4X66E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x66E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66E02
4DR5E 2F4VE 1NHIA 5LMUI 2LTRA 4OX9I 1EI1A 1X48A 4WUBA 2RS6A 2RTXA 2V8PA 1IBKE 1U2RA 4LF4E 4B3MI 4DR1E 1UILA 3J81C 3ADLA 4LF8E 2DEIA 1B62A 4DR4I 4LFBI 4B3SE 2J7KA 1IBMI 5A2QQ 1T4OA 2UU9E 3PYFA 4DUYI 4LF7I 4M1KA 1D6TA 1IBLE 2EFGA 2B3TB 2JVAA 4YY3E 2F4VI 1WHNA 1HR0I 5IWAE 1RQ0A 3J7Yp 3HULA 1EKZA 1IBKI 4LF4I 2DMYA 2UXDI 4DV5I 4DR1I 2GS8A 4GKKE 4HY1A 4LF8I 2UUBE 1Z0WA 3PYGA 4DV3E 2X36A 1UHZA 2VQFI 2BV3A 4DU7A 4DUZI 3JAMQ 3VYYA 1HNXI 1ZM9A 1XNRI 5CFFE 4YHHE 4X65E 1BKNA 1FI4A 2UU9I 2V2QA 2HHHI 4ED4A 1IBLI 3QT6A 4JI2I 4LF6E 5BR8E 1Z0TA 3OTOI 4DR7E 3ZKDA 4X64I 4DXLA 2NPFA 1YZ9A 4USMA 4DPWA 4DR2I 4GKKI 4FN5A 4R1FA 4JI7E 4DV0I 3F0NA 1PVGA 2UUBI 1NZ0A 2UXBI 2JY9A 1N36E 1DI2A 2V2VA 4HYMA 4X65I 1NHHA 1Z0VA 4DR6E 3T1HI 1FNMA 4XTJA 4LF6I 1YYOA 5L3JA 1J26A 4JI3E 3C4TA 4B3ME 2L3JA 3J80Q 3HTXA 3V2UC 1STUA 4JI7I 4ZVIA 3CWVA 4AQYE 2KHXA 4X62I 4LF9I 1H7SA 4LFCI 4X8WA 1HNWE 2L3CA 1HNZI 4LFBE 1IBME 1VISA 4P7AA 3C4BA 2CZ9A 4DUYE 2RS7A 4GKJI 2R42A 4DR6I 4DPYA 1ZM2A 2XEXA 4B3TI 2N3GA 2HK2A 4JI1E 3P1XA 1HR0E 2NA2A 1B63A 1FKAE 4Z7CA 1MU5A 4KQVA 1MX0A 2NUFA 4JI3I 2A2DA 2UXDE 4DV5E 1DARA 4HXZA 3M6AA 2L2KB 4AQYI 2UUAE 2HKJA 2VQFE 2NUGA 4DUZE 2ZM6I 1HNWI 2L33A 1Z5BA 1HNXE 3J81Q 1XNRE 1T4LB 2HHHE 3K1JA 3QT5A 1X49A 2LTSA 5FLXC 4JI2E 2UUCE 4JI1I 1OJ4A 3OTOE 3VYXA 3B78A 3T1YE 1I94I 4X64E 1KTVA 1GQEA 1ZM4A 4JI0I 2HK3A 2EZ6A 4RPFA 4JI8I 4DR2E 4DPXA 1XMOI 4KHPE 4DV0E 1N34E 2ZITA 4M30A 2UUAI 1H74A 2UXBE 5IT9C 2CPNA 1Z0GA 2HKEA 4DV2E 3WU6A 4DR3I 3T1HE 2VQEI 1O0WA 4DV6E 2UUCI 1X47A 3B82A 2YT4A 3T1YI 3D4JA 3Q1QA 4DV1E 1S16A 1H7UA 4X66E 4USKA 2DB2A 3PYDA 1XMQI 4LFAE 4KHPI 4URLA 1N33E 3V5RA 4X62E 4LF9E 1N34I 4LFCE 1HNZE 1RR9A 4DV7E 2DEJA 3LNUA 2UXCI 4DV2I 5LL6R 4GKJE 1UEKA 2AJ4A 4UT4A 4B3TE 2X7IA 2E5LE 4HACA 2L2NA 4DV6I 4NXMI 2BM0A 4FWHA 4DV1I 4P52A 3LPSA 1NHJA 2MDRA 4X66I 3ADJA 4LFAI 1Z5AA 1N0VC 1N33I 4JI6E 1RREA 4I3HA 2ZM6E 2OI2A 4DV7I 3ZM7A 2RSMA 1KVKA 4JYAI 1ZM3A 1Z59A 1T4NA 4B3RI 4K0KI 2E5LI 4HACB 2NUEA 1I94E 1WHQA 2LUPB 4JI0E 4DV4I 2IHR1 1Z0BA 3QT7A 4JI8E 4M2ZA 1XMOE 1J5EE 1WUUA 1XNQI 2B7TA 4JI6I 4WFTA 5GMDA 2R3VA 3ZZ0A 2VF3A 4DPTA 1A6FA 2L2MA 1YYWA 4DR3E 2VQEE 1ZXMA 1PKPA 4DPUA 4DKKA 4LF5I 5A2QC 2N3HA 2B7VA 2ZBKB 5FLXQ 1EA6A 1XMQE 1N32I 1J5EI 1H72C 2Q2EB 4FWGA 5LMNI 4Z7YA 1QU6A 1FWKA 3WU4A 4UTGA 4DU8A 4DR5I 1XHKA 4JI5E 4MYUA 2UXCE 2WW4A 1ZXNA 2HFSA 5IT9Q 2LBSB 1ZBTA 3H4LA 1K47A 2DIXA 1FJGE 3JAMC 4JV5E 3LTOA 1H73A 3ZZUA 4NXME 2LJHA 4EMDA 3WU5A 2LJPA 4B3SI 1PIEA 5GMEA 2LUQA 3ZKBA 1RC7A 1FWLA 3J7AM 4YY3I 4JI5I 3ADGA 5IWAI 4WUDA 4JYAE 4JI4E 2E1RA 4PU9A 4B3RE 4K0KE 2BM1A 2V2ZA 1Z0EA 3B8HA 2V34A 1FJGI 4JV5I 2HFUA 4OOGC 4NXNE 4WUCA 3LLHA 4DV3I 4DV4E 4MYTA 2LRSA 2A2CA 1QZRA 1KKHA 1XNQE 4YHHI 1N0UA 1MG7A 1S4EA 3WU3A 5LMUE 5BR8I 4OX9E 3J80C 4DR7I 4WYQB 1Z5CA 3QT8A 1YYKA 4JG4A 4JI4I 4PRXA 3ZZTA 3K17A 4LF5E 3ADIA 3J7AG 3PYEA 4NXNI 3GONA 4PRVA 1ELOA 4DR4E 4FW9A 1KIJA 1N36I 1N32E 5LMNE 1Z0CA 4FWDA 4LF7E
chains in the Genus database with same CATH superfamily
4KZSA 2JEBA 2Z5BA 2EORA 3UHMA 4DR5E 2F4VE 2ELZA 1NHIA 5LMUI 2LTRA 4OX9I 1EI1A 2PNLA 1X48A 3IWCA 3VHTB 3U1KA 4WUBA 4DMIA 2RS6A 2RTXA 4R2SA 2V8PA 1IBKE 1U2RA 4J8ZA 4LF4E 1IQOA 2RPCA 3C6MA 4DR1E 4B3MI 5TSEA 1UILA 1T39A 1SR9A 2EN2A 2PRTA 1Y60A 2BA1D 2I13A 3J81C 3ADLA 2J7JA 4LF8E 5JEAC 3C6KA 4BC9A 3K6QA 1BBGA 3P76A 2DEIA 5KL4A 2PO2A 1X5WA 1B62A 3ZOQB 2GO4A 2EM9A 4DR4I 4BA1B 4LCHA 4LFBI 4B3SE 2J7KA 1IBMI 5A2QQ 1T4OA 2UU9E 3M7ND 5LLQA 4ISAA 1N3GA 3PYFA 4DUYI 4LF7I 5JEAB 4M1KA 1D6TA 2JEBB 1IBLE 2EWLA 2EFGA 4MU3A 2B3TB 2JVAA 3TQMA 4YY3E 1A1GA 2CTDA 2F4VI 1WHNA 1HR0I 3H1CA 2NN6D 4FK5C 2E1MA 2M9AA 5IWAE 2YTGA 1RQ0A 1X6HA 2LJUA 3J7Yp 3B4TA 3HULA 1EKZA 1IBKI 3IWBA 4LF4I 2DMYA 1YH8A 2UXDI 4F6NA 2ENCA 4DV5I 3AUZA 4DR1I 2V85A 2LE2A 3OMLA 5DRQA 4OO1E 2GS8A 4GKKE 2EPCA 3UK3C 2EMWA 3JU0A 2GO3A 5A6KA 4HY1A 2EMBA 4P78A 4LPFA 4LF8I 2EMCA 2EPPA 2UUBE 1Z0WA 3PYGA 4DV3E 2X36A 4M0VA 3IWDA 1UHZA 1A1LA 2C38A 2VQFI 2BV3A 3M99B 4IFDA 1ZBQA 4DU7A 5EL9A 4DUZI 4OO1F 2EM5A 3HQ1A 1UN6B 3JAMQ 3VYYA 3THOB 1X6EA 1HNXI 2EN6A 5DROA 1ZM9A 1XNRI 2EOSA 5CFFE 4X65E 4YHHE 1BKNA 1FI4A 3GMEA 4GEQB 3NZKA 2UU9I 2DLKA 