4X66E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x66E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66E02
4OX9I 3WU6A 1H74A 4JI7I 1YYKA 1OJ4A 2OI2A 2EZ6A 4DV5E 3OTOI 1Z0EA 2N3GA 1Z5BA 4LF9I 1WHNA 2VQEI 4DPYA 3C4BA 2UUCI 1RQ0A 1N33E 2ZM6E 4JI3E 5L3JA 2DMYA 1ZM2A 4B3SE 1GQEA 2NUGA 3M6AA 1BKNA 4KHPI 4X66E 4X64I 4NXNI 1N34E 1B63A 4DR1I 3Q1QA 1IBLI 1X47A 4JI2I 2GS8A 1ZM3A 3C4TA 2L2NA 2JY9A 4AQYI 1YYOA 1YYWA 4X8WA 2UXCE 4DV0I 4NXME 1XNRE 1MU5A 3PYEA 4JG4A 4LF8E 1RREA 4DR2I 2NPFA 1XHKA 3ADIA 4LFBI 2DB2A 3PYGA 4B3ME 4LF6E 4DR7E 4GKKE 2F4VE 1H73A 1ZM9A 1Z0WA 3HULA 1B62A 3J80C 1NHJA 2V2QA 3H4LA 1N0UA 1QZRA 1NHHA 2LRSA 4DPTA 4LF4E 4UT4A 2UXDE 1IBKE 1Z0CA 2HHHE 4USMA 4JI4E 1FWLA 3VYYA 4HACB 4FWDA 1Z5AA 5CFFE 1KTVA 4DR6E 2RTXA 1XMOI 2HFSA 2HKEA 2LTRA 4URLA 3B8HA 3P1XA 1N36E 2B3TB 2A2CA 2MDRA 2IHR1 4LFBE 4JI0E 2WW4A 2L2MA 4LFCI 2L3JA 3T1HE 1XNQE 1RC7A 4DV4E 1FKAE 2HHHI 4MYUA 3LNUA 2UXBI 3CWVA 2X36A 4HY1A 2JVAA 3J80Q 4DV0E 4YY3I 2UUAI 4X62E 4DR5I 2HFUA 2HKJA 4LF7E 4K0KE 4PU9A 2LJPA 3ZKDA 2Q2EB 1QU6A 4YHHE 3QT5A 4JI0I 4LF5E 1XMQI 3HTXA 4X64E 4GKJI 4DV6E 1MX0A 4YY3E 1NZ0A 4M2ZA 2LJHA 4Z7YA 4DV3I 2L33A 1X48A 4DR5E 4X62I 1X49A 1FNMA 4DV4I 4Z7CA 4WUCA 4DPXA 4DV3E 2UXDI 4DV5I 2V8PA 4JI7E 2RS7A 1XMQE 4LF5I 3B82A 4DKKA 4JI5I 5LMNI 1T4NA 2F4VI 2E5LE 4PRXA 4LFCE 4UTGA 1STUA 3D4JA 2UUAE 2AJ4A 1HNZE 1XMOE 1O0WA 4DR6I 4LF4I 2CPNA 3WU5A 5FLXC 1WUUA 4DV1E 2UXBE 4P52A 3JAMQ 1H72C 2LTSA 2ZBKB 1EI1A 1ZM4A 4DV1I 4ED4A 3PYFA 3T1HI 1KVKA 1T4LB 1HNZI 4HACA 2HK3A 4DV6I 4DPUA 1ZBTA 4DR3I 3ADLA 4DU7A 1WHQA 5LMNE 3JAMC 1HNWE 4JV5I 4LF6I 4DR7I 2ZITA 4GKKI 3B78A 2HK2A 2N3HA 4NXNE 4KHPE 4DR2E 2KHXA 4B3SI 3V5RA 2BV3A 2R3VA 1N33I 1FJGI 3QT8A 3K1JA 3WU3A 2CZ9A 4NXMI 1EKZA 4B3RE 4DR1E 2XEXA 2UXCI 4GKJE 1H7SA 3LLHA 2LUPB 4PRVA 4YHHI 1VISA 3QT7A 1NHIA 3LTOA 4DR4I 4LFAI 4LF7I 4K0KI 1J26A 2UU9I 4JI4I 4JI6I 3ZZTA 3LPSA 1PVGA 5GMEA 3J81Q 1DI2A 4DUZE 2R42A 1UEKA 2ZM6I 1Z0BA 4DPWA 4RPFA 3V2UC 5IT9Q 1HR0E 2VQEE 4AQYE 1Z0GA 4DV2I 3ADGA 2VQFI 3OTOE 4HYMA 3J7AG 4JI2E 1XNQI 3GONA 4DXLA 3K17A 2YT4A 2VF3A 2B7TA 3F0NA 4X65I 1IBLE 4B3MI 2L2KB 4B3TI 4JYAE 1S4EA 1ZXMA 1N36I 3VYXA 1S16A 3J7Yp 3ZZUA 4I3HA 2J7KA 3ZKBA 3QT6A 1UILA 4JI3I 1FWKA 4WFTA 4EMDA 1PKPA 1K47A 3ADJA 2RSMA 1N32E 1IBKI 4WUDA 5A2QC 1J5EE 2V34A 5IWAE 1HNXE 5BR8E 2BM0A 4WYQB 1UHZA 1ELOA 1FI4A 1Z5CA 4DUZI 1KKHA 1EA6A 4M1KA 2NA2A 4DV7E 2UUBE 1N34I 3T1YE 4JI8I 1I94I 1Z0TA 2DEIA 2E1RA 3ZM7A 1U2RA 2NUFA 5A2QQ 4LF8I 1I94E 2V2ZA 4JYAI 4LF9E 4FW9A 4JI1E 4HXZA 3PYDA 1XNRI 4X65E 4B3RI 4ZVIA 2LBSB 4M30A 5IT9C 1ZXNA 4DV2E 1N0VC 1HR0I 4DUYE 1PIEA 1D6TA 1FJGE 1H7UA 4XTJA 4MYTA 3ZZ0A 4FWGA 1IBME 4KQVA 4JI1I 2LUQA 4JI6E 2UU9E 4FWHA 4DV7I 4X66I 2B7VA 4JV5E 1KIJA 2A2DA 4P7AA 1HNWI 4DR4E 2X7IA 1Z59A 2BM1A 2UUCE 5FLXQ 4DUYI 3J81C 2L3CA 1T4OA 4DR3E 2DIXA 1N32I 4OOGC 5BR8I 4OX9E 5IWAI 2NUEA 2EFGA 1DARA 4WUBA 5LMUE 4JI8E 1A6FA 3T1YI 4FN5A 1MG7A 4B3TE 4DU8A 2UUBI 2V2VA 5LMUI 4LFAE 3WU4A 2E5LI 4R1FA 5GMDA 1IBMI 4JI5E 4USKA 2VQFE 2RS6A 1YZ9A 1Z0VA 1RR9A 3J7AM 2DEJA 1HNXI 5LL6R 1J5EI
chains in the Genus database with same CATH superfamily
4OX9I 4IZJB 3C6KA 2EOJA 1H74A 5ELWA 3WU6A 4JI7I 1YYKA 1OJ4A 2OI2A 4GEQB 2EZ6A 2EN1A 4DV5E 2M4IA 3OTOI 2EPPA 3JTZA 1OYPA 1Z0EA 2HJJA 1DQ3A 2N3GA 2YU5A 1Z5BA 4LF9I 3F6HA 3HKMA 1WHNA 2VQEI 4DPYA 5JEAF 4OO1A 2EPRA 3C4BA 2UUCI 1RQ0A 1X6EA 2ZM6E 1A1IA 5KL2A 4NHRA 4JI3E 4WXCA 2DMYA 2EQ3A 5L3JA 1ZM2A 4MLQA 4B3SE 1GQEA 2NUGA 4HEIA 3M6AA 3C6MA 1TN9A 1BKNA 3AUZA 4X66E 4KHPI 3IWCA 4NXNI 4F6NA 1JK1A 4X64I 1N34E 1B63A 2EP3A 5AE2A 1N33E 3UK3C 4DR1I 3Q1QA 1IBLI 3L7ZA 2C39A 2VRDA 1ZAAC 2EMYA 1X47A 2JPAA 1XXEA 2GS8A 2EOXA 4JI2I 1ZM3A 3C4TA 2L2NA 2EJ4A 1JK2A 2JY9A 4AQYI 1YYOA 1YYWA 1GTKA 4X8WA 2Z5BA 2GQ0A 2UXCE 2EPMX 4DV0I 4BA1B 4NXME 1DGCA 2EN4A 5C0XF 2G7HA 3PS2A 1XNRE 2FGGA 2EPZA 1E3HA 1MU5A 3PYEA 2JEBA 5C0XA 4JG4A 3GLLA 3KRNA 4LF8E 4P78A 3HPZA 5JEAB 4J3DA 1RREA 1AAYA 4IZJA 3EPKA 2PNMA 3HQ1A 4DR2I 1KYQA 2NPFA 1XHKA 3ADIA 2M9AA 5KL3A 2ENCA 4LFBI 2DB2A 2YRMA 4N4RB 2I13A 3PYGA 4B3ME 4P7DA 4NZVA 4LF6E 4DR7E 4GKKE 2F4VE 2NN6D 1H73A 1A1GA 1VI7A 1Z0WA 1ZM9A 5DNXA 2DGCA 3HULA 1R6MA 4R2CA 1B62A 1EH8A 4R03A 3J80C 1LLMC 1NHJA 2V2QA 3H4LA 1X3CA 2JOXA 2DRPA 1N0UA 1QZRA 1NHHA 2YTQA 2LRSA 4BBYA 4DPTA 