4X66E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x66E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66E02
1T4OA 4DPWA 4DUYI 4R1FA 2EZ6A 4DV4E 3WU4A 4K0KE 1EI1A 4B3MI 3C4TA 2L2KB 2CPNA 1Z0CA 4JI7I 4DV1I 4JI3I 3PYEA 1ZM3A 4FWHA 4B3SE 1ZM2A 4RPFA 2ZITA 2E1RA 3OTOI 4LFBE 1XNQI 4LFCE 2UUAE 4DR4E 4FW9A 1KKHA 1J26A 1PKPA 3ZZTA 2JY9A 1DI2A 4AQYI 5FLXC 4X62E 4GKJE 4WYQB 1MG7A 1RC7A 1Z59A 4DV6I 4DV0E 4M1KA 1H74A 1XMOI 3B8HA 4DR6E 4JYAE 1HNWE 1I94E 1YYOA 2UXBI 4UT4A 4LFAI 3F0NA 2HHHE 5IT9C 2KHXA 1N36E 2BM1A 4DUZI 2WW4A 5A2QC 4YY3E 4HY1A 5L3JA 2X7IA 3ZZUA 4FN5A 4LF4I 2A2DA 2J7KA 1BKNA 1PVGA 4DR1E 1HNXI 2RTXA 2NPFA 3ZKBA 3C4BA 2V2ZA 4P7AA 4DR7I 1ZXMA 4X64I 1S16A 1Z5AA 5GMEA 1HR0E 2UU9I 4JI2I 3ZKDA 4DV4I 4K0KI 2L2MA 3J80Q 4OOGC 2L2NA 4GKKE 1KVKA 4B3SI 4DR5E 1S4EA 1K47A 3J81C 3V5RA 4LFBI 1ZM9A 4LFCI 2V2QA 2UUAI 4Z7YA 1UEKA 3WU3A 3V2UC 4DV3E 1HNZE 2LTSA 4LF5I 5BR8E 2VQEE 1N32E 1ZBTA 4UTGA 4X62I 4GKJI 3WU5A 2RSMA 4KHPE 4DPUA 2HKEA 1N0UA 3J81Q 4PRVA 4YHHI 4DV0I 1A6FA 3J7AG 1NHIA 4NXME 1H7UA 1Z0WA 4DR6I 2JVAA 4JYAI 1HNWI 1Z5BA 1I94I 2E5LE 1NHHA 4DV7E 2HHHI 4JI6E 2EFGA 1N36I 4DPTA 3T1HI 1T4NA 4DR2E 2MDRA 4JI8E 2B3TB 3HTXA 1FJGE 1ZXNA 1B62A 2XEXA 2DEIA 1XMQE 2HFSA 2CZ9A 4DR1I 1H73A 3D4JA 3QT7A 4JI4E 4OX9I 4JI0E 4X65E 3Q1QA 3VYXA 1OJ4A 4P52A 4JI1E 4Z7CA 4PU9A 3QT5A 2B7TA 3ADGA 1X49A 5LMNE 1HR0I 3ADLA 3LTOA 2HK3A 2Q2EB 1QZRA 1GQEA 1WHNA 4GKKI 3M6AA 4I3HA 2ZM6E 3P1XA 1IBLE 1NZ0A 4XTJA 2UXDE 2HK2A 4LF6E 2UUCE 4NXNI 5FLXQ 2LUPB 4DU7A 3J7AM 2L3CA 3CWVA 1FI4A 4DV3I 2X36A 1J5EE 2VQEI 1N32I 2UXCE 1N33E 1VISA 3K17A 1N34E 4KHPI 1O0WA 2NUFA 4X66E 4KQVA 3H4LA 4FWGA 2NA2A 1X47A 4JI7E 4B3TI 5IWAE 4NXMI 5IT9Q 4WFTA 2IHR1 2F4VE 4JI5E 5A2QQ 1WHQA 1IBME 2V8PA 3OTOE 2LTRA 2LJPA 4USMA 1XNQE 3ZM7A 3JAMC 1Z0EA 1EA6A 3K1JA 4JI8I 4AQYE 2NUEA 5GMDA 4M2ZA 1XMQI 1KIJA 3T1YE 1Z0VA 4JI4I 4DR4I 4JI0I 3ADJA 4X65I 1FNMA 1XMOE 2N3GA 1XHKA 4HACB 4JI1I 3LNUA 2LUQA 1Z5CA 5LMNI 1RQ0A 1Z0BA 1KTVA 3LLHA 2VQFE 1EKZA 2LJHA 5CFFE 2ZM6I 4DV5E 1IBLI 2R3VA 1IBKE 4LF7E 1Z0GA 1NHJA 3WU6A 3B78A 2N3HA 2UUBE 5LL6R 4LF6I 2UUCI 4WUCA 2HFUA 4YY3I 2ZBKB 1J5EI 4X64E 2UXCI 1N33I 1DARA 1N34I 3PYDA 2DB2A 1X48A 1PIEA 1H7SA 4LF8E 2UU9E 4JI2E 1XNRE 1B63A 4X66I 4DKKA 4HYMA 1H72C 4DXLA 4B3RE 5IWAI 2F4VI 4X8WA 4JI5I 2AJ4A 1ZM4A 4LF9E 1IBMI 2DIXA 1ELOA 4URLA 1RREA 4JV5E 2LRSA 1Z0TA 4HXZA 4DV2E 4DR5I 1N0VC 4ZVIA 4LF5E 4MYUA 1QU6A 2GS8A 3T1YI 4DR3E 2YT4A 2OI2A 2V34A 5LMUE 2A2CA 4YHHE 1WUUA 1HNZI 5BR8I 3PYGA 3ZZ0A 3B82A 4DUYE 3HULA 4B3ME 4DV1E 4JI3E 2HKJA 1T4LB 2VQFI 3LPSA 1MX0A 3T1HE 4PRXA 2L33A 1FWKA 2R42A 4DV5I 2E5LI 1IBKI 4LF7I 3J80C 1D6TA 2DMYA 3PYFA 2UUBI 4DV7I 4JI6I 2DEJA 3VYYA 1YYWA 4DR2I 4OX9E 2RS6A 1UHZA 3QT8A 1FJGI 1RR9A 1FKAE 2V2VA 4DU8A 1STUA 1FWLA 4DV6E 4USKA 1MU5A 4LF8I 2BM0A 1XNRI 4B3RI 1YYKA 4JG4A 3JAMQ 4MYTA 4WUBA 1UILA 2UXBE 3J7Yp 4LFAE 4ED4A 4LF9I 2VF3A 4NXNE 3GONA 4DUZE 4JV5I 2B7VA 1YZ9A 3ADIA 2LBSB 4DV2I 4M30A 4LF4E 4DPXA 2NUGA 2UXDI 4WUDA 4FWDA 1HNXE 4HACA 4DR3I 2RS7A 5LMUI 2L3JA 2BV3A 3QT6A 1U2RA 4EMDA 4B3TE 4DR7E 4DPYA
chains in the Genus database with same CATH superfamily
3DD6A 1UN6B 1IQOA 1T4OA 3PS1A 4DPWA 4DUYI 1N3GA 4M9VC 2EOZA 4R1FA 1NCSA 2EZ6A 2EOSA 2HGHA 2YZTA 1AAYA 4DV4E 3WU4A 3RMPA 4K0KE 2I13A 1EI1A 3C4TA 2L2KB 2CPNA 2EPCA 1LLMC 1Z0CA 4BCAA 4IS9A 4DV1I 4JI3I 4JI7I 1RHYA 2JEBA 3PYEA 2M4IA 1ZM3A 4FWHA 2EPMX 2F8BA 4B3SE 4R2PA 1ZM2A 4RPFA 3P3EA 1OYPA 2EOEA 2LCEA 4O24A 4R8OA 1WXRA 2ZITA 4IFDE 2E1RA 3OTOI 2IESA 1WRJA 4LFBE 1T38A 1XNQI 4I8OA 4LFCE 3QG5C 5LLQA 3H09A 2UUAE 4OO1B 2EN7A 2V87A 4DR4E 2EMBA 2EM0A 1KKHA 1J26A 4FW9A 2BA0G 2V8PA 2EM4A 4F9AB 1PKPA 3ZZTA 2JY9A 4GEQB 5A6KA 1DI2A 2C37B 2GO4A 5FLXC 2M1SA 2RPCA 4X62E 1WJPA 4GKJE 5C0XE 4LOMA 4WYQB 1MG7A 1RC7A 1Z59A 4AIDA 4DV6I 5A6BD 5A6BA 2EMGA 1A1KA 4ZYHA 4DV0E 2PO1B 4M1KA 2V86A 1H74A 2EN8A 2V85A 1XMOI 2MC6A 3KZZA 1Y4UA 2MKDA 3B8HA 2ODRD 4DR6E 4P78A 4JYAE 1HNWE 2PNLA 1I94E 5KL7A 1YYOA 2FV4B 2UXBI 4UT4A 1E3PA 4LFAI 4M0VA 2Z5CA 1MGTA 2Z5BB 3F0NA 3P76A 1ZAAC 5IT9C 2EPAA 2HHHE 4QNJA 2KHXA 3Q6NA 1N36E 2BM1A 2EN4A 2EOHA 2BR2A 2WW4A 4DUZI 4GZNC 2B9DA 5A2QC 3BIDA 4O43A 2EQ1A 2VF1A 5KL3A 4YY3E 4HY1A 2GLIA 3F6HA 3L00A 4NZVA 4R2DA 5L3JA 2I9IA 2X7IA 3ZZUA 4FN5A 4LF4I 4RHBB 2A2DA 2YTNA 2EMKA 2EQ3A 