1USVA

The structure of the complex between aha1 and hsp90
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
255
structure length
251
Chain Sequence
b'TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 73
structure length 251
sequence length 255
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1usvA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usvA02
2O1WA 1HK7A 3PRYA 1USUA 2O1VA 2CG9A 2IOPA 3Q6MA 3Q6NA 1Y4SA 2IOQA 1Y4UA 1Y6ZA 5FWKA 2O1TA 3HJCA 2GQ0A 2CGEA 2O1UA 1USVA
chains in the Genus database with same CATH superfamily
4Y3UA 2IYUA 3K70C 2QX4A 3OX4A 1XKLA 2WUWE 3NH6A 4TT3A 3WVNA 4OSEA 4BNWA 1S89A 5IT9C 4ZEXA 2SECE 4MVJP 3DW3X 1YDMA 1T4BA 1WHTA 3NALA 4HWOA 4HQKA 5EZ6B 2V7XA 2GUWA 4J6FA 2VJLA 4K9PA 1PW7A 4OK5A 2SHKA 4X6UA 2UXBI 2FA9A 1K6JA 2V4ZA 1Z6GA 2WICA 4MPPA 4IGAA 1WXIA 3W7AA 3RI3A 1KDOA 1HYBA 3H13A 1O3YA 3UBTA 2HSDA 2QW0X 3CLTD 3R6WA 5HUQA 3R4CA 3LP5A 2ERYA 3L7DA 4Z7QB 3CNOA 4XD2A 4MQEA 4HJXA 4OHBA 1IOLA 2VJAA 3I5UA 3ZXXA 1Z5VA 1MA0A 1S6YA 1HEIA 1F8UA 2WINI 5FO0A 4Z1MD 4QDOA 2ZUWA 4L57A 4MO9A 1VMDA 4ZTZB 1QCDA 2J6CA 4WJKB 5EAIA 3RC7A 4RZHA 5CFLA 1OW3B 4MVJE 4F3KA 4HMQA 2O1EA 4W5HA 5B3LA 1SUAA 1NV9A 4XWTA 4AU1A 4KL8S 1QQ5A 2VT6A 3HVJA 2EFCB 1OX4A 4J0FA 4PSUA 3SCZA 5TF0A 1LBEA 4BNMA 2XE8A 3UAYA 2RIPA 2PQ0A 4M4SA 1SPXA 4GW3A 1D7OA 3HR7A 4OBWA 5JXJA 5K7SA 1COZA 1JHMA 2GXSA 3D7LA 3EUWA 3LUFA 2RONA 3M83A 4GUAA 4TLBA 3AEKA 4BWFB 3ADDA 1KFEB 2PNLA 4DV7I 1NUPA 1SZPA 2WF8A 4H7FA 3IOCA 2I2CA 4YFVA 2OENG 2A57A 2CLMB 3QX7A 4U7GA 1JLLB 3UH1A 1GAQA 4RM3A 5CX4A 2JJ1D 2R5WA 5IX8A 4EI8A 4DXLA 2PMWB 3SYTA 1W25A 3UWDA 2GJ9A 3QWIA 1EAYA 1S16A 2NZXA 4L4UA 4MH0R 1EZ4A 1E9FA 4TUYF 3M6AA 1J24A 5KQMA 2D6FA 3B3JA 3FPJA 1NMZA 3PNQA 1OB5A 1Y3DE 4C05A 4FYHA 3K0SA 3WU3A 1JHRA 3HCDA 4OU5A 4R41A 4BP3A 5JATA 1NC1A 2YCLA 3CBGA 3G8YA 3GJSA 1G1AA 4JHLA 4LGVA 2XADA 4YS6A 3VU8A 4BX9A 2WHXA 2ZJ3A 2O19A 1D0SA 2CLDX 3DFKA 3G2LA 3WLSA 1K6EA 4JLPA 1KVSA 1XEFA 1GQYA 2IEGA 3C3EA 4WBXC 3RD5A 4BLPA 3HP4A 1SVIA 1Y0BA 4M37A 4U2BA 2GCPA 3QT7A 4WXEA 3SE7A 1J70A 5DNXA 3FGZA 3GDFA 4YHHI 4JUBA 4PG8A 4WUDA 4QIHA 1S1MA 2YHAA 1I1HA 4URUR 5HCNA 1L8OA 2BC9A 3DZHA 1DCTA 1PWZA 4NH4A 1Z37A 4WN9B 4CMAA 2B3DA 2P9YA 2JLRA 2KX7A 2Q0HA 4GECA 3L0CA 4G2NA 4WK2B 4CM8A 2HOQA 