2Z5EA

Crystal structure of proteasome assembling chaperone 3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
122
structure length
122
Chain Sequence
MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome Assembling Chaperone 3
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 29
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10178 PAC3 Proteasome assembly chaperone 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5eA00
2Z5CB 2Z5BB 2Z5EA
chains in the Genus database with same CATH superfamily
1FI4A 3P3GA 3J80C 1HR0I 1H7SA 4J3DA 2PO0A 4IFDF 1ELOA 2AE8A 5K36D 2WNRB 2NN6D 5EL9A 3OTOI 2V2VA 4LFCE 4JI1I 3P06A 1IBMI 2PO2B 1XNQE 4FW4A 4FW5A 4K0KI 4HACA 3Q6NA 1OJ4A 4YY3I 3QT5A 3HJCA 4AIDA 2X7IA 4B3TE 4DR7E 3Q6MA 1N36E 4GKJI 3P3EA 4MU0A 5DROA 1MX0A 1ZM4A 4R1FA 5LMNE 2Z5BB 3PS2A 4USMA 1Z0EA 4X65I 2C37A 4X62I 4YHHI 3GMEA 4DR2E 3L7ZA 4DV4E 3PRYA 4DV1E 1VISA 4IZKB 5DRRA 2J65A 2PNZA 1OYSA 4M1KA 4MYUA 5ELWA 2VF3A 1E3HA 1XMQI 4FW7A 5LMUI 1N33E 2JEBA 2ZBKB 1PIEA 2VQFE 5FWKA 4FW9A 4NXMI 2HKEA 4DR1I 1OYRA 4LFAI 4IFDE 4EMDA 3D4JA 1EA6A 4FW3A 3F0NA 4HXZA 4ED4A 4DUYI 3Q1QA 4DPTA 2VQEI 4JI7E 4JI5I 1H72C 3NZKA 4DR5I 3J7AM 3WU4A 2UU9I 1N0VC 2UUCE 3P3CA 4DR4E 3GCMA 1HNXE 4LF5I 4AQYE 5IT9Q 2Q2EB 1Y5YA 4GKKI 1D6TA 2F1DA 2BA1G 1HNWI 3PS1A 4IZJD 5K36C 2NN6C 1XNRI 3QT8A 3CDJA 1FKAE 4IFDA 2BA0G 3KRNA 1IBLE 1Z5CA 3ZZ0A 2HKJA 1ZM3A 1FWKA 2C39A 1Z5BA 2X36A 4DUZI 1PVGA 5JEAD 1Z0TA 2ZITA 4Z7YA 4DV2E 2V2ZA 1XNQI 5L3JA 1ZM9A 4WUDA 1VI7A 5IT9C 1XMOE 2O3ZA 2F4VE 5K36B 2V8PA 2O1VA 2DEIA 1FJGI 1WUUA 2NN6B 4X64E 4UT4A 1UEKA 3V2UC 2EFGA 4DR7I 1N36I 1UDOA 1YH8A 2C38B 4JI4I 4RPFA 2WNRA 2E1RA 1KKHA 4AM3A 4MDTA 4DR2I 4I3HA 4DV4I 2UXBE 1BKNA 1S4EA 2PO2A 1P42A 2GQ0A 4DV1I 2PNLA 4LF7I 2JT2A 4LCGA 5IWAE 5BR8I 5K36F 4X66I 2NN6F 4DR6E 4LF6E 1N33I 4MU1A 2BV3A 5C0XD 2VQFI 4OZEA 1IBKE 4LF9E 2Z5BA 1HNZE 4DPYA 4DV0I 3ZKDA 4IZKA 1B62A 4DPWA 4JI7I 2UUCI 4URLA 4B3SE 4DR4I 4LFBI 2UXCE 4AQYI 4DV3E 2GS8A 1N32E 4JV5I 5GMEA 4FW6A 4USKA 1I94E 4LF4E 5JEAC 1USUA 3H1CA 4PRXA 2HFUA 3U1KA 2IERA 4B3RI 1KIJA 