4X66E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x66E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66E02
3WU4A 1XMOI 3QT6A 3VYXA 2RS7A 4DPTA 2YT4A 2LBSB 1I94I 4JI6I 3T1YE 1B62A 1Z0BA 3LPSA 1WHNA 1Z5BA 2AJ4A 1RREA 3K1JA 3QT7A 2X36A 4DV0I 1QZRA 4JI8E 1MU5A 3P1XA 1XNRI 3WU6A 3K17A 5GMEA 5FLXQ 4KHPI 1Z0VA 4B3SE 2GS8A 1KTVA 4OOGC 4JV5E 3B78A 4JI5E 4DR4I 2UXCI 2LJPA 4X8WA 2RTXA 4LF5I 2ZBKB 3QT8A 1FJGE 2DIXA 4EMDA 2LUQA 1HNZE 1Z59A 2N3HA 1J5EE 5GMDA 4DPWA 1IBMI 1EA6A 1XMQE 3VYYA 4DR3I 1N36I 4DV2I 1XNQE 2HHHE 1IBLI 1IBLE 2UUAI 1S4EA 1XNQI 2UU9E 1XHKA 4DPXA 1UEKA 3PYEA 4JI3E 4WFTA 4DR1E 1O0WA 1OJ4A 1VISA 1N34I 2NPFA 4AQYE 5LMUE 4LF5E 3C4TA 2UXCE 1BKNA 4DPUA 4FN5A 1PKPA 4JV5I 5IT9Q 2B3TB 2LTRA 1Z0WA 4YHHE 1KVKA 1NZ0A 4DV4I 2ZM6I 3T1HI 1H72C 4DV3E 3J80Q 3Q1QA 4LF9I 1ZM9A 4FWGA 1S16A 3OTOE 2E5LE 4DV0E 4HACA 4R1FA 4DR5I 3H4LA 1ZXMA 4Z7YA 3LLHA 1YZ9A 3V5RA 2UUCE 4B3TI 2BM0A 1XMOE 4DPYA 4DR5E 3OTOI 3M6AA 4LF9E 2A2DA 4M1KA 1FWKA 1J26A 3ADGA 4X62I 4KQVA 4DV4E 4JI1I 2UXBE 1T4LB 4PRXA 1Z5CA 1HNWE 2VQEE 4DUZI 4I3HA 4K0KI 2LJHA 4X64E 5LMUI 4LF8E 4AQYI 2JVAA 1NHHA 4NXNI 2UUBI 4DUYI 4NXMI 2L2KB 4DR1I 1H7SA 3LNUA 2VQFE 1MG7A 2F4VE 2EZ6A 4X66E 4M30A 2UU9I 1B63A 1FNMA 1Z5AA 3ZM7A 2HHHI 2HK2A 5A2QQ 2UXDE 2WW4A 4JG4A 2L2NA 1MX0A 2HFUA 4DV1E 3J7AM 4YY3E 1J5EI 2MDRA 1H74A 4MYUA 3PYFA 1Z0EA 3J7Yp 3GONA 4MYTA 1T4OA 1WUUA 4DR4E 1ELOA 4JI5I 1FI4A 4B3RI 1EKZA 4X66I 2VQFI 1FKAE 1KKHA 2LTSA 3PYGA 4JI4E 4DU7A 4NXNE 4HXZA 3JAMQ 1YYWA 1ZBTA 2JY9A 3ADJA 1D6TA 4X64I 4DR6I 4JI8I 3PYDA 5IWAE 1N0UA 4JYAI 2VQEI 3T1YI 1I94E 4DV6E 3QT5A 4LFAI 2HKJA 4X62E 2OI2A 4B3ME 1EI1A 1DI2A 2DEJA 4LF7I 4URLA 1H7UA 1QU6A 4LFBE 1ZM4A 3J81C 3CWVA 3HULA 4JI2I 4USKA 5BR8I 2LRSA 2BM1A 1RC7A 2DEIA 2J7KA 4WUCA 4UTGA 4LF7E 4P52A 4DV7I 2HFSA 5A2QC 2V34A 1HR0I 2CPNA 4DV6I 4DR7E 1N33E 4XTJA 2DMYA 3ADLA 1K47A 4DKKA 2V2ZA 4DR6E 1YYOA 5CFFE 1Z0TA 1IBKI 2DB2A 4LF4I 2B7TA 4DV3I 4JI0E 4LFCI 2ZM6E 1A6FA 2XEXA 2R42A 1N32I 4ED4A 3B82A 4DR2I 2CZ9A 4P7AA 2L33A 1N32E 1UILA 4FW9A 4UT4A 1N34E 3ZKDA 2ZITA 2L2MA 4YY3I 4JI3I 2NUGA 4DV1I 4FWHA 2UXDI 4PRVA 1IBKE 1ZM2A 4ZVIA 1YYKA 3J81Q 4DV2E 1N36E 2F4VI 1N33I 2R3VA 4DUYE 2VF3A 1DARA 2LUPB 2N3GA 1WHQA 4DV7E 1NHJA 1U2RA 2Q2EB 1FJGI 3ZKBA 4Z7CA 3B8HA 3V2UC 1X47A 2KHXA 5FLXC 1RQ0A 4B3SI 2HKEA 3WU5A 4DXLA 2UXBI 4USMA 5LMNI 4DV5I 1HNXI 2RSMA 1XNRE 2X7IA 4B3MI 1HNXE 5LMNE 4DV5E 4LFAE 1FWLA 4PU9A 2E1RA 3D4JA 4WUDA 2BV3A 3WU3A 4JYAE 5IWAI 3C4BA 4JI6E 3JAMC 4WYQB 4LFBI 3J7AG 4HACB 2V8PA 4B3TE 2UUCI 4JI4I 3LTOA 4X65E 4B3RE 3F0NA 4RPFA 2E5LI 1UHZA 3ZZ0A 2B7VA 3T1HE 1PVGA 4DU8A 5IT9C 4YHHI 1ZXNA 1X49A 4LF6E 3HTXA 5L3JA 1N0VC 1H73A 1ZM3A 2NUEA 4HYMA 1Z0GA 1STUA 2A2CA 2RS6A 4JI7I 3ADIA 3ZZUA 4OX9E 3J80C 4DR2E 2NUFA 4GKJI 5LL6R 2NA2A 4GKKI 1RR9A 4NXME 4HY1A 2L3CA 2UUBE 4LFCE 4JI0I 4GKKE 4GKJE 4LF4E 2EFGA 4LF8I 4OX9I 2UUAE 4JI7E 4K0KE 4WUBA 1GQEA 4DUZE 2HK3A 1HNWI 1KIJA 4DR3E 1XMQI 4LF6I 4DR7I 1IBME 4JI1E 4FWDA 1HR0E 1NHIA 1HNZI 1T4NA 1X48A 4M2ZA 2V2QA 2L3JA 3ZZTA 2V2VA 5BR8E 4JI2E 4X65I 1Z0CA 1PIEA 4KHPE 2IHR1
chains in the Genus database with same CATH superfamily
1BBOA 4MQYA 3WU4A 3EPLA 4IZJB 1XMOI 2O3ZA 4BS9A 2EM4A 4X9JA 2Z5BB 2NABA 2EJ4A 3VYXA 3QT6A 2EMFA 2RS7A 4DPTA 2YT4A 2YPNA 2V89A 2LBSB 2PRTA 2PNLA 3P06A 1I94I 1P47A 4JI6I 1HK7A 3T1YE 1B62A 2O1TA 1IMUA 5KL7A 1Z0BA 3LPSA 3C6KA 1WHNA 1Z5BA 2AJ4A 3JTZA 3TQMA 1RREA 3K1JA 3QT7A 2X36A 4F6NA 1QZRA 1UN6B 4JI8E 4QNJA 3UHMA 5JEAD 3EPHA 1GTKA 1MU5A 5K36E 2EQ3A 3Q6NA 3M99B 3P1XA 1XNRI 3WU6A 3K17A 5GMEA 2LJUA 5FLXQ 4KHPI 4ZYDA 3M85D 1Z0VA 4B3SE 1KYQA 2KOUA 2YTPA 2GS8A 3K85A 2L8TA 1KTVA 4OOGC 4JV5E 4IZJD 3B78A 2N8XA 4JI5E 5EL9A 4DR4I 2UXCI 2LJPA 4X8WA 1T39A 3H1CA 2RTXA 4LF5I 2ZBKB 3QT8A 5DRPA 5AE3A 4BC9A 2H36X 1MGTA 2JT2A 5K36A 4BC7A 1FJGE 2DIXA 2WBSA 2EOHA 2LUQA 4EMDA 4R2CA 2JP9A 1HNZE 2V86A 2N3HA 1Z59A 4OO1C 2EOIA 1J5EE 5GMDA 4BCAA 2EPUA 2YTOA 1Z1BA 4DPWA 2EQ0A 1IBMI 2I13A 5KL2A 1X6HA 1XMQE 2ENHA 2V83A 3VYYA 1EA6A 5JEAB 4DV2I 4DR3I 1N36I 4M0VA 4WSPA 2YTDA 1XNQE 2LMZA 2HHHE 2YZTA 2M9AA 2YTQA 1IBLI 1IBLE 5ELWA 2UUAI 2EM7A 4OO1E 2EOQA 2LE2A 1S4EA 1XNQI 2UU9E 1XHKA 2JOBA 4DPXA 1UEKA 4DV0I 2WBTA 2EPOA 3PYEA 4JI3E 4WFTA 2PO2A 4DR1E 2WP8A 1O0WA 2EMBA 1A1LA 5K36B 1G2DC 1OJ4A 1VISA 1N34I 5T6JA 