2Z5EA

Crystal structure of proteasome assembling chaperone 3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
122
structure length
122
Chain Sequence
b'MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome Assembling Chaperone 3
molecule tags Chaperone
source organism Homo sapiens
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
total genus 29
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10178 PAC3 Proteasome assembly chaperone 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5eA00
2Z5CB 2Z5EA 2Z5BB
chains in the Genus database with same CATH superfamily
5LMUE 4KHPI 2JEAB 2VQEI 4X62I 5FLXQ 2UXCI 1IBMI 4JYAI 2NN6A 5LMNI 3L7ZA 4JI2I 3CWVA 4ED4A 1ZM2A 1XXEA 2HKEA 4BA1B 5BR8E 1XMQE 5JEAC 3J81Q 2UUAE 2HK2A 3V2UC 1USVA 4AQYI 3NZKA 2UXBE 4FW7A 1H7SA 3J7AG 2WNRB 4K0KI 1IBKI 1E3PA 1U2RA 3LNUA 5JEAE 4DV3E 3PS3A 4OKGA 2UUBI 5C0XF 1XHKA 4DR3I 1UEKA 1KTVA 5LL6R 1H73A 2CVEA 2V2VA 1HNZI 3LTOA 4IFDB 4JYAE 2PO0A 3P3GA 4NBQA 4DR5I 3ZZ0A 4DV6E 2BM1A 1XMOI 4YY3E 4KHPE 4B3ME 1NHIA 1XNRI 1ZM3A 4IZJB 1HR0I 2O1TA 5K36A 5GMEA 2WP8B 4WUBA 5K36D 4LCGA 2CG9A 4JI5I 1Y4SA 5DRPA 4JI8I 3LPSA 4JI4I 3K85A 2NN6B 1OYPA 2HK3A 3WU5A 1Z0WA 1N34I 3L7ZB 2BA1G 1YH8A 4DV0E 1R6LA 2Q2EB 1A6FA 1E3HA 4DV4I 1MU5A 1S16A 4USMA 4OO1B 1N0VC 4GKKE 3HULA 3P76A 3UHMA 1R6MA 1XMQI 2CZ9A 1N33E 4GKKI 2Z5BB 4JI2E 5JEAF 1Z5BA 2DEJA 2PNLA 5LMNE 3T1YE 3Q6NA 4FW4A 4LF5I 3J7AM 5JEAD 2GS8A 4X62E 4DV7I 4LF7E 4IZKA 2R3VA 4B3TI 3GLLA 4LFBI 1HNXE 2JE6A 4WUCA 2BA0D 4ZVIA 2WNRA 3P3EA 4JI8E 4DR4I 4DR2E 4DUYE 2C38A 4DR6E 1N36E 5C0XB 4DV2E 3Q1QA 4FWDA 2E5LI 2AJ4A 3U1KA 4IFDC 4JI0E 4LF8E 5L3JA 4PRXA 3V5RA 1Y6ZA 4DV4E 1XMOE 4DPTA 4LF4E 4DR5E 1UDQA 3J80Q 2PO2A 2BR2A 1B63A 3ZKDA 3JAMC 1N32I 2UU9I 1FJGI 4P52A 2WP8A 2JT2A 2UUBE 2O1UA 1Z59A 2IERA 2UXDE 1IBKE 3PYDA 1Y5YA 2VF3A 4UT4A 4HY1A 1USUA 3WU4A 1J5EI 2PO1A 3QT8A 2JEAA 4MU0A 4BA2A 4LFCI 1XNRE 3QT5A 2BA0G 4B3SE 4RPFA 5C0XC 4IFDD 3ZKBA 4DV6I 4GKJI 4IFDA 4DU8A 1MX0A 1HK7A 3U1YA 2Z5EA 2VQFE 1HNXI 4JI1I 2Z5CB 4LCHA 1ZXMA 4DR1E 1ZXNA 2GQ0A 4LF7I 3M85G 1J5EE 4PU9A 1Y4UA 