3T5AA 4JCCA 4EH1A 1PK7A 3CXRA 1GDTA 1SKBA 5CLGA 4HVAA 4MJ3A 5THXA 3IT0A 3T94A 3ZLBA 2R79A 4D02A 1YBFA 4CT4B 5ICEA 5GADl 3R5HA 4QU5A 3C7CB 1CZLA 2R5NA 1N5JA 3EVNA 3AXSA 3U3MA 4LSMA 2VAWA 2K7ZA 3G6WA 3P3CA 2IEYA 3ZJVA 1JXOA 1XROA 5GMEA 1G3UA 1X14A 3PC8A 1FEZA 1E7YA 1SG6A 1H1DA 2XBUA 2Z3ZA 3BXPA 3GLLA 5ADVA 5JH7A 3IPAA 5IEBA 5C8YB 1A2OA 1BVRA 3C15C 1XYGA 1CQIA 2JD0A 1E3WB 5F33A 4B79A 2Q2WA 3ZV3A 2VPIA 1FYVA 5AMXA 1H4QA 1JTFA 1PS0A 3COYA 2C58A 2IQIA 2X8JB 2XGSA 2GK6A 4K0RA 4P5PA 2JFFA 1Z6TA 2ZYIA 3PFGA 5K0GA 1RRFA 4CMIB 4RM2A 4B71A 2FWJA 2QYTA 5EKTA 1NQWA 1IZ0A 1ONNA 4X95A 5AI9A 4DMCA 4UKDA 3QA9A 5KTYA 1P4GA 1GKLA 2QTHA 4GLLA 1X7GA 2P1ZA 4X8HA 3V1LA 1Y1PA 4AN0A 4ZHQA 3H1PA 4KWTA 1RI1A 4YAFA 3VR5H 5JDCA 3L7ZB 3ROZA 1HDGO 1YC5A 3LBIA 4TVOA 5M7EA 4D3DA 4FHDA 3KKKA 4DGQA 1HNXB 3AEQB 2FRDA 4DR3E 1I6KA 2Y68A 2Q8NA 3PXUA 5CJ2A 4DM4A 4HT3B 1VLHA 1GCIA 1J9EA 1JIUA 2DMRA 1AZLA 4IDPA 3UGJA 1G0OA 1GTRA 2QZ4A 4MR9A 3PZBA 4E5PA 3RRFA 5JNTA 5AKIA 3NPAA 4RWEA 3SFZA 4YJDA 1HT1E 3BL5A 2WW4A 1IBKE 1OIWA 2CFSA 2IVZA 2OCLA 4UNRA 2GLTA 3TR5A 2HHLA 4G56A 2HA5A 3H5WA 5AKJA 1P17A 1IVYA 2B0JA 3R76A 3G9TA 4YRIA 3AEZA 4PC7A 4TRNA 4NBLA 3HGMA 1RJ9B 1PAUA 4QFCA 4EW2A 5C46F 5C1DA 4AW9A 4BKRA 2VSNA 1LPAB 3P9IA 5EJ9A 2DWCA 2E1PA 5DEOA 3IO5A 3TM5A 3VNBA 2XYPA 4LWOA 4M36A 3VPSA 1EX6A 4TQ9A 3WWEA 4R1FA 3R6DA 2OXEA 3R74A 3R1IA 2RJNA 3QE9Y 2JBAB 4WJZA 2ZYVX 3GI1A 4DLTA 3BQNB 3UC9A 1H3FA 1HI9A 4CQMB 1NQ5A 1J0EA 5KYYB 4TKZA 3QT6A 2JGRA 5DSXA 2XWQA 1FVXA 4FPXA 1GPAA 3JV7A 5EZ5A 4BAZA 4QT4A 4JJGA 1GA4A 5DHTA 1LW7A 3D7KA 1C41A 3KXPA 5E1OA 2O8BA 1FUIA 2RK4A 1U1EA 3EVGA 3IO3A 3WLHA 4RVHA 1O8BA 1ZMTA 1TIKA 3DOEA 1I4TD 1U0OC 4ZOAA 3ZDEA 4UM8B 4D9EA 5LA6F 4OHMA 5LIRA 1EB8A 1VG9B 4X65B 1F7UA 5B6IA 4TMTA 3PHJA 2EGUA 3E2MA 3KVNA 1C4OA 2DCUA 4DBLE 4V1CI 1L4FA 3KWFA 4DLSA 3J81Q 1B41A 3OU2A 2EC5A 3EXG2 1BVHA 2FVXA 4J9UE 4MUBA 3IP7A 3QF4B 4X3OA 3U3XA 3WMWA 3FNQA 2IYPA 4KE6A 1H5UA 4XASA 5CDUA 5E9AA 3GMIA 3GBSA 2AJBA 4G07A 3OT1A 3AF3A 3DW1X 4N3NA 3U4QA 1TMGE 5JWOA 3E82A 2J3JA 4RFLA 1F4LA 1PLJA 1NVEA 1EFLA 1R6XA 1WHTB 2VYCA 5JEAE 1AG9A 1FJGB 5TQJA 3OOWA 1EHYA 4LOKA 4K9RA 2WAYA 4WT7A 1LUAA 5DW0A 2NUBA 1GAXA 4GMDA 1PD1A 3IYLW 3ESYA 5SZJA 4MRNA 5DHUA 1VPEA 3W3AH 1FW8A 5E95A 2IHZA 1MG7A 1KEZA 