4X66E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x66E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66E02
4DR5E 4JI8E 2DIXA 3T1YE 4LFAE 3ZKBA 2RS7A 4DU7A 1KTVA 1RC7A 4DKKA 1IBKE 4FWGA 3J7AG 4B3TE 2F4VE 4R1FA 4DPXA 1FNMA 4NXNI 2BM1A 2V8PA 1Z0EA 1N0VC 3QT5A 1FWKA 2HFSA 4WUBA 4URLA 1BKNA 2EFGA 4B3RE 1T4LB 4OX9E 2N3HA 2LUQA 4YY3I 1HNXI 2VQEE 3WU3A 1UHZA 4DV2E 1T4NA 4DR6I 1UILA 1XNQE 1XMQI 2UUCI 4LF5I 3LLHA 1XNRE 1QZRA 4LF4E 1S4EA 4JI2I 4Z7CA 3F0NA 1HR0E 1N34I 4DR4I 4KQVA 4JI7I 4JI4I 4KHPI 4DV3I 1O0WA 1S16A 2UU9E 4K0KI 1STUA 4PU9A 4RPFA 5LMNE 2UUAI 1Z0VA 1N32I 2N3GA 4JI5I 3T1HE 1N0UA 4DR3I 1Z0CA 3GONA 4DV5E 1X47A 4GKJE 1WUUA 2MDRA 2NUFA 2UXCE 4DV7E 2UXDI 2NA2A 3ZZTA 2LTRA 4DR1E 1Z0TA 4LFBI 1WHQA 4DUYI 3J80C 4B3SE 4M1KA 4LF8E 4DR7E 4DV6E 4WUCA 1DARA 4JI1I 1T4OA 2DEIA 1HNWI 1YYOA 1Z0BA 4MYTA 1IBLI 4WFTA 3HULA 4DV1E 2E1RA 2JVAA 1ZM4A 1U2RA 5LMUI 4DV4I 2YT4A 2ZM6E 3D4JA 4FW9A 5LL6R 2WW4A 4FN5A 2UUBE 1J5EI 4X65I 1XMOI 2X7IA 2E5LE 2HK2A 2DEJA 1FJGE 3HTXA 3PYFA 4DUZI 4DV0E 2CPNA 4LF7I 2GS8A 4M2ZA 1ZXNA 4X66E 4B3MI 2V2VA 3V2UC 4X62E 4NXME 1N36I 4JV5E 4AQYI 4DR5I 2L2MA 4JI8I 4UT4A 4LFAI 4EMDA 1PIEA 1HNZI 1IBKI 2LUPB 4WUDA 2F4VI 5IWAI 3K1JA 4NXNE 2L2NA 2HHHE 1N33I 3J81Q 2L2KB 2LJHA 3LNUA 3ADLA 4DXLA 1ELOA 2VQEI 4YY3E 1EA6A 1HNXE 4LF9E 4ZVIA 3VYYA 1NZ0A 4DU8A 4USMA 2AJ4A 1KIJA 4JG4A 4ED4A 2CZ9A 3ADGA 3ZZUA 1NHJA 2RSMA 1FI4A 4JYAI 1Z5BA 1ZM2A 4LF5E 4GKKI 2ZBKB 2OI2A 1HR0I 4LFCI 2A2DA 2VQFI 1N34E 5A2QQ 4JI4E 1MG7A 4LF6I 4KHPE 4DV3E 1D6TA 3PYEA 4K0KE 2HKEA 1PKPA 2R3VA 5GMDA 2IHR1 3C4BA 3JAMC 4GKJI 4WYQB 1IBMI 2JY9A 4JI6E 3LPSA 3QT6A 1VISA 1UEKA 3K17A 2UXCI 2Q2EB 4I3HA 1YYKA 2X36A 4DV7I 2L3JA 1X48A 1ZBTA 4DR1I 2DB2A 4X64E 1RR9A 2V2ZA 3ZKDA 4DPYA 4B3SI 4DV6I 4UTGA 2HFUA 1QU6A 2UXBI 4JI1E 4JI3E 2V2QA 5BR8E 3VYXA 1MU5A 2L3CA 1H74A 4DPTA 1H73A 1Z0WA 3ADIA 2A2CA 5LMUE 2KHXA 5FLXQ 5IT9C 4DV4E 3J81C 1GQEA 4DR2E 4DPWA 3J7Yp 1H7SA 2EZ6A 2RS6A 4HXZA 1J5EE 3JAMQ 1Z0GA 1A6FA 1YZ9A 1FJGI 4YHHE 4MYUA 3WU4A 3B8HA 4JI0I 3OTOI 1I94E 4LF7E 1J26A 3C4TA 4B3ME 3T1YI 4USKA 2LTSA 4NXMI 1N36E 4HACA 4JV5I 5A2QC 4B3TI 4AQYE 4M30A 3LTOA 1NHHA 2NUEA 4PRXA 2HKJA 5IT9Q 1HNZE 5CFFE 3H4LA 3V5RA 5IWAE 4B3RI 1K47A 4P7AA 3J7AM 1H72C 4OX9I 3M6AA 5L3JA 2LRSA 2HHHI 2J7KA 2L33A 1PVGA 1N33E 3WU5A 3ZM7A 2VF3A 4DV2I 3ZZ0A 1Z5AA 1NHIA 4DPUA 4LF9I 4DR6E 1OJ4A 1XNQI 1XMQE 2UUCE 3QT8A 1XNRI 2ZITA 4LF4I 3PYDA 2DMYA 4JI2E 4P52A 4FWHA 4DR4E 4JI7E 5FLXC 2UU9I 4JYAE 4GKKE 1KKHA 5LMNI 2UUAE 1KVKA 1N32E 1DI2A 4JI5E 4LFCE 1B63A 2VQFE 3T1HI 1ZXMA 2R42A 4LF6E 4DV5I 4DR3E 1FWLA 1Z5CA 4Z7YA 5GMEA 4HACB 2HK3A 1XHKA 2V34A 2UXDE 4PRVA 4JI6I 1IBME 1H7UA 2RTXA 4LFBE 4DUYE 4LF8I 4DR7I 1Z59A 4OOGC 1ZM3A 3P1XA 4FWDA 2B7TA 3WU6A 3B78A 2B3TB 2NUGA 1HNWE 4X64I 1IBLE 4X8WA 2B7VA 1B62A 4DV1I 1EKZA 1WHNA 1RREA 2UXBE 4JI3I 5BR8I 1MX0A 3B82A 2ZM6I 3Q1QA 4XTJA 1RQ0A 1EI1A 2XEXA 2UUBI 2LBSB 4X65E 1XMOE 2E5LI 3QT7A 4DR2I 2LJPA 1FKAE 4DUZE 1X49A 4DV0I 1ZM9A 4YHHI 2NPFA 2BM0A 4X66I 3ADJA 3PYGA 4X62I 4JI0E 4HYMA 3CWVA 3OTOE 2BV3A 1I94I 3J80Q 1YYWA 4HY1A
chains in the Genus database with same CATH superfamily
4R2AA 4DR5E 2EMXA 5A6JA 2PNZB 2Q8UA 4JI8E 4M0VA 2DIXA 2EM9A 3T1YE 4LFAE 2G7HA 3ZKBA 2RS7A 5T6JA 4DU7A 1KTVA 1RC7A 4RHBB 4DKKA 1IBKE 3J7AG 1XXEA 4FWGA 4B3TE 3M7NG 1IQSA 2F4VE 2EQ1A 1SFEA 4R1FA 4DPXA 1FNMA 4NXNI 2V89A 2EMAA 1Z0EA 2HJJA 2BM1A 2V8PA 4AIMA 4WSPA 4HTGA 1N0VC 3QT5A 3WU6A 1Y6ZA 2Z5CB 1FWKA 2YSPA 4L5NC 2HFSA 4WUBA 2PRTA 4URLA 4AM3A 4I8OA 1BKNA 2EFGA 4F6MA 3EPHA 4B3RE 2YTFA 1T4LB 4OX9E 2N3HA 2LUQA 1DQ3A 4YY3I 1ZU1A 1HNXI 2VQEE 2VF1A 3MHSC 2EPMX 3WU3A 1UHZA 2DLKA 4IJDA 4P78A 4P7DA 2EMFA 2EOHA 5IXMB 4ZYEA 4DV2E 1TF3A 1DGCA 1EH6A 1T4NA 3LMLA 2EE8A 3ZOQB 1Y5YA 3FIGA 3F6HA 4DR6I 1UILA 1X6HA 5FWKA 2EWLA 2EOOA 2RSIA 5AASA 1XNQE 1XMQI 4F6NA 2UUCI 2EM3A 4LCFA 4LF5I 3AUZA 3BF2A 3THOB 3LLHA 5AE3A 1XNRE 1QZRA 1AAYA 4LF4E 1S4EA 3L7ZB 4JI2I 4OZEA 4O4KA 2EMGA 3F0NA 4Z7CA 1A1JA 1HR0E 1N34I 4DR4I 3DJWA 4KQVA 4JI7I 3F6GA 2JEBA 4JI4I 2GQ0A 4MQYA 4DV3I 1G2DC 1O0WA 1S16A 4KHPI 2UU9E 2MKDA 4RH8A 4K0KI 4R2EA 4IFDB 5KL6A 5JEAE 5C0XC 1STUA 2DRPA 2PNMA 4PU9A 5LMNE 4RPFA 2UUAI 1Z0VA 4IFDF 1N32I 2N3GA 4JI5I 2VE7C 3T1HE 2EPRA 1N0UA 5DNYA 4DR3I 1Z0CA 1HK7A 3RMPA 4DV5E 3GONA 2EL5A 1X47A 4GKJE 