4X66E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x66E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66E02
4DR5E 2LBSB 4JI8E 3H4LA 2UXDI 4M2ZA 2NUEA 4LF6I 1DARA 2V2QA 5LMUI 1S16A 4X65I 1FJGI 4YHHE 2V34A 2DIXA 4LF7I 3WU6A 4DV3E 2XEXA 2A2DA 4LF5I 4DV5I 2UXBI 2WW4A 1UEKA 3CWVA 4DPXA 4DV6E 2YT4A 1MX0A 1RR9A 2EFGA 1T4NA 1ELOA 1Z0CA 1KVKA 3HTXA 3QT5A 4JI0E 4JG4A 2L2MA 1KIJA 3PYEA 4DR7E 4LFAI 4HACB 3QT6A 5BR8I 4FWHA 4JI3I 4HACA 4DV2I 4X66I 1GQEA 1NZ0A 2JVAA 1PKPA 2LTRA 2DEIA 3OTOI 3J81Q 3ADJA 3T1HI 1XNRE 4PRVA 1YYKA 4DR2I 1IBMI 1Z5BA 4MYUA 2LUPB 1H74A 1HNXE 1IBKE 2VQFE 2UUCE 4DU8A 5A2QC 4FWDA 5LMNI 3LLHA 4DV7E 4DU7A 4X62E 1NHHA 4DPYA 2BM0A 4DV0I 4B3SE 4ED4A 4NXMI 2UXCI 5IT9Q 2UUAE 1HNZE 1B63A 1MG7A 4PRXA 2HKJA 3J7Yp 4DPWA 1N0UA 1YYWA 4KHPE 1YZ9A 2A2CA 4B3TI 4DV4I 4WFTA 2UUBI 5IWAI 1UILA 2LUQA 4JI4E 4LF8E 3JAMC 2UXDE 3ZZTA 4AQYI 2HFSA 3J80Q 4DKKA 4LF6E 1A6FA 1N32I 2NPFA 2HHHI 2BM1A 2NUFA 2ZM6E 1X47A 3PYFA 2BV3A 2B7VA 5LMUE 2HFUA 4X65E 3B78A 4LF7E 1BKNA 1KTVA 4EMDA 1KKHA 2CZ9A 4LF5E 4DV5E 2HK3A 2UXBE 4JI2I 1UHZA 4DR1E 3D4JA 4UT4A 2B3TB 1DI2A 4B3RI 1XHKA 4JV5E 2V8PA 1O0WA 2LRSA 1N33I 1I94I 4FW9A 1ZBTA 1FI4A 4K0KI 5GMDA 1T4OA 1EKZA 4JI1I 1H7SA 4NXNI 4DUZE 4DR4E 1J26A 4DV2E 1QU6A 4X66E 4B3MI 3T1YE 3OTOE 3T1HE 4Z7CA 5FLXC 3ADGA 1T4LB 4LFCI 4LF9I 4LF4E 4DR2E 1FWLA 1Z0GA 1IBME 3B82A 4JI6I 1VISA 1NHIA 1ZXMA 2R42A 4M1KA 2LTSA 4URLA 4DUYI 2L3JA 4MYTA 4OX9I 4HYMA 1Z5CA 2KHXA 4DV1E 4NXME 4YY3E 4ZVIA 2ZBKB 2V2ZA 2LJHA 2DB2A 1FKAE 3ADLA 1XMOI 4DPTA 4YHHI 1XNQI 4B3TE 4DV4E 2UUBE 4WYQB 5IWAE 1J5EE 2CPNA 4AQYE 2NA2A 2HHHE 2R3VA 3M6AA 3B8HA 4DPUA 4P52A 4DR6E 4JI7I 1N34I 1WHQA 1FNMA 4JI0I 1Z0TA 2L2NA 5L3JA 2UU9I 4DR7I 3WU3A 2VQEI 2HKEA 2DMYA 3P1XA 1RQ0A 4JYAI 3C4BA 2L2KB 2RSMA 3VYYA 1XMQI 4X8WA 4UTGA 1N33E 1IBLI 1I94E 1XNRI 2X36A 1Z5AA 5A2QQ 2IHR1 4K0KE 2RS7A 3LNUA 2LJPA 4HY1A 4JI1E 3C4TA 2VF3A 1FJGE 4FWGA 1D6TA 2RS6A 2F4VI 1HNXI 1Z0BA 2L33A 4X64I 2E5LI 2HK2A 1WUUA 4LFCE 1EI1A 1QZRA 3WU4A 1HNZI 1FWKA 4JI6E 2UUAI 2JY9A 2N3GA 3QT7A 3JAMQ 4LFAE 5BR8E 4JI3E 1PVGA 4DUYE 2B7TA 4OX9E 4USKA 4KQVA 1HNWI 5CFFE 4HXZA 3ZKBA 1N36I 4GKJI 4JI4I 4LF8I 4WUCA 1ZM3A 5GMEA 1ZM2A 3V2UC 4R1FA 2J7KA 3ZM7A 4DR3I 1HR0I 2AJ4A 2ZM6I 1XMOE 4LFBI 1XNQE 4JI5I 3J81C 1ZM4A 3WU5A 4GKKI 4PU9A 1RREA 3VYXA 5LMNE 3F0NA 4USMA 4WUBA 1X48A 4DR1I 3LTOA 2ZITA 1U2RA 4DV0E 4XTJA 4DR5I 2UXCE 1B62A 2NUGA 4JI8I 4JV5I 4JI7E 1WHNA 1N34E 3HULA 1NHJA 2UU9E 4DXLA 3PYDA 3K17A 2VQEE 5IT9C 4M30A 4DUZI 4DR4I 3ADIA 2DEJA 5FLXQ 4DV3I 3ZKDA 1EA6A 4JYAE 1XMQE 3T1YI 4DV6I 1IBLE 2EZ6A 1Z59A 1N32E 4WUDA 2OI2A 1H72C 4LF4I 2F4VE 3J7AG 3LPSA 4FN5A 3J80C 1ZM9A 4JI2E 4X64E 2Q2EB 1N0VC 2E5LE 2GS8A 1K47A 3Q1QA 4B3RE 3QT8A 4DV1I 4YY3I 1RC7A 3GONA 2V2VA 2RTXA 2X7IA 3K1JA 3V5RA 4NXNE 4OOGC 1Z0WA 5LL6R 1YYOA 2MDRA 1STUA 1Z0VA 1H7UA 3PYGA 1Z0EA 1IBKI 1HNWE 2L3CA 2VQFI 1PIEA 2UUCI 1X49A 1N36E 1S4EA 1H73A 3J7AM 4GKJE 4B3ME 4DV7I 3ZZUA 1J5EI 4Z7YA 4X62I 4DR3E 1HR0E 1OJ4A 1MU5A 2N3HA 4LF9E 4B3SI 4P7AA 4LFBE 4DR6I 4JI5E 3ZZ0A 4GKKE 4RPFA 4KHPI 2E1RA 1ZXNA 4I3HA
chains in the Genus database with same CATH superfamily
4DR5E 2LBSB 4JI8E 3H4LA 5T6JA 2E1MA 3MHSC 2UXDI 2YPNA 2JPAA 4ZYEA 4M2ZA 4NBQA 2NUEA 4LF6I 1DARA 4OO1D 2K7IA 2V2QA 5LMUI 1S16A 1EH8A 4X65I 4IFDB 4YHHE 2V34A 4IFDE 1FJGI 2DIXA 2ODRC 4ZYDA 3WU6A 4LF7I 5DNXA 5IV8B 4DV3E 2XEXA 2YTPA 2A2DA 1G2FC 4IFDA 4BS9A 3BBGA 3EPHA 5JEAC 4R2DA 2EN2A 2YZTA 4LF5I 1SR9A 4DV5I 2WBTA 2UXBI 2NN6D 3U1KA 1USVA 2WW4A 2M7QA 1UEKA 3CWVA 4DPXA 4DV6E 4NHRA 2YT4A 1MX0A 1RR9A 2ENAA 2EFGA 1X6HA 1T4NA 1P42A 2JEBB 4IZJD 1ELOA 1BB8A 5EL9A 2EPNA 2M1SA 2JP9A 1Z0CA 2CT1A 3IWDA 1IQSA 1KVKA 3K6QA 3HTXA 2JEBA 3QT5A 2LT7A 4JI0E 4JG4A 2L2MA 1KIJA 5A6KA 3PYEA 2JWOA 4DR7E 4L5NC 1A1FA 4LFAI 4HACB 1UBDC 3QT6A 2LE2A 4FWHA 5BR8I 4JI3I 1PDAA 4TUIA 1EH7A 4HACA 2YRKA 2LJUA 4Q28A 1HK7A 4DV2I 4X66I 1GQEA 1NZ0A 2JVAA 4M9VC 1PKPA 2KONA 2LTRA 1N3GA 2HJJA 2DEIA 4NZVA 4X9JA 4MU0A 2JR1A 4R2SA 3J81Q 3ADJA 2MDGA 1XNRE 3OTOI 3T1HI 4PRVA 2EM5A 1YYKA 5F3WA 1YH8A 2YSOA 3L00A 4BHCA 4DR2I 1IBMI 1Z5BA 5JEAD 4R2EA 4MYUA 2KOUA 2LUPB 1KJKA 1H74A 1HNXE 3GMEA 1GZ6A 1IBKE 2JEAB 2EM8A 2VQFE 2LCEA 2YRMA 2UUCE 4DU8A 5K36F 5C0XD 5A2QC 4FWDA 1PJTA 3F6GA 3JU0A 2L92A 2JEAA 3DF6A 5LMNI 2I9IA 3LLHA 4DV7E 