2Z5EA

Crystal structure of proteasome assembling chaperone 3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
122
structure length
122
Chain Sequence
MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Proteasome Assembling Chaperone 3
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10178 PAC3 Proteasome assembly chaperone 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5eA00
2Z5BB 2Z5EA 2Z5CB
chains in the Genus database with same CATH superfamily
4DV3I 4LF9E 1IBMI 4JI3I 4IZJB 5FWKA 2OI2A 1RR9A 4DU8A 5JEAB 1Z0CA 2CZ9A 2UUAE 1OYRA 1XNQI 2GO4A 4N3OA 1FKAE 4B3TI 5LMUI 3D4JA 1XHKA 5EL9A 4X64E 4IS9A 4MDTA 5K36C 2CG9A 4QNJA 1WUUA 1HR0E 2C38B 4MU1A 1DARA 4AM3A 4K0KE 4LF9I 2C37B 2PO1A 1UDQA 1MU5A 4FN5A 2NN6C 4JI1I 3B78A 2C39A 1R6MA 1VISA 3P3EA 4X64I 1XXEA 1H73A 4LCFA 5C0XA 4LF4E 1YHCA 2ZBKB 4FW5A 4GQUA 5JEAC 4GKKE 3UHMA 1RHYA 4LPFA 2ZITA 2AJ4A 1HR0I 2VQFE 4DPUA 2HKEA 4K0KI 4XTJA 4OO1B 4JI7E 2E1RA 3P3CA 2VF3A 3L7ZA 2Z5BA 4MQYA 3Q6MA 1Z0BA 1Z59A 1E3PA 1MX0A 4LF4I 4KHPE 4GKKI 3GMEA 2Z5CB 1H7UA 2PO0B 2VQFI 2UXCE 1D6TA 2CVEA 4X62E 2VESA 2J65A 4JI7I 2BA0G 4WUDA 1XMOE 2JE6A 2JEBB 4USMA 1EA6A 4WUCA 4OO1C 4HACB 3WU3A 4JI2E 4KHPI 4U3BA 2R3VA 2V2VA 1Z0EA 1FJGE 1K47A 1Z5CA 5K36B 5C0XE 1IBLE 4YHHE 2UXCI 4GKJE 4X62I 3PYGA 4HXZA 4JI4E 2HHHE 4LF6E 3WU6A 2BA1G 3PS2A 4MU0A 5C0XD 3M7ND 1XMOI 5GMEA 4DPWA 1HNWE 3T1YE 4IFDE 2UXBE 2NN6B 1N0UA 3NZKA 3T1HI 4X65E 2O3ZA 4JI2I 3ZKDA 2JEAA 4PRXA 1HNXE 4IFDD 4DV4E 1FJGI 1IBLI 4JI0E 3LNUA 4BA1A 4YHHI 1NHHA 4LCGA 4GKJI 4AQYE 3WU4A 2PO2A 4JI4I 2HHHI 4LF6I 2UXDE 2Q2EB 2UUBE 5FLXQ 4OZEA 3P3GA 3J7AG 1HNWI 4JV5E 3T1YI 2UXBI 2F4VE 4JYAE 5ELWA 4DR3E 2WP8A 3V2UC 4X65I 1UDOA 3P06A 4IZJA 1HNXI 2IERA 5JEAA 4R1FA 2XEXA 4DV4I 4JI0I 4DR2E 1Z0TA 3PYDA 1H72C 3LPSA 1HNZE 4LFBE 4AQYI 2UUAI 3PYEA 4DV5E 3H1CA 2UXDI 3ZZ0A 2UUBI 3OTOE 1ZM2A 4MYTA 5LL6R 4JV5I 2DEIA 4DV6E 2F4VI 2IESA 4JYAI 3QT5A 4DR3I 4FW6A 5L3JA 5EKWA 4IZKB 2A2CA 2VQEE 5BR8E 2GO3A 4DU7A 4DR2I 4IFDA 4Z7YA 1HNZI 4LFBI 5LMNE 4LFAE 2BM1A 4DV5I 1USVA 5FLXC 3P76A 1S16A 5DROA 1Y4SA 