5GMDA 4FWHA 5ELWA 2PNZA 3ZZUA 3ZM7A 2UXBI 2BR2B 1PKPA 5FLXC 1Z0TA 4Z7CA 1EA6A 2Z5CA 1I94E 1ZM4A 2BV3A 2F4VE 1RREA 5IT9Q 2BA1D 4HXZA 5BR8I 1HNWI 4OO1C 1Z5CA 1MG7A 2C37B 4M1KA 2X36A 2GO3A 3J80C 2UXCE 5C0XD 4JI6I 2VQEE 2V8PA 3GMEA 1WUUA 3T1HI 2J7KA 4X66E 1Z0CA 4AIDA 4U3BA 1HNWE 3PYFA 2C37A 4OO1E 2F1DA 2PO1B 2R42A 4B3RI 4AIMA 4ISAA 1UDSA 4R1FA 4DR6I 1NZ0A 1OYRA 1Z0EA 2NN6E 3GONA 1UDOA 1EI1A 4MU4A 4GQUA 2VQFI 2O1VA 2V2ZA 1RR9A 3T1HE 2C39A 4DR7I 2C38B 4OO1D 4LCFA 4DPWA 1FI4A 4GKJE 4LFAE 2O1WA 4Z7YA 1KKHA 1FKAE 5K36E 1KVKA 1H7UA 4B3SI 1DARA 5DNXA 3WU3A 4JI7I 4X64E 4K0KE 4IFDE 4YHHE 1IBLE 3M7NG 5DRRA 4YHHI 2V2QA 3H4LA 1IBLI 1FWLA 2IESA 2IOQA 1FNMA 5JEAB 4U3DA 4JI1E 1OYSA 4J3DA 2UU9E 2ZBKB 4IZKB 1KIJA 2PNZB 1QZRA 4JI5E 4JV5E 5JEAA 4IS9A 4LF4I 3D4JA 1P42A 4BA1A 1Z0GA 5IWAI 1XNQE 4MU3A 4DPXA 2NN6C 3KRNA 4DV1I 1OJ4A 2HKJA 2ZM6E 2NN6F 3Q6MA 3OTOI 4LPFA 4DUYI 2NN6D 1Z5AA 3B4TA 1D6TA 4USKA 4X65E 4MYTA 1FJGE 4DPUA 4LF9I 4JI3I 4X66I 3B8HA 4JG4A 1ZM9A 4DV3I 3M7ND 3M85D 5K36C 1Z0VA 4DV7E 5EL9A 4NXNE 3CDJA 1N33I 4JI7E 4WUDA 4AQYE 5FWKA 3GCMA 2OI2A 4OO1F 2UUAI 4FW6A 3M6AA 4DV2I 1S4EA 5DROA 1N36I 1FWKA 4QNKA 2XEXA 2JEBA 4DR7E 1Y60A 4DR1I 3K17A 2UUCI 3HKMA 2EFGA 5LMUI 4HACB 4LFBE 1N34E 2HHHE 3PYEA 2JEBB 2A2CA 2A2DA 1VI7A 2J65A 3DD6A 2GO4A 4HACA 4XTJA 2PO0B 4DV1E 5K36F 4DXLA 3HJCA 3PS2A 4DV5I 4B3MI 1PVGA 2WW4A 5IWAE 1XNQI 4NXNI 2LJPA 4JI6E 4FW9A 4DV0I 2C39B 4FW3A 2UXDI 4DU7A 4MDTA 2VESA 4LF6E 1N32E 4DR3E 2BM0A 1H74A 1N0UA 2JE6B 4KQVA 1VISA 1NHHA 4NXME 5C0XA 1UDNA 2IOPA 3OTOE 3F0NA 3B78A 3B82A 4X64I 3K1JA 4JI0I 4LF8I 5C0XE 1HR0E 5DRQA 4AM3A 3PYGA 4YY3I 2DEIA 3P06A 4I3HA 4OZEA 2HFSA 4JV5I 4DR4E 1IBME 1H72C 2V34A 2ZITA 1ELOA 5IT9C 1HNZE 2PNMA 2HHHI 2PO2B 3J81C 3WU6A 2HFUA 1YHCA 4B3TE 3CDIA 1Z0BA 4LFCE 2UUCE 3PS1A 4OO1A 4UTGA 1PIEA 3T1YI 4LF5E 1BKNA 2AE8A 4NXMI 4IFDF 4P7AA 5EKWA 2E1RA 4LOMA 4IZJD 4MYUA 1RHYA 4QNJA 4BA2B 4LFAI 4OX9E 4LF6I 4IZJA 1B62A 4MQYA 4FN5A 2Z5BA 4DPYA 5A2QQ 4DUZE 2CGEA 4N3OA 4HYMA 1NHJA 3H1CA 5K36B 4FWGA 1K47A 4DUZI 4MU1A 4JI3E 4LF9E 4DV5E 4OX9I 3P3CA 3PRYA 4X65I 2E5LE 4JI4E 1I94I 2NPFA 2F4VI 4FW5A 5DNLA 4PRVA 2O3ZA 2ZM6I 4URLA 3ZZTA 4DR2I 3QT6A 3QT7A 4B3RE 3JAMQ 2X7IA 4EMDA 5A2QC