1OYRA 4LF4E 4UT4A 5F3WA 2UXDE 1IBKE 4LCGA 1WXRA 1Z0CA 5IV8B 4KWYA 2BA1D 2HHHE 2EMHA 4WXDA 4JI4E 3ZOQB 4USMA 2PO1A 1FWLA 3VYYA 4HACB 4FWDA 5K36B 1Z5AA 5CFFE 1KTVA 3U1YA 4DR6E 2RTXA 2Z5BB 1XMOI 2NABA 2HFSA 2HKEA 3THOB 2LTRA 2EM6A 3B8HA 4URLA 3P1XA 4ISAA 1N36E 2YWQA 2B3TB 2A2CA 2MDRA 2IHR1 3HPSA 4LFBE 2BBGA 2LO3A 4JI0E 1RMDA 2O1WA 1ZU1A 2C37A 2L2MA 3BGHA 2WW4A 4BS9A 1RHYA 4LFCI 2RPCA 2L3JA 3AV0A 3EPLA 2ENAA 2RQLA 3T1HE 4M0VA 1XNQE 1RC7A 2BB8A 2LV2A 4BHBA 3DJWA 2GO4A 4LTYA 3KZYA 4N3OA 4DV4E 2JEAB 2EOQA 4LCHA 3GCMA 1FKAE 2JE6B 2HHHI 4MYUA 3LNUA 2YRHA 5A69A 4QNKA 2UXBI 2O1UA 3CWVA 2X36A 5ADZA 4HY1A 3K6QA 2AE8A 2JVAA 4OO1B 2O3ZA 1KJKA 3J80Q 5EKWA 4DV0E 4BC9A 4YY3I 3H1CA 2UUAI 4X62E 4DR5I 2YSOA 3M85D 1G2FC 2HFUA 4OKGA 2HKJA 2EM0A 5AC4A 4IJDA 4LF7E 4K0KE 2CVEA 4PU9A 2LJPA 3ZZ0A 4O43A 4MDTA 2EOEA 5A6JA 2EMBA 4NBQA 3ZKDA 3EQ1A 2PNZB 2Q2EB 3KWRA 1QU6A 2YTJA 5K36D 2EM4A 2R76A 4YHHE 3QT5A 2MKNA 4JI0I 4L8NA 4LF5E 1XMQI 3HTXA 4X64E 2LVHA 4GKJI 2EPCA 4DV6E 1MX0A 4YY3E 1NZ0A 1USVA 2IOPA 4O5GA 3DF6A 4M2ZA 4J8ZA 2LJHA 2C38B 4Z7YA 3BF2A 4DV3I 2CTDA 5C0XE 4MU3A 2EMIA 2WZOA 4RH8A 2L33A 4FW4A 1X48A 1T38A 2EL5A 2DLKA 3HXLA 4DR5E 1YH8A 1X49A 1FNMA 4X62I 4Z7CA 2KONA 4WUCA 2O1VA 4DV4I 4DPXA 4DV3E 2ELYA 4GZNC 3P3EA 2UXDI 2EMFA 4Q35B 4DV5I 2ODRD 1UBDC 1PJSA 2EMGA 2CGEA 5FWKA 4OO1C 2JXPA 5JEAA 2V85A 2V8PA 2R1FA 4JI7E 2V89A 4IFDA 2RS7A 2K4VA 1XMQE 2EMCA 1UDQA 4R2SA 2PO2B 4LF5I 1NCSA 3B82A 3EPJA 2BR2A 2EM2A 4DKKA 1MEYC 2EPUA 4LU9A 1X6FA 4JI5I 5LMNI 1T4NA 2F4VI 2E5LE 3P3CA 3K85A 2NN6E 4PRXA 1N3GA 4LFCE 4I8OA 4UTGA 1STUA 3D4JA 3PS1A 4ZYDA 2UUAE 2AJ4A 4OO1D 1HNZE 1E3PA 4IFDB 1XMOE 3Q6MA 1O0WA 4FW7A 4DR6I 2RSIA 4LF4I 5JEAE 4OO1E 2CPNA 5FLXC 3WU5A 1WUUA 1IQSA 2YU8A 4DV1E 2H36X 2V83A 4F9BB 2UXBE 3M7ND 1BB8A 2JOBA 4IFDD 2EM7A 2LE2A 5AE1A 4P52A 2ELZA 1USUA 3JAMQ 1H72C 2LTSA 2ZBKB 1EI1A 3DD6A 1ZM4A 2EPXA 2I9IA 3H09A 4DV1I 2Z5CA 4ED4A 3PYFA 3T1HI 1KVKA 1T4LB 3RMPA 2EMWA 1A1JA 2NN6C 5KL6A 4LPFA 1HNZI 2YPNA 2HK3A 4HACA 5K36A 2EM9A 4DV6I 4DPUA 1ZBTA 4DR3I 3ADLA 4HTGA 4DU7A 1WHQA 2EMAA 2EOMA 2L6MA 4MLVA 1WJPA 2L92A 4TUGA 4IZKB 1AH5A 5K36E 5TSEA 3JAMC 2EOZA 5LMNE 1HNWE 5JEAC 2C37B 4JV5I 2V8QB 4LF6I 4L5NC 2ZITA 4DR7I 4GKKI 1BBOA 3B4TA 2Z5CB 3B78A 1YFHA 5KL7A 2HK2A 2O1TA 4IFDE 4BC7A 2N3HA 2MDGA 4NXNE 4ZYGA 2WNRB 4BCAA 4KZSA 4KHPE 4DR2E 1TF3A 2JEAA 2KHXA 4B3SI 2E1MA 3CDJA 5LLQA 3V5RA 2BV3A 2R3VA 1N33I 4MU1A 1FJGI 4BMJA 1YHCA 3QT8A 2PO0B 2EMKA 2PRTA 4F9AB 2EOFA 4FW6A 3K1JA 3WU3A 2YTNA 2K7IA 1IQOA 5K36C 1YSAC 2CZ9A 3HJCA 1NEIA 4NXMI 1EKZA 4FWGA 4B3RE 4WSGA 4DR1E 2XEXA 2UXCI 4GKJE 1H7SA 3LLHA 2YRKA 2LUPB 4PRVA 4F6MA 2EWLA 4IFDC 2GO3A 4QNJA 2YTEA 4R2RA 3JU0A 3F6GA 2F8BA 1Y6ZA 4IZJD 4YHHI 1UDSA 3VK6A 2HC5A 1VISA 5DRRA 4X9JA 2EN7A 2EPLX 5KL4A 1Z1BA 3QT7A 1NHIA 3LTOA 2YTGA 4DR4I 3GMEA 4LFAI 2M1SA 2N8XA 4LF7I 4K0KI 2GLIA 2ADRA 1J26A 2WP8A 3Q6NA 2EL4A 2UU9I 4JI4I 4F2JC 1SR9A 4JI6I 2VF1A 3MHSC 3LPSA 3LMLA 3ZZTA 5DNYA 1PVGA 2EOSA 3PRYA 5GMEA 3J81Q 1DI2A 4DUZE 2R42A 1IMUA 2EN8A 1UEKA 3P76A 2ZM6I 1Z0BA 4DPWA 5AC5A 2EPOA 4IZKA 4RPFA 1EH7A 2YTPA 4OO1F 3V2UC 5IT9Q 1HR0E 2VQEE 4AQYE 2CT1A 1F2IG 1Z0GA 2NN6A 5DROA 4WPYA 4DV2I 3IWDA 3ADGA 4R2PA 1T39A 4FW5A 2CG9A 2VQFI 4DUZI 2ODRC 3OTOE 4HYMA 4R2AA 4JI2E 3J7AG 1XNQI 3GONA 4DXLA 3K17A 5DRPA 2A25A 2YT4A 2VF3A 2B7TA 3KZZA 3F0NA 4X65I 1IBLE 5AASA 4B3MI 2L2KB 4B3TI 2J7JA 4JYAE 1PDAA 1YPNA 1S4EA 1ZXMA 1N36I 3VYXA 1S16A 3J7Yp 3ZZUA 5A6BD 1TF6A 2NN6B 4I3HA 2WBTA 3OMLA 2J7KA 1X6HA 2EQ0A 1UILA 3QT6A 3ZKBA 4JI3I 2JWOA 3BBGA 1FWKA 4WFTA 2EMZA 2JR1A 2EOHA 2Q8UA 4EMDA 1PKPA 1K47A 4WX9A 3ADJA 2RSMA 4R2QA 1A1FA 1N32E 1IBKI 5A6KA 1A1LA 4FK5C 1QNTA 2BA1G 4WUDA 2YZTA 2JE6A 3BIDA 2LCEA 4U3DA 2YTIA 5A2QC 2YSPA 1Y60A 2C39B 2JP9A 3L00A 4IS9A 1J5EE 2VE7C 5IWAE 2FTXB 1HNXE 2V34A 1YUIA 5BR8E 2BM0A 2D9HA 4WYQB 2IOQA 4OZEA 4MU0A 5C0XB 1UHZA 4TUIA 2EN2A 3MHHC 1ELOA 1FI4A 1Z5CA 2EPKX 2KOUA 3EPHA 1EA6A 1KKHA 2PO2A 2GPIA 2L8TA 2V88A 2V87A 4DMIA 2IERA 4M1KA 2NA2A 4DV7E 4WSPA 2UUBE 2EOIA 1N34I 4Q28A 1UDNA 5EL9A 2FV4B 2EN6A 4F9CB 2B9DA 3T1YE 4JI8I 5A6AA 1I94I 2EE8A 1Z0TA 2WP8B 2LT7A 2DEIA 4IFDF 2E1RA 4BA2B 3ZM7A 1ZBQA 1U2RA 2NUFA 5A2QQ 2BA0D 1X5WA 2JT2A 4LF8I 1MGTA 1I94E 3P06A 4LCFA 1P47A 2V2ZA 1PJTA 2C38A 4JYAI 4LF9E 4AM3A 4FW9A 4JI1E 2LJUA 3PYDA 