3OTOI 4DR5E 2V2QA 3PS3A 4BA2B 2CGEA 3B82A 4DV6I 4MU3A 1Y60A 1S4EA 2A2DA 4DV0E 2O1WA 4ISAA 1KKHA 2ZM6E 2UU9E 3M85D 2BM0A 4AIDA 1XMQE 4OO1A 4DXLA 4DUYE 5C0XF 2VQEI 5BR8I 5C0XC 1ZXNA 3PRYA 2BA0D 5JEAE 1B62A 2X36A 5LMNI 2JE6B 4DR1E 3PYFA 3V5RA 3J80Q 4IFDF 2HFUA 4IZJD 5JEAD 2Z5CA 3K85A 5IT9C 4KQVA 4DV0I 4LF7E 3ZM7A 4DUZE 2ZM6I 2UU9I 2HK2A 4LF5E 1EI1A 1XMQI 3HKMA 4HY1A 4DUYI 1A6FA 4USKA 3DD6A 5A2QC 4OX9E 4DV7E 1N36E 2BA1D 3H4LA 3CDIA 4PRVA 2E5LE 4LCHA 4FWGA 4JG4A 4QNKA 3ZKBA 2X7IA 1B63A 4HACA 4DR1I 1KIJA 1RREA 4X66E 2EFGA 1PIEA 2WNRA 1N34E 1Z0VA 1VI7A 2O1VA 3QT7A 3JAMQ 4FW9A 2PNZB 4LF7I 5K36A 3ZZTA 4DUZI 2J7KA 4LF5I 4I3HA 1OYPA 3U1KA 2F1DA 2NPFA 1NHIA 4JI6E 4B3RE 1KVKA 1Z0GA 3F0NA 4WUBA 1XNQE 4FW7A 1QZRA 3J81Q 2BR2A 4OO1E 4OX9I 4DV7I 1N36I 3Q6NA 2NN6A 4DR4E 1Z5BA 4B3ME 3WU5A 2E5LI 1OJ4A 1PKPA 3J80C 3K1JA 4X66I 4OO1D 4MU4A 3GCMA 4FW3A 1N34I 4AIMA 1UDNA 3LTOA 4LOMA 1KTVA 4JI1E 4B3RI 4JI6I 2PO1B 3HJCA 1J5EE 3PS1A 3M6AA 4EMDA 2HKJA 5K36F 3KRNA 3ZZUA 4ZVIA 1U2RA 2C39B 1Z0WA 5IWAE 4DPYA 3QT6A 4DR4I 4B3MI 2GQ0A 5C0XB 1H7SA 2GS8A 1FNMA 2C38A 4FW4A 4DV2E 2R42A 3U1YA 5IT9Q 4LF8E 3QT8A 3JAMC 2NN6F 1I94E 1YH8A 2C37A 2LJPA 2HK3A 4JI5E 5A2QQ 5DNXA 1J5EI 4NXNE 5K36E 4Z7CA 3J81C 4IFDB 2AE8A 1ZXMA 4DV1E 3L7ZB 1FWLA 5JEAF 4B3SE 2Z5BB 5IWAI 4U3DA 2DEJA 5K36D 2JT2A 4YY3E 1IBKE 1H74A 1ZM4A 2NN6E 4IZKA 4PU9A 4DV2I 4LF8I 2O1UA 1NZ0A 1Z5AA 1Y5YA 1I94I 3B4TA 4RPFA 4JI8E 1N33E 1UDSA 4UT4A 4DR6E 4JI5I 1Y6ZA 1BKNA 4FWHA 2NN6D 2PNMA 3B8HA 4NXNI 5DRRA 4DV1I 3J7AM 4LFAI 4B3SI 4BA2A 1N0VC 2IOPA 1PVGA 1R6LA 2V2ZA 4DR5I 1E3HA 1USUA 2UUCE 3M85G 4YY3I 5DNLA 2WW4A 1UEKA 4M1KA 2PO0A 1IBKI 4IFDC 4NXME 1MG7A 1HK7A 1XNRE 1ELOA 5DRQA 4JI8I 1N33I 4ED4A 4P52A 4DR6I 4LFCE 3HULA 2V34A 2V8PA 4URLA 2O1TA 1P42A 3K17A 4DR7E 2JEBA 4OO1F 1N32E 3GLLA 3T1HE 2WNRB 2Z5EA 4OKGA 2UUCI 4DPTA 4FWDA 4DV3E 5GMDA 4HYMA 4DPXA 1IBME 4JI3E 4J3DA 2JEAB 1FWKA 4NXMI 3CDJA 4P7AA 1OYSA 1XNRI 4MYUA 1NHJA 3Q1QA 4BA1B 1ZM9A 3CWVA 4B3TE 4LFCI 2BR2B 5LMUE 2PO2B 3M7NG 3GONA 2BV3A 4DR7I 1Y4UA 4NBQA 2IOQA 1N32I 2HFSA 2PNLA 5DRPA 1FI4A 2PNZA 1ZM3A 2WP8B 4UTGA