3K85A 1WUUA 2JEAA 1A1HA 2MDRA 2I13A 2NUFA 3TQMA 2UXCE 3MHHC 3GLLA 2YTDA 4DV7E 2UXDI 2NA2A 3ZZTA 1P47A 4J8ZA 2LTRA 2YTOA 2LCEA 4DR1E 2CSHA 3P06A 1Z0TA 3P3CA 4MU1A 4NBQA 4LFBI 1WHQA 4DUYI 3J80C 4B3SE 4M1KA 4LF8E 4DR7E 2EN2A 4DV6E 4MU3A 3C6MA 1ZAAC 1BBOA 4WUCA 1DARA 4JI1I 1T4OA 1F2IG 2DEIA 3M85D 1HNWI 1YYOA 1Z0BA 1GTKA 1ZR9A 4MYTA 5JEAC 1IBLI 2EM0A 4WFTA 4ZYHA 2EMCA 2EL4A 3HULA 4DV1E 2NN6B 2E1RA 1AH5A 2EMZA 1UBDC 2JVAA 4TUIA 1E3PA 1ZM4A 1U2RA 5LMUI 4LTYA 4DV4I 3VHTB 2EMIA 5LLQA 4IZJA 2YT4A 2ZM6E 5DNXA 2K7IA 2Z5EA 3PS1A 1R6MA 3D4JA 5LL6R 1WXRA 4FW9A 2FV4B 2WW4A 4FN5A 4OO1A 1L4SA 3KRNA 4GZNC 2UUBE 5DNLA 2BA1D 1J5EI 2GHFA 2B9DA 4X65I 3M85G 2NN6D 2X7IA 2DMIA 1XMOI 5A69A 2E5LE 2HK2A 1USVA 4LCHA 2DEJA 1FJGE 2ELZA 2V8QB 3HTXA 3VK6A 2JEBB 2F1DA 3KZYA 2EPLX 3PYFA 2ODRD 4DUZI 1JK2A 2EOFA 4FW6A 3JTZA 4IFDE 4HEIA 2MC6A 4DV0E 2CGEA 2JP9A 5F3WA 2EJ4A 2KOUA 3L00A 2CPNA 4LF7I 2GS8A 2L6MA 2ENCA 2HC5A 5K36A 3P3EA 4M2ZA 1ZXNA 4X66E 4B3MI 2JOBA 1UDNA 5AE1A 2JOXA 2EM6A 2V2VA 4WXCA 2JEAB 3DD6A 4F54A 3V2UC 4X62E 3BIDA 4NXME 2BA1G 3NZKA 4BBYA 1N36I 5DRRA 4N3OA 4JV5E 1TN9A 4AQYI 4DR5I 2L2MA 3U1YA 4JI8I 4UT4A 2JXPA 2YTGA 4LFAI 4KWYA 4EMDA 1RMDA 2NABA 1OYRA 1PIEA 1HNZI 2EMWA 3CDIA 1IBKI 2LUPB 4WUDA 3PS2A 3AV0A 2F4VI 5IWAI 3EPKA 4BHBA 4WX9A 3H09A 3CDJA 3K1JA 1KJKA 2BR2A 2J7JA 4ISAA 4NXNE 2WNRA 4IFDC 2EOJA 3PRYA 2L2NA 1X6EA 2PO2A 4FW4A 2YRKA 2JYAA 2HHHE 5EL9A 3HXLA 4LU9A 4U3BA 3J81Q 1N33I 2EL6A 2V85A 2L2KB 2NN6A 2LJHA 3HQ1A 4R2SA 2NN6E 2O1WA 1LLMC 2O1UA 3LNUA 4BA2A 2YSOA 3ADLA 4DXLA 1ELOA 5KL3A 4IZJB 1QNTA 2M7QA 2VQEI 4YY3E 1EA6A 4O24A 1HNXE 4LF9E 4ZVIA 4LCGA 1A1FA 2GO3A 3B4TA 1EH8A 3VYYA 2EM4A 2YTJA 4OO1B 1NZ0A 4DU8A 2MKNA 4USMA 1UN6B 2IOPA 2LMZA 5AC4A 4OO1F 2AJ4A 1X5WA 2EM8A 2EQ0A 3BGHA 1KIJA 4JG4A 4ED4A 2EOSA 1YUIA 3IWBA 2YTQA 2CZ9A 3ADGA 5ADZA 3ZZUA 1NHJA 1R6LA 2RSMA 2N8XA 1FI4A 4JYAI 1Z5BA 1ZM2A 2EOYA 4IZJD 4LF5E 4N4RB 2IESA 4GKKI 2ZBKB 2YWQA 4BCAA 1OYPA 1USUA 2OI2A 4OO1D 1YFHA 1PJSA 1HR0I 3P76A 4LFCI 2A2DA 2YTNA 1N34E 2VQFI 4GQUA 5K36B 5A2QQ 4JI4E 1MG7A 5DROA 4KHPE 2BA0D 4DV3E 4R8OA 4LF6I 1D6TA 3PYEA 4K0KE 2HKEA 3PS3A 5K36F 2WP8A 4BC7A 4R03A 3OMLA 4NHRA 1PKPA 2ODRC 2PNLA 4FW7A 2EMYA 2EN3A 2EMHA 2R3VA 2EOMA 2EOXA 5GMDA 3THNA 4WXDA 2IHR1 3C4BA 1UDSA 2HGHA 4BS9A 2GO4A 2ENAA 2GLIA 4KZSA 3JAMC 2BBGA 4GKJI 4WYQB 2DGCA 1IBMI 2JY9A 4JI6E 5EKWA 5K36D 5KL2A 3LPSA 3QT6A 1VISA 4O43A 1UEKA 3K17A 2UXCI 2IERA 2Q2EB 4I3HA 1YYKA 3C6KA 1T39A 2X36A 2EPCA 2I9IA 2LE2A 4DV7I 2L3JA 1X48A 1ZBTA 5KL4A 2BR2B 5KL5A 4MLQA 4AIDA 4DR1I 2YRMA 2WNRB 2DB2A 3ECRA 4X64E 1RR9A 2PO2B 2V2ZA 3ZKDA 4DPYA 1A1LA 4B3SI 4DV6I 2PO1A 4UTGA 2HFUA 2F8BA 1QU6A 4WSGA 2V83A 2UXBI 4JI1E 4BA2B 1TF6A 1YSAC 2EOZA 4WPYA 4JI3E 2NN6F 2V2QA 5BR8E 3VYXA 4Q28A 5A6AA 2V86A 1MU5A 4Q35B 2LO3A 2L3CA 2EPKX 2CT1A 2EMBA 1EH7A 3Q6NA 1Y4SA 1H74A 4DPTA 3IWCA 1H73A 1Z0WA 3ADIA 2Z5BA 4OO1E 1E3HA 2A2CA 1X6FA 1A1KA 5LMUE 2KHXA 3M99B 5FLXQ 5IT9C 4DV4E 5C0XB 1UDOA 2JE6A 3J81C 1GQEA 4DR2E 1BB8A 4DPWA 3J7Yp 1H7SA 5KL7A 2EZ6A 4MLVA 3HKMA 2LT7A 2RS6A 4HXZA 2EMLA 1GZ6A 1J5EE 3EQ1A 3JAMQ 1Z0GA 2CTDA 1A6FA 1YZ9A 5DRPA 1FJGI 2M9AA 4YHHE 4IZKA 1YH8A 3KWRA 5A6KA 4OKGA 5K36E 4MYUA 3WU4A 2GPIA 5C0XD 3B8HA 2L8TA 2VRDA 4TUGA 2WP8B 4JI0I 1P42A 3OTOI 5AE2A 3EPJA 4LPFA 3M7ND 1I94E 2FGGA 4LF7E 1J26A 4OO1C 3C4TA 4BMJA 4B3ME 2YZTA 2YTPA 3T1YI 4USKA 2LTSA 4M9VC 4NXMI 2CVEA 4R2RA 2LV2A 1N36E 1WRJA 4HACA 4JV5I 5A2QC 4B3TI 4AQYE 4M30A 2WBSA 3P3GA 2YU5A 3LTOA 3MSWA 1NHHA 1A1IA 4GEQB 4U3DA 2NUEA 1N3GA 4PRXA 2HKJA 5IT9Q 2DSYA 4ZYGA 2C38B 1HNZE 5CFFE 2PO1B 4IS1C 5JEAD 5K36C 1KYQA 2EN4A 4BC9A 3H4LA 3V5RA 5IWAE 2RPCA 1K47A 4P7AA 3KZZA 4B3RI 3IWDA 3J7AM 5DRQA 1H72C 4QNKA 4OX9I 1PDAA 3M6AA 2LVHA 2DLQA 4F9CB 5L3JA 2LRSA 2K4VA 2HHHI 4R2PA 2J7KA 2L33A 2ENHA 2EPXA 2O1VA 1PVGA 1N33E 2WBTA 3U1KA 2Z5BB 2LJUA 4J3DA 3WU5A 2VF3A 3ZM7A 3ZZ0A 4DV2I 1Z5AA 4X9JA 1NHIA 2C39A 1Y60A 2KONA 2BB8A 5C0XA 3HJCA 5TSEA 4F9AB 5C0XE 4DPUA 2EPZA 4R2DA 4DR6E 2JE6B 4LF9I 1OJ4A 4R2QA 2ADRA 2EN7A 1XNQI 2IOQA 2JWOA 2YPNA 1XMQE 3JU0A 3UK3C 2RQLA 2UUCE 3QT8A 1XNRI 2ZITA 4LF4I 3PYDA 2DMYA 4JI2E 4P52A 3H1CA 4FWHA 1YHCA 4IZKB 1PJTA 4DR4E 1IMUA 2NN6C 4JI7E 5FLXC 1NCSA 1MEYC 2AE8A 2UU9I 4JYAE 2M4IA 4GKKE 2EOQA 5A6BD 1B69A 4LOMA 1KKHA 5LMNI 2VESA 2EOEA 2UUAE 1KVKA 