4DU7A 2EN8A 4R2AA 4X62E 2FGGA 1NHHA 2WNRB 4DPYA 4TUGA 4AM3A 4GEQB 2BM0A 4DV0I 4B3SE 1UDOA 2WBUA 4ED4A 4NXMI 2UXCI 2RPCA 2EM9A 2WNRA 2UUAE 5IT9Q 1HNZE 1B63A 3EQ1A 1OYSA 4ZYGA 4LU9A 1MG7A 4PRXA 3VK6A 2HKJA 1MGTA 3J7Yp 4HTGA 1N0UA 4DPWA 3Q6NA 5KL3A 2JOBA 1UDQA 1YYWA 4KHPE 1YZ9A 2O1UA 3TQMA 2A2CA 2C38B 2C39B 2EOEA 2GLIA 2EMBA 4AIMA 2Z5BB 2R1FA 2EM3A 2PRTA 4OO1C 2F8BA 4B3TI 4J3DA 2EN7A 2C38A 1ZU1A 5K36B 4DV4I 4LOMA 4WFTA 5K36E 4HEIA 2Z5BA 2UUBI 2CSHA 5IWAI 2FTXB 2LUQA 3BF2A 1QNTA 1UILA 2EMFA 4JI4E 4LF8E 3JAMC 1XXEA 2UXDE 3ZZTA 5K36A 1PJSA 4J8ZA 4WSGA 4AQYI 2O3ZA 2HFSA 5EKWA 4DKKA 3J80Q 4LF6E 1A6FA 2MKDA 1N32I 2NPFA 2HHHI 2BM1A 2NUFA 2NN6C 2ZM6E 1X47A 3PYFA 4GQUA 2BV3A 2DRPA 2B7VA 5LMUE 2HFUA 2IERA 4X65E 3B78A 4LF7E 1BKNA 1KTVA 1NCSA 3C6MA 4BHBA 4O4KA 4F6NA 4EMDA 1KKHA 4L8NA 1KYQA 2CZ9A 2EMLA 1A1GA 2LV2A 4LF5E 2PO1B 4R2CA 4DV5E 2UXBE 2HK3A 4LCHA 4MLVA 4JI2I 1UHZA 1Y5YA 4DR1E 5DNLA 2IOQA 4FW6A 2PO1A 3D4JA 4UT4A 2B3TB 1DI2A 4B3RI 1XHKA 2V8QB 4JV5E 2V8PA 3PS1A 2ENCA 3THNA 1O0WA 2D9HA 3Q6MA 2LRSA 1N33I 2CGEA 3DJWA 2EOXA 1I94I 2CTDA 4FW9A 4N4RB 1ZBTA 1FI4A 4K0KI 5GMDA 1T4OA 1AAYA 1EKZA 4JI1I 1H7SA 4NXNI 2L6MA 2DSYA 2YTGA 4DUZE 4DR4E 2EL5A 2J7JA 3HPSA 1J26A 4BC9A 2JOXA 2RQLA 3EPJA 2EN6A 3JTZA 1A1JA 2K4VA 3P3GA 1DGCA 4DV2E 5A6BD 1QU6A 4X66E 1RHYA 2EQ3A 4B3MI 2EPOA 3KZZA 2VRDA 4BMJA 3T1YE 3OTOE 1OYRA 3T1HE 5C0XC 2MC5A 2YTQA 4Z7CA 1MEYC 5FLXC 2DGCA 3ADGA 1T4LB 4LFCI 4LF9I 1A1IA 4FW7A 4LF4E 4DR2E 1FWLA 2N8XA 1Z0GA 1IBME 2CG9A 3B82A 4JI6I 1VISA 2GO4A 1NHIA 2JE6B 1ZXMA 2CVEA 2PNMA 2R42A 4M1KA 4WPYA 2LO3A 3C6KA 4BA2B 2LTSA 4URLA 1A1KA 4Q35B 2L3JA 4MQYA 4DUYI 4MYTA 4OX9I 4BA2A 4HYMA 1G2DC 1Z5CA 4OO1F 2MC6A 2KHXA 2BB8A 2EORA 3QG5C 3GCMA 1TN9A 4DV1E 3HPZA 1F2IG 4NXME 4YY3E 5AE3A 4F54A 2HGHA 3AUZA 1UDSA 4ZVIA 2JYAA 4FW3A 3M85D 2M4IA 2ZBKB 2EOZA 3M7ND 2EL6A 2V2ZA 2LJHA 2DB2A 1FKAE 1Z1BA 3ADLA 2NN6F 1YFHA 1ZBQA 1XMOI 4DPTA 2EPUA 3L7ZB 4YHHI 1Y4SA 1XNQI 3UK3C 4B3TE 5KL6A 3EPLA 1ZR9A 4DV4E 3K85A 3L7ZA 2UUBE 4WYQB 5IWAE 2Z5CB 4ZYHA 2EPPA 4KWYA 1J5EE 2CPNA 4AQYE 4LTYA 2NA2A 4F6MA 4OO1B 4OO1E 2DMIA 2JXPA 2HHHE 2R3VA 3M6AA 2GO3A 4OO1A 1B69A 3B8HA 1JK2A 4DPUA 1X5WA 2L8TA 2YTNA 4DR6E 4P52A 4JI7I 4MU1A 1N34I 1WHQA 3F6HA 1FNMA 2PO2B 4JI0I 2EMYA 2EOHA 1Z0TA 3HJCA 1WRJA 2L2NA 5L3JA 3M85G 2UU9I 3LMLA 2NN6B 3WU3A 3M7NG 2PO2A 4DR7I 2NN6E 2VQEI 2HKEA 2DMYA 2YTIA 4IFDD 1JK1A 1L4SA 3P1XA 3RMPA 1RQ0A 2C39A 2EOYA 4FK5C 4LPFA 2YU5A 5JEAF 4AIDA 4JYAI 3C4BA 2L2KB 2RSMA 5TSEA 3VYYA 4IZKB 4LCFA 2EPMX 4X8WA 2PNLA 1X3CA 1XMQI 4UTGA 2EM2A 4R2RA 1UN6B 1N33E 2EOMA 5C0XF 1IBLI 1I94E 1XNRI 1A1HA 2X36A 4IZKA 2I13A 1Z5AA 2PO0B 5A2QQ 2IHR1 4K0KE 2RS7A 3LNUA 4GZNC 2LJPA 4HY1A 4JI1E 2YSPA 3ZOQB 3C4TA 2VF3A 2PO0A 2EWLA 1FJGE 4FWGA 1D6TA 2RS6A 2F4VI 2EMIA 2EQ1A 1T38A 3DD6A 1HNXI 5AASA 4WXDA 3U1YA 2AE8A 1E3HA 1Z0BA 2L33A 2V87A 5KL5A 4OZEA 4X64I 1Y6ZA 2EM0A 3NZKA 3PS3A 2E5LI 2HK2A 3VHTB 1BBOA 1WUUA 2EMCA 1YUJA 1WJPA 3HQ1A 4LFCE 5DRQA 3CDJA 5JEAB 1EI1A 3HXLA 2EPLX 4F2JC 2EM4A 4F9BB 1QZRA 1FWKA 4JI6E 3WU4A 5JEAE 1HNZI 5LLQA 2UUAI 2V88A 3UHMA 2JY9A 2H36X 2N3GA 5JEAA 2EL4A 2WBSA 2EM7A 2YWQA 2EN3A 4F9AB 2VE7C 3QT7A 5C0XB 5C0XE 2EPRA 3THOB 2YTOA 5C0XA 3JAMQ 5AE1A 4LFAE 5BR8E 4JI3E 1PVGA 4DUYE 2O1WA 2B7TA 2EMZA 4OX9E 4USKA 3CDIA 4DMIA 2EN1A 2O1VA 4KQVA 3P3CA 2V86A 1HNWI 4U3BA 4BBYA 5CFFE 2FV4B 2EOSA 2IESA 2EMAA 1UDNA 4HXZA 3ZKBA 1N36I 4ISAA 4R8OA 4N3OA 4GKJI 2GHFA 4JI4I 4LF8I 4WUCA 1ZM3A 5GMEA 1ZM2A 3V2UC 4R1FA 2HC5A 2J7KA 3ZM7A 4DR3I 1HR0I 1R6MA 1DQ3A 5A6JA 2AJ4A 1P47A 2GPIA 4IJDA 2ZM6I 3KRNA 1XMOE 4LFBI 4RH8A 5ELWA 2ELZA 4O24A 2BBGA 2ELYA 1XNQE 4JI5I 5KL7A 1TF3A 3J81C 2GQ0A 1TF6A 1ZM4A 4IS9A 3WU5A 4WSPA 4GKKI 2EM6A 2JE6A 4PU9A 5FWKA 2YTEA 1RREA 2EN4A 3VYXA 5LMNE 4MU3A 2EPKX 1YSAC 3F0NA 2EPAA 4USMA 3ECRA 1X6FA 1X48A 1IMUA 4WUBA 4M0VA 2EPXA 4FW4A 4DR1I 3LTOA 2J65A 2ZITA 2V83A 1U2RA 2BA0D 4DV0E 4XTJA 4DR5I 5DRPA 2UXCE 1B62A 5K36D 4LCGA 2EMGA 5AC4A 2NUGA 4JI8I 4JV5I 4IFDC 2PNZB 4BCAA 4JI7E 1IQOA 1WHNA 1N34E 3P3EA 2EOIA 3HULA 2EMHA 1ZAAC 1NHJA 2PNZA 2UU9E 4DXLA 3PYDA 4R2PA 2EOQA 3B4TA 1NEIA 2EOOA 3K17A 2VQEE 5IT9C 2EPCA 4M30A 1Y4UA 1YUIA 4DUZI 4DR4I 5IXMB 1LLMC 2EP3A 3ADIA 2BA1D 2DEJA 2Z5EA 5KL4A 4BC7A 2Q8UA 5FLXQ 4DV3I 3ZKDA 3MHHC 1EA6A 1BBGA 4MU4A 4JYAE 3HKMA 3KZYA 