chains in the Genus database with same CATH topology
4DV3I 4LF9E 1IBMI 4JI3I 4IZJB 5FWKA 2OI2A 1RR9A 4DU8A 1Z0CA 2CZ9A 2UUAE 1XNQI 4N3OA 1FKAE 4B3TI 5LMUI 3D4JA 1XHKA 4X64E 2CG9A 1WUUA 1HR0E 1DARA 4K0KE 4LF9I 1MU5A 4FN5A 4JI1I 3B78A 1VISA 4X64I 1H73A 4LF4E 2ZBKB 4GKKE 2ZITA 2AJ4A 1HR0I 2VQFE 4DPUA 2HKEA 4K0KI 4XTJA 4JI7E 2E1RA 2VF3A 2Z5BA 3Q6MA 1Z0BA 1Z59A 1MX0A 4LF4I 4KHPE 4GKKI 2Z5CB 1H7UA 2VQFI 2UXCE 1D6TA 4X62E 4JI7I 4WUDA 1XMOE 4USMA 1EA6A 4WUCA 4HACB 3WU3A 4JI2E 4KHPI 2R3VA 2V2VA 1Z0EA 1FJGE 1K47A 1Z5CA 1IBLE 4YHHE 2UXCI 4GKJE 4X62I 3PYGA 4HXZA 4JI4E 2HHHE 4LF6E 3WU6A 1XMOI 5GMEA 4DPWA 1HNWE 3T1YE 2UXBE 1N0UA 3T1HI 4X65E 4JI2I 3ZKDA 4PRXA 1HNXE 4DV4E 1FJGI 1IBLI 4JI0E 3LNUA 4YHHI 1NHHA 4GKJI 4AQYE 3WU4A 4JI4I 2HHHI 4LF6I 2UXDE 2Q2EB 2UUBE 5FLXQ 3J7AG 1HNWI 4JV5E 3T1YI 2UXBI 2F4VE 4JYAE 4DR3E 3V2UC 4X65I 3P06A 4IZJA 1HNXI 4R1FA 2XEXA 4DV4I 4JI0I 4DR2E 1Z0TA 3PYDA 1H72C 3LPSA 1HNZE 4LFBE 4AQYI 2UUAI 3PYEA 4DV5E 2UXDI 3ZZ0A 2UUBI 3OTOE 1ZM2A 4MYTA 5LL6R 4JV5I 2DEIA 4DV6E 2F4VI 4JYAI 3QT5A 4DR3I 5L3JA 4IZKB 2A2CA 2VQEE 5BR8E 4DU7A 4DR2I 4Z7YA 1HNZI 4LFBI 5LMNE 4LFAE 2BM1A 4DV5I 1USVA 5FLXC 1S16A 3OTOI 1Y4SA 4DR5E 2V2QA 2CGEA 4DV6I 3B82A 2A2DA 1S4EA 4DV0E 2O1WA 1KKHA 2ZM6E 2UU9E 2BM0A 1XMQE 4DXLA 4DUYE 2VQEI 5BR8I 1ZXNA 3PRYA 1B62A 2X36A 5LMNI 4DR1E 3PYFA 3V5RA 3J80Q 2HFUA 4IZJD 2Z5CA 3K85A 5IT9C 4KQVA 4DV0I 4LF7E 3ZM7A 4DUZE 2ZM6I 2UU9I 2HK2A 4LF5E 1EI1A 1XMQI 4HY1A 4DUYI 1A6FA 4USKA 5A2QC 4OX9E 4DV7E 1N36E 3H4LA 4PRVA 2E5LE 4FWGA 4JG4A 3ZKBA 4DR1I 2X7IA 1B63A 4HACA 1KIJA 1RREA 4X66E 2EFGA 1PIEA 1N34E 1Z0VA 2O1VA 3QT7A 3JAMQ 4FW9A 4LF7I 3ZZTA 4DUZI 2J7KA 4LF5I 4I3HA 2NPFA 1NHIA 4JI6E 4B3RE 1KVKA 1Z0GA 3F0NA 4WUBA 1XNQE 1QZRA 3J81Q 4OX9I 4DV7I 1N36I 3Q6NA 4DR4E 1Z5BA 4B3ME 3WU5A 2E5LI 1OJ4A 1PKPA 3J80C 3K1JA 4X66I 1N34I 3LTOA 1KTVA 4JI1E 4B3RI 4JI6I 3HJCA 1J5EE 3M6AA 4EMDA 2HKJA 3ZZUA 4ZVIA 1U2RA 1Z0WA 5IWAE 4DPYA 3QT6A 4DR4I 4B3MI 2GQ0A 1H7SA 2GS8A 1FNMA 4DV2E 2R42A 5IT9Q 4LF8E 3QT8A 3JAMC 1I94E 2LJPA 2HK3A 4JI5E 5A2QQ 1J5EI 