2Z5CA 4OKGA 2NPFA 4FW5A 2YTJA 4AQYE 4RH8A 3H09A 4RHBB 5LMUE 2NN6B 3IWBA 4LF5E 4O43A 2DSYA 1UBDC 5LLQA 3C4TA 4O24A 2YU8A 3HXLA 2UXCE 1BKNA 1PKPA 4FN5A 4DPUA 4JV5I 5IT9Q 1BBGA 3DF6A 3F6HA 4KWYA 2BA0D 2B3TB 2YRKA 2GQ0A 2LTRA 2BA0G 1Z0WA 4YHHE 1TF6A 3THOB 1YUJA 1KVKA 2CVEA 2IESA 1NZ0A 3CDIA 2A25A 2C37A 1F2IG 2ZM6I 4DV4I 1A1KA 1X6EA 4U3BA 3T1HI 1H72C 3AUZA 4DV3E 4P7DA 2BA1G 3J80Q 3Q1QA 5TSEA 4LF9I 2ODRC 1ZM9A 2VE7C 4ZYHA 1S16A 3OTOE 1EH7A 2E5LE 4DV0E 3L7ZA 2YTEA 1IQSA 4BA2B 1VI7A 5KL6A 4HACA 2WNRB 2R1FA 4R1FA 5K36D 2EMXA 4DR5I 3OMLA 4TUGA 3H4LA 1R6LA 1ZXMA 3BF2A 1P42A 2NN6D 1UDOA 3VHTB 3LLHA 4Z7YA 4IFDE 4MDTA 1YZ9A 1NEIA 3L00A 2RSIA 2EM5A 3V5RA 2UUCE 4B3TI 2BM0A 1XMOE 2VRDA 3PS2A 4DPYA 2JE6B 2GO3A 5C0XE 3GCMA 5JEAF 3F6GA 1KJKA 4R2EA 4DR5E 3M7NG 2V8QB 3OTOI 3M6AA 1UDQA 4LF9E 4Q35B 2A2DA 3ECRA 4M1KA 1FWKA 1J26A 2KONA 3ADGA 4ZYGA 4TUIA 1EH8A 4KQVA 2Q8UA 1ZAAC 4DV4E 4X62I 2I9IA 2EPRA 4JI1I 2UXBE 2EOFA 2Z5EA 1T4LB 4PRXA 1Z5CA 1HNWE 2VQEE 4DUZI 4BHBA 2EOSA 4I3HA 4K0KI 4R03A 4FW4A 2LJHA 5JEAE 1Y6ZA 3LMLA 4X64E 5LMUI 4LF8E 4IZKA 4AQYI 2JVAA 4HEIA 4R2PA 2CG9A 2GLIA 1NHHA 4NXNI 5AE2A 2UUBI 3HPSA 4DUYI 4NXMI 2L2KB 4IFDF 2EMWA 4DR1I 3EPKA 2PNZB 1H7SA 2VQFE 3UK3C 3LNUA 1MG7A 2F4VE 2EZ6A 4X66E 2F1DA 4M30A 4OO1A 2E72A 2UU9I 1B63A 2EM2A 2FV4B 3GLLA 4F9AB 1WXRA 2MDGA 1FNMA 5K36C 1Z5AA 5F3WA 2DLQA 3ZM7A 2EOJA 2HHHI 2HK2A 3VK6A 5A2QQ 3MSWA 2JYAA 3EPJA 4F54A 2UXDE 2WW4A 4JG4A 3EQ1A 2L2NA 1MX0A 2PO2B 2HFUA 3L7ZB 4DV1E 5K36F 3J7AM 4ZYEA 4YY3E 1J5EI 4IJDA 2MDRA 1H74A 2HJJA 1EH6A 2Z5CB 3PYFA 4F2JC 2JEBA 4MYUA 5EKWA 1UDSA 4LCHA 1Z0EA 3J7Yp 2PNMA 3GONA 1WJPA 4MYTA 2YWQA 5C0XA 4QNKA 1T4OA 2HGHA 3HKMA 4OO1B 1WUUA 1YFHA 4DR4E 1ELOA 4JI5I 2EPLX 1JK1A 2DRPA 2C39A 4R2QA 4MU3A 1FI4A 4B3RI 1EKZA 4X66I 1PJQA 4IS1C 2EPZA 1X3CA 3CDJA 3P3EA 1SFEA 1FKAE 2VQFI 1KKHA 1YH8A 2LTSA 2YSOA 3HQ1A 4JI4E 2K4VA 2C37B 2G7HA 3PYGA 4DU7A 4NXNE 4HXZA 3P3GA 3JAMQ 1YYWA 1G2FC 5FWKA 2L6MA 2EN1A 2EPMX 1ZBTA 3NZKA 2BR2B 4GQUA 2ENAA 2JY9A 3ADJA 3JU0A 2EM0A 2ENCA 2BA1D 2V85A 4LCGA 4X64I 4DR6I 5A6JA 4JI8I 1D6TA 2EL4A 3PYDA 4MU1A 4NBQA 2JWOA 3DJWA 5IWAE 1N0UA 1OYSA 4JYAI 3KZYA 2VQEI 3T1YI 4GZNC 2EMHA 1LLMC 1I94E 1USUA 1YPNA 4DV6E 2C39B 1ZBQA 3QT5A 3U1YA 4LFAI 2MC5A 2HKJA 1RHYA 4F9BB 4X62E 2OI2A 4B3ME 1EI1A 2EP3A 2CTDA 4BMJA 1DI2A 4IFDB 4OO1D 2DEJA 4BA1A 4LF7I 2EOMA 4URLA 1DQ3A 2EM8A 1H7UA 2PO1A 1QU6A 2ELYA 4LFBE 3J81C 1Y4UA 1ZM4A 3CWVA 3HULA 4N3OA 4JI2I 4I8OA 4USKA 5BR8I 4GEQB 4IFDC 1E3HA 1A1GA 2EMYA 2EM9A 5A6BA 1IQOA 1A1JA 1ZR9A 3QG5C 2LRSA 2WCC3 3K6QA 2EPPA 2V87A 1RC7A 2BM1A 2DEIA 2J7KA 4LOMA 4WUCA 4UTGA 4R2RA 4LF7E 2WBUA 4P52A 4DV7I 2BBGA 2ADRA 2EMAA 2EMKA 5A2QC 2HFSA 2V34A 2AE8A 1TN9A 2Z5BA 1QNTA 2CPNA 3DD6A 1HR0I 2EOEA 4DR7E 4DV6I 2RQLA 1N33E 4IFDA 4HTGA 4XTJA 2ELZA 3MHHC 1WRJA 2DMYA 4R2DA 1AAYA 3KRNA 4WXDA 4BHCA 3ADLA 1K47A 3BBGA 4IFDD 2FTXB 4WSGA 4DKKA 4DR6E 1YYOA 2V2ZA 5CFFE 1Z0TA 1IBKI 2DB2A 4LF4I 5DROA 4BA2A 2B7TA 4DV3I 2EMGA 4JI0E 2WP8B 3B4TA 5C0XB 4LFCI 2ZM6E 3KZZA 5ADZA 3HPZA 4MLVA 1A6FA 2XEXA 4OZEA 2PO0A 3BGHA 2WZOA 2LVHA 4LTYA 2O1WA 2R42A 1N32I 4ED4A 1GZ6A 4L5NC 3B82A 4DR2I 4AM3A 4O5GA 2CZ9A 4LPFA 1A1IA 2J65A 4P7AA 5KL5A 2L33A 2EN6A 1N32E 1PJTA 2PO1B 2DMIA 1UILA 4FW9A 4UT4A 1N34E 3ZKDA 5DRQA 2EL6A 2ZITA 2L2MA 4YY3I 5AC4A 2JEBB 2NUGA 4ISAA 4NHRA 4DV1I 4JI3I 2CGEA 2YTNA 4FWHA 2UXDI 4PRVA 1PJSA 2EMIA 2DGCA 5JEAC 2LV2A 1IBKE 3PS1A 4OO1F 4F9CB 2EORA 2R76A 1ZM2A 5C0XD 5IXMB 3C6MA 2CSHA 4FWGA 4ZVIA 2VESA 1NCSA 1YYKA 3J81Q 4DV2E 2O1VA 1N36E 3BIDA 2F4VI 2F8BA 4FK5C 5DRRA 1N33I 2YTFA 2C38A 4J3DA 1UDNA 4FW3A 1N3GA 2R3VA 4DUYE 2VF3A 1DARA 2LUPB 3ZOQB 3IWDA 1RMDA 2N3GA 1WHQA 4DV7E 1NHJA 4J8ZA 2EMZA 1U2RA 2Q2EB 4AIDA 1FJGI 3ZKBA 2BR2A 3MHSC 1A1FA 2IERA 1SR9A 1XXEA 2LCEA 5DNYA 4Z7CA 5AASA 2GPIA 5A6AA 1B69A 3B8HA 3V2UC 1X47A 2YTGA 2KHXA 5FLXC 4LCFA 1RQ0A 5KL3A 4M9VC 2EM6A 2CT1A 2ODRD 2EQ1A 4B3SI 2HKEA 5DNXA 3WU5A 4DXLA 2UXBI 2HC5A 4USMA 5LMNI 4DV5I 1HNXI 2RSMA 2K7IA 1XNRE 2C38B 2EMCA 1OYPA 3PS3A 2X7IA 4B3MI 1HNXE 1X5WA 2EOYA 2EPCA 4R2AA 5LMNE 4DV5E 3KWRA 3P3CA 1YSAC 4LFAE 1FWLA 4PU9A 2B9DA 4BA1B 2E1RA 3U1KA 3D4JA 4WUDA 3M85G 4WPYA 2M7QA 2EN2A 2BV3A 2EMLA 2IOQA 3WU3A 5AE1A 4JYAE 2DLKA 2GO4A 5IWAI 1Y60A 3C4BA 5IV8B 2V88A 2EL5A 4JI6E 3M7ND 2YSPA 2GHFA 5A69A 2M1SA 