4OO1D 2CG9A 4LOMA 4OX9I 4IZJB 1IBLI 1B63A 1RHYA 4QNKA 1Z0GA 3V5RA 4MYTA 4KHPE 1UDQA 4LF8I 3QT7A 1N34E 1DARA 3T1HI 1E3PA 3LPSA 3K17A 1RREA 1H74A 1FWLA 5DRQA 5K36E 4DU8A 2NN6E 1EI1A 2JEAB 2UUBE 1FNMA 3PYFA 4XTJA 4B3MI 5JEAB 2HHHE 3CDIA 3ZZTA 4X64I 5EKWA 2UUAE 2UXDI 3T1YE 5C0XC 2JE6B 5DNLA 1MG7A 2C37B 5DRPA 3OTOE 1UDSA 1IBME 4JI1E 2IOQA 2BR2B 2NPFA 4DV7E 1USVA 5K36A 2IESA 2PNZB 2NN6A 4JI8E 2HFSA 4DR6I 5JEAF 4LF6I 1U2RA 2C38A 4OKGA 2IOPA 4YY3E 2CGEA 1IBKI 1YHCA 4LFCI 2WW4A 5A2QQ 4X62E 4YHHE 3PS3A 2V34A 4QNJA 5C0XB 4B3SI 4OO1C 4DU7A 4GQUA 4JI0E 4JI2E 2UXCI 2WP8B 4B3TI 1N32I 2VESA 2LJPA 2V2QA 4JI6E 2PO1B 1XMQE 5LMNI 4LF4I 4JYAE 5LMUE 4BA1B 3GONA 3UHMA 4NXME 4DR1E 1Y4UA 4LFAE 2R3VA 4DR3E 3K1JA 3K85A 1QZRA 2VQEE 2HK2A 5C0XF 3QT6A 4DR5E 1N34I 5A2QC 2UU9E 4BA2B 2HK3A 4OO1B 4FWDA 1KVKA 4P52A 3M7ND 3DD6A 3J7AG 5JEAE 4JI3E 4NXNE 3J81Q 4DV5E 3HKMA 4MU4A 1Z0CA 4IZJA 4PU9A 3B8HA 3HULA 2UUAI 2DEJA 4FWGA 1J5EE 3GLLA 4ZVIA 4IS9A 2ZM6E 1HNXI 3B82A 3T1YI 2Z5CB 1Z0BA 4DUZE 2BM1A 4IFDD 4DXLA 4OO1F 2E5LE 4U3BA 1Y6ZA 1NHIA 2PNMA 3ZZUA 4DV7I 2JEAA 1R6MA 3WU6A 2CZ9A 4AIMA 4JI8I 5JEAA 1ZXMA 4LCFA 1NHJA 2OI2A 1FJGE 3J81C 2PO0B 5FLXQ 4FWHA 2BA1D 3JAMQ 4HY1A 4DV2I 4JI4E 2CVEA 1Z0VA 3ZKBA 2JE6A 5C0XE 1XMOI 1R6LA 3CWVA 2F4VI 3M7NG 4N3OA 2BR2A 1ZM2A 3LTOA 4DV6E 4LF7E 2BA0D 1Z0WA 4JI0I 4JI2I 4LCHA 2O1WA 4DPXA 1HR0E 4HACB 3B78A 1S16A 3M6AA 5BR8E 1HK7A 4X66E 4JI6I 2O1UA 4JYAI 5DNXA 1Y60A 4KQVA 1Z59A 2UXBI 4WUBA 5FLXC 3JAMC 4DPUA 3L7ZB 3P76A 4NBQA 4DR3I 3PYGA 5C0XA 1RR9A 4DV0E 5IWAI 4UTGA 4OO1E 1OYPA 4PRVA 3B4TA 1N0UA 5LL6R 2WP8A 4K0KE 1NHHA 1XHKA 4JG4A 4LFBE 5GMDA 2PO1A 2GO3A 4MU3A 1KTVA 4FN5A 2JEBB 4GKJE 4LF9I 4P7AA 4JV5E 1HNZI 4JI3I 3LNUA 4NXNI 4BA1A 3U1YA 3M85D 4DV5I 4IFDC 4X65E 1XXEA 2J7KA 4B3RE 1J5EI 2ZM6I 4OX9E 2A2DA 4DV3I 4BA2A 1A6FA 4LF8E 4OO1A 1I94I 1PKPA 3T1HE 2E5LI 1Z5AA 1NZ0A 3J80Q 1K47A 2BM0A 1ZXNA 4MQYA 1Y4SA 3WU5A 2Z5EA 2A2CA 1H7UA 1UDNA 4DUYE 4B3ME 4IFDB 3PYDA 2GO4A 4KHPI 4JI5E 4HYMA 3H4LA 4LPFA 4ISAA 2C39B 2O1TA 2Z5CA 4LF5E 2UXDE 4GKKE 1MU5A 3PYEA 4U3DA 1HNWE 4Z7CA 4WUCA 2UUBI 2AJ4A 4DV6I 2XEXA 3M85G 2HHHI 1XNRE 3WU3A 2R42A 1H73A 3ZM7A