4NXNE 4Z7CA 3J81C 1ZXMA 4DV1E 1FWLA 4B3SE 2Z5BB 5IWAI 2DEJA 4YY3E 1IBKE 1H74A 1ZM4A 4PU9A 4IZKA 4DV2I 4LF8I 2O1UA 1NZ0A 1Z5AA 1I94I 4RPFA 4JI8E 1N33E 4UT4A 4DR6E 4JI5I 1Y6ZA 1BKNA 4FWHA 3B8HA 2PNMA 4NXNI 4DV1I 3J7AM 4LFAI 4B3SI 1N0VC 2IOPA 2V2ZA 4DR5I 2UUCE 1USUA 4YY3I 2WW4A 1UEKA 4M1KA 1IBKI 4NXME 1MG7A 1HK7A 1XNRE 1ELOA 4JI8I 1N33I 4ED4A 4P52A 4DR6I 4LFCE 3HULA 2V34A 2V8PA 4URLA 2O1TA 3K17A 4DR7E 1N32E 3T1HE 2Z5EA 2UUCI 4DPTA 4FWDA 4DV3E 5GMDA 4HYMA 4DPXA 1IBME 4JI3E 1FWKA 4NXMI 4P7AA 1XNRI 4MYUA 1NHJA 3Q1QA 1ZM9A 3CWVA 4B3TE 4LFCI 5LMUE 3GONA 2BV3A 4DR7I 1Y4UA 2IOQA 1N32I 2HFSA 2PNLA 1FI4A 1ZM3A 1PVGA 4UTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B B;  2Z5E A;  2Z5C B; 
#chains in the Genus database with same CATH topology
 4DV3 I;  4LF9 E;  1IBM I;  4JI3 I;  4IZJ B;  5FWK A;  2OI2 A;  1RR9 A;  4DU8 A;  5JEA B;  1Z0C A;  2CZ9 A;  2UUA E;  1OYR A;  1XNQ I;  2GO4 A;  4N3O A;  1FKA E;  4B3T I;  5LMU I;  3D4J A;  1XHK A;  5EL9 A;  4X64 E;  4IS9 A;  4MDT A;  5K36 C;  2CG9 A;  4QNJ A;  1WUU A;  1HR0 E;  2C38 B;  4MU1 A;  1DAR A;  4AM3 A;  4K0K E;  4LF9 I;  2C37 B;  2PO1 A;  1UDQ A;  1MU5 A;  4FN5 A;  2NN6 C;  4JI1 I;  3B78 A;  2C39 A;  1R6M A;  1VIS A;  3P3E A;  4X64 I;  1XXE A;  1H73 A;  4LCF A;  5C0X A;  4LF4 E;  1YHC A;  2ZBK B;  4FW5 A;  4GQU A;  5JEA C;  4GKK E;  3UHM A;  1RHY A;  4LPF A;  2ZIT A;  2AJ4 A;  1HR0 I;  2VQF E;  4DPU A;  2HKE A;  4K0K I;  4XTJ A;  4OO1 B;  4JI7 E;  2E1R A;  3P3C A;  2VF3 A;  3L7Z A;  2Z5B A;  4MQY A;  3Q6M A;  1Z0B A;  1Z59 A;  1E3P A;  1MX0 A;  4LF4 I;  4KHP E;  4GKK I;  3GME A;  2Z5C B;  1H7U A;  2PO0 B;  2VQF I;  2UXC E;  1D6T A;  2CVE A;  4X62 E;  2VES A;  2J65 A;  4JI7 I;  2BA0 G;  4WUD A;  1XMO E;  2JE6 A;  2JEB B;  4USM A;  1EA6 A;  4WUC A;  4OO1 C;  4HAC B;  3WU3 A;  4JI2 E;  4KHP I;  4U3B A;  2R3V A;  2V2V A;  1Z0E A;  1FJG E;  1K47 A;  1Z5C A;  5K36 B;  5C0X E;  1IBL E;  4YHH E;  2UXC I;  4GKJ E;  4X62 I;  3PYG A;  4HXZ A;  4JI4 E;  2HHH E;  4LF6 E;  3WU6 A;  2BA1 G;  3PS2 A;  4MU0 A;  5C0X D;  3M7N