1USVA

The structure of the complex between aha1 and hsp90
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
255
structure length
251
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 73
structure length 251
sequence length 255
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1usvA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usvA02
2IOPA 2O1VA 3Q6NA 2GQ0A 1USVA 2O1UA 1HK7A 2O1TA 2O1WA 3HJCA 2IOQA 1Y6ZA 3PRYA 1Y4SA 3Q6MA 1USUA 1Y4UA 2CG9A 2CGEA 5FWKA
chains in the Genus database with same CATH superfamily
3QKTA 1L7RA 1RWBA 2P65A 4BNHA 1FS6A 3O91A 1SCUA 2W2NA 3EJWA 4PRZA 5ELWA 1QGED 4OX9B 4BFUA 5LOVF 2TMYA 2UYGA 2AFIE 4KN8A 1HZZA 4KPUB 4PZYA 4Q3EA 2RGAA 3TNFA 1SUSA 4J91A 1P5FA 3ZV4A 3RS7A 2AUMA 5FBLB 4D9MA 4S05A 1JU9A 2HF2A 4KDEA 4DABA 1Y8CA 4F3NA 4OBXA 5TS2A 2XRFA 2YXBA 3KYDA 1BMDA 3N2YA 3PCRB 4I9GA 3U7QB 1TT7A 3RVMA 4BA2B 4RY8A 4ZT6A 3PNOA 5HIMA 5LKAA 3A6FA 4G9BA 5CLLA 2DETA 1YUNA 3MTEA 1PQWA 4IDOA 4X9XA 1T3SA 4JB3A 1TF7A 2DR3A 1YQTA 4S1TA 5G53C 2XZLA 2CGEA 3WE7A 4TXNA 1SXJC 4QE3A 3MUFA 1YK0A 1QDLB 5AJWA 3STTA 1RAEA 4KDFA 4LRWA 2Z5CA 2OLEA 2WB4A 5HCNA 3EIFA 4C04A 4K0KE 2PYDA 1MENA 2PNJA 1MA3A 4EEXA 3VR2D 3UW1A 3RJMA 1TK3A 3HP1A 4FHGA 3SK0A 1FOEB 1E89A 4NG5A 2IHTA 1N34E 1PTJC 1Q0SA 1BRMA 2GAOA 2ORWA 1NUTA 4BJ1A 2FR8A 5EE9A 3T7RA 4HOYA 3UVEA 5BSKA 1EFPA 3MMXA 2GHQA 1DIAA 4MS1B 5DKFA 5IBCA 1I10A 2JH3A 4JJFA 4TMZA 1RIFA 1C8KA 3I1IA 3LG2A 2R42A 4P84A 4A03A 5K6TA 1MGPA 4JOQA 1YS4A 4Q02A 1CFZA 3E05A 3LWBA 2C04A 5IN5A 3A27A 3ZGVA 5B6PA 3NANA 4WXMA 1D2GA 4WVFA 2IUEA 3JQ7B 3USCS 3UV3A 5K3OA 1YKGA 1DADA 1EE9A 4GPAA 1N5IA 1FLDA 5DHSA 1JLLA 4NCXA 4BMVA 5HZHA 2FK8A 1ZIDA 4JLPA 5L53A 3F90A 2BN4A 3MJSA 2Q41A 1R5NA 1Z0WA 1QIFA 3BH7A 5AJYA 5ETJA 1LVGA 3P5SA 5KX5F 4QVIA 1V7QA 2EBFX 3H9UA 2P40A 4D8UA 3L0SA 4TT3A 5FLXA 1ZMBA 4DSZA 1GNLA 2XDQA 5EIWA 1PCXA 2Q5IA 2YJTD 2YWBA 4RV4A 1MIHA 2QW0X 4LVCA 4L50A 4UAVA 3QT7A 1R6XA 3H5TA 2F00A 4KPEC 4LCHA 2GRUA 5DRTA 2HRDA 2W48A 2QAGB 3ONFA 4ZTZB 2CDBA 5CAEB 5AKGA 3ROXA 5AKZA 5J58A 5BXYA 4MWTA 3O8LA 2JPDA 4FGSA 3VZCA 4AQYE 3HH8A 3MT8A 5LN1A 3W5BA 1F9EA 4ZXFA 3ZJUA 1GGHA 3VPBA 2WUGA 2OAP1 3ZYCA 1H5QA 1Y7LA 2XRYA 4QPPA 3AUXA 3WNVA 2AC7A 2Q6LA 4ETNA 3DOCA 1R4NB 4BV8A 3IAM1 1ZWKA 1GYPA 2GN4A 1Y60A 4BNGA 4PPGA 1D09A 4XB6B 2G1KA 1WZEA 2YRXA 3BHIA 4G5YA 3T41A 2JFXA 4LFBE 4WFQA 3W5JA 2CFCA 1XDDA 1MTZA 2CMKA 2W6ID 4Q37A 5IVKA 4FBMA 1V9SA 1UWCA 1UADA 4KW7A 3GLVA 4PC1A 2JRLA 3MWDA 1ABFA 3ZGNA 4B4DA 4OY3A 4O1IA 1GTMA 3C24A 4M0UA 4YRJA 5K3DA 5DCUA 3Q11A 4JNKA 2Q4EA 4PYNA 1DX6A 1H05A 1WPGA 2W6NA 1V5WA 3GEMA 4OXKA 3KL2A 4ZC1A 3SG0A 3DDCA 3KAQA 1SVNA 4IV0A 1L5QA 1II8A 1EFLA 4RK5A 4TWJA 3G7UA 3TJRA 3V3KA 4LCJA 2IOYA 5LC1A 1OFVA 1MAHA 1DOAA 1YHNA 2G4LA 4P7BA 2J65A 4EJSA 3PKZA 1UBHS 5C1BA 3IOCA 4OM7A 4ZQCB 1XD2B 3VZRA 1Z16A 1WCIA 2VA8A 2XKJE 4X3PA 1B6SA 2VDPB 4US0R 4X62B 3BRCA 4ESOA 1Z0SA 2Z2YA 3DYIA 1NSTA 1E2LA 1Y5IA 3OPYB 3KUUA 5CBPB 1R0YA 2PH7A 3KQSA 3Q8MA 1YOBA 2H08A 3GLIE 2GH1A 3JQCA 4LXTA 4FEAA 1CRPA 2WILA 1WOYA 2H1CA 1AQUA 3OQJA 2HV8A 3ETLA 3HN6A 3Q98A 3QUAA 1EM8A 2BFCB 2X86A 1Y1QA 1A3CA 4IZJA 1YB5A 2R68A 4BXOB 2O8CA 3BWCA 1KJJA 1Z4PX 4JLJA 2WYWA 1I6WA 1TQ8A 4ZT2A 2IIBA 1PU2A 1J56A 1SHKA 3E35A 2YIDA 4CYMA 1T1EA 2A0XA 2H1LA 1JFVA 3VHQA 2GTPA 3SVLA 4I46A 3I28A 1E5DA 2CXPA 4NR0A 2GUWA 3KQMA 4NVRA 5EOVA 2IEGA 3FAKA 4XFJA 4ARZA 4QTTB 5IMSA 2P9ZA 3K8ZA 1U7HA 1VIYA 1XHEA 1N0UA 3NYWA 4S24A 3NYIA 4I1UA 2C5AA 3KVVA 4BL5A 1ZUD1 3DLBA 4DV3E 1CUZA 2C77A 4X7RA 3JQ8A 2W2QA 5ALVA 4CHTA 1PJQA 1VZ2A 1RT9A 4GZMA 4NBRA 4X45A 3RJZA 5DNXA 1GAQA 2V8OA 3BIJA 3DFZA 4TMVA 5CPBA 4MUJA 1TEZA 1O5TA 5AQEA 4B6FA 1QRDA 5K09A 5J1SB 3OHMA 4MUMA 2AJLI 3NGMA 3WK5A 3U31A 1ZEJA 1E6LA 1QH1A 4ITUA 4C1BA 1EFAA 3P20A 1E0DA 2VCHA 4JU9A 5ALUA 1VE7A 2HXSA 4XVCA 4J0GA 1TJ5A 4O4JA 2AS0A 3VO9A 1K0UA 2WRZA 4H1HA 4CDRA 5C18A 1RYBA 4JA0A 1X8KA 1OI4A 2RJNA 5I8WA 2VBCA 1BE8A 1HLFA 2PUTA 1ML3A 2HQ1A 4IDCA 3EC7A 3SQDA 3CUVA 1D6JA 1WABA 3QVTA 4CN9A 1NMZA 3T4UA 1I1QB 2A0KA 2C88A 4Y98A 5J4YA 4HDRA 1RQ2A 3WGGA 1ZI6A 1IOVA 3VC3A 5BQ3A 5CHEA 5EPEA 4TL7A 4LDZA 2V96A 4AZ0B 3CUEF 1MJ5A 4DJFC 4MR7B 1YZYA 1L6RA 1XXHE 2FPOA 2I99A 2OFOA 5AUPB 4MULA 3N0TA 1T9DA 1U7TA 3FYCA 3PYLA 1ZGAA 3DTVD 3LWDA 4O29A 5CVTA 1Q0TA 2WTNA 4U39A 1PGOA 4XX1A 2H06A 2WV9A 4KGVA 4W1RA 2WYHA 1E6KA 4R2HA 3UB3A 2Z5VA 1MD9A 3ICPA 4LF8B 1QGUA 4U2DA 1EEHA 5GGXA 5KTRA 1KERA 1OWMA 2VH1A 1AF4A 4O2BF 3RSHA 3C70A 1N5RA 2WU4A 4RK4A 4IDPA 1JHPA 1E3IA 4HRXA 4IXWA 1NXVA 3URMA 3MPUA 3GG9A 2PBRA 3M70A 4LIPD 4A0QA 3C6YA 1JFLA 2X22A 4OQFA 1ZD9A 3HPQA 1HA3A 3A9RA 1U0OC 5C8YB 1YR1A 3ZJTA 4LY3A 4Y6GB 1UKBA 4P2BA 4R0VA 5JCJD 2ARKA 1P5HA 4BWGA 5A06A 1WCV1 4JA2A 2GAJA 4XUCA 3A9VA 4JC0A 2P62A 1TEVA 4LDQA 4IHJF 3GZJA 2A5YB 3OOHA 1AGRA 2JKZA 4DU7A 2WG1A 3P9ZA 3VOTA 4PHGA 1V5FA 4WJLA 5CLQA 5JYDA 1KXZA 1E0KA 2F9LA 4C5CA 5LXTA 2PLAA 4QRDA 1AZSC 4D79A 3H8SA 3K0KA 2YYZA 1L7DA 1NAHA 2AMYA 5IZCA 4LZOA 4IR7A 1DARA 4NFYA 1I01A 5FIUA 1IHXA 1WNTA 1IBMI 1LDMA 2P35A 3ZCSA 5LIRA 1CRLA 2I22A 3R3UA 1WDWB 2R6JA 5B3JC 2R8XA 1FRZA 