2J7KA 3PS2A 4LU9A 1BKNA 4O5GA 1PVGA 3UHMA 5JEAB 4F2JC 4DR1E 2NN6F 1HNXI 5DNYA 4OKGA 1QNTA 2EMXA 2E72A 2RTXA 4FW4A 2NPFA 3TQMA 5KL2A 3C4BA 2O1TA 1KYQA 2V2ZA 4P7AA 3ZKBA 4IFDF 2JWOA 1ZXMA 4DR7I 1G2FC 2LE2A 4X64I 2PO2A 1PJTA 5KL5A 1S16A 2C39B 1Z5AA 5GMEA 1HR0E 2DGCA 1X6FA 2UU9I 1YFHA 3C6MA 2IERA 3ZKDA 2YSPA 5FWKA 4DV4I 2JP9A 4JI2I 4K0KI 2EM3A 2EPZA 3BGHA 2EN3A 2V8QB 5C0XF 2L2MA 4FW7A 3J80Q 4OOGC 4IZKB 1MEYC 2L2NA 4GKKE 1KVKA 4B3SI 4DR5E 1S4EA 5A6AA 2V88A 4ZYDA 1A1JA 3J81C 1K47A 2HJJA 2YTDA 4AQYI 3GMEA 4AM3A 1YPNA 3V5RA 1EH7A 4LFBI 1ZM9A 2WBTA 4F9BB 2DRPA 2YTIA 4LFCI 1X6HA 4LCGA 4IFDB 4FW6A 4BA2A 2V2QA 2YTFA 2UUAI 2V83A 4Z7YA 1PJQA 1UEKA 2JT2A 1X3CA 3WU3A 5K36B 3V2UC 4DV3E 1HNZE 2LTSA 4LF5I 5BR8E 3K85A 2VQEE 2EN2A 1ZBTA 2M9AA 4ZYGA 1N32E 2WZOA 4UTGA 4X62I 4GKJI 3WU5A 2A25A 4F6NA 2RSMA 2EWLA 4KHPE 1G2DC 1Y6ZA 4DPUA 2ELYA 2IOQA 2HKEA 3U1KA 1N0UA 1R6MA 1BBGA 4AIMA 4U3BA 2WNRB 3J81Q 4PRVA 4YHHI 2EPNA 3HKMA 4DV0I 1A6FA 3J7AG 3AV0A 1NHIA 4F54A 1YHCA 2ADRA 4NXME 1A1FA 1DQ3A 1H7UA 2GQ0A 1Z0WA 3PRYA 2JE6B 4DR6I 2JVAA 4JYAI 3GCMA 1HNWI 1Z5BA 1I94I 2E5LE 5ADZA 2O1VA 2EOOA 3M99B 3L7ZB 2DSYA 4MLQA 1NHHA 3DF6A 3JU0A 2YTOA 4DV7E 2HHHI 4JI6E 1Y4SA 2EFGA 1N36I 4DPTA 3T1HI 3MHSC 1T4NA 4TUIA 2LT7A 4DR2E 2NN6E 2PNZB 2E1MA 2MDRA 4F6MA 4QNKA 2ENHA 2AE8A 1IMUA 4JI8E 2EJ4A 2B3TB 3HTXA 2KOUA 1FJGE 1ZXNA 1B62A 2XEXA 2DEIA 2EM7A 2RSIA 1XMQE 2HFSA 2ELZA 2CZ9A 1EH8A 2PNMA 4DR1I 1H73A 1P47A 3D4JA 3QT7A 4JI4E 2BA1G 4OX9I 4BA1B 4JI0E 2EPXA 3M85D 4R03A 4X65E 2EMLA 3Q1QA 3VYXA 1OJ4A 4P52A 2YTJA 5AC5A 5TSEA 2DMIA 2YU5A 1YUIA 2JPAA 4JI1E 1X6EA 4Z7CA 4PU9A 2J7JA 2O3ZA 2YSOA 3QT5A 2B7TA 2L92A 2EMIA 3ADGA 1X49A 5JEAC 5LMNE 1DGCA 1HR0I 2EPUA 3ADLA 2FTXB 2EMWA 3LTOA 3HJCA 4F9CB 2M7QA 1A1LA 2HK3A 2EE8A 2C38B 2Q2EB 1QZRA 1GQEA 5DROA 5DNLA 1WHNA 4Q28A 4GKKI 3VK6A 4WXCA 2EPOA 3M6AA 4I3HA 3IWBA 2ZM6E 3P1XA 1IBLE 3EPLA 1NZ0A 3M7NG 3THNA 2BBGA 3KRNA 4XTJA 4OO1D 4OO1A 2EPRA 2UXDE 2EOJA 2R76A 5AC4A 2KONA 2HK2A 1USVA 4BA1A 4LF6E 4R2CA 2C37A 2UUCE 4NXNI 5FLXQ 2YTQA 2EOYA 2LUPB 4DU7A 2YRKA 2FGGA 3J7AM 2L3CA 3CWVA 1FI4A 4DV3I 2X36A 2G7HA 1J5EE 4ISAA 3THOB 4MU4A 2ENCA 2YWQA 5KL6A 2VQEI 1N32I 2UXCE 1N33E 4BHCA 1VISA 3K17A 1USUA 2CT1A 2EL4A 1N34E 2CG9A 4BMJA 2PO1A 4MLVA 1HK7A 4KHPI 2WP8B 1O0WA 3P3GA 3HPSA 2NUFA 2JEAB 4X66E 3ECRA 4KQVA 1E3HA 2MC5A 2L6MA 3H4LA 4FWGA 4WXDA 2EM6A 1X47A 2NA2A 4JI7E 1IQSA 4B3TI 5K36C 5KL4A 2Z5BA 5IWAE 3UK3C 4R2RA 2GPIA 1YSAC 4WFTA 4NXMI 4MQYA 5IT9Q 2IHR1 4J8ZA 2F4VE 3M85G 4JI5E 1YH8A 4FK5C 5A2QQ 1WHQA 1IBME 1RMDA 1SFEA 1JK2A 4BC7A 2F1DA 4WSGA 2LTRA 3OTOE 2LJPA 4U3DA 2PO0B 1ZR9A 1VI7A 4USMA 3BF2A 1XNQE 5DRRA 3JAMC 3ZM7A 1Z0EA 4OZEA 2CTDA 4WSPA 2O1UA 2N8XA 4L8NA 1EA6A 5JEAD 5JEAA 2EPKX 3K1JA 4JI8I 4R2AA 1PJSA 5DRPA 5EKWA 2NN6B 4AQYE 2NUEA 4BBYA 5GMDA 4M2ZA 1OYRA 1XMQI 2ENAA 4IZJB 1ZU1A 1KIJA 3T1YE 1OYSA 2LJUA 3EPJA 3Q6MA 4RH8A 1Z0VA 4JI4I 4IJDA 3MHHC 2D9HA 2C39A 4DR4I 2YTEA 2GO3A 4JI0I 3ADJA 4MU0A 4X65I 1FNMA 2H36X 1XMOE 2N3GA 1XHKA 4HACB 4BC9A 2EM8A 1GTKA 4JI1I 3LNUA 5T6JA 4IZKA 2LUQA 5C0XB 1Z5CA 3GLLA 1F2IG 2JR1A 5LMNI 3MSWA 5ELWA 1RQ0A 2EM2A 1Z0BA 4LCFA 1EH6A 4OO1C 1KTVA 3LLHA 3IWDA 2VQFE 1EKZA 2LJHA 2VRDA 5CFFE 2IOPA 3KWRA 4P7DA 2ZM6I 4DV5E 4L5NC 2Q8UA 4IFDA 1IBLI 4IFDD 2R3VA 1IBKE 4LF7E 2JEBB 1Z0GA 1ZBQA 1NHJA 5K36D 2DLKA 3B78A 3WU6A 3VHTB 5K36A 4HEIA 2N3HA 2UUBE 5LL6R 1P42A 4J3DA 4LF6I 2EOIA 2UUCI 3K6QA 2WBUA 4WUCA 2V89A 3FIGA 2HFUA 4Q35B 4YY3I 2EL6A 5C0XA 3EPKA 2EP3A 2ZBKB 1J5EI 4KZSA 4X64E 2YRHA 2EM9A 2EOXA 5AASA 2WNRA 2Z5EA 1N33I 2UXCI 2JOXA 4GQUA 4KWYA 1DARA 1N34I 1UDSA 3PYDA 2DB2A 4R2EA 3U1YA 1X48A 2JOBA 1PIEA 1H7SA 4LF8E 2UU9E 4JI2E 2EN6A 1XNRE 2EQ0A 2WBSA 1B63A 2JE6A 3B4TA 4N3OA 4X66I 4DKKA 2EPPA 1BB8A 5AE3A 4HYMA 1H72C 4R2SA 4DXLA 3OMLA 4B3RE 3HPZA 3L7ZA 2JXPA 5IWAI 2EMFA 1B69A 2F4VI 4X8WA 3EQ1A 4JI5I 2AJ4A 4LCHA 3EPHA 1ZM4A 4LF9E 2PNZA 1IBMI 2DIXA 4LTYA 1ELOA 3H1CA 4B3MI 3LMLA 2CSHA 4URLA 1RREA 4JV5E 5K36E 2LRSA 2RQLA 1Z0TA 4HXZA 4DV2E 4DR5I 1N0VC 3HQ1A 2Z5CB 5EL9A 3P06A 2YTPA 4ZVIA 4LF5E 1BBOA 2HC5A 2GHFA 2YRMA 4MYUA 2BR2B 1QU6A 2LV2A 4BS9A 2CVEA 2GS8A 2EOFA 1GZ6A 4WX9A 4FW3A 1Y60A 2EORA 4R2QA 3T1YI 5A6JA 4DR3E 2O1WA 2YT4A 3CDIA 2OI2A 2V34A 5LMUE 2A2CA 4NBQA 2EMCA 5JEAF 4YHHE 1WUUA 1HNZI 2VESA 5BR8I 1TF6A 3PYGA 