3JAMC 2IOPA 4WYQB 4MLQA 3J7AG 4LFBI 1L4SA 2NN6E 2PNZA 4HACB 2V8PA 2EE8A 4B3TE 2UUCI 2JR1A 4JI4I 1R6MA 4FW6A 2BB8A 3FIGA 3LTOA 4X65E 1A1HA 4IZJA 4WXCA 2EPNA 4B3RE 3F0NA 4NZVA 2D9HA 2JE6A 4RPFA 2E5LI 1UHZA 5KL4A 1E3PA 4MU0A 2YTIA 4R8OA 2YRMA 5DNLA 3ZZ0A 2B7VA 3T1HE 1PVGA 4L8NA 4O4KA 2EM3A 4DU8A 5IT9C 2EN8A 5JEAA 2EPAA 4YHHI 2PO0B 2EN4A 2NN6C 2JXPA 1X49A 1JK2A 1DGCA 4LF6E 3HTXA 1USVA 5A6BD 1ZXNA 2WNRA 5L3JA 1N0VC 1BB8A 1H73A 1MEYC 2NUEA 1ZM3A 2MC6A 2MKNA 2EOOA 3P76A 4HYMA 1Z0GA 2YRHA 1STUA 1PDAA 2A2CA 4U3DA 2RS6A 4JI7I 3ADIA 2EN7A 4R2SA 1YUIA 4OX9E 3ZZUA 2JOXA 3J80C 3AV0A 2O1UA 4DR2E 2NUFA 4GKJI 2EWLA 4MU4A 5LL6R 2NA2A 3PRYA 1T38A 4GKKI 1TF3A 3GMEA 1RR9A 3IWCA 4NXME 4AIMA 2EOZA 4HY1A 2L3CA 2UUBE 4LFCE 2EPKX 2JEAA 4KZSA 1X6FA 3HJCA 4GKKE 4JI0I 4F6MA 4GKJE 4LF4E 2EFGA 4LF8I 4IS9A 1OYRA 3Q6MA 4OX9I 4P78A 2UUAE 4BBYA 4JI7E 2NN6F 2M4IA 4DMIA 1Y4SA 5C0XC 1YHCA 4K0KE 4WUBA 1GQEA 2EOXA 5A6KA 4DUZE 3RMPA 2LO3A 4LU9A 1KIJA 2HK3A 2JEAB 1HNWI 4DR3E 1Y5YA 1XMQI 4WX9A 4LF6I 4DR7I 1IBME 4JI1E 1NHIA 1HR0E 4FW7A 4FWDA 2E1MA 2EPXA 5C0XF 1HNZI 1T4NA 4Q28A 2YU5A 2L92A 1X48A 2JPAA 2EN3A 4M2ZA 2V2QA 2FGGA 2L3JA 3THNA 2RPCA 3ZZTA 4IZKB 2LT7A 2J7JA 4N4RB 5AC5A 2VF1A 2V2VA 5BR8E 4JI2E 2MKDA 4X65I 1Z0CA 1PIEA 4KHPE 2NN6A 1ZU1A 1AH5A 2IHR1
chains in the Genus database with same CATH topology
3WU4A 4IZJB 1XMOI 2Z5BB 4BS9A 3QT6A 3VYXA 2RS7A 4DPTA 2YT4A 2V89A 2LBSB 3P06A 2PNLA 1I94I 4JI6I 1HK7A 3T1YE 1B62A 2O1TA 1Z0BA 3LPSA 1WHNA 1Z5BA 2AJ4A 3JTZA 1RREA 3K1JA 3QT7A 2X36A 4DV0I 1QZRA 4JI8E 1MU5A 3Q6NA 3P1XA 1XNRI 3WU6A 3K17A 5GMEA 5FLXQ 4KHPI 1Z0VA 4B3SE 2GS8A 2KOUA 3K85A 2L8TA 1KTVA 4OOGC 4JV5E 4IZJD 3B78A 4JI5E 4DR4I 2UXCI 2LJPA 4X8WA 2RTXA 4LF5I 2ZBKB 3QT8A 5AE3A 4BC9A 2H36X 4BC7A 1FJGE 2DIXA 4EMDA 2LUQA 1HNZE 2V86A 2N3HA 1Z59A 1J5EE 5GMDA 4BCAA 4DPWA 1IBMI 1EA6A 1XMQE 2V83A 3VYYA 4DR3I 4DV2I 1N36I 4M0VA 4WSPA 1XNQE 2LMZA 2HHHE 2YZTA 1IBLI 1IBLE 2UUAI 1S4EA 2LE2A 1XNQI 2UU9E 1XHKA 2JOBA 4DPXA 1UEKA 3PYEA 4JI3E 4WFTA 4DR1E 1O0WA 1OJ4A 1VISA 1N34I 5T6JA 2Z5CA 2NPFA 4AQYE 3H09A 5LMUE 3IWBA 4LF5E 2DSYA 3C4TA 2UXCE 1BKNA 3HXLA 4FN5A 4DPUA 1PKPA 4JV5I 5IT9Q 3DF6A 3F6HA 2GQ0A 2B3TB 2LTRA 1Z0WA 4YHHE 1KVKA 1NZ0A 4DV4I 2ZM6I 3T1HI 1H72C 3AUZA 4DV3E 4P7DA 3J80Q 3Q1QA 4LF9I 2ODRC 1ZM9A 2VE7C 1S16A 4FWGA 3OTOE 2E5LE 4DV0E 4HACA 4R1FA 4DR5I 3OMLA 4TUGA 3H4LA 1ZXMA 4Z7YA 3LLHA 1YZ9A 3V5RA 2UUCE 4B3TI 2BM0A 1XMOE 4DPYA 3F6GA 4DR5E 2V8QB 3OTOI 3M6AA 4LF9E 2A2DA 4M1KA 1FWKA 1J26A 2KONA 3ADGA 4TUIA 4X62I 4KQVA 4DV4E 4JI1I 2UXBE 2Z5EA 1T4LB 4PRXA 1Z5CA 1HNWE 2VQEE 4DUZI 4I3HA 4K0KI 4R03A 2LJHA 1Y6ZA 3LMLA 4X64E 5LMUI 4LF8E 4IZKA 4AQYI 2JVAA 2CG9A 1NHHA 4NXNI 5AE2A 2UUBI 3HPSA 4DUYI 4NXMI 2L2KB 4DR1I 1H7SA 2VQFE 3LNUA 1MG7A 2F4VE 2EZ6A 4X66E 4M30A 2UU9I 1B63A 2FV4B 4F9AB 1WXRA 1FNMA 1Z5AA 5F3WA 3ZM7A 2HHHI 2HK2A 3VK6A 5A2QQ 3MSWA 4F54A 2UXDE 2WW4A 4JG4A 2L2NA 1MX0A 2HFUA 4DV1E 3J7AM 4YY3E 1J5EI 2MDRA 1H74A 4MYUA 2Z5CB 3PYFA 1Z0EA 3J7Yp 2PNMA 3GONA 4MYTA 1T4OA 1WUUA 4DR4E 1ELOA 4JI5I 1FI4A 4B3RI 1EKZA 4X66I 2VQFI 1FKAE 1KKHA 2LTSA 3HQ1A 4JI4E 2K4VA 3PYGA 2G7HA 4DU7A 4NXNE 4HXZA 3JAMQ 5FWKA 1YYWA 2L6MA 1ZBTA 3JU0A 2JY9A 3ADJA 1D6TA 2V85A 4X64I 4DR6I 4JI8I 3PYDA 2JWOA 3DJWA 5IWAE 1N0UA 4JYAI 2VQEI 3T1YI 1USUA 1I94E 4DV6E 1ZBQA 3QT5A 4LFAI 2MC5A 2HKJA 4F9BB 4X62E 2OI2A 4B3ME 1EI1A 1DI2A 4BMJA 2DEJA 4LF7I 4URLA 1DQ3A 1H7UA 1QU6A 4LFBE 1ZM4A 3J81C 1Y4UA 3CWVA 3HULA 4N3OA 4JI2I 4I8OA 4USKA 5BR8I 4GEQB 2LRSA 3K6QA 2V87A 2BM1A 1RC7A 2DEIA 2J7KA 4WUCA 4UTGA 4LF7E 4P52A 4DV7I 5A2QC 2HFSA 2V34A 2Z5BA 1HR0I 2CPNA 4DV6I 4DR7E 1N33E 4XTJA 2DMYA 3ADLA 1K47A 2FTXB 4DKKA 2V2ZA 4DR6E 1YYOA 5CFFE 1Z0TA 1IBKI 2DB2A 4LF4I 2B7TA 4DV3I 4JI0E 4LFCI 2ZM6E 5ADZA 3HPZA 1A6FA 2XEXA 2R42A 2WZOA 4LTYA 2O1WA 1N32I 4ED4A 1GZ6A 4L5NC 3B82A 4DR2I 2CZ9A 4P7AA 2L33A 1N32E 1UILA 4FW9A 4UT4A 1N34E 3ZKDA 2ZITA 2L2MA 4YY3I 4JI3I 2NUGA 4DV1I 2CGEA 4FWHA 2UXDI 4PRVA 1IBKE 4F9CB 1ZM2A 4ZVIA 1YYKA 3J81Q 4DV2E 2O1VA 1N36E 2F4VI 2F8BA 1N33I 2R3VA 4DUYE 2VF3A 1DARA 2LUPB 3IWDA 3ZOQB 2N3GA 1U2RA 1WHQA 4DV7E 4J8ZA 1NHJA 2Q2EB 1FJGI 3ZKBA 1SR9A 5DNYA 4Z7CA 5AASA 3B8HA 3V2UC 1X47A 2KHXA 5FLXC 1RQ0A 4B3SI 2ODRD 2HKEA 3WU5A 4DXLA 2UXBI 4USMA 5LMNI 4DV5I 1HNXI 2RSMA 1XNRE 2X7IA 4B3MI 1HNXE 5LMNE 