4BHCA 1N32E 1DI2A 3GCMA 4JI5E 4LFCE 1B63A 2VQFE 4MU0A 3T1HI 2FTXB 4BA1A 1T38A 1ZXMA 2R42A 4LF6E 4DV5I 4DR3E 5JEAA 2MC5A 2EN1A 1FWLA 1Z5CA 2C37A 4Z7YA 5GMEA 2PO0A 3GMEA 4HACB 3HPZA 3HPSA 2JPAA 2HK3A 2PNZA 1A1GA 1XHKA 1UDQA 2UXDE 2V34A 4PRVA 2ELYA 2YTEA 2J65A 4JI6I 1IBME 2BA0G 3EPLA 1G2FC 2RTXA 1H7UA 3Q6MA 2C38A 4LFBE 4DUYE 2YU8A 5ELWA 2EQ3A 4IS9A 4LF8I 4DR7I 1Z59A 4OOGC 1ZM3A 3P1XA 2EPAA 2B7TA 2O1TA 2O3ZA 3B78A 2EPPA 2MDGA 4R2CA 2YRHA 4IFDD 2B3TB 2NUGA 4O5GA 1HNWE 4X64I 1IBLE 1IQOA 1PJQA 2EN8A 4X8WA 2B7VA 1B62A 1YYWA 3QG5C 2Z5CA 1EKZA 4DV1I 1VI7A 1MGTA 1Y4UA 4QNJA 1WHNA 2EN6A 2WZOA 4DMIA 1RREA 2UXBE 4JI3I 2EM2A 2V88A 5AC5A 1JK1A 2C39B 5BR8I 5IV8B 1RHYA 1MX0A 3B82A 2A25A 2ZM6I 1YPNA 2EPUA 2EPNA 2YTIA 2E1MA 1SR9A 2H36X 2V87A 4XTJA 3Q1QA 5A6BA 3BBGA 1RQ0A 4FK5C 5C0XF 1EI1A 4FWDA 2XEXA 2R76A 4F9BB 2UUBI 2R1FA 3UHMA 4MDTA 4MU4A 2EOIA 2L92A 2LBSB 2EM5A 4X65E 1XMOE 2E5LI 3QT7A 2JT2A 4DR2I 1YUJA 2E72A 1BBGA 2EP3A 4L8NA 4ZYDA 1WJPA 2WBUA 2LJPA 3DF6A 4FW3A 1FKAE 4NZVA 4DUZE 2EORA 1OYSA 1X49A 2M1SA 4F2JC 1ZM9A 3L7ZA 2EM7A 4DV0I 2D9HA 4YHHI 1ZBQA 2JR1A 2NPFA 2BM0A 4BA1B 4X66I 3K6QA 1NEIA 4FW5A 3ADJA 2WCC3 5JEAB 4IFDA 2CG9A 3PYGA 4X62I 1X3CA 2EPOA 4JI0E 4HYMA 3CWVA 3OTOE 2BV3A 2C37B 5JEAF 1I94I 1Z1BA 2PO0B 3J80Q 2EMKA 4HY1A
chains in the Genus database with same CATH topology
4DR5E 4JI8E 4M0VA 2DIXA 3T1YE 4LFAE 2G7HA 3ZKBA 2RS7A 5T6JA 4DU7A 1KTVA 1RC7A 4DKKA 1IBKE 3J7AG 4FWGA 4B3TE 2F4VE 4R1FA 4DPXA 1FNMA 4NXNI 2V89A 2BM1A 1Z0EA 2V8PA 4WSPA 1N0VC 3QT5A 1Y6ZA 2Z5CB 1FWKA 2HFSA 4L5NC 4WUBA 4URLA 4I8OA 1BKNA 2EFGA 4B3RE 1T4LB 4OX9E 2N3HA 2LUQA 1DQ3A 4YY3I 1HNXI 2VQEE 2VF1A 3WU3A 1UHZA 4P7DA 4P78A 4DV2E 1T4NA 3LMLA 3ZOQB 3FIGA 3F6HA 4DR6I 1UILA 5FWKA 2EWLA 5AASA 1XNQE 1XMQI 2UUCI 4LF5I 3AUZA 3LLHA 5AE3A 1XNRE 1QZRA 4LF4E 1S4EA 4JI2I 4Z7CA 3F0NA 1HR0E 1N34I 4DR4I 3DJWA 4KQVA 4JI7I 3F6GA 4JI4I 2GQ0A 4KHPI 4DV3I 1O0WA 1S16A 2UU9E 4K0KI 1STUA 4PU9A 2PNMA 4RPFA 5LMNE 2UUAI 1Z0VA 1N32I 2N3GA 4JI5I 2VE7C 3T1HE 1N0UA 5DNYA 4DR3I 1Z0CA 1HK7A 3RMPA 4DV5E 3GONA 3K85A 1X47A 4GKJE 1WUUA 2MDRA 2NUFA 2UXCE 4DV7E 2UXDI 2NA2A 3ZZTA 4J8ZA 2LTRA 4DR1E 3P06A 1Z0TA 4LFBI 1WHQA 4DUYI 3J80C 4B3SE 4M1KA 4LF8E 4DR7E 4DV6E 4WUCA 1DARA 4JI1I 1T4OA 2DEIA 1HNWI 1YYOA 1Z0BA 4MYTA 1IBLI 4WFTA 3HULA 4DV1E 2E1RA 2JVAA 4TUIA 1ZM4A 1U2RA 5LMUI 4LTYA 4DV4I 4IZJA 2YT4A 2ZM6E 2Z5EA 3D4JA 5LL6R 1WXRA 4FW9A 2FV4B 2WW4A 4FN5A 2UUBE 1J5EI 2B9DA 4X65I 1XMOI 2X7IA 2E5LE 2HK2A 1USVA 2DEJA 1FJGE 2V8QB 3HTXA 3VK6A 3PYFA 2ODRD 4DUZI 3JTZA 2MC6A 4DV0E 2CGEA 5F3WA 2KOUA 2CPNA 4LF7I 2GS8A 2L6MA 4M2ZA 1ZXNA 4X66E 4B3MI 2JOBA 5AE1A 2JOXA 2V2VA 4F54A 3V2UC 4X62E 4NXME 4BBYA 1N36I 4N3OA 4JV5E 4AQYI 4DR5I 2L2MA 4JI8I 4UT4A 4LFAI 4EMDA 1PIEA 1HNZI 1IBKI 2LUPB 4WUDA 3AV0A 2F4VI 5IWAI 3H09A 3K1JA 4NXNE 3PRYA 2L2NA 2HHHE 3HXLA 4LU9A 1N33I 3J81Q 2V85A 2L2KB 2LJHA 3HQ1A 2O1WA 2O1UA 3LNUA 3ADLA 4DXLA 1ELOA 4IZJB 2M7QA 2VQEI 1EA6A 4YY3E 1HNXE 4LF9E 4ZVIA 3VYYA 1NZ0A 4DU8A 4USMA 2IOPA 2LMZA 2AJ4A 1KIJA 4JG4A 4ED4A 3IWBA 2CZ9A 3ADGA 5ADZA 3ZZUA 1NHJA 2RSMA 1FI4A 4JYAI 1Z5BA 1ZM2A 4IZJD 4LF5E 4GKKI 2ZBKB 4BCAA 1USUA 2OI2A 1HR0I 4LFCI 2A2DA 2VQFI 1N34E 5A2QQ 4JI4E 1MG7A 4LF6I 4KHPE 4DV3E 4R8OA 1D6TA 3PYEA 4K0KE 2HKEA 4BC7A 4R03A 3OMLA 1PKPA 2ODRC 2PNLA 2R3VA 5GMDA 2IHR1 3C4BA 4BS9A 4KZSA 3JAMC 4GKJI 4WYQB 1IBMI 2JY9A 4JI6E 3LPSA 3QT6A 1VISA 1UEKA 3K17A 2UXCI 2Q2EB 4I3HA 1YYKA 2X36A 2LE2A 4DV7I 2L3JA 1X48A 1ZBTA 4DR1I 2DB2A 4X64E 1RR9A 2V2ZA 3ZKDA 4DPYA 4B3SI 4DV6I 4UTGA 2HFUA 2F8BA 1QU6A 2V83A 2UXBI 4JI1E 4WPYA 4JI3E 2V2QA 5BR8E 3VYXA 4Q28A 2V86A 1MU5A 2L3CA 3Q6NA 1Y4SA 1H74A 4DPTA 3IWCA 1H73A 1Z0WA 3ADIA 2Z5BA 2A2CA 5LMUE 2KHXA 5FLXQ 5IT9C 4DV4E 3J81C 1GQEA 4DR2E 4DPWA 3J7Yp 1H7SA 2EZ6A 2RS6A 4HXZA 1GZ6A 1J5EE 3JAMQ 1Z0GA 1A6FA 1YZ9A 1FJGI 4YHHE 4IZKA 3KWRA 4MYUA 3WU4A 3B8HA 2L8TA 4TUGA 4JI0I 3OTOI 5AE2A 1I94E 2FGGA 4LF7E 1J26A 3C4TA 4BMJA 4B3ME 2YZTA 3T1YI 4USKA 2LTSA 4NXMI 1N36E 4HACA 4JV5I 5A2QC 4B3TI 4AQYE 4M30A 3LTOA 3MSWA 1NHHA 4GEQB 2NUEA 4PRXA 2HKJA 5IT9Q 2DSYA 1HNZE 5CFFE 4BC9A 3H4LA 3V5RA 5IWAE 4B3RI 1K47A 4P7AA 3IWDA 3J7AM 1H72C 4OX9I 3M6AA 4F9CB 5L3JA 2LRSA 2K4VA 2HHHI 2J7KA 2L33A 2O1VA 1PVGA 1N33E 2Z5BB 3WU5A 3ZM7A 2VF3A 4DV2I 3ZZ0A 1Z5AA 1NHIA 2KONA 3HJCA 