2Z5EA

Crystal structure of proteasome assembling chaperone 3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
122
structure length
122
Chain Sequence
MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Proteasome Assembling Chaperone 3
total genus 29
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10178 PAC3 Proteasome assembly chaperone 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5eA00
2Z5BB 2Z5CB 2Z5EA
chains in the Genus database with same CATH superfamily
2UUBI 1NHHA 4LCHA 1Y5YA 3J80C 5JEAA 4B3TI 1J5EI 2E5LE 4ISAA 2R3VA 2VESA 4WUDA 2NPFA 2UXBE 1MX0A 3ZZ0A 3CWVA 5K36F 4FW4A 4OX9E 2C37A 5DRPA 4GKJE 3J81Q 2UUBE 3M7ND 1N33I 1N32E 3J80Q 1XXEA 1ZM4A 3PYFA 4LF8E 4J3DA 4NXNE 4DR3I 1HR0I 5FLXC 4X64E 4U3BA 3T1HE 4NBQA 4HY1A 5GMEA 1N36E 1XNQI 2CGEA 3PYGA 5BR8I 2VQFI 5LL6R 4MYUA 5LMNE 2BA1D 2PO1A 1N0VC 4YY3E 2OI2A 4JI5E 1P42A 3K1JA 5C0XE 2A2DA 1HNXI 3Q6MA 2WNRB 2E1RA 4AM3A 4DR3E 4LF9E 1HNWE 3HKMA 1U2RA 3CDIA 3ZM7A 4OO1F 2PO2B 1OYPA 1YHCA 1Z0WA 5JEAF 2PO0A 2UU9E 4BA2B 4JV5E 1Z0VA 4FWHA 4OX9I 4AIMA 2GS8A 3LTOA 5C0XC 2JEBB 2V34A 2XEXA 2UUAI 3ZKDA 4JI0E 5DRRA 4MDTA 3DD6A 1OYSA 1BKNA 2PNMA 4JI1E 1ELOA 4QNKA 4LF6I 3P3EA 4DR5I 1FKAE 5LMUI 1DARA 3PRYA 2ZITA 1VI7A 4DV3I 1N0UA 1ZM3A 3QT6A 4DR7E 2J7KA 4B3ME 4DU8A 1MG7A 2GO3A 4LFAI 1H7UA 4JI7E 5C0XA 4LF7E 3OTOI 4X62I 4DR1I 4PU9A 4JV5I 3PS3A 4DV2E 2O1VA 1RREA 5K36E 2UUCI 3U1YA 4KHPI 5ELWA 1IBLE 4IZJB 4FN5A 1Z0EA 4DU7A 2WW4A 2CVEA 5L3JA 1XMOI 2Z5CB 2F4VI 1RHYA 2C39B 1IBKI 4LCFA 4LF5E 1VISA 4DV6E 2BR2B 1XMOE 2JEAA 1E3PA 1UDQA 2JEAB 3ZZTA 5DNLA 2BV3A 5DROA 2VQEI 4LFCI 1I94E 3M85D 5LMUE 3GMEA 4ZVIA 4JI3I 4JI2E 5JEAB 4FW9A 4GKJI 3K17A 3M6AA 4P52A 1QZRA 3HULA 5IWAI 1FWKA 4DV7E 3WU4A 4YHHE 3OTOE 2NN6E 2UUCE 4DPYA 4LFBI 1KTVA 4PRVA 4DR4E 1HNXE 2VQEE 2Z5BB 2NN6F 4JG4A 2V2QA 4DV6I 4DR2I 4KQVA 4IZKB 4K0KE 4GKKI 5K36C 4DR5E 4IZJD 2DEIA 5A2QQ 2Z5CA 1B62A 4HXZA 1Z59A 2X7IA 3JAMQ 2CG9A 2BA0G 3J81C 4DV4I 5LMNI 5JEAC 2UXDI 4OO1E 1D6TA 4DV2I 3H1CA 2A2CA 3HJCA 2J65A 2AE8A 2V2VA 2JE6B 2WP8B 5DRQA 4M1KA 1I94I 4LFCE 4HACA 