2V2QA 2HHHI 2EOOA 4ED4A 1RMDA 1IBLI 2WCC3 3QT6A 2L92A 1KYQA 4QNJA 4JI2I 4LF6E 5BR8E 1Z0TA 3OTOI 4DR7E 2WP8B 4I8OA 2EMHA 2NN6E 3ZKDA 4X64I 1IMUA 2MDGA 4DXLA 2D9HA 2NPFA 1YZ9A 4IFDC 4USMA 2C39B 1Y4SA 4KWYA 5KL3A 2DRPA 4DPWA 4LCFA 1WRJA 2LV2A 4DR2I 2YPNA 2NN6F 2EOJA 5FWKA 4GKKI 4FN5A 5K36D 4R1FA 4JI7E 4DV0I 1ZR9A 5C0XD 3F0NA 1PVGA 2EPKX 4TUGA 2EPXA 4N4RB 2UUBI 2HGHA 2EMZA 2VF1A 1NZ0A 2UXBI 4AIMA 2IERA 2JY9A 1N36E 1DI2A 3KRNA 2V2VA 1JK1A 2DMIA 1A1KA 3BF2A 4M9VC 2LVHA 4HYMA 4X65I 1NHHA 1Z0VA 2EP3A 2EPRA 4DR6E 4F54A 3T1HI 1YUJA 1FNMA 4Q35B 3CDJA 1QNTA 5T6JA 4XTJA 2CT1A 4LF6I 1YYOA 1GTKA 5L3JA 4MQYA 1J26A 2EOEA 3MHHC 5F3WA 4JI3E 4MU4A 3F6HA 4FW6A 3C4TA 1A1FA 4B3ME 4MDTA 3EQ1A 2L3JA 4LU9A 2BA1G 3J80Q 3HTXA 4BA2B 3K85A 2YTDA 2YRKA 3V2UC 1STUA 4IS9A 4JI7I 1P47A 4ZVIA 5K36E 2FTXB 2J65A 5C0XE 3CWVA 2EOMA 4AQYE 2VESA 2KHXA 4R2RA 2EPUA 2NABA 4X62I 4FW3A 1H7SA 4LFCI 4LF9I 4X8WA 2NN6B 4MLQA 4BA1A 1HNWE 2L3CA 1L4SA 1HNZI 4LFBE 1IBME 1VISA 4P7DA 4P7AA 2EQ0A 1MEYC 5ADZA 3C4BA 1MGTA 2V8QB 1Y5YA 4U3DA 5C0XF 3M7NG 2CZ9A 4O5GA 2RS7A 4DUYE 2R42A 4GKJI 4DR6I 2A25A 2I9IA 3LMLA 1ZM2A 2XEXA 3HKMA 4DPYA 4B3TI 4FW4A 1ZU1A 2N3GA 2JOBA 2HK2A 2YTJA 1ZAAC 4JI1E 2JPAA 3P1XA 2V88A 4F9AB 2NA2A 1LLMC 1HR0E 1FKAE 2JP9A 1B63A 3DJWA 2BR2A 3VK6A 1MU5A 4Z7CA 2AE8A 3EPJA 4KQVA 2MKDA 4HEIA 1MX0A 2IOQA 2EPNA 1YHCA 2PO0B 2L6MA 2NUFA 4JI3I 2R76A 2A2DA 2UXDE 5A6JA 4DV5E 2JT2A 1DGCA 4OO1D 1DARA 4NZVA 4HXZA 1PJSA 3BIDA 2V89A 4R2EA 1T38A 3M6AA 4TUIA 2L2KB 4RHBB 4NHRA 4AQYI 2HJJA 2YRMA 2UUAE 2HKJA 4WX9A 2VQFE 4IJDA 5A6BA 2NUGA 4DUZE 2ZM6I 1HNWI 2L33A 1G2DC 3HXLA 1Z5BA 1HNXE 3J81Q 3PRYA 1XNRE 3CDIA 1T4LB 3BGHA 4QNKA 4F6MA 2HHHE 5AE2A 4GZNC 3K1JA 3QT5A 1X49A 5K36B 2JXPA 2LTSA 2ODRC 5FLXC 4BMJA 4JI2E 2UUCE 2CGEA 1OJ4A 4JI1I 3OTOE 3VYXA 2WP8A 2YTPA 3B78A 2BR2B 3T1YE 1I94I 4X64E 4BHBA 3EPLA 5AC5A 2LMZA 1KTVA 1GQEA 1ZM4A 2C39A 4OKGA 4JI0I 2HK3A 2EZ6A 3H09A 2EN1A 4RPFA 3PS3A 4JI8I 4DR2E 4DPXA 3Q6NA 1XMOI 4KHPE 2VE7C 4DV0E 3EPHA 2JEAB 3KZZA 1YUIA 4R2DA 1N34E 2ZITA 4M30A 2UUAI 3Q6MA 1H74A 2UXBE 2EN8A 1TF3A 2GLIA 5IV8B 5AC4A 5IT9C 2CPNA 1Z0GA 2O1WA 1UDOA 2HKEA 4IFDE 2F8BA 4F9BB 4DV2E 4GQUA 1Y6ZA 4AIDA 4L5NC 4OO1A 4WXDA 3WU6A 4WSPA 3T1HE 4DR3I 2VQEI 1O0WA 2YWQA 5IXMB 4DV6E 1TF6A 2MKNA 2UUCI 2EL5A 1X47A 4IFDF 3B82A 1A1HA 2YT4A 3THNA 3T1YI 2GHFA 3KWRA 3D4JA 4BS9A 2CG9A 1EH8A 4IS1C 2GQ0A 2EM3A 4DV1E 3Q1QA 1IQSA 2Z5EA 1S16A 4FW7A 4NBQA 1H7UA 4X66E 2EOZA 4USKA 1UDNA 2DB2A 3PYDA 1XMQI 1X6FA 4LFAE 4BA2A 4KHPI 4R2QA 1EH6A 3P3EA 4URLA 1USUA 1N33E 1X3CA 1Y4UA 3V5RA 1F2IG 4X62E 4LF9E 1N34I 2EN4A 4LFCE 2NN6A 2C37A 2EPZA 2JWOA 2WBUA 1HNZE 1RR9A 4MU0A 2YTNA 4DV7E 2DEJA 3LNUA 2KONA 2WNRB 2WBTA 3JTZA 5A6AA 1UDSA 2UXCI 4DV2I 5LL6R 5AASA 2EOYA 4F9CB 4GKJE 4OO1B 1UEKA 2AJ4A 4UT4A 4B3TE 2X7IA 3PS1A 2E5LE 1G2FC 1YSAC 4HACA 2L2NA 4DV6I 4MU1A 5JEAD 2EM8A 2EOIA 2EPLX 2YTOA 2EM6A 4NXMI 2EMKA 2BM0A 4FWHA 2MC6A 1WJPA 4DV1I 2NN6C 2PO0A 2EL6A 4P52A 2EN7A 1OYPA 3LPSA 1NHJA 2MDRA 1NCSA 4BHCA 2E72A 2RQLA 4X66I 3ADJA 4R03A 4LFAI 1Z5AA 2V86A 3AV0A 1N0VC 2O1TA 1PJTA 1N33I 5AE1A 2YTEA 2B9DA 2ODRD 2YU8A 4JI6E 2YSPA 5DRPA 3MHSC 1RREA 2VRDA 4I3HA 2ZM6E 2EMAA 4BCAA 2C37B 1B69A 2OI2A 4DV7I 3M85D 3ZM7A 2FGGA 4R2CA 2RSMA 1KVKA 4JYAI 1ZM3A 2K7IA 5DNXA 1Z59A 1T4NA 3GLLA 4IZJD 5K36A 1HK7A 4B3RI 4K0KI 2E5LI 4HACB 5C0XA 1WXRA 4ZYGA 3EPKA 1XXEA 3HJCA 3PS2A 5JEAE 2NUEA 5JEAA 4WPYA 1I94E 4X9JA 3L00A 2G7HA 1WHQA 1NEIA 2LUPB 4JI0E 2JYAA 4DV4I 1AH5A 2IHR1 4O24A 2DSYA 4MLVA 1Z0BA 3QT7A 5JEAF 4JI8E 4F2JC 1XMOE 4M2ZA 1J5EE 5AE3A 4Q28A 5KL6A 3DD6A 2JEAA 2YTQA 1WUUA 1XNQI 4R2PA 2O1UA 5K36C 2B7TA 4R8OA 2EM4A 2R1FA 4AM3A 4JI6I 4WFTA 5GMDA 1YPNA 5C0XC 2R3VA 1VI7A 3ZZ0A 3HPSA 2VF3A 2GPIA 2LCEA 2BB8A 5DNYA 2EMLA 2EM7A 3L7ZA 1PDAA 4DPTA 2YRHA 4IFDD 1A6FA 2BA0G 2L2MA 2YZTA 2MC5A 4RH8A 1YYWA 2F1DA 5KL7A 3DF6A 4DR3E 1DQ3A 2VQEE 5C0XB 1ZXMA 1Z1BA 1PKPA 4DPUA 4DKKA 4LF5I 2H36X 2EMXA 1R6MA 2HC5A 5KL5A 4O43A 1GZ6A 5A2QC 3P3GA 2N3HA 2K4VA 2B7VA 2ENAA 2IESA 4R2AA 1EH7A 4L8NA 4LTYA 1P42A 2ZBKB 5FLXQ 1EA6A 4LCGA 1XMQE 1N32I 1J5EI 1H72C 2Q2EB 4FWGA 4IZJA 5LMNI 2EMFA 4Z7YA 4O4KA 1QU6A 1FWKA 2CVEA 3WU4A 4UTGA 4DU8A 2Z5BB 4DR5I 2ADRA 2YTFA 1XHKA 4WSGA 2DLQA 2EOXA 3L7ZB 2WNRA 4JI5E 4MYUA 2UXCE 3KZYA 2BA0D 1E3HA 2WW4A 1ZXNA 2HFSA 3QG5C 