3ZZ0A 2EOQA 2NN6C 1TN9A 3B82A 1A1GA 4DUYE 2C38A 5IXMB 2L8TA 3NZKA 3HULA 2EN1A 4IFDC 4B3ME 2EMAA 2PO2B 3HXLA 4DV1E 5AE2A 4JI3E 2HKJA 1T4LB 2VQFI 3LPSA 1UDQA 1MX0A 3T1HE 4PRXA 2L33A 1FWKA 2R42A 4DV5I 2YU8A 2VE7C 4HTGA 2E5LI 3DJWA 1IBKI 4LF7I 3J80C 5C0XC 2YPNA 2EPLX 4FW5A 2DMYA 1D6TA 3PYFA 4OO1E 2UUBI 1Z1BA 3BBGA 2CGEA 4DV7I 4DMIA 1PDAA 2EMZA 5DNXA 2JYAA 1A1HA 2DEJA 2R1FA 4JI6I 3VYYA 1YYWA 4DR2I 3AUZA 4MU1A 3IWCA 4OX9E 1UBDC 2PRTA 3F6GA 2RS6A 2WP8A 1UHZA 4TUGA 2JEAA 3QT8A 2YTGA 1UDNA 4BHBA 4WPYA 2EM5A 5A69A 4BA2B 1FJGI 1RR9A 4MDTA 2K4VA 5K36F 1FKAE 2V2VA 4DU8A 1STUA 1FWLA 4DV6E 4USKA 1NEIA 1R6LA 1MU5A 4LF8I 4X9JA 1UDOA 2BM0A 1XNRI 1KJKA 5AE1A 2LMZA 1YUJA 2PO0A 3P3CA 2J65A 4B3RI 1SR9A 1AH5A 1YYKA 4JG4A 1JK1A 3JAMQ 4MU3A 4MYTA 4WUBA 2LVHA 1UILA 4LPFA 2UXBE 3J7Yp 4IS1C 2MDGA 5F3WA 4LFAE 5IV8B 4ED4A 4LF9I 2EMHA 2VF3A 2BA1D 2NABA 2MKNA 4O4KA 2NN6D 4NHRA 2BA0D 4NXNE 2NN6A 4DUZE 3GONA 4JV5I 2B7VA 1YZ9A 2WCC3 3ADIA 2LBSB 4DV2I 1X5WA 4IZJD 4IZJA 2EL5A 1T39A 5JEAE 2DLQA 1L4SA 4M30A 3ZOQB 2LO3A 4LF4E 4N4RB 4DPXA 2NUGA 2EMYA 2UXDI 2BB8A 1TF3A 4WUDA 3JTZA 3CDJA 4ZYEA 1XXEA 1HNXE 4FWDA 4HACA 4DR3I 2EOMA 2K7IA 2ODRC 3PS3A 2RS7A 5LMUI 2L3JA 2BV3A 1Y5YA 3QT6A 5C0XD 1U2RA 3C6KA 1A1IA 5DRQA 4EMDA 3KZYA 4B3TE 3M7ND 4DR7E 4DPYA 4OO1F
chains in the Genus database with same CATH topology
1T4OA 4DPWA 4DUYI 4R1FA 2EZ6A 2YZTA 4DV4E 3WU4A 3RMPA 4K0KE 1EI1A 4B3MI 3C4TA 2L2KB 2CPNA 1Z0CA 4BCAA 4DV1I 4JI3I 4JI7I 3PYEA 2M4IA 1ZM3A 4FWHA 2F8BA 4B3SE 1ZM2A 4RPFA 4R8OA 1WXRA 2ZITA 2E1RA 3OTOI 4LFBE 1XNQI 4I8OA 4LFCE 2UUAE 3H09A 2V87A 4DR4E 4FW9A 1KKHA 1J26A 4F9AB 1PKPA 3ZZTA 2JY9A 4GEQB 1DI2A 4AQYI 5FLXC 2M1SA 4X62E 4GKJE 4WYQB 1MG7A 1RC7A 1Z59A 4DV6I 4DV0E 4M1KA 2V86A 1H74A 2V85A 1XMOI 2MC6A 1Y4UA 3B8HA 2ODRD 4DR6E 4P78A 1HNWE 4JYAE 2PNLA 1I94E 1YYOA 2UXBI 2FV4B 4UT4A 4LFAI 4M0VA 2Z5CA 2Z5BB 3F0NA 2HHHE 5IT9C 2KHXA 3Q6NA 1N36E 2BM1A 4DUZI 2WW4A 2B9DA 5A2QC 2VF1A 4YY3E 4HY1A 3F6HA 5L3JA 2X7IA 3ZZUA 4FN5A 4LF4I 2A2DA 2J7KA 4LU9A 1BKNA 1PVGA 4DR1E 1HNXI 5DNYA 2RTXA 2NPFA 3ZKBA 2O1TA 3C4BA 2V2ZA 4P7AA 2JWOA 1ZXMA 4DR7I 2LE2A 4X64I 1S16A 1Z5AA 5GMEA 1HR0E 2UU9I 4JI2I 3ZKDA 4DV4I 5FWKA 4K0KI 2V8QB 2L2MA 3J80Q 4OOGC 4IZKB 2L2NA 4GKKE 1KVKA 4B3SI 4DR5E 1S4EA 2V88A 1K47A 3J81C 3V5RA 4LFBI 1ZM9A 4F9BB 4LFCI 2V2QA 2UUAI 2V83A 4Z7YA 1UEKA 3WU3A 3V2UC 4DV3E 1HNZE 2LTSA 4LF5I 5BR8E 3K85A 2VQEE 1N32E 1ZBTA 2WZOA 4UTGA 4X62I 4GKJI 3WU5A 2RSMA 2EWLA 4KHPE 1Y6ZA 4DPUA 2IOQA 2HKEA 1N0UA 3J81Q 4PRVA 4YHHI 4DV0I 1A6FA 3J7AG 3AV0A 1NHIA 4F54A 4NXME 1DQ3A 1H7UA 2GQ0A 1Z0WA 3PRYA 4DR6I 2JVAA 4JYAI 1HNWI 1Z5BA 1I94I 2E5LE 5ADZA 2O1VA 2DSYA 1NHHA 3DF6A 3JU0A 4DV7E 2HHHI 4JI6E 1Y4SA 2EFGA 1N36I 4DPTA 3T1HI 1T4NA 4TUIA 4DR2E 2E1MA 2MDRA 4JI8E 2B3TB 3HTXA 2KOUA 1FJGE 1ZXNA 1B62A 2XEXA 2DEIA 1XMQE 2HFSA 2CZ9A 2PNMA 4DR1I 1H73A 3D4JA 3QT7A 4JI4E 4OX9I 4JI0E 4R03A 4X65E 3Q1QA 3VYXA 1OJ4A 4P52A 4JI1E 4Z7CA 4PU9A 3QT5A 2B7TA 2L92A 3ADGA 1X49A 5LMNE 1HR0I 3ADLA 3LTOA 2FTXB 3HJCA 4F9CB 2M7QA 2HK3A 2Q2EB 1QZRA 1GQEA 1WHNA 4Q28A 4GKKI 3VK6A 3M6AA 4I3HA 3IWBA 2ZM6E 3P1XA 1IBLE 1NZ0A 4XTJA 2UXDE 2HK2A 2KONA 1USVA 4LF6E 2UUCE 4NXNI 5FLXQ 2LUPB 4DU7A 2FGGA 3J7AM 2L3CA 3CWVA 1FI4A 4DV3I 2X36A 2G7HA 1J5EE 2VQEI 1N32I 2UXCE 1N33E 1VISA 3K17A 1USUA 1N34E 2CG9A 4BMJA 1HK7A 4KHPI 1O0WA 2NUFA 3HPSA 4X66E 4KQVA 3H4LA 2MC5A 2L6MA 4FWGA 2NA2A 1X47A 4JI7E 4B3TI 2Z5BA 5IWAE 4NXMI 5IT9Q 4WFTA 2IHR1 4J8ZA 2F4VE 4JI5E 5A2QQ 1WHQA 1IBME 2V8PA 4BC7A 3OTOE 2LTRA 2LJPA 4USMA 1XNQE 3JAMC 3ZM7A 1Z0EA 4WSPA 2O1UA 4L8NA 1EA6A 3K1JA 4JI8I 4AQYE 2NUEA 4BBYA 5GMDA 4M2ZA 1XMQI 4IZJB 1KIJA 3T1YE 3Q6MA 1Z0VA 4JI4I 4DR4I 4JI0I 3ADJA 4X65I 1FNMA 2H36X 1XMOE 2N3GA 1XHKA 4HACB 4BC9A 4JI1I 3LNUA 5T6JA 4IZKA 2LUQA 1Z5CA 2JR1A 5LMNI 3MSWA 1RQ0A 1Z0BA 1KTVA 3LLHA 3IWDA 2VQFE 1EKZA 2LJHA 5CFFE 2IOPA 3KWRA 4P7DA 2ZM6I 4DV5E 4L5NC 1IBLI 2R3VA 1IBKE 4LF7E 1Z0GA 1ZBQA 1NHJA 3WU6A 3B78A 2N3HA 2UUBE 5LL6R 4LF6I 2UUCI 3K6QA 4WUCA 2V89A 3FIGA 2HFUA 4YY3I 2ZBKB 1J5EI 4KZSA 4X64E 5AASA 2Z5EA 1N33I 2UXCI 2JOXA 1DARA 1N34I 3PYDA 2DB2A 1X48A 2JOBA 1PIEA 1H7SA 4LF8E 2UU9E 4JI2E 1XNRE 1B63A 4X66I 4N3OA 4DKKA 5AE3A 4HYMA 1H72C 4DXLA 3OMLA 4B3RE 3HPZA 5IWAI 2F4VI 4X8WA 4JI5I 2AJ4A 1ZM4A 4LF9E 1IBMI 2DIXA 4LTYA 1ELOA 3LMLA 