3IYLW 4AFNA 4ENRA 2BMFA 2GJ9A 3PHHA 1LWNA 2D0IA 5AUQA 2CNWD 1KDOA 2G83A 3K35A 4CCWA 3P71T 3BKXA 3G2HA 1W96A 3QIAA 3PCTA 1T10A 2O4UX 1EHIA 4ASUD 3DKPA 3FMPB 2B8WA 1EP1B 1ZN8A 1AKMA 1PLKA 4RZQA 4MLCA 1O0CA 3WV4A 2E4AA 1SD2A 4HN2A 3LLVA 4PONA 4AG5A 2G5CA 4L9WA 1J2YA 1UOQA 1Z39A 3M0EA 1D4AA 1C2YA 4FDLA 5IDXA 5AVKA 3RC2A 5M2QA 1UFQA 3ZCPA 2XWQA 3OZCA 1BG6A 1Q20A 4G8BA 1BMQA 1AQYA 1D8AA 3NHKA 1G59A 3VYUB 1SCKA 4DWVA 4K28A 4J49A 2IVZA 4WTOA 3EBOA 1XBTA 5ICEA 4EPVA 3WFJA 3BD9A 4CL0A 2BUBA 3QEMA 4ZOBA 3Q3IA 1JLKA 1KVUA 3LT5A 2OA0A 4B7XA 2PUGA 4BASA 1USKA 3UWSA 2KMLA 1OYSA 4X85A 5EXEA 1HUQA 1H85A 2H00A 4UAJA 2BMEA 3I37X 5LJIA 5IF9A 1GQSA 4PLWA 3PXCX 1IE3A 1RACA 3ZX5A 3Q2OA 1UDWA 1Z25A 5CHYA 2X1LA 3I9V6 3WS7A 4HZUA 4U4AA 1DAIA 3U9LA 2O0JA 3LXXA 5CEEA 4RLHA 1KH2A 1B1CA 2WKSA 5LMNI 4YREA 3AESB 3UAZA 3DBLB 1V47A 3CF0A 1M8KA 1SOVA 2IQ5A 1V4VA 3KHKA 2J3MA 4M1ZA 4C21A 4F12A 3CF2A 4PSVA 4KWTA 1FRVA 4HY1A 1P1FA 1ZU5A 3NX4A 2IU3A 4RJKA 1PBNA 2DWOA 5T57A 4EVSA 5MGNA 5CB0A 2Q62A 3ZBQA 3NVKI 3H6GA 3I5UA 4PGMA 3HVRA 2A9KA 1K86A 3OCJA 3TAUA 3QFSA 4E3WA 2VNJA 1GPH1 3GVXA 4JUBA 4KQKA 5AKIA 4M0EA 2YVAA 2BVNA 2R9VA 5JD4A 2J59A 3K1JA 4NKRA 2CZ9A 5KHAA 2VAVA 4OQQA 4CFYA 1GILA 1GNTA 1CB0A 2JL1A 1JF8A 1ZGCA 1Q6YA 3K1AB 4PICA 1I13A 2YMMA 4C4ZA 3ODPA 3CJQA 4B85A 3CRQA 3OTOB 3JQEA 1P0QA 2A2CA 1EGVB 1VGRA 2CHGA 3OCZA 3RU9A 3QA9A 1PV4A 1MEJA 3HCNA 4U6QA 1O94A 1E7SA 2A4MA 1QOPB 4WZAA 4GF5A 1AZLA 1KJQA 4CF4A 4GKKE 2EIXA 3N07A 4UTZA 5E6RA 3THYA 1H8ED 1FDVA 4GD3Q 2OM6A 4CKBA 5JXJA 1P72A 1W4RA 1KI8A 2HU5A 1QWSA 1XMSA 5DK4A 1JBKA 1W75A 2WB2A 3TD9A 4M9ZA 4RMJA 5KU7A 3D7MA 4PPFA 5F76A 1E5TA 4GLBA 1CUVA 2K4MA 5EKTA 1Y4SA 4CODB 1H3FA 2ZI6A 4IDGA 1F17A 4FMDF 4U7JA 1ZRNA 4UZFA 4C6TB 3SNHA 4CQMD 1N2IA 4ZZ3A 1CCWA 4KP7A 1FSSA 1SUPA 2F6RA 3IOBA 4MIOA 5LPNA 1QHIA 2HRBA 2R6GA 4F3KA 1ECCA 1POXA 4ZVKA 4AY2A 3ZZ0A 5K3FA 4D9IA 1V11B 2PAFA 4I36A 3Q7EA 2CXNA 2XIJA 4JLBA 1BWQA 5THKA 3C3WA 5IDVA 1UOPA 2DE0X 5BN4B 4RQTA 1IQUA 3DBIA 3QVLA 4LOAA 4YV0A 4EG1A 4TL8A 3IAEA 1XRPA 1SA0B 4TSFD 4BKQA 1E77A 3D1JA 3OTIA 3B70A 4ITVA 4JI8E 4NBTA 4PG5A 4J43A 3H1GA 3LBIA 1WUHS 5J40A 3T9CA 1HQKA 3HKDA 4IBOA 3BYZA 2UUCI 3AWIA 3OO0A 1H6DA 4KJXA 2FG7C 2HK7A 4LYGA 4Q1CA 3LMKA 3OQIB 5E6UA 2VSFA 4LDRA 1SVOA 1VL0A 4WEQA 4DANA 4LC0A 3IP8A 1JYEA 3HWWA 4A1FA 1QYXA 1R9GA 1P6QA 4J3JA 4QTZA 2B20A 3VHXA 1ESDA 5AW3A 3HA2A 1U5BA 3JALA 2EG9A 4PC3A 3RBZA 5KC8A 3ER9A 5C5EA 1TQ2A 2C39B 3H8JA 4UAGA 4HDKB 4G26A 1X7YB 3RUIA 4CLHA 4BA1B 1CNEA 2VK2A 5B2EA 1Y1SA 1Z2PX 1O54A 4IOJA 5IX8A 1G41A 1SAYA 1JHQA 4GZLA 5JO0A 3KX2A 2JFBA 3WZLA 1C30B 4AMGA 4Y2QA 2PX2A 3MLEA 3RE1A 4OHFA 1YZLA 5BORA 4D9EA 2ZBEA 2VTVA 1VCNA 3O3NB 2QXTA 3BKWA 3SZ3A 1E2PA 4ZP1A 3N75A 1SZDA 4NCHA 3N8IA 2H5EA 4DV7E 2DBRA 3ELBA 2FUCA 4V02A 3AXSA 4OMDA 2YCBA 4DLYA 4HS9A 4RPIA 3EVZA 5A4FS 3A4NA 2GYYA 4HQFA 2NO5A 3M1IA 3QEJA 3PYMA 4LXXA 3CVUA 4GX1A 1NATA 1JWAB 3MJHA 5ENDA 1KZ1A 3A1EA 4Z1MA 3DD1A 2VPWA 3INYA 1I2MA 3IVRA 4Q12A 1I7SB 2DPYA 5K4HA 5C2JB 2IZ6A 3EN0A 1YKSA 4TT3D 1GTG1 3ETHA 4V0MA 3RQSA 2XUPA 4EHKA 3PUKA 2UYOA 3CLRC 3PNYA 2WKRA 1U3FA 2NUBA 3OPQA 3QVGB 1HDOA 1M5TA 5DMXA 3KVNA 3PQDA 5K99A 4WXRA 1PUJA 2YINC 4IIHA 3D02A 1X1TA 4DMMA 4D56A 1KA9H 5EE5B 3VO1A 4AX4A 1NMEA 4J4TA 1NR1A 3G2KA 1GJRA 3OCCA 4HDSA 4EMUA 2ZI7A 3BL5A 3BIOA 4PSCA 1OH8A 1BH6A 2FG5A 3O8OA 4CI0B 3PI6A 4FK8A 4QFBA 1KVRA 1A9YA 1VDZA 1XJWA 1KMHA 3WL8A 2ZTVA 2VBGA 4RF3A 3IP9A 2GYUA 1RM5A 2ES4A 3FHTA 3L7ZA 1L5LA 4JJAA 2FQXA 4CV0A 4TUYA 1ZSNA 4F56A 1T5LA 5IMBA 2GA9A 2PANA 3BUSA 5EIBC 1FA9A 1WZUA 1U2QA 3S2UA 4R8MA 1GAXA 2MJLA 3EDQA 2R6DA 4JXJA 2QZSA 4WEOA 1T29A 2IQIA 3DZBA 5FBKA 1T9BA 4HAIA 1UP7A 1BS1A 4XVHA 1L5NA 1ACLA 2AJ4A 2ASVA 2RJ3A 4GECA 5COBA 4E5VA 3EUWA 2YV5A 3DZKA 5DP1A 1QQ6A 3IUMA 5G40A 4FFSA 1T9CA 3CDJA 1U0TA 1GQYA 2H4FA 2ZXFA 5ENVA 1N0WA 3DAHA 5TLSA 2ZJ3A 1MPTA 2UYYA 3GMTA 3BJIC 4X1YA 2VJQA 3F6CA 3K4HA 3P27A 4C3OB 4RK0A 3ETNA 2QSZA 2RGEA 4R68A 1OXXK 1E9FA 2RH5A 4NBNA 4QRHA 5AW7A 4F38A 4FZ3A 4DZRA 2PO0B 3TLJA 3JXEA 3RSGA 4ATNA 3JZIA 3K92A 1J8YF 5H4GA 3GRFA 1I9GA 1PL0A 1Z6ZA 2ATIA 1P1BA 1ZVQA 2WJ6A 3OOSA 4IS3A 4BGVA 3MHTA 4N8DA 1Z38A 4IZJD 3RRZA 3UXMA 3PUXA 4BP1A 4LTNA 4YP5A 3WYEA 4BJ3A 3PENA 3Q3GE 2HHCA 3DEIA 3TW6A 2BGNA 2YFYA 4H6XA 4BV2A 2PNLA 3CU5A 3GY0A 5IEJA 1I2CA 3OQNA 4J0FA 4KQCA 4YP1A 2HHJA 3UB2A 5JCXA 1UOEA 1CF2O 1YQEA 1G63A 3G0CA 1E5LA 3P1JA 3J81A 4BO2A 1SU6A 3G7NA 5FTNA 2X9NA 1TCUA 2RAPA 2ZVDA 4GP6A 3RVKA 3WQQA 1G5FA 2VFAA 4IX1A 4PPNA 4RMIA 2H8KA 2QX7A 2R87A 3HBJA 2AG8A 2QTAA 3CZRA 5HKOA 3RIYA 2E5LI 1QJCA 2C0QA 2JVIA 1I4WA 2CFTA 2NW6A 2R4QA 2W71A 3COYA 3EGDB 3ROFA 1JDBC 3KZVA 2Z8YA 1I7LA 3WLKX 2C2HA 4DTIA 2ZRPA 1A9XB 4A15A 1RRCA 5K4AA 3I58A 1P2TA 2Y1KA 5FBZA 5C0XB 4PINA 3GLFA 1WSWA 3L8FA 4CKEB 3KKQA 3OJXA 4DUZB 1NMYA 3WGLA 2V1XA 3E61A 5DCLA 4QBTA 4AVYA 1AA9A 1DZIA 1ULTA 2JLAA 3SF8B 1Q91A 3C8MA 5JAMA 3FDJA 3FMFA 3VMMA 2WFZA 3RYCB 4KACA 1ZOOA 5AHKA 4MJ7A 1YHZA 5EESA 2IZ5A 5MDHA 2ANCA 4HH0A 4D9FA 2V4MA 4ZIRB 4UTOA 1FBNA 3BULA 4R4JA 4C7BA 4WZAE 2AOTB 5EFOA 2Q2EB 2QT1A 1PVGA 