chains in the Genus database with same CATH topology
1FI4A 3J80C 1HR0I 1H7SA 1ELOA 3OTOI 2V2VA 4LFCE 4JI1I 3P06A 1IBMI 1XNQE 4K0KI 4HACA 3Q6NA 1OJ4A 4YY3I 3QT5A 3HJCA 4B3TE 2X7IA 4DR7E 3Q6MA 1N36E 4GKJI 1MX0A 1ZM4A 4R1FA 5LMNE 2Z5BB 4USMA 4X65I 1Z0EA 4X62I 4YHHI 4DR2E 4DV4E 3PRYA 4DV1E 1VISA 4IZKB 4M1KA 4MYUA 2VF3A 1XMQI 5LMUI 1N33E 2ZBKB 1PIEA 2VQFE 5FWKA 4FW9A 4NXMI 2HKEA 4DR1I 4LFAI 4EMDA 3D4JA 1EA6A 3F0NA 4HXZA 4ED4A 4DUYI 3Q1QA 4DPTA 2VQEI 4JI7E 4JI5I 1H72C 4DR5I 3J7AM 3WU4A 2UU9I 1N0VC 2UUCE 4DR4E 1HNXE 4LF5I 4AQYE 5IT9Q 2Q2EB 4GKKI 1D6TA 1HNWI 4IZJD 1XNRI 3QT8A 1FKAE 1IBLE 1Z5CA 3ZZ0A 2HKJA 1ZM3A 1FWKA 1Z5BA 2X36A 4DUZI 1PVGA 1Z0TA 2ZITA 4Z7YA 4DV2E 2V2ZA 1XNQI 5L3JA 1ZM9A 4WUDA 5IT9C 1XMOE 2F4VE 2V8PA 2O1VA 2DEIA 1FJGI 1WUUA 4X64E 4UT4A 1UEKA 3V2UC 2EFGA 4DR7I 1N36I 4JI4I 4RPFA 2E1RA 1KKHA 4DR2I 4I3HA 4DV4I 2UXBE 1BKNA 1S4EA 4DV1I 2GQ0A 2PNLA 4LF7I 5IWAE 5BR8I 4X66I 4DR6E 4LF6E 1N33I 2BV3A 2VQFI 1IBKE 4LF9E 2Z5BA 1HNZE 4DPYA 4DV0I 3ZKDA 4IZKA 1B62A 4DPWA 4JI7I 2UUCI 4URLA 4B3SE 4DR4I 4LFBI 2UXCE 4AQYI 4DV3E 2GS8A 1N32E 4JV5I 5GMEA 4USKA 1I94E 4LF4E 1USUA 4PRXA 2HFUA 4B3RI 1KIJA 2CG9A 4OX9I 4IZJB 1IBLI 1B63A 1Z0GA 3V5RA 4MYTA 4KHPE 4LF8I 3QT7A 1N34E 1DARA 3T1HI 3LPSA 3K17A 1RREA 1H74A 1FWLA 4DU8A 1EI1A 2UUBE 1FNMA 3PYFA 4XTJA 4B3MI 2HHHE 3ZZTA 4X64I 2UUAE 2UXDI 3T1YE 1MG7A 3OTOE 1IBME 4JI1E 2IOQA 2NPFA 4DV7E 1USVA 4JI8E 2HFSA 4DR6I 4LF6I 1U2RA 2IOPA 4YY3E 2CGEA 1IBKI 4LFCI 2WW4A 5A2QQ 4X62E 4YHHE 2V34A 4B3SI 4DU7A 4JI0E 4JI2E 2UXCI 4B3TI 1N32I 2LJPA 2V2QA 4JI6E 1XMQE 5LMNI 4LF4I 4JYAE 5LMUE 3GONA 4NXME 4DR1E 1Y4UA 4LFAE 2R3VA 4DR3E 3K1JA 3K85A 1QZRA 2VQEE 2HK2A 3QT6A 4DR5E 1N34I 5A2QC 2UU9E 2HK3A 4FWDA 1KVKA 4P52A 3J7AG 4JI3E 4NXNE 3J81Q 4DV5E 1Z0CA 4IZJA 4PU9A 3B8HA 3HULA 2UUAI 2DEJA 4FWGA 1J5EE 2ZM6E 4ZVIA 1HNXI 3B82A 3T1YI 2Z5CB 1Z0BA 4DUZE 2BM1A 4DXLA 2E5LE 1Y6ZA 1NHIA 2PNMA 3ZZUA 4DV7I 3WU6A 2CZ9A 4JI8I 1ZXMA 1NHJA 2OI2A 1FJGE 3J81C 5FLXQ 4FWHA 3JAMQ 4HY1A 4DV2I 4JI4E 1Z0VA 3ZKBA 1XMOI 