80C 3VQSA 1IBCB 2MJUA 3UPFA 3HPOA 4B3SE 2ASDA 2FHKA 5H9EJ 1Y4UA 2W01A 2R8KA 2OFGX 1KKHA 1HBNB 2NXUA 2VF3A 4L75A 2HW3A 4AQYE 2K1RA 3L7ZA 3KHGA 3NXZA 1BE4A 2VQEJ 5C0XD 3U1LA 3FSIA 1H7SA 1VHFA 2ATCB
chains in the Genus database with same CATH topology
4LFCE 1HK7A 5LL6R 4B3RI 4NXNI 1Z0CA 5FLXQ 4JI0E 4FWGA 4LF5I 2HFUA 1HNZE 4DV6I 4JI8E 3T1YI 4DUYI 1N32E 2PNMA 2UXDI 4LFBI 3WU5A 2HHHI 1N33E 2BM1A 2IOQA 1PVGA 1RREA 1FI4A 1USVA 1XNQI 4X66I 3J81Q 2DEIA 3WU4A 4JG4A 4I3HA 1ELOA 1Z0EA 2HK2A 4LF8I 2O1UA 2X36A 5LMNE 5LMUI 4DV3I 1HNWI 4DPYA 2WW4A 4LF4E 4R1FA 1PKPA 2HFSA 3HJCA 2V8PA 4DXLA 1Z0GA 4DR3I 1H74A 4B3RE 1NZ0A 1ZM2A 1ZM4A 1QZRA 1PIEA 4LF5E 4B3SI 3ZKBA 4DV6E 4KHPI 3T1YE 2UUAI 2UU9I 1IBLI 3QT7A 2CZ9A 4DPTA 4LFBE 3T1HI 3D4JA 1MG7A 1K47A 4NXMI 4DPUA 4JV5I 5IT9Q 1OJ4A 4DV4E 1Z0WA 4ZVIA 3PYFA 3J80Q 4LF8E 4DR4I 3J7AG 4JI3I 4JI0I 3PYDA 2Z5EA 4LFAE 4JYAE 1HNZI 1HR0E 1J5EE 4PRXA 3ZZ0A 4GKJE 4IZKA 1Z0BA 4DR3E 1N32I 3WU3A 4YY3I 3LTOA 4HXZA 2O1TA 4KQVA 2GQ0A 1UEKA 4DR5I 4KHPE 2ZM6E 3F0NA 1XMOI 3JAMQ 1Z59A 3J7AM 2DEJA 1ZM3A 1FWKA 3M6AA 4Z7CA 4WUBA 4NXME 4LF6I 4FWDA 4LF4I 4JV5E 4X65E 4X64I 4DUZE 4DR4E 4JI3E 1FWLA 1ZXMA 5A2QC 1XMQE 3WU6A 1BKNA 4DV0I 4HYMA 2R42A 1A6FA 1H7UA 1KIJA 2ZBKB 2F4VI 4YY3E 2Q2EB 2XEXA 4JI5E 4DR5E 4USMA 2NPFA 4RPFA 1XMOE 2A2CA 4DR7I 4JI1I 2V2ZA 2A2DA 4DV4I 3QT8A 4IZKB 1MX0A 3GONA 4HACA 3PYGA 4MYTA 4P52A 4LF6E 4LFAI 4JYAI 1HR0I 1J5EI 4X64E 4GKJI 5IWAI 4JI4I 1IBKE 4DV0E 4DV1E 2ZM6I 1XHKA 2V34A 1Z5BA 1KTVA 2F4VE 2Z5CB 2VQEI 3B82A 4B3MI 2Z5BB 2O1VA 1EI1A 4DR7E 3LNUA 4PRVA 4X65I 4JI1E 4DU8A 2ZITA 4DUZI 2CG9A 4GKKE 4HY1A 2HKEA 2X7IA 3QT5A 4DV7E 1XMQI 2UUCI 1N34I 4B3TE 2AJ4A 4LF7E 4DPWA 2J7KA 3ZKDA 1EA6A 1IBMI 5IWAE 1FNMA 3K85A 2VQFI 1USUA 5GMEA 4X62E 4JI4E 3ZM7A 4JI5I 4JI2I 4HACB 4N3OA 4DU7A 1Z5CA 1N0VC 1DARA 2VQEE 2CGEA 4MYUA 1KVKA 2BV3A 5A2QQ 4B3ME 2LJPA 1S16A 3PRYA 4XTJA 4YHHI 1N36E 3B8HA 2Z5CA 4LF9E 2Z5BA 3B78A 2UUCE 1N34E 1IBKI 1NHIA 4DV1I 3OTOE 4DR2I 1RR9A 2UUBE 4IZJD 4K0KE 2V2VA 1IBME 5FWKA 1HNXE 2VQFE 1Z5AA 3PYEA 