4DV5E 3KWRA 4LFAE 1FWLA 4PU9A 2B9DA 2E1RA 3D4JA 4WUDA 4WPYA 2M7QA 2BV3A 2IOQA 3WU3A 5AE1A 4JYAE 5IWAI 3C4BA 2V88A 4JI6E 2M1SA 3JAMC 2IOPA 4WYQB 4LFBI 3J7AG 4HACB 2V8PA 4B3TE 2UUCI 2JR1A 4JI4I 3FIGA 3LTOA 4X65E 4IZJA 4B3RE 3F0NA 4RPFA 2E5LI 1UHZA 4R8OA 3ZZ0A 2B7VA 3T1HE 1PVGA 4L8NA 4DU8A 5IT9C 4YHHI 1ZXNA 1X49A 4LF6E 1USVA 3HTXA 5L3JA 1N0VC 1H73A 1ZM3A 2NUEA 4HYMA 2MC6A 1Z0GA 1STUA 2A2CA 2RS6A 4JI7I 3ADIA 3ZZUA 4OX9E 2JOXA 3J80C 3AV0A 2O1UA 4DR2E 2NUFA 4GKJI 2EWLA 5LL6R 2NA2A 3PRYA 4GKKI 1RR9A 3IWCA 4NXME 4HY1A 2L3CA 2UUBE 4LFCE 4KZSA 3HJCA 4JI0I 4GKKE 4GKJE 4LF4E 2EFGA 4LF8I 3Q6MA 4OX9I 4P78A 2UUAE 4BBYA 4JI7E 2M4IA 4DMIA 1Y4SA 4K0KE 4WUBA 1GQEA 4DUZE 3RMPA 2HK3A 1HNWI 4LU9A 1KIJA 4DR3E 1XMQI 4LF6I 4DR7I 1IBME 4JI1E 1NHIA 1HR0E 4FWDA 2E1MA 1HNZI 1T4NA 4Q28A 2L92A 1X48A 4M2ZA 2V2QA 2FGGA 2L3JA 3ZZTA 4IZKB 2VF1A 2V2VA 5BR8E 4JI2E 4X65I 1Z0CA 1PIEA 4KHPE 2IHR1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU4 A;  1XMO I;  3QT6 A;  3VYX A;  2RS7 A;  4DPT A;  2YT4 A;  2LBS B;  1I94 I;  4JI6 I;  3T1Y E;  1B62 A;  1Z0B A;  3LPS A;  1WHN A;  1Z5B A;  2AJ4 A;  1RRE A;  3K1J A;  3QT7 A;  2X36 A;  4DV0 I;  1QZR A;  4JI8 E;  1MU5 A;  3P1X A;  1XNR I;  3WU6 A;  3K17 A;  5GME A;  5FLX Q;  4KHP I;  1Z0V A;  4B3S E;  2GS8 A;  1KTV A;  4OOG C;  4JV5 E;  3B78 A;  4JI5 E;  4DR4 I;  2UXC I;  2LJP A;  4X8W A;  2RTX A;  4LF5 I;  2ZBK B;  3QT8 A;  1FJG E;  2DIX A;  4EMD A;  2LUQ A;  1HNZ E;  1Z59 A;  2N3H A;  1J5E E;  5GMD A;  4DPW A;  1IBM I;  1EA6 A;  1XMQ E;  3VYY A;  4DR3 I;  1N36 I;  4DV2 I;  1XNQ E;  2HHH E;  1IBL I;  1IBL E;  2UUA I;  1S4E A;  1XNQ I;  2UU9 E;  1XHK A;  4DPX A;  1UEK A;  3PYE A;  4JI3 E;  4WFT A;  4DR1 E;  1O0W A;  1OJ4 A;  1VIS A;  1N34 I;  2NPF A;  4AQY E;  5LMU E;  4LF5 E;  3C4T A;  2UXC E;  1BKN A;  4DPU A;  4FN5 A;  1PKP A;  4JV5 I;  5IT9 Q;  2B3T B;  2LTR A;  1Z0W A;  4YHH E;  1KVK A;  1NZ0 A;  4DV4 I;  2ZM6 I;  3T1H I;  1H72 C;  4DV3 E;  3J80 Q;  3Q1Q A;  4LF9 I;  1ZM9 A;  4FWG A;  1S16 A;  3OTO E;  2E5L E;  4DV0 E;  4HAC A;  4R1F A;  4DR5 I;  3H4L A;  1ZXM A;  4Z7Y A;  3LLH A;  1YZ9 A;  3V5R A;  2UUC E;  4B3T I;  2BM0 A;  1XMO E;  4DPY A;  4DR5 E;  3OTO I;  3M6A A;  4LF9 E;  2A2D A;  4M1K A;  1FWK A;  1J26 A;  3ADG A;  4X62 I;  4KQV A;  4DV4 E;  4JI1 I;  2UXB E;  1T4L B;  4PRX A;  1Z5C A;  1HNW E;  2VQE E;  4DUZ I;  4I3H A;  4K0K I;  2LJH A;  4X64 E;  5LMU I;  4LF8 E;  4AQY I;  2JVA A;  1NHH A;  4NXN I;  2UUB I;  4DUY I;  4NXM I;  2L2K B;  4DR1 I;  1H7S A;  3LNU A;  2VQF E;  1MG7 A;  2F4V E;  2EZ6 A;  4X66 E;  4M30 A;  2UU9 I;  1B63 A;  1FNM A;  1Z5A A;  3ZM7 A;  2HHH I;  2HK2 A;  5A2Q Q;  2UXD E;  2WW4 A;  4JG4 A;  2L2N A;  1MX0 A;  2HFU A;  4DV1 E;  3J7A M;  4YY3 E;  1J5E I;  2MDR A;  1H74 A;  4MYU A;  3PYF A;  1Z0E A;  3J7Y p;  3GON A;  4MYT A;  1T4O A;  1WUU A;  4DR4 E;  1ELO A;  4JI5 I;  1FI4 A;  4B3R I;  1EKZ A;  4X66 I;  2VQF I;  1FKA E;  1KKH A;  2LTS A;  3PYG A;  4JI4 E;  4DU7 A;  4NXN E;  4HXZ A;  3JAM Q;  1YYW A;  1ZBT A;  2JY9 A;  3ADJ A;  1D6T A;  4X64 I;  4DR6 I;  4JI8 I;  3PYD A;  5IWA E;  1N0U A;  4JYA I;  2VQE I;  3T1Y I;  1I94 E;  4DV6 E;  3QT5 A;  4LFA I;  2HKJ A;  4X62 E;  2OI2 A;  4B3M E;  1EI1 A;  1DI2 A;  2DEJ A;  4LF7 I;  4URL A;  1H7U A;  1QU6 A;  4LFB E;  1ZM4 A;  3J81 C;  3CWV A;  3HUL A;  4JI2 I;  4USK A;  5BR8 I;  2LRS A;  2BM1 A;  1RC7 A;  2DEI A;  2J7K A;  4WUC A;  4UTG A;  4LF7 E;  4P52 A;  4DV7 I;  2HFS A;  5A2Q C;  2V34 A;  1HR0 I;  2CPN A;  4DV6 I;  4DR7 E;  1N33 E;  4XTJ A;  2DMY A;  3ADL A;  1K47 A;  4DKK A;  2V2Z A;  4DR6 E;  1YYO A;  5CFF E;  1Z0T A;  1IBK I;  2DB2 A;  4LF4 I;  2B7T A;  4DV3 I;  4JI0 E;  4LFC I;  2ZM6 E;  1A6F A;  2XEX A;  2R42 A;  1N32 I;  4ED4 A;  3B82 A;  4DR2 I;  2CZ9 A;  4P7A A;  2L33 A;  1N32 E;  1UIL A;  4FW9 A;  4UT4 A;  1N34 E;  3ZKD A;  2ZIT A;  2L2M A;  4YY3 I;  4JI3 I;  2NUG A;  4DV1 I;  4FWH A;  2UXD I;  4PRV A;  1IBK E;  1ZM2 A;  4ZVI A;  1YYK A;  3J81 Q;  4DV2 E;  1N36 E;  2F4V I;  1N33 I;  2R3V A;  4DUY E;  2VF3 A;  1DAR A;  2LUP B;  2N3G A;  1WHQ A;  4DV7 E;  1NHJ A;  1U2R A;  2Q2E B;  1FJG I;  3ZKB A;  4Z7C A;  3B8H A;  3V2U C;  1X47 A;  2KHX A;  5FLX C;  1RQ0 A;  4B3S I;  2HKE A;  3WU5 A;  4DXL A;  2UXB