1YFHA 2Z5CA 5IT9Q 2LBSB 1ZBTA 2PNZA 3H4LA 1K47A 2DIXA 2JOXA 3JAMC 1FJGE 4JV5E 1H73A 1R6LA 3LTOA 4IZKA 1SFEA 4NXME 2EPOA 3ZZUA 3P06A 4ZYDA 2M7QA 5EKWA 2LJHA 2M1SA 4LOMA 4EMDA 2PO2B 2O3ZA 3WU5A 2BBGA 4HTGA 4N3OA 2LJPA 1UDQA 4B3SI 2L8TA 1E3PA 2EQ3A 1PIEA 2LUQA 4IZJB 5GMEA 2PO1A 4OO1C 2ELYA 2M4IA 3ZKBA 1A1JA 1RC7A 4ZYHA 1FWLA 2EMGA 3M85G 3J7AM 4YY3I 4U3BA 1BB8A 2LT7A 1BBOA 3ECRA 4JI5I 1USVA 3ADGA 1OYSA 5IWAI 2EJ4A 4WUDA 4JYAE 4JI4E 3BBGA 2E1RA 4PU9A 4B3RE 4K0KE 2Z5CB 2BM1A 2CSHA 2EN3A 4BC7A 2O1VA 1Z0EA 2V2ZA 3B8HA 5DNLA 2PNZB 2IOPA 2V34A 1FJGI 4JV5I 2HFUA 4IZKB 2Q8UA 4OOGC 4NXNE 4WUCA 3LLHA 2EOFA 4DV3I 2PNMA 4ZYEA 4DV4E 4MYTA 2LRSA 2C38B 4IFDB 3P3CA 2A2CA 2KOUA 2JE6A 1QZRA 2V83A 1KKHA 2EOQA 1XNQE 4YHHI 2PO1B 2YSOA 1N0UA 1MG7A 1S4EA 2EOHA 2EPMX 3WU3A 5LMUE 5BR8I 4WXCA 5KL2A 3J80C 3RMPA 4OX9E 4DR7I 4WYQB 1Z5CA 1TN9A 2RSIA 5A6BD 1A1IA 2EE8A 1YYKA 3QT8A 5DRRA 1JK2A 3U1YA 2JR1A 2EM0A 2EL4A 2EQ1A 4JG4A 5ELWA 4JI4I 1AAYA 1UBDC 4BBYA 1KJKA 5A69A 3FIGA 4PRXA 3ZZTA 3K17A 4J3DA 1PJQA 2LO3A 2WZOA 2FV4B 3GCMA 4LF5E 2EMYA 4FW5A 3ADIA 1OYRA 3J7AG 3PYEA 2N8XA 1RHYA 2YTIA 4OZEA 4NXNI 3F6GA 3GONA 4PRVA 1ELOA 2EPAA 4DR4E 2WBSA 4FW9A 1KIJA 3HPZA 1N36I 1N32E 2ENHA 5K36F 2EMIA 3MSWA 2JE6B 5LMNE 2V87A 2DGCA 1Z0CA 4FWDA 2YU5A 2EM2A 4LF7E
chains in the Genus database with same CATH topology
4KZSA 2Z5BA 4DR5E 2F4VE 1NHIA 5LMUI 2LTRA 4OX9I 1EI1A 2PNLA 1X48A 3IWCA 4WUBA 4DMIA 2RS6A 2RTXA 2V8PA 1IBKE 1U2RA 4J8ZA 4LF4E 4B3MI 4DR1E 1UILA 1SR9A 3J81C 3ADLA 4LF8E 4BC9A 3K6QA 2DEIA 1B62A 3ZOQB 4DR4I 4LFBI 4B3SE 2J7KA 1IBMI 5A2QQ 1T4OA 2UU9E 3PYFA 4DUYI 4LF7I 4M1KA 1D6TA 1IBLE 2EWLA 2EFGA 2B3TB 2JVAA 4YY3E 2F4VI 1WHNA 1HR0I 2E1MA 5IWAE 1RQ0A 3J7Yp 3HULA 1EKZA 1IBKI 3IWBA 4LF4I 2DMYA 2UXDI 4DV5I 3AUZA 4DR1I 2V85A 2LE2A 3OMLA 2GS8A 4GKKE 4HY1A 3JU0A 4LF8I 4P78A 2UUBE 1Z0WA 3PYGA 4DV3E 2X36A 4M0VA 3IWDA 1UHZA 2VQFI 2BV3A 1ZBQA 4DU7A 4DUZI 3HQ1A 3JAMQ 3VYYA 1HNXI 1ZM9A 1XNRI 5CFFE 4X65E 4YHHE 1BKNA 1FI4A 2UU9I 4GEQB 2V2QA 2HHHI 4ED4A 1IBLI 3QT6A 2L92A 4JI2I 4LF6E 5BR8E 1Z0TA 3OTOI 4DR7E 4I8OA 3ZKDA 4X64I 4DXLA 2NPFA 1YZ9A 4USMA 1Y4SA 4DPWA 4DR2I 5FWKA 4GKKI 4FN5A 4R1FA 4JI7E 4DV0I 3F0NA 1PVGA 4TUGA 2UUBI 2VF1A 1NZ0A 2UXBI 2JY9A 1N36E 1DI2A 2V2VA 4HYMA 4X65I 1NHHA 1Z0VA 4DR6E 4F54A 3T1HI 1FNMA 5T6JA 4XTJA 4LF6I 1YYOA 5L3JA 1J26A 5F3WA 4JI3E 3F6HA 3C4TA 4B3ME 2L3JA 4LU9A 3J80Q 3HTXA 3K85A 3V2UC 1STUA 4JI7I 4ZVIA 2FTXB 3CWVA 4AQYE 2KHXA 4X62I 4LF9I 1H7SA 4LFCI 4X8WA 1HNWE 2L3CA 1HNZI 4LFBE 1IBME 1VISA 4P7DA 4P7AA 5ADZA 3C4BA 2V8QB 2CZ9A 4DUYE 2RS7A 4GKJI 2R42A 4DR6I 4DPYA 3LMLA 1ZM2A 2XEXA 4B3TI 2N3GA 2JOBA 2HK2A 4JI1E 3P1XA 2V88A 4F9AB 2NA2A 1HR0E 1B63A 1FKAE 4Z7CA 3DJWA 3VK6A 1MU5A 4KQVA 1MX0A 2IOQA 2L6MA 2NUFA 4JI3I 2A2DA 2UXDE 4DV5E 1DARA 4HXZA 2V89A 3M6AA 4TUIA 2L2KB 4AQYI 2UUAE 2HKJA 2VQFE 2NUGA 4DUZE 2ZM6I 1HNWI 2L33A 3HXLA 1Z5BA 1HNXE 3J81Q 3PRYA 1XNRE 1T4LB 2HHHE 5AE2A 3K1JA 3QT5A 1X49A 2LTSA 2ODRC 5FLXC 4BMJA 4JI2E 2UUCE 2CGEA 1OJ4A 4JI1I 3OTOE 3VYXA 3B78A 3T1YE 1I94I 4X64E 1KTVA 2LMZA 1GQEA 1ZM4A 4JI0I 2HK3A 2EZ6A 3H09A 4RPFA 4JI8I 4DR2E 4DPXA 3Q6NA 1XMOI 4KHPE 2VE7C 4DV0E 1N34E 2ZITA 4M30A 2UUAI 3Q6MA 1H74A 2UXBE 5IT9C 2CPNA 1Z0GA 2O1WA 2HKEA 2F8BA 4F9BB 4DV2E 1Y6ZA 4L5NC 3WU6A 4WSPA 3T1HE 4DR3I 2VQEI 1O0WA 4DV6E 2UUCI 1X47A 3B82A 2YT4A 3T1YI 3KWRA 3D4JA 4BS9A 2CG9A 2GQ0A 3Q1QA 4DV1E 2Z5EA 1S16A 1H7UA 4X66E 4USKA 2DB2A 3PYDA 1XMQI 4LFAE 4KHPI 4URLA 1USUA 1N33E 1Y4UA 3V5RA 4X62E 4LF9E 1N34I 4LFCE 2JWOA 1HNZE 1RR9A 4DV7E 2DEJA 3LNUA 2KONA 3JTZA 2UXCI 4DV2I 5LL6R 5AASA 4F9CB 4GKJE 1UEKA 2AJ4A 4UT4A 4B3TE 2X7IA 2E5LE 4HACA 2L2NA 4DV6I 4NXMI 2BM0A 4FWHA 2MC6A 4DV1I 4P52A 3LPSA 1NHJA 2MDRA 4X66I 3ADJA 4R03A 4LFAI 1Z5AA 2V86A 3AV0A 1N0VC 2O1TA 1N33I 5AE1A 2B9DA 2ODRD 4JI6E 1RREA 4I3HA 2ZM6E 4BCAA 2OI2A 4DV7I 3ZM7A 2FGGA 2RSMA 1KVKA 4JYAI 1ZM3A 1Z59A 1T4NA 4IZJD 1HK7A 4B3RI 4K0KI 2E5LI 4HACB 1WXRA 3HJCA 2NUEA 4WPYA 1I94E 2G7HA 1WHQA 2LUPB 4JI0E 4DV4I 2IHR1 2DSYA 1Z0BA 3QT7A 4JI8E 4M2ZA 1XMOE 1J5EE 5AE3A 4Q28A 1WUUA 1XNQI 2O1UA 2B7TA 4R8OA 4JI6I 4WFTA 5GMDA 2R3VA 3ZZ0A 3HPSA 2VF3A 5DNYA 4DPTA 1A6FA 2L2MA 2YZTA 2MC5A 1YYWA 3DF6A 4DR3E 1DQ3A 2VQEE 1ZXMA 1PKPA 4DPUA 4DKKA 4LF5I 2H36X 5A2QC 1GZ6A 2N3HA 2K4VA 2B7VA 4L8NA 4LTYA 2ZBKB 5FLXQ 