4JI2E 4JI6E 1NHHA 1FKAE 4IZJA 4OX9E 2UXBE 4DV2E 4JI7E 4ED4A 2O1WA 1B63A 3Q6MA 2GS8A 4DR6I 4GKKI 4Z7YA 4USKA 3HULA 1NHJA 4DV7I 4YHHE 4B3TI 4LF7I 1B62A 2E1RA 4DR1I 5FLXC 5BR8E 4PU9A 3Q1QA 2BM0A 2V2QA 1XNRI 1N0UA 3V2UC 4X62I 3QT6A 1H72C 2HKJA 4DR2E 4WUCA 4DPXA 2PNLA 3ZZUA 3J81C 4M1KA 4UT4A 4UTGA 2OI2A 2UXCI 1S4EA 3LPSA 1WUUA 3ZZTA 4NXNE 1I94I 3K17A 1N36I 3Q6NA 1VISA 4DR6E 4DUYE 4LF9I 2UXDE 2HHHE 4AQYI 2EFGA 1FJGI 3OTOI 3CWVA 2UUBI 4DV5I 4DR1E 1XNQE 1D6TA 4IZJB 4K0KI 4X66E 2E5LI 1Y4SA 1Y6ZA 5GMDA 1HNXI 1XNRE 1ZM9A 1ZXNA 4FWHA 1H73A 4JI6I 4LFCI 2R3VA 5LMUE 4DV3E 1HNWE 4OX9I 2UXBI 1U2RA 5L3JA 4DV2I 4JI7I 4JI8I 5IT9C 2UXCE 1Z0TA 2IOPA 4URLA 1N33I 3J80C 1I94E 3H4LA 1MU5A 4B3SE 2UUAE 5BR8I 2UU9E 1Y4UA 4FN5A 4WUDA 1IBLE 1KKHA 3T1HE 2VF3A 4AQYE 1Z0VA 3P06A 1FJGE 5LMNI 4DV5E 3V5RA 4P7AA 2E5LE 4FW9A 4EMDA 1H7SA 3JAMC 2HK3A 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC E;  5LL6 R;  4B3R I;  4NXN I;  1Z0C A;  5FLX Q;  4JI0 E;  4FWG A;  4LF5 I;  2HFU A;  1HNZ E;  4DV6 I;  4JI8 E;  3T1Y I;  4DUY I;  1N32 E;  2UXD I;  4LFB I;  3WU5 A;  2HHH I;  1N33 E;  2BM1 A;  1PVG A;  1RRE A;  1FI4 A;  1XNQ I;  4X66 I;  3J81 Q;  2DEI A;  3WU4 A;  4JG4 A;  4I3H A;  1ELO A;  1Z0E A;  2HK2 A;  4LF8 I;  2X36 A;  5LMN E;  5LMU I;  4DV3 I;  1HNW I;  4DPY A;  2WW4 A;  4LF4 E;  4R1F A;  1PKP A;  2HFS A;  2V8P A;  4DXL A;  1Z0G A;  4DR3 I;  1H74 A;  4B3R E;  1NZ0 A;  1ZM2 A;  1ZM4 A;  1QZR A;  1PIE A;  4LF5 E;  4B3S I;  3ZKB A;  4DV6 E;  4KHP I;  3T1Y E;  2UUA I;  2UU9 I;  1IBL I;  3QT7 A;  2CZ9 A;  4DPT A;  4LFB E;  3T1H I;  3D4J A;  1MG7 A;  1K47 A;  4NXM I;  4DPU A;  4JV5 I;  5IT9 Q;  1OJ4 A;  4DV4 E;  1Z0W A;  4ZVI A;  3PYF A;  3J80 Q;  4LF8 E;  4DR4 I;  3J7A G;  4JI3 I;  4JI0 I;  3PYD A;  4LFA E;  4JYA E;  1HNZ I;  1HR0 E;  1J5E E;  4PRX A;  3ZZ0 A;  4GKJ E;  1Z0B A;  4DR3 E;  1N32 I;  3WU3 A;  4YY3 I;  3LTO A;  4HXZ A;  4KQV A;  1UEK A;  4DR5 I;  4KHP E;  2ZM6 E;  3F0N A;  1XMO I;  3JAM Q;  1Z59 A;  3J7A M;  2DEJ A;  1ZM3 A;  1FWK A;  