I;  4USM A;  5LMN I;  4DV5 I;  1HNX I;  2RSM A;  1XNR E;  2X7I A;  4B3M I;  1HNX E;  5LMN E;  4DV5 E;  4LFA E;  1FWL A;  4PU9 A;  2E1R A;  3D4J A;  4WUD A;  2BV3 A;  3WU3 A;  4JYA E;  5IWA I;  3C4B A;  4JI6 E;  3JAM C;  4WYQ B;  4LFB I;  3J7A G;  4HAC B;  2V8P A;  4B3T E;  2UUC I;  4JI4 I;  3LTO A;  4X65 E;  4B3R E;  3F0N A;  4RPF A;  2E5L I;  1UHZ A;  3ZZ0 A;  2B7V A;  3T1H E;  1PVG A;  4DU8 A;  5IT9 C;  4YHH I;  1ZXN A;  1X49 A;  4LF6 E;  3HTX A;  5L3J A;  1N0V C;  1H73 A;  1ZM3 A;  2NUE A;  4HYM A;  1Z0G A;  1STU A;  2A2C A;  2RS6 A;  4JI7 I;  3ADI A;  3ZZU A;  4OX9 E;  3J80 C;  4DR2 E;  2NUF A;  4GKJ I;  5LL6 R;  2NA2 A;  4GKK I;  1RR9 A;  4NXM E;  4HY1 A;  2L3C A;  2UUB E;  4LFC E;  4JI0 I;  4GKK E;  4GKJ E;  4LF4 E;  2EFG A;  4LF8 I;  4OX9 I;  2UUA E;  4JI7 E;  4K0K E;  4WUB A;  1GQE A;  4DUZ E;  2HK3 A;  1HNW I;  1KIJ A;  4DR3 E;  1XMQ I;  4LF6 I;  4DR7 I;  1IBM E;  4JI1 E;  4FWD A;  1HR0 E;  1NHI A;  1HNZ I;  1T4N A;  1X48 A;  4M2Z A;  2V2Q A;  2L3J A;  3ZZT A;  2V2V A;  5BR8 E;  4JI2 E;  4X65 I;  1Z0C A;  1PIE A;  4KHP E;  2IHR 1; 
#chains in the Genus database with same CATH topology
 1BBO A;  4MQY A;  3WU4 A;  3EPL A;  4IZJ B;  1XMO I;  2O3Z A;  4BS9 A;  2EM4 A;  4X9J A;  2Z5B B;  2NAB A;  2EJ4 A;  3VYX A;  3QT6 A;  2EMF A;  2RS7 A;  4DPT A;  2YT4 A;  2YPN A;  2V89 A;  2LBS B;  2PRT A;  2PNL A;  3P06 A;  1I94 I;  1P47 A;  4JI6 I;  1HK7 A;  3T1Y E;  1B62 A;  2O1T A;  1IMU A;  5KL7 A;  1Z0B A;  3LPS A;  3C6K A;  1WHN A;  1Z5B A;  2AJ4 A;  3JTZ A;  3TQM A;  1RRE A;  3K1J A;  3QT7 A;  2X36 A;  4F6N A;  1QZR A;  1UN6 B;  4JI8 E;  4QNJ A;  3UHM A;  5JEA D;  3EPH A;  1GTK A;  1MU5 A;  5K36 E;  2EQ3 A;  3Q6N A;  3M99 B;  3P1X A;  1XNR I;  3WU6 A;  3K17 A;  5GME A;  2LJU A;  5FLX Q;  4KHP I;  4ZYD A;  3M85 D;  1Z0V A;  4B3S E;  1KYQ A;  2KOU A;  2YTP A;  2GS8 A;  3K85 A;  2L8T A;  1KTV A;  4OOG C;  4JV5 E;  4IZJ D;  3B78 A;  2N8X A;  4JI5 E;  5EL9 A;  4DR4 I;  2UXC I;  2LJP A;  4X8W A;  1T39 A;  3H1C A;  2RTX A;  4LF5 I;  2ZBK B;  3QT8 A;  5DRP A;  5AE3 A;  4BC9 A;  2H36 X;  1MGT A;  2JT2 A;  5K36 A;  4BC7 A;  1FJG E;  2DIX A;  2WBS A;  2EOH A;  2LUQ A;  4EMD A;  4R2C A;  2JP9 A;  1HNZ E;  2V86 A;  2N3H A;  1Z59 A;  4OO1 C;  2EOI A;  1J5E E;  5GMD A;  4BCA A;  2EPU A;  2YTO A;  1Z1B A;  4DPW A;  2EQ0 A;  1IBM I;  2I13 A;  5KL2 A;  1X6H A;  1XMQ E;  2ENH A;  2V83 A;  3VYY A;  1EA6 A;  5JEA B;  4DV2 I;  4DR3 I;  1N36 I;  4M0V A;  4WSP A;  2YTD A;  1XNQ E;  2LMZ A;  2HHH E;  2YZT A;  2M9A A;  2YTQ A;  1IBL I;  1IBL E;  5ELW A;  2UUA I;  2EM7 A;  4OO1 E;  2EOQ A;  2LE2 A;  1S4E A;  1XNQ I;  2UU9 E;  1XHK A;  2JOB A;  4DPX A;  1UEK A;  4DV0 I;  2WBT A;  2EPO A;  3PYE A;  4JI3 E;  4WFT A;  2PO2 A;  4DR1 E;  2WP8 A;  1O0W A;  2EMB A;  1A1L A;  5K36 B;  1G2D C;  1OJ4 A;  1VIS A;  1N34 I;  5T6J A;  2Z5C A;  4OKG A;  2NPF A;  4FW5 A;  2YTJ A;  4AQY E;  4RH8 A;  3H09 A;  4RHB B;  5LMU E;  2NN6 B;  3IWB A;  4LF5 E;  4O43 A;  2DSY A;  1UBD C;  5LLQ A;  3C4T A;  4O24 A;  2YU8 A;  3HXL A;  2UXC E;  1BKN A;  1PKP A;  4FN5 A;  4DPU A;  4JV5 I;  5IT9 Q;  1BBG A;  3DF6 A;  3F6H A;  4KWY A;  2BA0 D;  2B3T B;  2YRK A;  2GQ0 A;  2LTR A;  2BA0 G;  1Z0W A;  4YHH E;  1TF6 A;  3THO B;  1YUJ A;  1KVK A;  2CVE A;  2IES A;  1NZ0 A;  3CDI A;  2A25 A;  2C37 A;  1F2I G;  2ZM6 I;  4DV4 I;  1A1K A;  1X6E A;  4U3B A;  3T1H I;  1H72 C;  3AUZ A;  4DV3 E;  4P7D A;  2BA1 G;  3J80 Q;  3Q1Q A;  5TSE A;  4LF9 I;  2ODR C;  1ZM9 A;  2VE7 C;  4ZYH A;  1S16 A;  3OTO E;  1EH7 A;  2E5L E;  4DV0 E;  3L7Z A;  2YTE A;  1IQS A;  4BA2 B;  1VI7 A;  5KL6 A;  4HAC A;  2WNR B;  2R1F A;  4R1F A;  5K36 D;  2EMX A;  4DR5 I;  3OML A;  4TUG A;  3H4L A;  1R6L A;  1ZXM A;  3BF2 A;  1P42 A;  2NN6 D;  1UDO A;  3VHT B;  3LLH A;  4Z7Y A;  4IFD E;  4MDT A;  1YZ9 A;  1NEI A;  3L00 A;  2RSI A;  2EM5 A;  3V5R A;  2UUC E;  4B3T I;  2BM0 A;  1XMO E;  2VRD A;  3PS2 A;  4DPY A;  2JE6 B;  2GO3 A;  5C0X E;  3GCM A;  5JEA F;  3F6G A;  1KJK A;  4R2E A;  4DR5 E;  3M7N G;  2V8Q B;  3OTO I;  3M6A A;  1UDQ A;  4LF9 E;  4Q35 B;  2A2D A;  3ECR A;  4M1K A;  1FWK A;  1J26 A;  2KON A;  3ADG A;  4ZYG A;  4TUI A;  1EH8 A;  4KQV A;  2Q8U A;  1ZAA C;  4DV4 E;  4X62 I;  2I9I A;  