4USMA 1IBME 4BA1B 3LPSA 1XMQE 4MQYA 3WU6A 5C0XF 1Z0BA 4MYTA 3PS2A 2O1WA 2V8PA 4DV5E 1Z5AA 3T1HI 1XNQE 2EFGA 1H74A 3UHMA 2O1UA 2C38B 4JI8E 3QT5A 4FWGA 4JI0I 2VQFE 4K0KI 4KHPE 1IBKE 2PNLA 1N33E 4LFBE 1ZXNA 2GO4A 1N34I 1USVA 4X62E 1ZM2A 2BM0A 2AJ4A 4BA2A 2Q2EB 1NZ0A 4LF4I 4HACB 1N32I 3WU5A 1RR9A 3PS1A 1B63A 3ZZUA 4DR1E 1HNZI 2BA1G 2JE6A 4DR7I 2Z5BA 4UT4A 4ED4A 3QT7A 4RPFA 4Z7CA 4DUYE 4WUCA 1N36I 3L7ZB 3GLLA 3H4LA 4I3HA 5K36D 5GMDA 1Z0TA 4DV1I 4DUZE 4PRXA 1HR0E 1Z0GA 1S16A 1ZM9A 4XTJA 4X66E 2DEJA 4OO1B 4NXME 1S4EA 3PYEA 1IBMI 3M7NG 1Y4UA 5C0XB 3B8HA 5K36A 4B3SE 1Y4SA 2CZ9A 4WUBA 5FWKA 4LF8I 2WNRA 4IS9A 4IFDC 1K47A 2UXBI 1KVKA 2C37B 1Y60A 4IFDE 1H72C 4DPXA 2VF3A 4URLA 4OZEA 4Z7YA 4JI2I 4JI3E 2GQ0A 2HK2A 4YY3I 4JI5I 4LF9I 4P7AA 2IOQA 4LFAE 4JI6I 4JI8I 3U1KA 4JYAE 4LF6E 1YH8A 4B3TE 3J7AM 2BR2A 4OO1C 1OJ4A 4DV3E 1FNMA 2LJPA 4LF5I 4FWDA 1E3HA 1Z5CA 3P3CA 3JAMC 3LNUA 1FJGE 1Z0CA 4B3RE 5A2QC 5IT9C 1XMQI 4IFDB 5K36B 2BM1A 4FW6A 3QT8A 1EI1A 4DXLA 2UXCE 2HKEA 4UTGA 1MU5A 1UDNA 3K85A 3PYDA 1A6FA 1HNWI 4LPFA 4MU1A 3GONA 1KKHA 3Q1QA 3J7AG 3P06A 1FWLA 1WUUA 3P76A 4DPTA 2HFSA 3NZKA 2NN6C 4LCGA 2IOPA 2BA0D 4DV4E 3P3GA 3B78A 4X65E 3T1YE 4IZKA 5IT9Q 3B82A 5JEAE 1NHIA 3L7ZA 3Q6NA 2PNZB 3GCMA 4DV0I 1PIEA 1HK7A 1N34E 5EKWA 1R6LA 4MU3A 1ZXMA 2ZBKB 4AIDA 2F4VE 5EL9A 1FJGI 2PO1B 4OKGA 5DNXA 2ZM6I 4DR6E 1R6MA 4JI1I 4X64I 2C38A 1IBLI 1H7SA 4DR6I 3ZKBA 5C0XD 4JI6E 3D4JA 1USUA 5FLXQ 4DR2E 4YHHI 2HK3A 1J5EE 2PO0B 2E5LI 1XNRI 2PO2A 2NN6A 2UU9I 2NN6B 4DR4I 1KIJA 4BA1A 2JEBA 2WP8A 2C39A 4FW3A 4MU0A 2X36A 2IESA 1PKPA 4DPUA 4B3SI 4IFDD 2UXCI 2NN6D 2R42A 4R1FA 1EA6A 4JI4E 4NXMI 3V2UC 1OYRA 5BR8E 2HHHE 2UXDE 1UDSA 4JI4I 2IERA 2O3ZA 4IFDA 1XHKA 2ZM6E 1NHJA 4MU4A 4EMDA 2UUAE 2HKJA 4NXNI 4FW7A 4X66I 4DUYI 3T1YI 4OO1A 3WU3A 2O1TA 4AQYE 4GKKE 1Y6ZA 3B4TA 4LOMA 1H73A 4N3OA 4DV1E 4IFDF 4DV0E 1UDOA 1FI4A 4GQUA 1HNZE 1XNRE 4FW5A 2HFUA 3V5RA 2JT2A 4AQYI 4OO1D 1Z5BA 4HYMA 4B3MI 3M85G 1PVGA 4DV7I 1UEKA 2F1DA 4U3DA 5IWAE 3KRNA 3F0NA 3CDJA 4IZJA 4QNJA 4LF7I 4USKA 4JI7I 4LF4E 2Z5EA 4DPWA 4DUZI 5JEAD 2V2ZA 4DV5I 2PNZA 4B3RI 4JYAI 2HHHI 4X65I