4F9AB 4DPUA 4LF9I 4DR6E 1OJ4A 1XNQI 2IOQA 2JWOA 1XMQE 3JU0A 2UUCE 3QT8A 1XNRI 2ZITA 4LF4I 3PYDA 2DMYA 4JI2E 4P52A 4FWHA 4IZKB 4DR4E 4JI7E 5FLXC 2UU9I 4JYAE 2M4IA 4GKKE 1KKHA 5LMNI 2UUAE 1KVKA 1N32E 1DI2A 4JI5E 4LFCE 1B63A 2VQFE 3T1HI 2FTXB 1ZXMA 2R42A 4LF6E 4DV5I 4DR3E 2MC5A 1FWLA 1Z5CA 4Z7YA 5GMEA 4HACB 3HPZA 3HPSA 2HK3A 1XHKA 2V34A 2UXDE 4PRVA 4JI6I 1IBME 1H7UA 3Q6MA 2RTXA 4LFBE 4DUYE 4LF8I 4DR7I 1Z59A 4OOGC 1ZM3A 3P1XA 2O1TA 2B7TA 4FWDA 3WU6A 3B78A 2B3TB 2NUGA 1HNWE 4X64I 1IBLE 4X8WA 2B7VA 1B62A 2Z5CA 4DV1I 1EKZA 1Y4UA 1WHNA 2WZOA 4DMIA 1RREA 2UXBE 4JI3I 2V88A 5BR8I 1MX0A 3B82A 2ZM6I 2E1MA 1SR9A 2H36X 2V87A 4XTJA 3Q1QA 1RQ0A 1EI1A 2XEXA 4F9BB 2UUBI 2L92A 2LBSB 4X65E 1XMOE 2E5LI 3QT7A 4DR2I 4L8NA 2LJPA 3DF6A 1FKAE 4DUZE 1X49A 2M1SA 1ZM9A 4DV0I 4YHHI 1ZBQA 2JR1A 2NPFA 2BM0A 4X66I 3K6QA 3ADJA 2CG9A 3PYGA 4X62I 4JI0E 4HYMA 3CWVA 3OTOE 2BV3A 1I94I 3J80Q 1YYWA 4HY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  4JI8 E;  2DIX A;  3T1Y E;  4LFA E;  3ZKB A;  2RS7 A;  4DU7 A;  1KTV A;  1RC7 A;  4DKK A;  1IBK E;  4FWG A;  3J7A G;  4B3T E;  2F4V E;  4R1F A;  4DPX A;  1FNM A;  4NXN I;  2BM1 A;  2V8P A;  1Z0E A;  1N0V C;  3QT5 A;  1FWK A;  2HFS A;  4WUB A;  4URL A;  1BKN A;  2EFG A;  4B3R E;  1T4L B;  4OX9 E;  2N3H A;  2LUQ A;  4YY3 I;  1HNX I;  2VQE E;  3WU3 A;  1UHZ A;  4DV2 E;  1T4N A;  4DR6 I;  1UIL A;  1XNQ E;  1XMQ I;  2UUC I;  4LF5 I;  3LLH A;  1XNR E;  1QZR A;  4LF4 E;  1S4E A;  4JI2 I;  4Z7C A;  3F0N A;  1HR0 E;  1N34 I;  4DR4 I;  4KQV A;  4JI7 I;  4JI4 I;  4KHP I;  4DV3 I;  1O0W A;  1S16 A;  2UU9 E;  4K0K I;  1STU A;  4PU9 A;  4RPF A;  5LMN E;  2UUA I;  1Z0V A;  1N32 I;  2N3G A;  4JI5 I;  3T1H E;  1N0U A;  4DR3 I;  1Z0C A;  3GON A;  4DV5 E;  1X47 A;  4GKJ E;  1WUU A;  2MDR A;  2NUF A;  2UXC E;  4DV7 E;  2UXD I;  2NA2 A;  3ZZT A;  2LTR A;  4DR1 E;  1Z0T A;  4LFB I;  1WHQ A;  4DUY I;  3J80 C;  4B3S E;  4M1K A;  4LF8 E;  4DR7 E;  4DV6 E;  4WUC A;  1DAR A;  4JI1 I;  1T4O A;  2DEI A;  1HNW I;  1YYO A;  1Z0B A;  4MYT A;  1IBL I;  4WFT A;  3HUL A;  4DV1 E;  2E1R A;  2JVA A;  1ZM4 A;  1U2R A;  5LMU I;  4DV4 I;  2YT4 A;  2ZM6 E;  3D4J A;  4FW9 A;  5LL6 R;  2WW4 A;  4FN5 A;  2UUB E;  1J5E I;  4X65 I;  1XMO I;  2X7I A;  2E5L E;  2HK2 A;  2DEJ A;  1FJG E;  3HTX A;  3PYF A;  4DUZ I;  4DV0 E;  2CPN A;  4LF7 I;  2GS8 A;  4M2Z A;  1ZXN A;  4X66 E;  4B3M I;  2V2V A;  3V2U C;  4X62 E;  4NXM E;  1N36 I;  4JV5 E;  4AQY I;  4DR5 I;  2L2M A;  4JI8 I;  4UT4 A;  4LFA I;  4EMD A;  1PIE A;  1HNZ I;  1IBK I;  2LUP B;  4WUD A;  2F4V I;  5IWA I;  3K1J A;  4NXN E;  2L2N A;  2HHH E;  1N33 I;  3J81 Q;  2L2K B;  2LJH A;  3LNU A;  3ADL A;  4DXL A;  1ELO A;  2VQE I;  4YY3 E;  1EA6 A;  1HNX E;  4LF9 E;  4ZVI A;  3VYY A;  1NZ0 A;  4DU8 A;  4USM A;  2AJ4 A;  1KIJ A;  4JG4 A;  4ED4 A;  2CZ9 A;  3ADG A;  3ZZU A;  1NHJ A;  2RSM A;  1FI4 A;  4JYA I;  1Z5B A;  1ZM2 A;  4LF5 E;  4GKK I;  2ZBK B;  2OI2 A;  1HR0 I;  4LFC I;  2A2D A;  2VQF I;  1N34 E;  5A2Q Q;  4JI4 E;  1MG7 A;  4LF6 I;  4KHP E;  4DV3 E;  1D6T A;  3PYE A;  4K0K E;  2HKE A;  1PKP A;  2R3V A;  5GMD A;  2IHR 1;  3C4B A;  3JAM C;  4GKJ I;  4WYQ B;  1IBM I;  2JY9 A;  4JI6 E;  3LPS A;  3QT6 A;  1VIS A;  1UEK A;  3K17 A;  2UXC I;  2Q2E B;  4I3H A;  1YYK A;  2X36 A;  4DV7 I;  2L3J A;  1X48 A;  1ZBT A;  4DR1 I;  2DB2 A;  4X64 E;  1RR9 A;  2V2Z A;  3ZKD A;  4DPY A;  4B3S I;  4DV6 I;  4UTG A;  2HFU A;  1QU6 A;  2UXB I;  4JI1 E;  4JI3 E;  2V2Q A;  5BR8 E;  3VYX A;  1MU5 A;  2L3C A;  1H74 A;  4DPT A;  1H73 A;  1Z0W A;  3ADI A;  2A2C A;  5LMU E;  2KHX A;  5FLX Q;  5IT9 C;  4DV4 E;  3J81 C;  1GQE A;  4DR2 E;  4DPW A;  3J7Y p;  1H7S A;  2EZ6 A;  2RS6 A;  4HXZ A;  1J5E E;  3JAM Q;  1Z0G A;  1A6F A;  1YZ9 A;  1FJG I;  4YHH E;  4MYU A;  3WU4 A;  3B8H A;  4JI0 I;  3OTO I;  1I94 E;  4LF7 E;  1J26 A;  3C4T A;  4B3M E;  3T1Y I;  4USK A;  2LTS A;  4NXM I;  1N36 E;  4HAC A;  4JV5 I;  5A2Q C;  4B3T I;  4AQY E;  4M30 A;  3LTO A;  1NHH A;  2NUE A;  4PRX A;  2HKJ A;  5IT9 Q;  1HNZ E;  5CFF E;  3H4L A;  3V5R A;  5IWA E;  4B3R I;  1K47 A;  4P7A A;  3J7A M;  1H72 C;  4OX9 I;  3M6A A;  5L3J A;  2LRS A;  2HHH I;  2J7K A;  2L33 A;  1PVG A;  1N33 E;  3WU5 A;  3ZM7 A;  2VF3 A;  4DV2 I;  3ZZ0 A;  1Z5A