3CWVA 2F4VI 4N3OA 1ZM2A 3LTOA 4DV6E 4LF7E 1Z0WA 4JI0I 4JI2I 2O1WA 4DPXA 1HR0E 4HACB 3B78A 1S16A 3M6AA 5BR8E 1HK7A 4X66E 4JI6I 2O1UA 4JYAI 4KQVA 1Z59A 2UXBI 4WUBA 5FLXC 3JAMC 4DPUA 4DR3I 3PYGA 1RR9A 4DV0E 5IWAI 4UTGA 4PRVA 1N0UA 5LL6R 4K0KE 1NHHA 1XHKA 4JG4A 4LFBE 5GMDA 1KTVA 4FN5A 4GKJE 4LF9I 4P7AA 4JV5E 1HNZI 4JI3I 3LNUA 4NXNI 4DV5I 4X65E 2J7KA 4B3RE 1J5EI 2ZM6I 4OX9E 2A2DA 4DV3I 1A6FA 4LF8E 1I94I 1PKPA 3T1HE 2E5LI 1Z5AA 1NZ0A 3J80Q 1K47A 2BM0A 1ZXNA 1Y4SA 3WU5A 2Z5EA 2A2CA 1H7UA 4DUYE 4B3ME 3PYDA 4KHPI 4JI5E 4HYMA 3H4LA 2O1TA 2Z5CA 4LF5E 2UXDE 4GKKE 1MU5A 3PYEA 1HNWE 4Z7CA 4WUCA 2UUBI 2AJ4A 4DV6I 2XEXA 2HHHI 1XNRE 3WU3A 2R42A 1H73A 3ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C B;  2Z5B B;  2Z5E A; 
#chains in the Genus database with same CATH topology
 1FI4 A;  3P3G A;  3J80 C;  1HR0 I;  1H7S A;  4J3D A;  2PO0 A;  4IFD F;  1ELO A;  2AE8 A;  5K36 D;  2WNR B;  2NN6 D;  5EL9 A;  3OTO I;  2V2V A;  4LFC E;  4JI1 I;  3P06 A;  1IBM I;  2PO2 B;  1XNQ E;  4FW4 A;  4FW5 A;  4K0K I;  4HAC A;  3Q6N A;  1OJ4 A;  4YY3 I;  3QT5 A;  3HJC A;  4AID A;  2X7I A;  4B3T E;  4DR7 E;  3Q6M A;  1N36 E;  4GKJ I;  3P3E A;  4MU0 A;  5DRO A;  1MX0 A;  1ZM4 A;  4R1F A;  5LMN E;  2Z5B B;  3PS2 A;  4USM A;  1Z0E A;  4X65 I;  2C37 A;  4X62 I;  4YHH I;  3GME A;  4DR2 E;  3L7Z A;  4DV4 E;  3PRY A;  4DV1 E;  1VIS A;  4IZK B;  5DRR A;  2J65 A;  2PNZ A;  1OYS A;  4M1K A;  4MYU A;  5ELW A;  2VF3 A;  1E3H A;  1XMQ I;  4FW7 A;  5LMU I;  1N33 E;  2JEB A;  2ZBK B;  1PIE A;  2VQF E;  5FWK A;  4FW9 A;  4NXM I;  2HKE A;  4DR1 I;  1OYR A;  4LFA I;  4IFD E;  4EMD A;  3D4J A;  1EA6 A;  4FW3 A;  3F0N A;  4HXZ A;  4ED4 A;  4DUY I;  3Q1Q A;  4DPT A;  2VQE I;  4JI7 E;  4JI5 I;  1H72 C;  3NZK A;  4DR5 I;  3J7A M;  3WU4 A;  2UU9 I;  1N0V C;  2UUC E;  3P3C A;  4DR4 E;  3GCM A;  1HNX E;  4LF5 I;  4AQY E;  5IT9 Q;  2Q2E B;  1Y5Y A;  4GKK I;  1D6T A;  2F1D A;  2BA1 G;  1HNW I;  3PS1 A;  4IZJ D;  5K36 C;  2NN6 C;  1XNR I;  3QT8 A;  3CDJ A;  1FKA E;  4IFD A;  2BA0 G;  3KRN A;  1IBL E;  1Z5C A;  3ZZ0 A;  