chains in the Genus database with same CATH topology
2UUBI 1NHHA 3J80C 4B3TI 1J5EI 2E5LE 2R3VA 4WUDA 2NPFA 2UXBE 1MX0A 3ZZ0A 3CWVA 4OX9E 4GKJE 3J81Q 2UUBE 1N33I 1N32E 3J80Q 1ZM4A 3PYFA 4LF8E 4NXNE 4DR3I 1HR0I 5FLXC 4X64E 3T1HE 1XNQI 4HY1A 5GMEA 1N36E 2CGEA 3PYGA 5BR8I 2VQFI 5LL6R 4MYUA 5LMNE 1N0VC 4YY3E 2OI2A 4JI5E 3K1JA 2A2DA 1HNXI 3Q6MA 2E1RA 4DR3E 4LF9E 1HNWE 1U2RA 3ZM7A 1Z0WA 2UU9E 4JV5E 1Z0VA 4FWHA 4OX9I 2GS8A 3LTOA 2V34A 2XEXA 2UUAI 3ZKDA 4JI0E 4JI1E 1BKNA 2PNMA 1ELOA 4LF6I 4DR5I 1FKAE 5LMUI 1DARA 3PRYA 2ZITA 4DV3I 1N0UA 1ZM3A 3QT6A 4DR7E 2J7KA 4B3ME 4DU8A 1MG7A 4LFAI 1H7UA 4JI7E 4LF7E 3OTOI 4X62I 4DR1I 4PU9A 4JV5I 4DV2E 2O1VA 1RREA 2UUCI 4KHPI 1IBLE 4IZJB 4FN5A 1Z0EA 4DU7A 2WW4A 5L3JA 1XMOI 2Z5CB 2F4VI 1IBKI 4LF5E 1VISA 4DV6E 1XMOE 3ZZTA 2BV3A 2VQEI 4LFCI 1I94E 5LMUE 4ZVIA 4JI3I 4JI2E 4FW9A 4GKJI 3K17A 3M6AA 4P52A 1QZRA 3HULA 5IWAI 1FWKA 4DV7E 3WU4A 4YHHE 3OTOE 2UUCE 4DPYA 4LFBI 1KTVA 4PRVA 4DR4E 1HNXE 2VQEE 2Z5BB 4JG4A 2V2QA 4DV6I 4DR2I 4KQVA 4IZKB 4K0KE 4GKKI 4DR5E 4IZJD 2DEIA 5A2QQ 2Z5CA 1B62A 4HXZA 1Z59A 2X7IA 3JAMQ 2CG9A 3J81C 4DV4I 5LMNI 2UXDI 1D6TA 4DV2I 2A2CA 3HJCA 2V2VA 4M1KA 1I94I 4LFCE 4HACA 4USMA 1IBME 3LPSA 1XMQE 3WU6A 1Z0BA 4MYTA 2O1WA 2V8PA 4DV5E 1Z5AA 3T1HI 1XNQE 2EFGA 1H74A 2O1UA 4JI8E 3QT5A 4FWGA 4JI0I 2VQFE 4K0KI 4KHPE 1IBKE 2PNLA 1N33E 4LFBE 1ZXNA 1N34I 1USVA 4X62E 1ZM2A 2BM0A 2AJ4A 2Q2EB 1NZ0A 4LF4I 4HACB 1N32I 3WU5A 1RR9A 1B63A 3ZZUA 4DR1E 1HNZI 4DR7I 2Z5BA 4UT4A 4ED4A 3QT7A 4RPFA 4Z7CA 4DUYE 4WUCA 1N36I 3H4LA 4I3HA 5GMDA 1Z0TA 4DV1I 4DUZE 4PRXA 1HR0E 1Z0GA 1S16A 1ZM9A 4XTJA 4X66E 2DEJA 4NXME 1S4EA 3PYEA 1IBMI 1Y4UA 3B8HA 4B3SE 1Y4SA 2CZ9A 4WUBA 5FWKA 4LF8I 1K47A 2UXBI 1KVKA 1H72C 4DPXA 2VF3A 4URLA 4Z7YA 4JI2I 4JI3E 2GQ0A 2HK2A 4YY3I 4JI5I 4LF9I 4P7AA 2IOQA 4LFAE 4JI6I 4JI8I 4JYAE 4LF6E 4B3TE 3J7AM 1OJ4A 4DV3E 1FNMA 2LJPA 4LF5I 4FWDA 1Z5CA 3JAMC 3LNUA 1FJGE 1Z0CA 4B3RE 5A2QC 5IT9C 1XMQI 2BM1A 3QT8A 1EI1A 4DXLA 2UXCE 2HKEA 4UTGA 1MU5A 3PYDA 3K85A 1A6FA 1HNWI 3GONA 1KKHA 3Q1QA 3J7AG 3P06A 1FWLA 