1MB0A 2I6SA 4GEGA 4DV5B 2VDWA 4M60A 5FPSA 2FDXA 4DPTA 1BMFD 3ZU4A 4PS1A 2V6BA 3G0CA 3OO1A 1FC0A 3DMRA 1NBHA 3L0SA 3R77A 5J63A 3BFXA 1HFWA 4DG5A 3IAXA 4P7AA 2O8FA 9ATCA 4F4HA 2NN6E 1MQSA 4II2A 4RX1A 4DR5E 1A2QA 4HN9A 4MR8A 1EVZA 3GNSA 3GLHA 1N0HA 4XYMA 4DB4A 2E7ZA 2RHBA 3IXLA 3TFQA 1JUDA 1VPDA 5HIJA 3QWHA 2ZDGA 3RG2A 4E09A 1CKEA 4NE9A 4XVCA 5T3UA 4Y2GA 1UZLA 3LPAA 2BF4A 4IMIB 1Z6QA 1Q21A 2DQKA 4KQEA 2FPRA 2OLKA 1Z36A 3M33A 3BIFA 2JI6A 2C2BA 1OX4B 4JEHA 2OO5C 2P4EA 1A9RA 3JZIA 4N18A 2XV1A 4JJ4A 4HAYA 2HUPA 2PFSA 4WESA 4CG2A 3BDIA 1ODTC 1HSOA 3AEKB 1L7RA 1ES9A 3OOYA 5H16A 2WU4A 4DPXA 2W8BA 5FBLB 1P3DA 3BK1A 4HNUA 1ZI9A 4M7PA 3O93A 1QBKC 3FWHA 3D4JA 3PYMA 4GVLA 1KY3A 1EEXB 1QWSA 2H2DA 1S8AA 1SD1A 2PQ6A 4S1OA 4CFSA 4J3DA 4WGGA 5IFLA 2ZITA 2C9YA 4QHSA 3BSYA 3CONA 3HJAA 4N3BA 1BAPA 2GZ3A 2O05A 3HV0A 3LYHA 4J0HA 3ROPA 3NC1C 3Q2IA 4WX2B 3IKVA 1C0KA 3EW7A 1F2UA 2NG1A 1UXIA 3E7FA 4BZWA 4JYBA 1JYFA 2CL0X 4NXNI 3I3OA 3R75A 1J39A 1W9MA 1AQ6A 1F38A 2MTBA 3BCHA 3STXA 2WM8A 2XMGA 3A26A 3WL7A 2VRCA 3U3DA 3GQBA 1DWPA 2EZTA 3G9XA 3JQFC 3H8WA 3QE4A 4MW0A 4OXYA 4RORA 5B3JA 1PK8A 4BMVA 3NT2A 4DILA 1XVTA 4KODA 3VR2A 4D6PA 4PPYA 2XUPA 4E4RA 1Q1ZA 1CCWA 4F8YA 2ZIAA 1XD2A 1XF9A 3FNFA 3NTVA 4CM8B 4GMFA 3R3WA 3KR1A 3T3IA 4AKTA 2OOKA 2Y6UA 3IJRA 3JQ9C 3WSTA 2GWRA 5IZCA 521PA 2CDBA 2PA0A 2YZMA 4B6PA 3MMXA 4PO1A 1DJMA 3JVVA 2OV2A 2VXCA 2QVGA 3AI2A 1XC7A 5DROA 4LHSA 4HLQB 3STTA 3VVLA 2C4NA 2VDMB 1H65A 1OKKD 4ZI5A 5HZMA 5GY7A 1MC4A 4LI3X 2JLSA 5KHLB 4V3CA 1BWPA 4PRZA 4KQFA 1ZWLA 1NWHA 1ZM4A 1CX9B 1CZNA 2VKQA 3ZWVA 3O2SB 3SZRA 5BMVA 5JH7B 1IBSA 2FW9A 5BW6B 4Q1FA 4NQZA 3N58A 1NHWA 4JCOA 2FR8A 1HT2E 2VXOA 2PS1A 4YRFA 1N2CA 1CQIB 1FLNA 1ZKMA 1GFIA 4TSRA 3RGGA 4AJHA 4HEJA 3ZNOA 3ORHA 4KQMA 4ND7A 2A58A 5DNVA 3IBGA 3SHTA 5IBPA 1PR3A 4AYTA 3CRQA 5CA0F 2EP8A 1VBKA 1IXRC 1YQEA 2XWPA 1UKVY 3G88A 3ENKA 1T1SA 5H1YA 2GD6A 1RPZA 4ESVA 4AC9A 2JLYA 9LDBA 1D6MA 1WDTA 1H8EA 3R9XA 1RJDA 3HKDA 4W7IA 1GCAA 2WA2A 3IBCA 3Q41A 4L72A 4R8MA 5EG5A 3WZLA 4CLXA 2AG0A 3IP8A 4ZHQB 4YJ2F 1QLHA 2C2MA 2QE6A 5DM60 3FNHA 1BE0A 1FWKA 1STOA 4B5KA 4R71A 3RRYA 2FZ4A 1CXZA 1ZD8A 5CVVA 5K0EA 1U0BB 4PPFA 3G5TA 3B51X 4DBLC 1XNRB 4S1NA 5KYKA 1UBFA 4ZDJA 2AOVA 2AG8A 2PA3A 3IAFA 4HPXB 2HMTA 4R2JA 4N0QA 1N4DA 