chains in the Genus database with same CATH topology
5LMUE 4KHPI 2VQEI 4X62I 5FLXQ 2UXCI 1IBMI 4JYAI 5LMNI 4JI2I 3CWVA 4ED4A 1ZM2A 2HKEA 1XMQE 5BR8E 3J81Q 2UUAE 2HK2A 3V2UC 1USVA 4AQYI 2UXBE 3J7AG 1H7SA 4K0KI 1IBKI 1U2RA 3LNUA 4DV3E 2UUBI 1XHKA 4DR3I 1UEKA 1KTVA 5LL6R 1H73A 2V2VA 1HNZI 3LTOA 4JYAE 4DR5I 3ZZ0A 4DV6E 2BM1A 1XMOI 4YY3E 4KHPE 4B3ME 1NHIA 1XNRI 1ZM3A 4IZJB 1HR0I 2O1TA 5GMEA 4WUBA 2CG9A 4JI5I 1Y4SA 4JI8I 3LPSA 4JI4I 3K85A 2HK3A 3WU5A 1Z0WA 1N34I 4DV0E 2Q2EB 1A6FA 4DV4I 1MU5A 1S16A 4USMA 1N0VC 4GKKE 3HULA 1XMQI 2CZ9A 1N33E 4GKKI 2Z5BB 4JI2E 1Z5BA 2DEJA 2PNLA 5LMNE 3T1YE 3Q6NA 4LF5I 3J7AM 2GS8A 4X62E 4DV7I 4LF7E 4IZKA 2R3VA 4B3TI 4LFBI 1HNXE 4WUCA 4ZVIA 4JI8E 4DR4I 4DR2E 4DUYE 4DR6E 1N36E 4DV2E 3Q1QA 4FWDA 2E5LI 2AJ4A 4JI0E 4LF8E 5L3JA 4PRXA 3V5RA 1Y6ZA 4DV4E 1XMOE 4DPTA 4LF4E 4DR5E 3J80Q 3ZKDA 1B63A 3JAMC 1N32I 2UU9I 1FJGI 4P52A 2UUBE 2O1UA 1Z59A 2UXDE 1IBKE 3PYDA 2VF3A 4UT4A 4HY1A 1USUA 3WU4A 1J5EI 3QT8A 4LFCI 1XNRE 3QT5A 4B3SE 4RPFA 3ZKBA 4DV6I 4GKJI 4DU8A 1MX0A 1HK7A 2VQFE 2Z5EA 1HNXI 4JI1I 2Z5CB 1ZXMA 4DR1E 1ZXNA 2GQ0A 4LF7I 1J5EE 4PU9A 1Y4UA 5GMDA 4FWHA 3ZZUA 3ZM7A 2UXBI 1PKPA 5FLXC 1Z0TA 4Z7CA 1EA6A 2Z5CA 1I94E 1ZM4A 2BV3A 2F4VE 1RREA 5IT9Q 4HXZA 5BR8I 1HNWI 1Z5CA 1MG7A 4M1KA 2X36A 3J80C 2UXCE 4JI6I 2VQEE 2V8PA 1WUUA 3T1HI 2J7KA 4X66E 1Z0CA 1HNWE 3PYFA 2R42A 4B3RI 4R1FA 4DR6I 1NZ0A 1Z0EA 3GONA 1EI1A 2VQFI 2O1VA 2V2ZA 1RR9A 3T1HE 4DR7I 4DPWA 1FI4A 4GKJE 4LFAE 2O1WA 4Z7YA 1KKHA 1FKAE 1KVKA 1H7UA 4B3SI 1DARA 3WU3A 4JI7I 4X64E 4K0KE 4YHHE 1IBLE 1IBLI 4YHHI 2V2QA 3H4LA 1FWLA 2IOQA 1FNMA 4JI1E 2UU9E 2ZBKB 4IZKB 1KIJA 1QZRA 4JI5E 4JV5E 4LF4I 3D4JA 5IWAI 1Z0GA 1XNQE 4DPXA 4DV1I 1OJ4A 2HKJA 2ZM6E 3Q6MA 3OTOI 4DUYI 1Z5AA 1D6TA 4USKA 4X65E 4MYTA 1FJGE 4DPUA 4LF9I 4JI3I 4X66I 3B8HA 4JG4A 1ZM9A 4DV3I 1Z0VA 4DV7E 4NXNE 1N33I 4JI7E 4WUDA 4AQYE 5FWKA 2OI2A 2UUAI 3M6AA 4DV2I 1S4EA 1N36I 1FWKA 2XEXA 4DR7E 4DR1I 3K17A 2UUCI 2EFGA 5LMUI 4HACB 4LFBE 1N34E 2HHHE 