3M6A A;  4Z7C A;  4WUB A;  4NXM E;  4LF6 I;  4FWD A;  4LF4 I;  4JV5 E;  4X65 E;  4X64 I;  4DUZ E;  4DR4 E;  4JI3 E;  1FWL A;  1ZXM A;  5A2Q C;  1XMQ E;  3WU6 A;  1BKN A;  4DV0 I;  4HYM A;  2R42 A;  1A6F A;  1H7U A;  1KIJ A;  2ZBK B;  2F4V I;  4YY3 E;  2Q2E B;  2XEX A;  4JI5 E;  4DR5 E;  4USM A;  2NPF A;  4RPF A;  1XMO E;  2A2C A;  4DR7 I;  4JI1 I;  2V2Z A;  2A2D A;  4DV4 I;  3QT8 A;  1MX0 A;  3GON A;  4HAC A;  3PYG A;  4MYT A;  4P52 A;  4LF6 E;  4LFA I;  4JYA I;  1HR0 I;  1J5E I;  4X64 E;  4GKJ I;  5IWA I;  4JI4 I;  1IBK E;  4DV0 E;  4DV1 E;  2ZM6 I;  1XHK A;  2V34 A;  1Z5B A;  1KTV A;  2F4V E;  2VQE I;  3B82 A;  4B3M I;  1EI1 A;  4DR7 E;  3LNU A;  4PRV A;  4X65 I;  4JI1 E;  4DU8 A;  2ZIT A;  4DUZ I;  4GKK E;  4HY1 A;  2HKE A;  2X7I A;  3QT5 A;  4DV7 E;  1XMQ I;  2UUC I;  1N34 I;  4B3T E;  2AJ4 A;  4LF7 E;  4DPW A;  2J7K A;  3ZKD A;  1EA6 A;  1IBM I;  5IWA E;  1FNM A;  2VQF I;  5GME A;  4X62 E;  4JI4 E;  3ZM7 A;  4JI5 I;  4JI2 I;  4HAC B;  4DU7 A;  1Z5C A;  1N0V C;  1DAR A;  2VQE E;  4MYU A;  1KVK A;  2BV3 A;  5A2Q Q;  4B3M E;  2LJP A;  1S16 A;  4XTJ A;  4YHH I;  1N36 E;  3B8H A;  4LF9 E;  3B78 A;  2UUC E;  1N34 E;  1IBK I;  1NHI A;  4DV1 I;  3OTO E;  4DR2 I;  1RR9 A;  2UUB E;  4K0K E;  2V2V A;  1IBM E;  1HNX E;  2VQF E;  1Z5A A;  3PYE A;  4JI2 E;  4JI6 E;  1NHH A;  1FKA E;  4OX9 E;  2UXB E;  4DV2 E;  4JI7 E;  4ED4 A;  1B63 A;  2GS8 A;  4DR6 I;  4GKK I;  4Z7Y A;  4USK A;  3HUL A;  1NHJ A;  4DV7 I;  4YHH E;  4B3T I;  4LF7 I;  1B62 A;  2E1R A;  4DR1 I;  5FLX C;  5BR8 E;  4PU9 A;  3Q1Q A;  2BM0 A;  2V2Q A;  1XNR I;  1N0U A;  3V2U C;  4X62 I;  3QT6 A;  1H72 C;  2HKJ A;  4DR2 E;  4WUC A;  4DPX A;  3ZZU A;  3J81 C;  4M1K A;  4UT4 A;  4UTG A;  2OI2 A;  2UXC I;  1S4E A;  3LPS A;  1WUU A;  3ZZT A;  4NXN E;  1I94 I;  3K17 A;  1N36 I;  1VIS A;  4DR6 E;  4DUY E;  4LF9 I;  2UXD E;  2HHH E;  4AQY I;  2EFG A;  1FJG I;  3OTO I;  3CWV A;  2UUB I;  4DV5 I;  4DR1 E;  1XNQ E;  1D6T A;  4K0K I;  4X66 E;  2E5L I;  5GMD A;  1HNX I;  1XNR