4HXZA 1XNRI 4X65E 4B3RI 4IS1C 5DRQA 3MSWA 2PO0A 1Y4UA 4ZVIA 2EMLA 3IWBA 2WBUA 4F54A 4M30A 2EOYA 2LBSB 5IT9C 1A1HA 2DLQA 1ZXNA 3M7NG 4DV2E 1N0VC 1HR0I 2M7QA 2F1DA 1WRJA 1SFEA 4DUYE 1PIEA 3VHTB 4M9VC 1D6TA 1FJGE 1H7UA 3NZKA 4XTJA 4MYTA 2ENHA 2DSYA 2EPAA 3FIGA 5AE3A 1GZ6A 2EM5A 1IBME 2HGHA 3CDIA 2DMIA 1Y5YA 1BBGA 5KL5A 1P42A 2EM8A 4O4KA 2BA0G 2YTOA 1PJQA 3PS3A 4KQVA 2JYAA 4JI1I 1Y4SA 2LUQA 4JI6E 4AIMA 2UU9E 2J65A 2PNZA 5DNLA 4FWHA 4DV7I 2PNLA 2B7VA 4R2EA 4X66I 4JV5E 1KIJA 2A2DA 4P7AA 1HNWI 4DR4E 2NN6F 2EORA 1UN6B 2X7IA 5JEAD 2WNRA 1Z59A 2BM1A 2UUCE 2E72A 5FLXQ 4LOMA 2EN3A 4DUYI 2MC6A 3QG5C 2EL6A 3J81C 2L3CA 1T4OA 2LMZA 4DR3E 1YUJA 2DIXA 4ZYHA 2EOOA 4R2DA 4AIDA 4MU4A 4U3BA 2EM3A 1EH6A 1N32I 4OOGC 3ECRA 2GHFA 1R6LA 2WBSA 3THNA 5C0XC 2YTDA 5BR8I 3L7ZB 2MC5A 4OX9E 4MQYA 5A6BA 2WCC3 5IWAI 2NUEA 2EFGA 1DARA 3P3GA 3UHMA 4R8OA 2EQ1A 1HK7A 5T6JA 2VESA 4RHBB 4WUBA 4O24A 2EPNA 2BR2B 2PO1B 5LMUE 4GQUA 1A1KA 4ZYEA 4BA2A 3M99B 4JI8E 1A6FA 3TQMA 3T1YI 1UDOA 4FN5A 4BHCA 4BA1A 2MKDA 1G2DC 2Z5EA 1MG7A 4B3TE 4DU8A 5IXMB 2IESA 2V2VA 4FW3A 2UUBI 2V86A 5K36F 1L4SA 5LMUI 4LFAE 5C0XD 2YTFA 3WU4A 2E5LI 1B69A 4R1FA 5GMDA 4JI5E 2JEBB 1IBMI 3M85G 1OYSA 4USKA 2EMXA 1ZR9A 2CSHA 2RS6A 2VQFE 1YZ9A 1Z0VA 3U1KA 1RR9A 3J7AM 2DEJA 1HNXI 5LL6R 1J5EI
chains in the Genus database with same CATH topology
4OX9I 4IZJB 3WU6A 1H74A 4JI7I 1YYKA 1OJ4A 2OI2A 4GEQB 2EZ6A 4DV5E 2M4IA 3OTOI 3JTZA 1Z0EA 2N3GA 1DQ3A 1Z5BA 4LF9I 3F6HA 1WHNA 2VQEI 4DPYA 3C4BA 2UUCI 1RQ0A 1N33E 2ZM6E 4JI3E 5L3JA 2DMYA 1ZM2A 4B3SE 1GQEA 2NUGA 3M6AA 1BKNA 4KHPI 3AUZA 4X66E 3IWCA 4NXNI 4X64I 1N34E 1B63A 5AE2A 4DR1I 3Q1QA 1IBLI 1X47A 4JI2I 2GS8A 1ZM3A 3C4TA 2L2NA 2JY9A 4AQYI 1YYOA 1YYWA 4X8WA 2Z5BA 2GQ0A 2UXCE 4DV0I 4NXME 2G7HA 1XNRE 2FGGA 1MU5A 3PYEA 4JG4A 4LF8E 4P78A 3HPZA 1RREA 4IZJA 2PNMA 3HQ1A 4DR2I 2NPFA 1XHKA 3ADIA 4LFBI 2DB2A 3PYGA 4B3ME 4P7DA 4LF6E 4DR7E 4GKKE 2F4VE 1H73A 1ZM9A 1Z0WA 3HULA 1B62A 4R03A 3J80C 1NHJA 2V2QA 3H4LA 2JOXA 1N0UA 1QZRA 1NHHA 2LRSA 4BBYA 4DPTA 4LF4E 4UT4A 5F3WA 2UXDE 1IBKE 1WXRA 1Z0CA 2HHHE 4USMA 4JI4E 3ZOQB 1FWLA 3VYYA 4HACB 4FWDA 1Z5AA 5CFFE 1KTVA 4DR6E 2RTXA 2Z5BB 1XMOI 2HFSA 2HKEA 2LTRA 4URLA 3B8HA 3P1XA 1N36E 2B3TB 2A2CA 2MDRA 2IHR1 4LFBE 3HPSA 4JI0E 2O1WA 2WW4A 2L2MA 4LFCI 4BS9A 2L3JA 3AV0A 3T1HE 4M0VA 1XNQE 1RC7A 3DJWA 4LTYA 4N3OA 4DV4E 1FKAE 2HHHI 4MYUA 3LNUA 2UXBI 2O1UA 3CWVA 2X36A 5ADZA 4HY1A 3K6QA 2JVAA 3J80Q 4DV0E 4BC9A 4YY3I 2UUAI 4X62E 4DR5I 2HFUA 2HKJA 4LF7E 4K0KE 4PU9A 2LJPA 3ZKDA 2Q2EB 3KWRA 1QU6A 4YHHE 3QT5A 4JI0I 4L8NA 4LF5E 1XMQI 3HTXA 4X64E 4GKJI 4DV6E 1MX0A 4YY3E 1NZ0A 1USVA 2IOPA 3DF6A 4M2ZA 4J8ZA 2LJHA 4Z7YA 4DV3I 2WZOA 2L33A 1X48A 3HXLA 4DR5E 4X62I 1X49A 1FNMA 4DV4I 4Z7CA 2KONA 4WUCA 2O1VA 4DPXA 4DV3E 2UXDI 4DV5I 2ODRD 5FWKA 2CGEA 2V85A 2V8PA 4JI7E 2V89A 2RS7A 2K4VA 1XMQE 4LF5I 3B82A 4DKKA 4LU9A 4JI5I 5LMNI 1T4NA 2F4VI 2E5LE 3K85A 4PRXA 4LFCE 4I8OA 4UTGA 1STUA 3D4JA 2UUAE 2AJ4A 1HNZE 1XMOE 3Q6MA 1O0WA 4DR6I 4LF4I 2CPNA 5FLXC 3WU5A 1WUUA 4DV1E 2H36X 2V83A 4F9BB 2UXBE 2JOBA 2LE2A 5AE1A 4P52A 1USUA 3JAMQ 1H72C 2LTSA 2ZBKB 1EI1A 1ZM4A 3H09A 4DV1I 2Z5CA 4ED4A 3PYFA 3T1HI 1KVKA 1T4LB 3RMPA 1HNZI 4HACA 2HK3A 4DV6I 4DPUA 1ZBTA 4DR3I 3ADLA 4DU7A 1WHQA 2L6MA 4IZKB 2L92A 4TUGA 3JAMC 5LMNE 1HNWE 4JV5I 4LF6I 4DR7I 4L5NC 2ZITA 4GKKI 2Z5CB 3B78A 2O1TA 2HK2A 4BC7A 2N3HA 4NXNE 4BCAA 4KZSA 4KHPE 4DR2E 2KHXA 4B3SI 2E1MA 3V5RA 2BV3A 2R3VA 1N33I 1FJGI 4BMJA 3QT8A 4F9AB 3K1JA 3WU3A 2CZ9A 3HJCA 4NXMI 1EKZA 4B3RE 4DR1E 2XEXA 2UXCI 4GKJE 1H7SA 3LLHA 2LUPB 4PRVA 2EWLA 3JU0A 3F6GA 2F8BA 1Y6ZA 4IZJD 4YHHI 3VK6A 1VISA 3QT7A 1NHIA 3LTOA 4DR4I 4LFAI 2M1SA 4LF7I 4K0KI 1J26A 3Q6NA 2UU9I 4JI4I 1SR9A 4JI6I 2VF1A 3ZZTA 3LPSA 3LMLA 5DNYA 1PVGA 3PRYA 5GMEA 3J81Q 1DI2A 4DUZE 2R42A 1UEKA 2ZM6I 1Z0BA 4DPWA 4IZKA 4RPFA 3V2UC 5IT9Q 1HR0E 2VQEE 4AQYE 1Z0GA 4DV2I 4WPYA 3IWDA 3ADGA 2CG9A 2VQFI 2ODRC 3OTOE 4HYMA 3J7AG 4JI2E 1XNQI 3GONA 4DXLA 3K17A 2YT4A 2VF3A 2B7TA 3F0NA 4X65I 1IBLE 5AASA 4B3MI 2L2KB 4B3TI 4JYAE 1S4EA 1ZXMA 1N36I 3VYXA 1S16A 3J7Yp 3ZZUA 4I3HA 3OMLA 2J7KA 3ZKBA 3QT6A 1UILA 4JI3I 2JWOA 1FWKA 4WFTA 2JR1A 4EMDA 1PKPA 1K47A 3ADJA 2RSMA 1N32E 1IBKI 4WUDA 2YZTA 5A2QC 1J5EE 2VE7C 5IWAE 1HNXE 2FTXB 2V34A 5BR8E 2BM0A 4WYQB 2IOQA 1UHZA 4TUIA 1ELOA 1FI4A 