3PYEA 2A2CA 2A2DA 4HACA 4XTJA 4DV1E 4DXLA 3HJCA 4DV5I 4B3MI 1PVGA 2WW4A 5IWAE 1XNQI 4NXNI 2LJPA 4JI6E 4FW9A 4DV0I 2UXDI 4DU7A 4LF6E 1N32E 4DR3E 2BM0A 1H74A 1N0UA 4KQVA 1VISA 1NHHA 4NXME 2IOPA 3OTOE 3F0NA 3B78A 3B82A 4X64I 3K1JA 4JI0I 4LF8I 1HR0E 3PYGA 4YY3I 2DEIA 3P06A 4I3HA 2HFSA 4JV5I 4DR4E 1IBME 1H72C 2V34A 2ZITA 1ELOA 5IT9C 1HNZE 2PNMA 2HHHI 3J81C 3WU6A 2HFUA 4B3TE 1Z0BA 4LFCE 2UUCE 4UTGA 3T1YI 1PIEA 4LF5E 1BKNA 4NXMI 4P7AA 2E1RA 4IZJD 4MYUA 4LFAI 4OX9E 4LF6I 4IZJA 1B62A 4DPYA 4FN5A 2Z5BA 5A2QQ 4DUZE 2CGEA 4HYMA 1NHJA 4N3OA 4FWGA 1K47A 4DUZI 4JI3E 4LF9E 4DV5E 4OX9I 3PRYA 4X65I 2E5LE 4JI4E 1I94I 2NPFA 2F4VI 4PRVA 2ZM6I 4URLA 3ZZTA 4DR2I 3QT6A 3QT7A 4B3RE 3JAMQ 2X7IA 4EMDA 5A2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C B;  2Z5E A;  2Z5B B; 
#chains in the Genus database with same CATH topology
 5LMU E;  4KHP I;  2JEA B;  2VQE I;  4X62 I;  5FLX Q;  2UXC I;  1IBM I;  4JYA I;  2NN6 A;  5LMN I;  3L7Z A;  4JI2 I;  3CWV A;  4ED4 A;  1ZM2 A;  1XXE A;  2HKE A;  4BA1 B;  5BR8 E;  1XMQ E;  5JEA C;  3J81 Q;  2UUA E;  2HK2 A;  3V2U C;  1USV A;  4AQY I;  3NZK A;  2UXB E;  4FW7 A;  1H7S A;  3J7A G;  2WNR B;  4K0K I;  1IBK I;  1E3P A;  1U2R A;  3LNU A;  5JEA E;  4DV3 E;  3PS3 A;  4OKG A;  2UUB I;  5C0X F;  1XHK A;  4DR3 I;  1UEK A;  1KTV A;  5LL6 R;  1H73 A;  2CVE A;  2V2V A;  1HNZ I;  3LTO A;  4IFD B;  4JYA E;  2PO0 A;  3P3G A;  4NBQ A;  4DR5 I;  3ZZ0 A;  4DV6 E;  2BM1 A;  1XMO I;  4YY3 E;  4KHP E;  4B3M E;  1NHI A;  1XNR I;  1ZM3 A;  4IZJ B;  1HR0 I;  2O1T A;  5K36 A;  5GME A;  2WP8 B;  4WUB A;  5K36 D;  4LCG A;  2CG9 A;  4JI5 I;  1Y4S A;  5DRP A;  4JI8 I;  3LPS A;  4JI4 I;  3K85 A;  2NN6 B;  1OYP A;  2HK3 A;  3WU5 A;  1Z0W A;  1N34 I;  3L7Z B;  2BA1 G;  1YH8 A;  4DV0 E;  1R6L A;  2Q2E B;  1A6F A;  1E3H A;  4DV4 I;  1MU5 A;  1S16 A;  4USM A;  4OO1 B;  1N0V C;  4GKK E;  3HUL A;  3P76 A;  3UHM A;  1R6M A;  1XMQ I;  2CZ9 A;  1N33 E;  4GKK I;  2Z5B B;  4JI2 E;  5JEA F;  1Z5B A;  2DEJ A;  2PNL A;  5LMN E;  3T1Y E;  3Q6N A;  4FW4 A;  4LF5 I;  3J7A M;  5JEA D;  2GS8 A;  