1WUUA 4DPTA 2HFSA 2IOPA 4DV4E 3B78A 4X65E 3T1YE 4IZKA 5IT9Q 3B82A 1NHIA 3Q6NA 4DV0I 1PIEA 1HK7A 1N34E 1ZXMA 2ZBKB 2F4VE 1FJGI 2ZM6I 4DR6E 4JI1I 4X64I 1IBLI 1H7SA 4DR6I 3ZKBA 4JI6E 3D4JA 1USUA 5FLXQ 4DR2E 4YHHI 2HK3A 1J5EE 2E5LI 1XNRI 2UU9I 4DR4I 1KIJA 4DPUA 2X36A 4B3SI 1PKPA 2UXCI 2R42A 4R1FA 1EA6A 4JI4E 4NXMI 3V2UC 5BR8E 2HHHE 2UXDE 4JI4I 1XHKA 2ZM6E 1NHJA 4EMDA 2UUAE 2HKJA 4NXNI 4X66I 4DUYI 3T1YI 3WU3A 2O1TA 4AQYE 4GKKE 1Y6ZA 1H73A 4N3OA 4DV1E 4DV0E 1FI4A 1HNZE 1XNRE 2HFUA 3V5RA 4AQYI 1Z5BA 4HYMA 4B3MI 1PVGA 4DV7I 1UEKA 5IWAE 3F0NA 4IZJA 4LF7I 4USKA 4JI7I 4LF4E 2Z5EA 4DPWA 4DUZI 2V2ZA 4DV5I 4B3RI 4JYAI 2HHHI 4X65I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B B;  2Z5C B;  2Z5E A; 
#chains in the Genus database with same CATH topology
 2UUB I;  1NHH A;  4LCH A;  1Y5Y A;  3J80 C;  5JEA A;  4B3T I;  1J5E I;  2E5L E;  4ISA A;  2R3V A;  2VES A;  4WUD A;  2NPF A;  2UXB E;  1MX0 A;  3ZZ0 A;  3CWV A;  5K36 F;  4FW4 A;  4OX9 E;  2C37 A;  5DRP A;  4GKJ E;  3J81 Q;  2UUB E;  3M7N D;  1N33 I;  1N32 E;  3J80 Q;  1XXE A;  1ZM4 A;  3PYF A;  4LF8 E;  4J3D A;  4NXN E;  4DR3 I;  1HR0 I;  5FLX C;  4X64 E;  4U3B A;  3T1H E;  4NBQ A;  4HY1 A;  5GME A;  1N36 E;  1XNQ I;  2CGE A;  3PYG A;  5BR8 I;  2VQF I;  5LL6 R;  4MYU A;  5LMN E;  2BA1 D;  2PO1 A;  1N0V C;  4YY3 E;  2OI2 A;  4JI5 E;  1P42 A;  3K1J A;  5C0X E;  2A2D A;  1HNX I;  3Q6M A;  2WNR B;  2E1R A;  4AM3 A;  4DR3 E;  4LF9 E;  1HNW E;  3HKM A;  1U2R A;  3CDI A;  3ZM7 A;  4OO1 F;  2PO2 B;  1OYP A;  1YHC A;  1Z0W A;  5JEA F;  2PO0 A;  2UU9 E;  4BA2 B;  4JV5 E;  1Z0V A;  4FWH A;  4OX9 I;  4AIM A;  2GS8 A;  3LTO A;  5C0X C;  2JEB B;  2V34 A;  2XEX A;  2UUA I;  3ZKD A;  4JI0 E;  5DRR A;  4MDT A;  3DD6 A;  1OYS A;  1BKN A;  2PNM A;  4JI1 E;  1ELO A;  4QNK A;  4LF6 I;  3P3E A;  4DR5 I;  1FKA E;  5LMU I;  1DAR A;  3PRY A;  2ZIT A;  1VI7 A;  4DV3 I;  1N0U A;  1ZM3 A;  3QT6 A;  4DR7 E;  2J7K A;  4B3M E;  4DU8 A;  1MG7 A;  2GO3 A;  4LFA I;  1H7U A;  4JI7 E;  5C0X A;  4LF7 E;  3OTO I;  4X62 I;  4DR1 I;  4PU9 A;  4JV5 