1XMQE 5A69A 3H1CA 2EOFA 2Z5CA 4DV6I 3T1YI 2G7HA 1IBLE 2EOJA 2EMXA 2EZ6A 1Z59A 1N32E 1A1LA 2ODRD 4KZSA 4WUDA 1PJQA 3M99B 2OI2A 3H09A 1H72C 1R6LA 4LF4I 2R76A 3MSWA 1YPNA 2F4VE 2BA0G 3AV0A 4IS1C 3FIGA 3J7AG 4OKGA 3IWBA 2EE8A 3J80C 3LPSA 4FN5A 2ENHA 2YRHA 1OYPA 1ZM9A 2F1DA 1USUA 4U3DA 5A6BA 4JI2E 4X64E 2Q2EB 1N0VC 5KL2A 2NN6A 1T39A 2E5LE 2JT2A 3PS2A 2GS8A 5DNYA 2V89A 4IZJB 1K47A 4QNKA 4P78A 4R03A 5DROA 3Q1QA 1VI7A 2B9DA 1AH5A 4B3RE 2DLQA 2BA1G 2EPZA 3QT8A 4DV1I 2RSIA 4YY3I 3IWCA 4IZJA 5ADZA 1RC7A 2MKNA 2E72A 2YU8A 4I8OA 3GONA 2YTFA 2M9AA 2EQ0A 1E3PA 4MDTA 2V2VA 2RTXA 5AE2A 2X7IA 4FW5A 4O43A 2DLKA 3K1JA 3V5RA 2O1TA 2BR2B 4NXNE 4O5GA 4OOGC 5LL6R 1Z0WA 1YYOA 2YTJA 2MDRA 1STUA 5A6AA 2EJ4A 1GTKA 1H7UA 1Z0VA 1Z0EA 3PYGA 2A25A 2BR2A 1IBKI 3EPKA 1HNWE 2L3CA 2VQFI 1PIEA 2UUCI 1X49A 3GLLA 3KWRA 1N36E 1S4EA 1H73A 3J7AM 4GKJE 4B3ME 4QNJA 4DV7I 1RMDA 3ZZUA 1J5EI 4Z7YA 2LMZA 4MLQA 3PRYA 4DR3E 4X62I 1WXRA 1HR0E 1OJ4A 4R2QA 3P06A 1MU5A 2NABA 4BA1B 2N3HA 4LF9E 4B3SI 1X6EA 4P7AA 4LFBE 4IFDF 4F9CB 4BA1A 4DR6I 2EMWA 2C37B 4JI5E 4RHBB 2V85A 2VESA 2WP8B 5DRRA 5K36C 4WX9A 1EH6A 2EMKA 3OMLA 3ZZ0A 4GKKE 5AC5A 4RPFA 2WZOA 4WXCA 2VF1A 1Y60A 2C37A 2E1RA 4KHPI 2WP8A 2ADRA 2IOPA 3BGHA 1YHCA 2WCC3 1SFEA 1ZXNA 2YTDA 3P76A 4P7DA 4I3HA 2LVHA 3BIDA
chains in the Genus database with same CATH topology
4DR5E 2LBSB 4JI8E 3H4LA 5T6JA 2E1MA 2UXDI 4M2ZA 2NUEA 4LF6I 1DARA 2V2QA 5LMUI 1S16A 4X65I 1FJGI 4YHHE 2V34A 2DIXA 2ODRC 3WU6A 4LF7I 4DV3E 2XEXA 2A2DA 4BS9A 4LF5I 1SR9A 4DV5I 2UXBI 1USVA 2WW4A 2M7QA 1UEKA 3CWVA 4DPXA 4DV6E 2YT4A 1MX0A 1RR9A 2EFGA 1T4NA 4IZJD 1ELOA 2M1SA 1Z0CA 3IWDA 1KVKA 3K6QA 3HTXA 3QT5A 4JI0E 4JG4A 2L2MA 1KIJA 3PYEA 2JWOA 4DR7E 4L5NC 4LFAI 4HACB 3QT6A 5BR8I 2LE2A 4FWHA 4JI3I 4TUIA 4HACA 4Q28A 1HK7A 4DV2I 4X66I 1GQEA 1NZ0A 2JVAA 1PKPA 2KONA 2LTRA 2DEIA 2JR1A 3OTOI 3J81Q 3ADJA 3T1HI 1XNRE 4PRVA 1YYKA 5F3WA 4DR2I 1IBMI 1Z5BA 4MYUA 2KOUA 2LUPB 1H74A 1HNXE 1GZ6A 1IBKE 2VQFE 2UUCE 4DU8A 5A2QC 4FWDA 3F6GA 3JU0A 2L92A 3DF6A 5LMNI 3LLHA 4DV7E 4DU7A 4X62E 2FGGA 1NHHA 4DPYA 4TUGA 4GEQB 2BM0A 4DV0I 4B3SE 4ED4A 4NXMI 2UXCI 5IT9Q 2UUAE 1HNZE 1B63A 4LU9A 1MG7A 4PRXA 3VK6A 2HKJA 3J7Yp 4DPWA 1N0UA 3Q6NA 2JOBA 1YYWA 4KHPE 1YZ9A 2O1UA 2A2CA 2Z5BB 2F8BA 4B3TI 4DV4I 4WFTA 2UUBI 2Z5BA 5IWAI 1UILA 2LUQA 2FTXB 4JI4E 4LF8E 3JAMC 2UXDE 3ZZTA 4J8ZA 4AQYI 2HFSA 3J80Q 4DKKA 4LF6E 1A6FA 1N32I 2NPFA 2HHHI 2BM1A 2NUFA 2ZM6E 1X47A 3PYFA 2BV3A 2B7VA 5LMUE 2HFUA 4X65E 3B78A 4LF7E 1BKNA 1KTVA 4EMDA 1KKHA 4L8NA 2CZ9A 4LF5E 4DV5E 2HK3A 2UXBE 4JI2I 1UHZA 4DR1E 2IOQA 3D4JA 4UT4A 2B3TB 1DI2A 4B3RI 1XHKA 2V8QB 4JV5E 2V8PA 1O0WA 3Q6MA 2LRSA 1N33I 2CGEA 3DJWA 1I94I 4FW9A 1ZBTA 1FI4A 4K0KI 5GMDA 1T4OA 1EKZA 4JI1I 1H7SA 4NXNI 2L6MA 2DSYA 4DUZE 4DR4E 3HPSA 1J26A 4BC9A 2JOXA 3JTZA 2K4VA 4DV2E 1QU6A 4X66E 4B3MI 4BMJA 3T1YE 3OTOE 3T1HE 2MC5A 4Z7CA 5FLXC 3ADGA 1T4LB 4LFCI 4LF9I 4LF4E 4DR2E 1FWLA 1Z0GA 1IBME 2CG9A 3B82A 4JI6I 1VISA 1NHIA 1ZXMA 2PNMA 2R42A 4M1KA 4WPYA 2LTSA 4URLA 4DUYI 2L3JA 4MYTA 4OX9I 4HYMA 1Z5CA 2MC6A 2KHXA 4NXME 4DV1E 3HPZA 4YY3E 5AE3A 4F54A 3AUZA 4ZVIA 2M4IA 2ZBKB 2V2ZA 2LJHA 2DB2A 1FKAE 3ADLA 1ZBQA 1XMOI 4DPTA 4YHHI 1Y4SA 1XNQI 4B3TE 4DV4E 3K85A 2UUBE 4WYQB 5IWAE 2Z5CB 1J5EE 2CPNA 4AQYE 4LTYA 2NA2A 2HHHE 2R3VA 3M6AA 3B8HA 4DPUA 2L8TA 4DR6E 4P52A 4JI7I 1N34I 1WHQA 3F6HA 1FNMA 4JI0I 3HJCA 1Z0TA 2L2NA 5L3JA 2UU9I 3LMLA 4DR7I 3WU3A 2VQEI 2HKEA 2DMYA 3P1XA 3RMPA 1RQ0A 4JYAI 3C4BA 2L2KB 2RSMA 3VYYA 4IZKB 1XMQI 4X8WA 2PNLA 4UTGA 1N33E 1IBLI 1I94E 1XNRI 2X36A 4IZKA 1Z5AA 5A2QQ 2IHR1 4K0KE 2RS7A 3LNUA 2LJPA 4HY1A 4JI1E 3ZOQB 3C4TA 2VF3A 2EWLA 1FJGE 4FWGA 1D6TA 2RS6A 2F4VI 1HNXI 5AASA 1Z0BA 2L33A 2V87A 4X64I 1Y6ZA 2E5LI 2HK2A 1WUUA 3HQ1A 4LFCE 1EI1A 3HXLA 1QZRA 4F9BB 3WU4A 1FWKA 4JI6E 1HNZI 2UUAI 2V88A 2JY9A 2H36X 2N3GA 4F9AB 3QT7A 2VE7C 3JAMQ 5AE1A 4LFAE 5BR8E 4JI3E 1PVGA 4DUYE 2O1WA 2B7TA 4OX9E 4USKA 4DMIA 2O1VA 4KQVA 1HNWI 2V86A 4BBYA 5CFFE 2FV4B 4HXZA 3ZKBA 1N36I 4R8OA 4N3OA 4GKJI 4JI4I 4LF8I 4WUCA 1ZM3A 5GMEA 1ZM2A 3V2UC 4R1FA 2J7KA 3ZM7A 4DR3I 1HR0I 1DQ3A 2AJ4A 2ZM6I 1XMOE 4LFBI 1XNQE 4JI5I 3J81C 2GQ0A 1ZM4A 3WU5A 4WSPA 4GKKI 4PU9A 5FWKA 1RREA 3VYXA 5LMNE 3F0NA 4USMA 4WUBA 1X48A 4M0VA 4DR1I 3LTOA 2ZITA 2V83A 1U2RA 4DV0E 4XTJA 4DR5I 2UXCE 1B62A 