4URLA 1RREA 4JV5E 2LRSA 1Z0TA 4HXZA 4DV2E 4DR5I 1N0VC 3HQ1A 2Z5CB 3P06A 4ZVIA 4LF5E 4MYUA 1QU6A 4BS9A 2GS8A 1GZ6A 3T1YI 4DR3E 2O1WA 2YT4A 2OI2A 2V34A 5LMUE 2A2CA 4YHHE 1WUUA 1HNZI 5BR8I 3PYGA 3ZZ0A 3B82A 4DUYE 2L8TA 3HULA 4B3ME 3HXLA 4DV1E 5AE2A 4JI3E 2HKJA 1T4LB 2VQFI 3LPSA 1MX0A 3T1HE 4PRXA 2L33A 1FWKA 2R42A 4DV5I 2VE7C 2E5LI 3DJWA 1IBKI 4LF7I 3J80C 1D6TA 2DMYA 3PYFA 2UUBI 2CGEA 4DV7I 4DMIA 4JI6I 2DEJA 3VYYA 1YYWA 4DR2I 3AUZA 3IWCA 4OX9E 3F6GA 2RS6A 1UHZA 4TUGA 3QT8A 4WPYA 1FJGI 1RR9A 2K4VA 1FKAE 2V2VA 4DU8A 1STUA 1FWLA 4DV6E 4USKA 1MU5A 4LF8I 2BM0A 1XNRI 5AE1A 2LMZA 4B3RI 1SR9A 1YYKA 4JG4A 3JAMQ 4MYTA 4WUBA 1UILA 2UXBE 3J7Yp 5F3WA 4LFAE 4ED4A 4LF9I 2VF3A 4NXNE 3GONA 4DUZE 4JV5I 2B7VA 1YZ9A 3ADIA 2LBSB 4DV2I 4IZJD 4IZJA 4M30A 3ZOQB 4LF4E 4DPXA 2NUGA 2UXDI 4WUDA 3JTZA 4FWDA 1HNXE 4HACA 4DR3I 2ODRC 2RS7A 5LMUI 2L3JA 2BV3A 3QT6A 1U2RA 4EMDA 4B3TE 4DR7E 4DPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4O A;  4DPW A;  4DUY I;  4R1F A;  2EZ6 A;  4DV4 E;  3WU4 A;  4K0K E;  1EI1 A;  4B3M I;  3C4T A;  2L2K B;  2CPN A;  1Z0C A;  4JI7 I;  4DV1 I;  4JI3 I;  3PYE A;  1ZM3 A;  4FWH A;  4B3S E;  1ZM2 A;  4RPF A;  2ZIT A;  2E1R A;  3OTO I;  4LFB E;  1XNQ I;  4LFC E;  2UUA E;  4DR4 E;  4FW9 A;  1KKH A;  1J26 A;  1PKP A;  3ZZT A;  2JY9 A;  1DI2 A;  4AQY I;  5FLX C;  4X62 E;  4GKJ E;  4WYQ B;  1MG7 A;  1RC7 A;  1Z59 A;  4DV6 I;  4DV0 E;  4M1K A;  1H74 A;  1XMO I;  3B8H A;  4DR6 E;  4JYA E;  1HNW E;  1I94 E;  1YYO A;  2UXB I;  4UT4 A;  4LFA I;  3F0N A;  2HHH E;  5IT9 C;  2KHX A;  1N36 E;  2BM1 A;  4DUZ I;  2WW4 A;  5A2Q C;  4YY3 E;  4HY1 A;  5L3J A;  2X7I A;  3ZZU A;  4FN5 A;  4LF4 I;  2A2D A;  2J7K A;  1BKN A;  1PVG A;  4DR1 E;  1HNX I;  2RTX A;  2NPF A;  3ZKB A;  3C4B A;  2V2Z A;  4P7A A;  4DR7 I;  1ZXM A;  4X64 I;  1S16 A;  1Z5A A;  5GME A;  1HR0 E;  2UU9 I;  4JI2 I;  3ZKD A;  4DV4 I;  4K0K I;  2L2M A;  3J80 Q;  4OOG C;  2L2N A;  4GKK E;  1KVK A;  4B3S I;  4DR5 E;  1S4E A;  1K47 A;  3J81 C;  3V5R A;  4LFB I;  1ZM9 A;  4LFC I;  2V2Q A;  2UUA I;  4Z7Y A;  1UEK A;  3WU3 A;  3V2U C;  4DV3 E;  1HNZ E;  2LTS A;  4LF5 I;  5BR8 E;  2VQE E;  1N32 E;  1ZBT A;  4UTG A;  4X62 I;  4GKJ I;  3WU5 A;  2RSM A;  4KHP E;  4DPU A;  2HKE A;  1N0U A;  3J81 Q;  4PRV A;  4YHH I;  4DV0 I;  1A6F A;  3J7A G;  1NHI A;  4NXM E;  1H7U A;  1Z0W A;  4DR6 I;  2JVA A;  4JYA I;  1HNW I;  1Z5B A;  1I94 I;  2E5L E;  1NHH A;  4DV7 E;  2HHH I;  4JI6 E;  2EFG A;  1N36 I;  4DPT A;  3T1H I;  1T4N A;  4DR2 E;  2MDR A;  4JI8 E;  2B3T B;  3HTX A;  1FJG E;  1ZXN A;  1B62 A;  2XEX A;  2DEI A;  1XMQ E;  2HFS A;  2CZ9 A;  4DR1 I;  1H73 A;  3D4J A;  3QT7 A;  4JI4 E;  4OX9 I;  4JI0 E;  4X65 E;  3Q1Q A;  3VYX A;  1OJ4 A;  4P52 A;  4JI1 E;  4Z7C A;  4PU9 A;  3QT5 A;  2B7T A;  3ADG A;  1X49 A;  5LMN E;  1HR0 I;  3ADL A;  3LTO A;  2HK3 A;  2Q2E B;  1QZR A;  1GQE A;  1WHN A;  4GKK I;  3M6A A;  4I3H A;  2ZM6 E;  3P1X A;  1IBL E;  1NZ0 A;  4XTJ A;  2UXD E;  2HK2 A;  4LF6 E;  2UUC E;  4NXN I;  5FLX Q;  2LUP B;  4DU7 A;  3J7A M;  2L3C A;  3CWV A;  1FI4 A;  4DV3 I;  2X36 A;  1J5E E;  2VQE I;  1N32 I;  2UXC E;  1N33 E;  1VIS A;  3K17 A;  1N34 E;  4KHP I;  1O0W A;  2NUF A;  4X66 E;  4KQV A;  3H4L A;  4FWG A;  2NA2 A;  1X47 A;  4JI7 E;  4B3T I;  5IWA E;  4NXM I;  5IT9 Q;  4WFT A;  2IHR 1;  2F4V E;  4JI5 E;  5A2Q Q;  1WHQ A;  1IBM E;  2V8P A;  3OTO E;  2LTR A;  2LJP A;  4USM A;  1XNQ E;  3ZM7 A;  3JAM C;  1Z0E A;  1EA6 A;  3K1J A;  4JI8 I;  4AQY E;  2NUE A;  5GMD A;  4M2Z A;  1XMQ I;  1KIJ A;  3T1Y E;  1Z0V A;  4JI4 I;  4DR4 I;  4JI0 I;  3ADJ A;  4X65 I;  1FNM A;  1XMO E;  2N3G A;  1XHK A;  4HAC B;  4JI1 I;  3LNU A;  2LUQ A;  1Z5C A;  5LMN I;  1RQ0 A;  1Z0B A;  1KTV A;  3LLH A;  2VQF E;  1EKZ A;  2LJH A;  5CFF E;  2ZM6 I;  4DV5 E;  1IBL I;  2R3V A;  1IBK E;  4LF7 E;  1Z0G A;  1NHJ A;  3WU6 A;  3B78 A;  2N3H A;  2UUB E;  5LL6 R;  4LF6 I;  2UUC I;  4WUC A;  2HFU A;  4YY3 I;  2ZBK B;  1J5E I;  4X64 E;  2UXC I;  1N33 I;  1DAR A;  1N34 I;  3PYD A;  2DB2 A;  1X48 A;  1PIE A;  1H7S A;  4LF8 E;  2UU9 E;  4JI2 E;  1XNR E;  1B63 A;  4X66 I;  4DKK A;  4HYM A;  1H72 C;  4DXL A;  4B3R E;  5IWA I;  2F4V I;  4X8W A;  4JI5 I;  2AJ4 A;  1ZM4 A;  4LF9 E;  1IBM I;  2DIX A;  1ELO A;  