I;  3PS3 A;  4DV2 E;  2O1V A;  1RRE A;  5K36 E;  2UUC I;  3U1Y A;  4KHP I;  5ELW A;  1IBL E;  4IZJ B;  4FN5 A;  1Z0E A;  4DU7 A;  2WW4 A;  2CVE A;  5L3J A;  1XMO I;  2Z5C B;  2F4V I;  1RHY A;  2C39 B;  1IBK I;  4LCF A;  4LF5 E;  1VIS A;  4DV6 E;  2BR2 B;  1XMO E;  2JEA A;  1E3P A;  1UDQ A;  2JEA B;  3ZZT A;  5DNL A;  2BV3 A;  5DRO A;  2VQE I;  4LFC I;  1I94 E;  3M85 D;  5LMU E;  3GME A;  4ZVI A;  4JI3 I;  4JI2 E;  5JEA B;  4FW9 A;  4GKJ I;  3K17 A;  3M6A A;  4P52 A;  1QZR A;  3HUL A;  5IWA I;  1FWK A;  4DV7 E;  3WU4 A;  4YHH E;  3OTO E;  2NN6 E;  2UUC E;  4DPY A;  4LFB I;  1KTV A;  4PRV A;  4DR4 E;  1HNX E;  2VQE E;  2Z5B B;  2NN6 F;  4JG4 A;  2V2Q A;  4DV6 I;  4DR2 I;  4KQV A;  4IZK B;  4K0K E;  4GKK I;  5K36 C;  4DR5 E;  4IZJ D;  2DEI A;  5A2Q Q;  2Z5C A;  1B62 A;  4HXZ A;  1Z59 A;  2X7I A;  3JAM Q;  2CG9 A;  2BA0 G;  3J81 C;  4DV4 I;  5LMN I;  5JEA C;  2UXD I;  4OO1 E;  1D6T A;  4DV2 I;  3H1C A;  2A2C A;  3HJC A;  2J65 A;  2AE8 A;  2V2V A;  2JE6 B;  2WP8 B;  5DRQ A;  4M1K A;  1I94 I;  4LFC E;  4HAC A;  4USM A;  1IBM E;  4BA1 B;  3LPS A;  1XMQ E;  4MQY A;  3WU6 A;  5C0X F;  1Z0B A;  4MYT A;  3PS2 A;  2O1W A;  2V8P A;  4DV5 E;  1Z5A A;  3T1H I;  1XNQ E;  2EFG A;  1H74 A;  3UHM A;  2O1U A;  2C38 B;  4JI8 E;  3QT5 A;  4FWG A;  4JI0 I;  2VQF E;  4K0K I;  4KHP E;  1IBK E;  2PNL A;  1N33 E;  4LFB E;  1ZXN A;  2GO4 A;  1N34 I;  1USV A;  4X62 E;  1ZM2 A;  2BM0 A;  2AJ4 A;  4BA2 A;  2Q2E B;  1NZ0 A;  4LF4 I;  4HAC B;  1N32 I;  3WU5 A;  1RR9 A;  3PS1 A;  1B63 A;  3ZZU A;  4DR1 E;  1HNZ I;  2BA1 G;  2JE6 A;  4DR7 I;  2Z5B A;  4UT4 A;  4ED4 A;  3QT7 A;  4RPF A;  4Z7C A;  4DUY E;  4WUC A;  1N36 I;  3L7Z B;  3GLL A;  3H4L A;  4I3H A;  5K36 D;  5GMD A;  1Z0T A;  4DV1 I;  4DUZ E;  4PRX A;  1HR0 E;  1Z0G A;  1S16 A;  1ZM9 A;  4XTJ A;  4X66 E;  2DEJ A;  4OO1 B;  4NXM E;  1S4E A;  3PYE A;  1IBM I;  3M7N G;  1Y4U A;  5C0X B;  3B8H A;  5K36 A;  4B3S E;  1Y4S A;  2CZ9 A;  4WUB A;  5FWK A;  4LF8 I;  2WNR A;  4IS9 A;  4IFD C;  1K47 A;  2UXB I;  1KVK A;  2C37 B;  1Y60 A;  4IFD