2EPR A;  4JI1 I;  2UXB E;  2EOF A;  2Z5E A;  1T4L B;  4PRX A;  1Z5C A;  1HNW E;  2VQE E;  4DUZ I;  4BHB A;  2EOS A;  4I3H A;  4K0K I;  4R03 A;  4FW4 A;  2LJH A;  5JEA E;  1Y6Z A;  3LML A;  4X64 E;  5LMU I;  4LF8 E;  4IZK A;  4AQY I;  2JVA A;  4HEI A;  4R2P A;  2CG9 A;  2GLI A;  1NHH A;  4NXN I;  5AE2 A;  2UUB I;  3HPS A;  4DUY I;  4NXM I;  2L2K B;  4IFD F;  2EMW A;  4DR1 I;  3EPK A;  2PNZ B;  1H7S A;  2VQF E;  3UK3 C;  3LNU A;  1MG7 A;  2F4V E;  2EZ6 A;  4X66 E;  2F1D A;  4M30 A;  4OO1 A;  2E72 A;  2UU9 I;  1B63 A;  2EM2 A;  2FV4 B;  3GLL A;  4F9A B;  1WXR A;  2MDG A;  1FNM A;  5K36 C;  1Z5A A;  5F3W A;  2DLQ A;  3ZM7 A;  2EOJ A;  2HHH I;  2HK2 A;  3VK6 A;  5A2Q Q;  3MSW A;  2JYA A;  3EPJ A;  4F54 A;  2UXD E;  2WW4 A;  4JG4 A;  3EQ1 A;  2L2N A;  1MX0 A;  2PO2 B;  2HFU A;  3L7Z B;  4DV1 E;  5K36 F;  3J7A M;  4ZYE A;  4YY3 E;  1J5E I;  4IJD A;  2MDR A;  1H74 A;  2HJJ A;  1EH6 A;  2Z5C B;  3PYF A;  4F2J C;  2JEB A;  4MYU A;  5EKW A;  1UDS A;  4LCH A;  1Z0E A;  3J7Y p;  2PNM A;  3GON A;  1WJP A;  4MYT A;  2YWQ A;  5C0X A;  4QNK A;  1T4O A;  2HGH A;  3HKM A;  4OO1 B;  1WUU A;  1YFH A;  4DR4 E;  1ELO A;  4JI5 I;  2EPL X;  1JK1 A;  2DRP A;  2C39 A;  4R2Q A;  4MU3 A;  1FI4 A;  4B3R I;  1EKZ A;  4X66 I;  1PJQ A;  4IS1 C;  2EPZ A;  1X3C A;  3CDJ A;  3P3E A;  1SFE A;  1FKA E;  2VQF I;  1KKH A;  1YH8 A;  2LTS A;  2YSO A;  3HQ1 A;  4JI4 E;  2K4V A;  2C37 B;  2G7H A;  3PYG A;  4DU7 A;  4NXN E;  4HXZ A;  3P3G A;  3JAM Q;  1YYW A;  1G2F C;  5FWK A;  2L6M A;  2EN1 A;  2EPM X;  1ZBT A;  3NZK A;  2BR2 B;  4GQU A;  2ENA A;  2JY9 A;  3ADJ A;  3JU0 A;  2EM0 A;  2ENC A;  2BA1 D;  2V85 A;  4LCG A;  4X64 I;  4DR6 I;  5A6J A;  4JI8 I;  1D6T A;  2EL4 A;  3PYD A;  4MU1 A;  4NBQ A;  2JWO A;  3DJW A;  5IWA E;  1N0U A;  1OYS A;  4JYA I;  3KZY A;  2VQE I;  3T1Y I;  4GZN C;  2EMH A;  1LLM C;  1I94 E;  1USU A;  1YPN A;  4DV6 E;  2C39 B;  1ZBQ A;  3QT5 A;  3U1Y A;  4LFA I;  2MC5 A;  2HKJ A;  1RHY A;  4F9B B;  4X62 E;  2OI2 A;  4B3M E;  1EI1 A;  2EP3 A;  2CTD A;  4BMJ A;  1DI2 A;  4IFD B;  4OO1 D;  2DEJ A;  4BA1 A;  4LF7 I;  2EOM A;  4URL A;  1DQ3 A;  2EM8 A;  1H7U A;  2PO1 A;  1QU6 A;  2ELY A;  4LFB E;  3J81 C;  1Y4U A;  1ZM4 A;  3CWV A;  3HUL A;  4N3O A;  4JI2 I;  4I8O A;  4USK A;  5BR8 I;  4GEQ B;  4IFD C;  1E3H A;  1A1G A;  2EMY A;  2EM9 A;  5A6B A;  1IQO A;  1A1J A;  1ZR9 A;  3QG5 C;  2LRS A;  2WCC 3;  3K6Q A;  2EPP A;  2V87 A;  1RC7 A;  2BM1 A;  2DEI A;  2J7K A;  4LOM A;  4WUC A;  4UTG A;  4R2R A;  4LF7 E;  2WBU A;  4P52 A;  4DV7 I;  2BBG A;  2ADR A;  2EMA A;  2EMK A;  5A2Q C;  2HFS A;  2V34 A;  2AE8 A;  1TN9 A;  2Z5B A;  1QNT A;  2CPN A;  3DD6 A;  1HR0 I;  2EOE A;  4DR7 E;  4DV6 I;  2RQL A;  1N33 E;  4IFD A;  4HTG A;  4XTJ A;  2ELZ A;  3MHH C;  1WRJ A;  2DMY A;  4R2D A;  1AAY A;  3KRN A;  4WXD A;  4BHC A;  3ADL A;  1K47 A;  3BBG A;  4IFD D;  2FTX B;  4WSG A;  4DKK A;  4DR6 E;  1YYO A;  2V2Z A;  5CFF E;  1Z0T A;  1IBK I;  2DB2 A;  4LF4 I;  5DRO A;  4BA2 A;  2B7T A;  4DV3 I;  2EMG A;  4JI0 E;  2WP8 B;  3B4T A;  5C0X B;  4LFC I;  2ZM6 E;  3KZZ A;  5ADZ A;  3HPZ A;  4MLV A;  1A6F A;  2XEX A;  4OZE A;  2PO0 A;  3BGH A;  2WZO A;  2LVH A;  4LTY A;  2O1W A;  2R42 A;  1N32 I;  4ED4 A;  1GZ6 A;  4L5N C;  3B82 A;  4DR2 I;  4AM3 A;  4O5G A;  2CZ9 A;  4LPF A;  1A1I A;  2J65 A;  4P7A A;  5KL5 A;  2L33 A;  2EN6 A;  1N32 E;  1PJT A;  2PO1 B;  2DMI A;  1UIL A;  4FW9 A;  4UT4 A;  1N34 E;  3ZKD A;  5DRQ A;  2EL6 A;  2ZIT A;  2L2M A;  4YY3 I;  5AC4 A;  2JEB B;  2NUG A;  4ISA A;  4NHR A;  4DV1 I;  4JI3 I;  2CGE A;  2YTN A;  4FWH A;  2UXD I;  4PRV A;  1PJS A;  2EMI A;  2DGC A;  5JEA C;  2LV2 A;  1IBK E;  3PS1 A;  4OO1 F;  4F9C B;  2EOR A;  2R76 A;  1ZM2 A;  5C0X D;  5IXM B;  3C6M A;  2CSH A;  4FWG A;  4ZVI A;  2VES A;  1NCS A;  1YYK A;  3J81 Q;  4DV2 E;  2O1V A;  1N36 E;  3BID A;  2F4V I;  2F8B A;  4FK5 C;  5DRR A;  1N33 I;  2YTF A;  2C38 A;  4J3D A;  1UDN A;  4FW3 A;  1N3G A;  2R3V A;  4DUY E;  2VF3 A;  1DAR A;  2LUP B;  3ZOQ B;  3IWD A;  1RMD A;  2N3G A;  1WHQ A;  4DV7 E;  1NHJ A;  4J8Z A;  2EMZ A;  1U2R A;  2Q2E B;  4AID A;  1FJG I;  3ZKB A;  2BR2 A;  3MHS C;  1A1F A;  2IER A;  1SR9 A;  1XXE A;  2LCE A;  5DNY A;  4Z7C A;  5AAS A;  2GPI A;  