3RWBA 1WXWA 1FUKA 4KCGA 2R1UA 2VPTA 1V8OA 3D6HA 3L43A 5ICCA 4MR9B 2XQFA 3JQBA 4AZ0A 4UTVA 4U7DA 1CP3A 2D2VA 2W9XA 4RLSA 4ZQGA 3ZS8A 4ZARA 4ZOLA 4PSKA 2H2WA 1XLUA 3L8FA 2GETA 4AY3A 1AKUA 3ZXUB 3BD7A 2NYVA 3KLMX 5JEAC 2GF2A 3I09A 4E1VA 1B16A 1KU6A 1SUBA 3W4IA 4O2BF 3F7OA 2GVZC 3I1JA 1U7TA 3HYSA 3MK31 4BX3A 5BWNA 2PX2A 1UFQA 3TLGA 3EDOA 721PA 3U7RA 2BWJA 2BDTA 1Y8RA 4L2IA 2SKDA 2V9PA 3C3KA 4TXNA 1JALA 4NE7A 3V9AA 1K6MA 4MWEA 1VJ0A 1YCHA 1HETA 4K3VA 4JK3A 4RD1A 5CGQB 2UUBB 3VPDA 5AJUA 4RGYA 4FZ5A 4B8ZA 2IH4A 2NN6C 1N25A 3KSDO 4KK4A 5UKDA 3WFJA 2BONA 1VM6A 4MHTA 1QLJA 3OE7A 5EGSA 3CEPB 4QREA 5CA1F 2F4VI 4MX8A 2BKUA 1L1FA 1X1BA 3A27A 2DUMA 3L8MA 2C8JA 4OJNA 4UHEA 4Y9RA 5HGXA 2YWBA 1UFVA 3O1IC 2V2ZA 3OZWA 5AKGA 1IXKA 1HSZA 1U3WA 5HRAA 3EEQA 5A0TA 2V8OA 3AERA 4TZ0A 1M6EX 3TRDA 2Z2IA 3SFVA 3GLQA 1N1DA 4C76A 1J0CA 4X64E 2ATIA 4AP9A 5JNSA 3AU8A 1M8KA 1RM3A 3BH0A 2JH3A 3E5NA 4K6KA 3AUXA 5LQNA 2YWXA 3EC2A 1EVIA 4FNGA 1OLXA 2XUIA 1XTJA 3EF3A 4Y2PA 1D4AA 1H6CA 1C9DB 3ZIAD 821PA 3OT1B 3HYRA 4G41A 4N0EA 3DT9A 5L8VA 3U4QB 2H0QA 4H7KA 5IK2A 2X86A 4AJ1A 2R7AA 3BSSA 3GF4A 4JMLA 5BXYA 1Y9JA 1W2GA 1A9QA 2JAHA 4GRAA 1Z56C 3RVJA 4AKHA 1Z7GA 3GGJA 3IPCA 2C03A 4IH4A 4XPIA 3PTZA 5FWXA 1MH9A 1WB4A 2H9YA 4HPWA 2WD9A 4JI1I 4TYMA 5G3YA 1F0PA 4MJXA 4NCIA 2II6A 4Y2VA 5EXEA 2P2ZA 1YVRA 1B15A 3IT2A 2I6FA 2R8EA 4IIJF 1HM5A 2HFKA 4PWYA 4AWAA 4HUTA 4BJ3A 4DV4E 4E2XA 5C18A 2X8LA 2O8FB 4X60A 2WJAA 3U60B 4LHXA 4Q7MB 3NNSA 1OWLA 2Z56A 5FKJA 1ETUA 2I54A 4MR8B 1SB9A 4CLHA 4F5EA 3GLHB 4Z0HO 3MLEA 4WADA 2ZU6A 3LY7A 2H16A 4IY1A 1ZH8A 3BB3A 5AYVA 2Q6KA 3STHA 2BMFA 1MAWA 4IQ0A 6ADHA 5DXJA 2XOEA 1YB6A 2H07A 1SUSA 1NBEA 5K01A 1XLVA 4WESB 3VUFA 4AF6A 3FFWA 2WSYB 4JLVA 5L51A 1NAIA 1U7ZA 3W5DA 2BTOA 2HAEA 3T5MA 3NWOA 4EX7A 2W8BB 5FULA 2PGDA 2G71A 5GMDA 1TYBE 2HJ9A 4OGLA 2Z2KA 3A37A 2PXCA 3AJ9A 4NBKA 5AM0A 5CBKA 4OMCA 3NEJA 5J1SB 4K9OA 3OZDA 3GH3A 3GPCA 3SMQA 1RYZA 3SYKA 2C0PA 4CMBA 4WZBE 1HFEL 3A6ZA 3BICA 2PGLA 3JASA 3Q7IA 2D1TA 2IYZA 2V7VA 4FDUA 4GBJA 4I9FA 1LPPA 5T8KA 3ZE0B 4KX3A 3J7AG 4L7VA 2O8CA 4ZJYA 1KR2A 4MSUA 3B4TA 2O3TA 4UNQA 4QJIA 4AUEA 4Z4GA 2XZLA 1F2UB 1AC5A 3ONWA 3GDHA 5DWQA 4P93A 1ZOIA 1SHUX 3OFND 2FVYA 2J41A 1DRJA 1DXHA 3NT4A 3QHPA 4WAUA 1QK5A 2IHYA 3GQBB 3H5TA 2TMDA 