1Z5CA 4DUZI 1KKHA 2KOUA 1EA6A 4M1KA 2L8TA 2V88A 2V87A 4DMIA 2NA2A 4DV7E 4WSPA 2UUBE 1N34I 4Q28A 2FV4B 4F9CB 2B9DA 3T1YE 4JI8I 1I94I 1Z0TA 2DEIA 2E1RA 3ZM7A 1ZBQA 1U2RA 2NUFA 5A2QQ 4LF8I 1I94E 3P06A 2V2ZA 4JYAI 4LF9E 4FW9A 4JI1E 4HXZA 3PYDA 1XNRI 4X65E 4B3RI 3MSWA 4ZVIA 1Y4UA 3IWBA 4F54A 4M30A 2LBSB 5IT9C 1ZXNA 4DV2E 1N0VC 1HR0I 2M7QA 4DUYE 1PIEA 1D6TA 1FJGE 1H7UA 4XTJA 4MYTA 3FIGA 2DSYA 3ZZ0A 5AE3A 4FWGA 1GZ6A 1IBME 4KQVA 4JI1I 1Y4SA 2LUQA 4JI6E 2UU9E 4FWHA 4DV7I 2PNLA 2B7VA 4X66I 4JV5E 1KIJA 2A2DA 4P7AA 1HNWI 4DR4E 2X7IA 1Z59A 2BM1A 2UUCE 5FLXQ 4DUYI 2MC6A 3J81C 2L3CA 1T4OA 2LMZA 4DR3E 2DIXA 1N32I 4OOGC 5BR8I 2MC5A 4OX9E 5IWAI 2NUEA 2EFGA 1DARA 4R8OA 1HK7A 5T6JA 4WUBA 5LL6R 5LMUE 4JI8E 1A6FA 3T1YI 4FN5A 2Z5EA 1MG7A 4B3TE 4DU8A 2UUBI 2V2VA 2V86A 5LMUI 4LFAE 3WU4A 2E5LI 4R1FA 5GMDA 1IBMI 4JI5E 4USKA 2VQFE 2RS6A 1YZ9A 1Z0VA 1RR9A 3J7AM 2DEJA 1HNXI 2V8QB 1J5EI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 I;  3WU6 A;  1H74 A;  4JI7 I;  1YYK A;  1OJ4 A;  2OI2 A;  2EZ6 A;  4DV5 E;  3OTO I;  1Z0E A;  2N3G A;  1Z5B A;  4LF9 I;  1WHN A;  2VQE I;  4DPY A;  3C4B A;  2UUC I;  1RQ0 A;  1N33 E;  2ZM6 E;  4JI3 E;  5L3J A;  2DMY A;  1ZM2 A;  4B3S E;  1GQE A;  2NUG A;  3M6A A;  1BKN A;  4KHP I;  4X66 E;  4X64 I;  4NXN I;  1N34 E;  1B63 A;  4DR1 I;  3Q1Q A;  1IBL I;  1X47 A;  4JI2 I;  2GS8 A;  1ZM3 A;  3C4T A;  2L2N A;  2JY9 A;  4AQY I;  1YYO A;  1YYW A;  4X8W A;  2UXC E;  4DV0 I;  4NXM E;  1XNR E;  1MU5 A;  3PYE A;  4JG4 A;  4LF8 E;  1RRE A;  4DR2 I;  2NPF A;  1XHK A;  3ADI A;  4LFB I;  2DB2 A;  3PYG A;  4B3M E;  4LF6 E;  4DR7 E;  4GKK E;  2F4V E;  1H73 A;  1ZM9 A;  1Z0W A;  3HUL A;  1B62 A;  3J80 C;  1NHJ A;  2V2Q A;  3H4L A;  1N0U A;  1QZR A;  1NHH A;  2LRS A;  4DPT A;  4LF4 E;  4UT4 A;  2UXD E;  1IBK E;  1Z0C A;  2HHH E;  4USM A;  4JI4 E;  1FWL A;  3VYY A;  4HAC B;  4FWD A;  1Z5A A;  5CFF E;  1KTV A;  4DR6 E;  2RTX A;  1XMO I;  2HFS A;  2HKE A;  2LTR A;  4URL A;  3B8H A;  3P1X A;  1N36 E;  2B3T B;  2A2C A;  2MDR A;  2IHR 1;  4LFB E;  4JI0 E;  2WW4 A;  2L2M A;  4LFC I;  2L3J A;  3T1H E;  1XNQ E;  1RC7 A;  4DV4 E;  1FKA E;  2HHH I;  4MYU A;  3LNU A;  2UXB I;  3CWV A;  2X36 A;  4HY1 A;  2JVA A;  3J80 Q;  4DV0 E;  4YY3 I;  2UUA I;  4X62 E;  4DR5 I;  2HFU A;  2HKJ A;  4LF7 E;  4K0K E;  4PU9 A;  2LJP A;  3ZKD A;  2Q2E B;  1QU6 A;  4YHH E;  3QT5 A;  4JI0 I;  4LF5 E;  1XMQ I;  3HTX A;  4X64 E;  4GKJ I;  4DV6 E;  1MX0 A;  4YY3 E;  1NZ0 A;  4M2Z A;  2LJH A;  4Z7Y A;  4DV3 I;  2L33 A;  1X48 A;  4DR5 E;  4X62 I;  1X49 A;  1FNM A;  4DV4 I;  4Z7C A;  4WUC A;  4DPX A;  4DV3 E;  2UXD I;  4DV5 I;  2V8P A;  4JI7 E;  2RS7 A;  1XMQ E;  4LF5 I;  3B82 A;  4DKK A;  4JI5 I;  5LMN I;  1T4N A;  2F4V I;  2E5L E;  4PRX A;  4LFC E;  4UTG A;  1STU A;  3D4J A;  2UUA E;  2AJ4 A;  1HNZ E;  1XMO E;  1O0W A;  4DR6 I;  4LF4 I;  2CPN A;  3WU5 A;  5FLX C;  1WUU A;  4DV1 E;  2UXB E;  4P52 A;  3JAM Q;  1H72 C;  2LTS A;  2ZBK B;  1EI1 A;  1ZM4 A;  4DV1 I;  4ED4 A;  3PYF A;  3T1H I;  1KVK A;  1T4L B;  1HNZ I;  4HAC A;  2HK3 A;  4DV6 I;  4DPU A;  1ZBT A;  4DR3 I;  3ADL A;  4DU7 A;  1WHQ A;  5LMN E;  3JAM C;  1HNW E;  4JV5 I;  4LF6 I;  4DR7 I;  2ZIT A;  4GKK I;  3B78 A;  2HK2 A;  2N3H A;  4NXN E;  4KHP E;  4DR2 E;  2KHX A;  4B3S I;  3V5R A;  2BV3 A;  2R3V A;  1N33 I;  1FJG I;  3QT8 A;  3K1J A;  3WU3 A;  2CZ9 A;  4NXM I;  1EKZ A;  4B3R E;  4DR1 E;  2XEX A;  2UXC I;  4GKJ E;  1H7S A;  3LLH A;  2LUP B;  4PRV A;  4YHH I;  1VIS A;  3QT7 A;  1NHI A;  3LTO A;  4DR4 I;  4LFA I;  4LF7 I;  4K0K I;  1J26 A;  2UU9 I;  4JI4 I;  4JI6 I;  3ZZT A;  3LPS A;  1PVG A;  5GME A;  3J81 Q;  1DI2 A;  4DUZ E;  2R42 A;  1UEK A;  2ZM6 I;  1Z0B A;  4DPW A;  4RPF A;  3V2U C;  5IT9 Q;  1HR0 E;  2VQE E;  4AQY E;  1Z0G A;  4DV2 I;  3ADG A;  2VQF I;  3OTO E;  4HYM A;  3J7A G;  4JI2 E;  1XNQ I;  3GON A;  4DXL A;  3K17 A;  2YT4 A;  2VF3 A;  2B7T A;  3F0N A;  4X65 I;  1IBL E;  4B3M I;  2L2K B;  4B3T I;  4JYA E;  1S4E A;  1ZXM A;  1N36 I;  3VYX A;  1S16 A;  3J7Y p;  3ZZU A;  4I3H A;  2J7K A;  3ZKB A;  3QT6 A;  1UIL A;  4JI3 I;  1FWK A;  4WFT A;  4EMD A;  1PKP A;  1K47 A;  3ADJ A;  2RSM A;  1N32 E;  1IBK I;  4WUD A;  5A2Q C;  1J5E E;  2V34 A;  5IWA E;  1HNX E;  5BR8 E;  2BM0 A;  