D;  1XMO I;  5GME A;  4DPW A;  1HNW E;  3T1Y E;  4IFD E;  2UXB E;  2NN6 B;  1N0U A;  3NZK A;  3T1H I;  4X65 E;  2O3Z A;  4JI2 I;  3ZKD A;  2JEA A;  4PRX A;  1HNX E;  4IFD D;  4DV4 E;  1FJG I;  1IBL I;  4JI0 E;  3LNU A;  4BA1 A;  4YHH I;  1NHH A;  4LCG A;  4GKJ I;  4AQY E;  3WU4 A;  2PO2 A;  4JI4 I;  2HHH I;  4LF6 I;  2UXD E;  2Q2E B;  2UUB E;  5FLX Q;  4OZE A;  3P3G A;  3J7A G;  1HNW I;  4JV5 E;  3T1Y I;  2UXB I;  2F4V E;  4JYA E;  5ELW A;  4DR3 E;  2WP8 A;  3V2U C;  4X65 I;  1UDO A;  3P06 A;  4IZJ A;  1HNX I;  2IER A;  5JEA A;  4R1F A;  2XEX A;  4DV4 I;  4JI0 I;  4DR2 E;  1Z0T A;  3PYD A;  1H72 C;  3LPS A;  1HNZ E;  4LFB E;  4AQY I;  2UUA I;  3PYE A;  4DV5 E;  3H1C A;  2UXD I;  3ZZ0 A;  2UUB I;  3OTO E;  1ZM2 A;  4MYT A;  5LL6 R;  4JV5 I;  2DEI A;  4DV6 E;  2F4V I;  2IES A;  4JYA I;  3QT5 A;  4DR3 I;  4FW6 A;  5L3J A;  5EKW A;  4IZK B;  2A2C A;  2VQE E;  5BR8 E;  2GO3 A;  4DU7 A;  4DR2 I;  4IFD A;  4Z7Y A;  1HNZ I;  4LFB I;  5LMN E;  4LFA E;  2BM1 A;  4DV5 I;  1USV A;  5FLX C;  3P76 A;  1S16 A;  5DRO A;  1Y4S A;  3OTO I;  4DR5 E;  2V2Q A;  3PS3 A;  4BA2 B;  2CGE A;  3B82 A;  4DV6 I;  4MU3 A;  1Y60 A;  1S4E A;  2A2D A;  4DV0 E;  2O1W A;  4ISA A;  1KKH A;  2ZM6 E;  2UU9 E;  3M85 D;  2BM0 A;  4AID A;  1XMQ E;  4OO1 A;  4DXL A;  4DUY E;  5C0X F;  2VQE I;  5BR8 I;  5C0X C;  1ZXN A;  3PRY A;  2BA0 D;  5JEA E;  1B62 A;  2X36 A;  5LMN I;  2JE6 B;  4DR1 E;  3PYF A;  3V5R A;  3J80 Q;  4IFD F;  2HFU A;  4IZJ D;  5JEA D;  2Z5C A;  3K85 A;  5IT9 C;  4KQV A;  4DV0 I;  4LF7 E;  3ZM7 A;  4DUZ E;  2ZM6 I;  2UU9 I;  2HK2 A;  4LF5 E;  1EI1 A;  1XMQ I;  3HKM A;  4HY1 A;  4DUY I;  1A6F A;  4USK A;  3DD6 A;  5A2Q C;  4OX9 E;  4DV7 E;  1N36 E;  2BA1 D;  3H4L A;  3CDI A;  4PRV A;  2E5L E;  4LCH A;  4FWG A;  4JG4 A;  4QNK A;  3ZKB A;  2X7I A;  1B63 A;  4HAC A;  4DR1 I;  1KIJ A;  1RRE A;  4X66 E;  2EFG A;  1PIE A;  2WNR A;  1N34 E;  1Z0V A;  1VI7 A;  2O1V A;  3QT7 A;  3JAM Q;  4FW9 A;  2PNZ B;  4LF7 I;  5K36 A;  3ZZT A;  4DUZ I;  2J7K A;  4LF5 I;  4I3H A;  1OYP A;  3U1K A;  