1EA6A 1XMQE 1N32I 1J5EI 1H72C 2Q2EB 4FWGA 4IZJA 5LMNI 4Z7YA 1QU6A 1FWKA 3WU4A 4UTGA 4DU8A 2Z5BB 4DR5I 1XHKA 4JI5E 4MYUA 2UXCE 2WW4A 1ZXNA 2HFSA 2Z5CA 5IT9Q 2LBSB 1ZBTA 3H4LA 1K47A 2DIXA 2JOXA 3JAMC 1FJGE 4JV5E 1H73A 3LTOA 4IZKA 3ZZUA 4NXME 3P06A 2M7QA 2LJHA 2M1SA 4EMDA 3WU5A 4N3OA 2LJPA 4B3SI 2L8TA 4IZJB 1PIEA 5GMEA 2LUQA 2M4IA 3ZKBA 1RC7A 1FWLA 3J7AM 4YY3I 4JI5I 1USVA 3ADGA 5IWAI 4WUDA 4JYAE 4JI4E 2E1RA 4PU9A 4B3RE 4K0KE 2Z5CB 2BM1A 4BC7A 2O1VA 1Z0EA 2V2ZA 3B8HA 2IOPA 2V34A 1FJGI 4JV5I 2HFUA 4IZKB 4OOGC 4NXNE 4WUCA 3LLHA 4DV3I 2PNMA 4DV4E 4MYTA 2LRSA 2A2CA 2KOUA 1QZRA 2V83A 1KKHA 1XNQE 4YHHI 1N0UA 1MG7A 1S4EA 3WU3A 5LMUE 5BR8I 3RMPA 3J80C 4OX9E 4DR7I 4WYQB 1Z5CA 3QT8A 1YYKA 2JR1A 4JG4A 4JI4I 4BBYA 3FIGA 4PRXA 3ZZTA 3K17A 2WZOA 2FV4B 4LF5E 3ADIA 3J7AG 3PYEA 4NXNI 3F6GA 3GONA 4PRVA 1ELOA 4DR4E 4FW9A 1KIJA 3HPZA 1N36I 1N32E 3MSWA 5LMNE 2V87A 1Z0CA 4FWDA 4LF7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  2F4V E;  1NHI A;  5LMU I;  2LTR A;  4OX9 I;  1EI1 A;  1X48 A;  4WUB A;  2RS6 A;  2RTX A;  2V8P A;  1IBK E;  1U2R A;  4LF4 E;  4B3M I;  4DR1 E;  1UIL A;  3J81 C;  3ADL A;  4LF8 E;  2DEI A;  1B62 A;  4DR4 I;  4LFB I;  4B3S E;  2J7K A;  1IBM I;  5A2Q Q;  1T4O A;  2UU9 E;  3PYF A;  4DUY I;  4LF7 I;  4M1K A;  1D6T A;  1IBL E;  2EFG A;  2B3T B;  2JVA A;  4YY3 E;  2F4V I;  1WHN A;  1HR0 I;  5IWA E;  1RQ0 A;  3J7Y p;  3HUL A;  1EKZ A;  1IBK I;  4LF4 I;  2DMY A;  2UXD I;  4DV5 I;  4DR1 I;  2GS8 A;  4GKK E;  4HY1 A;  4LF8 I;  2UUB E;  1Z0W A;  3PYG A;  4DV3 E;  2X36 A;  1UHZ A;  2VQF I;  2BV3 A;  4DU7 A;  4DUZ I;  3JAM Q;  3VYY A;  1HNX I;  1ZM9 A;  1XNR I;  5CFF E;  4YHH E;  4X65 E;  1BKN A;  1FI4 A;  2UU9 I;  2V2Q A;  2HHH I;  4ED4 A;  1IBL I;  3QT6 A;  4JI2 I;  4LF6 E;  5BR8 E;  1Z0T A;  3OTO I;  4DR7 E;  3ZKD A;  4X64 I;  4DXL A;  2NPF A;  1YZ9 A;  4USM A;  4DPW A;  4DR2 I;  4GKK I;  4FN5 A;  4R1F A;  4JI7 E;  4DV0 I;  3F0N A;  1PVG A;  2UUB I;  1NZ0 A;  2UXB I;  2JY9 A;  1N36 E;  1DI2 A;  2V2V A;  4HYM A;  4X65 I;  1NHH A;  1Z0V A;  4DR6 E;  3T1H I;  1FNM A;  4XTJ A;  4LF6 I;  1YYO A;  5L3J A;  1J26 A;  4JI3 E;  3C4T A;  4B3M E;  2L3J A;  3J80 Q;  3HTX A;  3V2U C;  1STU A;  4JI7 I;  4ZVI A;  3CWV A;  4AQY E;  2KHX A;  4X62 I;  4LF9 I;  1H7S A;  4LFC I;  4X8W A;  1HNW E;  2L3C A;  1HNZ I;  4LFB E;  1IBM E;  1VIS A;  4P7A A;  3C4B A;  2CZ9 A;  4DUY E;  2RS7 A;  4GKJ I;  2R42 A;  4DR6 I;  4DPY A;  1ZM2 A;  2XEX A;  4B3T I;  2N3G A;  2HK2 A;  4JI1 E;  3P1X A;  1HR0 E;  2NA2 A;  1B63 A;  1FKA E;  4Z7C A;  1MU5 A;  4KQV A;  1MX0 A;  2NUF A;  4JI3 I;  2A2D A;  2UXD E;  4DV5 E;  1DAR A;  4HXZ A;  3M6A A;  2L2K B;  4AQY I;  2UUA E;  2HKJ A;  2VQF E;  2NUG A;  4DUZ E;  2ZM6 I;  1HNW I;  2L33 A;  1Z5B A;  1HNX E;  3J81 Q;  1XNR E;  1T4L B;  2HHH E;  3K1J A;  3QT5 A;  1X49 A;  2LTS A;  5FLX C;  4JI2 E;  2UUC E;  4JI1 I;  1OJ4 A;  3OTO E;  3VYX A;  3B78 A;  3T1Y E;  1I94 I;  4X64 E;  1KTV A;  1GQE A;  1ZM4 A;  4JI0 I;  2HK3 A;  2EZ6 A;  4RPF A;  4JI8 I;  4DR2 E;  4DPX A;  1XMO I;  4KHP E;  4DV0 E;  1N34 E;  2ZIT A;  4M30 A;  2UUA I;  1H74 A;  2UXB E;  5IT9 C;  2CPN A;  1Z0G A;  2HKE A;  4DV2 E;  3WU6 A;  4DR3 I;  3T1H E;  2VQE I;  1O0W A;  4DV6 E;  2UUC I;  1X47 A;  3B82 A;  2YT4 A;  3T1Y I;  3D4J A;  3Q1Q A;  4DV1 E;  1S16 A;  1H7U A;  4X66 E;  4USK A;  2DB2 A;  3PYD A;  1XMQ I;  4LFA E;  4KHP I;  4URL A;  1N33 E;  3V5R A;  4X62 E;  4LF9 E;  1N34 I;  4LFC E;  1HNZ E;  1RR9 A;  4DV7 E;  2DEJ A;  3LNU A;  2UXC I;  4DV2 I;  5LL6 R;  4GKJ E;  1UEK A;  2AJ4 A;  4UT4 A;  4B3T E;  2X7I A;  2E5L E;  4HAC A;  2L2N A;  4DV6 I;  4NXM I;  2BM0 A;  4FWH A;  4DV1 I;  4P52 A;  3LPS A;  1NHJ A;  2MDR A;  4X66 I;  3ADJ A;  4LFA I;  1Z5A A;  1N0V C;  1N33 I;  4JI6 E;  1RRE A;  4I3H A;  2ZM6 E;  2OI2 A;  4DV7 I;  3ZM7 A;  2RSM A;  1KVK A;  4JYA I;  1ZM3 A;  1Z59 A;  1T4N A;  4B3R I;  4K0K I;  2E5L I;  4HAC B;  2NUE A;  1I94 E;  1WHQ A;  2LUP B;  4JI0 E;  4DV4 I;  2IHR 1;  1Z0B A;  3QT7 A;  4JI8 E;  4M2Z A;  1XMO E;  1J5E E;  1WUU A;  1XNQ I;  2B7T A;  4JI6 I;  4WFT A;  5GMD A;  2R3V A;  3ZZ0 A;  2VF3 A;  4DPT A;  1A6F A;  2L2M A;  1YYW A;  4DR3 E;  2VQE E;  1ZXM A;  1PKP A;  4DPU A;  4DKK A;  4LF5 I;  5A2Q C;  2N3H A;  2B7V