4WYQ B;  1UHZ A;  1ELO A;  1FI4 A;  1Z5C A;  4DUZ I;  1KKH A;  1EA6 A;  4M1K A;  2NA2 A;  4DV7 E;  2UUB E;  1N34 I;  3T1Y E;  4JI8 I;  1I94 I;  1Z0T A;  2DEI A;  2E1R A;  3ZM7 A;  1U2R A;  2NUF A;  5A2Q Q;  4LF8 I;  1I94 E;  2V2Z A;  4JYA I;  4LF9 E;  4FW9 A;  4JI1 E;  4HXZ A;  3PYD A;  1XNR I;  4X65 E;  4B3R I;  4ZVI A;  2LBS B;  4M30 A;  5IT9 C;  1ZXN A;  4DV2 E;  1N0V C;  1HR0 I;  4DUY E;  1PIE A;  1D6T A;  1FJG E;  1H7U A;  4XTJ A;  4MYT A;  3ZZ0 A;  4FWG A;  1IBM E;  4KQV A;  4JI1 I;  2LUQ A;  4JI6 E;  2UU9 E;  4FWH A;  4DV7 I;  4X66 I;  2B7V A;  4JV5 E;  1KIJ A;  2A2D A;  4P7A A;  1HNW I;  4DR4 E;  2X7I A;  1Z59 A;  2BM1 A;  2UUC E;  5FLX Q;  4DUY I;  3J81 C;  2L3C A;  1T4O A;  4DR3 E;  2DIX A;  1N32 I;  4OOG C;  5BR8 I;  4OX9 E;  5IWA I;  2NUE A;  2EFG A;  1DAR A;  4WUB A;  5LMU E;  4JI8 E;  1A6F A;  3T1Y I;  4FN5 A;  1MG7 A;  4B3T E;  4DU8 A;  2UUB I;  2V2V A;  5LMU I;  4LFA E;  3WU4 A;  2E5L I;  4R1F A;  5GMD A;  1IBM I;  4JI5 E;  4USK A;  2VQF E;  2RS6 A;  1YZ9 A;  1Z0V A;  1RR9 A;  3J7A M;  2DEJ A;  1HNX I;  5LL6 R;  1J5E I; 
#chains in the Genus database with same CATH topology
 4OX9 I;  4IZJ B;  3C6K A;  2EOJ A;  1H74 A;  5ELW A;  3WU6 A;  4JI7 I;  1YYK A;  1OJ4 A;  2OI2 A;  4GEQ B;  2EZ6 A;  2EN1 A;  4DV5 E;  2M4I A;  3OTO I;  2EPP A;  3JTZ A;  1OYP A;  1Z0E A;  2HJJ A;  1DQ3 A;  2N3G A;  2YU5 A;  1Z5B A;  4LF9 I;  3F6H A;  3HKM A;  1WHN A;  2VQE I;  4DPY A;  5JEA F;  4OO1 A;  2EPR A;  3C4B A;  2UUC I;  1RQ0 A;  1X6E A;  2ZM6 E;  1A1I A;  5KL2 A;  4NHR A;  4JI3 E;  4WXC A;  2DMY A;  2EQ3 A;  5L3J A;  1ZM2 A;  4MLQ A;  4B3S E;  1GQE A;  2NUG A;  4HEI A;  3M6A A;  3C6M A;  1TN9 A;  1BKN A;  3AUZ A;  4X66 E;  4KHP I;  3IWC A;  4NXN I;  4F6N A;  1JK1 A;  4X64 I;  1N34 E;  1B63 A;  2EP3 A;  5AE2 A;  1N33 E;  3UK3 C;  4DR1 I;  3Q1Q A;  1IBL I;  3L7Z A;  2C39 A;  2VRD A;  1ZAA C;  2EMY A;  1X47 A;  2JPA A;  1XXE A;  2GS8 A;  2EOX A;  4JI2 I;  1ZM3 A;  3C4T A;  2L2N A;  2EJ4 A;  1JK2 A;  2JY9 A;  4AQY I;  1YYO A;  1YYW A;  1GTK A;  4X8W A;  2Z5B A;  2GQ0 A;  2UXC E;  2EPM X;  4DV0 I;  4BA1 B;  4NXM E;  1DGC A;  2EN4 A;  5C0X F;  2G7H A;  3PS2 A;  1XNR E;  2FGG A;  2EPZ A;  1E3H A;  1MU5 A;  3PYE A;  2JEB A;  5C0X A;  4JG4 A;  3GLL A;  3KRN A;  4LF8 E;  4P78 A;  3HPZ A;  5JEA B;  4J3D A;  1RRE A;  1AAY A;  4IZJ A;  3EPK A;  2PNM A;  3HQ1 A;  4DR2 I;  1KYQ A;  2NPF A;  1XHK A;  3ADI A;  2M9A A;  5KL3 A;  2ENC A;  4LFB I;  2DB2 A;  2YRM A;  4N4R B;  2I13 A;  3PYG A;  4B3M E;  4P7D A;  4NZV A;  4LF6 E;  4DR7 E;  4GKK E;  2F4V E;  2NN6 D;  1H73 A;  1A1G A;  1VI7 A;  1Z0W A;  1ZM9 A;  5DNX A;  2DGC A;  3HUL A;  1R6M A;  4R2C A;  1B62 A;  1EH8 A;  4R03 A;  3J80 C;  1LLM C;  1NHJ A;  2V2Q A;  3H4L A;  1X3C A;  2JOX A;  2DRP A;  1N0U A;  1QZR A;  1NHH A;  2YTQ A;  2LRS A;  4BBY A;  4DPT A;  1OYR A;  4LF4 E;  4UT4 A;  5F3W A;  2UXD E;  1IBK E;  4LCG A;  1WXR A;  1Z0C A;  5IV8 B;  4KWY A;  2BA1 D;  2HHH E;  2EMH A;  4WXD A;  4JI4 E;  3ZOQ B;  4USM A;  2PO1 A;  1FWL A;  3VYY A;  4HAC B;  4FWD A;  5K36 B;  1Z5A A;  5CFF E;  1KTV A;  3U1Y A;  4DR6 E;  2RTX A;  2Z5B B;  1XMO I;  2NAB A;  2HFS A;  2HKE A;  3THO B;  2LTR A;  2EM6 A;  3B8H A;  4URL A;  3P1X A;  4ISA A;  1N36 E;  2YWQ A;  2B3T B;  2A2C A;  2MDR A;  2IHR 1;  3HPS A;  4LFB E;  2BBG A;  2LO3 A;  4JI0 E;  1RMD A;  2O1W A;  1ZU1 A;  2C37 A;  2L2M A;  3BGH A;  2WW4 A;  4BS9 A;  1RHY A;  4LFC I;  2RPC A;  2L3J A;  3AV0 A;  3EPL A;  2ENA A;  2RQL A;  3T1H E;  4M0V A;  1XNQ E;  1RC7 A;  2BB8 A;  2LV2 A;  4BHB A;  3DJW A;  2GO4 A;  4LTY A;  3KZY A;  4N3O A;  4DV4 E;  2JEA B;  2EOQ A;  4LCH A;  3GCM A;  1FKA E;  2JE6 B;  2HHH I;  4MYU A;  3LNU A;  2YRH A;  5A69 A;  4QNK A;  2UXB I;  2O1U A;  3CWV A;  2X36 A;  5ADZ A;  4HY1 A;  3K6Q A;  2AE8 A;  2JVA A;  4OO1 B;  2O3Z A;  1KJK A;  3J80 Q;  5EKW A;  4DV0 E;  4BC9 A;  4YY3 I;  3H1C A;  2UUA I;  4X62 E;  4DR5 I;  2YSO A;  3M85 D;  1G2F C;  2HFU A;  4OKG A;  2HKJ A;  2EM0 A;  5AC4 A;  4IJD A;  4LF7 E;  4K0K E;  2CVE A;  4PU9 A;  2LJP A;  3ZZ0 A;  4O43 A;  4MDT A;  2EOE A;  5A6J A;  2EMB A;  4NBQ A;  3ZKD A;  3EQ1 A;  2PNZ B;  2Q2E B;  3KWR A;  1QU6 A;  2YTJ A;  5K36 D;  2EM4 A;  2R76 A;  4YHH E;  3QT5 A;  