E;  1ZM9 A;  1ZXN A;  4FWH A;  1H73 A;  4JI6 I;  4LFC I;  2R3V A;  5LMU E;  4DV3 E;  1HNW E;  4OX9 I;  2UXB I;  1U2R A;  5L3J A;  4DV2 I;  4JI7 I;  4JI8 I;  5IT9 C;  2UXC E;  1Z0T A;  4URL A;  1N33 I;  3J80 C;  1I94 E;  3H4L A;  1MU5 A;  4B3S E;  2UUA E;  5BR8 I;  2UU9 E;  4FN5 A;  4WUD A;  1IBL E;  1KKH A;  3T1H E;  2VF3 A;  4AQY E;  1Z0V A;  1FJG E;  5LMN I;  4DV5 E;  3V5R A;  4P7A A;  2E5L E;  4FW9 A;  4EMD A;  1H7S A;  3JAM C;  2HK3 A;  3K1J A; 
#chains in the Genus database with same CATH topology
 4H4O A;  3CJ8 A;  2I38 A;  2IER A;  3MEE B;  1Z0C A;  3T1Y I;  2KHC A;  2YNF A;  4HR2 A;  3NGU A;  2HS3 A;  2D3Z A;  1S57 A;  3FMB A;  3KG1 A;  4L76 A;  4EYI B;  1PVG A;  1RLC L;  2XMM A;  2NS1 B;  2XZW A;  2DH7 A;  2B51 A;  3IR5 B;  5FLX U;  5AXM A;  3NKY A;  2VBY A;  5LMN E;  2D1C A;  1NXI A;  3RB6 A;  3MOZ A;  2V8P A;  2EFO A;  1FXL A;  5HBM A;  3G6V A;  4DR3 I;  3MM8 B;  4YHH J;  2ZH7 A;  1UDO A;  8AT1 B;  1S4F A;  2C2R A;  1BXN A;  1A6L A;  4RW4 B;  3N0V A;  1FNX H;  2PNZ B;  4F36 A;  4IFV A;  2R2U A;  1B7Y B;  3OFH A;  2EI5 A;  4WKY A;  5BYQ A;  4DR2 J;  2A0F B;  1N5Y B;  1NDP A;  4X4P A;  1XN9 A;  4DV4 E;  2JT2 A;  2N3O A;  2MPU A;  3PR4 A;  1Z1Z A;  2DGV A;  4DFM A;  1PCA A;  1D3W A;  1X4E A;  3OD2 A;  4IFD A;  3BBF A;  3H5U A;  4HH0 A;  5ETN A;  4LF7 J;  1F9H A;  2CPJ A;  3MR5 A;  1FHT A;  1NBE B;  2RU9 A;  3HVT B;  1XIQ A;  1X4H A;  5ETQ A;  4RX6 A;  1TKT B;  4NI2 A;  2ZFH A;  4AUK A;  1NSQ A;  1X31 C;  2XYG B;  3D6H B;  2UV8 A;  2YQ0 A;  4U8Y A;  1HL6 A;  1WOR A;  5D4N A;  2KB2 A;  3NAI A;  3M8S A;  1CPZ A;  1E6Y B;  4ZPV R;  4X65 E;  4BWM A;  3KUG A;  1VDH A;  1V3S A;  3GII A;  3DLH A;  4ISA A;  1Q79 A;  3NAH A;  4LBH A;  3W65 A;  4PXC A;  4OX8 A;  3IS9 B;  4LRE A;  2M4M A;  3UN3 A;  2RSQ A;  1DTT A;  2LEB A;  1S1U A;  3WBZ A;  4J9U E;  1TK5 A;  4KH1 B;  3ILO A;  3I4P A;  2M88 A;  4Y2I A;  1MX0 A;  5B0E A;  3K8W A;  3QRR A;  1TZ0 A;  2PFD A;  3Q8V A;  3RG6 A;  4LFA I;  4ZVT B;  1J5E I;  4OZJ A;  1RT5 