E;  1H72 C;  4DPX A;  2VF3 A;  4URL A;  4OZE A;  4Z7Y A;  4JI2 I;  4JI3 E;  2GQ0 A;  2HK2 A;  4YY3 I;  4JI5 I;  4LF9 I;  4P7A A;  2IOQ A;  4LFA E;  4JI6 I;  4JI8 I;  3U1K A;  4JYA E;  4LF6 E;  1YH8 A;  4B3T E;  3J7A M;  2BR2 A;  4OO1 C;  1OJ4 A;  4DV3 E;  1FNM A;  2LJP A;  4LF5 I;  4FWD A;  1E3H A;  1Z5C A;  3P3C A;  3JAM C;  3LNU A;  1FJG E;  1Z0C A;  4B3R E;  5A2Q C;  5IT9 C;  1XMQ I;  4IFD B;  5K36 B;  2BM1 A;  4FW6 A;  3QT8 A;  1EI1 A;  4DXL A;  2UXC E;  2HKE A;  4UTG A;  1MU5 A;  1UDN A;  3K85 A;  3PYD A;  1A6F A;  1HNW I;  4LPF A;  4MU1 A;  3GON A;  1KKH A;  3Q1Q A;  3J7A G;  3P06 A;  1FWL A;  1WUU A;  3P76 A;  4DPT A;  2HFS A;  3NZK A;  2NN6 C;  4LCG A;  2IOP A;  2BA0 D;  4DV4 E;  3P3G A;  3B78 A;  4X65 E;  3T1Y E;  4IZK A;  5IT9 Q;  3B82 A;  5JEA E;  1NHI A;  3L7Z A;  3Q6N A;  2PNZ B;  3GCM A;  4DV0 I;  1PIE A;  1HK7 A;  1N34 E;  5EKW A;  1R6L A;  4MU3 A;  1ZXM A;  2ZBK B;  4AID A;  2F4V E;  5EL9 A;  1FJG I;  2PO1 B;  4OKG A;  5DNX A;  2ZM6 I;  4DR6 E;  1R6M A;  4JI1 I;  4X64 I;  2C38 A;  1IBL I;  1H7S A;  4DR6 I;  3ZKB A;  5C0X D;  4JI6 E;  3D4J A;  1USU A;  5FLX Q;  4DR2 E;  4YHH I;  2HK3 A;  1J5E E;  2PO0 B;  2E5L I;  1XNR I;  2PO2 A;  2NN6 A;  2UU9 I;  2NN6 B;  4DR4 I;  1KIJ A;  4BA1 A;  2JEB A;  2WP8 A;  2C39 A;  4FW3 A;  4MU0 A;  2X36 A;  2IES A;  1PKP A;  4DPU A;  4B3S I;  4IFD D;  2UXC I;  2NN6 D;  2R42 A;  4R1F A;  1EA6 A;  4JI4 E;  4NXM I;  3V2U C;  1OYR A;  5BR8 E;  2HHH E;  2UXD E;  1UDS A;  4JI4 I;  2IER A;  2O3Z A;  4IFD A;  1XHK A;  2ZM6 E;  1NHJ A;  4MU4 A;  4EMD A;  2UUA E;  2HKJ A;  4NXN I;  4FW7 A;  4X66 I;  4DUY I;  3T1Y I;  4OO1 A;  3WU3 A;  2O1T A;  4AQY E;  4GKK E;  1Y6Z A;  3B4T A;  4LOM A;  1H73 A;  4N3O A;  4DV1 E;  4IFD F;  4DV0 E;  1UDO A;  1FI4 A;  4GQU A;  1HNZ E;  1XNR E;  4FW5 A;  2HFU A;  3V5R A;  2JT2 A;  4AQY I;  4OO1 D;  1Z5B A;  4HYM A;  4B3M I;  3M85 G;  1PVG A;  4DV7 I;  1UEK A;  2F1D A;  4U3D A;  5IWA E;  3KRN A;  3F0N A;  3CDJ A;  4IZJ A;  4QNJ A;  4LF7 I;  4USK A;  4JI7 I;  4LF4 E;  2Z5E A;  4DPW A;  4DUZ I;  5JEA D;  2V2Z A;  4DV5 I;  2PNZ A;  4B3R I;  4JYA I;  2HHH I;  4X65 I; 