A;  1NHI A;  4DPU A;  4LF9 I;  4DR6 E;  1OJ4 A;  1XNQ I;  1XMQ E;  2UUC E;  3QT8 A;  1XNR I;  2ZIT A;  4LF4 I;  3PYD A;  2DMY A;  4JI2 E;  4P52 A;  4FWH A;  4DR4 E;  4JI7 E;  5FLX C;  2UU9 I;  4JYA E;  4GKK E;  1KKH A;  5LMN I;  2UUA E;  1KVK A;  1N32 E;  1DI2 A;  4JI5 E;  4LFC E;  1B63 A;  2VQF E;  3T1H I;  1ZXM A;  2R42 A;  4LF6 E;  4DV5 I;  4DR3 E;  1FWL A;  1Z5C A;  4Z7Y A;  5GME A;  4HAC B;  2HK3 A;  1XHK A;  2V34 A;  2UXD E;  4PRV A;  4JI6 I;  1IBM E;  1H7U A;  2RTX A;  4LFB E;  4DUY E;  4LF8 I;  4DR7 I;  1Z59 A;  4OOG C;  1ZM3 A;  3P1X A;  4FWD A;  2B7T A;  3WU6 A;  3B78 A;  2B3T B;  2NUG A;  1HNW E;  4X64 I;  1IBL E;  4X8W A;  2B7V A;  1B62 A;  4DV1 I;  1EKZ A;  1WHN A;  1RRE A;  2UXB E;  4JI3 I;  5BR8 I;  1MX0 A;  3B82 A;  2ZM6 I;  3Q1Q A;  4XTJ A;  1RQ0 A;  1EI1 A;  2XEX A;  2UUB I;  2LBS B;  4X65 E;  1XMO E;  2E5L I;  3QT7 A;  4DR2 I;  2LJP A;  1FKA E;  4DUZ E;  1X49 A;  4DV0 I;  1ZM9 A;  4YHH I;  2NPF A;  2BM0 A;  4X66 I;  3ADJ A;  3PYG A;  4X62 I;  4JI0 E;  4HYM A;  3CWV A;  3OTO E;  2BV3 A;  1I94 I;  3J80 Q;  1YYW A;  4HY1 A; 
#chains in the Genus database with same CATH topology
 4R2A A;  4DR5 E;  2EMX A;  5A6J A;  2PNZ B;  2Q8U A;  4JI8 E;  4M0V A;  2DIX A;  2EM9 A;  3T1Y E;  4LFA E;  2G7H A;  3ZKB A;  2RS7 A;  5T6J A;  4DU7 A;  1KTV A;  1RC7 A;  4RHB B;  4DKK A;  1IBK E;  3J7A G;  1XXE A;  4FWG A;  4B3T E;  3M7N G;  1IQS A;  2F4V E;  2EQ1 A;  1SFE A;  4R1F A;  4DPX A;  1FNM A;  4NXN I;  2V89 A;  2EMA A;  1Z0E A;  2HJJ A;  2BM1 A;  2V8P A;  4AIM A;  4WSP A;  4HTG A;  1N0V C;  3QT5 A;  3WU6 A;  1Y6Z A;  2Z5C B;  1FWK A;  2YSP A;  4L5N C;  2HFS A;  4WUB A;  2PRT A;  4URL A;  4AM3 A;  4I8O A;  1BKN A;  2EFG A;  4F6M A;  3EPH A;  4B3R E;  2YTF A;  1T4L B;  4OX9 E;  2N3H A;  2LUQ A;  1DQ3 A;  4YY3 I;  1ZU1 A;  1HNX I;  2VQE E;  2VF1 A;  3MHS C;  2EPM X;  3WU3 A;  1UHZ A;  2DLK A;  4IJD A;  4P78 A;  4P7D A;  2EMF A;  2EOH A;  5IXM B;  4ZYE A;  4DV2 E;  1TF3 A;  1DGC A;  1EH6 A;  1T4N A;  3LML A;  2EE8 A;  3ZOQ B;  1Y5Y A;  3FIG A;  3F6H A;  4DR6 I;  1UIL A;  1X6H A;  5FWK A;  2EWL A;  2EOO A;  2RSI A;  5AAS A;  1XNQ E;  1XMQ I;  4F6N A;  2UUC I;  2EM3 A;  4LCF A;  4LF5 I;  3AUZ A;  3BF2 A;  3THO B;  3LLH A;  5AE3 A;  1XNR E;  1QZR A;  1AAY A;  4LF4 E;  1S4E A;  3L7Z B;  4JI2 I;  4OZE A;  4O4K A;  2EMG A;  3F0N A;  4Z7C A;  1A1J A;  1HR0 E;  1N34 I;  4DR4 I;  3DJW A;  4KQV A;  4JI7 I;  3F6G A;  2JEB A;  4JI4 I;  2GQ0 A;  4MQY A;  4DV3 I;  1G2D C;  1O0W A;  1S16 A;  4KHP I;  2UU9 E;  2MKD A;  4RH8 A;  4K0K I;  4R2E A;  4IFD B;  5KL6 A;  5JEA E;  5C0X C;  1STU A;  2DRP A;  2PNM A;  4PU9 A;  5LMN E;  4RPF A;  2UUA I;  1Z0V A;  4IFD F;  1N32 I;  2N3G A;  4JI5 I;  2VE7 C;  3T1H E;  2EPR A;  1N0U A;  5DNY A;  4DR3 I;  1Z0C A;  1HK7 A;  3RMP A;  4DV5 E;  3GON A;  2EL5 A;  1X47 A;  4GKJ E;  3K85 A;  1WUU A;  2JEA A;  1A1H A;  2MDR A;  2I13 A;  2NUF A;  3TQM A;  2UXC E;  3MHH C;  3GLL A;  2YTD A;  4DV7 E;  2UXD I;  2NA2 A;  3ZZT A;  1P47 A;  4J8Z A;  2LTR A;  2YTO A;  2LCE A;  4DR1 E;  2CSH A;  3P06 A;  1Z0T A;  3P3C A;  4MU1 A;  4NBQ A;  4LFB I;  1WHQ A;  4DUY I;  3J80 C;  4B3S E;  4M1K A;  4LF8 E;  4DR7 E;  2EN2 A;  4DV6 E;  4MU3 A;  3C6M A;  1ZAA C;  1BBO A;  4WUC A;  1DAR A;  4JI1 I;  1T4O A;  1F2I G;  2DEI A;  3M85 D;  1HNW I;  1YYO A;  1Z0B A;  1GTK A;  1ZR9 A;  4MYT A;  5JEA C;  1IBL I;  2EM0 A;  4WFT A;  4ZYH A;  2EMC A;  2EL4 A;  3HUL A;  4DV1 E;  2NN6 B;  2E1R A;  1AH5 A;  2EMZ A;  1UBD C;  2JVA A;  4TUI A;  1E3P A;  1ZM4 A;  1U2R A;  5LMU I;  4LTY A;  4DV4 I;  3VHT B;  2EMI A;  5LLQ A;  4IZJ A;  2YT4 A;  2ZM6 E;  5DNX A;  2K7I A;  2Z5E A;  3PS1 A;  1R6M A;  3D4J A;  5LL6 R;  1WXR A;  4FW9 A;  2FV4 B;  2WW4 A;  4FN5 A;  4OO1 A;  1L4S A;  3KRN A;  4GZN C;  2UUB E;  5DNL A;  2BA1 D;  1J5E I;  2GHF A;  2B9D A;  4X65 I;  3M85 G;  2NN6 D;  2X7I A;  2DMI A;  1XMO I;  5A69 A;  2E5L E;  2HK2 A;  1USV A;  4LCH A;  2DEJ A;  1FJG E;  2ELZ A;  2V8Q B;  3HTX A;  3VK6 A;  2JEB B;  2F1D A;  3KZY A;  2EPL X;  3PYF A;  2ODR D;  4DUZ I;  1JK2 A;  2EOF A;  4FW6 A;  3JTZ A;  4IFD E;  4HEI A;  2MC6 A;  4DV0 E;  2CGE A;  2JP9 A;  5F3W A;  2EJ4 A;  2KOU A;  3L00 A;  2CPN A;  4LF7 I;  2GS8 A;  2L6M A;  2ENC