4X62 E;  4DV7 I;  4LF7 E;  4IZK A;  2R3V A;  4B3T I;  3GLL A;  4LFB I;  1HNX E;  2JE6 A;  4WUC A;  2BA0 D;  4ZVI A;  2WNR A;  3P3E A;  4JI8 E;  4DR4 I;  4DR2 E;  4DUY E;  2C38 A;  4DR6 E;  1N36 E;  5C0X B;  4DV2 E;  3Q1Q A;  4FWD A;  2E5L I;  2AJ4 A;  3U1K A;  4IFD C;  4JI0 E;  4LF8 E;  5L3J A;  4PRX A;  3V5R A;  1Y6Z A;  4DV4 E;  1XMO E;  4DPT A;  4LF4 E;  4DR5 E;  1UDQ A;  3J80 Q;  2PO2 A;  2BR2 A;  1B63 A;  3ZKD A;  3JAM C;  1N32 I;  2UU9 I;  1FJG I;  4P52 A;  2WP8 A;  2JT2 A;  2UUB E;  2O1U A;  1Z59 A;  2IER A;  2UXD E;  1IBK E;  3PYD A;  1Y5Y A;  2VF3 A;  4UT4 A;  4HY1 A;  1USU A;  3WU4 A;  1J5E I;  2PO1 A;  3QT8 A;  2JEA A;  4MU0 A;  4BA2 A;  4LFC I;  1XNR E;  3QT5 A;  2BA0 G;  4B3S E;  4RPF A;  5C0X C;  4IFD D;  3ZKB A;  4DV6 I;  4GKJ I;  4IFD A;  4DU8 A;  1MX0 A;  1HK7 A;  3U1Y A;  2Z5E A;  2VQF E;  1HNX I;  4JI1 I;  2Z5C B;  4LCH A;  1ZXM A;  4DR1 E;  1ZXN A;  2GQ0 A;  4LF7 I;  3M85 G;  1J5E E;  4PU9 A;  1Y4U A;  5GMD A;  4FWH A;  5ELW A;  2PNZ A;  3ZZU A;  3ZM7 A;  2UXB I;  2BR2 B;  1PKP A;  5FLX C;  1Z0T A;  4Z7C A;  1EA6 A;  2Z5C A;  1I94 E;  1ZM4 A;  2BV3 A;  2F4V E;  1RRE A;  5IT9 Q;  2BA1 D;  4HXZ A;  5BR8 I;  1HNW I;  4OO1 C;  1Z5C A;  1MG7 A;  2C37 B;  4M1K A;  2X36 A;  2GO3 A;  3J80 C;  2UXC E;  5C0X D;  4JI6 I;  2VQE E;  2V8P A;  3GME A;  1WUU A;  3T1H I;  2J7K A;  4X66 E;  1Z0C A;  4AID A;  4U3B A;  1HNW E;  3PYF A;  2C37 A;  4OO1 E;  2F1D A;  2PO1 B;  2R42 A;  4B3R I;  4AIM A;  4ISA A;  1UDS A;  4R1F A;  4DR6 I;  1NZ0 A;  1OYR A;  1Z0E A;  2NN6 E;  3GON A;  1UDO A;  1EI1 A;  4MU4 A;  4GQU A;  2VQF I;  2O1V A;  2V2Z A;  1RR9 A;  3T1H E;  2C39 A;  4DR7 I;  2C38 B;  4OO1 D;  4LCF A;  4DPW A;  1FI4 A;  4GKJ E;  4LFA E;  2O1W A;  4Z7Y A;  1KKH A;  1FKA E;  5K36 E;  1KVK A;  1H7U A;  4B3S I;  1DAR A;  5DNX A;  3WU3 A;  4JI7 I;  4X64 E;  4K0K E;  4IFD E;  4YHH E;  1IBL E;  3M7N G;  5DRR A;  4YHH I;  2V2Q A;  3H4L A;  1IBL I;  1FWL A;  2IES A;  2IOQ A;  1FNM A;  5JEA B;  4U3D A;  4JI1 E;  1OYS A;  4J3D A;  2UU9 E;  2ZBK B;  4IZK B;  1KIJ A;  2PNZ B;  