2NUGA 4JI8I 4JV5I 4BCAA 4JI7E 1WHNA 1N34E 3HULA 1NHJA 2UU9E 4DXLA 3PYDA 3K17A 2VQEE 5IT9C 4M30A 1Y4UA 4DUZI 4DR4I 3ADIA 2Z5EA 2DEJA 5FLXQ 4DV3I 4BC7A 3ZKDA 1EA6A 4JYAE 1XMQE 2Z5CA 4DV6I 3T1YI 2G7HA 1IBLE 2EZ6A 1Z59A 1N32E 2ODRD 4KZSA 4WUDA 2OI2A 3H09A 1H72C 4LF4I 3MSWA 2F4VE 3AV0A 3J7AG 3FIGA 3IWBA 3LPSA 3J80C 4FN5A 1ZM9A 1USUA 4JI2E 4X64E 2Q2EB 1N0VC 2E5LE 2GS8A 5DNYA 2V89A 4IZJB 1K47A 4P78A 4R03A 3Q1QA 2B9DA 4B3RE 3QT8A 4DV1I 4YY3I 3IWCA 4IZJA 5ADZA 1RC7A 4I8OA 3GONA 2V2VA 2RTXA 5AE2A 2X7IA 3K1JA 3V5RA 2O1TA 4NXNE 4OOGC 5LL6R 1Z0WA 1YYOA 2MDRA 1STUA 1Z0VA 1H7UA 1Z0EA 3PYGA 1IBKI 1HNWE 2L3CA 2VQFI 1PIEA 2UUCI 1X49A 3KWRA 1N36E 1S4EA 1H73A 3J7AM 4GKJE 4B3ME 4DV7I 3ZZUA 1J5EI 4Z7YA 2LMZA 3PRYA 4X62I 4DR3E 1WXRA 1HR0E 1OJ4A 3P06A 1MU5A 2N3HA 4LF9E 4B3SI 4P7AA 4LFBE 4F9CB 4DR6I 4JI5E 2V85A 3OMLA 3ZZ0A 4GKKE 4RPFA 4KHPI 2WZOA 2VF1A 2E1RA 2IOPA 1ZXNA 4P7DA 4I3HA 2YZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  2LBS B;  4JI8 E;  3H4L A;  2UXD I;  4M2Z A;  2NUE A;  4LF6 I;  1DAR A;  2V2Q A;  5LMU I;  1S16 A;  4X65 I;  1FJG I;  4YHH E;  2V34 A;  2DIX A;  4LF7 I;  3WU6 A;  4DV3 E;  2XEX A;  2A2D A;  4LF5 I;  4DV5 I;  2UXB I;  2WW4 A;  1UEK A;  3CWV A;  4DPX A;  4DV6 E;  2YT4 A;  1MX0 A;  1RR9 A;  2EFG A;  1T4N A;  1ELO A;  1Z0C A;  1KVK A;  3HTX A;  3QT5 A;  4JI0 E;  4JG4 A;  2L2M A;  1KIJ A;  3PYE A;  4DR7 E;  4LFA I;  4HAC B;  3QT6 A;  5BR8 I;  4FWH A;  4JI3 I;  4HAC A;  4DV2 I;  4X66 I;  1GQE A;  1NZ0 A;  2JVA A;  1PKP A;  2LTR A;  2DEI A;  3OTO I;  3J81 Q;  3ADJ A;  3T1H I;  1XNR E;  4PRV A;  1YYK A;  4DR2 I;  1IBM I;  1Z5B A;  4MYU A;  2LUP B;  1H74 A;  1HNX E;  1IBK E;  2VQF E;  2UUC E;  4DU8 A;  5A2Q C;  4FWD A;  5LMN I;  3LLH A;  4DV7 E;  4DU7 A;  4X62 E;  1NHH A;  4DPY A;  2BM0 A;  4DV0 I;  4B3S E;  4ED4 A;  4NXM I;  2UXC I;  5IT9 Q;  2UUA E;  1HNZ E;  1B63 A;  1MG7 A;  4PRX A;  2HKJ A;  3J7Y p;  4DPW A;  1N0U A;  1YYW A;  4KHP E;  1YZ9 A;  2A2C A;  4B3T I;  4DV4 I;  4WFT A;  2UUB I;  5IWA I;  1UIL A;  2LUQ A;  4JI4 E;  4LF8 E;  3JAM C;  2UXD E;  3ZZT A;  4AQY I;  2HFS A;  3J80 Q;  4DKK A;  4LF6 E;  1A6F A;  1N32 I;  2NPF A;  2HHH I;  2BM1 A;  2NUF A;  2ZM6 E;  1X47 A;  3PYF A;  2BV3 A;  2B7V A;  5LMU E;  2HFU A;  4X65 E;  3B78 A;  4LF7 E;  1BKN A;  1KTV A;  4EMD A;  1KKH A;  2CZ9 A;  4LF5 E;  4DV5 E;  2HK3 A;  2UXB E;  4JI2 I;  1UHZ A;  4DR1 E;  3D4J A;  4UT4 A;  2B3T B;  1DI2 A;  4B3R I;  1XHK A;  4JV5 E;  2V8P A;  1O0W A;  2LRS A;  1N33 I;  1I94 I;  4FW9 A;  1ZBT A;  1FI4 A;  4K0K I;  5GMD A;  1T4O A;  1EKZ A;  4JI1 I;  1H7S A;  4NXN I;  4DUZ E;  4DR4 E;  1J26 A;  4DV2 E;  1QU6 A;  4X66 E;  4B3M I;  3T1Y E;  3OTO E;  3T1H E;  4Z7C A;  5FLX C;  3ADG A;  1T4L B;  4LFC I;  4LF9 I;  4LF4 E;  4DR2 E;  1FWL A;  1Z0G A;  1IBM E;  3B82 A;  4JI6 I;  1VIS A;  1NHI A;  1ZXM A;  2R42 A;  4M1K A;  2LTS A;  4URL A;  4DUY I;  2L3J A;  4MYT A;  4OX9 I;  4HYM A;  1Z5C A;  2KHX A;  4DV1 E;  4NXM E;  4YY3 E;  4ZVI A;  2ZBK B;  2V2Z A;  2LJH A;  2DB2 A;  1FKA E;  3ADL A;  1XMO I;  4DPT A;  4YHH I;  1XNQ I;  4B3T E;  4DV4 E;  2UUB E;  4WYQ B;  5IWA E;  1J5E E;  2CPN A;  4AQY E;  2NA2 A;  2HHH E;  2R3V A;  3M6A A;  3B8H A;  4DPU A;  4P52 A;  4DR6 E;  4JI7 I;  1N34 I;  1WHQ A;  1FNM A;  4JI0 I;  1Z0T A;  2L2N A;  5L3J A;  2UU9 I;  4DR7 I;  3WU3 A;  2VQE I;  2HKE A;  2DMY A;  3P1X A;  1RQ0 A;  4JYA I;  3C4B A;  2L2K B;  2RSM A;  3VYY A;  1XMQ I;  4X8W A;  4UTG A;  1N33 E;  1IBL I;  1I94 E;  1XNR I;  2X36 A;  1Z5A A;  5A2Q Q;  2IHR 1;  4K0K E;  2RS7 A;  3LNU A;  2LJP A;  4HY1 A;  4JI1 E;  3C4T A;  2VF3 A;  1FJG E;  4FWG A;  1D6T A;  2RS6 A;  2F4V I;  1HNX I;  1Z0B A;  2L33 A;  4X64 I;  2E5L I;  2HK2 A;  1WUU A;  4LFC E;  1EI1 A;  1QZR A;  3WU4 A;  1HNZ I;  1FWK A;  4JI6 E;  2UUA I;  2JY9 A;  2N3G A;  3QT7 A;  3JAM Q;  4LFA E;  5BR8 E;  4JI3 E;  1PVG A;  4DUY E;  2B7T A;  4OX9 E;  4USK A;  4KQV A;  1HNW I;  5CFF E;  4HXZ A;  3ZKB A;  1N36 I;  4GKJ I;  4JI4 I;  4LF8 I;  4WUC A;  1ZM3 A;  5GME A;  1ZM2 A;  3V2U C;  4R1F A;  2J7K A;  3ZM7 A;  4DR3 I;  1HR0 I;  2AJ4 A;  2ZM6 I;  1XMO E;  4LFB I;  1XNQ E;  4JI5 I;  3J81 C;  1ZM4 A;  3WU5 A;  4GKK I;  4PU9 A;  1RRE A;  3VYX A;  5LMN E;  3F0N A;  4USM A;  4WUB