4RZQA 3R40A 2H7YA 4H60A 4BVGA 1I7QB 3W9SA 2Q46A 3WYAA 3CO0S 1CRLA 3RTCA 3E53A 3O91A 3GCZA 4D0LB 2VF3A 1VFPA 1L4UA 4BFYA 4YRCA 4EI2A 3TAUA 1T5BA 5FA6A 3WB2A 1XD2B 3WR5A 3ZU6A 2CG9A 1OX5A 1KZ1A 5IJ0A 4XJVA 4YRKA 3HSYA 1IM8A 1DQZA 1UEKA 3UENA 3D1LA 4BO6A 1BHO1 3F98A 2HHAA 4MKGA 4PWZA 1N8NA 4KLNA 5FH9A 3MERA 2JRLA 4J43A 4DR2E 4W9NA 5JWHA 3RHTA 1L1RA 5KJ6A 4KOEC 1ZK0A 4QPDA 5DGXA 3U3OA 3TG2A 1XTRA 3RUHA 4NMWA 3IEVA 4DDTA 1GTL1 1KK0A 3QT8A 5JS2A 2BGKA 3UB4A 1N5RA 3DZIA 4NEQA 5BMVB 5J40A 2G63A 3AF5A 5LQAA 2ZVDA 1N32B 1UANA 1ZP6A 2VJBA 1C80A 1N2CB 4JKIA 4FXPA 4B3FX 2X15A 3S44A 3BD6A 1JN0A 2OZKA 4YR9A 1M2VA 3CRRA 5FAKA 5JHHB 2I7XA 5A9SA 1NF9A 2HQBA 2FPXA 3KQSA 5JAHA 1JG4A 4ISAA 1CV2A 1YU9A 2DY1A 4L5JA 1S96A 3AP3A 3A0UA 4OMFG 1BCRA 1NIJA 1YJQA 4V0OA 5EZYF 4ARCA 3UQYS 3R9XB 2EP7A 1X42A 2HF9A 2PN1A 2AQ8A 3HPQA 1FLAA 1G2QA 3NKLA 4Y2SA 5AK5A 3VAAA 4QPPA 1U0LA 1AGNA 2IV2X 1L9XA 4KSBA 1OI4A 2WKRA 1TC2A 2DFVA 1MAUA 1M0SA 5DFAA 2LUOA 4D0NA 1EIZA 2GX6A 5KC9A 2P4UA 1TM2A 1XMOE 2AX3A 3G8AA 1MIHA 4M1KA 1PL0A 4LV6A 5IJZA 1QV6A 1XP5A 4H7JA 1I94I 4KXQA 3V33A 1Z0ZA 2SICE 3FE2A 1EWVA 4BVKA 1OGJA 1E6LA 4KQCA 4QPZA 5ILGA 4PFQA 1NF2A 2BGLA 2X7XA 2XUOA 1U7OA 4J3NA 5DCYA 4AZ0B 5AKEA 3O8NA 5U1PA 4ZOLB 1N0WA 5CBPA 3H2YA 4HGPA 5BSWA 3UXMA 3U13A 1MKYA 3KJHA 3FSJX 1E7MA 2A1IA 2ZKLA 4KDCA 1OV4A 4BGVA 5LLTA 3DDNA 2DPHA 4GF5A 1H6AA 3ZY4A 3VR5A 3H9GA 1XSEA 2VJPA 3TLGB 2GPTA 2BF7A 4JBWA 1H0RA 1I4DD 2M9MA 2WBLC 3AM3A 1I2ZA 4P54A 3UKOA 5BR4A 4JV5I 4JI3B 1U1IA 1UKYA 1Y8RB 3CUKA 4L2IB 4MVXA 3SX0A 4E94A 4ZQIA 1J0BA 1O57A 2H1WA 1FNSA 3M6WA 1G60A 2XUDA 4TUYA 3SQNA 4K6GA 3QXHA 3AVTA 4EM6A 4FKMA 1NWCA 2C5SA 3SSNA 3V1TC 4FHCA 1CF4A 4MUHA 3STYA 2E21A 3IMGA 4F93B 1ID8A 3IA7A 4KW7A 3DBHA 1EFHA 2BY4A 3A9UA 1ESDA 5TGDA 3WK6A 1GHTA 3P9QA 4LF9B 3DS8A 3GXOA 4FMDF 3H1TA 5J59A 3OCYA 1NYQA 5JISA 1IJEA 3NKFA 3UWKA 1WV1A 4OMDA 3DH0A 3AERB 2YZ7A 3FAKA 3OM9A 1FMTA 4ROTA 1KOLA 5DCWA 3SBXA 1GUBA 5LM3A 3N05A 1EI9A 1EG7A 1ZC4A 1RXEA 1MNAA 2B94A 3EOZA 1O6ZA 2V8BA 2VJOA 4EA7A 2WWTA 3GLGA 4UBIA 4DRXA 1BHQ1 3H3FA 1KKUA 1OCEA 1OLXB 5ABPA 4CL2A 2OKCA 3FPSA 1J8DA 3DOIA 3NB0A 4FNOA 4MNTA 4QYMA 1YZYA 4MMZB 2WTUA 2OAQ1 3F46A 2CLSA 3P2MA 4M9SA 3TW6A 4IFTA 1U3VA 1DRWA 1O87A 3UV7A 5KYUA 4XWWA 1JIXA 3R20A 1T4CA 