4URL A;  1RRE A;  4JV5 E;  2LRS A;  1Z0T A;  4HXZ A;  4DV2 E;  4DR5 I;  1N0V C;  4ZVI A;  4LF5 E;  4MYU A;  1QU6 A;  2GS8 A;  3T1Y I;  4DR3 E;  2YT4 A;  2OI2 A;  2V34 A;  5LMU E;  2A2C A;  4YHH E;  1WUU A;  1HNZ I;  5BR8 I;  3PYG A;  3ZZ0 A;  3B82 A;  4DUY E;  3HUL A;  4B3M E;  4DV1 E;  4JI3 E;  2HKJ A;  1T4L B;  2VQF I;  3LPS A;  1MX0 A;  3T1H E;  4PRX A;  2L33 A;  1FWK A;  2R42 A;  4DV5 I;  2E5L I;  1IBK I;  4LF7 I;  3J80 C;  1D6T A;  2DMY A;  3PYF A;  2UUB I;  4DV7 I;  4JI6 I;  2DEJ A;  3VYY A;  1YYW A;  4DR2 I;  4OX9 E;  2RS6 A;  1UHZ A;  3QT8 A;  1FJG I;  1RR9 A;  1FKA E;  2V2V A;  4DU8 A;  1STU A;  1FWL A;  4DV6 E;  4USK A;  1MU5 A;  4LF8 I;  2BM0 A;  1XNR I;  4B3R I;  1YYK A;  4JG4 A;  3JAM Q;  4MYT A;  4WUB A;  1UIL A;  2UXB E;  3J7Y p;  4LFA E;  4ED4 A;  4LF9 I;  2VF3 A;  4NXN E;  3GON A;  4DUZ E;  4JV5 I;  2B7V A;  1YZ9 A;  3ADI A;  2LBS B;  4DV2 I;  4M30 A;  4LF4 E;  4DPX A;  2NUG A;  2UXD I;  4WUD A;  4FWD A;  1HNX E;  4HAC A;  4DR3 I;  2RS7 A;  5LMU I;  2L3J A;  2BV3 A;  3QT6 A;  1U2R A;  4EMD A;  4B3T E;  4DR7 E;  4DPY A; 
#chains in the Genus database with same CATH topology
 3DD6 A;  1UN6 B;  1IQO A;  1T4O A;  3PS1 A;  4DPW A;  4DUY I;  1N3G A;  4M9V C;  2EOZ A;  4R1F A;  1NCS A;  2EZ6 A;  2EOS A;  2HGH A;  2YZT A;  1AAY A;  4DV4 E;  3WU4 A;  3RMP A;  4K0K E;  2I13 A;  1EI1 A;  3C4T A;  2L2K B;  2CPN A;  2EPC A;  1LLM C;  1Z0C A;  4BCA A;  4IS9 A;  4DV1 I;  4JI3 I;  4JI7 I;  1RHY A;  2JEB A;  3PYE A;  2M4I A;  1ZM3 A;  4FWH A;  2EPM X;  2F8B A;  4B3S E;  4R2P A;  1ZM2 A;  4RPF A;  3P3E A;  1OYP A;  2EOE A;  2LCE A;  4O24 A;  4R8O A;  1WXR A;  2ZIT A;  4IFD E;  2E1R A;  3OTO I;  2IES A;  1WRJ A;  4LFB E;  1T38 A;  1XNQ I;  4I8O A;  4LFC E;  3QG5 C;  5LLQ A;  3H09 A;  2UUA E;  4OO1 B;  2EN7 A;  2V87 A;  4DR4 E;  2EMB A;  2EM0 A;  1KKH A;  1J26 A;  4FW9 A;  2BA0 G;  2V8P A;  2EM4 A;  4F9A B;  1PKP A;  3ZZT A;  2JY9 A;  4GEQ B;  5A6K A;  1DI2 A;  2C37 B;  2GO4 A;  5FLX C;  2M1S A;  2RPC A;  4X62 E;  1WJP A;  4GKJ E;  5C0X E;  4LOM A;  4WYQ B;  1MG7 A;  1RC7 A;  1Z59 A;  4AID A;  4DV6 I;  5A6B D;  5A6B A;  2EMG A;  1A1K A;  4ZYH A;  4DV0 E;  2PO1 B;  4M1K A;  2V86 A;  1H74 A;  2EN8 A;  2V85 A;  1XMO I;  2MC6 A;  3KZZ A;  1Y4U A;  2MKD A;  3B8H A;  2ODR D;  4DR6 E;  4P78 A;  4JYA E;  1HNW E;  2PNL A;  1I94 E;  5KL7 A;  1YYO A;  2FV4 B;  2UXB I;  4UT4 A;  1E3P A;  4LFA I;  4M0V A;  2Z5C A;  1MGT A;  2Z5B B;  3F0N A;  3P76 A;  1ZAA C;  5IT9 C;  2EPA A;  2HHH E;  4QNJ A;  2KHX A;  3Q6N A;  1N36 E;  2BM1 A;  2EN4 A;  2EOH A;  2BR2 A;  2WW4 A;  4DUZ I;  4GZN C;  2B9D A;  5A2Q C;  3BID A;  4O43 A;  2EQ1 A;  2VF1 A;  5KL3 A;  4YY3 E;  4HY1 A;  2GLI A;  3F6H A;  3L00 A;  4NZV A;  4R2D A;  5L3J A;  2I9I A;  2X7I A;  3ZZU A;  4FN5 A;  4LF4 I;  4RHB B;  2A2D A;  2YTN A;  2EMK A;  2EQ3 A;  2J7K A;  3PS2 A;  4LU9 A;  1BKN A;  4O5G A;  1PVG A;  3UHM A;  5JEA B;  4F2J C;  4DR1 E;  2NN6 F;  1HNX I;  5DNY A;  4OKG A;  1QNT A;  2EMX A;  2E72 A;  2RTX A;  4FW4 A;  2NPF A;  3TQM A;  5KL2 A;  3C4B A;  2O1T A;  1KYQ A;  2V2Z A;  4P7A A;  3ZKB A;  4IFD F;  2JWO A;  1ZXM A;  4DR7 I;  1G2F C;  2LE2 A;  4X64 I;  2PO2 A;  1PJT A;  5KL5 A;  1S16 A;  2C39 B;  1Z5A A;  5GME A;  1HR0 E;  2DGC A;  1X6F A;  2UU9 I;  1YFH A;  3C6M A;  2IER A;  3ZKD A;  2YSP A;  5FWK A;  4DV4 I;  2JP9 A;  4JI2 I;  4K0K I;  2EM3 A;  2EPZ A;  3BGH A;  2EN3 A;  2V8Q B;  5C0X F;  2L2M A;  4FW7 A;  3J80 Q;  4OOG C;  4IZK B;  1MEY C;  2L2N A;  4GKK E;  1KVK A;  4B3S I;  4DR5 E;  1S4E A;  5A6A A;  2V88 A;  4ZYD A;  1A1J A;  3J81 C;  1K47 A;  2HJJ A;  2YTD A;  4AQY I;  3GME A;  4AM3 A;  1YPN A;  3V5R A;  1EH7 A;  4LFB I;  1ZM9 A;  2WBT A;  4F9B B;  2DRP A;  2YTI A;  4LFC I;  1X6H A;  4LCG A;  4IFD B;  4FW6 A;  4BA2 A;  2V2Q A;  2YTF A;  2UUA I;  2V83 A;  4Z7Y A;  1PJQ A;  1UEK A;  2JT2 A;  1X3C A;  3WU3 A;  5K36 B;  3V2U C;  4DV3 E;  1HNZ E;  2LTS A;  4LF5 I;  5BR8 E;  3K85 A;  2VQE E;  2EN2 A;  1ZBT A;  2M9A A;  4ZYG A;  1N32 E;  2WZO A;  4UTG A;  4X62 I;  4GKJ I;  3WU5 A;  2A25 A;  4F6N A;  2RSM A;  2EWL A;  4KHP E;  1G2D C;  1Y6Z A;  4DPU A;  2ELY A;  2IOQ A;  2HKE A;  3U1K A;  1N0U A;  1R6M A;  1BBG A;  4AIM A;  4U3B A;  2WNR B;  3J81 Q;  