3MTIA 2UXDB 1OLXA 3E9QA 1PD0A 3LY8A 3G1WA 3FKSA 4GYYA 1PS8A 3ETEA 4DMRA 2IP2A 1EBUA 3MMZA 2H9IA 5ADWA 3CGWA 1ZHFA 1R6LA 2C2OA 3AHGA 2ZBDA 4IIDA 3F3KA 4M3NA 4Y0VA 2ZM6E 4LXYA 1QHHA 3SC6A 5IKMA 1MU5A 2BRUA 4FWIB 4BNMA 4YV7A 2OC9A 2GWHA 4DHEA 4QNJA 2ZBVA 1RWXA 2VPIA 1KAQA 4MQLA 3UXHA 3I72A 4M1EA 1UDXA 1P1HA 3I2JA 3QM1A 4LSZA 4IGFA 2JIOA 2F3PA 2OG1A 3SI7A 3V7WA 2NTVA 1BYUA 1P9OA 1GGEA 3I01A 3HB4X 3X1MA 1R0ZA 5K8LA 2JIQA 1JSRA 1NP7A 3B2EA 3H11B 4LGCA 1NNLA 2WC1A 5T7BA 2Y1OA 2PHZA 4UU8A 4YCJA 5SY4A 3U7RA 2O8DA 3O2SB 3T38A 3S2SA 3BS4A 3ZW9A 3IFSA 3E5RA 2PS3A 3HU2A 3CW2A 2EJBA 1AO3A 2PDAA 4OL9A 2VRCA 1XAIA 1IUKA 1U3GA 5LQAA 2WYIA 4YV2A 1A2KC 3GCWA 1MC1A 2P9HA 3COJA 4KR6A 3NYQA 3NM5A 1VHWA 4I3FA 3DTNA 3TVDA 3WYAA 3H4TA 2F55A 5FYDA 3V1NA 4R6XA 5HQTA 2ZJOA 4BA2A 3VZDA 2PMWB 2XZDA 3AJEA 4DHWA 2ZJ6A 4DPXA 1A8PA 1VJ5A 1IC6A 1U2EA 1WLSA 1HT3A 3IBTA 3KFLA 1FCJA 3NKVA 3ZYZA 2C9MA 4XQGA 5JSHA 4C29A 2E37A 2PXCA 4FIZA 4CMIB 5IS2A 2IYPA 2V7BA 3UWPA 4M0KA 3AF0A 4PO1A 5EP2A 4Y30A 1WZCA 2IYSA 2DPHA 3PWSA 1GPKA 4N5NA 4UUMA 1SBQA 5DI3B 3J7AM 3F5DA 4QQFA 5KNDD 1R5OA 2XWPA 4TL9A 3EOZA 2WHYA 4K3VA 4TWAA 1A98A 1WCXA 2OCBA 2OP0A 4O4JF 3ZV3A 2FMKA 4ETWA 1J9GA 2N0SA 1MVOA 3SIWA 4JC4A 4MS1A 4PIVA 4EG3A 1OT3A 3O8QB 3DVRX 4UREA 1DCTA 4Q21A 3BXGA 3SX4A 3VTZA 2X7IA 1NW4A 4NH0A 2GZ1A 2JS7A 2H51A 1KO5A 1N4AA 1RU3A 4N03A 4UPVA 1QTNA 4AM8A 2XQVA 3ETDA 1ZM9A 4LFCI 3D3KA 1BN6A 1ORHA 4RO0A 5E2BA 2X0EA 3V9AA 1G5PA 4H1UA 4Y2TA 3IQWA 1SCNE 5JC1A 4IMIB 2ZWOA 1BA3A 1R4MB 3H7AA 3HEBA 1FXSA 4FNMA 4HNAB 3GHHA 2EFEB 4BNWA 1TKAA 4IZHA 4TTIA 1CERA 5FXMA 3IBCA 3O31A 2TSYB 1ILWA 1EUCA 1CUGA 4J0KA 3KAPA 2JCXA 2EEZA 1FE8A 2XI4A 2ZWAA 3GLGA 3P9QA 2G09A 2WSSD 1EHCA 4IL5A 5JIBA 4DUYB 1Y6GA 1HDCA 1Z07A 3QWAA 2WM9B 3CPHA 5CVVA 3EVEA 3UM9A 5CAEA 2AXEA 5ESWA 1UIRA 1N1EA 2QM3A 3WRWA 4C4SA 1YJ5A 3IR5A 3CSDA 4EG4A 2DFLA 3KUDA 2O57A 4IKEA 4DC9A 3KDPA 2RFLA 4F4IA 3KCQA 3L46A 3THRA 4XEHA 2C82A 6YASA 5BUCA 1USWA 4X60A 1DAOA 4S35A 4J94A 4B40A 4JG4A 2P91A 4Z4CA 1NM5A 5HMMA 3LQKA 1E9AA 3LJKA 1ZEMA 3NJ8A 4M53A 3JZMA 4UUBA 2A3NA 2W0MA 3RRBA 1RKXA 3IVCA 3K71B 2R7MA 1FFDA 4EQZA 5K4GA 3O4VA 3E84A 4RENA 2IEZA 3WWPA 5A3JA 1IQRA 4MQFB 1A95A 4JH0A 4F2GA 4ZHSA 1HR0I 5JNTA 5B37A 1UXGA 1JG2A 2WBLC 2XBUA 3O95A 2BGKA 3SHTA 4DKXA 3KOXA 4JODA 3GFSA 4EDHA 2WNRB 1RLOA 1U8XX 3WP1B 4EECA 3GP5A 1LPSA 1I1HA 4REOA 4U3JB 3UJPA 4BU1A 3MS2A 4DLRA 1PSWA 4KUGA 1YU9A 3G0IA 5JVDF 1NRXA 2VSYA 1O94D 4UEWA 2O8EA 1U0JA 4BO0A 1E5VA 1GNRA 1G98A 2HO4A 3PQ3A 4GM0A 4JI1I 2QTVB 3CX7A 3MWGA 5FO1A 1YDHA 4Y6PA 3IAM6 1XD2A 4OYHA 1TRHA 4A8JA 4CT0A 3CRRA 2VHUA 3U4QB 4TYPA 1IM2A 2IUTA 5CBPA 2GLTA 1XYGA 5JS6A 2M6KA 5EL0A 1I2ZA 4MGZR 4WZ6A 3QE0A 2CLIB 2HH9A 1EUQA 3FWHA 3VSAA 4LSWA 3CTPA 2DECA 4JLAA 4PZPA 4CR8A 3FFBA 4AY4A 2R751 4YJDA 4AUMA 2BFCA 4QT4A 2C9DA 2A9QA 3UWKA 2R8YA 4BXOA 1L9XA 2ZS9A 3AJAA 4UHEA 4JSRA 1JTFA 5TJ9A 1R64A 4DV4B 3VVLA 5IZ4A 2V6MA 3GQVA 2Y1WA 3VHLB 2EL7A 3PRHA 2ZR0A 3MYRA 4FTWA 1NX9A 2B69A 1HFWA 5EAIA 4QOJA 2WSMA 3ZGZA 1X7WB 3IAFA 4YRLA 2FZVA 1UJNA 3V42A 3L6CA 5A2QQ 4FUTA 4CMCA 4A2CA 1ZJZA 3H3XA 5JH7B 3F3MA 1P1JA 4Y1RB 3WMRA 4AIIA 1BGWA 3SXUB 2CNOA 1JJBA 2VJYA 1J0EA 1SUAA 2QTRA 3HN7A 4P4SB 3A36A 3V46A 2JEAB 5KYUA 3GLFE 1HE3A 1X92A 2OBMA 1T6BY 2PV0A 2ZFUA 4KQIA 3TTXA 4IIGA 4G8CA 2PXHA 4JV5B 2O7RA 1BVRA 1FVHA 2HA3A 3ACDA 2RIPA 4USMA 4XIJA 1G9SA 2XQJA 3HHPA 1LZKA 5F9FA 2YOFA 1FLNA 4XUEA 3WA6A 5KSWB 2BR2A 2BF7A 1XMJA 3EIWA 4TQAA 1HORA 1K7EB 3QJGA 4KO1S 2BL4A 1EVIA 2Z2KA 4AJOA 4XWGA 4BP9A 2H54A 4GPZA 4UOQA 4D0RA 2JAWA 3KEOA 2AG0A 3HO6A 1XWIA 2H17A 4HC4A 3EFOA 4QBHA 2C4HA 2V8BA 5A4AA 4RWZA 3V2UA 3D0RA 3C4VA 5E7IA 4L8FA 4XPZA 1H73A 2NSDA 1U28A 1RMTA 2XKKA 2R60A 2D62A 2PK3A 4YLGA 1HL7A 3EXG1 2OGZA 1XF1A 3SBDA 1HE5A 1Y5RA 3DR3A 4U2KA 3IJRA 1SBYA 2W70A 2X4GA 4OD0A 3KLBA 1A4XA 5DASA 1FS4A 2HMUA 4AZ0A 3SGLA 1AKNA 4MR7A 4YWHA 4OHZA 3O4FA 4F5DA 4MVYA 4BNXA 1XO1A 4ZDIA 4X6YA 3IAUA 5FNZA 2FPUA 1OBCA 2IU4A 5F3WB 1AG9A 1QORA 1CSEE 1DEAA 1T26A 4Q15A 3BE4A 2BE9A 4G5FA 2OVFA 5EJ4A 4P35A 5D01A 3NLLA 2ZLBA 3WC4A 1FUIA 4KFCA 1Q0RA 1P9RA 4A5SA 2IX9A 4WXEA 5ER9A 4OX9E 2FFAA 3F78A 1N6NA 1NULA 1Q0QA 1QPBA 2HU2A 2OZLB 2WMNB 1R4ZA 2XMPA 1NT2A 3BMOB 3LPMA 4N5LA 4V3BA 1WCYA 2FZ5A 5AW8A 3IQGX 3GFTA 2MINB 4LSMA 3A6DA 5EG5A 1JIIA 3EXIA 2CUKA 1N6LA 5A9SB 1NKSA 3K05A 1TIBA 1IXSB 2FX5A 1JQDA 3N87A 4F5EA 1EI1A 3OFKA 5AVWA 1LW7A 2R7AA 4ZJZA 5F77A 1RQNA 2WUVA 4F21A 1ZGGA 4DGQA 1L7XA 1NLZA 1PK8A 4JJ8A 1X9HA 5D6NA 4IZ6A 5LA6B 4HVLA 1POWA 3T34A 1TM1E 4EKNB 3UJ7A 4D45A 1AMNA 2YJZA 4IFEA 3VPHA 1UZAA 3LLCA 1SXHA 5KJ1A 1E79A 3T5BA 4GL2A 2EGUA 2ZJFA 4B0OA 4Y2SA 1G6HA 2CE7A 1ZW6A 3OJWA 4EHBA 1RRPA 5FQOA 3VR4D 3K73O 2A9JA 5J63A 3A1FA 3B5JA 5IUKC 1KGSA 3SXJA 3EPKA 1CUIA 1NQTA 1CJBA 1XZFA 2VOEA 4HDNA 1XDZA 5DROA 1B6TA 2KW5A 3X1WA 4QGSA 3I9KA 1YB1A 4DCMA 1E3DA 1WX1A 1WZIA 4DADA 1O6CA 2O3RA 2P6MA 3LE8A 2G88A 1QYDA 2G5GX 3IVXA 2ZQZA 2NVOA 1AZTA 1E1QD 4L4SA 4MPPA 3K94A 4R9NA 4YQZA 4QG3A 2BM9A 2ODNA 2Y3IA 2OHHA 1BSVA 3QXXA 4LQ4A 5LCXA 2OO7A 1XRSB 4TTSA 5H16A 3UJBA 3ENKA 1VSQA 