5K8IA 3W8NA 4COOA 2IIQA 3QOYA 4TXHA 2XVXA 5T57A 2PYIA 3DO5A 4XPIB 1IBLB 5FWXB 4TVSA 4JI6I 5DBEX 3VKFA 3CUWA 5C4IA 3DMNA 4B2IA 1PCXA 1YK0A 2VHZA 2I33A 3G0OA 3O2NA 3OSZA 1KSGA 3RCBA 1RPTA 3W6UA 1X1TA 3MJFA 3WTBA 4GR4A 2E89A 4A10A 1MJNA 2CDCA 3A3OA 2WM9B 5J2UF 1PP4A 1U8YA 1UBEA 5KCMA 4AF7A 5TVGA 3RYCA 1KYTA 3L4SO 1TA4A 3KYJB 3F74A 3KSZO 2PZGA 3ZWYA 1FXUA 2FP4A 3T1NA 5I4KA 1IWBB 2HD4A 4J0QA 3TLCA 3AIIA 1T9KA 2JFGA 2JVJA 4Q03A 3R2JA 4UVDA 3W8DA 1MORA 5P8WA 1KQ3A 2LWIA 4YCDA 4RQTA 5JMWA 4KG7A 5A2QA 3ZHXA 5BSFA 1GEGA 4R9UC 3BH7A 1E6MA 5FWKA 3NJ4A 7MDHA 5KOJA 3BXFA 3ZQKA 4XWGA 2BUAA 4ZVQA 4KV9A 3STUA 2HLPA 1GRNA 3AHJA 3CUVA 3H19A 4P9NA 4PQEA 5JYCA 2O3ZA 2O7RA 1I14A 3WYGA 1TZ2A 2Q4RA 3OUZA 5GTDA 1T5IA 3HB4X 5J5VA 5CB4F 4DKXA 4MVJI 3BG5A 5DBIA 3FI9A 5FBKA 1EVKA 3FCSB 5T4HA 4LJ8A 3WIDA 4CDNA 5FDFA 1T5DX 3UC5A 4CCYA 1WVMA 2QTZA 4D4HA 2C2KA 4USMA 4NABA 3JASB 4WK4B 1GZVA 4Z86A 4YCBA 3T3GA 2IY8A 3O1HB 1S8NA 2IUTA 3EZ7A 1UJ2A 1XNGA 4YXWD 3D6NB 2QUBA 3KYBA 3FMOB 4K5QA 1C1XA 1XL0A 2XA9A 2OUKA 2WD8A 4DLBA 3SLGA 1CBUA 1I2MA 2IXDA 3K0BA 4C87A 3QU2A 5BRAA 1V5WA 2ZS9A 4HH0A 2J1LA 4ECAA 2F55A 1SBZA 4MUXA 4IFIA 1WZNA 1RR6A 4KK3A 4MYUA 4EBBA 3MTBA 2SCUA 1O96A 4L8VA 3WYCA 4IJ6A 2PD4A 4YJKA 3QXGA 2WA1A 4OYYA 5JSZB 1UBMS 1CY4A 4XDHA 3BIWA 1GG5A 5K3DA 4B85A 4AF8A 3HB5X 5LA6A 5IJ0B 2ATXA 2GHTA 2D54A 1VLQA 2EG5A 2IZZA 2WJ4A 3H1GA 3SJBA 1D4FA 1IHDA 4IDDA 1O0BA 1H8HD 2GR9A 1XVIA 1SBIA 4JT9A 2C42A 5JNRA 1HMYA 1YVPA 4ZI2A 3FOAA 4XYEA 2V96A 3K2BA 2I4IA 4FXOA 3G2NA 5THQA 2DY0A 3KOYA 3KO8A 4DSNA 5I8WA 5JD6A 2HSJA 3JQAD 4MB0A 4YTEA 3UKDA 4HAUA 5G41A 4GI3A 1I0IA 3E8MA 3M34A 5F12A 3HXLA 1H9AA 4NP6A 5D8DA 4F4CA 3C4JA 4M1ZA 3PXEA 4NBVA 5EQFA 3GEMA 3AHDA 3U1YA 3P20A 3UBMA 5LMUB 3WGYA 4C0XA 4EUKA 1K3UB 4OGFA 4I9UA 3PJEA 4QRIA 5IHPA 1M2VB 2WIFA 1UM8A 2PH3A 3LPSA 5A9SB 5KPDA 3KD3A 3IC5A 1QPGA 1RLUA 4D8XA 5EJGA 4L0MA 1BCRB 1TEXA 1DEXA 1TAQA 5F9HA 2B35A 1WUKS 3FBTA 1N2ZA 3LJKA 5E3HA 1G7CA 1XDUA 3WGHA 4JELA 5E4TA 4EW3A 5I5GA 4FWIB 2CEAA 1QCYA 3KT6A 1PGPA 1AY0A 5AK4A 3N0RA 3I1IA 3B1FA 3DQQA 4UHCA 5HZHA 2O1WA 2EW8A 3RSFA 1DIGA 2Q45A 4K9KA 2P9QA 3FSRA 1E1YA 3MT9A 3ZE6A 1QGOA 2GXAA 1Y4ZA 1HFJA 2WLTA 5DDIP 5KNBD 1CR1A 1IDOA 2BUCA 3QBDA 1SC6A 1KQNA 5CBPB 4WK6A 2JZOA 2P6MA 3JVIA 3I6ZA 