4PRV A;  4YHH I;  2EPN A;  3HKM A;  4DV0 I;  1A6F A;  3J7A G;  3AV0 A;  1NHI A;  4F54 A;  1YHC A;  2ADR A;  4NXM E;  1A1F A;  1DQ3 A;  1H7U A;  2GQ0 A;  1Z0W A;  3PRY A;  2JE6 B;  4DR6 I;  2JVA A;  4JYA I;  3GCM A;  1HNW I;  1Z5B A;  1I94 I;  2E5L E;  5ADZ A;  2O1V A;  2EOO A;  3M99 B;  3L7Z B;  2DSY A;  4MLQ A;  1NHH A;  3DF6 A;  3JU0 A;  2YTO A;  4DV7 E;  2HHH I;  4JI6 E;  1Y4S A;  2EFG A;  1N36 I;  4DPT A;  3T1H I;  3MHS C;  1T4N A;  4TUI A;  2LT7 A;  4DR2 E;  2NN6 E;  2PNZ B;  2E1M A;  2MDR A;  4F6M A;  4QNK A;  2ENH A;  2AE8 A;  1IMU A;  4JI8 E;  2EJ4 A;  2B3T B;  3HTX A;  2KOU A;  1FJG E;  1ZXN A;  1B62 A;  2XEX A;  2DEI A;  2EM7 A;  2RSI A;  1XMQ E;  2HFS A;  2ELZ A;  2CZ9 A;  1EH8 A;  2PNM A;  4DR1 I;  1H73 A;  1P47 A;  3D4J A;  3QT7 A;  4JI4 E;  2BA1 G;  4OX9 I;  4BA1 B;  4JI0 E;  2EPX A;  3M85 D;  4R03 A;  4X65 E;  2EML A;  3Q1Q A;  3VYX A;  1OJ4 A;  4P52 A;  2YTJ A;  5AC5 A;  5TSE A;  2DMI A;  2YU5 A;  1YUI A;  2JPA A;  4JI1 E;  1X6E A;  4Z7C A;  4PU9 A;  2J7J A;  2O3Z A;  2YSO A;  3QT5 A;  2B7T A;  2L92 A;  2EMI A;  3ADG A;  1X49 A;  5JEA C;  5LMN E;  1DGC A;  1HR0 I;  2EPU A;  3ADL A;  2FTX B;  2EMW A;  3LTO A;  3HJC A;  4F9C B;  2M7Q A;  1A1L A;  2HK3 A;  2EE8 A;  2C38 B;  2Q2E B;  1QZR A;  1GQE A;  5DRO A;  5DNL A;  1WHN A;  4Q28 A;  4GKK I;  3VK6 A;  4WXC A;  2EPO A;  3M6A A;  4I3H A;  3IWB A;  2ZM6 E;  3P1X A;  1IBL E;  3EPL A;  1NZ0 A;  3M7N G;  3THN A;  2BBG A;  3KRN A;  4XTJ A;  4OO1 D;  4OO1 A;  2EPR A;  2UXD E;  2EOJ A;  2R76 A;  5AC4 A;  2KON A;  2HK2 A;  1USV A;  4BA1 A;  4LF6 E;  4R2C A;  2C37 A;  2UUC E;  4NXN I;  5FLX Q;  2YTQ A;  2EOY A;  2LUP B;  4DU7 A;  2YRK A;  2FGG A;  3J7A M;  2L3C A;  3CWV A;  1FI4 A;  4DV3 I;  2X36 A;  2G7H A;  1J5E E;  4ISA A;  3THO B;  4MU4 A;  2ENC A;  2YWQ A;  5KL6 A;  2VQE I;  1N32 I;  2UXC E;  1N33 E;  4BHC A;  1VIS A;  3K17 A;  1USU A;  2CT1 A;  2EL4 A;  1N34 E;  2CG9 A;  4BMJ A;  2PO1 A;  4MLV A;  1HK7 A;  4KHP I;  2WP8 B;  1O0W A;  3P3G A;  3HPS A;  2NUF A;  2JEA B;  4X66 E;  3ECR A;  4KQV A;  1E3H A;  2MC5 A;  2L6M A;  3H4L A;  4FWG A;  4WXD A;  2EM6 A;  1X47 A;  2NA2 A;  4JI7 E;  1IQS A;  4B3T I;  5K36 C;  5KL4 A;  2Z5B A;  5IWA E;  3UK3 C;  4R2R A;  2GPI A;  1YSA C;  4WFT A;  4NXM I;  4MQY A;  5IT9 Q;  2IHR 1;  4J8Z A;  2F4V E;  3M85 G;  4JI5 E;  1YH8 A;  4FK5 C;  5A2Q Q;  1WHQ A;  1IBM E;  1RMD A;  1SFE A;  1JK2 A;  4BC7 A;  2F1D A;  4WSG A;  2LTR A;  3OTO E;  2LJP A;  4U3D A;  2PO0 B;  1ZR9 A;  1VI7 A;  4USM A;  3BF2 A;  1XNQ E;  5DRR A;  3JAM C;  3ZM7 A;  1Z0E A;  4OZE A;  2CTD A;  4WSP A;  2O1U A;  2N8X A;  4L8N A;  1EA6 A;  5JEA D;  5JEA A;  2EPK X;  3K1J A;  4JI8 I;  4R2A A;  1PJS A;  5DRP A;  5EKW A;  2NN6 B;  4AQY E;  2NUE A;  4BBY A;  5GMD A;  4M2Z A;  1OYR A;  1XMQ I;  2ENA A;  4IZJ B;  1ZU1 A;  1KIJ A;  3T1Y E;  1OYS A;  2LJU A;  3EPJ A;  3Q6M A;  4RH8 A;  1Z0V A;  4JI4 I;  4IJD A;  3MHH C;  2D9H A;  2C39 A;  4DR4 I;  2YTE A;  2GO3 A;  4JI0 I;  3ADJ A;  4MU0 A;  4X65 I;  1FNM A;  2H36 X;  1XMO E;  2N3G A;  1XHK A;  4HAC B;  4BC9 A;  2EM8 A;  1GTK A;  4JI1 I;  3LNU A;  5T6J A;  4IZK A;  2LUQ A;  5C0X B;  1Z5C A;  3GLL A;  1F2I G;  2JR1 A;  5LMN I;  3MSW A;  5ELW A;  1RQ0 A;  2EM2 A;  1Z0B A;  4LCF A;  1EH6 A;  4OO1 C;  1KTV A;  3LLH A;  3IWD A;  2VQF E;  1EKZ A;  2LJH A;  2VRD A;  5CFF E;  2IOP A;  3KWR A;  4P7D A;  2ZM6 I;  4DV5 E;  4L5N C;  2Q8U A;  4IFD A;  1IBL I;  4IFD D;  2R3V A;  1IBK E;  4LF7 E;  2JEB B;  1Z0G A;  1ZBQ A;  1NHJ A;  5K36 D;  2DLK A;  3B78 A;  3WU6 A;  3VHT B;  5K36 A;  4HEI A;  2N3H A;  2UUB E;  5LL6 R;  1P42 A;  4J3D A;  4LF6 I;  2EOI A;  2UUC I;  3K6Q A;  2WBU A;  4WUC A;  2V89 A;  3FIG A;  2HFU A;  4Q35 B;  4YY3 I;  2EL6 A;  5C0X A;  3EPK A;  2EP3 A;  2ZBK B;  1J5E I;  4KZS A;  4X64 E;  2YRH A;  2EM9 A;  2EOX A;  5AAS A;  2WNR A;  2Z5E A;  1N33 I;  2UXC I;  2JOX A;  4GQU A;  4KWY A;  1DAR A;  1N34 I;  1UDS A;  3PYD A;  2DB2 A;  4R2E A;  3U1Y A;  1X48 A;  2JOB A;  1PIE A;  1H7S A;  4LF8 E;  2UU9 E;  4JI2 E;  2EN6 A;  1XNR E;  2EQ0 A;  2WBS A;  1B63 A;  2JE6 A;  3B4T A;  4N3O A;  4X66 I;  4DKK A;  2EPP A;  1BB8 A;  5AE3 A;  4HYM A;  1H72 C;  4R2S A;  4DXL A;  3OML A;  4B3R E;  3HPZ A;  3L7Z A;  