1FUKA 1L4GA 3K4QA 3G7SA 4JT9A 4KAAA 4R8KA 3HZZA 3T12A 4F2PA 5JNSA 1ABBA 3GGGA 1P2FA 3OJ0A 3NDBB 2HWYA 4NBQA 3QELB 1DWUA 4FEYA 1GG2A 2M1ZA 4W8HA 1XTZA 4IS2A 4XKJA 1DBQA 2HF9A 3T7JA 1NBHA 3K70D 4AJEA 1D1SA 5DPMA 1VE9A 2Q1YA 2KJQA 1MX5A 1QNFA 1XEWY 3TVYA 4E4YA 1K4KA 3BH6A 4ZEOA 4UCWA 1A76A 1U1GA 4ZGWA 3ZHVA 1YQUA 3LK7A 3NDRA 2XITA 1HFJA 3DLIA 2BMWA 5ED0A 3B38A 2G9UA 4QODA 4B3MB 1EVLA 2YX1A 5A3RA 3KSRA 3NDPA 1KDRA 3A6LA 3EULA 4HLUA 2EOAA 5KSPA 2I6SA 1I7PA 1QIJA 3R0ZA 4ZJPA 3HCCA 5BYJA 3T3GA 2J5QA 4KTVE 2RGGA 4YAWA 5HTOA 2ZUSA 4V2UA 1WUUA 2ZE7A 3ML1A 1V8ZA 3E3AA 1AC5A 4DDWA 3GGDA 1GGMA 5DLEA 3F1KA 5LVAA 4Q7KA 4AX8A 4G41A 2K7ZA 1U0EA 2FSUA 1MZVA 4J1NA 4OQ4A 3UH1A 3L84A 1GN9A 3GXBA 4MWDA 1Q1BA 1DMSA 5TVKA 3BPSA 5BN1A 2J5XA 3V8QA 2IBTA 1C0KA 4UM9B 2NPIA 1AGNA 3OQ6A 3QA3E 3G2NA 4Q7LA 4WNYA 4BP8A 1P2GA 2HLDD 2PMCA 2ZK7A 5BT8A 3K1AA 3CV3A 4FW8A 4R51A 2HHHE 4REMA 5GIOE 3VKUA 3C8DA 1MFZA 3TTSA 1FTYA 1RR6A 3ICQB 3IQZA 1MH9A 1XTSA 4F45A 5LFAA 1VIMA 2CCJA 3HBLA 4RJLA 4X62E 2Y1FA 3QITA 4LDAA 2EKDA 2V7QA 3I2KA 2EZ9A 5BSEA 2VKQA 4HZGA 3FPFA 1FBTA 3GG2A 3GDOA 4XA8A 4Y2HA 3BILA 5KOHB 4KQVA 4LHEA 5JOQA 5JJIA 3Q4GA 2YJGA 1JAXA 3H75A 3EXHB 1DTSA 4GPEA 2YR0A 1W9HA 1ADGA 4BX9A 1W5BA 4KMRA 1VSBA 2QM8A 3LUJA 4IMRA 1XL1A 4MVCA 2BIFA 1Y6QA 1NBEA 1A7KA 1U98A 2CDNA 5LP6B 1C80A 3FJYA 1U3DA 1MX3A 1U8TA 2J3HA 2XDAA 4B47A 5AVOA 1V11A 1ODSA 5HFAA 1GQRA 2CW5A 1PG2A 3GQBA 1QV9A 3AK4A 4JB8A 1T9GR 3HDGA 4JBYA 3RK0A 3HDTA 1WR8A 4HB0A 1K6EA 4IIJB 2XKBA 1SA0A 2RK4A 4FIDA 3KJNA 1GPYA 3GRPA 1TXGA 4ZVUA 1HDIA 3PIDA 4MYRA 4R8RA 4ESHA 3U81A 2JAQA 4WWHA 1YFJA 2XVAA 4LZLA 3JRNA 4R81A 4DIUA 3LH5A 1HKHA 1QR6A 3IHWA 3WU3A 3B6MA 3OQIA 4NULA 1GZ3A 3RJ9A 3SR3A 1W6RA 4AP9A 1FYXA 2LCIA 4FE4A 1QIMA 4OHWA 1Z8FA 2PRKA 5DX0A 4FJ2A 2X6RA 3TO5A 2PZGA 1S02A 1WVGA 1VHDA 2BZ0A 1Y42X 2VAPA 4K6MA 2Q4TA 4NU6A 4IW3B 1DC3A 4HRAA 4U6NA 2C39A 1ESZA 3IKVA 1FFYA 1X7YA 2HQOA 1B93A 5B2FA 1TAUA 3CO0S 3HB0A 3RUFA 2VDKB 4G9GA 5BV8A 1KP9A 1UBGA 1VFNA 2P4QA 5DN9A 3N5KA 3KLNA 4KVZA 5D3KA 5ILOA 1Q17A 1XL0A 2RSLA 9ATCA 3CNHA 1C30A 2NVUA 3B7WA 3BD6A 1KDPA 1DDGA 4M0FA 4CTOA 4F06A 1CY2A 3OMXA 5KSZA 4DLLA 1UP6A 3FNFA 3AR4A 3OT1B 2REQB 1KBQA 3FPGA 1XEFA 3PXBA 2PUDA 3SYMA 2E21A 2D0PB 4TT8A 3RRYA 4NHEA 4Q39A 4XTCS 2W2LD 3HFJA 3KJFA 4X24A 1PV2A 1Z35A 2GK6A 4OUKX 3T3IA 1M8JA 1C3XA 1GRQA 3ANSA 2NYRA 3HA7A 3LO5A 1U2RA 1GUBA 2UZIR 2X5OA 3LA6A 4O2AB 2CVEA 2JI6A 4Q3CA 4QREA 2AT1A 4WX2B 3X2SA 2PH5A 3CMCO 3I6YA 5F5XA 1IZZA 1KKUA 4LF8E 1RTTA 2AQKA 2X0KA 4ICIA 2GNAA 3G2IA 2C38A 3HCOA 1CRQA 3HJBA 4JENA 5EP1A 1YV9A 1LSSA 4Q93A 2IT1A 3EZ6A 4PM4A 4EPWA 2Q2QA 2WAYA 1GDTA 3QVGA 5KTTA 4U8GA 5TMPA 1M6HA 4MUAA 5IAJA 3EC2A 1W1UA 3BGIA 5CLJA 2Z0MA 1E6CA 3IP1A 2NOAA 3CUWA 2O0KA 3AERB 3KZOA 4QFDA 4AZTA 2ZXUA 3OI7A 1SBIA 2PLNA 5EJMA 1ODJA 3C1UA 2RI1A 4MHSA 2AMJA 2J0VA 3FETA 2EFYA 1NOKA 4M0CA 4GPBA 3N8NA 4QBFA 2HJ9A 3FNGA 4CM3A 2RD2A 2E82A 2X7JA 3NAQA 4HPXB 2JVJA 3REGA 4Q1AA 1MZPA 5CXQA 1U9IC 4IWNA 1T8WA 4GYJA 3B9RA 3MWJA 4G1MB 1UBTS 1JW9B 4NK5A 1B2LA 1ONBA 1AVTA 1PZFA 3KKOA 4X7BA 4GICA 8OHMA 3MS4A 1NBME 4INJA 4BJ6A 2B35A 2FN3A 4HFNA 4LYAA 2WVHA 3VU3A 2QD3A 2SNIE 4EG0A 2F3SA 3OZSA 3WLOA 1XPOA 3SICE 3UFXA 3O4GA 3ZI4A 3C4JA 4Z9AA 1G2IA 2DQKA 1R6VA 2UDPA 1JDNA 1UPAA 3A3YA 1U5AA 4O08A 2VO1A 4B4UA 1O0BA 4PTYA 3PE3A 4AJIA 2DOKA 5BPHA 1XCLA 2UZ1A 2VBFA 1JWLA 3ZDQA 1SOUA 3VZSA 3ZEIA 2JLSA 3FR8A 4BNVA 1WDLA 2Q6TA 5BO5A 3DLCA 4Y6QA 1JR6A 4GO1A 4JBLA 5HUJA 5F98A 1UDAA 1U1FA 3A3KA 5DNWA 2FFJA 2X5NA 2ZSUA 1UDCA 2WHEA 5KYWB 2V2VA 3R4VA 3SQXA 1VL6A 2JAXA 2VQEB 4DIBA 5CCBA 3VR5A 1XFAA 2ID9A 2P1ZA 1YMVA 1A6FA 2PO0A 3EDMA 4H4DA 4H77A 5CLHA 1P5RA 4Y9UA 4ZT3A 3LQRA 3GNSA 4P3OA 3LUFA 4GRDA 5DN6A 1EK5A 1OT5A 3T7AA 3CLHA 3H5AA 5CH3A 2XIQA 4UZEA 3CLTD 1CNMA 2IODA 4UTVA 3MB5A 1O95C 4WKNA 1HE2A 3AM5A 3LHKA 5EZ6B 3AUAA 4NZPA 1NF8A 1L1QA 3JQGA 4QDKA 4Q4CA 4Z4GA 3A1DA 2QSJA 5DWVA 3FROA 3GXOA 2J67A 2C2BA 5CJ2A 2SKDA 4WK6A 4W7SA 3TSZA 1D2CA 4W5NA 3QUCA 2V65A 2I4NA 1D5CA 2L69A 2VT2A 4K9OA 1JDZA 1QH0A 2P4UA 3AL2A 4GMFA 4MUXA 3MINB 3W8FA 2NYUA 3OZIA 2ODWA 1YFLA 3FLAA 1QQ5A 2BD0A 3EGDA 2EV9A 4LEIA 3NTXA 1QSGA 1BEZA 3VPXA 3A4LA 2N1MA 1RS0A 5C0XA 3D4NA 1K98A 4CKEA 2FSSA 1HX7A 2ZAGA 3NIFB 4BZZA 4NBLA 4K0RA 1ICEA 1SD5A 4LOLA 3EIUA 3MXTA 3EAQA 1YL6A 2GPWA 3H3JA 3SF8A 1KEKA 4LF4B 2JGAA 2B21A 3RC3A 2J3IA 3KP1A 4HQLA 3L40A 3RYCA 1KFKB 3FTPA 2FEOA 2WWHA 1A4UA 1G3IA 2XX3A 4MA5A 4MTCA 1PFWA 5AIAA 3T5TA 4YHHI 4HLNA 3DEYX 4PLGA 4FOTA 4FFWA 4ZIRA 3DHNA 5T4HA 3FYDA 3D31A 2AOTA 4PO8A 3DSRA 2CLEB 1OYYA 3C3PA 3E58A 3IT2A 4UNQA 5BMVF 4MARA 1H1DA 3KZNA 4ZOQI 1NVXQ 1QAOA 1FKAE 1D1TA 5FUXA 1G291 4KIWA 5ITWA 5GMDA 1ZSYA 5K0ZA 5DRQA 4P0QB 1A9SA 1NXXA 4NU0A 4YY3B 4IJ6A 5K0CA 3A14A 3F3YA 3Q12A 2B3DA 4TMTA 2WP8J 2OCIA 2OUIA 2X0DA 4ZCQA 1Y4AE 3T3OA 1R5JA 3NORA 3R5JA 3RUPA 3SVTA 2ETVA 2O8VA 1K9VF 1ZI8A 1BXKA 2O9JA 3AR7A 4NL4H 3RSZA 1P7PA 1RBYA 3TB6A 1KEZA 2VJDA 2VYQA 3LC1O 1XMQB 3K16A 3IB6A 2IOHA 3PGVA 2ODPA 3QBJA 3TZCA 1K5PA 3NIGB 5C51B 4R1TA 1EE1A 3EX7C 3M4NA 1ETHA 2H4HA 2COEA 3Q9LA 3JQAD 3O8NA 