A;  1X48 A;  4DR1 I;  3LTO A;  2ZIT A;  1U2R A;  4DV0 E;  4XTJ A;  4DR5 I;  2UXC E;  1B62 A;  2NUG A;  4JI8 I;  4JV5 I;  4JI7 E;  1WHN A;  1N34 E;  3HUL A;  1NHJ A;  2UU9 E;  4DXL A;  3PYD A;  3K17 A;  2VQE E;  5IT9 C;  4M30 A;  4DUZ I;  4DR4 I;  3ADI A;  2DEJ A;  5FLX Q;  4DV3 I;  3ZKD A;  1EA6 A;  4JYA E;  1XMQ E;  3T1Y I;  4DV6 I;  1IBL E;  2EZ6 A;  1Z59 A;  1N32 E;  4WUD A;  2OI2 A;  1H72 C;  4LF4 I;  2F4V E;  3J7A G;  3LPS A;  4FN5 A;  3J80 C;  1ZM9 A;  4JI2 E;  4X64 E;  2Q2E B;  1N0V C;  2E5L E;  2GS8 A;  1K47 A;  3Q1Q A;  4B3R E;  3QT8 A;  4DV1 I;  4YY3 I;  1RC7 A;  3GON A;  2V2V A;  2RTX A;  2X7I A;  3K1J A;  3V5R A;  4NXN E;  4OOG C;  1Z0W A;  5LL6 R;  1YYO A;  2MDR A;  1STU A;  1Z0V A;  1H7U A;  3PYG A;  1Z0E A;  1IBK I;  1HNW E;  2L3C A;  2VQF I;  1PIE A;  2UUC I;  1X49 A;  1N36 E;  1S4E A;  1H73 A;  3J7A M;  4GKJ E;  4B3M E;  4DV7 I;  3ZZU A;  1J5E I;  4Z7Y A;  4X62 I;  4DR3 E;  1HR0 E;  1OJ4 A;  1MU5 A;  2N3H A;  4LF9 E;  4B3S I;  4P7A A;  4LFB E;  4DR6 I;  4JI5 E;  3ZZ0 A;  4GKK E;  4RPF A;  4KHP I;  2E1R A;  1ZXN A;  4I3H A; 
#chains in the Genus database with same CATH topology
 4DR5 E;  2LBS B;  4JI8 E;  3H4L A;  5T6J A;  2E1M A;  3MHS C;  2UXD I;  2YPN A;  2JPA A;  4ZYE A;  4M2Z A;  4NBQ A;  2NUE A;  4LF6 I;  1DAR A;  4OO1 D;  2K7I A;  2V2Q A;  5LMU I;  1S16 A;  1EH8 A;  4X65 I;  4IFD B;  4YHH E;  2V34 A;  4IFD E;  1FJG I;  2DIX A;  2ODR C;  4ZYD A;  3WU6 A;  4LF7 I;  5DNX A;  5IV8 B;  4DV3 E;  2XEX A;  2YTP A;  2A2D A;  1G2F C;  4IFD A;  4BS9 A;  3BBG A;  3EPH A;  5JEA C;  4R2D A;  2EN2 A;  2YZT A;  4LF5 I;  1SR9 A;  4DV5 I;  2WBT A;  2UXB I;  2NN6 D;  3U1K A;  1USV A;  2WW4 A;  2M7Q A;  1UEK A;  3CWV A;  4DPX A;  4DV6 E;  4NHR A;  2YT4 A;  1MX0 A;  1RR9 A;  2ENA A;  2EFG A;  1X6H A;  1T4N A;  1P42 A;  2JEB B;  4IZJ D;  1ELO A;  1BB8 A;  5EL9 A;  2EPN A;  2M1S A;  2JP9 A;  1Z0C A;  2CT1 A;  3IWD A;  1IQS A;  1KVK A;  3K6Q A;  3HTX A;  2JEB A;  3QT5 A;  2LT7 A;  4JI0 E;  4JG4 A;  2L2M A;  1KIJ A;  5A6K A;  3PYE A;  2JWO A;  4DR7 E;  4L5N C;  1A1F A;  4LFA I;  4HAC B;  1UBD C;  3QT6 A;  2LE2 A;  4FWH A;  5BR8 I;  4JI3 I;  1PDA A;  4TUI A;  1EH7 A;  4HAC A;  2YRK A;  2LJU A;  4Q28 A;  1HK7 A;  4DV2 I;  4X66 I;  1GQE A;  1NZ0 A;  2JVA A;  4M9V C;  1PKP A;  2KON A;  2LTR A;  1N3G A;  2HJJ A;  2DEI A;  4NZV A;  4X9J A;  4MU0 A;  2JR1 A;  4R2S A;  3J81 Q;  3ADJ A;  2MDG A;  1XNR E;  3OTO I;  3T1H I;  4PRV A;  2EM5 A;  1YYK A;  5F3W A;  1YH8 A;  2YSO A;  3L00 A;  4BHC A;  4DR2 I;  1IBM I;  1Z5B A;  5JEA D;  4R2E A;  4MYU A;  2KOU A;  2LUP B;  1KJK A;  1H74 A;  1HNX E;  3GME A;  1GZ6 A;  1IBK E;  2JEA B;  2EM8 A;  2VQF E;  2LCE A;  2YRM A;  2UUC E;  4DU8 A;  5K36 F;  5C0X D;  5A2Q C;  4FWD A;  1PJT A;  3F6G A;  3JU0 A;  2L92 A;  2JEA A;  3DF6 A;  5LMN I;  2I9I A;  3LLH A;  4DV7 E;  4DU7 A;  2EN8 A;  4R2A A;  4X62 E;  2FGG A;  1NHH A;  2WNR B;  4DPY A;  4TUG A;  4AM3 A;  4GEQ B;  2BM0 A;  4DV0 I;  4B3S E;  1UDO A;  2WBU A;  4ED4 A;  4NXM I;  2UXC I;  2RPC A;  2EM9 A;  2WNR A;  2UUA E;  5IT9 Q;  1HNZ E;  1B63 A;  3EQ1 A;  1OYS A;  4ZYG A;  4LU9 A;  1MG7 A;  4PRX A;  3VK6 A;  2HKJ A;  1MGT A;  3J7Y p;  4HTG A;  1N0U A;  4DPW A;  3Q6N A;  5KL3 A;  2JOB A;  1UDQ A;  1YYW A;  4KHP E;  1YZ9 A;  2O1U A;  3TQM A;  2A2C A;  2C38 B;  2C39 B;  2EOE A;  2GLI A;  2EMB A;  4AIM A;  2Z5B B;  2R1F A;  2EM3 A;  2PRT A;  4OO1 C;  2F8B A;  4B3T I;  4J3D A;  2EN7 A;  2C38 A;  1ZU1 A;  5K36 B;  4DV4 I;  4LOM A;  4WFT A;  5K36 E;  4HEI A;  2Z5B A;  2UUB I;  2CSH A;  5IWA I;  2FTX B;  2LUQ A;  3BF2 A;  1QNT A;  1UIL A;  2EMF A;  4JI4 E;  4LF8 E;  3JAM C;  1XXE A;  2UXD E;  3ZZT A;  5K36 A;  1PJS A;  4J8Z A;  4WSG A;  4AQY I;  2O3Z A;  2HFS A;  5EKW A;  4DKK A;  3J80 Q;  4LF6 E;  1A6F A;  2MKD A;  1N32 I;  2NPF A;  2HHH I;  2BM1 A;  2NUF A;  2NN6 C;  2ZM6 E;  1X47 A;  3PYF A;  4GQU A;  2BV3 A;  2DRP A;  2B7V A;  5LMU E;  2HFU A;  2IER A;  4X65 E;  3B78 A;  4LF7 E;  1BKN A;  1KTV A;  1NCS A;  3C6M A;  4BHB A;  4O4K A;  4F6N A;  4EMD A;  1KKH A;  4L8N A;  1KYQ A;  2CZ9 A;  2EML A;  1A1G A;  2LV2 A;  4LF5 E;  2PO1 B;  4R2C A;  4DV5 E;  2UXB E;  2HK3 A;  4LCH A;  4MLV A;  4JI2 I;  1UHZ A;  1Y5Y A;  4DR1 E;  5DNL