1QZR A;  4JI5 E;  4JV5 E;  5JEA A;  4IS9 A;  4LF4 I;  3D4J A;  1P42 A;  4BA1 A;  1Z0G A;  5IWA I;  1XNQ E;  4MU3 A;  4DPX A;  2NN6 C;  3KRN A;  4DV1 I;  1OJ4 A;  2HKJ A;  2ZM6 E;  2NN6 F;  3Q6M A;  3OTO I;  4LPF A;  4DUY I;  2NN6 D;  1Z5A A;  3B4T A;  1D6T A;  4USK A;  4X65 E;  4MYT A;  1FJG E;  4DPU A;  4LF9 I;  4JI3 I;  4X66 I;  3B8H A;  4JG4 A;  1ZM9 A;  4DV3 I;  3M7N D;  3M85 D;  5K36 C;  1Z0V A;  4DV7 E;  5EL9 A;  4NXN E;  3CDJ A;  1N33 I;  4JI7 E;  4WUD A;  4AQY E;  5FWK A;  3GCM A;  2OI2 A;  4OO1 F;  2UUA I;  4FW6 A;  3M6A A;  4DV2 I;  1S4E A;  5DRO A;  1N36 I;  1FWK A;  4QNK A;  2XEX A;  2JEB A;  4DR7 E;  1Y60 A;  4DR1 I;  3K17 A;  2UUC I;  3HKM A;  2EFG A;  5LMU I;  4HAC B;  4LFB E;  1N34 E;  2HHH E;  3PYE A;  2JEB B;  2A2C A;  2A2D A;  1VI7 A;  2J65 A;  3DD6 A;  2GO4 A;  4HAC A;  4XTJ A;  2PO0 B;  4DV1 E;  5K36 F;  4DXL A;  3HJC A;  3PS2 A;  4DV5 I;  4B3M I;  1PVG A;  2WW4 A;  5IWA E;  1XNQ I;  4NXN I;  2LJP A;  4JI6 E;  4FW9 A;  4DV0 I;  2C39 B;  4FW3 A;  2UXD I;  4DU7 A;  4MDT A;  2VES A;  4LF6 E;  1N32 E;  4DR3 E;  2BM0 A;  1H74 A;  1N0U A;  2JE6 B;  4KQV A;  1VIS A;  1NHH A;  4NXM E;  5C0X A;  1UDN A;  2IOP A;  3OTO E;  3F0N A;  3B78 A;  3B82 A;  4X64 I;  3K1J A;  4JI0 I;  4LF8 I;  5C0X E;  1HR0 E;  5DRQ A;  4AM3 A;  3PYG A;  4YY3 I;  2DEI A;  3P06 A;  4I3H A;  4OZE A;  2HFS A;  4JV5 I;  4DR4 E;  1IBM E;  1H72 C;  2V34 A;  2ZIT A;  1ELO A;  5IT9 C;  1HNZ E;  2PNM A;  2HHH I;  2PO2 B;  3J81 C;  3WU6 A;  2HFU A;  1YHC A;  4B3T E;  3CDI A;  1Z0B A;  4LFC E;  2UUC E;  3PS1 A;  4OO1 A;  4UTG A;  1PIE A;  3T1Y I;  4LF5 E;  1BKN A;  2AE8 A;  4NXM I;  4IFD F;  4P7A A;  5EKW A;  2E1R A;  4LOM A;  4IZJ D;  4MYU A;  1RHY A;  4QNJ A;  4BA2 B;  4LFA I;  4OX9 E;  4LF6 I;  4IZJ A;  1B62 A;  4MQY A;  4FN5 A;  2Z5B A;  4DPY A;  5A2Q Q;  4DUZ E;  2CGE A;  4N3O A;  4HYM A;  1NHJ A;  3H1C A;  5K36 B;  4FWG A;  1K47 A;  4DUZ I;  4MU1 A;  4JI3 E;  4LF9 E;  4DV5 E;  4OX9 I;  3P3C A;  3PRY A;  4X65 I;  2E5L E;  4JI4 E;  1I94 I;  2NPF A;  2F4V I;  4FW5 A;  5DNL A;  4PRV A;  2O3Z A;  2ZM6 I;  4URL A;  3ZZT A;  4DR2 I;  3QT6 A;  3QT7 A;  4B3R E;  3JAM Q;  2X7I A;  4EMD A;  5A2Q C; 