5A6A A;  1B69 A;  3B8H A;  3V2U C;  1X47 A;  2YTG A;  2KHX A;  5FLX C;  4LCF A;  1RQ0 A;  5KL3 A;  4M9V C;  2EM6 A;  2CT1 A;  2ODR D;  2EQ1 A;  4B3S I;  2HKE A;  5DNX A;  3WU5 A;  4DXL A;  2UXB I;  2HC5 A;  4USM A;  5LMN I;  4DV5 I;  1HNX I;  2RSM A;  2K7I A;  1XNR E;  2C38 B;  2EMC A;  1OYP A;  3PS3 A;  2X7I A;  4B3M I;  1HNX E;  1X5W A;  2EOY A;  2EPC A;  4R2A A;  5LMN E;  4DV5 E;  3KWR A;  3P3C A;  1YSA C;  4LFA E;  1FWL A;  4PU9 A;  2B9D A;  4BA1 B;  2E1R A;  3U1K A;  3D4J A;  4WUD A;  3M85 G;  4WPY A;  2M7Q A;  2EN2 A;  2BV3 A;  2EML A;  2IOQ A;  3WU3 A;  5AE1 A;  4JYA E;  2DLK A;  2GO4 A;  5IWA I;  1Y60 A;  3C4B A;  5IV8 B;  2V88 A;  2EL5 A;  4JI6 E;  3M7N D;  2YSP A;  2GHF A;  5A69 A;  2M1S A;  3JAM C;  2IOP A;  4WYQ B;  4MLQ A;  3J7A G;  4LFB I;  1L4S A;  2NN6 E;  2PNZ A;  4HAC B;  2V8P A;  2EE8 A;  4B3T E;  2UUC I;  2JR1 A;  4JI4 I;  1R6M A;  4FW6 A;  2BB8 A;  3FIG A;  3LTO A;  4X65 E;  1A1H A;  4IZJ A;  4WXC A;  2EPN A;  4B3R E;  3F0N A;  4NZV A;  2D9H A;  2JE6 A;  4RPF A;  2E5L I;  1UHZ A;  5KL4 A;  1E3P A;  4MU0 A;  2YTI A;  4R8O A;  2YRM A;  5DNL A;  3ZZ0 A;  2B7V A;  3T1H E;  1PVG A;  4L8N A;  4O4K A;  2EM3 A;  4DU8 A;  5IT9 C;  2EN8 A;  5JEA A;  2EPA A;  4YHH I;  2PO0 B;  2EN4 A;  2NN6 C;  2JXP A;  1X49 A;  1JK2 A;  1DGC A;  4LF6 E;  3HTX A;  1USV A;  5A6B D;  1ZXN A;  2WNR A;  5L3J A;  1N0V C;  1BB8 A;  1H73 A;  1MEY C;  2NUE A;  1ZM3 A;  2MC6 A;  2MKN A;  2EOO A;  3P76 A;  4HYM A;  1Z0G A;  2YRH A;  1STU A;  1PDA A;  2A2C A;  4U3D A;  2RS6 A;  4JI7 I;  3ADI A;  2EN7 A;  4R2S A;  1YUI A;  4OX9 E;  3ZZU A;  2JOX A;  3J80 C;  3AV0 A;  2O1U A;  4DR2 E;  2NUF A;  4GKJ I;  2EWL A;  4MU4 A;  5LL6 R;  2NA2 A;  3PRY A;  1T38 A;  4GKK I;  1TF3 A;  3GME A;  1RR9 A;  3IWC A;  4NXM E;  4AIM A;  2EOZ A;  4HY1 A;  2L3C A;  2UUB E;  4LFC E;  2EPK X;  2JEA A;  4KZS A;  1X6F A;  3HJC A;  4GKK E;  4JI0 I;  4F6M A;  4GKJ E;  4LF4 E;  2EFG A;  4LF8 I;  4IS9 A;  1OYR A;  3Q6M A;  4OX9 I;  4P78 A;  2UUA E;  4BBY A;  4JI7 E;  2NN6 F;  2M4I A;  4DMI A;  1Y4S A;  5C0X C;  1YHC A;  4K0K E;  4WUB A;  1GQE A;  2EOX A;  5A6K A;  4DUZ E;  3RMP A;  2LO3 A;  4LU9 A;  1KIJ A;  2HK3 A;  2JEA B;  1HNW I;  4DR3 E;  1Y5Y A;  1XMQ I;  4WX9 A;  4LF6 I;  4DR7 I;  1IBM E;  4JI1 E;  1NHI A;  1HR0 E;  4FW7 A;  4FWD A;  2E1M A;  2EPX A;  5C0X F;  1HNZ I;  1T4N A;  4Q28 A;  2YU5 A;  2L92 A;  1X48 A;  2JPA A;  2EN3 A;  4M2Z A;  2V2Q A;  2FGG A;  2L3J A;  3THN A;  2RPC A;  3ZZT A;  4IZK B;  2LT7 A;  2J7J A;  4N4R B;  5AC5 A;  2VF1 A;  2V2V A;  5BR8 E;  4JI2 E;  2MKD A;  4X65 I;  1Z0C A;  1PIE A;  4KHP E;  2NN6 A;  1ZU1 A;  1AH5 A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 3WU4 A;  4IZJ B;  1XMO I;  2Z5B B;  4BS9 A;  3QT6 A;  3VYX A;  2RS7 A;  4DPT A;  2YT4 A;  2V89 A;  2LBS B;  3P06 A;  2PNL A;  1I94 I;  4JI6 I;  1HK7 A;  3T1Y E;  1B62 A;  2O1T A;  1Z0B A;  3LPS A;  1WHN A;  1Z5B A;  2AJ4 A;  3JTZ A;  1RRE A;  3K1J A;  3QT7 A;  2X36 A;  4DV0 I;  1QZR A;  4JI8 E;  1MU5 A;  3Q6N A;  3P1X A;  1XNR I;  3WU6 A;  3K17 A;  5GME A;  5FLX Q;  4KHP I;  1Z0V A;  4B3S E;  2GS8 A;  2KOU A;  3K85 A;  2L8T A;  1KTV A;  4OOG C;  4JV5 E;  4IZJ D;  3B78 A;  4JI5 E;  4DR4 I;  2UXC I;  2LJP A;  4X8W A;  2RTX A;  4LF5 I;  2ZBK B;  3QT8 A;  5AE3 A;  4BC9 A;  2H36 X;  4BC7 A;  1FJG E;  2DIX A;  4EMD A;  2LUQ A;  1HNZ E;  2V86 A;  2N3H A;  1Z59 A;  1J5E E;  5GMD A;  4BCA A;  4DPW A;  1IBM I;  1EA6 A;  1XMQ E;  2V83 A;  3VYY A;  4DR3 I;  4DV2 I;  1N36 I;  4M0V A;  4WSP A;  1XNQ E;  2LMZ A;  2HHH E;  2YZT A;  1IBL I;  1IBL E;  2UUA I;  1S4E A;  2LE2 A;  1XNQ I;  2UU9 E;  1XHK A;  2JOB A;  4DPX A;  1UEK A;  3PYE A;  4JI3 E;  4WFT A;  4DR1 E;  1O0W A;  1OJ4 A;  1VIS A;  1N34 I;  5T6J A;  2Z5C A;  2NPF A;  4AQY E;  3H09 A;  5LMU E;  3IWB A;  4LF5 E;  2DSY A;  3C4T A;  2UXC E;  1BKN A;  3HXL A;  4FN5 A;  4DPU A;  1PKP A;  4JV5 I;  5IT9 Q;  3DF6 A;  3F6H A;  2GQ0 A;  2B3T B;  2LTR A;  1Z0W A;  4YHH E;  1KVK A;  1NZ0 A;  4DV4 I;  2ZM6 I;  3T1H I;  1H72 C;  3AUZ A;  4DV3 E;  4P7D A;  3J80 Q;  3Q1Q A;  4LF9 I;  2ODR C;  1ZM9 A;  2VE7 C;  1S16 A;  4FWG A;  3OTO E;  2E5L E;  4DV0 E;  4HAC A;  4R1F A;  4DR5 I;  3OML A;  4TUG A;  3H4L A;  1ZXM A;  