A;  2IOQ A;  4FW6 A;  2PO1 A;  3D4J A;  4UT4 A;  2B3T B;  1DI2 A;  4B3R I;  1XHK A;  2V8Q B;  4JV5 E;  2V8P A;  3PS1 A;  2ENC A;  3THN A;  1O0W A;  2D9H A;  3Q6M A;  2LRS A;  1N33 I;  2CGE A;  3DJW A;  2EOX A;  1I94 I;  2CTD A;  4FW9 A;  4N4R B;  1ZBT A;  1FI4 A;  4K0K I;  5GMD A;  1T4O A;  1AAY A;  1EKZ A;  4JI1 I;  1H7S A;  4NXN I;  2L6M A;  2DSY A;  2YTG A;  4DUZ E;  4DR4 E;  2EL5 A;  2J7J A;  3HPS A;  1J26 A;  4BC9 A;  2JOX A;  2RQL A;  3EPJ A;  2EN6 A;  3JTZ A;  1A1J A;  2K4V A;  3P3G A;  1DGC A;  4DV2 E;  5A6B D;  1QU6 A;  4X66 E;  1RHY A;  2EQ3 A;  4B3M I;  2EPO A;  3KZZ A;  2VRD A;  4BMJ A;  3T1Y E;  3OTO E;  1OYR A;  3T1H E;  5C0X C;  2MC5 A;  2YTQ A;  4Z7C A;  1MEY C;  5FLX C;  2DGC A;  3ADG A;  1T4L B;  4LFC I;  4LF9 I;  1A1I A;  4FW7 A;  4LF4 E;  4DR2 E;  1FWL A;  2N8X A;  1Z0G A;  1IBM E;  2CG9 A;  3B82 A;  4JI6 I;  1VIS A;  2GO4 A;  1NHI A;  2JE6 B;  1ZXM A;  2CVE A;  2PNM A;  2R42 A;  4M1K A;  4WPY A;  2LO3 A;  3C6K A;  4BA2 B;  2LTS A;  4URL A;  1A1K A;  4Q35 B;  2L3J A;  4MQY A;  4DUY I;  4MYT A;  4OX9 I;  4BA2 A;  4HYM A;  1G2D C;  1Z5C A;  4OO1 F;  2MC6 A;  2KHX A;  2BB8 A;  2EOR A;  3QG5 C;  3GCM A;  1TN9 A;  4DV1 E;  3HPZ A;  1F2I G;  4NXM E;  4YY3 E;  5AE3 A;  4F54 A;  2HGH A;  3AUZ A;  1UDS A;  4ZVI A;  2JYA A;  4FW3 A;  3M85 D;  2M4I A;  2ZBK B;  2EOZ A;  3M7N D;  2EL6 A;  2V2Z A;  2LJH A;  2DB2 A;  1FKA E;  1Z1B A;  3ADL A;  2NN6 F;  1YFH A;  1ZBQ A;  1XMO I;  4DPT A;  2EPU A;  3L7Z B;  4YHH I;  1Y4S A;  1XNQ I;  3UK3 C;  4B3T E;  5KL6 A;  3EPL A;  1ZR9 A;  4DV4 E;  3K85 A;  3L7Z A;  2UUB E;  4WYQ B;  5IWA E;  2Z5C B;  4ZYH A;  2EPP A;  4KWY A;  1J5E E;  2CPN A;  4AQY E;  4LTY A;  2NA2 A;  4F6M A;  4OO1 B;  4OO1 E;  2DMI A;  2JXP A;  2HHH E;  2R3V A;  3M6A A;  2GO3 A;  4OO1 A;  1B69 A;  3B8H A;  1JK2 A;  4DPU A;  1X5W A;  2L8T A;  2YTN A;  4DR6 E;  4P52 A;  4JI7 I;  4MU1 A;  1N34 I;  1WHQ A;  3F6H A;  1FNM A;  2PO2 B;  4JI0 I;  2EMY A;  2EOH A;  1Z0T A;  3HJC A;  1WRJ A;  2L2N A;  5L3J A;  3M85 G;  2UU9 I;  3LML A;  2NN6 B;  3WU3 A;  3M7N G;  2PO2 A;  4DR7 I;  2NN6 E;  2VQE I;  2HKE A;  2DMY A;  2YTI A;  4IFD D;  1JK1 A;  1L4S A;  3P1X A;  3RMP A;  1RQ0 A;  2C39 A;  2EOY A;  4FK5 C;  4LPF A;  2YU5 A;  5JEA F;  4AID A;  4JYA I;  3C4B A;  2L2K B;  2RSM A;  5TSE A;  3VYY A;  4IZK B;  4LCF A;  2EPM X;  4X8W A;  2PNL A;  1X3C A;  1XMQ I;  4UTG A;  2EM2 A;  4R2R A;  1UN6 B;  1N33 E;  2EOM A;  5C0X F;  1IBL I;  1I94 E;  1XNR I;  1A1H A;  2X36 A;  4IZK A;  2I13 A;  1Z5A A;  2PO0 B;  5A2Q Q;  2IHR 1;  4K0K E;  2RS7 A;  3LNU A;  4GZN C;  2LJP A;  4HY1 A;  4JI1 E;  2YSP A;  3ZOQ B;  3C4T A;  2VF3 A;  2PO0 A;  2EWL A;  1FJG E;  4FWG A;  1D6T A;  2RS6 A;  2F4V I;  2EMI A;  2EQ1 A;  1T38 A;  3DD6 A;  1HNX I;  5AAS A;  4WXD A;  3U1Y A;  2AE8 A;  1E3H A;  1Z0B A;  2L33 A;  2V87 A;  5KL5 A;  4OZE A;  4X64 I;  1Y6Z A;  2EM0 A;  3NZK A;  3PS3 A;  2E5L I;  2HK2 A;  3VHT B;  1BBO A;  1WUU A;  2EMC A;  1YUJ A;  1WJP A;  3HQ1 A;  4LFC E;  5DRQ A;  3CDJ A;  5JEA B;  1EI1 A;  3HXL A;  2EPL X;  4F2J C;  2EM4 A;  4F9B B;  1QZR A;  1FWK A;  4JI6 E;  3WU4 A;  5JEA E;  1HNZ I;  5LLQ A;  2UUA I;  2V88 A;  3UHM A;  2JY9 A;  2H36 X;  2N3G A;  5JEA A;  2EL4 A;  2WBS A;  2EM7 A;  2YWQ A;  2EN3 A;  4F9A B;  2VE7 C;  3QT7 A;  5C0X B;  5C0X E;  2EPR A;  3THO B;  2YTO A;  5C0X A;  3JAM Q;  5AE1 A;  4LFA E;  5BR8 E;  4JI3 E;  1PVG A;  4DUY E;  2O1W A;  2B7T A;  2EMZ A;  4OX9 E;  4USK A;  3CDI A;  4DMI A;  2EN1 A;  2O1V A;  4KQV A;  3P3C A;  2V86 A;  1HNW I;  4U3B A;  4BBY A;  5CFF E;  2FV4 B;  2EOS A;  2IES A;  2EMA A;  1UDN A;  4HXZ A;  3ZKB A;  1N36 I;  4ISA A;  4R8O A;  4N3O A;  4GKJ I;  2GHF A;  4JI4 I;  4LF8 I;  4WUC A;  1ZM3 A;  5GME A;  1ZM2 A;  3V2U C;  4R1F A;  2HC5 A;  2J7K A;  3ZM7 A;  4DR3 I;  1HR0 I;  1R6M A;  1DQ3 A;  5A6J A;  2AJ4 A;  1P47 A;  2GPI A;  4IJD A;  2ZM6 I;  3KRN A;  1XMO E;  4LFB I;  4RH8 A;  5ELW A;  2ELZ A;  4O24 A;  2BBG A;  2ELY A;  1XNQ E;  4JI5 I;  5KL7 A;  1TF3 A;  3J81 C;  2GQ0 A;  1TF6 A;  1ZM4 A;  4IS9 A;  3WU5 A;  4WSP A;  4GKK I;  2EM6 A;  2JE6 A;  4PU9 A;  5FWK A;  2YTE A;  1RRE A;  2EN4 A;  3VYX A;  5LMN E;  4MU3 A;  2EPK X;  1YSA C;  3F0N A;  2EPA A;  4USM A;  