2F1D A;  2NPF A;  1NHI A;  4JI6 E;  4B3R E;  1KVK A;  1Z0G A;  3F0N A;  4WUB A;  1XNQ E;  4FW7 A;  1QZR A;  3J81 Q;  2BR2 A;  4OO1 E;  4OX9 I;  4DV7 I;  1N36 I;  3Q6N A;  2NN6 A;  4DR4 E;  1Z5B A;  4B3M E;  3WU5 A;  2E5L I;  1OJ4 A;  1PKP A;  3J80 C;  3K1J A;  4X66 I;  4OO1 D;  4MU4 A;  3GCM A;  4FW3 A;  1N34 I;  4AIM A;  1UDN A;  3LTO A;  4LOM A;  1KTV A;  4JI1 E;  4B3R I;  4JI6 I;  2PO1 B;  3HJC A;  1J5E E;  3PS1 A;  3M6A A;  4EMD A;  2HKJ A;  5K36 F;  3KRN A;  3ZZU A;  4ZVI A;  1U2R A;  2C39 B;  1Z0W A;  5IWA E;  4DPY A;  3QT6 A;  4DR4 I;  4B3M I;  2GQ0 A;  5C0X B;  1H7S A;  2GS8 A;  1FNM A;  2C38 A;  4FW4 A;  4DV2 E;  2R42 A;  3U1Y A;  5IT9 Q;  4LF8 E;  3QT8 A;  3JAM C;  2NN6 F;  1I94 E;  1YH8 A;  2C37 A;  2LJP A;  2HK3 A;  4JI5 E;  5A2Q Q;  5DNX A;  1J5E I;  4NXN E;  5K36 E;  4Z7C A;  3J81 C;  4IFD B;  2AE8 A;  1ZXM A;  4DV1 E;  3L7Z B;  1FWL A;  5JEA F;  4B3S E;  2Z5B B;  5IWA I;  4U3D A;  2DEJ A;  5K36 D;  2JT2 A;  4YY3 E;  1IBK E;  1H74 A;  1ZM4 A;  2NN6 E;  4IZK A;  4PU9 A;  4DV2 I;  4LF8 I;  2O1U A;  1NZ0 A;  1Z5A A;  1Y5Y A;  1I94 I;  3B4T A;  4RPF A;  4JI8 E;  1N33 E;  1UDS A;  4UT4 A;  4DR6 E;  4JI5 I;  1Y6Z A;  1BKN A;  4FWH A;  2NN6 D;  2PNM A;  3B8H A;  4NXN I;  5DRR A;  4DV1 I;  3J7A M;  4LFA I;  4B3S I;  4BA2 A;  1N0V C;  2IOP A;  1PVG A;  1R6L A;  2V2Z A;  4DR5 I;  1E3H A;  1USU A;  2UUC E;  3M85 G;  4YY3 I;  5DNL A;  2WW4 A;  1UEK A;  4M1K A;  2PO0 A;  1IBK I;  4IFD C;  4NXM E;  1MG7 A;  1HK7 A;  1XNR E;  1ELO A;  5DRQ A;  4JI8 I;  1N33 I;  4ED4 A;  4P52 A;  4DR6 I;  4LFC E;  3HUL A;  2V34 A;  2V8P A;  4URL A;  2O1T A;  1P42 A;  3K17 A;  4DR7 E;  2JEB A;  4OO1 F;  1N32 E;  3GLL A;  3T1H E;  2WNR B;  2Z5E A;  4OKG A;  2UUC I;  4DPT A;  4FWD A;  4DV3 E;  5GMD A;  4HYM A;  4DPX A;  1IBM E;  4JI3 E;  4J3D A;  2JEA B;  1FWK A;  4NXM I;  3CDJ A;  4P7A A;  1OYS A;  1XNR I;  4MYU A;  1NHJ A;  3Q1Q A;  4BA1 B;  1ZM9 A;  3CWV A;  4B3T E;  4LFC I;  2BR2 B;  5LMU E;  2PO2 B;  3M7N G;  3GON A;  2BV3 A;  4DR7 I;  1Y4U A;  4NBQ A;  2IOQ A;  1N32 I;  2HFS A;  2PNL A;  5DRP A;  1FI4 A;  2PNZ A;  1ZM3 A;  2WP8 B;  4UTG A; 