4Z7Y A;  3LLH A;  1YZ9 A;  3V5R A;  2UUC E;  4B3T I;  2BM0 A;  1XMO E;  4DPY A;  3F6G A;  4DR5 E;  2V8Q B;  3OTO I;  3M6A A;  4LF9 E;  2A2D A;  4M1K A;  1FWK A;  1J26 A;  2KON A;  3ADG A;  4TUI A;  4X62 I;  4KQV A;  4DV4 E;  4JI1 I;  2UXB E;  2Z5E A;  1T4L B;  4PRX A;  1Z5C A;  1HNW E;  2VQE E;  4DUZ I;  4I3H A;  4K0K I;  4R03 A;  2LJH A;  1Y6Z A;  3LML A;  4X64 E;  5LMU I;  4LF8 E;  4IZK A;  4AQY I;  2JVA A;  2CG9 A;  1NHH A;  4NXN I;  5AE2 A;  2UUB I;  3HPS A;  4DUY I;  4NXM I;  2L2K B;  4DR1 I;  1H7S A;  2VQF E;  3LNU A;  1MG7 A;  2F4V E;  2EZ6 A;  4X66 E;  4M30 A;  2UU9 I;  1B63 A;  2FV4 B;  4F9A B;  1WXR A;  1FNM A;  1Z5A A;  5F3W A;  3ZM7 A;  2HHH I;  2HK2 A;  3VK6 A;  5A2Q Q;  3MSW A;  4F54 A;  2UXD E;  2WW4 A;  4JG4 A;  2L2N A;  1MX0 A;  2HFU A;  4DV1 E;  3J7A M;  4YY3 E;  1J5E I;  2MDR A;  1H74 A;  4MYU A;  2Z5C B;  3PYF A;  1Z0E A;  3J7Y p;  2PNM A;  3GON A;  4MYT A;  1T4O A;  1WUU A;  4DR4 E;  1ELO A;  4JI5 I;  1FI4 A;  4B3R I;  1EKZ A;  4X66 I;  2VQF I;  1FKA E;  1KKH A;  2LTS A;  3HQ1 A;  4JI4 E;  2K4V A;  3PYG A;  2G7H A;  4DU7 A;  4NXN E;  4HXZ A;  3JAM Q;  5FWK A;  1YYW A;  2L6M A;  1ZBT A;  3JU0 A;  2JY9 A;  3ADJ A;  1D6T A;  2V85 A;  4X64 I;  4DR6 I;  4JI8 I;  3PYD A;  2JWO A;  3DJW A;  5IWA E;  1N0U A;  4JYA I;  2VQE I;  3T1Y I;  1USU A;  1I94 E;  4DV6 E;  1ZBQ A;  3QT5 A;  4LFA I;  2MC5 A;  2HKJ A;  4F9B B;  4X62 E;  2OI2 A;  4B3M E;  1EI1 A;  1DI2 A;  4BMJ A;  2DEJ A;  4LF7 I;  4URL A;  1DQ3 A;  1H7U A;  1QU6 A;  4LFB E;  1ZM4 A;  3J81 C;  1Y4U A;  3CWV A;  3HUL A;  4N3O A;  4JI2 I;  4I8O A;  4USK A;  5BR8 I;  4GEQ B;  2LRS A;  3K6Q A;  2V87 A;  2BM1 A;  1RC7 A;  2DEI A;  2J7K A;  4WUC A;  4UTG A;  4LF7 E;  4P52 A;  4DV7 I;  5A2Q C;  2HFS A;  2V34 A;  2Z5B A;  1HR0 I;  2CPN A;  4DV6 I;  4DR7 E;  1N33 E;  4XTJ A;  2DMY A;  3ADL A;  1K47 A;  2FTX B;  4DKK A;  2V2Z A;  4DR6 E;  1YYO A;  5CFF E;  1Z0T A;  1IBK I;  2DB2 A;  4LF4 I;  2B7T A;  4DV3 I;  4JI0 E;  4LFC I;  2ZM6 E;  5ADZ A;  3HPZ A;  1A6F A;  2XEX A;  2R42 A;  2WZO A;  4LTY A;  2O1W A;  1N32 I;  4ED4 A;  1GZ6 A;  4L5N C;  3B82 A;  4DR2 I;  2CZ9 A;  4P7A A;  2L33 A;  1N32 E;  1UIL A;  4FW9 A;  4UT4 A;  1N34 E;  3ZKD A;  2ZIT A;  2L2M A;  4YY3 I;  4JI3 I;  2NUG A;  4DV1 I;  2CGE A;  4FWH A;  2UXD I;  4PRV A;  1IBK E;  4F9C B;  1ZM2 A;  4ZVI A;  1YYK A;  3J81 Q;  4DV2 E;  2O1V A;  1N36 E;  2F4V I;  2F8B A;  1N33 I;  2R3V A;  4DUY E;  2VF3 A;  1DAR A;  2LUP B;  3IWD A;  3ZOQ B;  2N3G A;  1U2R A;  1WHQ A;  4DV7 E;  4J8Z A;  1NHJ A;  2Q2E B;  1FJG I;  3ZKB A;  1SR9 A;  5DNY A;  4Z7C A;  5AAS A;  3B8H A;  3V2U C;  1X47 A;  2KHX A;  5FLX C;  1RQ0 A;  4B3S I;  2ODR D;  2HKE A;  3WU5 A;  4DXL A;  2UXB I;  4USM A;  5LMN I;  4DV5 I;  1HNX I;  2RSM A;  1XNR E;  2X7I A;  4B3M I;  1HNX E;  5LMN E;  4DV5 E;  3KWR A;  4LFA E;  1FWL A;  4PU9 A;  2B9D A;  2E1R A;  3D4J A;  4WUD A;  4WPY A;  2M7Q A;  2BV3 A;  2IOQ A;  3WU3 A;  5AE1 A;  4JYA E;  5IWA I;  3C4B A;  2V88 A;  4JI6 E;  2M1S A;  3JAM C;  2IOP A;  4WYQ B;  4LFB I;  3J7A G;  4HAC B;  2V8P A;  4B3T E;  2UUC I;  2JR1 A;  4JI4 I;  3FIG A;  3LTO A;  4X65 E;  4IZJ A;  4B3R E;  3F0N A;  4RPF A;  2E5L I;  1UHZ A;  4R8O A;  3ZZ0 A;  2B7V A;  3T1H E;  1PVG A;  4L8N A;  4DU8 A;  5IT9 C;  4YHH I;  1ZXN A;  1X49 A;  4LF6 E;  1USV A;  3HTX A;  5L3J A;  1N0V C;  1H73 A;  1ZM3 A;  2NUE A;  4HYM A;  2MC6 A;  1Z0G A;  1STU A;  2A2C A;  2RS6 A;  4JI7 I;  3ADI A;  3ZZU A;  4OX9 E;  2JOX A;  3J80 C;  3AV0 A;  2O1U A;  4DR2 E;  2NUF A;  4GKJ I;  2EWL A;  5LL6 R;  2NA2 A;  3PRY A;  4GKK I;  1RR9 A;  3IWC A;  4NXM E;  4HY1 A;  2L3C A;  2UUB E;  4LFC E;  4KZS A;  3HJC A;  4JI0 I;  4GKK E;  4GKJ E;  4LF4 E;  2EFG A;  4LF8 I;  3Q6M A;  4OX9 I;  4P78 A;  2UUA E;  4BBY A;  4JI7 E;  2M4I A;  4DMI A;  1Y4S A;  4K0K E;  4WUB A;  1GQE A;  4DUZ E;  3RMP A;  2HK3 A;  1HNW I;  4LU9 A;  1KIJ A;  4DR3 E;  1XMQ I;  4LF6 I;  4DR7 I;  1IBM E;  4JI1 E;  1NHI A;  1HR0 E;  4FWD A;  2E1M A;  1HNZ I;  1T4N A;  4Q28 A;  2L92 A;  1X48 A;  4M2Z A;  2V2Q A;  2FGG A;  2L3J A;  3ZZT A;  4IZK B;  2VF1 A;  2V2V A;  5BR8 E;  4JI2 E;  4X65 I;  1Z0C A;  1PIE A;  4KHP E;  2IHR 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...