2HKJ A;  1ZM3 A;  1FWK A;  2C39 A;  1Z5B A;  2X36 A;  4DUZ I;  1PVG A;  5JEA D;  1Z0T A;  2ZIT A;  4Z7Y A;  4DV2 E;  2V2Z A;  1XNQ I;  5L3J A;  1ZM9 A;  4WUD A;  1VI7 A;  5IT9 C;  1XMO E;  2O3Z A;  2F4V E;  5K36 B;  2V8P A;  2O1V A;  2DEI A;  1FJG I;  1WUU A;  2NN6 B;  4X64 E;  4UT4 A;  1UEK A;  3V2U C;  2EFG A;  4DR7 I;  1N36 I;  1UDO A;  1YH8 A;  2C38 B;  4JI4 I;  4RPF A;  2WNR A;  2E1R A;  1KKH A;  4AM3 A;  4MDT A;  4DR2 I;  4I3H A;  4DV4 I;  2UXB E;  1BKN A;  1S4E A;  2PO2 A;  1P42 A;  2GQ0 A;  4DV1 I;  2PNL A;  4LF7 I;  2JT2 A;  4LCG A;  5IWA E;  5BR8 I;  5K36 F;  4X66 I;  2NN6 F;  4DR6 E;  4LF6 E;  1N33 I;  4MU1 A;  2BV3 A;  5C0X D;  2VQF I;  4OZE A;  1IBK E;  4LF9 E;  2Z5B A;  1HNZ E;  4DPY A;  4DV0 I;  3ZKD A;  4IZK A;  1B62 A;  4DPW A;  4JI7 I;  2UUC I;  4URL A;  4B3S E;  4DR4 I;  4LFB I;  2UXC E;  4AQY I;  4DV3 E;  2GS8 A;  1N32 E;  4JV5 I;  5GME A;  4FW6 A;  4USK A;  1I94 E;  4LF4 E;  5JEA C;  1USU A;  3H1C A;  4PRX A;  2HFU A;  3U1K A;  2IER A;  4B3R I;  1KIJ A;  4OO1 D;  2CG9 A;  4LOM A;  4OX9 I;  4IZJ B;  1IBL I;  1B63 A;  1RHY A;  4QNK A;  1Z0G A;  3V5R A;  4MYT A;  4KHP E;  1UDQ A;  4LF8 I;  3QT7 A;  1N34 E;  1DAR A;  3T1H I;  1E3P A;  3LPS A;  3K17 A;  1RRE A;  1H74 A;  1FWL A;  5DRQ A;  5K36 E;  4DU8 A;  2NN6 E;  1EI1 A;  2JEA B;  2UUB E;  1FNM A;  3PYF A;  4XTJ A;  4B3M I;  5JEA B;  2HHH E;  3CDI A;  3ZZT A;  4X64 I;  5EKW A;  2UUA E;  2UXD I;  3T1Y E;  5C0X C;  2JE6 B;  5DNL A;  1MG7 A;  2C37 B;  5DRP A;  3OTO E;  1UDS A;  1IBM E;  4JI1 E;  2IOQ A;  2BR2 B;  2NPF A;  4DV7 E;  1USV A;  5K36 A;  2IES A;  2PNZ B;  2NN6 A;  4JI8 E;  2HFS A;  4DR6 I;  5JEA F;  4LF6 I;  1U2R A;  2C38 A;  4OKG A;  2IOP A;  4YY3 E;  2CGE A;  1IBK I;  1YHC A;  4LFC I;  2WW4 A;  5A2Q Q;  4X62 E;  4YHH E;  3PS3 A;  2V34 A;  4QNJ A;  5C0X B;  4B3S I;  4OO1 C;  4DU7 A;  4GQU A;  4JI0 E;  4JI2 E;  2UXC I;  2WP8 B;  4B3T I;  1N32 I;  2VES A;  2LJP A;  2V2Q A;  4JI6 E;  2PO1 B;  1XMQ E;  5LMN I;  4LF4 I;  4JYA E;  5LMU E;  4BA1 B;  3GON A;  3UHM A;  4NXM E;  4DR1 E;  