B;  5KFL A;  1FK9 B;  2R8I A;  2BW2 A;  4FF1 A;  1D8Y A;  2DR6 A;  1PGZ A;  1JLA A;  5LJ3 Y;  3GLL A;  1Y5I B;  2CNO B;  2I2Y A;  1QE1 B;  3JTN A;  4UY8 T;  4DR7 E;  5BYS A;  2A3J A;  2X7I A;  3SYZ A;  2WVC A;  4DV6 J;  2ZD1 B;  4DUY J;  2ZOM A;  2CFX A;  4A8W A;  3W2V A;  3FBB A;  4EZ6 A;  2AYG A;  2VQF I;  5GME A;  1S1V A;  4X62 E;  3MPW A;  1JJH A;  4XAK A;  1OIA A;  3EMT A;  1FKA F;  4ZLP A;  4ZVQ B;  1RA7 A;  3R27 A;  1DAR A;  2J0S D;  4P9S A;  1NK0 A;  4TXS A;  2WNR B;  3ISZ A;  4IH7 A;  5T7L A;  4TQS A;  3F73 A;  5EHH A;  4NZ6 A;  3IBW A;  3TYT A;  3SV3 A;  1RWM B;  5ETK A;  1BHN A;  1LQ9 A;  1S1X A;  2HHS A;  2YTC A;  2N82 B;  3CCR S;  1XWL A;  4V19 X;  1AW0 A;  3V4M A;  1Q0N A;  4ED4 A;  2O1W A;  4OZ1 A;  1FTC A;  3TOQ A;  2XC9 A;  1Y0H A;  1VC0 A;  1XNQ F;  2OSR A;  2YNG B;  2DNM A;  3Q1Q A;  4ZPB A;  1OSC A;  1U8S A;  1NJY A;  3RZA A;  4LF8 F;  1RUS A;  3TAR A;  3LQV A;  5D3G A;  4OI2 A;  2BAC A;  2EW9 A;  5HQM A;  4YDD B;  3TAQ A;  4UTG A;  2B6A A;  2ZBP A;  4OFZ A;  4LF4 J;  1H2T Z;  2VFV A;  4G3I A;  1T05 B;  4KHR A;  2G1H A;  1IKX A;  5DQH A;  1NSK L;  2DGO A;  4LF9 I;  4OO1 B;  4C98 A;  3T1H F;  4DV1 J;  1VRU B;  3TZZ A;  3MD3 A;  5J1E A;  1VIO A;  5AJ3 F;  3BSN A;  4ILM A;  4K0K I;  2OD4 A;  5F8M A;  4ECY A;  4JI0 F;  3DRS B;  3M8Z A;  1HBM A;  3OXL A;  3QLH A;  2XY5 A;  4WF9 Q;  3QQC D;  1S59 A;  3FK4 A;  2KJW A;  1SUQ A;  1Z0T A;  4J9V A;  2AEF A;  4DQQ A;  3MFI A;  4DR5 F;  3QNW B;  4L72 B;  2X1A A;  2JEA A;  1MU2 B;  3DLE B;  3GCM A;  3OHA A;  1TAU A;  2RDD A;  2QLX A;  1S9F A;  4GQU A;  1Q86 T;  1JLB B;  1FVS A;  2UVR A;  1EET B;  3HJV A;  4YQW A;  1FRL A;  4K4S A;  4OYW A;  2YPY A;  3QGG A;  3K8V A;  2L9D A;  2BYC A;  2EKY A;  5GMK a;  4LFC E;  4NLT A;  5KT6 A;  2BAB A;  5LL6 R;  2VPW B;  2GVZ A;  3LW5 C;  4FPR A;  4DUZ J;  1HBO A;  3Q8U A;  1GAO A;  4K7Q A;  2PNM A;  3KLG B;  2MY7 A;  3RR7 A;  4F3O A;  3K5N A;  1FRH A;  3H2L A;  4DCJ B;  2W8L A;  4F02 A;  4ECU A;  1TFY A;  2LYV A;  2DNK