A;  2ZBK B;  5FLX Q;  1EA6 A;  1XMQ E;  1N32 I;  1J5E I;  1H72 C;  2Q2E B;  4FWG A;  5LMN I;  4Z7Y A;  1QU6 A;  1FWK A;  3WU4 A;  4UTG A;  4DU8 A;  4DR5 I;  1XHK A;  4JI5 E;  4MYU A;  2UXC E;  2WW4 A;  1ZXN A;  2HFS A;  5IT9 Q;  2LBS B;  1ZBT A;  3H4L A;  1K47 A;  2DIX A;  1FJG E;  3JAM C;  4JV5 E;  3LTO A;  1H73 A;  3ZZU A;  4NXM E;  2LJH A;  4EMD A;  3WU5 A;  2LJP A;  4B3S I;  1PIE A;  5GME A;  2LUQ A;  3ZKB A;  1RC7 A;  1FWL A;  3J7A M;  4YY3 I;  4JI5 I;  3ADG A;  5IWA I;  4WUD A;  4JYA E;  4JI4 E;  2E1R A;  4PU9 A;  4B3R E;  4K0K E;  2BM1 A;  2V2Z A;  1Z0E A;  3B8H A;  2V34 A;  1FJG I;  4JV5 I;  2HFU A;  4OOG C;  4NXN E;  4WUC A;  3LLH A;  4DV3 I;  4DV4 E;  4MYT A;  2LRS A;  2A2C A;  1QZR A;  1KKH A;  1XNQ E;  4YHH I;  1N0U A;  1MG7 A;  1S4E A;  3WU3 A;  5LMU E;  5BR8 I;  4OX9 E;  3J80 C;  4DR7 I;  4WYQ B;  1Z5C A;  3QT8 A;  1YYK A;  4JG4 A;  4JI4 I;  4PRX A;  3ZZT A;  3K17 A;  4LF5 E;  3ADI A;  3J7A G;  3PYE A;  4NXN I;  3GON A;  4PRV A;  1ELO A;  4DR4 E;  4FW9 A;  1KIJ A;  1N36 I;  1N32 E;  5LMN E;  1Z0C A;  4FWD A;  4LF7 E; 
#chains in the Genus database with same CATH topology
 4KZS A;  2JEB A;  2Z5B A;  2EOR A;  3UHM A;  4DR5 E;  2F4V E;  2ELZ A;  1NHI A;  5LMU I;  2LTR A;  4OX9 I;  1EI1 A;  2PNL A;  1X48 A;  3IWC A;  3VHT B;  3U1K A;  4WUB A;  4DMI A;  2RS6 A;  2RTX A;  4R2S A;  2V8P A;  1IBK E;  1U2R A;  4J8Z A;  4LF4 E;  1IQO A;  2RPC A;  3C6M A;  4DR1 E;  4B3M I;  5TSE A;  1UIL A;  1T39 A;  1SR9 A;  2EN2 A;  2PRT A;  1Y60 A;  2BA1 D;  2I13 A;  3J81 C;  3ADL A;  2J7J A;  4LF8 E;  5JEA C;  3C6K A;  4BC9 A;  3K6Q A;  1BBG A;  3P76 A;  2DEI A;  5KL4 A;  2PO2 A;  1X5W A;  1B62 A;  3ZOQ B;  2GO4 A;  2EM9 A;  4DR4 I;  4BA1 B;  4LCH A;  4LFB I;  4B3S E;  2J7K A;  1IBM I;  5A2Q Q;  1T4O A;  2UU9 E;  3M7N D;  5LLQ A;  4ISA A;  1N3G A;  3PYF A;  4DUY I;  4LF7 I;  5JEA B;  4M1K A;  1D6T A;  2JEB B;  1IBL E;  2EWL A;  2EFG A;  4MU3 A;  2B3T B;  2JVA A;  3TQM A;  4YY3 E;  1A1G A;  2CTD A;  2F4V I;  1WHN A;  1HR0 I;  3H1C A;  2NN6 D;  4FK5 C;  2E1M A;  2M9A A;  5IWA E;  2YTG A;  1RQ0 A;  1X6H A;  2LJU A;  3J7Y p;  3B4T A;  3HUL A;  1EKZ A;  1IBK I;  3IWB A;  4LF4 I;  2DMY A;  1YH8 A;  2UXD I;  4F6N A;  2ENC A;  4DV5 I;  3AUZ A;  4DR1 I;  2V85 A;  2LE2 A;  3OML A;  5DRQ A;  4OO1 E;  2GS8 A;  4GKK E;  2EPC A;  3UK3 C;  2EMW A;  3JU0 A;  2GO3 A;  5A6K A;  4HY1 A;  2EMB A;  4P78 A;  4LPF A;  4LF8 I;  2EMC A;  2EPP A;  2UUB E;  1Z0W A;  3PYG A;  4DV3 E;  2X36 A;  4M0V A;  3IWD A;  1UHZ A;  1A1L A;  2C38 A;  2VQF I;  2BV3 A;  3M99 B;  4IFD A;  1ZBQ A;  4DU7 A;  5EL9 A;  4DUZ I;  4OO1 F;  2EM5 A;  3HQ1 A;  1UN6 B;  3JAM Q;  3VYY A;  3THO B;  1X6E A;  1HNX I;  2EN6 A;  5DRO A;  1ZM9 A;  1XNR I;  2EOS A;  5CFF E;  4X65 E;  4YHH E;  1BKN A;  1FI4 A;  3GME A;  4GEQ B;  3NZK A;  2UU9 I;  2DLK A;  2V2Q A;  2HHH I;  2EOO A;  4ED4 A;  1RMD A;  1IBL I;  2WCC 3;  3QT6 A;  2L92 A;  1KYQ A;  4QNJ A;  4JI2 I;  4LF6 E;  5BR8 E;  1Z0T A;  3OTO I;  4DR7 E;  2WP8 B;  4I8O A;  2EMH A;  2NN6 E;  3ZKD A;  4X64 I;  1IMU A;  2MDG A;  4DXL A;  2D9H A;  2NPF A;  1YZ9 A;  4IFD C;  4USM A;  2C39 B;  1Y4S A;  4KWY A;  5KL3 A;  2DRP A;  4DPW A;  4LCF A;  1WRJ A;  2LV2 A;  4DR2 I;  2YPN A;  2NN6 F;  2EOJ A;  5FWK A;  4GKK I;  4FN5 A;  5K36 D;  4R1F A;  4JI7 E;  4DV0 I;  1ZR9 A;  5C0X D;  3F0N A;  1PVG A;  2EPK X;  4TUG A;  2EPX A;  4N4R B;  2UUB I;  2HGH A;  2EMZ A;  2VF1 A;  1NZ0 A;  2UXB I;  4AIM A;  2IER A;  2JY9 A;  1N36 E;  1DI2 A;  3KRN A;  2V2V A;  1JK1 A;  2DMI A;  1A1K A;  3BF2 A;  4M9V C;  2LVH A;  4HYM A;  4X65 I;  1NHH A;  1Z0V A;  2EP3 A;  2EPR A;  4DR6 E;  4F54 A;  3T1H I;  1YUJ A;  1FNM A;  4Q35 B;  3CDJ A;  1QNT A;  5T6J A;  4XTJ A;  2CT1 A;  4LF6 I;  1YYO A;  1GTK A;  5L3J A;  4MQY A;  1J26 A;  2EOE A;  3MHH C;  5F3W A;  4JI3 E;  4MU4 A;  3F6H A;  4FW6 A;  3C4T A;  1A1F A;  4B3M E;  4MDT A;  3EQ1 A;  2L3J A;  4LU9 A;  2BA1 G;  3J80 Q;  3HTX A;  4BA2 B;  3K85 A;  2YTD A;  2YRK A;  3V2U C;  1STU A;  4IS9 A;  4JI7 I;  1P47 A;  4ZVI A;  5K36 E;  2FTX B;  2J65 A;  5C0X E;  3CWV A;  2EOM A;  4AQY E;  2VES A;  2KHX A;  4R2R A;  2EPU A;  2NAB A;  4X62 I;  4FW3 A;  1H7S A;  4LFC I;  4LF9 I;  4X8W A;  2NN6 B;  4MLQ A;  