2MKN A;  4JI0 I;  4L8N A;  4LF5 E;  1XMQ I;  3HTX A;  4X64 E;  2LVH A;  4GKJ I;  2EPC A;  4DV6 E;  1MX0 A;  4YY3 E;  1NZ0 A;  1USV A;  2IOP A;  4O5G A;  3DF6 A;  4M2Z A;  4J8Z A;  2LJH A;  2C38 B;  4Z7Y A;  3BF2 A;  4DV3 I;  2CTD A;  5C0X E;  4MU3 A;  2EMI A;  2WZO A;  4RH8 A;  2L33 A;  4FW4 A;  1X48 A;  1T38 A;  2EL5 A;  2DLK A;  3HXL A;  4DR5 E;  1YH8 A;  1X49 A;  1FNM A;  4X62 I;  4Z7C A;  2KON A;  4WUC A;  2O1V A;  4DV4 I;  4DPX A;  4DV3 E;  2ELY A;  4GZN C;  3P3E A;  2UXD I;  2EMF A;  4Q35 B;  4DV5 I;  2ODR D;  1UBD C;  1PJS A;  2EMG A;  2CGE A;  5FWK A;  4OO1 C;  2JXP A;  5JEA A;  2V85 A;  2V8P A;  2R1F A;  4JI7 E;  2V89 A;  4IFD A;  2RS7 A;  2K4V A;  1XMQ E;  2EMC A;  1UDQ A;  4R2S A;  2PO2 B;  4LF5 I;  1NCS A;  3B82 A;  3EPJ A;  2BR2 A;  2EM2 A;  4DKK A;  1MEY C;  2EPU A;  4LU9 A;  1X6F A;  4JI5 I;  5LMN I;  1T4N A;  2F4V I;  2E5L E;  3P3C A;  3K85 A;  2NN6 E;  4PRX A;  1N3G A;  4LFC E;  4I8O A;  4UTG A;  1STU A;  3D4J A;  3PS1 A;  4ZYD A;  2UUA E;  2AJ4 A;  4OO1 D;  1HNZ E;  1E3P A;  4IFD B;  1XMO E;  3Q6M A;  1O0W A;  4FW7 A;  4DR6 I;  2RSI A;  4LF4 I;  5JEA E;  4OO1 E;  2CPN A;  5FLX C;  3WU5 A;  1WUU A;  1IQS A;  2YU8 A;  4DV1 E;  2H36 X;  2V83 A;  4F9B B;  2UXB E;  3M7N D;  1BB8 A;  2JOB A;  4IFD D;  2EM7 A;  2LE2 A;  5AE1 A;  4P52 A;  2ELZ A;  1USU A;  3JAM Q;  1H72 C;  2LTS A;  2ZBK B;  1EI1 A;  3DD6 A;  1ZM4 A;  2EPX A;  2I9I A;  3H09 A;  4DV1 I;  2Z5C A;  4ED4 A;  3PYF A;  3T1H I;  1KVK A;  1T4L B;  3RMP A;  2EMW A;  1A1J A;  2NN6 C;  5KL6 A;  4LPF A;  1HNZ I;  2YPN A;  2HK3 A;  4HAC A;  5K36 A;  2EM9 A;  4DV6 I;  4DPU A;  1ZBT A;  4DR3 I;  3ADL A;  4HTG A;  4DU7 A;  1WHQ A;  2EMA A;  2EOM A;  2L6M A;  4MLV A;  1WJP A;  2L92 A;  4TUG A;  4IZK B;  1AH5 A;  5K36 E;  5TSE A;  3JAM C;  2EOZ A;  5LMN E;  1HNW E;  5JEA C;  2C37 B;  4JV5 I;  2V8Q B;  4LF6 I;  4L5N C;  2ZIT A;  4DR7 I;  4GKK I;  1BBO A;  3B4T A;  2Z5C B;  3B78 A;  1YFH A;  5KL7 A;  2HK2 A;  2O1T A;  4IFD E;  4BC7 A;  2N3H A;  2MDG A;  4NXN E;  4ZYG A;  2WNR B;  4BCA A;  4KZS A;  4KHP E;  4DR2 E;  1TF3 A;  2JEA A;  2KHX A;  4B3S I;  2E1M A;  3CDJ A;  5LLQ A;  3V5R A;  2BV3 A;  2R3V A;  1N33 I;  4MU1 A;  1FJG I;  4BMJ A;  1YHC A;  3QT8 A;  2PO0 B;  2EMK A;  2PRT A;  4F9A B;  2EOF A;  4FW6 A;  3K1J A;  3WU3 A;  2YTN A;  2K7I A;  1IQO A;  5K36 C;  1YSA C;  2CZ9 A;  3HJC A;  1NEI A;  4NXM I;  1EKZ A;  4FWG A;  4B3R E;  4WSG A;  4DR1 E;  2XEX A;  2UXC I;  4GKJ E;  1H7S A;  3LLH A;  2YRK A;  2LUP B;  4PRV A;  4F6M A;  2EWL A;  4IFD C;  2GO3 A;  4QNJ A;  2YTE A;  4R2R A;  3JU0 A;  3F6G A;  2F8B A;  1Y6Z A;  4IZJ D;  4YHH I;  1UDS A;  3VK6 A;  2HC5 A;  1VIS A;  5DRR A;  4X9J A;  2EN7 A;  2EPL X;  5KL4 A;  1Z1B A;  3QT7 A;  1NHI A;  3LTO A;  2YTG A;  4DR4 I;  3GME A;  4LFA I;  2M1S A;  2N8X A;  4LF7 I;  4K0K I;  2GLI A;  2ADR A;  1J26 A;  2WP8 A;  3Q6N A;  2EL4 A;  2UU9 I;  4JI4 I;  4F2J C;  1SR9 A;  4JI6 I;  2VF1 A;  3MHS C;  3LPS A;  3LML A;  3ZZT A;  5DNY A;  1PVG A;  2EOS A;  3PRY A;  5GME A;  3J81 Q;  1DI2 A;  4DUZ E;  2R42 A;  1IMU A;  2EN8 A;  1UEK A;  3P76 A;  2ZM6 I;  1Z0B A;  4DPW A;  5AC5 A;  2EPO A;  4IZK A;  4RPF A;  1EH7 A;  2YTP A;  4OO1 F;  3V2U C;  5IT9 Q;  1HR0 E;  2VQE E;  4AQY E;  2CT1 A;  1F2I G;  1Z0G A;  2NN6 A;  5DRO A;  4WPY A;  4DV2 I;  3IWD A;  3ADG A;  4R2P A;  1T39 A;  4FW5 A;  2CG9 A;  2VQF I;  4DUZ I;  2ODR C;  3OTO E;  4HYM A;  4R2A A;  4JI2 E;  3J7A G;  1XNQ I;  3GON A;  4DXL A;  3K17 A;  5DRP A;  2A25 A;  2YT4 A;  2VF3 A;  2B7T A;  3KZZ A;  3F0N A;  4X65 I;  1IBL E;  5AAS A;  4B3M I;  2L2K B;  4B3T I;  2J7J A;  4JYA E;  1PDA A;  1YPN A;  1S4E A;  1ZXM A;  1N36 I;  3VYX A;  1S16 A;  3J7Y p;  3ZZU A;  5A6B D;  1TF6 A;  2NN6 B;  4I3H A;  2WBT A;  3OML A;  2J7K A;  1X6H A;  2EQ0 A;  1UIL A;  3QT6 A;  3ZKB A;  4JI3 I;  2JWO A;  3BBG A;  1FWK A;  4WFT A;  2EMZ A;  2JR1 A;  2EOH A;  2Q8U A;  4EMD A;  1PKP A;  1K47 A;  4WX9 A;  3ADJ A;  2RSM A;  4R2Q A;  1A1F A;  1N32 E;  1IBK I;  5A6K A;  1A1L A;  4FK5 C;  1QNT A;  2BA1 G;  4WUD A;  2YZT A;  2JE6 A;  3BID A;  2LCE A;  4U3D A;  2YTI A;  5A2Q C;  2YSP A;  1Y60 A;  2C39 B;  2JP9 A;  3L00 A;  4IS9 A;  1J5E E;  2VE7 C;  5IWA E;  2FTX B;  1HNX E;  2V34 A;  