A;  3NG8 A;  2V9K A;  1YDL A;  3JTO A;  4EFA C;  2WW4 A;  2AJ2 A;  3JYT A;  4WE1 A;  2F63 A;  3KJQ B;  4NAS A;  3FUY A;  3EDQ B;  4NEY A;  5B0B A;  3ZKB A;  4GO5 X;  2UUA I;  2MLX A;  3LP0 A;  2P5V A;  3TX8 A;  5IT0 A;  3NNC A;  5DG8 A;  1JNZ B;  1Q95 G;  1WKJ A;  1OJ4 A;  1VQS A;  2IRX A;  4UQG A;  3PYF A;  4JI3 I;  5DS7 A;  2E5J A;  1HQE B;  3UDV A;  1CUL B;  2NN6 D;  1SQE A;  3BB5 A;  3QWU A;  3WU3 A;  4YY3 I;  5BJR A;  3BO2 A;  3J7Y U;  1BQN B;  1UEK A;  1JLG B;  1UW4 A;  1R27 B;  3CDU A;  4ZS6 A;  1XNR J;  3J7A M;  3MHY A;  2FVQ A;  3HHL D;  1D9F A;  1M1H A;  2MGZ A;  2MKC A;  2GVD A;  2WVE A;  5CH7 B;  1SKW A;  2LEA A;  3T41 A;  4ZLN A;  4DL5 A;  2XMA A;  2QTW A;  4M8L A;  1FJG J;  1AA1 B;  2N3L A;  5C7P A;  1H2V Z;  2BA1 G;  2KVQ E;  5ELW A;  2F65 A;  1X7V A;  1U0S A;  1PG5 B;  2LA4 A;  1U6F A;  2WSE C;  3HCX A;  2J0Q D;  3UD5 A;  1N33 J;  2O66 A;  2JEG A;  5CYM A;  4Y2K A;  3NWR A;  1LK5 A;  2Z5C B;  2CXE A;  4MK8 A;  4B3M I;  2OPR B;  3U1M A;  2J76 E;  3RB0 A;  1SJQ A;  1JIH A;  1O5J A;  3LNU A;  2WZ1 A;  1TK0 A;  3ILI A;  5MAO A;  3CDB A;  3NS5 A;  1FKO B;  2Z2Y B;  1IQZ A;  4P2X A;  4ZVE A;  1XMQ I;  1TL3 B;  2GIR A;  2XMK A;  2RQC A;  3C16 A;  2MJN A;  2VUG A;  2OEJ A;  3DRP B;  3JSM A;  2NN6 E;  4USV A;  1PC4 A;  2CPX A;  3CCL S;  4X66 J;  3RBD A;  2XZD B;  1UEU A;  2UXB F;  1UWB B;  2D3O R;  3MWB A;  4ZCK A;  1P9Y A;  3QPI A;  4OO1 C;  2BJD A;  2DNN A;  4MYU A;  5D0R A;  1HNW J;  1RKI A;  4K4X A;  1RWU A;  3V4I B;  1VQ8 S;  1R0A B;  1FJE B;  3D1Q A;  2I0X A;  5EX3 A;  1RT2 B;  1NB2 A;  1GH8 A;  4KHP J;  4QYZ K;  1NHI A;  5A2Q U;  1NCL A;  2DBB A;  4P2F A;  1RHU B;  1RHM B;  4YS2 A;  1IBM E;  3SBM A;  2HNY B;  2DGW A;  4QU6 A;  4JI2 E;  4JI6 E;  3M8Q B;  5DQG A;  3LWL A;  1UDS A;  5DRQ A;  4OX9 E;  1CQM A;  1OYS A;  4DR4 J;  3DLG B;  2HHH F;  5EDW A;  1SKR A;  3PRD A;  3U1K A;  1N5V A;  3QGI A;  3H98 A;  1QAX A;  2V0N A;  4DSJ A;  3UD4 P;  4FVM A;  1CVJ A;  3QT6 A;  3N5F A;  3Q8S B;  3P49 B;  2ALY B;  