4BA1 A;  1HNW E;  2L3C A;  1L4S A;  1HNZ I;  4LFB E;  1IBM E;  1VIS A;  4P7D A;  4P7A A;  2EQ0 A;  1MEY C;  5ADZ A;  3C4B A;  1MGT A;  2V8Q B;  1Y5Y A;  4U3D A;  5C0X F;  3M7N G;  2CZ9 A;  4O5G A;  2RS7 A;  4DUY E;  2R42 A;  4GKJ I;  4DR6 I;  2A25 A;  2I9I A;  3LML A;  1ZM2 A;  2XEX A;  3HKM A;  4DPY A;  4B3T I;  4FW4 A;  1ZU1 A;  2N3G A;  2JOB A;  2HK2 A;  2YTJ A;  1ZAA C;  4JI1 E;  2JPA A;  3P1X A;  2V88 A;  4F9A B;  2NA2 A;  1LLM C;  1HR0 E;  1FKA E;  2JP9 A;  1B63 A;  3DJW A;  2BR2 A;  3VK6 A;  1MU5 A;  4Z7C A;  2AE8 A;  3EPJ A;  4KQV A;  2MKD A;  4HEI A;  1MX0 A;  2IOQ A;  2EPN A;  1YHC A;  2PO0 B;  2L6M A;  2NUF A;  4JI3 I;  2R76 A;  2A2D A;  2UXD E;  5A6J A;  4DV5 E;  2JT2 A;  1DGC A;  4OO1 D;  1DAR A;  4NZV A;  4HXZ A;  1PJS A;  3BID A;  2V89 A;  4R2E A;  1T38 A;  3M6A A;  4TUI A;  2L2K B;  4RHB B;  4NHR A;  4AQY I;  2HJJ A;  2YRM A;  2UUA E;  2HKJ A;  4WX9 A;  2VQF E;  4IJD A;  5A6B A;  2NUG A;  4DUZ E;  2ZM6 I;  1HNW I;  2L33 A;  1G2D C;  3HXL A;  1Z5B A;  1HNX E;  3J81 Q;  3PRY A;  1XNR E;  3CDI A;  1T4L B;  3BGH A;  4QNK A;  4F6M A;  2HHH E;  5AE2 A;  4GZN C;  3K1J A;  3QT5 A;  1X49 A;  5K36 B;  2JXP A;  2LTS A;  2ODR C;  5FLX C;  4BMJ A;  4JI2 E;  2UUC E;  2CGE A;  1OJ4 A;  4JI1 I;  3OTO E;  3VYX A;  2WP8 A;  2YTP A;  3B78 A;  2BR2 B;  3T1Y E;  1I94 I;  4X64 E;  4BHB A;  3EPL A;  5AC5 A;  2LMZ A;  1KTV A;  1GQE A;  1ZM4 A;  2C39 A;  4OKG A;  4JI0 I;  2HK3 A;  2EZ6 A;  3H09 A;  2EN1 A;  4RPF A;  3PS3 A;  4JI8 I;  4DR2 E;  4DPX A;  3Q6N A;  1XMO I;  4KHP E;  2VE7 C;  4DV0 E;  3EPH A;  2JEA B;  3KZZ A;  1YUI A;  4R2D A;  1N34 E;  2ZIT A;  4M30 A;  2UUA I;  3Q6M A;  1H74 A;  2UXB E;  2EN8 A;  1TF3 A;  2GLI A;  5IV8 B;  5AC4 A;  5IT9 C;  2CPN A;  1Z0G A;  2O1W A;  1UDO A;  2HKE A;  4IFD E;  2F8B A;  4F9B B;  4DV2 E;  4GQU A;  1Y6Z A;  4AID A;  4L5N C;  4OO1 A;  4WXD A;  3WU6 A;  4WSP A;  3T1H E;  4DR3 I;  2VQE I;  1O0W A;  2YWQ A;  5IXM B;  4DV6 E;  1TF6 A;  2MKN A;  2UUC I;  2EL5 A;  1X47 A;  4IFD F;  3B82 A;  1A1H A;  2YT4 A;  3THN A;  3T1Y I;  2GHF A;  3KWR A;  3D4J A;  4BS9 A;  2CG9 A;  1EH8 A;  4IS1 C;  2GQ0 A;  2EM3 A;  4DV1 E;  3Q1Q A;  1IQS A;  2Z5E A;  1S16 A;  4FW7 A;  4NBQ A;  1H7U A;  4X66 E;  2EOZ A;  4USK A;  1UDN A;  2DB2 A;  3PYD A;  1XMQ I;  1X6F A;  4LFA E;  4BA2 A;  4KHP I;  4R2Q A;  1EH6 A;  3P3E A;  4URL A;  1USU A;  1N33 E;  1X3C A;  1Y4U A;  3V5R A;  1F2I G;  4X62 E;  4LF9 E;  1N34 I;  2EN4 A;  4LFC E;  2NN6 A;  2C37 A;  2EPZ A;  2JWO A;  2WBU A;  1HNZ E;  1RR9 A;  4MU0 A;  2YTN A;  4DV7 E;  2DEJ A;  3LNU A;  2KON A;  2WNR B;  2WBT A;  3JTZ A;  5A6A A;  1UDS A;  2UXC I;  4DV2 I;  5LL6 R;  5AAS A;  2EOY A;  4F9C B;  4GKJ E;  4OO1 B;  1UEK A;  2AJ4 A;  4UT4 A;  4B3T E;  2X7I A;  3PS1 A;  2E5L E;  1G2F C;  1YSA C;  4HAC A;  2L2N A;  4DV6 I;  4MU1 A;  5JEA D;  2EM8 A;  2EOI A;  2EPL X;  2YTO A;  2EM6 A;  4NXM I;  2EMK A;  2BM0 A;  4FWH A;  2MC6 A;  1WJP A;  4DV1 I;  2NN6 C;  2PO0 A;  2EL6 A;  4P52 A;  2EN7 A;  1OYP A;  3LPS A;  1NHJ A;  2MDR A;  1NCS A;  4BHC A;  2E72 A;  2RQL A;  4X66 I;  3ADJ A;  4R03 A;  4LFA I;  1Z5A A;  2V86 A;  3AV0 A;  1N0V C;  2O1T A;  1PJT A;  1N33 I;  5AE1 A;  2YTE A;  2B9D A;  2ODR D;  2YU8 A;  4JI6 E;  2YSP A;  5DRP A;  3MHS C;  1RRE A;  2VRD A;  4I3H A;  2ZM6 E;  2EMA A;  4BCA A;  2C37 B;  1B69 A;  2OI2 A;  4DV7 I;  3M85 D;  3ZM7 A;  2FGG A;  4R2C A;  2RSM A;  1KVK A;  4JYA I;  1ZM3 A;  2K7I A;  5DNX A;  1Z59 A;  1T4N A;  3GLL A;  4IZJ D;  5K36 A;  1HK7 A;  4B3R I;  4K0K I;  2E5L I;  4HAC B;  5C0X A;  1WXR A;  4ZYG A;  3EPK A;  1XXE A;  3HJC A;  3PS2 A;  5JEA E;  2NUE A;  5JEA A;  4WPY A;  1I94 E;  4X9J A;  3L00 A;  2G7H A;  1WHQ A;  1NEI A;  2LUP B;  4JI0 E;  2JYA A;  4DV4 I;  1AH5 A;  2IHR 1;  4O24 A;  2DSY A;  4MLV A;  1Z0B A;  3QT7 A;  5JEA F;  4JI8 E;  4F2J C;  1XMO E;  4M2Z A;  1J5E E;  5AE3 A;  4Q28 A;  5KL6 A;  3DD6 A;  2JEA A;  2YTQ A;  1WUU A;  1XNQ I;  4R2P A;  2O1U A;  5K36 C;  2B7T A;  4R8O A;  2EM4 A;  2R1F A;  4AM3 A;  4JI6 I;  4WFT A;  5GMD A;  1YPN A;  5C0X C;  2R3V A;  1VI7 A;  3ZZ0 A;  3HPS A;  2VF3 A;  2GPI A;  2LCE A;  2BB8 A;  5DNY A;  2EML A;  2EM7 A;  3L7Z A;  1PDA A;  4DPT A;  2YRH A;  4IFD D;  1A6F A;  2BA0 G;  