3ECR A;  1X6F A;  1X48 A;  1IMU A;  4WUB A;  4M0V A;  2EPX A;  4FW4 A;  4DR1 I;  3LTO A;  2J65 A;  2ZIT A;  2V83 A;  1U2R A;  2BA0 D;  4DV0 E;  4XTJ A;  4DR5 I;  5DRP A;  2UXC E;  1B62 A;  5K36 D;  4LCG A;  2EMG A;  5AC4 A;  2NUG A;  4JI8 I;  4JV5 I;  4IFD C;  2PNZ B;  4BCA A;  4JI7 E;  1IQO A;  1WHN A;  1N34 E;  3P3E A;  2EOI A;  3HUL A;  2EMH A;  1ZAA C;  1NHJ A;  2PNZ A;  2UU9 E;  4DXL A;  3PYD A;  4R2P A;  2EOQ A;  3B4T A;  1NEI A;  2EOO A;  3K17 A;  2VQE E;  5IT9 C;  2EPC A;  4M30 A;  1Y4U A;  1YUI A;  4DUZ I;  4DR4 I;  5IXM B;  1LLM C;  2EP3 A;  3ADI A;  2BA1 D;  2DEJ A;  2Z5E A;  5KL4 A;  4BC7 A;  2Q8U A;  5FLX Q;  4DV3 I;  3ZKD A;  3MHH C;  1EA6 A;  1BBG A;  4MU4 A;  4JYA E;  3HKM A;  3KZY A;  1XMQ E;  5A69 A;  3H1C A;  2EOF A;  2Z5C A;  4DV6 I;  3T1Y I;  2G7H A;  1IBL E;  2EOJ A;  2EMX A;  2EZ6 A;  1Z59 A;  1N32 E;  1A1L A;  2ODR D;  4KZS A;  4WUD A;  1PJQ A;  3M99 B;  2OI2 A;  3H09 A;  1H72 C;  1R6L A;  4LF4 I;  2R76 A;  3MSW A;  1YPN A;  2F4V E;  2BA0 G;  3AV0 A;  4IS1 C;  3FIG A;  3J7A G;  4OKG A;  3IWB A;  2EE8 A;  3J80 C;  3LPS A;  4FN5 A;  2ENH A;  2YRH A;  1OYP A;  1ZM9 A;  2F1D A;  1USU A;  4U3D A;  5A6B A;  4JI2 E;  4X64 E;  2Q2E B;  1N0V C;  5KL2 A;  2NN6 A;  1T39 A;  2E5L E;  2JT2 A;  3PS2 A;  2GS8 A;  5DNY A;  2V89 A;  4IZJ B;  1K47 A;  4QNK A;  4P78 A;  4R03 A;  5DRO A;  3Q1Q A;  1VI7 A;  2B9D A;  1AH5 A;  4B3R E;  2DLQ A;  2BA1 G;  2EPZ A;  3QT8 A;  4DV1 I;  2RSI A;  4YY3 I;  3IWC A;  4IZJ A;  5ADZ A;  1RC7 A;  2MKN A;  2E72 A;  2YU8 A;  4I8O A;  3GON A;  2YTF A;  2M9A A;  2EQ0 A;  1E3P A;  4MDT A;  2V2V A;  2RTX A;  5AE2 A;  2X7I A;  4FW5 A;  4O43 A;  2DLK A;  3K1J A;  3V5R A;  2O1T A;  2BR2 B;  4NXN E;  4O5G A;  4OOG C;  5LL6 R;  1Z0W A;  1YYO A;  2YTJ A;  2MDR A;  1STU A;  5A6A A;  2EJ4 A;  1GTK A;  1H7U A;  1Z0V A;  1Z0E A;  3PYG A;  2A25 A;  2BR2 A;  1IBK I;  3EPK A;  1HNW E;  2L3C A;  2VQF I;  1PIE A;  2UUC I;  1X49 A;  3GLL A;  3KWR A;  1N36 E;  1S4E A;  1H73 A;  3J7A M;  4GKJ E;  4B3M E;  4QNJ A;  4DV7 I;  1RMD A;  3ZZU A;  1J5E I;  4Z7Y A;  2LMZ A;  4MLQ A;  3PRY A;  4DR3 E;  4X62 I;  1WXR A;  1HR0 E;  1OJ4 A;  4R2Q A;  3P06 A;  1MU5 A;  2NAB A;  4BA1 B;  2N3H A;  4LF9 E;  4B3S I;  1X6E A;  4P7A A;  4LFB E;  4IFD F;  4F9C B;  4BA1 A;  4DR6 I;  2EMW A;  2C37 B;  4JI5 E;  4RHB B;  2V85 A;  2VES A;  2WP8 B;  5DRR A;  5K36 C;  4WX9 A;  1EH6 A;  2EMK A;  3OML A;  3ZZ0 A;  4GKK E;  5AC5 A;  4RPF A;  2WZO A;  4WXC A;  2VF1 A;  1Y60 A;  2C37 A;  2E1R A;  4KHP I;  2WP8 A;  2ADR A;  2IOP A;  3BGH A;  1YHC A;  2WCC 3;  1SFE A;  1ZXN A;  2YTD A;  3P76 A;  4P7D A;  4I3H A;  2LVH A;  3BID A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  2LBS B;  4JI8 E;  3H4L A;  5T6J A;  2E1M A;  2UXD I;  4M2Z A;  2NUE A;  4LF6 I;  1DAR A;  2V2Q A;  5LMU I;  1S16 A;  4X65 I;  1FJG I;  4YHH E;  2V34 A;  2DIX A;  2ODR C;  3WU6 A;  4LF7 I;  4DV3 E;  2XEX A;  2A2D A;  4BS9 A;  4LF5 I;  1SR9 A;  4DV5 I;  2UXB I;  1USV A;  2WW4 A;  2M7Q A;  1UEK A;  3CWV A;  4DPX A;  4DV6 E;  2YT4 A;  1MX0 A;  1RR9 A;  2EFG A;  1T4N A;  4IZJ D;  1ELO A;  2M1S A;  1Z0C A;  3IWD A;  1KVK A;  3K6Q A;  3HTX A;  3QT5 A;  4JI0 E;  4JG4 A;  2L2M A;  1KIJ A;  3PYE A;  2JWO A;  4DR7 E;  4L5N C;  4LFA I;  4HAC B;  3QT6 A;  5BR8 I;  2LE2 A;  4FWH A;  4JI3 I;  4TUI A;  4HAC A;  4Q28 A;  1HK7 A;  4DV2 I;  4X66 I;  1GQE A;  1NZ0 A;  2JVA A;  1PKP A;  2KON A;  2LTR A;  2DEI A;  2JR1 A;  3OTO I;  3J81 Q;  3ADJ A;  3T1H I;  1XNR E;  4PRV A;  1YYK A;  5F3W A;  4DR2 I;  1IBM I;  1Z5B A;  4MYU A;  2KOU A;  2LUP B;  1H74 A;  1HNX E;  1GZ6 A;  1IBK E;  2VQF E;  2UUC E;  4DU8 A;  5A2Q C;  4FWD A;  3F6G A;  3JU0 A;  2L92 A;  3DF6 A;  5LMN I;  3LLH A;  4DV7 E;  4DU7 A;  4X62 E;  2FGG A;  1NHH A;  4DPY A;  4TUG A;  4GEQ B;  2BM0 A;  4DV0 I;  4B3S E;  4ED4 A;  4NXM I;  2UXC I;  5IT9 Q;  2UUA E;  1HNZ E;  1B63 A;  4LU9 A;  1MG7 A;  4PRX A;  3VK6 A;  2HKJ A;  3J7Y p;  4DPW A;  1N0U A;  3Q6N A;  2JOB A;  1YYW A;  4KHP E;  1YZ9 A;  2O1U A;  2A2C A;  2Z5B B;  2F8B A;  4B3T I;  4DV4 I;  4WFT A;  2UUB I;  2Z5B A;  5IWA I;  1UIL A;  2LUQ A;  2FTX B;  4JI4 E;  4LF8 E;  3JAM C;  2UXD E;  3ZZT A;  4J8Z A;  4AQY I;  2HFS A;  3J80 Q;  4DKK A;  