5KFX A;  4DPX A;  4CTA A;  4M1K A;  3AXK A;  3T1A A;  4UT4 A;  2LFV A;  3OSP A;  4F2R A;  2KTQ A;  4OYM A;  4O4R A;  1DLO B;  4CLT A;  2NZ4 A;  3PIP Q;  1QUV A;  2R8J A;  4C7Q A;  3NY0 A;  4U8V A;  1HI1 A;  1ZBT A;  1WKK A;  2MXY A;  4DV5 I;  4DR1 E;  1R6M A;  4NLR A;  2F4V J;  2ZH4 A;  1RWO B;  3SQO P;  4IQX A;  4N56 A;  5FDL A;  2PA3 A;  2QLF B;  4NX9 A;  2BKO A;  4Q0B B;  1HNZ F;  5A0Y B;  4JI8 I;  5KFS A;  1RBA A;  3W2W A;  4YB6 A;  4Q8E A;  3D7S B;  3HSG A;  4WUD A;  4JI4 J;  2D3O 1;  5IQQ A;  5HJY A;  1S7I A;  3ET6 B;  2D41 A;  4A4J A;  3KMQ A;  2FZK B;  2ZBI A;  3FRZ A;  1U6Z A;  2D9P A;  3DLB A;  4IG3 B;  1MWZ A;  1HK7 A;  1V3Z A;  2KT5 A;  4A8S A;  5JXS A;  2HFV A;  3MED B;  2HFU A;  2ZH5 A;  2XMU A;  2IVM A;  3ENV A;  4DX5 A;  5DDP C;  2YBV A;  3WHI A;  2IOQ A;  4K0K J;  3TJ9 A;  5KFW A;  1RE1 B;  4JI5 J;  4UY8 5;  1DBD A;  3MM5 B;  4KRW A;  3DMJ A;  5LMU I;  4DV3 I;  1IXK A;  3H1C A;  3G6E S;  4DPY A;  2HND B;  5H9F K;  4ZMM A;  2GNK A;  3BGL A;  4LR7 A;  1D8Z A;  4B3R E;  4CYU A;  2HLT A;  2GAH C;  2HHT A;  1YHC A;  4NEZ A;  5KFG A;  1JJC B;  2VC1 A;  3D4J A;  2FVP A;  2GX8 A;  2IDE A;  4DQP A;  2Q3P A;  3FEX B;  4MTP A;  4LBP A;  2BE2 B;  3BGF A;  4JV5 I;  4G1P A;  1PBA A;  5HP1 B;  1VC5 A;  3VAM A;  1WG4 A;  5I3U B;  2BAN A;  2DRA A;  3TZX A;  3G8T A;  3PYD A;  4JYA E;  4IUF A;  3ZTR A;  2FGO A;  1QDU B;  2HMI B;  5A8W A;  3D6T B;  2HHX A;  2R7X A;  1Q8B A;  4KQV A;  3IRW P;  4URG A;  2QFJ A;  1B70 B;  1WG1 A;  2C2M B;  1K44 A;  4Z2X A;  2GO4 A;  2ACY A;  4QW9 A;  1CSJ A;  1SKS A;  5DET A;  4F0H A;  2VPZ B;  2XBP A;  2CQP A;  1VBZ A;  4MT1 A;  2UXC J;  2XHW A;  5K8P A;  5HMX A;  1FCA A;  4KY3 A;  3D9B A;  4LSL A;  1NSP A;  2CPY A;  3EJM A;  2XEX A;  3UDL A;  2E5L J;  4QJV A;  4JI1 F;  2YWE A;  2DIV A;  4YR0 A;  4YME A;  4MIA A;  5G0R B;  2A2D A;  2H5I B;  3S1T A;  4C0B A;  2CPH A;  2E5I A;  4CI0 B;  4HAC A;  3HVT A;  5DNL A;  5K8N A;  1S6Q A;  3CSK A;  2MDA A;  4GO7 X;  5IWA I;  2H4Y B;  4YUD A;  