A;  2HC5 A;  5K36 A;  3P3E A;  4M2Z A;  1ZXN A;  4X66 E;  4B3M I;  2JOB A;  1UDN A;  5AE1 A;  2JOX A;  2EM6 A;  2V2V A;  4WXC A;  2JEA B;  3DD6 A;  4F54 A;  3V2U C;  4X62 E;  3BID A;  4NXM E;  2BA1 G;  3NZK A;  4BBY A;  1N36 I;  5DRR A;  4N3O A;  4JV5 E;  1TN9 A;  4AQY I;  4DR5 I;  2L2M A;  3U1Y A;  4JI8 I;  4UT4 A;  2JXP A;  2YTG A;  4LFA I;  4KWY A;  4EMD A;  1RMD A;  2NAB A;  1OYR A;  1PIE A;  1HNZ I;  2EMW A;  3CDI A;  1IBK I;  2LUP B;  4WUD A;  3PS2 A;  3AV0 A;  2F4V I;  5IWA I;  3EPK A;  4BHB A;  4WX9 A;  3H09 A;  3CDJ A;  3K1J A;  1KJK A;  2BR2 A;  2J7J A;  4ISA A;  4NXN E;  2WNR A;  4IFD C;  2EOJ A;  3PRY A;  2L2N A;  1X6E A;  2PO2 A;  4FW4 A;  2YRK A;  2JYA A;  2HHH E;  5EL9 A;  3HXL A;  4LU9 A;  4U3B A;  3J81 Q;  1N33 I;  2EL6 A;  2V85 A;  2L2K B;  2NN6 A;  2LJH A;  3HQ1 A;  4R2S A;  2NN6 E;  2O1W A;  1LLM C;  2O1U A;  3LNU A;  4BA2 A;  2YSO A;  3ADL A;  4DXL A;  1ELO A;  5KL3 A;  4IZJ B;  1QNT A;  2M7Q A;  2VQE I;  4YY3 E;  1EA6 A;  4O24 A;  1HNX E;  4LF9 E;  4ZVI A;  4LCG A;  1A1F A;  2GO3 A;  3B4T A;  1EH8 A;  3VYY A;  2EM4 A;  2YTJ A;  4OO1 B;  1NZ0 A;  4DU8 A;  2MKN A;  4USM A;  1UN6 B;  2IOP A;  2LMZ A;  5AC4 A;  4OO1 F;  2AJ4 A;  1X5W A;  2EM8 A;  2EQ0 A;  3BGH A;  1KIJ A;  4JG4 A;  4ED4 A;  2EOS A;  1YUI A;  3IWB A;  2YTQ A;  2CZ9 A;  3ADG A;  5ADZ A;  3ZZU A;  1NHJ A;  1R6L A;  2RSM A;  2N8X A;  1FI4 A;  4JYA I;  1Z5B A;  1ZM2 A;  2EOY A;  4IZJ D;  4LF5 E;  4N4R B;  2IES A;  4GKK I;  2ZBK B;  2YWQ A;  4BCA A;  1OYP A;  1USU A;  2OI2 A;  4OO1 D;  1YFH A;  1PJS A;  1HR0 I;  3P76 A;  4LFC I;  2A2D A;  2YTN A;  1N34 E;  2VQF I;  4GQU A;  5K36 B;  5A2Q Q;  4JI4 E;  1MG7 A;  5DRO A;  4KHP E;  2BA0 D;  4DV3 E;  4R8O A;  4LF6 I;  1D6T A;  3PYE A;  4K0K E;  2HKE A;  3PS3 A;  5K36 F;  2WP8 A;  4BC7 A;  4R03 A;  3OML A;  4NHR A;  1PKP A;  2ODR C;  2PNL A;  4FW7 A;  2EMY A;  2EN3 A;  2EMH A;  2R3V A;  2EOM A;  2EOX A;  5GMD A;  3THN A;  4WXD A;  2IHR 1;  3C4B A;  1UDS A;  2HGH A;  4BS9 A;  2GO4 A;  2ENA A;  2GLI A;  4KZS A;  3JAM C;  2BBG A;  4GKJ I;  4WYQ B;  2DGC A;  1IBM I;  2JY9 A;  4JI6 E;  5EKW A;  5K36 D;  5KL2 A;  3LPS A;  3QT6 A;  1VIS A;  4O43 A;  1UEK A;  3K17 A;  2UXC I;  2IER A;  2Q2E B;  4I3H A;  1YYK A;  3C6K A;  1T39 A;  2X36 A;  2EPC A;  2I9I A;  2LE2 A;  4DV7 I;  2L3J A;  1X48 A;  1ZBT A;  5KL4 A;  2BR2 B;  5KL5 A;  4MLQ A;  4AID A;  4DR1 I;  2YRM A;  2WNR B;  2DB2 A;  3ECR A;  4X64 E;  1RR9 A;  2PO2 B;  2V2Z A;  3ZKD A;  4DPY A;  1A1L A;  4B3S I;  4DV6 I;  2PO1 A;  4UTG A;  2HFU A;  2F8B A;  1QU6 A;  4WSG A;  2V83 A;  2UXB I;  4JI1 E;  4BA2 B;  1TF6 A;  1YSA C;  2EOZ A;  4WPY A;  4JI3 E;  2NN6 F;  2V2Q A;  5BR8 E;  3VYX A;  4Q28 A;  5A6A A;  2V86 A;  1MU5 A;  4Q35 B;  2LO3 A;  2L3C A;  2EPK X;  2CT1 A;  2EMB A;  1EH7 A;  3Q6N A;  1Y4S A;  1H74 A;  4DPT A;  3IWC A;  1H73 A;  1Z0W A;  3ADI A;  2Z5B A;  4OO1 E;  1E3H A;  2A2C A;  1X6F A;  1A1K A;  5LMU E;  2KHX A;  3M99 B;  5FLX Q;  5IT9 C;  4DV4 E;  5C0X B;  1UDO A;  2JE6 A;  3J81 C;  1GQE A;  4DR2 E;  1BB8 A;  4DPW A;  3J7Y p;  1H7S A;  5KL7 A;  2EZ6 A;  4MLV A;  3HKM A;  2LT7 A;  2RS6 A;  4HXZ A;  2EML A;  1GZ6 A;  1J5E E;  3EQ1 A;  3JAM Q;  1Z0G A;  2CTD A;  1A6F A;  1YZ9 A;  5DRP A;  1FJG I;  2M9A A;  4YHH E;  4IZK A;  1YH8 A;  3KWR A;  5A6K A;  4OKG A;  5K36 E;  4MYU A;  3WU4 A;  2GPI A;  5C0X D;  3B8H A;  2L8T A;  2VRD A;  4TUG A;  2WP8 B;  4JI0 I;  1P42 A;  3OTO I;  5AE2 A;  3EPJ A;  4LPF A;  3M7N D;  1I94 E;  2FGG A;  4LF7 E;  1J26 A;  4OO1 C;  3C4T A;  4BMJ A;  4B3M E;  2YZT A;  2YTP A;  3T1Y I;  4USK A;  2LTS A;  4M9V C;  4NXM I;  2CVE A;  4R2R A;  2LV2 A;  1N36 E;  1WRJ A;  4HAC A;  4JV5 I;  5A2Q C;  4B3T I;  4AQY E;  4M30 A;  2WBS A;  3P3G A;  2YU5 A;  3LTO A;  3MSW A;  1NHH A;  1A1I A;  4GEQ B;  4U3D A;  2NUE A;  1N3G A;  4PRX A;  2HKJ A;  5IT9 Q;  2DSY A;  4ZYG A;  2C38 B;  1HNZ E;  5CFF E;  2PO1 B;  4IS1 C;  5JEA D;  5K36 C;  1KYQ A;  2EN4 A;  4BC9 A;  3H4L A;  3V5R A;  5IWA E;  2RPC A;  1K47 A;  4P7A A;  3KZZ A;  4B3R I;  3IWD A;  3J7A M;  5DRQ A;  1H72 C;  4QNK A;  4OX9 I;  1PDA A;  3M6A A;  2LVH A;  2DLQ A;  4F9C B;  5L3J A;  2LRS A;  2K4V A;  2HHH I;  4R2P A;  2J7K A;  2L33 A;  2ENH A;  2EPX A;  