#chains in the Genus database with same CATH homology
 5LMU E;  4KHP I;  2VQE I;  4X62 I;  5FLX Q;  2UXC I;  1IBM I;  4JYA I;  5LMN I;  4JI2 I;  3CWV A;  4ED4 A;  1ZM2 A;  2HKE A;  1XMQ E;  5BR8 E;  3J81 Q;  2UUA E;  2HK2 A;  3V2U C;  1USV A;  4AQY I;  2UXB E;  3J7A G;  1H7S A;  4K0K I;  1IBK I;  1U2R A;  3LNU A;  4DV3 E;  2UUB I;  1XHK A;  4DR3 I;  1UEK A;  1KTV A;  5LL6 R;  1H73 A;  2V2V A;  1HNZ I;  3LTO A;  4JYA E;  4DR5 I;  3ZZ0 A;  4DV6 E;  2BM1 A;  1XMO I;  4YY3 E;  4KHP E;  4B3M E;  1NHI A;  1XNR I;  1ZM3 A;  4IZJ B;  1HR0 I;  2O1T A;  5GME A;  4WUB A;  2CG9 A;  4JI5 I;  1Y4S A;  4JI8 I;  3LPS A;  4JI4 I;  3K85 A;  2HK3 A;  3WU5 A;  1Z0W A;  1N34 I;  4DV0 E;  2Q2E B;  1A6F A;  4DV4 I;  1MU5 A;  1S16 A;  4USM A;  1N0V C;  4GKK E;  3HUL A;  1XMQ I;  2CZ9 A;  1N33 E;  4GKK I;  2Z5B B;  4JI2 E;  1Z5B A;  2DEJ A;  2PNL A;  5LMN E;  3T1Y E;  3Q6N A;  4LF5 I;  3J7A M;  2GS8 A;  4X62 E;  4DV7 I;  4LF7 E;  4IZK A;  2R3V A;  4B3T I;  4LFB I;  1HNX E;  4WUC A;  4ZVI A;  4JI8 E;  4DR4 I;  4DR2 E;  4DUY E;  4DR6 E;  1N36 E;  4DV2 E;  3Q1Q A;  4FWD A;  2E5L I;  2AJ4 A;  4JI0 E;  4LF8 E;  5L3J A;  4PRX A;  3V5R A;  1Y6Z A;  4DV4 E;  1XMO E;  4DPT A;  4LF4 E;  4DR5 E;  3J80 Q;  3ZKD A;  1B63 A;  3JAM C;  1N32 I;  2UU9 I;  1FJG I;  4P52 A;  2UUB E;  2O1U A;  1Z59 A;  2UXD E;  1IBK E;  3PYD A;  2VF3 A;  4UT4 A;  4HY1 A;  1USU A;  3WU4 A;  1J5E I;  3QT8 A;  4LFC I;  1XNR E;  3QT5 A;  4B3S E;  4RPF A;  3ZKB A;  4DV6 I;  4GKJ I;  4DU8 A;  1MX0 A;  1HK7 A;  2VQF E;  2Z5E A;  1HNX I;  4JI1 I;  2Z5C B;  1ZXM A;  4DR1 E;  1ZXN A;  2GQ0 A;  4LF7 I;  1J5E E;  4PU9 A;  1Y4U A;  5GMD A;  4FWH A;  3ZZU A;  3ZM7 A;  2UXB I;  1PKP A;  5FLX C;  1Z0T A;  4Z7C A;  1EA6 A;  2Z5C A;  1I94 E;  1ZM4 A;  2BV3 A;  2F4V E;  1RRE A;  5IT9 Q;  4HXZ A;  5BR8 I;  1HNW I;  1Z5C A;  1MG7 A;  4M1K A;  2X36 A;  3J80 C;  2UXC E;  4JI6 I;  2VQE E;  2V8P A;  1WUU A;  3T1H I;  2J7K A;  4X66 E;  1Z0C A;  1HNW