1YUI A;  5BR8 E;  2BM0 A;  2D9H A;  4WYQ B;  2IOQ A;  4OZE A;  4MU0 A;  5C0X B;  1UHZ A;  4TUI A;  2EN2 A;  3MHH C;  1ELO A;  1FI4 A;  1Z5C A;  2EPK X;  2KOU A;  3EPH A;  1EA6 A;  1KKH A;  2PO2 A;  2GPI A;  2L8T A;  2V88 A;  2V87 A;  4DMI A;  2IER A;  4M1K A;  2NA2 A;  4DV7 E;  4WSP A;  2UUB E;  2EOI A;  1N34 I;  4Q28 A;  1UDN A;  5EL9 A;  2FV4 B;  2EN6 A;  4F9C B;  2B9D A;  3T1Y E;  4JI8 I;  5A6A A;  1I94 I;  2EE8 A;  1Z0T A;  2WP8 B;  2LT7 A;  2DEI A;  4IFD F;  2E1R A;  4BA2 B;  3ZM7 A;  1ZBQ A;  1U2R A;  2NUF A;  5A2Q Q;  2BA0 D;  1X5W A;  2JT2 A;  4LF8 I;  1MGT A;  1I94 E;  3P06 A;  4LCF A;  1P47 A;  2V2Z A;  1PJT A;  2C38 A;  4JYA I;  4LF9 E;  4AM3 A;  4FW9 A;  4JI1 E;  2LJU A;  3PYD A;  4HXZ A;  1XNR I;  4X65 E;  4B3R I;  4IS1 C;  5DRQ A;  3MSW A;  2PO0 A;  1Y4U A;  4ZVI A;  2EML A;  3IWB A;  2WBU A;  4F54 A;  4M30 A;  2EOY A;  2LBS B;  5IT9 C;  1A1H A;  2DLQ A;  1ZXN A;  3M7N G;  4DV2 E;  1N0V C;  1HR0 I;  2M7Q A;  2F1D A;  1WRJ A;  1SFE A;  4DUY E;  1PIE A;  3VHT B;  4M9V C;  1D6T A;  1FJG E;  1H7U A;  3NZK A;  4XTJ A;  4MYT A;  2ENH A;  2DSY A;  2EPA A;  3FIG A;  5AE3 A;  1GZ6 A;  2EM5 A;  1IBM E;  2HGH A;  3CDI A;  2DMI A;  1Y5Y A;  1BBG A;  5KL5 A;  1P42 A;  2EM8 A;  4O4K A;  2BA0 G;  2YTO A;  1PJQ A;  3PS3 A;  4KQV A;  2JYA A;  4JI1 I;  1Y4S A;  2LUQ A;  4JI6 E;  4AIM A;  2UU9 E;  2J65 A;  2PNZ A;  5DNL A;  4FWH A;  4DV7 I;  2PNL A;  2B7V A;  4R2E A;  4X66 I;  4JV5 E;  1KIJ A;  2A2D A;  4P7A A;  1HNW I;  4DR4 E;  2NN6 F;  2EOR A;  1UN6 B;  2X7I A;  5JEA D;  2WNR A;  1Z59 A;  2BM1 A;  2UUC E;  2E72 A;  5FLX Q;  4LOM A;  2EN3 A;  4DUY I;  2MC6 A;  3QG5 C;  2EL6 A;  3J81 C;  2L3C A;  1T4O A;  2LMZ A;  4DR3 E;  1YUJ A;  2DIX A;  4ZYH A;  2EOO A;  4R2D A;  4AID A;  4MU4 A;  4U3B A;  2EM3 A;  1EH6 A;  1N32 I;  4OOG C;  3ECR A;  2GHF A;  1R6L A;  2WBS A;  3THN A;  5C0X C;  2YTD A;  5BR8 I;  3L7Z B;  2MC5 A;  4OX9 E;  4MQY A;  5A6B A;  2WCC 3;  5IWA I;  2NUE A;  2EFG A;  1DAR A;  3P3G A;  3UHM A;  4R8O A;  2EQ1 A;  1HK7 A;  5T6J A;  2VES A;  4RHB B;  4WUB A;  4O24 A;  2EPN A;  2BR2 B;  2PO1 B;  5LMU E;  4GQU A;  1A1K A;  4ZYE A;  4BA2 A;  3M99 B;  4JI8 E;  1A6F A;  3TQM A;  3T1Y I;  1UDO A;  4FN5 A;  4BHC A;  4BA1 A;  2MKD A;  1G2D C;  2Z5E A;  1MG7 A;  4B3T E;  4DU8 A;  5IXM B;  2IES A;  2V2V A;  4FW3 A;  2UUB I;  2V86 A;  5K36 F;  1L4S A;  5LMU I;  4LFA E;  5C0X D;  2YTF A;  3WU4 A;  2E5L I;  1B69 A;  4R1F A;  5GMD A;  4JI5 E;  2JEB B;  1IBM I;  3M85 G;  1OYS A;  4USK A;  2EMX A;  1ZR9 A;  2CSH A;  2RS6 A;  2VQF E;  1YZ9 A;  1Z0V A;  3U1K A;  1RR9 A;  3J7A M;  2DEJ A;  1HNX I;  5LL6 R;  1J5E I; 
#chains in the Genus database with same CATH homology
 4OX9 I;  4IZJ B;  3WU6 A;  1H74 A;  4JI7 I;  1YYK A;  1OJ4 A;  2OI2 A;  4GEQ B;  2EZ6 A;  4DV5 E;  2M4I A;  3OTO I;  3JTZ A;  1Z0E A;  2N3G A;  1DQ3 A;  1Z5B A;  4LF9 I;  3F6H A;  1WHN A;  2VQE I;  4DPY A;  3C4B A;  2UUC I;  1RQ0 A;  1N33 E;  2ZM6 E;  4JI3 E;  5L3J A;  2DMY A;  1ZM2 A;  4B3S E;  1GQE A;  2NUG A;  3M6A A;  1BKN A;  4KHP I;  3AUZ A;  4X66 E;  3IWC A;  4NXN I;  4X64 I;  1N34 E;  1B63 A;  5AE2 A;  4DR1 I;  3Q1Q A;  1IBL I;  1X47 A;  4JI2 I;  2GS8 A;  1ZM3 A;  3C4T A;  2L2N A;  2JY9 A;  4AQY I;  1YYO A;  1YYW A;  4X8W A;  2Z5B A;  2GQ0 A;  2UXC E;  4DV0 I;  4NXM E;  2G7H A;  1XNR E;  2FGG A;  1MU5 A;  3PYE A;  4JG4 A;  4LF8 E;  4P78 A;  3HPZ A;  1RRE A;  4IZJ A;  2PNM A;  3HQ1 A;  4DR2 I;  2NPF A;  1XHK A;  3ADI A;  4LFB I;  2DB2 A;  3PYG A;  4B3M E;  4P7D A;  4LF6 E;  4DR7 E;  4GKK E;  2F4V E;  1H73 A;  1ZM9 A;  1Z0W A;  3HUL A;  1B62 A;  4R03 A;  3J80 C;  1NHJ A;  2V2Q A;  3H4L A;  2JOX A;  1N0U A;  1QZR A;  1NHH A;  2LRS A;  4BBY A;  4DPT A;  4LF4 E;  4UT4 A;  5F3W A;  2UXD E;  1IBK E;  1WXR A;  1Z0C A;  2HHH E;  4USM A;  4JI4 E;  3ZOQ B;  1FWL A;  3VYY A;  4HAC B;  4FWD A;  1Z5A A;  5CFF E;  1KTV A;  4DR6 E;  2RTX A;  2Z5B B;  1XMO I;  2HFS A;  2HKE A;  2LTR A;  4URL A;  3B8H A;  3P1X A;  1N36 E;  2B3T B;  2A2C A;  2MDR A;  2IHR 1;  4LFB E;  3HPS A;  4JI0 E;  2O1W A;  2WW4 A;  2L2M A;  4LFC I;  4BS9 A;  2L3J A;  3AV0 A;  3T1H E;  4M0V A;  1XNQ E;  1RC7 A;  3DJW A;  4LTY A;  4N3O A;  4DV4 E;  1FKA E;  2HHH I;  4MYU A;  3LNU A;  