4FZ5A 4C6TA 5KOJB 2GAIA 1E7MA 2PCLA 2YHAA 3ST7A 4G36A 3UC5A 3IGFA 5CYGA 2NZYA 3GJ7A 3HVHA 5EZYB 1JIVA 2GCOA 4LNAA 5FOXA 3FB4A 5AM5A 1LJLA 3JTEA 3T1HI 1E20A 3SDBA 2C97A 2N9UA 1NKTA 3H5IA 1JPNA 4KNVA 1R66A 1LPNA 3U3MA 1F6DA 1P42A 1SQ0A 3W4KA 3CPEA 2CXQA 3M7NG 4XYBA 5BSRA 3DE7X 4KQGA 2C8JA 3R9IA 5EUQB 1C50A 4U63A 1VG0B 1VB3A 3NKFA 3HDHA 5HF5A 3NUGA 4R8VA 1U6JA 1IAVA 3NHPA 3QEKA 1KKLA 3MF4A 4GNRA 3ROMA 2QGFA 1Z06A 1EFTA 3D4OA 4NECA 3N59A 2WIJA 3NWJA 4C4OA 4CMIA 5C5DA 1J2TA 1E79D 3EUFA 2XCRB 4FD2A 4FFBA 5JBNA 2WJHA 2O59A 1SCIA 1Q50A 5JQGB 4GX5A 1ZH6A 1XJ0A 5ALLA 5DI3A 5L45A 4Q66C 1KO4A 1UXHA 2FWRA 1H0SA 3UY4A 1PDOA 1D3AA 5BUQA 3TSOA 4LA4A 4C0WA 1IU9A 1V45E 1JYSA 5AVYA 4EGFA 4UOEA 4O4HA 1ZNZA 3PJGA 3N2NA 5CNIA 4YASA 3TM5A 1FF9A 4L5JA 2H59A 1AK2A 1XG5A 4DVGA 3GPLA 2RGUA 3SKVA 3RUDA 4YUYA 1A04A 2BMVA 5K8UA 3CLVA 4KSBA 1OXSC 2C92A 5D84A 3VZPA 4ZALA 5HJ7A 2VYFA 2FMXA 3GK3A 4MQYA 1KY4A 3L8EA 3L93A 1QLJA 4FDVA 4M7WA 3LC2O 2ZBPA 3NOVA 1EX6A 4NFHA 4JYAB 1GZUA 2WG2A 1E9EA 5CT6A 3SC2B 2RIRA 3TK1A 2P79A 3WWEA 5L4SA 4IGEA 4DR6I 2X1MA 3KVRA 5SYNA 4B3FX 3DXXA 4QYTA 1R4MA 1C1DB 2HKEA 1RAHA 3OP1A 4FYJA 4Y9DA 1EWQA 1OVMA 3WDSA 3IVMA 4JLMA 4D8XA 3DL0A 4BLWA 3PGA1 4GOJA 5FJIA 3O8RA 2G36A 1XQ1A 2COKA 1WG8A 2I3GA 1XQWA 2NTYC 1SWVA 1U7WA 2FHPA 3DO8A 3DB1A 4D41A 4RULA 2JG3A 3DJFA 4HB4A 4MGYR 4QATA 4N47A 1TL7C 1FMCA 2RGWA 3TBKA 1YB7A 3D7KA 4FMPA 1M66A 2Q1SA 1PKEA 1PLLA 5KMGB 4B3SI 3QG1A 5HGXA 1YJCA 2DWUA 2ZKIA 4B2LA 4LBZA 2E0IA 3CNEA 1WEKA 4K9KA 2IERA 3FDXA 1OF1A 1O6GA 3D6MA 3PXDA 3BB4A 3DNMA 4P98A 2PMEA 5EA2A 3FHCB 4DUPA 1Y48E 4X66B 5KDDA 2N1BA 2O05A 5TJHA 3T7EA 4EKEA 3CONA 4CLDA 1XNQB 1SVLA 2E4YA 3QI2A 2QDXA 5I9SA 3FMGA 1JHRA 2EERA 3C3BA 1E1YA 5B36A 2VF5X 4JI5I 4E7PA 4MRSA 1BIFA 1XHLA 2F8SA 2YC4C 4II2A 1RRFA 2NT3A 3TXYA 1Z0JA 3IQEA 1O4WA 3B13B 1PFUA 4MQFA 5BQFA 4WLUA 2G08A 3EPLA 1XUOA 4DQDA 3SYKA 3HXPA 2DULA 1C1HA 3THOA 3EEYA 3LQ1A 4DBLC 2WNRA 1WMSA 4CKWB 1GXSA 4M8NE 4U3JA 1V41E 2EKPA 4PW0A 5FLEX 1RWQA 1YKFA 3LFHA 3OLZA 5DX1A 4R01A 3NBFA 3LYUA 4O5AA 3T5DA 3L01A 4CIDA 1LBTA 2XA2A 4BO9A 4GOXA 3FF1A 2V7QD 1U7XA 2BHTA 3KVYA 5IW8A 4YUVA 3SAJA 3N74A 4F0JA 3PR2B 4US2R 4EW6A 1TEXA 2ZUVA 2V2ZA 2AEJA 2MYPA 4V0LA 2F1RA 3D3EA 2QJFA 1N36I 2HPHA 1RWKA 4M9XA 5I4CA 2NN6C 3HGMA 1IVYA 4LZWA 2O8BB 5G41A 2PPVA 1R4AA 4D5EA 3F5FA 4N3NA 4TSRA 4LWPA 2EZ4A 2G70A 1UMCB 1XVUA 2VTBB 1GZ4A 3CH4B 5JZSA 1Y1KE 2GJKA 1OUMA 1QO0D 1CR6A 1YRHA 3G9UA 4FXOA 4LI3X 2VA9A 2QQ5A 1N75A 3DWIA 1Y8AA 2A9PA 1SC6A 3QVOA 2JZCA 4TV9B 3NXKA 2WKQA 4D9JA 5JDCA 5L7TA 1AURA 3EA5A 3C3KA 2LV8A 2BGRA 2YXPX 3SBEA 1KDZA 3U26A 4ZMRA 5JLJA 3N6XA 5I7FA 1DMRA 3C7DB 3OT4A 4MKZA 1N33E 2NUPB 4CV2A 3HB5X 5CDHA 3ABSB 2ON6A 2B83A 5EYPB 4IFDB 3KEGA 1T13A 1OV6A 2P1DA 4K0KI 1M6VA 2FE1A 1QHSA 2A0YA 1C7FA 1W6UA 2QLBA 3PVCA 4FN4A 4Y1RA 5E0OA 3SXUA 7MDHA 5KNBH 1AD2A 3IBSA 3INTA 3DPUA 4JY7A 1RADA 2QV7A 3JQFC 1F7UA 5HK9A 1TO2E 4CIWA 3G49A 4P4SA 5C0XE 4EO4A 2JEAA 2HIMA 1OR8A 3CH7A 3RTGA 3FTDA 1UPFA 3ZHSA 2Q3BA 2Y1CA 3TRHA 3TLEA 4QYXA 4JI0B 3OQMA 5E38A 5ICFA 4NCAA 4QUEA 1RPTA 2PX6A 1FDWA 3PQCA 1B3RA 3QNWA 4ZOAA 1SMKA 1N9ZA 2CD7A 3L0OA 3IQXA 3TBHA 4EI8A 3EPJA 3FPEA 3TOCA 4NATA 2WJVA 3TVTA 5K8TA 2GEFA 3V6LA 4DZZA 1CUAA 2UXDE 4JQOA 4GKJI 2JDID 1AHHA 4OQMA 3A1VA 3FYHA 2AKEA 4OXRA 1ELOA 2XMQA 5AFSA 1VL8A 2XB4A 1UANA 1QHEA 3C48A 3FGNA 3WY9A 4LRYA 2E3JA 3HV2A 2XLBA 4OPMA 4EG6A 4OP1A 3CCBA 4PLZA 5JEDA 3FUWA 5K3EA 1XP8A 1O96A 5K6AC 3ID6C 1ZINA 2EIHA 1L7VC 1TCAA 2VT3A 4DLUA 3AVTA 1NSFA 4DVJA 5E3JA 2JFPA 4YP6A 3WBJA 3V2GA 4GIBA 1PSZA 3NAGA 4J7AA 2O8FB 1T8TA 2JIMA 4NICA 4G4IA 1H2FA 4CE6A 2UZAA 3IB3A 4UT4A 3LUPA 1GEEA 1RVDA 3GLKA 4V0SA 3I76A 3IAS1 1IDOA 3V5NA 2GPYA 2HBZA 2YHUA 3L8YA 1PJ3A 3QGMA 1ZZEA 6NULA 3PFNA 2GB4A 2QRKA 4YUWA 4B71A 2YCLA 4MIYA 3LUKA 1AGXA 1YR3A 1JR3A 1EZ1A 1J0CA 3KRTA 4FN5A 4J2TA 4R7TA 3A3OA 3P4UA 5BSUA 2ZE5A 4CM9D 4DPYA 3IV6A 5GY7A 4D9HA 4IG9A 3TFOA 4B3IA 2OZLA 4F85A 1U90A 4K9LA 2IXDA 4OGKA 3G9QA 5HIAA 5KKNB 1LUAA 3C45A 4B7ZA 1Y3HA 4LFBI 2QENA 4MQ4A 1RJWA 2MINA 4F5ZA 1CPYA 2G8LA 5AQ1A 4FW4A 2IC5A 4WGFA 1UCFA 3AU9A 1XK7A 4AJPA 4MPTA 2IU0A 4WPGA 5IULC 1SZJG 4CEHB 2C4KA 2RGBA 2DHRA 1UIMA 5TQJA 4AYTA 3NIWA 3ZVNA 1L8OA 2XCLA 3C6QA 4DR5I 1ISGA 1SURA 1UMBB 1CBUA 3FUCA 4QARA 4ZV9A 1KTIA 4J8PA 3A9SA 3SHOA 3BHNA 4E15A 4MWEA 5H9VA 4MKXA 1BGVA 1DFGA 4HSGA 1BJTA 1XKQA 4A0FA 4D42A 5LA6A 2W8BA 2VP2A 5D85A 1SEPA 1N3BA 3N53A 4H3SA 4QTXA 5EGNA 3TL2A 4ZEMA 4EI9A 2P6RA 1NQXA 2MCFA 4MV0A 5DM70 3AO0B 2CDCA 4IUYA 3COZA 5LQCA 1MABA 3WLHA 3DMGA 4DCCA 3B9QA 4EI7A 2XTMA 3SSNA 1YACA 3ZWNA 2ADFA 3LDHA 4E33A 5KX5B 1HDRA 1MR3F 2R3SA 1YI1A 2UVPA 3HDQA 1B73A 4RUKA 5AUOB 3CJTA 3OEWA 4YFVA 1QG6A 5G1OA 1J5EB 1JNXX 1BXGB 4M0LA 1E3EA 4HAZA 3KXLA 3CIFA 4W7IA 1J7KA 1X70A 3JQRA 1PDWA 3JWJA 1TGVA 4WADA 3RABA 3RSSA 3H5OA 1ZP6A 3AJ8A 3QKRB 2WKPA 4LPFA 2VF4X 5FA6A 3VR5D 3TPCA 4OV6B 1C3EA 2BKLA 4ZICA 4L5CA 5DBIA 3WJ1A 1F1BA 3IDQA 1FYWA 3AY0A 5DN6D 3CVXA 1YSCA 3PCXA 5AI8A 2YOGA 2ZWMA 3RVBA 1WXHA 3K9WA 3GEDA 3QU2A 3QELA 1S16A 3QKSB 1OFGA 3FMOB 4IYJA 1SY7A 1OTYA 