4AG6A 8ABPA 2TRSB 4OLBA 4GNRA 2YICA 3PYFA 4ZT5A 2HQ1A 2H00A 3MGCA 5J4LA 5ADWA 1N5MA 4G5HA 4DR3I 4IJUA 2JHPA 3WBKA 2IYNA 3SBEA 3RVRA 1PSDA 4ZRMA 3T34A 1X3SA 3NKVA 3BGVA 3JQ8A 1DQNA 4ZT6A 1Z33A 1PHRA 2V1XA 3L05A 5LLDA 5H9WA 2O2DA 3LUBA 4HLNA 4DV0B 3DE6X 4R2HA 5H83A 4KXMA 4TUYB 4XR4A 3RT1A 4XM0A 5JS8A 4MIOA 4DIUA 4NCNA 1EYZA 1HRDA 2ZJAA 3LUGA 1XE3A 4G0ZA 2R7KA 1SC1A 1MU0A 1M2KA 3FHJA 2EBFX 2MSWA 3H5VA 3PFWO 4YJGA 3NLLA 1P9RA 1Q0HA 1TVEA 3DBHB 4FI3C 4GXQA 4RABA 1Q2UA 5BSRA 1G3RA 5DGCA 3DT6A 3UPDA 4FW3A 4OHOA 2F1HA 3ZWDA 3KT3A 4C88A 1T9CA 4KAJA 4RL6A 5E8RA 3X1XA 2VJCA 2EP5A 2ZI6A 4TN5A 4Y6PA 1A72A 4DRYA 4ZALA 2DPLA 1A96A 2C29D 1IUNA 2ZRMA 3CX3A 3L0IB 3C45A 3GLGB 1XZJA 2D2IA 4XXHA 1XCOA 3RRJA 1ISRA 1CERA 1UT5A 4HVTA 4DRXB 1I1QB 4IG9A 2P77A 2H1FA 5DYWA 3OIVA 3Q40A 4GE3A 4IV5A 2QRMA 2A33A 4LRXA 4MQ5A 4NTZA 4W1RA 2WI8A 3UANA 4QKQA 1KJZA 4NNJA 4RXUA 4EATA 3QEOA 3WC4A 1LLUA 3CDJA 8LDHA 2G5CA 4DMFA 2C4TA 4CIYA 4LXQA 3WIBA 4XOIA 3FPFA 1QHXA 3L46A 4OXXA 5CNMA 1NVBA 2WIDA 1T4CB 4BKPA 5KWEA 1ZL2A 1B2RA 3A1TA 4A16A 4DXHA 1DX9A 4KGVA 4RZ2A 2GXUA 1ISMA 1YACA 2JHGA 1KYQA 5ALTA 1Z47A 2MOKA 1DIOB 3G7UA 1JLKA 3HULA 5L7YA 2ILVA 2XMPA 2VYVD 1OHHA 4NXMI 4DJJA 2CFOA 1A8PA 3IKMB 1N3IA 2BI8A 1QF6A 4B6EA 5CXXA 1B42A 3VU3A 4NU0A 2H65A 5E2AA 4Z7NB 2Z08A 3PI6A 3RYCB 4I4NA 2I6XA 4QASA 5CA0A 4DDHA 2FEMA 1DC3A 2NZYA 2FP4B 4WN3A 1UBRS 3JPYA 3LVRE 5GV7A 4CM1A 3IQFA 3WLFA 6YASA 3BGSA 2PK3A 4I4IA 3H5AA 4KQ9A 2AD5A 3K35A 2EV9A 3B5EA 3MJHA 3MN1A 4P7GA 4S1VA 3LK6A 4XCVA 5CX1A 1MX5A 5L3RA 5KOJB 1ZG3A 3CW9A 5ALOA 2WZDA 4MEAA 2XUAA 3TZKA 3V4OA 2MSLA 1RCUA 1T1EA 2IV7A 1DAFA 3TX6A 1ZM3A 1JIJA 3B1YA 1ECPA 3DOCA 4J29A 1YMQA 4MV4A 5BW5A 1DQYA 4DR5I 1TMOA 5E6UA 3HM9A 6Q21A 1SQ0A 4DCTA 2Y1WA 1A2BA 5B3JC 3R3VA 1Z2AA 3GRVA 2Q99A 1X8LA 3AF4A 1K8QA 2DRIA 5DCLA 1AZTA 4NZZA 3WMEA 4F7WA 3KSBC 4CCYB 1L5SA 1TADA 2CK3D 2J08A 4AS3A 2FSFA 4G5QA 4G01B 3WGVA 3K0CC 4BMZA 3QPCA 2UZ0A 4O2BA 2FMFA 2AB0A 2C3MA 4CUKA 5ECDA 4WLUA 3WWYA 3AWDA 3BMCA 1SZCA 2WPDD 3CR8A 3OOSA 3H2IA 4LTDA 3Q1LA 3CYFA 1URPA 3M0EA 1C1XB 1ZD1A 4RAQA 3PPWA 3TQTA 1KIJA 2GA9A 3E6AA 4DDWA 1N5OX 2MJLA 1TU3A 1I10A 3NZKA 1KR5A 2C7GA 1J2EA 2PU5A 3GEPA 4G0YA 3WMXA 3IDAA 2ZUVA 5L6LB 1UDSA 2ZYHA 3Q85A 1JB9A 4UAUA 1GWNA 4EHJA 4TVKA 2EL7A 