#chains in the Genus database with same CATH homology
 2UUB I;  1NHH A;  3J80 C;  4B3T I;  1J5E I;  2E5L E;  2R3V A;  4WUD A;  2NPF A;  2UXB E;  1MX0 A;  3ZZ0 A;  3CWV A;  4OX9 E;  4GKJ E;  3J81 Q;  2UUB E;  1N33 I;  1N32 E;  3J80 Q;  1ZM4 A;  3PYF A;  4LF8 E;  4NXN E;  4DR3 I;  1HR0 I;  5FLX C;  4X64 E;  3T1H E;  1XNQ I;  4HY1 A;  5GME A;  1N36 E;  2CGE A;  3PYG A;  5BR8 I;  2VQF I;  5LL6 R;  4MYU A;  5LMN E;  1N0V C;  4YY3 E;  2OI2 A;  4JI5 E;  3K1J A;  2A2D A;  1HNX I;  3Q6M A;  2E1R A;  4DR3 E;  4LF9 E;  1HNW E;  1U2R A;  3ZM7 A;  1Z0W A;  2UU9 E;  4JV5 E;  1Z0V A;  4FWH A;  4OX9 I;  2GS8 A;  3LTO A;  2V34 A;  2XEX A;  2UUA I;  3ZKD A;  4JI0 E;  4JI1 E;  1BKN A;  2PNM A;  1ELO A;  4LF6 I;  4DR5 I;  1FKA E;  5LMU I;  1DAR A;  3PRY A;  2ZIT A;  4DV3 I;  1N0U A;  1ZM3 A;  3QT6 A;  4DR7 E;  2J7K A;  4B3M E;  4DU8 A;  1MG7 A;  4LFA I;  1H7U A;  4JI7 E;  4LF7 E;  3OTO I;  4X62 I;  4DR1 I;  4PU9 A;  4JV5 I;  4DV2 E;  2O1V A;  1RRE A;  2UUC I;  4KHP I;  1IBL E;  4IZJ B;  4FN5 A;  1Z0E A;  4DU7 A;  2WW4 A;  5L3J A;  1XMO I;  2Z5C B;  2F4V I;  1IBK I;  4LF5 E;  1VIS A;  4DV6 E;  1XMO E;  3ZZT A;  2BV3 A;  2VQE I;  4LFC I;  1I94 E;  5LMU E;  4ZVI A;  4JI3 I;  4JI2 E;  4FW9 A;  4GKJ I;  3K17 A;  3M6A A;  4P52 A;  1QZR A;  3HUL A;  5IWA I;  1FWK A;  4DV7 E;  3WU4 A;  4YHH E;  3OTO E;  2UUC E;  4DPY A;  4LFB I;  1KTV A;  4PRV A;  4DR4 E;  1HNX E;  2VQE E;  2Z5B B;  4JG4 A;  2V2Q A;  4DV6 I;  4DR2 I;  4KQV A;  4IZK B;  4K0K E;  4GKK I;  4DR5 E;  4IZJ D;  2DEI A;  5A2Q Q;  2Z5C A;  1B62 A;  4HXZ A;  1Z59 A;  2X7I A;  3JAM Q;  2CG9 A;  3J81 C;  4DV4 I;  5LMN I;  2UXD I;  1D6T A;  4DV2 I;  2A2C A;  3HJC A;  2V2V A;  4M1K A;  1I94 I;  4LFC E;  4HAC A;  4USM A;  1IBM E;  3LPS A;  1XMQ E;  3WU6 A;  1Z0B A;  4MYT A;  2O1W A;  2V8P A;  4DV5 E;  1Z5A A;  3T1H I;  1XNQ E;  2EFG A;  1H74 A;  2O1U A;  4JI8 E;  3QT5 A;  4FWG A;  4JI0 I;  2VQF E;  4K0K I;  4KHP E;  1IBK E;  2PNL A;  1N33 E;  4LFB E;  