2NO0A 3PEWA 1VHLA 4R98A 4DUYE 4KAFA 1F4PA 3UG6A 3D7RA 4PX5A 4DB2A 2E4ZA 4TRNA 1G16A 4OMCA 3FX2A 1N7GA 2CDAA 2I55A 2CXTA 1AGYA 4OQXA 5TQ0B 3O75A 3QBEA 4LHXA 1YJXA 3TQSA 3WDMA 4F8JA 3LNTA 3HXTA 3RAPR 2I91A 4KXLA 1VJ0A 4BMCA 4CMBA 4DAEA 1BX3A 3IMKA 5EPOA 3T3EA 4JUIA 4FFDA 1DQYA 1UJMA 3D3JA 4WASA 1X1DA 4CCYB 3WLLA 3FZGA 4RVNA 1G6OA 1YB2A 3I4CA 3NRBA 4HMOA 3TZQA 3UWDA 5HIKA 2IOFK 3HO8A 3BSYA 4DLTA 2LJPA 3NXSA 3PDHA 1NGSA 1I32A 5A4KA 3LKVA 2XTZA 4YRAA 3VPFA 3OZDA 2D7JA 2AHOA 2FB9A 3JSXA 1R00A 1XLTC 2G1UA 1E62A 1CJMA 1B8VA 3RKUA 3Q8WA 2ZJBA 2PIDA 1PJSA 2Q9AA 2QN1A 3HMKA 5FBRB 3DO5A 3DNFA 4Y0NA 5T6MA 4DM7A 4CMAA 4YQFA 3U13A 3ADDA 2WM2A 2TRSB 3SHVA 1V7PC 1EVJA 1GQOA 2IYUA 2O5RA 3CRNA 3E9CA 4C4XA 1H0HA 2CVPA 3PE6A 3AF2A 3D7SA 4QGBA 3LCRA 4XSVA 3ZHRA 4BLRA 1Y9ZA 4ESVA 1IJBA 2O4CA 5DZSA 5IWAI 1KSHA 3ACBA 5T3YA 5DWQA 1QHYA 3Q9SA 4BX8A 3QUBA 2Q46A 1S2NA 1QFXA 1IWPB 2QHXA 1VPTA 3AW9A 3EHEA 1ONSA 3FVRA 3NFRA 4G63A 3CC8A 1M76A 4IPTA 4KYTA 2JLBA 1HE8B 1DKUA 4M1YA 4TYNA 3EY9A 1N33B 4XDGA 4XGQA 1LRJA 3A6ZA 1XYYA 1BFKA 4ACBA 3JWHA 3WNQA 5GM1A 1RE0A 5MFZA 3J80C 2C0CA 3Q2KA 4R6WA 5KOHA 1YCGA 2VYVA 1RPJA 3A6GA 3EXHA 1TA0A 1LRKA 3AM3A 2FWPA 1CY8A 2GETA 3ORYA 1TW3A 2DFDA 3ESRA 4FGUA 2Z6UA 3FSJX 3HVIA 4CR6A 1OX5A 2HFSA 4DV4E 1CQPA 4KX5A 3ONVA 4DJAA 5LP6A 3K4PA 4FU0A 4P22A 4TVKA 1PUXA 2C84A 4UXIA 5AVRA 1JU3A 3W8EA 3ZWVA 1K6JA 3MT0A 2LDBA 4JP8A 1PW7A 4TQUS 3ZLVA 3HUUA 4ZV4A 3S1SA 1QU2A 1CUSA 2XMBA 3CH5A 1RYMA 2BCJQ 2XF2A 4UQOA 2QD2A 2LRHA 2XSZA 2XYQA 4P7KA 1RYNA 3IXMA 2WLTA 4IIJA 2VF8A 4MWSA 3ITKA 3S2YA 3RIXA 2X0FA 3VO2A 3CG4A 2DHCA 2OTCA 1V16A 2MSNA 3W6ZA 3KOYA 5H8WA 3ZDBA 2H18A 3G2JA 4TMYA 3TXXA 2HDNB 1NXQA 3RM3A 2PZMA 3UYKA 3G0GA 4RIFA 2BW0A 2WT4A 4JV5E 2F43B 3P32A 4KR2A 3OAAA 4XE5A 4EGJA 1F2VA 2UZ3A 5DULA 3MTBA 3W90A 2C37B 4B3RI 4DCNA 3T7SA 4F3TA 4I55B 3DWEX 4YGYA 5EJIA 1TO1E 3G2MA 4NMLA 5TMEA 3WYDA 2QRVA 2OQIA 1ST3A 3QEOA 4K9NA 4LJ7A 3WLSA 1RWPA 1JHMA 4EX6A 5C0XF 1F0YA 3DAOA 3B9BA 3L0PA 3KJQA 1OWNA 1BVYF 1C1YA 2NSLA 3OJFA 4CMGA 4MW7A 4QUGA 3U1BA 3FDIA 4JLSA 5DI9A 1Y3AA 1P8JA 4YMGA 3P0RA 2FP4B 3H65A 3IA2A 3OOYA 4MCHA 1NP3A 1QVRA 1YVUA 4TTTS 4HWPA 3OA2A 5K8IA 1NC3A 3O1JC 4E6EA 5J4KA 3A8TA 5JCPA 4RZSA 2I6QA 4UMEA 3DZFA 4MEBA 1DHRA 2GK3A 2REQA 4EFMA 4ZHQA 1VJ1A 4RDIA 3ZVRA 2JLRA 3HJTA 3QVXA 4INPA 1BU5A 1Y3DE 3BJMA 4MMXB 4DQUA 1KE1A 3EOBI 3VAAA 2BGUA 5FBHA 4B8ZA 4USKA 3GD5A 4NF2A 3WK8A 3IIIA 1HDXA 4O2AA 4RW0A 1KZ9A 4X8HA 4LF6B 4NHOA 5GZ6A 4JI6B 2BMDA 2FU5C 1JR3E 3L43A 4LJAA 5A5VA 3PRJA 4HDMB 2RGNA 2VDWB 4BZQA 1I0LA 3KLMX 1MB4A 4Z0TA 4A2QA 1JI3A 1S6YA 1OU0A 1H0KA 4ZZ2A 3WLEA 1AKEA 4LVNA 5A4MS 2C4TA 3BHMA 3U09A 1ADJA 1AXEA 1YB4A 2HSZA 3PWZA 2WHRA 3BFJA 3VTAA 5FB3A 4JI4B 5AVXA 1YJQA 4RTRA 1KMMA 1U65A 1MAAA 2D1YA 5T8KA 1KU0A 2YZNA 1RHYA 5HCUA 1QRSA 1L9KA 4FC6A 4ALMA 5EQJB 3KEQA 1U0BB 1TYAE 1E9DA 3E4DA 2JGDB 3AERA 4I1VA 4YMSA 4DMUB 2F4VB 5IKEA 4NE2A 1Y4UA 2QL5A 3O84A 2VRWA 1YFKA 1AX9A 1PVDA 3SR4A 5KNCH 4G5RA 3BGSA 1JHVA 3FWKA 2JC3A 3R3WA 5G0WA 1DEOA 4R1UA 4D3ZA 4FYYA 4D74A 1Z75A 1IRXA 3WLMA 5CIWA 3A6EA 4TYQA 4PLTA 1LPAB 2BHNA 3B3AA 4FSDA 5HOEA 5L9AA 1M9NA 1VXOA 2H2FA 1CUWA 3BMQA 3H9GA 4JGBA 4BIIA 1DB3A 3FJOA 1ZXBA 1XD8A 4J0QA 4AMYA 3T8YA 4LFAI 4CFZA 2FOLA 3LW7A 4WACA 5CDUA 2C57A 4TWZA 2E2WA 3D5EA 2Q9CA 3CB4A 5CW1A 4KC0A 2WUFA 1ZCFA 1WHTA 2ZXEA 4W6QA 5DU2A 3T3NA 4LGVA 2I3ZA 1G6KA 5L4LA 2EBUA 4P3XA 4HGYA 1FMFA 3ZBPA 4E31A 2IXTA 3M8KA 3WAGA 4L5BA 1PZXA 4E7OA 4KH1A 1UDQA 2NGRA 1C5KA 3M6VA 4MLDA 3VUEA 4IAOA 3VDMA 1ZJWA 3JAMQ 1JJIA 4Y6SA 2NV0A 1SKAA 3UT5B 4WAUA 4URUR 2UXBI 3GR6A 4RA6B 5GP1A 3CFYA 1E4VA 2C7BA 2D7CA 3FUUA 3NTUA 1JRLA 1EX7A 2WWRA 2Z5GA 2ZRHA 1COWA 4FW9A 1LLQA 1WUYA 3QLJA 1NONA 3CDIA 2FF7A 2VQSA 1ZRMA 3GUUA 3R5FA 2B9EA 1YZHA 2WSLA 4P80A 3UK0A 2YWXA 1BFUA 3OMWA 2R6ZA 2IEIA 4N0MA 3KOZA 3H3FA 3BFVA 3IPRA 2C5LA 3TN7A 4OXIA 4FDMA 1IY9A 1ZJ5A 4K3UA 3U0BA 3PNQA 3HKBB 3PFIA 2HA4A 4QASA 3ZIAA 3B3GA 2YN2A 1CV2A 4PRYA 5TVGA 2ZJ7A 2ZUFA 2XGMA 2R8BA 3BERA 5ICSA 3U4MA 1GPUA 1OZFA 1QQTA 2VUTA 3K7EA 3RHZA 3LUDA 2QTGA 4DEYA 2Z5FA 1DFHA 1PQ4A 5TEVA 3D64A 4DV5I 4B3ME 4HGZA 1R8QA 4FWDA 3NV9A 3UXYA 4YJHB 1IY2A 1ZMRA 3HR7A 3A4YA 4ZGBA 2R44A 1VI5A 3DG9A 3AP3A 4GU5A 1MB9A 4HADA 2CLFB 3KG2A 4EELA 4I2VA 3NZKA 2DUUA 3GNQA 1GSOA 4M98A 5FPHA 1JEAA 3T0GA 3UJ6A 1W5EA 2QSUA 3C0KA 1U8CB 2QAIA 1SUBA 1XDGA 3RD5A 4A6PA 3TLMA 4DMCA 2Y1EA 3NHYA 2H2DA 5EUCA 4JYZA 3CRZA 2G5TA 3KSBC 2PNMA 1MO5A 2HK3A 2DWQA 221PA 3I8XA 4UD6A 2XH8A 2H4JA 1SN7A 1EQUA 4JEUA 4OGLA 5F33A 2Q7DA 4QBGB 5K3AA 5ITZA 1IBMB 2JT2A 4ZTBA 3EYAA 1ZD8A 1CUUA 4WY8A 5JNWA 1OBOA 1FDIA 1U5CA 2BGLA 3N8KA 3LW8A 2ATXA 1XNJA 3QTTA 4HI0E 1YJ8A 5K8CA 5HG0A 3KFVA 1R6TA 4QDZA 1W46A 2BI7A 2EP5A 2Z5LA 4CDGA 3HGQA 2HEGA 3X1KA 2C2ZA 2HMYB 3ICCA 1Q92A 2WWTA 4MPRA 4ZO6A 3UW3A 5CLFA 2QT0A 4MQ6A 5CRIA 4BMOB 1X3SA 2L17A 4A0HA 2RGXA 2XJ9A 2CL6X 2VPPA 2I9PA 3JQPA 3LRPA 4KAXA 4Q7EA 4UXHA 5LL6P 4D46A 2OSVA 4I0WB 3GO4A 1HZZC 1U3UA 2AN9A 2W2KB 3EVFA 1T3HA 4J7XA 1LEHA 1QZ3A 3TZLA 3VBEA 1ESEA 4BRSA 2I2FA 2VHWA 3HZOA 8GPBA 3K0FA 2ZYVX 2PSFA 4ZWNA 