2O1V A;  1PVG A;  1N33 E;  2WBT A;  3U1K A;  2Z5B B;  2LJU A;  4J3D A;  3WU5 A;  2VF3 A;  3ZM7 A;  3ZZ0 A;  4DV2 I;  1Z5A A;  4X9J A;  1NHI A;  2C39 A;  1Y60 A;  2KON A;  2BB8 A;  5C0X A;  3HJC A;  5TSE A;  4F9A B;  5C0X E;  4DPU A;  2EPZ A;  4R2D A;  4DR6 E;  2JE6 B;  4LF9 I;  1OJ4 A;  4R2Q A;  2ADR A;  2EN7 A;  1XNQ I;  2IOQ A;  2JWO A;  2YPN A;  1XMQ E;  3JU0 A;  3UK3 C;  2RQL A;  2UUC E;  3QT8 A;  1XNR I;  2ZIT A;  4LF4 I;  3PYD A;  2DMY A;  4JI2 E;  4P52 A;  3H1C A;  4FWH A;  1YHC A;  4IZK B;  1PJT A;  4DR4 E;  1IMU A;  2NN6 C;  4JI7 E;  5FLX C;  1NCS A;  1MEY C;  2AE8 A;  2UU9 I;  4JYA E;  2M4I A;  4GKK E;  2EOQ A;  5A6B D;  1B69 A;  4LOM A;  1KKH A;  5LMN I;  2VES A;  2EOE A;  2UUA E;  1KVK A;  4BHC A;  1N32 E;  1DI2 A;  3GCM A;  4JI5 E;  4LFC E;  1B63 A;  2VQF E;  4MU0 A;  3T1H I;  2FTX B;  4BA1 A;  1T38 A;  1ZXM A;  2R42 A;  4LF6 E;  4DV5 I;  4DR3 E;  5JEA A;  2MC5 A;  2EN1 A;  1FWL A;  1Z5C A;  2C37 A;  4Z7Y A;  5GME A;  2PO0 A;  3GME A;  4HAC B;  3HPZ A;  3HPS A;  2JPA A;  2HK3 A;  2PNZ A;  1A1G A;  1XHK A;  1UDQ A;  2UXD E;  2V34 A;  4PRV A;  2ELY A;  2YTE A;  2J65 A;  4JI6 I;  1IBM E;  2BA0 G;  3EPL A;  1G2F C;  2RTX A;  1H7U A;  3Q6M A;  2C38 A;  4LFB E;  4DUY E;  2YU8 A;  5ELW A;  2EQ3 A;  4IS9 A;  4LF8 I;  4DR7 I;  1Z59 A;  4OOG C;  1ZM3 A;  3P1X A;  2EPA A;  2B7T A;  2O1T A;  2O3Z A;  3B78 A;  2EPP A;  2MDG A;  4R2C A;  2YRH A;  4IFD D;  2B3T B;  2NUG A;  4O5G A;  1HNW E;  4X64 I;  1IBL E;  1IQO A;  1PJQ A;  2EN8 A;  4X8W A;  2B7V A;  1B62 A;  1YYW A;  3QG5 C;  2Z5C A;  1EKZ A;  4DV1 I;  1VI7 A;  1MGT A;  1Y4U A;  4QNJ A;  1WHN A;  2EN6 A;  2WZO A;  4DMI A;  1RRE A;  2UXB E;  4JI3 I;  2EM2 A;  2V88 A;  5AC5 A;  1JK1 A;  2C39 B;  5BR8 I;  5IV8 B;  1RHY A;  1MX0 A;  3B82 A;  2A25 A;  2ZM6 I;  1YPN A;  2EPU A;  2EPN A;  2YTI A;  2E1M A;  1SR9 A;  2H36 X;  2V87 A;  4XTJ A;  3Q1Q A;  5A6B A;  3BBG A;  1RQ0 A;  4FK5 C;  5C0X F;  1EI1 A;  4FWD A;  2XEX A;  2R76 A;  4F9B B;  2UUB I;  2R1F A;  3UHM A;  4MDT A;  4MU4 A;  2EOI A;  2L92 A;  2LBS B;  2EM5 A;  4X65 E;  1XMO E;  2E5L I;  3QT7 A;  2JT2 A;  4DR2 I;  1YUJ A;  2E72 A;  1BBG A;  2EP3 A;  4L8N A;  4ZYD A;  1WJP A;  2WBU A;  2LJP A;  3DF6 A;  4FW3 A;  1FKA E;  4NZV A;  4DUZ E;  2EOR A;  1OYS A;  1X49 A;  2M1S A;  4F2J C;  1ZM9 A;  3L7Z A;  2EM7 A;  4DV0 I;  2D9H A;  4YHH I;  1ZBQ A;  2JR1 A;  2NPF A;  2BM0 A;  4BA1 B;  4X66 I;  3K6Q A;  1NEI A;  4FW5 A;  3ADJ A;  2WCC 3;  5JEA B;  4IFD A;  2CG9 A;  3PYG A;  4X62 I;  1X3C A;  2EPO A;  4JI0 E;  4HYM A;  3CWV A;  3OTO E;  2BV3 A;  2C37 B;  5JEA F;  1I94 I;  1Z1B A;  2PO0 B;  3J80 Q;  2EMK A;  4HY1 A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  4JI8 E;  4M0V A;  2DIX A;  3T1Y E;  4LFA E;  2G7H A;  3ZKB A;  2RS7 A;  5T6J A;  4DU7 A;  1KTV A;  1RC7 A;  4DKK A;  1IBK E;  3J7A G;  4FWG A;  4B3T E;  2F4V E;  4R1F A;  4DPX A;  1FNM A;  4NXN I;  2V89 A;  2BM1 A;  1Z0E A;  2V8P A;  4WSP A;  1N0V C;  3QT5 A;  1Y6Z A;  2Z5C B;  1FWK A;  2HFS A;  4L5N C;  4WUB A;  4URL A;  4I8O A;  1BKN A;  2EFG A;  4B3R E;  1T4L B;  4OX9 E;  2N3H A;  2LUQ A;  1DQ3 A;  4YY3 I;  1HNX I;  2VQE E;  2VF1 A;  3WU3 A;  1UHZ A;  4P7D A;  4P78 A;  4DV2 E;  1T4N A;  3LML A;  3ZOQ B;  3FIG A;  3F6H A;  4DR6 I;  1UIL A;  5FWK A;  2EWL A;  5AAS A;  1XNQ E;  1XMQ I;  2UUC I;  4LF5 I;  3AUZ A;  3LLH A;  5AE3 A;  1XNR E;  1QZR A;  4LF4 E;  1S4E A;  4JI2 I;  4Z7C A;  3F0N A;  1HR0 E;  1N34 I;  4DR4 I;  3DJW A;  4KQV A;  4JI7 I;  3F6G A;  4JI4 I;  2GQ0 A;  4KHP I;  4DV3 I;  1O0W A;  1S16 A;  2UU9 E;  4K0K I;  1STU A;  4PU9 A;  2PNM A;  4RPF A;  5LMN E;  2UUA I;  1Z0V A;  1N32 I;  2N3G A;  4JI5 I;  2VE7 C;  3T1H E;  1N0U A;  5DNY A;  4DR3 I;  1Z0C A;  1HK7 A;  3RMP A;  4DV5 E;  3GON A;  3K85 A;  1X47 A;  4GKJ E;  1WUU A;  2MDR A;  2NUF A;  2UXC E;  4DV7 E;  2UXD I;  2NA2 A;  3ZZT A;  4J8Z A;  2LTR A;  4DR1 E;  3P06 A;  1Z0T A;  4LFB I;  1WHQ A;  4DUY I;  3J80 C;  4B3S E;  4M1K A;  4LF8 E;  4DR7 E;  4DV6 E;  4WUC A;  1DAR A;  4JI1 I;  1T4O A;  2DEI A;  1HNW I;  1YYO A;  1Z0B A;  4MYT A;  1IBL I;  4WFT A;  3HUL A;  4DV1 E;  2E1R A;  2JVA A;  4TUI A;  1ZM4 A;  1U2R A;  5LMU I;  4LTY A;  4DV4 I;  4IZJ A;  2YT4 A;  2ZM6 E;  