2L2M A;  2YZT A;  2MC5 A;  4RH8 A;  1YYW A;  2F1D A;  5KL7 A;  3DF6 A;  4DR3 E;  1DQ3 A;  2VQE E;  5C0X B;  1ZXM A;  1Z1B A;  1PKP A;  4DPU A;  4DKK A;  4LF5 I;  2H36 X;  2EMX A;  1R6M A;  2HC5 A;  5KL5 A;  4O43 A;  1GZ6 A;  5A2Q C;  3P3G A;  2N3H A;  2K4V A;  2B7V A;  2ENA A;  2IES A;  4R2A A;  1EH7 A;  4L8N A;  4LTY A;  1P42 A;  2ZBK B;  5FLX Q;  1EA6 A;  4LCG A;  1XMQ E;  1N32 I;  1J5E I;  1H72 C;  2Q2E B;  4FWG A;  4IZJ A;  5LMN I;  2EMF A;  4Z7Y A;  4O4K A;  1QU6 A;  1FWK A;  2CVE A;  3WU4 A;  4UTG A;  4DU8 A;  2Z5B B;  4DR5 I;  2ADR A;  2YTF A;  1XHK A;  4WSG A;  2DLQ A;  2EOX A;  3L7Z B;  2WNR A;  4JI5 E;  4MYU A;  2UXC E;  3KZY A;  2BA0 D;  1E3H A;  2WW4 A;  1ZXN A;  2HFS A;  3QG5 C;  1YFH A;  2Z5C A;  5IT9 Q;  2LBS B;  1ZBT A;  2PNZ A;  3H4L A;  1K47 A;  2DIX A;  2JOX A;  3JAM C;  1FJG E;  4JV5 E;  1H73 A;  1R6L A;  3LTO A;  4IZK A;  1SFE A;  4NXM E;  2EPO A;  3ZZU A;  3P06 A;  4ZYD A;  2M7Q A;  5EKW A;  2LJH A;  2M1S A;  4LOM A;  4EMD A;  2PO2 B;  2O3Z A;  3WU5 A;  2BBG A;  4HTG A;  4N3O A;  2LJP A;  1UDQ A;  4B3S I;  2L8T A;  1E3P A;  2EQ3 A;  1PIE A;  2LUQ A;  4IZJ B;  5GME A;  2PO1 A;  4OO1 C;  2ELY A;  2M4I A;  3ZKB A;  1A1J A;  1RC7 A;  4ZYH A;  1FWL A;  2EMG A;  3M85 G;  3J7A M;  4YY3 I;  4U3B A;  1BB8 A;  2LT7 A;  1BBO A;  3ECR A;  4JI5 I;  1USV A;  3ADG A;  1OYS A;  5IWA I;  2EJ4 A;  4WUD A;  4JYA E;  4JI4 E;  3BBG A;  2E1R A;  4PU9 A;  4B3R E;  4K0K E;  2Z5C B;  2BM1 A;  2CSH A;  2EN3 A;  4BC7 A;  2O1V A;  1Z0E A;  2V2Z A;  3B8H A;  5DNL A;  2PNZ B;  2IOP A;  2V34 A;  1FJG I;  4JV5 I;  2HFU A;  4IZK B;  2Q8U A;  4OOG C;  4NXN E;  4WUC A;  3LLH A;  2EOF A;  4DV3 I;  2PNM A;  4ZYE A;  4DV4 E;  4MYT A;  2LRS A;  2C38 B;  4IFD B;  3P3C A;  2A2C A;  2KOU A;  2JE6 A;  1QZR A;  2V83 A;  1KKH A;  2EOQ A;  1XNQ E;  4YHH I;  2PO1 B;  2YSO A;  1N0U A;  1MG7 A;  1S4E A;  2EOH A;  2EPM X;  3WU3 A;  5LMU E;  5BR8 I;  4WXC A;  5KL2 A;  3J80 C;  3RMP A;  4OX9 E;  4DR7 I;  4WYQ B;  1Z5C A;  1TN9 A;  2RSI A;  5A6B D;  1A1I A;  2EE8 A;  1YYK A;  3QT8 A;  5DRR A;  1JK2 A;  3U1Y A;  2JR1 A;  2EM0 A;  2EL4 A;  2EQ1 A;  4JG4 A;  5ELW A;  4JI4 I;  1AAY A;  1UBD C;  4BBY A;  1KJK A;  5A69 A;  3FIG A;  4PRX A;  3ZZT A;  3K17 A;  4J3D A;  1PJQ A;  2LO3 A;  2WZO A;  2FV4 B;  3GCM A;  4LF5 E;  2EMY A;  4FW5 A;  3ADI A;  1OYR A;  3J7A G;  3PYE A;  2N8X A;  1RHY A;  2YTI A;  4OZE A;  4NXN I;  3F6G A;  3GON A;  4PRV A;  1ELO A;  2EPA A;  4DR4 E;  2WBS A;  4FW9 A;  1KIJ A;  3HPZ A;  1N36 I;  1N32 E;  2ENH A;  5K36 F;  2EMI A;  3MSW A;  2JE6 B;  5LMN E;  2V87 A;  2DGC A;  1Z0C A;  4FWD A;  2YU5 A;  2EM2 A;  4LF7 E; 
#chains in the Genus database with same CATH homology
 4KZS A;  2Z5B A;  4DR5 E;  2F4V E;  1NHI A;  5LMU I;  2LTR A;  4OX9 I;  1EI1 A;  2PNL A;  1X48 A;  3IWC A;  4WUB A;  4DMI A;  2RS6 A;  2RTX A;  2V8P A;  1IBK E;  1U2R A;  4J8Z A;  4LF4 E;  4B3M I;  4DR1 E;  1UIL A;  1SR9 A;  3J81 C;  3ADL A;  4LF8 E;  4BC9 A;  3K6Q A;  2DEI A;  1B62 A;  3ZOQ B;  4DR4 I;  4LFB I;  4B3S E;  2J7K A;  1IBM I;  5A2Q Q;  1T4O A;  2UU9 E;  3PYF A;  4DUY I;  4LF7 I;  4M1K A;  1D6T A;  1IBL E;  2EWL A;  2EFG A;  2B3T B;  2JVA A;  4YY3 E;  2F4V I;  1WHN A;  1HR0 I;  2E1M A;  5IWA E;  1RQ0 A;  3J7Y p;  3HUL A;  1EKZ A;  1IBK I;  3IWB A;  4LF4 I;  2DMY A;  2UXD I;  4DV5 I;  3AUZ A;  4DR1 I;  2V85 A;  2LE2 A;  3OML A;  2GS8 A;  4GKK E;  4HY1 A;  3JU0 A;  4LF8 I;  4P78 A;  2UUB E;  1Z0W A;  3PYG A;  4DV3 E;  2X36 A;  4M0V A;  3IWD A;  1UHZ A;  2VQF I;  2BV3 A;  1ZBQ A;  4DU7 A;  4DUZ I;  3HQ1 A;  3JAM Q;  3VYY A;  1HNX I;  1ZM9 A;  1XNR I;  5CFF E;  4X65 E;  4YHH E;  1BKN A;  1FI4 A;  2UU9 I;  4GEQ B;  2V2Q A;  2HHH I;  4ED4 A;  1IBL I;  3QT6 A;  2L92 A;  4JI2 I;  4LF6 E;  5BR8 E;  1Z0T A;  3OTO I;  4DR7 E;  4I8O A;  3ZKD A;  4X64 I;  4DXL A;  2NPF A;  1YZ9 A;  4USM A;  1Y4S A;  4DPW A;  4DR2 I;  5FWK A;  4GKK I;  4FN5 A;  4R1F A;  4JI7 E;  4DV0 I;  3F0N A;  1PVG A;  4TUG A;  2UUB I;  2VF1 A;  1NZ0 A;  2UXB I;  2JY9 A;  1N36 E;  1DI2 A;  2V2V A;  4HYM A;  4X65 I;  1NHH A;  1Z0V A;  4DR6 E;  4F54 A;  3T1H I;  1FNM A;  5T6J A;  4XTJ A;  4LF6 I;  1YYO A;  5L3J A;  1J26 A;  5F3W A;  4JI3 E;  3F6H A;  3C4T A;  4B3M E;  2L3J A;  