#chains in the Genus database with same CATH homology
 4DV3 I;  4LF9 E;  1IBM I;  4JI3 I;  4IZJ B;  5FWK A;  2OI2 A;  1RR9 A;  4DU8 A;  1Z0C A;  2CZ9 A;  2UUA E;  1XNQ I;  4N3O A;  1FKA E;  4B3T I;  5LMU I;  3D4J A;  1XHK A;  4X64 E;  2CG9 A;  1WUU A;  1HR0 E;  1DAR A;  4K0K E;  4LF9 I;  1MU5 A;  4FN5 A;  4JI1 I;  3B78 A;  1VIS A;  4X64 I;  1H73 A;  4LF4 E;  2ZBK B;  4GKK E;  2ZIT A;  2AJ4 A;  1HR0 I;  2VQF E;  4DPU A;  2HKE A;  4K0K I;  4XTJ A;  4JI7 E;  2E1R A;  2VF3 A;  2Z5B A;  3Q6M A;  1Z0B A;  1Z59 A;  1MX0 A;  4LF4 I;  4KHP E;  4GKK I;  2Z5C B;  1H7U A;  2VQF I;  2UXC E;  1D6T A;  4X62 E;  4JI7 I;  4WUD A;  1XMO E;  4USM A;  1EA6 A;  4WUC A;  4HAC B;  3WU3 A;  4JI2 E;  4KHP I;  2R3V A;  2V2V A;  1Z0E A;  1FJG E;  1K47 A;  1Z5C A;  1IBL E;  4YHH E;  2UXC I;  4GKJ E;  4X62 I;  3PYG A;  4HXZ A;  4JI4 E;  2HHH E;  4LF6 E;  3WU6 A;  1XMO I;  5GME A;  4DPW A;  1HNW E;  3T1Y E;  2UXB E;  1N0U A;  3T1H I;  4X65 E;  4JI2 I;  3ZKD A;  4PRX A;  1HNX E;  4DV4 E;  1FJG I;  1IBL I;  4JI0 E;  3LNU A;  4YHH I;  1NHH A;  4GKJ I;  4AQY E;  3WU4 A;  4JI4 I;  2HHH I;  4LF6 I;  2UXD E;  2Q2E B;  2UUB E;  5FLX Q;  3J7A G;  1HNW I;  4JV5 E;  3T1Y I;  2UXB I;  2F4V E;  4JYA E;  4DR3 E;  3V2U C;  4X65 I;  3P06 A;  4IZJ A;  1HNX I;  4R1F A;  2XEX A;  4DV4 I;  4JI0 I;  4DR2 E;  1Z0T A;  3PYD A;  1H72 C;  3LPS A;  1HNZ E;  4LFB E;  4AQY I;  2UUA I;  3PYE A;  4DV5 E;  2UXD I;  3ZZ0 A;  2UUB I;  3OTO E;  1ZM2 A;  4MYT A;  5LL6 R;  4JV5 I;  2DEI A;  4DV6 E;  2F4V I;  4JYA I;  3QT5 A;  4DR3 I;  5L3J A;  4IZK B;  2A2C A;  2VQE E;  5BR8 E;  4DU7 A;  4DR2 I;  4Z7Y A;  1HNZ I;  4LFB I;  5LMN E;  4LFA E;  2BM1 A;  4DV5 I;  1USV A;  5FLX C;  1S16 A;  3OTO I;  1Y4S A;  4DR5 E;  2V2Q A;  2CGE A;  4DV6 I;  3B82 A;  2A2D A;  1S4E A;  4DV0 E;  2O1W A;  1KKH A;  2ZM6 E;  2UU9 E;  2BM0 A;  1XMQ E;  4DXL A;  4DUY E;  2VQE I;  5BR8 I;  1ZXN A;  3PRY A;  1B62 A;  2X36 A;  5LMN I;  4DR1 E;  3PYF A;  3V5R A;  3J80 Q;  