2Z5E A;  3D4J A;  5LL6 R;  1WXR A;  4FW9 A;  2FV4 B;  2WW4 A;  4FN5 A;  2UUB E;  1J5E I;  2B9D A;  4X65 I;  1XMO I;  2X7I A;  2E5L E;  2HK2 A;  1USV A;  2DEJ A;  1FJG E;  2V8Q B;  3HTX A;  3VK6 A;  3PYF A;  2ODR D;  4DUZ I;  3JTZ A;  2MC6 A;  4DV0 E;  2CGE A;  5F3W A;  2KOU A;  2CPN A;  4LF7 I;  2GS8 A;  2L6M A;  4M2Z A;  1ZXN A;  4X66 E;  4B3M I;  2JOB A;  5AE1 A;  2JOX A;  2V2V A;  4F54 A;  3V2U C;  4X62 E;  4NXM E;  4BBY A;  1N36 I;  4N3O A;  4JV5 E;  4AQY I;  4DR5 I;  2L2M A;  4JI8 I;  4UT4 A;  4LFA I;  4EMD A;  1PIE A;  1HNZ I;  1IBK I;  2LUP B;  4WUD A;  3AV0 A;  2F4V I;  5IWA I;  3H09 A;  3K1J A;  4NXN E;  3PRY A;  2L2N A;  2HHH E;  3HXL A;  4LU9 A;  1N33 I;  3J81 Q;  2V85 A;  2L2K B;  2LJH A;  3HQ1 A;  2O1W A;  2O1U A;  3LNU A;  3ADL A;  4DXL A;  1ELO A;  4IZJ B;  2M7Q A;  2VQE I;  1EA6 A;  4YY3 E;  1HNX E;  4LF9 E;  4ZVI A;  3VYY A;  1NZ0 A;  4DU8 A;  4USM A;  2IOP A;  2LMZ A;  2AJ4 A;  1KIJ A;  4JG4 A;  4ED4 A;  3IWB A;  2CZ9 A;  3ADG A;  5ADZ A;  3ZZU A;  1NHJ A;  2RSM A;  1FI4 A;  4JYA I;  1Z5B A;  1ZM2 A;  4IZJ D;  4LF5 E;  4GKK I;  2ZBK B;  4BCA A;  1USU A;  2OI2 A;  1HR0 I;  4LFC I;  2A2D A;  2VQF I;  1N34 E;  5A2Q Q;  4JI4 E;  1MG7 A;  4LF6 I;  4KHP E;  4DV3 E;  4R8O A;  1D6T A;  3PYE A;  4K0K E;  2HKE A;  4BC7 A;  4R03 A;  3OML A;  1PKP A;  2ODR C;  2PNL A;  2R3V A;  5GMD A;  2IHR 1;  3C4B A;  4BS9 A;  4KZS A;  3JAM C;  4GKJ I;  4WYQ B;  1IBM I;  2JY9 A;  4JI6 E;  3LPS A;  3QT6 A;  1VIS A;  1UEK A;  3K17 A;  2UXC I;  2Q2E B;  4I3H A;  1YYK A;  2X36 A;  2LE2 A;  4DV7 I;  2L3J A;  1X48 A;  1ZBT A;  4DR1 I;  2DB2 A;  4X64 E;  1RR9 A;  2V2Z A;  3ZKD A;  4DPY A;  4B3S I;  4DV6 I;  4UTG A;  2HFU A;  2F8B A;  1QU6 A;  2V83 A;  2UXB I;  4JI1 E;  4WPY A;  4JI3 E;  2V2Q A;  5BR8 E;  3VYX A;  4Q28 A;  2V86 A;  1MU5 A;  2L3C A;  3Q6N A;  1Y4S A;  1H74 A;  4DPT A;  3IWC A;  1H73 A;  1Z0W A;  3ADI A;  2Z5B A;  2A2C A;  5LMU E;  2KHX A;  5FLX Q;  5IT9 C;  4DV4 E;  3J81 C;  1GQE A;  4DR2 E;  4DPW A;  3J7Y p;  1H7S A;  2EZ6 A;  2RS6 A;  4HXZ A;  1GZ6 A;  1J5E E;  3JAM Q;  1Z0G A;  1A6F A;  1YZ9 A;  1FJG I;  4YHH E;  4IZK A;  3KWR A;  4MYU A;  3WU4 A;  3B8H A;  2L8T A;  4TUG A;  4JI0 I;  3OTO I;  5AE2 A;  1I94 E;  2FGG A;  4LF7 E;  1J26 A;  3C4T A;  4BMJ A;  4B3M E;  2YZT A;  3T1Y I;  4USK A;  2LTS A;  4NXM I;  1N36 E;  4HAC A;  4JV5 I;  5A2Q C;  4B3T I;  4AQY E;  4M30 A;  3LTO A;  3MSW A;  1NHH A;  4GEQ B;  2NUE A;  4PRX A;  2HKJ A;  5IT9 Q;  2DSY A;  1HNZ E;  5CFF E;  4BC9 A;  3H4L A;  3V5R A;  5IWA E;  4B3R I;  1K47 A;  4P7A A;  3IWD A;  3J7A M;  1H72 C;  4OX9 I;  3M6A A;  4F9C B;  5L3J A;  2LRS A;  2K4V A;  2HHH I;  2J7K A;  2L33 A;  2O1V A;  1PVG A;  1N33 E;  2Z5B B;  3WU5 A;  3ZM7 A;  2VF3 A;  4DV2 I;  3ZZ0 A;  1Z5A A;  1NHI A;  2KON A;  3HJC A;  4F9A B;  4DPU A;  4LF9 I;  4DR6 E;  1OJ4 A;  1XNQ I;  2IOQ A;  2JWO A;  1XMQ E;  3JU0 A;  2UUC E;  3QT8 A;  1XNR I;  2ZIT A;  4LF4 I;  3PYD A;  2DMY A;  4JI2 E;  4P52 A;  4FWH A;  4IZK B;  4DR4 E;  4JI7 E;  5FLX C;  2UU9 I;  4JYA E;  2M4I A;  4GKK E;  1KKH A;  5LMN I;  2UUA E;  1KVK A;  1N32 E;  1DI2 A;  4JI5 E;  4LFC E;  1B63 A;  2VQF E;  3T1H I;  2FTX B;  1ZXM A;  2R42 A;  4LF6 E;  4DV5 I;  4DR3 E;  2MC5 A;  1FWL A;  1Z5C A;  4Z7Y A;  5GME A;  4HAC B;  3HPZ A;  3HPS A;  2HK3 A;  1XHK A;  2V34 A;  2UXD E;  4PRV A;  4JI6 I;  1IBM E;  1H7U A;  3Q6M A;  2RTX A;  4LFB E;  4DUY E;  4LF8 I;  4DR7 I;  1Z59 A;  4OOG C;  1ZM3 A;  3P1X A;  2O1T A;  2B7T A;  4FWD A;  3WU6 A;  3B78 A;  2B3T B;  2NUG A;  1HNW E;  4X64 I;  1IBL E;  4X8W A;  2B7V A;  1B62 A;  2Z5C A;  4DV1 I;  1EKZ A;  1Y4U A;  1WHN A;  2WZO A;  4DMI A;  1RRE A;  2UXB E;  4JI3 I;  2V88 A;  5BR8 I;  1MX0 A;  3B82 A;  2ZM6 I;  2E1M A;  1SR9 A;  2H36 X;  2V87 A;  4XTJ A;  3Q1Q A;  1RQ0 A;  1EI1 A;  2XEX A;  4F9B B;  2UUB I;  2L92 A;  2LBS B;  4X65 E;  1XMO E;  2E5L I;  3QT7 A;  4DR2 I;  4L8N A;  2LJP A;  3DF6 A;  1FKA E;  4DUZ E;  1X49 A;  2M1S A;  1ZM9 A;  4DV0 I;  4YHH I;  1ZBQ A;  2JR1 A;  2NPF A;  2BM0 A;  4X66 I;  3K6Q A;  3ADJ A;  2CG9 A;  3PYG A;  4X62 I;  4JI0 E;  4HYM A;  3CWV A;  3OTO E;  2BV3 A;  1I94 I;  3J80 Q;  1YYW A;  4HY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...