4LU9 A;  3J80 Q;  3HTX A;  3K85 A;  3V2U C;  1STU A;  4JI7 I;  4ZVI A;  2FTX B;  3CWV A;  4AQY E;  2KHX A;  4X62 I;  4LF9 I;  1H7S A;  4LFC I;  4X8W A;  1HNW E;  2L3C A;  1HNZ I;  4LFB E;  1IBM E;  1VIS A;  4P7D A;  4P7A A;  5ADZ A;  3C4B A;  2V8Q B;  2CZ9 A;  4DUY E;  2RS7 A;  4GKJ I;  2R42 A;  4DR6 I;  4DPY A;  3LML A;  1ZM2 A;  2XEX A;  4B3T I;  2N3G A;  2JOB A;  2HK2 A;  4JI1 E;  3P1X A;  2V88 A;  4F9A B;  2NA2 A;  1HR0 E;  1B63 A;  1FKA E;  4Z7C A;  3DJW A;  3VK6 A;  1MU5 A;  4KQV A;  1MX0 A;  2IOQ A;  2L6M A;  2NUF A;  4JI3 I;  2A2D A;  2UXD E;  4DV5 E;  1DAR A;  4HXZ A;  2V89 A;  3M6A A;  4TUI A;  2L2K B;  4AQY I;  2UUA E;  2HKJ A;  2VQF E;  2NUG A;  4DUZ E;  2ZM6 I;  1HNW I;  2L33 A;  3HXL A;  1Z5B A;  1HNX E;  3J81 Q;  3PRY A;  1XNR E;  1T4L B;  2HHH E;  5AE2 A;  3K1J A;  3QT5 A;  1X49 A;  2LTS A;  2ODR C;  5FLX C;  4BMJ A;  4JI2 E;  2UUC E;  2CGE A;  1OJ4 A;  4JI1 I;  3OTO E;  3VYX A;  3B78 A;  3T1Y E;  1I94 I;  4X64 E;  1KTV A;  2LMZ A;  1GQE A;  1ZM4 A;  4JI0 I;  2HK3 A;  2EZ6 A;  3H09 A;  4RPF A;  4JI8 I;  4DR2 E;  4DPX A;  3Q6N A;  1XMO I;  4KHP E;  2VE7 C;  4DV0 E;  1N34 E;  2ZIT A;  4M30 A;  2UUA I;  3Q6M A;  1H74 A;  2UXB E;  5IT9 C;  2CPN A;  1Z0G A;  2O1W A;  2HKE A;  2F8B A;  4F9B B;  4DV2 E;  1Y6Z A;  4L5N C;  3WU6 A;  4WSP A;  3T1H E;  4DR3 I;  2VQE I;  1O0W A;  4DV6 E;  2UUC I;  1X47 A;  3B82 A;  2YT4 A;  3T1Y I;  3KWR A;  3D4J A;  4BS9 A;  2CG9 A;  2GQ0 A;  3Q1Q A;  4DV1 E;  2Z5E A;  1S16 A;  1H7U A;  4X66 E;  4USK A;  2DB2 A;  3PYD A;  1XMQ I;  4LFA E;  4KHP I;  4URL A;  1USU A;  1N33 E;  1Y4U A;  3V5R A;  4X62 E;  4LF9 E;  1N34 I;  4LFC E;  2JWO A;  1HNZ E;  1RR9 A;  4DV7 E;  2DEJ A;  3LNU A;  2KON A;  3JTZ A;  2UXC I;  4DV2 I;  5LL6 R;  5AAS A;  4F9C B;  4GKJ E;  1UEK A;  2AJ4 A;  4UT4 A;  4B3T E;  2X7I A;  2E5L E;  4HAC A;  2L2N A;  4DV6 I;  4NXM I;  2BM0 A;  4FWH A;  2MC6 A;  4DV1 I;  4P52 A;  3LPS A;  1NHJ A;  2MDR A;  4X66 I;  3ADJ A;  4R03 A;  4LFA I;  1Z5A A;  2V86 A;  3AV0 A;  1N0V C;  2O1T A;  1N33 I;  5AE1 A;  2B9D A;  2ODR D;  4JI6 E;  1RRE A;  4I3H A;  2ZM6 E;  4BCA A;  2OI2 A;  4DV7 I;  3ZM7 A;  2FGG A;  2RSM A;  1KVK A;  4JYA I;  1ZM3 A;  1Z59 A;  1T4N A;  4IZJ D;  1HK7 A;  4B3R I;  4K0K I;  2E5L I;  4HAC B;  1WXR A;  3HJC A;  2NUE A;  4WPY A;  1I94 E;  2G7H A;  1WHQ A;  2LUP B;  4JI0 E;  4DV4 I;  2IHR 1;  2DSY A;  1Z0B A;  3QT7 A;  4JI8 E;  4M2Z A;  1XMO E;  1J5E E;  5AE3 A;  4Q28 A;  1WUU A;  1XNQ I;  2O1U A;  2B7T A;  4R8O A;  4JI6 I;  4WFT A;  5GMD A;  2R3V A;  3ZZ0 A;  3HPS A;  2VF3 A;  5DNY A;  4DPT A;  1A6F A;  2L2M A;  2YZT A;  2MC5 A;  1YYW A;  3DF6 A;  4DR3 E;  1DQ3 A;  2VQE E;  1ZXM A;  1PKP A;  4DPU A;  4DKK A;  4LF5 I;  2H36 X;  5A2Q C;  1GZ6 A;  2N3H A;  2K4V A;  2B7V A;  4L8N A;  4LTY A;  2ZBK B;  5FLX Q;  1EA6 A;  1XMQ E;  1N32 I;  1J5E I;  1H72 C;  2Q2E B;  4FWG A;  4IZJ A;  5LMN I;  4Z7Y A;  1QU6 A;  1FWK A;  3WU4 A;  4UTG A;  4DU8 A;  2Z5B B;  4DR5 I;  1XHK A;  4JI5 E;  4MYU A;  2UXC E;  2WW4 A;  1ZXN A;  2HFS A;  2Z5C A;  5IT9 Q;  2LBS B;  1ZBT A;  3H4L A;  1K47 A;  2DIX A;  2JOX A;  3JAM C;  1FJG E;  4JV5 E;  1H73 A;  3LTO A;  4IZK A;  3ZZU A;  4NXM E;  3P06 A;  2M7Q A;  2LJH A;  2M1S A;  4EMD A;  3WU5 A;  4N3O A;  2LJP A;  4B3S I;  2L8T A;  4IZJ B;  1PIE A;  5GME A;  2LUQ A;  2M4I A;  3ZKB A;  1RC7 A;  1FWL A;  3J7A M;  4YY3 I;  4JI5 I;  1USV A;  3ADG A;  5IWA I;  4WUD A;  4JYA E;  4JI4 E;  2E1R A;  4PU9 A;  4B3R E;  4K0K E;  2Z5C B;  2BM1 A;  4BC7 A;  2O1V A;  1Z0E A;  2V2Z A;  3B8H A;  2IOP A;  2V34 A;  1FJG I;  4JV5 I;  2HFU A;  4IZK B;  4OOG C;  4NXN E;  4WUC A;  3LLH A;  4DV3 I;  2PNM A;  4DV4 E;  4MYT A;  2LRS A;  2A2C A;  2KOU A;  1QZR A;  2V83 A;  1KKH A;  1XNQ E;  4YHH I;  1N0U A;  1MG7 A;  1S4E A;  3WU3 A;  5LMU E;  5BR8 I;  3RMP A;  3J80 C;  4OX9 E;  4DR7 I;  4WYQ B;  1Z5C A;  3QT8 A;  1YYK A;  2JR1 A;  4JG4 A;  4JI4 I;  4BBY A;  3FIG A;  4PRX A;  3ZZT A;  3K17 A;  2WZO A;  2FV4 B;  4LF5 E;  3ADI A;  3J7A G;  3PYE A;  4NXN I;  3F6G A;  3GON A;  4PRV A;  1ELO A;  4DR4 E;  4FW9 A;  1KIJ A;  3HPZ A;  1N36 I;  1N32 E;  3MSW A;  5LMN E;  2V87 A;  1Z0C A;  4FWD A;  4LF7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...