2V94 A;  4OZL A;  1IR2 A;  1SQG A;  1R6Y A;  3P6Y C;  5LL6 d;  4I67 A;  5IOL A;  3ZTP A;  4WP3 A;  3SSQ A;  1L3U A;  2MQP A;  3CCZ A;  3B6B A;  2X1B A;  1SCJ B;  4IKA A;  2HNZ B;  3GQC A;  2B4O A;  1U1P A;  2X3G A;  2ZIT A;  3P3G A;  4J9P A;  2JLE A;  5L1K A;  2KXH A;  4NXN J;  4ZPT R;  4DSK A;  4DLE A;  2CDQ A;  4LF7 E;  3OTE A;  3FSX A;  3HMJ G;  1X9W A;  2UXD J;  3K85 A;  2DCL A;  2B9X A;  3GCW P;  3IRX A;  2VG7 A;  1T94 A;  4DV2 F;  3CWJ A;  2IC3 A;  3AA8 A;  1Y7P A;  4A8K A;  1N0V C;  1FK9 A;  4KSE B;  2B56 A;  2MQM A;  1TVR B;  3MDF A;  3H0P A;  4OYB A;  1FFW B;  2P6T A;  3I9V 9;  2M7S A;  4A46 A;  3MM7 A;  2Z2L A;  1S72 S;  2G13 A;  2HFZ A;  4DR2 F;  2UU9 J;  4QU7 A;  4IZJ D;  4C8O A;  3VGV A;  1IBL J;  1WTF A;  1RT4 A;  3OVA A;  4ANC A;  4F8R A;  2VB6 A;  4M5N A;  1MRO A;  1REG X;  5JJB A;  4FW3 A;  2J9D A;  4LCG A;  4GKK I;  2FGC A;  2V50 A;  1VOM A;  3P45 B;  5IV3 A;  1HMV B;  1XMQ J;  2FY1 A;  2BR2 B;  4NMX A;  2HSE B;  4EBE A;  1RAG B;  4WFY A;  4OV6 A;  1H2U X;  2YX7 A;  3GTY X;  4WZQ A;  2WNR A;  2X51 A;  5A8R A;  2XMT A;  2VU5 A;  2VKZ G;  4ECR A;  3Q23 A;  2BEF A;  4S0M A;  2J6U A;  2KI2 A;  1S6P A;  2Y9H A;  2VJU A;  3R5G A;  4LF6 J;  2HG4 A;  3LPS A;  4X64 J;  2WP8 B;  1M0S A;  4AD6 A;  1JXV A;  4DUY E;  4M5J A;  1C1C B;  2RS2 A;  2B9E A;  2CVI A;  4QYR A;  4DV0 J;  2HZC A;  4J9M A;  4K4Y A;  2UVW A;  2PO2 B;  2HGN A;  1B7F A;  3E2E A;  1WD6 A;  1IKY A;  1WF2 A;  2KYZ A;  1HNX I;  1WHW A;  2P9E A;  3R5J B;  1S6U A;  2YNG A;  1HHT P;  2RDJ A;  2LEC A;  3R5C A;  3GU0 A;  4URL A;  1GXU A;  2ZC4 A;  2D7S A;  2DVI A;  2RQM A;  3WZ0 A;  1RTZ A;  2VV5 A;  2FHJ D;  4X4S A;  3P06 A;  4OYO A;  1F5B A;  4G1Q A;  4MQY A;  2QLJ B;  5F0W A;  3OR1 B;  4OHW A;  3UN2 A;  4CLP A;  2E7W A;  3I0S A;  2WCX A;  5J2Q B;  5IV4 A;  2XCA A;  2CZ4 A;  4FWG A;  2WOM A;  5IC4 B;  3TEH B;  2BE9 B;  3K2Y A;  1YG0 A;  1K0T A;  1AFI A;  1WEX A;  2RS8 A;  2LXU A;  3GIR A;  1J5O A;  3OUY B;  1XTZ A;  2DT9 A;  4U95 A;  4YR3 A;  3P96