2JXP A;  5IWA I;  2EMF A;  1B69 A;  2F4V I;  4X8W A;  3EQ1 A;  4JI5 I;  2AJ4 A;  4LCH A;  3EPH A;  1ZM4 A;  4LF9 E;  2PNZ A;  1IBM I;  2DIX A;  4LTY A;  1ELO A;  3H1C A;  4B3M I;  3LML A;  2CSH A;  4URL A;  1RRE A;  4JV5 E;  5K36 E;  2LRS A;  2RQL A;  1Z0T A;  4HXZ A;  4DV2 E;  4DR5 I;  1N0V C;  3HQ1 A;  2Z5C B;  5EL9 A;  3P06 A;  2YTP A;  4ZVI A;  4LF5 E;  1BBO A;  2HC5 A;  2GHF A;  2YRM A;  4MYU A;  2BR2 B;  1QU6 A;  2LV2 A;  4BS9 A;  2CVE A;  2GS8 A;  2EOF A;  1GZ6 A;  4WX9 A;  4FW3 A;  1Y60 A;  2EOR A;  4R2Q A;  3T1Y I;  5A6J A;  4DR3 E;  2O1W A;  2YT4 A;  3CDI A;  2OI2 A;  2V34 A;  5LMU E;  2A2C A;  4NBQ A;  2EMC A;  5JEA F;  4YHH E;  1WUU A;  1HNZ I;  2VES A;  5BR8 I;  1TF6 A;  3PYG A;  3ZZ0 A;  2EOQ A;  2NN6 C;  1TN9 A;  3B82 A;  1A1G A;  4DUY E;  2C38 A;  5IXM B;  2L8T A;  3NZK A;  3HUL A;  2EN1 A;  4IFD C;  4B3M E;  2EMA A;  2PO2 B;  3HXL A;  4DV1 E;  5AE2 A;  4JI3 E;  2HKJ A;  1T4L B;  2VQF I;  3LPS A;  1UDQ A;  1MX0 A;  3T1H E;  4PRX A;  2L33 A;  1FWK A;  2R42 A;  4DV5 I;  2YU8 A;  2VE7 C;  4HTG A;  2E5L I;  3DJW A;  1IBK I;  4LF7 I;  3J80 C;  5C0X C;  2YPN A;  2EPL X;  4FW5 A;  2DMY A;  1D6T A;  3PYF A;  4OO1 E;  2UUB I;  1Z1B A;  3BBG A;  2CGE A;  4DV7 I;  4DMI A;  1PDA A;  2EMZ A;  5DNX A;  2JYA A;  1A1H A;  2DEJ A;  2R1F A;  4JI6 I;  3VYY A;  1YYW A;  4DR2 I;  3AUZ A;  4MU1 A;  3IWC A;  4OX9 E;  1UBD C;  2PRT A;  3F6G A;  2RS6 A;  2WP8 A;  1UHZ A;  4TUG A;  2JEA A;  3QT8 A;  2YTG A;  1UDN A;  4BHB A;  4WPY A;  2EM5 A;  5A69 A;  4BA2 B;  1FJG I;  1RR9 A;  4MDT A;  2K4V A;  5K36 F;  1FKA E;  2V2V A;  4DU8 A;  1STU A;  1FWL A;  4DV6 E;  4USK A;  1NEI A;  1R6L A;  1MU5 A;  4LF8 I;  4X9J A;  1UDO A;  2BM0 A;  1XNR I;  1KJK A;  5AE1 A;  2LMZ A;  1YUJ A;  2PO0 A;  3P3C A;  2J65 A;  4B3R I;  1SR9 A;  1AH5 A;  1YYK A;  4JG4 A;  1JK1 A;  3JAM Q;  4MU3 A;  4MYT A;  4WUB A;  2LVH A;  1UIL A;  4LPF A;  2UXB E;  3J7Y p;  4IS1 C;  2MDG A;  5F3W A;  4LFA E;  5IV8 B;  4ED4 A;  4LF9 I;  2EMH A;  2VF3 A;  2BA1 D;  2NAB A;  2MKN A;  4O4K A;  2NN6 D;  4NHR A;  2BA0 D;  4NXN E;  2NN6 A;  4DUZ E;  3GON A;  4JV5 I;  2B7V A;  1YZ9 A;  2WCC 3;  3ADI A;  2LBS B;  4DV2 I;  1X5W A;  4IZJ D;  4IZJ A;  2EL5 A;  1T39 A;  5JEA E;  2DLQ A;  1L4S A;  4M30 A;  3ZOQ B;  2LO3 A;  4LF4 E;  4N4R B;  4DPX A;  2NUG A;  2EMY A;  2UXD I;  2BB8 A;  1TF3 A;  4WUD A;  3JTZ A;  3CDJ A;  4ZYE A;  1XXE A;  1HNX E;  4FWD A;  4HAC A;  4DR3 I;  2EOM A;  2K7I A;  2ODR C;  3PS3 A;  2RS7 A;  5LMU I;  2L3J A;  2BV3 A;  1Y5Y A;  3QT6 A;  5C0X D;  1U2R A;  3C6K A;  1A1I A;  5DRQ A;  4EMD A;  3KZY A;  4B3T E;  3M7N D;  4DR7 E;  4DPY A;  4OO1 F; 
#chains in the Genus database with same CATH homology
 1T4O A;  4DPW A;  4DUY I;  4R1F A;  2EZ6 A;  2YZT A;  4DV4 E;  3WU4 A;  3RMP A;  4K0K E;  1EI1 A;  4B3M I;  3C4T A;  2L2K B;  2CPN A;  1Z0C A;  4BCA A;  4DV1 I;  4JI3 I;  4JI7 I;  3PYE A;  2M4I A;  1ZM3 A;  4FWH A;  2F8B A;  4B3S E;  1ZM2 A;  4RPF A;  4R8O A;  1WXR A;  2ZIT A;  2E1R A;  3OTO I;  4LFB E;  1XNQ I;  4I8O A;  4LFC E;  2UUA E;  3H09 A;  2V87 A;  4DR4 E;  4FW9 A;  1KKH A;  1J26 A;  4F9A B;  1PKP A;  3ZZT A;  2JY9 A;  4GEQ B;  1DI2 A;  4AQY I;  5FLX C;  2M1S A;  4X62 E;  4GKJ E;  4WYQ B;  1MG7 A;  1RC7 A;  1Z59 A;  4DV6 I;  4DV0 E;  4M1K A;  2V86 A;  1H74 A;  2V85 A;  1XMO I;  2MC6 A;  1Y4U A;  3B8H A;  2ODR D;  4DR6 E;  4P78 A;  1HNW E;  4JYA E;  2PNL A;  1I94 E;  1YYO A;  2UXB I;  2FV4 B;  4UT4 A;  4LFA I;  4M0V A;  2Z5C A;  2Z5B B;  3F0N A;  2HHH E;  5IT9 C;  2KHX A;  3Q6N A;  1N36 E;  2BM1 A;  4DUZ I;  2WW4 A;  2B9D A;  5A2Q C;  2VF1 A;  4YY3 E;  4HY1 A;  3F6H A;  5L3J A;  2X7I A;  3ZZU A;  4FN5 A;  4LF4 I;  2A2D A;  2J7K A;  4LU9 A;  1BKN A;  1PVG A;  4DR1 E;  1HNX I;  5DNY A;  2RTX A;  2NPF A;  3ZKB A;  2O1T A;  3C4B A;  2V2Z A;  4P7A A;  2JWO A;  1ZXM A;  4DR7 I;  2LE2 A;  4X64 I;  1S16 A;  1Z5A A;  5GME A;  1HR0 E;  2UU9 I;  4JI2 I;  3ZKD A;  4DV4 I;  5FWK A;  4K0K I;  2V8Q B;  2L2M A;  3J80 Q;  4OOG C;  4IZK B;  2L2N A;  4GKK E;  1KVK A;  4B3S I;  4DR5 E;  1S4E A;  2V88 A;  1K47 A;  3J81 C;  3V5R A;  4LFB I;  1ZM9 A;  4F9B B;  4LFC I;  2V2Q A;  2UUA I;  2V83 A;  4Z7Y A;  1UEK A;  3WU3 A;  3V2U C;  4DV3 E;  1HNZ E;  2LTS