1Y4U A;  4LFA E;  2R3V A;  4DR3 E;  3K1J A;  3K85 A;  1QZR A;  2VQE E;  2HK2 A;  5C0X F;  3QT6 A;  4DR5 E;  1N34 I;  5A2Q C;  2UU9 E;  4BA2 B;  2HK3 A;  4OO1 B;  4FWD A;  1KVK A;  4P52 A;  3M7N D;  3DD6 A;  3J7A G;  5JEA E;  4JI3 E;  4NXN E;  3J81 Q;  4DV5 E;  3HKM A;  4MU4 A;  1Z0C A;  4IZJ A;  4PU9 A;  3B8H A;  3HUL A;  2UUA I;  2DEJ A;  4FWG A;  1J5E E;  3GLL A;  4ZVI A;  4IS9 A;  2ZM6 E;  1HNX I;  3B82 A;  3T1Y I;  2Z5C B;  1Z0B A;  4DUZ E;  2BM1 A;  4IFD D;  4DXL A;  4OO1 F;  2E5L E;  4U3B A;  1Y6Z A;  1NHI A;  2PNM A;  3ZZU A;  4DV7 I;  2JEA A;  1R6M A;  3WU6 A;  2CZ9 A;  4AIM A;  4JI8 I;  5JEA A;  1ZXM A;  4LCF A;  1NHJ A;  2OI2 A;  1FJG E;  3J81 C;  2PO0 B;  5FLX Q;  4FWH A;  2BA1 D;  3JAM Q;  4HY1 A;  4DV2 I;  4JI4 E;  2CVE A;  1Z0V A;  3ZKB A;  2JE6 A;  5C0X E;  1XMO I;  1R6L A;  3CWV A;  2F4V I;  3M7N G;  4N3O A;  2BR2 A;  1ZM2 A;  3LTO A;  4DV6 E;  4LF7 E;  2BA0 D;  1Z0W A;  4JI0 I;  4JI2 I;  4LCH A;  2O1W A;  4DPX A;  1HR0 E;  4HAC B;  3B78 A;  1S16 A;  3M6A A;  5BR8 E;  1HK7 A;  4X66 E;  4JI6 I;  2O1U A;  4JYA I;  5DNX A;  1Y60 A;  4KQV A;  1Z59 A;  2UXB I;  4WUB A;  5FLX C;  3JAM C;  4DPU A;  3L7Z B;  3P76 A;  4NBQ A;  4DR3 I;  3PYG A;  5C0X A;  1RR9 A;  4DV0 E;  5IWA I;  4UTG A;  4OO1 E;  1OYP A;  4PRV A;  3B4T A;  1N0U A;  5LL6 R;  2WP8 A;  4K0K E;  1NHH A;  1XHK A;  4JG4 A;  4LFB E;  5GMD A;  2PO1 A;  2GO3 A;  4MU3 A;  1KTV A;  4FN5 A;  2JEB B;  4GKJ E;  4LF9 I;  4P7A A;  4JV5 E;  1HNZ I;  4JI3 I;  3LNU A;  4NXN I;  4BA1 A;  3U1Y A;  3M85 D;  4DV5 I;  4IFD C;  4X65 E;  1XXE A;  2J7K A;  4B3R E;  1J5E I;  2ZM6 I;  4OX9 E;  2A2D A;  4DV3 I;  4BA2 A;  1A6F A;  4LF8 E;  4OO1 A;  1I94 I;  1PKP A;  3T1H E;  2E5L I;  1Z5A A;  1NZ0 A;  3J80 Q;  1K47 A;  2BM0 A;  1ZXN A;  4MQY A;  1Y4S A;  3WU5 A;  2Z5E A;  2A2C A;  1H7U A;  1UDN A;  4DUY E;  4B3M E;  4IFD B;  3PYD A;  2GO4 A;  4KHP I;  4JI5 E;  4HYM A;  3H4L A;  4LPF A;  4ISA A;  2C39 B;  2O1T A;  2Z5C A;  4LF5 E;  2UXD E;  4GKK E;  1MU5 A;  3PYE A;  4U3D A;  1HNW E;  4Z7C A;  4WUC A;  2UUB I;  2AJ4 A;  4DV6 I;  2XEX A;  3M85 G;  2HHH I;  1XNR E;  3WU3 A;  2R42 A;  1H73 A;  3ZM7 A; 