4E2XA 3P8ZA 5BOSB 4EB6B 5A62A 1ZLYA 4B3GA 2JLWA 2ENWA 3OIUA 3A6KA 1UBLS 1K27A 5EWJA 2DTXA 5AKYA 3OM0A 2H63A 1LTQA 4WK4B 2HADA 4EUSA 4CG1A 5JAZA 1YS9A 1TRKA 2PMKA 4PTZA 1JR3D 4MW4A 1EFVA 3OVMA 2WZCA 2ZIGA 1GR0A 2XB8A 1WW3A 3DL7A 1L1FA 1E1CB 1Y6ZA 3WQBA 4EHJA 1XOIA 4W9NA 3P9SA 2FUNB 5CD1A 3VSBA 2CLMB 2OYSA 3ZI0A 5K03A 2QROA 1HDZA 2O8DB 2BEUA 2Y99A 2OILA 4BQNA 3OQOA 2Z58A 1N4DA 1B7GO 1C7ZA 3HSKA 4GRIA 4MZDA 2V7GA 2BBWA 1TECE 3Q3CA 2FR8C 4M6WA 4W5WA 1SBTA 3LGSA 5J2UB 3NOQA 2TMKA 1DQSA 4JN6B 3HKEA 4K03A 5FULA 1BE1A 4I4CA 4R8SA 5I9MA 4CU5A 4NOKA 2HV9A 5JH7F 5AI6A 2JBAA 3FAZA 3U3XA 2C3OA 4FEEA 5GZ3A 1YCDA 2I87A 2HIGA 4H15A 3LDAA 3EZNA 2QTLA 4PXSA 3VKWA 4M9QA 5SY6A 3ZTTA 4NG4A 4BVKA 1YS2X 2EQ5A 3R6DA 4RADA 1RYZA 1VMKA 5A3VA 4X8LA 1HNNA 2DFVA 4X64B 1W49A 1HTWA 4PE5B 1MQ9A 2X36A 1K2WA 4TLMB 4DMHA 4GMHA 1U7OA 5HP4A 1P75A 3A28A 4YUZA 3SZMA 4DY4A 2HAEA 5JQGA 1X8LA 1V8DA 4MDYA 1XCBA 1W48A 2QTNA 5FKJA 5LBTA 4O63O 3Q88A 4A6XA 4DXAA 4EYSA 2F3QA 3K6SB 2OZVA 1KQ3A 1P33A 3WR5A 1BGXT 2GBCA 4AW9A 4DSOA 5ALZA 3LUBA 2HKIA 5LWHA 4U00A 1VQ1A 3NNSA 2HEIA 4DV0B 3F8SA 3M3DA 3UXEA 2EJUA 4UVGA 1L4FA 2F8MA 1N2CA 3BJRA 1QFJA 3CNOA 2ZOSA 5IJ0B 1SHLA 1VPVA 3EIEA 1L5MA 2CHFA 3G0OA 4G1BA 1GO2A 3AEKB 4XAQA 3AP2A 5BWBA 4RFSA 1IBKI 1W25A 3SC2A 1K4YA 5B7GA 1LB1B 3L79A 5JARA 5B4TA 1CE8A 4EKDA 1XJ5A 2QRUA 1ID1A 4OH7A 4RPLA 2B3TA 4FR0A 1C1DA 4H4EA 4MGIR 4QXAA 4DV2I 4JGGA 4OYRA 4Z3DA 4CMEA 1YWGO 4DPWA 1XEWX 2H1IA 1TUIA 3COPA 4ZI7B 5BWMA 1EMDA 5F1YA 4NV3A 1HYQA 5KKAA 1ARZA 2FEKA 3U2QA 1BEEA 3ITNA 3PV0A 3E7WA 3QLUA 1VHQA 1P73A 4D57A 2ZRBA 3A32A 3FI0A 3RGWS 3SYRA 4D4GA 5I7OA 4B6GA 5IK2D 3O74A 3AH8A 4EHFA 1OYPA 4U02A 4GAEA 3U7GA 4CM5A 1S2DA 1ODFA 3C3JA 2WT8A 5KMGA 3JYOA 2GOYA 1MV5A 3ZDEA 4AG6A 4EY7A 3GLRA 3T1YI 2PO1A 1JLSA 1ZNXA 1AKQA 2IXEA 4HYYA 4LZZA 4RCVA 4DG9A 3AVQA 1OA0A 4B75A 5DTIA 4OSPA 1QQ7A 5BRJA 4FGJA 4OL0A 2HU8A 3DDOA 4EJSC 4ISCA 2JFZA 1S5PA 4W82A 5JZBA 5GPBA 4NZNA 2I6XA 4IOKA 4TKMA 1Z63A 3LQ4A 2Z3VA 1XEAA 1C14A 2CLKB 3EZGA 1X0XA 2A78A 3IEPA 2N3ZA 3D81A 4PANA 3AI3A 1XZBA 1ISRA 3N39C 3PD7A 4XOUA 3ZD7A 3KPWA 2C9ZA 3C1OA 2I3DA 3H05A 4HACB 5LA6F 2G04A 3P0JA 1WW2A 1IBCA 2GD6A 2ZM6I 3HSYA 1LX6A 2OYCA 3SZOA 3TCKA 1NBIA 4CN8A 4DG8A 4I6GA 3ITEA 2ST1A 2LCQA 4CKWA 2V6BA 2OECA 2WD9A 4BP3A 1SKYB 3NTVA 2KB0A 2WVJA 3ONWA 1CR4A 3KD3A 3T7DA 3UGTA 4C5AA 2EDCA 3SMQA 4Z9XA 3MAAC 4XGRA 4C1NA 2VSOA 2C20A 2VQEE 1QFSA 4NXME 3SD7A 2D0OB 4MVJA 2JJYA 2AA3A 1IBLI 2ZR9A 1ZUNB 5CT5A 1NQAO 1NBOA 1YGYA 2CJPA 3O4IA 4YRBA 3L0ZA 1V3UA 2O8BA 1FXUA 1PKPA 1TF2A 2HR1A 2OVBA 4Q4AB 4KVAA 2AJTA 1UMCA 1CR1A 1SXJB 5DEIA 4ZI2A 2OORC 3D8SA 4TKZA 3DVAB 4HYTA 3T1OA 5HOQA 4QA9A 3IKTA 1EG7A 3H2SA 2HQSA 4TX1A 1G8PA 1NXPA 4TV9A 4LJ5A 1YGPA 3OC6A 4RPFA 2PO7A 3ZGOA 5CDSA 5IK2A 4ED4A 4E70A 4B2IA 1G8AA 3PI7A 3E4CA 5EIOA 1JXAA 2NUPA 2XSZD 4J6FA 1TW2A 5EYPA 3RYHA 4B76A 4G5OA 1GITA 1U99A 4BNLA 3E1SA 1GGNA 4FPXA 1N2SA 4B82A 1NUUA 3ZE1B 1Z4LA 5IM5A 3WGYA 3F4LA 2FJ0A 3THYB 1CEXA 1THTA 1XTPA 2PS9A 5KB3A 4E4TA 2EZUA 2PKRA 4L4UA 5DB4A 2QRHA 4ZEXA 3HYTA 3NHZA 4I50B 4BB9A 5C32A 3NC1C 3C15C 1VRVA 1A8QA 4LF4E 2DG2A 1PJ8A 4D9CA 2JASA 4RTOA 4CGZA 1KZGB 1I51A 1N5LA 5HZMA 1QYCA 4DRXB 2GM5A 3I6ZA 1U4OA 1S4MA 3Q1QA 4LAFA 4C0BA 4GGPA 4MMZB 3TRJA 1YR7A 3ISVA 3LX8A 2QXUA 1VLHA 5BQOA 1ZUIA 2C3UA 1Z13A 4D9GA 3DUWA 4YAOA 1NUQA 3W6UA 1X2BA 5C8XA 1Z0UA 3R0IA 3LYAA 1NG1A 1B8OA 2MYTA 4O4LB 2GVNA 3WMEA 1K08A 2QOEA 2VP3A 1NV9A 2RH9B 3L1IA 1O77A 4DCUA 5KOIA 5MN5A 2F48A 4YY3E 3IPCA 5A7FA 2LIPA 4DV1I 4K8OA 2IZ0A 5KVQA 1ENPA 2XMGA 4PF1A 2VPQA 4ZJUA 4HT3B 3DL4A 1YRQA 2IZZA 4TGLA 3IALA 4WCVA 1BKNA 4PN7A 4BC1A 1J39A 8ATCA 3ORRA 4ETMA 4XRGA 1RPZA 1XMQE 4RLSA 4YBZA 3ROZA 3F6BX 2C2KA 1YOVA 3VDXA 3ILXA 2D8AA 2H0AA 1Z5PA 5M34A 2AV6A 3PQ8A 4JBHA 3HK2A 4H7KA 4J07A 5IRCD 3P26A 3RIEA 1U7UA 1NU8A 2CYAA 3S70A 3TW4A 1KQGA 1UWLA 3LBHA 3VU9B 3ZGLA 4W9RA 1DO8A 5IZCC 5LP6F 2EJWA 3ICWA 3VJLA 1RI3A 3CSUA 4R3WA 1PF7E 1OPXA 2ZSKA 1Q19A 2IHBA 2DPGA 3PJFA 3PXAA 1ZXXA 4IQFA 5M5BA 2IY7A 2Y1GA 3SKXA 4ND5A 1PR4A 5BWLA 2QBYB 3M85G 5DTEA 4CEHA 4OGGA 5DNCA 2GXQA 1XNRB 5E8JA 5L6MB 2UYHA 3BHJA 3HCPA 3B85A 1HZJA 3IAS6 5B3KA 2WMOB 3M2PA 4XLTA 2F2TA 2JD1A 2A6PA 2BKXA 1NYLA 1YR6A 3ANMA 3LFUA 3NHAA 2WZQA 5CFNA 3HACA 1H65A 3F46A 1K5HA 3O1LA 3HU5A 1VLZA 1XAHA 1SFRA 1X7GA 2O3TA 3KB8A 5TY0A 1TUGA 3BTSA 3FKQA 3BH0A 4PZLA 1IEQA 3B1ZA 3BK7A 5I01A 1YR8A 2IYZA 2NSYA 2R8RA 3ANNA 5ITSA 4Y1GA 3ZZ1A 2UXCB 3M6AA 1GTVA 1ZIPA 1C41A 1X1AA 2I2AA 3EW9A 4OOEA 1TLFA 4HRVA 2ZKLA 3L7LA 1JT2A 4R5MA 3LU1A 3ME5A 4XUGB 4EO7A 1C4XA 4MI6A 1CEYA 5HWSA 4BVGA 1U3CA 3EGOA 2IPNA 1BCRB 5GINE 2ZIEA 3FCAA 3GBPA 1BC5A 1BXGA 4NARA 6GPBA 4AD8A 3Q7RA 4MYTA 4L08A 4QFMA 3I09A 4G4GA 1COWD 4L5IA 4UM5A 1L6IA 3GIWA 1R0RE 1ZL0A 1M7HA 4JYAE 1EFCA 16PKA 1C9MA 2XUQA 1H2WA 2QRLA 2J6HA 3H8WA 3QKRA 1NOJA 4QNNA 3DE3X 2Z2XA 4ITRC 2VDJA 2HK9A 3OFVA 3ROQA 4QULA 4ZHQF 3GRZA 4UCQA 4M4SA 2GERA 5H0IA 1OLOA 1PS0A 3BGDA 4RKRA 4RM3A 5K7SA 1TZ2A 2VTDA 4P92A 5IDWA 3F2VA 3BIWA 1ORDA 3LVRE 3ZIAD 3SJBA 1ISJA 3HCEA 3PK0A 4ZCIA 3IP7A 3Q8XB 4AF6A 5BQ5A 