2HFU A;  4IZJ D;  2Z5C A;  3K85 A;  5IT9 C;  4KQV A;  4DV0 I;  4LF7 E;  3ZM7 A;  4DUZ E;  2ZM6 I;  2UU9 I;  2HK2 A;  4LF5 E;  1EI1 A;  1XMQ I;  4HY1 A;  4DUY I;  1A6F A;  4USK A;  5A2Q C;  4OX9 E;  4DV7 E;  1N36 E;  3H4L A;  4PRV A;  2E5L E;  4FWG A;  4JG4 A;  3ZKB A;  4DR1 I;  2X7I A;  1B63 A;  4HAC A;  1KIJ A;  1RRE A;  4X66 E;  2EFG A;  1PIE A;  1N34 E;  1Z0V A;  2O1V A;  3QT7 A;  3JAM Q;  4FW9 A;  4LF7 I;  3ZZT A;  4DUZ I;  2J7K A;  4LF5 I;  4I3H A;  2NPF A;  1NHI A;  4JI6 E;  4B3R E;  1KVK A;  1Z0G A;  3F0N A;  4WUB A;  1XNQ E;  1QZR A;  3J81 Q;  4OX9 I;  4DV7 I;  1N36 I;  3Q6N A;  4DR4 E;  1Z5B A;  4B3M E;  3WU5 A;  2E5L I;  1OJ4 A;  1PKP A;  3J80 C;  3K1J A;  4X66 I;  1N34 I;  3LTO A;  1KTV A;  4JI1 E;  4B3R I;  4JI6 I;  3HJC A;  1J5E E;  3M6A A;  4EMD A;  2HKJ A;  3ZZU A;  4ZVI A;  1U2R A;  1Z0W A;  5IWA E;  4DPY A;  3QT6 A;  4DR4 I;  4B3M I;  2GQ0 A;  1H7S A;  2GS8 A;  1FNM A;  4DV2 E;  2R42 A;  5IT9 Q;  4LF8 E;  3QT8 A;  3JAM C;  1I94 E;  2LJP A;  2HK3 A;  4JI5 E;  5A2Q Q;  1J5E I;  4NXN E;  4Z7C A;  3J81 C;  1ZXM A;  4DV1 E;  1FWL A;  4B3S E;  2Z5B B;  5IWA I;  2DEJ A;  4YY3 E;  1IBK E;  1H74 A;  1ZM4 A;  4PU9 A;  4IZK A;  4DV2 I;  4LF8 I;  2O1U A;  1NZ0 A;  1Z5A A;  1I94 I;  4RPF A;  4JI8 E;  1N33 E;  4UT4 A;  4DR6 E;  4JI5 I;  1Y6Z A;  1BKN A;  4FWH A;  3B8H A;  2PNM A;  4NXN I;  4DV1 I;  3J7A M;  4LFA I;  4B3S I;  1N0V C;  2IOP A;  2V2Z A;  4DR5 I;  2UUC E;  1USU A;  4YY3 I;  2WW4 A;  1UEK A;  4M1K A;  1IBK I;  4NXM E;  1MG7 A;  1HK7 A;  1XNR E;  1ELO A;  4JI8 I;  1N33 I;  4ED4 A;  4P52 A;  4DR6 I;  4LFC E;  3HUL A;  2V34 A;  2V8P A;  4URL A;  2O1T A;  3K17 A;  4DR7 E;  1N32 E;  3T1H E;  2Z5E A;  2UUC I;  4DPT A;  4FWD A;  4DV3 E;  5GMD A;  4HYM A;  4DPX A;  1IBM E;  4JI3 E;  1FWK A;  4NXM I;  4P7A A;  1XNR I;  4MYU A;  1NHJ A;  3Q1Q A;  1ZM9 A;  3CWV A;  4B3T E;  4LFC I;  5LMU E;  3GON A;  2BV3 A;  4DR7 I;  1Y4U A;  2IOQ A;  1N32 I;  2HFS A;  2PNL A;  1FI4 A;  1ZM3 A;  1PVG A;  4UTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...