#chains in the Genus database with same CATH homology
 1FI4 A;  3J80 C;  1HR0 I;  1H7S A;  1ELO A;  3OTO I;  2V2V A;  4LFC E;  4JI1 I;  3P06 A;  1IBM I;  1XNQ E;  4K0K I;  4HAC A;  3Q6N A;  1OJ4 A;  4YY3 I;  3QT5 A;  3HJC A;  4B3T E;  2X7I A;  4DR7 E;  3Q6M A;  1N36 E;  4GKJ I;  1MX0 A;  1ZM4 A;  4R1F A;  5LMN E;  2Z5B B;  4USM A;  4X65 I;  1Z0E A;  4X62 I;  4YHH I;  4DR2 E;  4DV4 E;  3PRY A;  4DV1 E;  1VIS A;  4IZK B;  4M1K A;  4MYU A;  2VF3 A;  1XMQ I;  5LMU I;  1N33 E;  2ZBK B;  1PIE A;  2VQF E;  5FWK A;  4FW9 A;  4NXM I;  2HKE A;  4DR1 I;  4LFA I;  4EMD A;  3D4J A;  1EA6 A;  3F0N A;  4HXZ A;  4ED4 A;  4DUY I;  3Q1Q A;  4DPT A;  2VQE I;  4JI7 E;  4JI5 I;  1H72 C;  4DR5 I;  3J7A M;  3WU4 A;  2UU9 I;  1N0V C;  2UUC E;  4DR4 E;  1HNX E;  4LF5 I;  4AQY E;  5IT9 Q;  2Q2E B;  4GKK I;  1D6T A;  1HNW I;  4IZJ D;  1XNR I;  3QT8 A;  1FKA E;  1IBL E;  1Z5C A;  3ZZ0 A;  2HKJ A;  1ZM3 A;  1FWK A;  1Z5B A;  2X36 A;  4DUZ I;  1PVG A;  1Z0T A;  2ZIT A;  4Z7Y A;  4DV2 E;  2V2Z A;  1XNQ I;  5L3J A;  1ZM9 A;  4WUD A;  5IT9 C;  1XMO E;  2F4V E;  2V8P A;  2O1V A;  2DEI A;  1FJG I;  1WUU A;  4X64 E;  4UT4 A;  1UEK A;  3V2U C;  2EFG A;  4DR7 I;  1N36 I;  4JI4 I;  4RPF A;  2E1R A;  1KKH A;  4DR2 I;  4I3H A;  4DV4 I;  2UXB E;  1BKN A;  1S4E A;  4DV1 I;  2GQ0 A;  2PNL A;  4LF7 I;  5IWA E;  5BR8 I;  4X66 I;  4DR6 E;  4LF6 E;  1N33 I;  2BV3 A;  2VQF I;  1IBK E;  4LF9 E;  2Z5B A;  1HNZ E;  4DPY A;  4DV0 I;  3ZKD A;  4IZK A;  1B62 A;  4DPW A;  4JI7 I;  2UUC I;  4URL A;  4B3S E;  4DR4 I;  4LFB I;  2UXC E;  4AQY I;  4DV3 E;  2GS8 A;  1N32 E;  4JV5 I;  5GME A;  4USK A;  1I94 E;  4LF4 E;  1USU A;  4PRX A;  2HFU A;  4B3R I;  1KIJ A;  2CG9 A;  4OX9 I;  4IZJ B;  1IBL I;  1B63 A;  1Z0G A;  3V5R A;  4MYT A;  4KHP E;  4LF8 I;  3QT7 A;  1N34 E;  1DAR A;  3T1H I;  3LPS A;  3K17 A;  1RRE A;  1H74 A;  1FWL A;  4DU8 A;  1EI1 A;  2UUB E;  1FNM A;  3PYF A;  4XTJ A;  4B3M I;  2HHH E;  3ZZT A;  4X64 I;  2UUA E;  