A;  4LF5 I;  5BR8 E;  3K85 A;  2VQE E;  1N32 E;  1ZBT A;  2WZO A;  4UTG A;  4X62 I;  4GKJ I;  3WU5 A;  2RSM A;  2EWL A;  4KHP E;  1Y6Z A;  4DPU A;  2IOQ A;  2HKE A;  1N0U A;  3J81 Q;  4PRV A;  4YHH I;  4DV0 I;  1A6F A;  3J7A G;  3AV0 A;  1NHI A;  4F54 A;  4NXM E;  1DQ3 A;  1H7U A;  2GQ0 A;  1Z0W A;  3PRY A;  4DR6 I;  2JVA A;  4JYA I;  1HNW I;  1Z5B A;  1I94 I;  2E5L E;  5ADZ A;  2O1V A;  2DSY A;  1NHH A;  3DF6 A;  3JU0 A;  4DV7 E;  2HHH I;  4JI6 E;  1Y4S A;  2EFG A;  1N36 I;  4DPT A;  3T1H I;  1T4N A;  4TUI A;  4DR2 E;  2E1M A;  2MDR A;  4JI8 E;  2B3T B;  3HTX A;  2KOU A;  1FJG E;  1ZXN A;  1B62 A;  2XEX A;  2DEI A;  1XMQ E;  2HFS A;  2CZ9 A;  2PNM A;  4DR1 I;  1H73 A;  3D4J A;  3QT7 A;  4JI4 E;  4OX9 I;  4JI0 E;  4R03 A;  4X65 E;  3Q1Q A;  3VYX A;  1OJ4 A;  4P52 A;  4JI1 E;  4Z7C A;  4PU9 A;  3QT5 A;  2B7T A;  2L92 A;  3ADG A;  1X49 A;  5LMN E;  1HR0 I;  3ADL A;  3LTO A;  2FTX B;  3HJC A;  4F9C B;  2M7Q A;  2HK3 A;  2Q2E B;  1QZR A;  1GQE A;  1WHN A;  4Q28 A;  4GKK I;  3VK6 A;  3M6A A;  4I3H A;  3IWB A;  2ZM6 E;  3P1X A;  1IBL E;  1NZ0 A;  4XTJ A;  2UXD E;  2HK2 A;  2KON A;  1USV A;  4LF6 E;  2UUC E;  4NXN I;  5FLX Q;  2LUP B;  4DU7 A;  2FGG A;  3J7A M;  2L3C A;  3CWV A;  1FI4 A;  4DV3 I;  2X36 A;  2G7H A;  1J5E E;  2VQE I;  1N32 I;  2UXC E;  1N33 E;  1VIS A;  3K17 A;  1USU A;  1N34 E;  2CG9 A;  4BMJ A;  1HK7 A;  4KHP I;  1O0W A;  2NUF A;  3HPS A;  4X66 E;  4KQV A;  3H4L A;  2MC5 A;  2L6M A;  4FWG A;  2NA2 A;  1X47 A;  4JI7 E;  4B3T I;  2Z5B A;  5IWA E;  4NXM I;  5IT9 Q;  4WFT A;  2IHR 1;  4J8Z A;  2F4V E;  4JI5 E;  5A2Q Q;  1WHQ A;  1IBM E;  2V8P A;  4BC7 A;  3OTO E;  2LTR A;  2LJP A;  4USM A;  1XNQ E;  3JAM C;  3ZM7 A;  1Z0E A;  4WSP A;  2O1U A;  4L8N A;  1EA6 A;  3K1J A;  4JI8 I;  4AQY E;  2NUE A;  4BBY A;  5GMD A;  4M2Z A;  1XMQ I;  4IZJ B;  1KIJ A;  3T1Y E;  3Q6M A;  1Z0V A;  4JI4 I;  4DR4 I;  4JI0 I;  3ADJ A;  4X65 I;  1FNM A;  2H36 X;  1XMO E;  2N3G A;  1XHK A;  4HAC B;  4BC9 A;  4JI1 I;  3LNU A;  5T6J A;  4IZK A;  2LUQ A;  1Z5C A;  2JR1 A;  5LMN I;  3MSW A;  1RQ0 A;  1Z0B A;  1KTV A;  3LLH A;  3IWD A;  2VQF E;  1EKZ A;  2LJH A;  5CFF E;  2IOP A;  3KWR A;  4P7D A;  2ZM6 I;  4DV5 E;  4L5N C;  1IBL I;  2R3V A;  1IBK E;  4LF7 E;  1Z0G A;  1ZBQ A;  1NHJ A;  3WU6 A;  3B78 A;  2N3H A;  2UUB E;  5LL6 R;  4LF6 I;  2UUC I;  3K6Q A;  4WUC A;  2V89 A;  3FIG A;  2HFU A;  4YY3 I;  2ZBK B;  1J5E I;  4KZS A;  4X64 E;  5AAS A;  2Z5E A;  1N33 I;  2UXC I;  2JOX A;  1DAR A;  1N34 I;  3PYD A;  2DB2 A;  1X48 A;  2JOB A;  1PIE A;  1H7S A;  4LF8 E;  2UU9 E;  4JI2 E;  1XNR E;  1B63 A;  4X66 I;  4N3O A;  4DKK A;  5AE3 A;  4HYM A;  1H72 C;  4DXL A;  3OML A;  4B3R E;  3HPZ A;  5IWA I;  2F4V I;  4X8W A;  4JI5 I;  2AJ4 A;  1ZM4 A;  4LF9 E;  1IBM I;  2DIX A;  4LTY A;  1ELO A;  3LML A;  4URL A;  1RRE A;  4JV5 E;  2LRS A;  1Z0T A;  4HXZ A;  4DV2 E;  4DR5 I;  1N0V C;  3HQ1 A;  2Z5C B;  3P06 A;  4ZVI A;  4LF5 E;  4MYU A;  1QU6 A;  4BS9 A;  2GS8 A;  1GZ6 A;  3T1Y I;  4DR3 E;  2O1W A;  2YT4 A;  2OI2 A;  2V34 A;  5LMU E;  2A2C A;  4YHH E;  1WUU A;  1HNZ I;  5BR8 I;  3PYG A;  3ZZ0 A;  3B82 A;  4DUY E;  2L8T A;  3HUL A;  4B3M E;  3HXL A;  4DV1 E;  5AE2 A;  4JI3 E;  2HKJ A;  1T4L B;  2VQF I;  3LPS A;  1MX0 A;  3T1H E;  4PRX A;  2L33 A;  1FWK A;  2R42 A;  4DV5 I;  2VE7 C;  2E5L I;  3DJW A;  1IBK I;  4LF7 I;  3J80 C;  1D6T A;  2DMY A;  3PYF A;  2UUB I;  2CGE A;  4DV7 I;  4DMI A;  4JI6 I;  2DEJ A;  3VYY A;  1YYW A;  4DR2 I;  3AUZ A;  3IWC A;  4OX9 E;  3F6G A;  2RS6 A;  1UHZ A;  4TUG A;  3QT8 A;  4WPY A;  1FJG I;  1RR9 A;  2K4V A;  1FKA E;  2V2V A;  4DU8 A;  1STU A;  1FWL A;  4DV6 E;  4USK A;  1MU5 A;  4LF8 I;  2BM0 A;  1XNR I;  5AE1 A;  2LMZ A;  4B3R I;  1SR9 A;  1YYK A;  4JG4 A;  3JAM Q;  4MYT A;  4WUB A;  1UIL A;  2UXB E;  3J7Y p;  5F3W A;  4LFA E;  4ED4 A;  4LF9 I;  2VF3 A;  4NXN E;  3GON A;  4DUZ E;  4JV5 I;  2B7V A;  1YZ9 A;  3ADI A;  2LBS B;  4DV2 I;  4IZJ D;  4IZJ A;  4M30 A;  3ZOQ B;  4LF4 E;  4DPX A;  2NUG A;  2UXD I;  4WUD A;  3JTZ A;  4FWD A;  1HNX E;  4HAC A;  4DR3 I;  2ODR C;  2RS7 A;  5LMU I;  2L3J A;  2BV3 A;  3QT6 A;  1U2R A;  4EMD A;  4B3T E;  4DR7 E;  4DPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...