4O2AF 3N2LA 1PX2A 2WWWA 1E6MA 1E3QA 1X9GA 5FWKA 3RAEC 1U3VA 3KTAB 3TUZC 2OESA 2A67A 1WXGA 5EWLB 1P9LA 4BQIA 2YICA 1TADA 4XM0A 2LZ0A 3TG8A 2YW2A 3HC7A 2OYRA 1D0SA 1RCTE 1JSXA 3W3AA 4WT7A 3FDZB 3O4HA 2Q2OA 3IPYA 5JJBA 1FZQA 5KNDH 3KPVA 1I36A 1YXMA 3IUJA 4HAXA 1NVVQ 2O0LA 4JQSA 4UNSA 4Z7QB 1UDNA 2I6FA 3BQNB 4KMMA 5TQ0A 1MG7A 4OO3A 3KZ1E 2VHZA 2ECPA 4X66E 2FK7A 3AHIA 1E2UA 3HU3A 2H4WA 3QMPA 1L5ZA 2B92A 1WY7A 1XNQE 1S3FA 1O94C 2MSKA 2JLVA 3FVVA 3AEQB 5I7WA 2B82A 4GE3A 5JAIA 1H1LA 4EATA 4JCOA 5AO9A 4CCYA 5LD2C 1O8BA 1SVIA 3ABZA 3NHWA 4DCVA 3D1VA 3ZV7A 3GGSA 4FLFA 4M54A 5HA5A 2EFHB 3R3XA 4LY9A 4JDUA 2NZXA 3NEPX 4B6SA 4B8WA 3W5DA 4Q9LA 1L4KA 1EI9A 4UEKA 1T1RA 3HNPA 5G0TA 2JLYA 2BEKA 2EHJA 3KDAA 4G1CA 3GLQA 2C9OA 2XVXA 4NENB 2LP4Y 4RY9A 1SBHA 3TR6A 2C2GA 3MWKA 4JQZA 1LK0A 3TNYA 2PWBA 3M33A 1X80B 4WNCA 1AKUA 3E9MA 2YVUA 3ZTYA 5C1PA 2FLVA 4KMOA 4JR1A 5C5CA 5K3CA 1WMAA 2JHGA 4KYUA 1QZXA 1II9A 4Y8VA 1UT6A 3L7BA 4HG2A 4EW2A 4MVJE 5ALTA 2PEZA 4OB6A 4Z9YA 4E0BA 2FG6C 2VHJA 3G9TA 3HLYA 1R0KA 4J1TA 2G6TA 1J07A 3H99A 4F3YA 5EIBD 2GXUA 2H8GA 4IEEA 1JLHA 2CLDX 2I2BA 5BYKA 1PS9A 4L3VA 2IYEA 4FFLA 2HPVA 1YZ3A 4LC9A 1ISIA 2X14A 1TA4A 5T4FA 3W2IA 4BEBA 2ZU0C 3A4IA 3TQQA 1NNEA 1U31A 3HNOA 4MDEA 4PYOA 1XDBA 4ZQBA 5B2ZA 1DJPA 2IXAA 3GH1A 3H9QA 3C1TA 4RZUA 2O1XA 3KDSE 3VYWA 3EGWA 4CQNA 5CM2Z 2P7HA 3MG9A 1L3CA 4WKCA 4Y6OA 3PNBA 3K72B 4BTEA 5FFMA 4OKNA 2YWGA 4BWFB 1FDSA 1NVUQ 2C4VA 4LZNA 2GPBA 4IFDE 1K6MA 4Y1EA 5HKAA 3GB9A 1AB6A 3PLAE 1IM8A 2I67A 2E87A 4CIVA 3TFWA 4MHTA 1EP2B 3ZWMA 1WMEA 3MVEA 4HYQA 3I83A 2WD8A 3QVKA 3H5RA 4HQOA 3B9PA 3IAAA 3N2GB 1FRFS 2IKQA 1L5SA 1PEYA 5FUQA 1IZ0A 2E1RA 3OBBA 3WVNA 4RNDB 2FYTA 4RIGA 3MJ4A 4JI0E 1OD6A 3WRVA 3Q10A 3PXXA 2AEMA 3BQ9A 3S2GA 4DDUA 4D4MA 1OH6A 2VYCA 1WKVA 4URVR 3C5VA 5BN5B 4UDYX 1NI5A 1OGIA 1NJSA 2MR5A 2W43A 2WHPA 3ECAA 4I55A 4P4UA 5CTAA 2Z57A 1PJ4A 3ZBTA 1EESA 2X5JO 3C3CA 1LNSA 3AXTA 3WQHA 4IDEA 1T3GA 4XCQA 3A04A 1DS6A 5AUNB 5BR8I 3NVDA 1HOTA 3CVYA 1VPWA 3VDRA 2AOXA 4H4CA 4F1WA 3LLSA 4I6JA 1DLJA 2XUZA 4MQBA 1UKCA 4YJ2B 1QE3A 3MHPA 2C00A 5EVCA 4YJKA 4BB5A 2FWJA 2PYZA 3T0FA 2VWGA 3GRRA 1TZKA 1ZVMA 1SKQA 1WV1A 2C8LA 2FP4A 3A0UA 4MP3A 1EA6A 4YC7A 4YT4A 1OLSB 4BNIA 2IDKA 4U7WA 3L9WA 5EFZA 2BUAA 2GA8A 2Z9BA 4ZEWA 1CDOA 4M49A 2CFRA 2QPTA 4CXMA 1XE3A 2QVYX 4QLBA 2XEXA 2GF2A 2R0QC 1TMOA 5I4BA 3LX4A 1GR1A 4QO7A 1VLQA 1J1IA 1Y3BE 5JYCA 3S99A 3T5AA 3UATA 2JGKA 2R2GA 1THGA 2DKOA 1G8KA 1L4BA 2BH9A 2VUIB 4A0GA 5AWFC 4RGBA 2AVDA 4MDTA 1NQWA 3V4FA 4BMZA 4DIOA 2ZDHA 1CZKA 2BM1A 2FWIA 4K2AA 1NNI1 2QJWA 3VTKA 2NO4A 5EWMB 2I33A 4LHZA 2CNBA 3A58B 4AS2A 1FFCA 2WU3A 3L04A 3VV3A 4CF3A 1QO7A 2CUTA 1WQ3A 2ATVA 4YMUA 5I7EA 4AY6A 4BCDA 1UC4B 1CXZA 1KIFA 4MWGA 4CRWB 5HKBA 1W581 1G0OA 1W5SA 2QW8A 3ZKBA 3PSAA 5E4YA 2Y0PA 2NVWA 2W83A 1CUFA 2QVGA 3TOZA 3KELA 4OHPA 3UKOA 4BNDA 2NG1A 3GWGA 4ZREA 2PTGA 3GMSA 2FKAA 5D5QA 5IT9A 2JGDA 5DXAA 2AF4C 3TQFA 4ANFA 1ZCBA 2PBLA 2VLBA 3A7EA 2DYKA 1GT91 1ORWA 2PU5A 1SVUA 2WJIA 3FCUB 2JFHA 4BKMA 1JG7A 2EQBA 3ZI7A 1A88A 4UQLA 2GBGA 4H08A 1NXSA 4ARSA 2VJKA 2DUMA 5TSDA 1YA8A 2BFNA 4QPNA 4R84A 2W2XA 1TYBE 2Q9BA 4XR9A 5TPZA 3P97A 4QWMA 2Q7OE 4BQPA 2XGJA 4NMXB 1S3IA 3QU7A 3RVPA 1W2GA 2ZR7A 5ECGC 4B7CA 1QKKA 2AK3A 2CEAA 3HJAA 3VHRA 3L77A 4GEGA 3A9TA 1LVUA 2YNMD 3BSSA 3V4LA 2JLQA 4LJSA 1KS9A 3HZHA 4R1QA 5HF6A 5J4LA 4F4CA 3QXGA 2PGXA 4AMVA 4O33A 1T9AA 3EXEA 1EAMA 3QVJA 2WTBA 4HD8A 1J5EE 2OO5A 5LL6R 1E8NA 2BSXA 3IIMA 4TXJA 4MS3B 5JQGF 2CN1A 2GEDA 4OUDB 5GONA 3B1WA 2C9BA 4M2LA 4S12A 4MO2A 5EXDA 2ZANA 4ND2A 2OV1A 3RNLA 5DH9A 4E08A 1BTOA 5B4VA 3U19A 1XZLA 5DTMA 2YJ6A 4DR2B 1TD1A 3QU9A 3J81C 3MOGA 2JEBB 4JLUA 3E9EA 4NIMA 1P0PA 1T2DA 4HEA6 4RA6A 4DJEC 3RLFA 3BMNA 1EVEA 3AUJB 4MV4A 3ZDFA 6AT1A 2IYOA 2V5VA 1ODIA 1ZOPA 2RARA 3IMGA 3E8MA 4NYMQ 4DGSA 3PEYA 2EFDB 2DY0A 5JYEA 2VJLA 2CDRA 3GELA 1Q1EA 4IDBA 2ZEJA 5TDHA 3U16A 3E3NA 1ZD5A 2Z1MA 5IH3A 3RVSA 5KTYA 4N18A 3NWEA 1C4KA 3K5PA 4DDKA 1VG8A 5B3LA 2GBPA 3GPDG 5CT8A 2JHFA 3S2IA 4ZCSA 3OZEA 1QLWA 5L7WA 3H4MA 3UGQA 3WXMA 3L49A 4DR7B 5JFTA 3DZIA 3O1IC 3EVAA 3KR9A 1INLA 4X92A 5KKCA 4YRQA 2R11A 3GJXC 4LRQA 4FKZA 4MAAA 4NSNA 1T9GS 4G0MA 2HA7A 2GPTA 3LLUA 3NHBA 4QPCA 4AUNA 2Q2WA 1TNDA 2GN0A 2FMUA 2LUOA 1UBFA 3AEYA 4UCFA 1ONPA 3KZXA 1XMPA 4TOIA 3AF5A 3M7IA 4BUZA 4BRUA 1NXWA 3ABQB 4FX2A 4OHBA 5D7BA 1BWSA 1ACJA 4S2EA 1LDNA 3WDLA 4YPOA 1VYTA 4TN1A 2OFFA 1B4DA 4LF9B 3HB1A 1RAIA 2IPAB 1MMFB 3DDNA 5J4VA 1KNXA 3IJPA 4O5OA 3K0CA 4GR4A 1UJCA 3HABA 4L9SA 5E4JA 1P4SA 3TSYA 4L28A 5DBHX 4QLOA 4M7PA 4UU7A 1J24A 4UARA 4RL4A 4Q6BA 2VQFB 1HLPA 1KMQA 5IC6A 1N6IA 1NPYA 2D2FA 5CITA 1U2GA 1TU0A 1ZVJA 2J09A 3SJAA 1F7VA 3RKRA 4F3RA 1WUTA 2C96A 4NCIA 3KWLA 4IMPA 4DA0A 2Q2VA 2NYVA 3DCIA 1G7RA 4ZAZA 3KQNA 3KQKA 1ZD1A 3WB2A 3V8MA 1XMVA 2FFHA 3EXFB 1T8PA 3WJ2A 2GZDA 2OBYA 1EVYA 1E9VA 2FSIA 3E1KA 1FFSA 4NMHA 5IAKA 3OOEA 1JVNA 4KNWA 5J5AA 2YJ5A 3VR3A 1ZONA 2C42A 3P9RA 3ZBUA 3U5TA 1SG6A 3HULA 4EVRA 4RC9A 5BOSA 3B1KA 4TL6A 4XTJA 3IVAA 2BJVA 2C5GA 3IR7A 2JANA 2PH1A 3TCNA 3NZEA 3FHOA 1CS4C 1DSSG 1U0NA 2IOPA 1XZQA