2UXD I;  3T1Y E;  1MG7 A;  3OTO E;  1IBM E;  4JI1 E;  2IOQ A;  2NPF A;  4DV7 E;  1USV A;  4JI8 E;  2HFS A;  4DR6 I;  4LF6 I;  1U2R A;  2IOP A;  4YY3 E;  2CGE A;  1IBK I;  4LFC I;  2WW4 A;  5A2Q Q;  4X62 E;  4YHH E;  2V34 A;  4B3S I;  4DU7 A;  4JI0 E;  4JI2 E;  2UXC I;  4B3T I;  1N32 I;  2LJP A;  2V2Q A;  4JI6 E;  1XMQ E;  5LMN I;  4LF4 I;  4JYA E;  5LMU E;  3GON A;  4NXM E;  4DR1 E;  1Y4U A;  4LFA E;  2R3V A;  4DR3 E;  3K1J A;  3K85 A;  1QZR A;  2VQE E;  2HK2 A;  3QT6 A;  4DR5 E;  1N34 I;  5A2Q C;  2UU9 E;  2HK3 A;  4FWD A;  1KVK A;  4P52 A;  3J7A G;  4JI3 E;  4NXN E;  3J81 Q;  4DV5 E;  1Z0C A;  4IZJ A;  4PU9 A;  3B8H A;  3HUL A;  2UUA I;  2DEJ A;  4FWG A;  1J5E E;  2ZM6 E;  4ZVI A;  1HNX I;  3B82 A;  3T1Y I;  2Z5C B;  1Z0B A;  4DUZ E;  2BM1 A;  4DXL A;  2E5L E;  1Y6Z A;  1NHI A;  2PNM A;  3ZZU A;  4DV7 I;  3WU6 A;  2CZ9 A;  4JI8 I;  1ZXM A;  1NHJ A;  2OI2 A;  1FJG E;  3J81 C;  5FLX Q;  4FWH A;  3JAM Q;  4HY1 A;  4DV2 I;  4JI4 E;  1Z0V A;  3ZKB A;  1XMO I;  3CWV A;  2F4V I;  4N3O A;  1ZM2 A;  3LTO A;  4DV6 E;  4LF7 E;  1Z0W A;  4JI0 I;  4JI2 I;  2O1W A;  4DPX A;  1HR0 E;  4HAC B;  3B78 A;  1S16 A;  3M6A A;  5BR8 E;  1HK7 A;  4X66 E;  4JI6 I;  2O1U A;  4JYA I;  4KQV A;  1Z59 A;  2UXB I;  4WUB A;  5FLX C;  3JAM C;  4DPU A;  4DR3 I;  3PYG A;  1RR9 A;  4DV0 E;  5IWA I;  4UTG A;  4PRV A;  1N0U A;  5LL6 R;  4K0K E;  1NHH A;  1XHK A;  4JG4 A;  4LFB E;  5GMD A;  1KTV A;  4FN5 A;  4GKJ E;  4LF9 I;  4P7A A;  4JV5 E;  1HNZ I;  4JI3 I;  3LNU A;  4NXN I;  4DV5 I;  4X65 E;  2J7K A;  4B3R E;  1J5E I;  2ZM6 I;  4OX9 E;  2A2D A;  4DV3 I;  1A6F A;  4LF8 E;  1I94 I;  1PKP A;  3T1H E;  2E5L I;  1Z5A A;  1NZ0 A;  3J80 Q;  1K47 A;  2BM0 A;  1ZXN A;  1Y4S A;  3WU5 A;  2Z5E A;  2A2C A;  1H7U A;  4DUY E;  4B3M E;  3PYD A;  4KHP I;  4JI5 E;  4HYM A;  3H4L A;  2O1T A;  2Z5C A;  4LF5 E;  2UXD E;  4GKK E;  1MU5 A;  3PYE A;  1HNW E;  4Z7C A;  4WUC A;  2UUB I;  2AJ4 A;  4DV6 I;  2XEX A;  2HHH I;  1XNR E;  3WU3 A;  2R42 A;  1H73 A;  3ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...