1ZXN A;  1N34 I;  1USV A;  4X62 E;  1ZM2 A;  2BM0 A;  2AJ4 A;  2Q2E B;  1NZ0 A;  4LF4 I;  4HAC B;  1N32 I;  3WU5 A;  1RR9 A;  1B63 A;  3ZZU A;  4DR1 E;  1HNZ I;  4DR7 I;  2Z5B A;  4UT4 A;  4ED4 A;  3QT7 A;  4RPF A;  4Z7C A;  4DUY E;  4WUC A;  1N36 I;  3H4L A;  4I3H A;  5GMD A;  1Z0T A;  4DV1 I;  4DUZ E;  4PRX A;  1HR0 E;  1Z0G A;  1S16 A;  1ZM9 A;  4XTJ A;  4X66 E;  2DEJ A;  4NXM E;  1S4E A;  3PYE A;  1IBM I;  1Y4U A;  3B8H A;  4B3S E;  1Y4S A;  2CZ9 A;  4WUB A;  5FWK A;  4LF8 I;  1K47 A;  2UXB I;  1KVK A;  1H72 C;  4DPX A;  2VF3 A;  4URL A;  4Z7Y A;  4JI2 I;  4JI3 E;  2GQ0 A;  2HK2 A;  4YY3 I;  4JI5 I;  4LF9 I;  4P7A A;  2IOQ A;  4LFA E;  4JI6 I;  4JI8 I;  4JYA E;  4LF6 E;  4B3T E;  3J7A M;  1OJ4 A;  4DV3 E;  1FNM A;  2LJP A;  4LF5 I;  4FWD A;  1Z5C A;  3JAM C;  3LNU A;  1FJG E;  1Z0C A;  4B3R E;  5A2Q C;  5IT9 C;  1XMQ I;  2BM1 A;  3QT8 A;  1EI1 A;  4DXL A;  2UXC E;  2HKE A;  4UTG A;  1MU5 A;  3PYD A;  3K85 A;  1A6F A;  1HNW I;  3GON A;  1KKH A;  3Q1Q A;  3J7A G;  3P06 A;  1FWL A;  1WUU A;  4DPT A;  2HFS A;  2IOP A;  4DV4 E;  3B78 A;  4X65 E;  3T1Y E;  4IZK A;  5IT9 Q;  3B82 A;  1NHI A;  3Q6N A;  4DV0 I;  1PIE A;  1HK7 A;  1N34 E;  1ZXM A;  2ZBK B;  2F4V E;  1FJG I;  2ZM6 I;  4DR6 E;  4JI1 I;  4X64 I;  1IBL I;  1H7S A;  4DR6 I;  3ZKB A;  4JI6 E;  3D4J A;  1USU A;  5FLX Q;  4DR2 E;  4YHH I;  2HK3 A;  1J5E E;  2E5L I;  1XNR I;  2UU9 I;  4DR4 I;  1KIJ A;  4DPU A;  2X36 A;  4B3S I;  1PKP A;  2UXC I;  2R42 A;  4R1F A;  1EA6 A;  4JI4 E;  4NXM I;  3V2U C;  5BR8 E;  2HHH E;  2UXD E;  4JI4 I;  1XHK A;  2ZM6 E;  1NHJ A;  4EMD A;  2UUA E;  2HKJ A;  4NXN I;  4X66 I;  4DUY I;  3T1Y I;  3WU3 A;  2O1T A;  4AQY E;  4GKK E;  1Y6Z A;  1H73 A;  4N3O A;  4DV1 E;  4DV0 E;  1FI4 A;  1HNZ E;  1XNR E;  2HFU A;  3V5R A;  4AQY I;  1Z5B A;  4HYM A;  4B3M I;  1PVG A;  4DV7 I;  1UEK A;  5IWA E;  3F0N A;  4IZJ A;  4LF7 I;  4USK A;  4JI7 I;  4LF4 E;  2Z5E A;  4DPW A;  4DUZ I;  2V2Z A;  4DV5 I;  4B3R I;  4JYA I;  2HHH I;  4X65 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...