2UXB I;  2O1U A;  3CWV A;  2X36 A;  5ADZ A;  4HY1 A;  3K6Q A;  2JVA A;  3J80 Q;  4DV0 E;  4BC9 A;  4YY3 I;  2UUA I;  4X62 E;  4DR5 I;  2HFU A;  2HKJ A;  4LF7 E;  4K0K E;  4PU9 A;  2LJP A;  3ZKD A;  2Q2E B;  3KWR A;  1QU6 A;  4YHH E;  3QT5 A;  4JI0 I;  4L8N A;  4LF5 E;  1XMQ I;  3HTX A;  4X64 E;  4GKJ I;  4DV6 E;  1MX0 A;  4YY3 E;  1NZ0 A;  1USV A;  2IOP A;  3DF6 A;  4M2Z A;  4J8Z A;  2LJH A;  4Z7Y A;  4DV3 I;  2WZO A;  2L33 A;  1X48 A;  3HXL A;  4DR5 E;  4X62 I;  1X49 A;  1FNM A;  4DV4 I;  4Z7C A;  2KON A;  4WUC A;  2O1V A;  4DPX A;  4DV3 E;  2UXD I;  4DV5 I;  2ODR D;  5FWK A;  2CGE A;  2V85 A;  2V8P A;  4JI7 E;  2V89 A;  2RS7 A;  2K4V A;  1XMQ E;  4LF5 I;  3B82 A;  4DKK A;  4LU9 A;  4JI5 I;  5LMN I;  1T4N A;  2F4V I;  2E5L E;  3K85 A;  4PRX A;  4LFC E;  4I8O A;  4UTG A;  1STU A;  3D4J A;  2UUA E;  2AJ4 A;  1HNZ E;  1XMO E;  3Q6M A;  1O0W A;  4DR6 I;  4LF4 I;  2CPN A;  5FLX C;  3WU5 A;  1WUU A;  4DV1 E;  2H36 X;  2V83 A;  4F9B B;  2UXB E;  2JOB A;  2LE2 A;  5AE1 A;  4P52 A;  1USU A;  3JAM Q;  1H72 C;  2LTS A;  2ZBK B;  1EI1 A;  1ZM4 A;  3H09 A;  4DV1 I;  2Z5C A;  4ED4 A;  3PYF A;  3T1H I;  1KVK A;  1T4L B;  3RMP A;  1HNZ I;  4HAC A;  2HK3 A;  4DV6 I;  4DPU A;  1ZBT A;  4DR3 I;  3ADL A;  4DU7 A;  1WHQ A;  2L6M A;  4IZK B;  2L92 A;  4TUG A;  3JAM C;  5LMN E;  1HNW E;  4JV5 I;  4LF6 I;  4DR7 I;  4L5N C;  2ZIT A;  4GKK I;  2Z5C B;  3B78 A;  2O1T A;  2HK2 A;  4BC7 A;  2N3H A;  4NXN E;  4BCA A;  4KZS A;  4KHP E;  4DR2 E;  2KHX A;  4B3S I;  2E1M A;  3V5R A;  2BV3 A;  2R3V A;  1N33 I;  1FJG I;  4BMJ A;  3QT8 A;  4F9A B;  3K1J A;  3WU3 A;  2CZ9 A;  3HJC A;  4NXM I;  1EKZ A;  4B3R E;  4DR1 E;  2XEX A;  2UXC I;  4GKJ E;  1H7S A;  3LLH A;  2LUP B;  4PRV A;  2EWL A;  3JU0 A;  3F6G A;  2F8B A;  1Y6Z A;  4IZJ D;  4YHH I;  3VK6 A;  1VIS A;  3QT7 A;  1NHI A;  3LTO A;  4DR4 I;  4LFA I;  2M1S A;  4LF7 I;  4K0K I;  1J26 A;  3Q6N A;  2UU9 I;  4JI4 I;  1SR9 A;  4JI6 I;  2VF1 A;  3ZZT A;  3LPS A;  3LML A;  5DNY A;  1PVG A;  3PRY A;  5GME A;  3J81 Q;  1DI2 A;  4DUZ E;  2R42 A;  1UEK A;  2ZM6 I;  1Z0B A;  4DPW A;  4IZK A;  4RPF A;  3V2U C;  5IT9 Q;  1HR0 E;  2VQE E;  4AQY E;  1Z0G A;  4DV2 I;  4WPY A;  3IWD A;  3ADG A;  2CG9 A;  2VQF I;  2ODR C;  3OTO E;  4HYM A;  3J7A G;  4JI2 E;  1XNQ I;  3GON A;  4DXL A;  3K17 A;  2YT4 A;  2VF3 A;  2B7T A;  3F0N A;  4X65 I;  1IBL E;  5AAS A;  4B3M I;  2L2K B;  4B3T I;  4JYA E;  1S4E A;  1ZXM A;  1N36 I;  3VYX A;  1S16 A;  3J7Y p;  3ZZU A;  4I3H A;  3OML A;  2J7K A;  3ZKB A;  3QT6 A;  1UIL A;  4JI3 I;  2JWO A;  1FWK A;  4WFT A;  2JR1 A;  4EMD A;  1PKP A;  1K47 A;  3ADJ A;  2RSM A;  1N32 E;  1IBK I;  4WUD A;  2YZT A;  5A2Q C;  1J5E E;  2VE7 C;  5IWA E;  1HNX E;  2FTX B;  2V34 A;  5BR8 E;  2BM0 A;  4WYQ B;  2IOQ A;  1UHZ A;  4TUI A;  1ELO A;  1FI4 A;  1Z5C A;  4DUZ I;  1KKH A;  2KOU A;  1EA6 A;  4M1K A;  2L8T A;  2V88 A;  2V87 A;  4DMI A;  2NA2 A;  4DV7 E;  4WSP A;  2UUB E;  1N34 I;  4Q28 A;  2FV4 B;  4F9C B;  2B9D A;  3T1Y E;  4JI8 I;  1I94 I;  1Z0T A;  2DEI A;  2E1R A;  3ZM7 A;  1ZBQ A;  1U2R A;  2NUF A;  5A2Q Q;  4LF8 I;  1I94 E;  3P06 A;  2V2Z A;  4JYA I;  4LF9 E;  4FW9 A;  4JI1 E;  4HXZ A;  3PYD A;  1XNR I;  4X65 E;  4B3R I;  3MSW A;  4ZVI A;  1Y4U A;  3IWB A;  4F54 A;  4M30 A;  2LBS B;  5IT9 C;  1ZXN A;  4DV2 E;  1N0V C;  1HR0 I;  2M7Q A;  4DUY E;  1PIE A;  1D6T A;  1FJG E;  1H7U A;  4XTJ A;  4MYT A;  3FIG A;  2DSY A;  3ZZ0 A;  5AE3 A;  4FWG A;  1GZ6 A;  1IBM E;  4KQV A;  4JI1 I;  1Y4S A;  2LUQ A;  4JI6 E;  2UU9 E;  4FWH A;  4DV7 I;  2PNL A;  2B7V A;  4X66 I;  4JV5 E;  1KIJ A;  2A2D A;  4P7A A;  1HNW I;  4DR4 E;  2X7I A;  1Z59 A;  2BM1 A;  2UUC E;  5FLX Q;  4DUY I;  2MC6 A;  3J81 C;  2L3C A;  1T4O A;  2LMZ A;  4DR3 E;  2DIX A;  1N32 I;  4OOG C;  5BR8 I;  2MC5 A;  4OX9 E;  5IWA I;  2NUE A;  2EFG A;  1DAR A;  4R8O A;  1HK7 A;  5T6J A;  4WUB A;  5LL6 R;  5LMU E;  4JI8 E;  1A6F A;  3T1Y I;  4FN5 A;  2Z5E A;  1MG7 A;  4B3T E;  4DU8 A;  2UUB I;  2V2V A;  2V86 A;  5LMU I;  4LFA E;  3WU4 A;  2E5L I;  4R1F A;  5GMD A;  1IBM I;  4JI5 E;  4USK A;  2VQF E;  2RS6 A;  1YZ9 A;  1Z0V A;  1RR9 A;  3J7A M;  2DEJ A;  1HNX I;  2V8Q B;  1J5E I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...