E;  3PYF A;  2R42 A;  4B3R I;  4R1F A;  4DR6 I;  1NZ0 A;  1Z0E A;  3GON A;  1EI1 A;  2VQF I;  2O1V A;  2V2Z A;  1RR9 A;  3T1H E;  4DR7 I;  4DPW A;  1FI4 A;  4GKJ E;  4LFA E;  2O1W A;  4Z7Y A;  1KKH A;  1FKA E;  1KVK A;  1H7U A;  4B3S I;  1DAR A;  3WU3 A;  4JI7 I;  4X64 E;  4K0K E;  4YHH E;  1IBL E;  1IBL I;  4YHH I;  2V2Q A;  3H4L A;  1FWL A;  2IOQ A;  1FNM A;  4JI1 E;  2UU9 E;  2ZBK B;  4IZK B;  1KIJ A;  1QZR A;  4JI5 E;  4JV5 E;  4LF4 I;  3D4J A;  5IWA I;  1Z0G A;  1XNQ E;  4DPX A;  4DV1 I;  1OJ4 A;  2HKJ A;  2ZM6 E;  3Q6M A;  3OTO I;  4DUY I;  1Z5A A;  1D6T A;  4USK A;  4X65 E;  4MYT A;  1FJG E;  4DPU A;  4LF9 I;  4JI3 I;  4X66 I;  3B8H A;  4JG4 A;  1ZM9 A;  4DV3 I;  1Z0V A;  4DV7 E;  4NXN E;  1N33 I;  4JI7 E;  4WUD A;  4AQY E;  5FWK A;  2OI2 A;  2UUA I;  3M6A A;  4DV2 I;  1S4E A;  1N36 I;  1FWK A;  2XEX A;  4DR7 E;  4DR1 I;  3K17 A;  2UUC I;  2EFG A;  5LMU I;  4HAC B;  4LFB E;  1N34 E;  2HHH E;  3PYE A;  2A2C A;  2A2D A;  4HAC A;  4XTJ A;  4DV1 E;  4DXL A;  3HJC A;  4DV5 I;  4B3M I;  1PVG A;  2WW4 A;  5IWA E;  1XNQ I;  4NXN I;  2LJP A;  4JI6 E;  4FW9 A;  4DV0 I;  2UXD I;  4DU7 A;  4LF6 E;  1N32 E;  4DR3 E;  2BM0 A;  1H74 A;  1N0U A;  4KQV A;  1VIS A;  1NHH A;  4NXM E;  2IOP A;  3OTO E;  3F0N A;  3B78 A;  3B82 A;  4X64 I;  3K1J A;  4JI0 I;  4LF8 I;  1HR0 E;  3PYG A;  4YY3 I;  2DEI A;  3P06 A;  4I3H A;  2HFS A;  4JV5 I;  4DR4 E;  1IBM E;  1H72 C;  2V34 A;  2ZIT A;  1ELO A;  5IT9 C;  1HNZ E;  2PNM A;  2HHH I;  3J81 C;  3WU6 A;  2HFU A;  4B3T E;  1Z0B A;  4LFC E;  2UUC E;  4UTG A;  3T1Y I;  1PIE A;  4LF5 E;  1BKN A;  4NXM I;  4P7A A;  2E1R A;  4IZJ D;  4MYU A;  4LFA I;  4OX9 E;  4LF6 I;  4IZJ A;  1B62 A;  4DPY A;  4FN5 A;  2Z5B A;  5A2Q Q;  4DUZ E;  2CGE A;  4HYM A;  1NHJ A;  4N3O A;  4FWG A;  1K47 A;  4DUZ I;  4JI3 E;  4LF9 E;  4DV5 E;  4OX9 I;  3PRY A;  4X65 I;  2E5L E;  4JI4 E;  1I94 I;  2NPF A;  2F4V I;  4PRV A;  2ZM6 I;  4URL A;  3ZZT A;  4DR2 I;  3QT6 A;  3QT7 A;  4B3R E;  3JAM Q;  2X7I A;  4EMD A;  5A2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...