4LF6 E;  1A6F A;  1N32 I;  2NPF A;  2HHH I;  2BM1 A;  2NUF A;  2ZM6 E;  1X47 A;  3PYF A;  2BV3 A;  2B7V A;  5LMU E;  2HFU A;  4X65 E;  3B78 A;  4LF7 E;  1BKN A;  1KTV A;  4EMD A;  1KKH A;  4L8N A;  2CZ9 A;  4LF5 E;  4DV5 E;  2HK3 A;  2UXB E;  4JI2 I;  1UHZ A;  4DR1 E;  2IOQ A;  3D4J A;  4UT4 A;  2B3T B;  1DI2 A;  4B3R I;  1XHK A;  2V8Q B;  4JV5 E;  2V8P A;  1O0W A;  3Q6M A;  2LRS A;  1N33 I;  2CGE A;  3DJW A;  1I94 I;  4FW9 A;  1ZBT A;  1FI4 A;  4K0K I;  5GMD A;  1T4O A;  1EKZ A;  4JI1 I;  1H7S A;  4NXN I;  2L6M A;  2DSY A;  4DUZ E;  4DR4 E;  3HPS A;  1J26 A;  4BC9 A;  2JOX A;  3JTZ A;  2K4V A;  4DV2 E;  1QU6 A;  4X66 E;  4B3M I;  4BMJ A;  3T1Y E;  3OTO E;  3T1H E;  2MC5 A;  4Z7C A;  5FLX C;  3ADG A;  1T4L B;  4LFC I;  4LF9 I;  4LF4 E;  4DR2 E;  1FWL A;  1Z0G A;  1IBM E;  2CG9 A;  3B82 A;  4JI6 I;  1VIS A;  1NHI A;  1ZXM A;  2PNM A;  2R42 A;  4M1K A;  4WPY A;  2LTS A;  4URL A;  4DUY I;  2L3J A;  4MYT A;  4OX9 I;  4HYM A;  1Z5C A;  2MC6 A;  2KHX A;  4NXM E;  4DV1 E;  3HPZ A;  4YY3 E;  5AE3 A;  4F54 A;  3AUZ A;  4ZVI A;  2M4I A;  2ZBK B;  2V2Z A;  2LJH A;  2DB2 A;  1FKA E;  3ADL A;  1ZBQ A;  1XMO I;  4DPT A;  4YHH I;  1Y4S A;  1XNQ I;  4B3T E;  4DV4 E;  3K85 A;  2UUB E;  4WYQ B;  5IWA E;  2Z5C B;  1J5E E;  2CPN A;  4AQY E;  4LTY A;  2NA2 A;  2HHH E;  2R3V A;  3M6A A;  3B8H A;  4DPU A;  2L8T A;  4DR6 E;  4P52 A;  4JI7 I;  1N34 I;  1WHQ A;  3F6H A;  1FNM A;  4JI0 I;  3HJC A;  1Z0T A;  2L2N A;  5L3J A;  2UU9 I;  3LML A;  4DR7 I;  3WU3 A;  2VQE I;  2HKE A;  2DMY A;  3P1X A;  3RMP A;  1RQ0 A;  4JYA I;  3C4B A;  2L2K B;  2RSM A;  3VYY A;  4IZK B;  1XMQ I;  4X8W A;  2PNL A;  4UTG A;  1N33 E;  1IBL I;  1I94 E;  1XNR I;  2X36 A;  4IZK A;  1Z5A A;  5A2Q Q;  2IHR 1;  4K0K E;  2RS7 A;  3LNU A;  2LJP A;  4HY1 A;  4JI1 E;  3ZOQ B;  3C4T A;  2VF3 A;  2EWL A;  1FJG E;  4FWG A;  1D6T A;  2RS6 A;  2F4V I;  1HNX I;  5AAS A;  1Z0B A;  2L33 A;  2V87 A;  4X64 I;  1Y6Z A;  2E5L I;  2HK2 A;  1WUU A;  3HQ1 A;  4LFC E;  1EI1 A;  3HXL A;  1QZR A;  4F9B B;  3WU4 A;  1FWK A;  4JI6 E;  1HNZ I;  2UUA I;  2V88 A;  2JY9 A;  2H36 X;  2N3G A;  4F9A B;  3QT7 A;  2VE7 C;  3JAM Q;  5AE1 A;  4LFA E;  5BR8 E;  4JI3 E;  1PVG A;  4DUY E;  2O1W A;  2B7T A;  4OX9 E;  4USK A;  4DMI A;  2O1V A;  4KQV A;  1HNW I;  2V86 A;  4BBY A;  5CFF E;  2FV4 B;  4HXZ A;  3ZKB A;  1N36 I;  4R8O A;  4N3O A;  4GKJ I;  4JI4 I;  4LF8 I;  4WUC A;  1ZM3 A;  5GME A;  1ZM2 A;  3V2U C;  4R1F A;  2J7K A;  3ZM7 A;  4DR3 I;  1HR0 I;  1DQ3 A;  2AJ4 A;  2ZM6 I;  1XMO E;  4LFB I;  1XNQ E;  4JI5 I;  3J81 C;  2GQ0 A;  1ZM4 A;  3WU5 A;  4WSP A;  4GKK I;  4PU9 A;  5FWK A;  1RRE A;  3VYX A;  5LMN E;  3F0N A;  4USM A;  4WUB A;  1X48 A;  4M0V A;  4DR1 I;  3LTO A;  2ZIT A;  2V83 A;  1U2R A;  4DV0 E;  4XTJ A;  4DR5 I;  2UXC E;  1B62 A;  2NUG A;  4JI8 I;  4JV5 I;  4BCA A;  4JI7 E;  1WHN A;  1N34 E;  3HUL A;  1NHJ A;  2UU9 E;  4DXL A;  3PYD A;  3K17 A;  2VQE E;  5IT9 C;  4M30 A;  1Y4U A;  4DUZ I;  4DR4 I;  3ADI A;  2Z5E A;  2DEJ A;  5FLX Q;  4DV3 I;  4BC7 A;  3ZKD A;  1EA6 A;  4JYA E;  1XMQ E;  2Z5C A;  4DV6 I;  3T1Y I;  2G7H A;  1IBL E;  2EZ6 A;  1Z59 A;  1N32 E;  2ODR D;  4KZS A;  4WUD A;  2OI2 A;  3H09 A;  1H72 C;  4LF4 I;  3MSW A;  2F4V E;  3AV0 A;  3J7A G;  3FIG A;  3IWB A;  3LPS A;  3J80 C;  4FN5 A;  1ZM9 A;  1USU A;  4JI2 E;  4X64 E;  2Q2E B;  1N0V C;  2E5L E;  2GS8 A;  5DNY A;  2V89 A;  4IZJ B;  1K47 A;  4P78 A;  4R03 A;  3Q1Q A;  2B9D A;  4B3R E;  3QT8 A;  4DV1 I;  4YY3 I;  3IWC A;  4IZJ A;  5ADZ A;  1RC7 A;  4I8O A;  3GON A;  2V2V A;  2RTX A;  5AE2 A;  2X7I A;  3K1J A;  3V5R A;  2O1T A;  4NXN E;  4OOG C;  5LL6 R;  1Z0W A;  1YYO A;  2MDR A;  1STU A;  1Z0V A;  1H7U A;  1Z0E A;  3PYG A;  1IBK I;  1HNW E;  2L3C A;  2VQF I;  1PIE A;  2UUC I;  1X49 A;  3KWR A;  1N36 E;  1S4E A;  1H73 A;  3J7A M;  4GKJ E;  4B3M E;  4DV7 I;  3ZZU A;  1J5E I;  4Z7Y A;  2LMZ A;  3PRY A;  4X62 I;  4DR3 E;  1WXR A;  1HR0 E;  1OJ4 A;  3P06 A;  1MU5 A;  2N3H A;  4LF9 E;  4B3S I;  4P7A A;  4LFB E;  4F9C B;  4DR6 I;  4JI5 E;  2V85 A;  3OML A;  3ZZ0 A;  4GKK E;  4RPF A;  4KHP I;  2WZO A;  2VF1 A;  2E1R A;  2IOP A;  1ZXN A;  4P7D A;  4I3H A;  2YZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...