1TQ8A 3AW9A 3K32A 4OP2A 3IT3A 5B2ZA 1UDOA 1ATIA 4HLCA 1F06A 4I3HA 1VTKA 1O96B 2JVIA 2YHIA 4LK3A 5CA1A 5FLYA 2H92A 3D6JA 1VSBA 3CTPA 4Z0TA 4PRLA 1TJ3A 3SEFA 1LQTA 3TJZA 3I01M 5LA6B 4EHAA 3PYGA 5AUPB 3HADA 3HN2A 4M1SA 1WTCA 3IE2A 2EJUA 3TOZA 2VH5R 5AI0A 1ESEA 1JU4A 1G18A 3TLJA 5I7UA 3RLIA 2B4QA 3HCFA 2IDMA 1UQTA 2VWGA 4NBQA 2B61A 1B0UA 1XDSA 3RASA 2WZCA 3AFHA 3I30X 4DUGA 5FLXC 1N75A 1T9HA 2N47A 2FSUA 3FTNA 4HQRA 1TXGA 1YH8A 2IEZA 1XF1A 5E38A 5A4MS 1WS6A 1PWXA 5I8PA 3I6IA 5K0FA 3R7BA 1H1TA 1WXDA 4YP9A 5TY0A 1R0RE 1WO8A 4DRZA 5DASA 4YRMA 3H1BA 2D7JA 4OHVA 2OWEA 3UVEA 3TSOA 2Z5EA 1H4VB 4Z54A 5GINE 5A2QQ 2Z4TA 2DE0X 2FSHA 3IDZA 5HRCA 3IL2A 1DINA 3F4KA 2O2YA 4EI9A 1IY8A 2V65A 1HYHA 2E3JA 3WQQA 5KTOA 1MHTA 4IZ6A 1Z39A 3W9UA 2B4TO 1KY4A 2QNIA 1NBMD 4UZSA 4I46A 1JLRA 3FVQA 4ZK2A 3IJEB 5F98A 1AKYA 4V0LA 3TFWA 4EFNA 1VG1A 4IIJA 1CPYA 3EAFA 3OZUA 3GT0A 4KNVA 2AJ4A 3C43A 4O5OA 5DRTA 2CJYA 5MN4A 2MSNA 4PHCA 3MUOA 1DG9A 1IY2A 4E11A 1YE5A 2YIDA 5KBYA 2RAPA 1EE2A 3CNBA 2Q5LA 3S0JA 3KEGA 4BKUA 3HY6A 5JZMA 2NACA 1Z29A 2ZRBA 2G28A 3I12A 1NRJB 3LKDA 3RSQA 1PYDA 3HWSA 4RCVA 4A1FA 2FOXA 3NV9A 4R0NA 4EHDA 4GP6A 4H31A 1BFKA 5JI2E 3V55A 1YR8A 4OLHA 1C9NA 1W52X 4GOND 2Q6TA 1NNUA 4E22A 4EK9A 2HA7A 2Y9PB 3FFTA 1FKAE 4RELA 3BCUA 2BHTA 4PZYA 2XB6A 4J2TA 1SUFA 3L06A 4CCAA 3HJRA 3DE7X 3O8RA 3JQ8B 1LJUA 2G8NA 3MRSA 5FB3A 4WCDA 4XD7D 4EG3A 1SWWA 4HFRA 3FYSA 4LZPA 5JDIA 3V3KA 2WPNA 2C2WA 4Q3CA 1MB4A 3NAGA 3QVLA 5EIXA 1O5OA 3LUJA 1QP0A 2KM1A 3HCAA 3T35A 5F52A 4EKEA 5D01A 3ZJUA 3QUBA 2OCYC 3T4XA 4YJGB 2QORA 3CPSA 3H7IA 3QMMA 4NYMR 1Y98A 4BNJA 2FUG6 4DWWA 5A62A 2GFIA 2F00A 1QIIA 4ABYA 1Y42X 3OZBA 4B3JA 1XZFA 4JYZA 4M9RA 2P2CA 1OFUX 1P5RA 4LY9A 3VQTA 1WU8A 3TW4A 3FFXA 4FT4A 3KU4A 4QNMA 2Q2EB 1G8KA 3AL3A 4CQJA 4ZGWA 2A2DA 2HA3A 2G76A 1QG4A 4DN6A 3A25A 4Q1DA 1KIMA 2XYQA 4MUEA 1AQYA 8ADHA 1PZFA 1TCUA 1CUCA 3ENWA 3N2EA 4KN5A 2AKAB 2LD4A 4QA9A 1OB2A 1UBUS 1DQSA 3E48A 3P19A 1P9LA 2FLWA 1GPUA 1U8EA 3Q0IA 3SNKA 2BTQA 3VR3A 5BR8B 2PS9A 3IAUA 2RG1A 1U28A 2B1JA 3KQOA 3RE1A 2QJFA 3W1VA 2IFTA 2QP9X 4OXIA 2J9RA 3I76A 4IEEA 2UUCB 4X64I 2VF8A 4PAOA 4YMUA 4OX9B 1JYSA 5DRRA 1JBKA 2O2XA 3R5SA 4XIJA 3QLVA 5DTEA 2P90A 5LB4A 5IN4A 1EA7A 2WU8A 4YALA 2CUKA 3DEHA 3D6MA 3ELYA 2XA1A 4RK6A 2Y1XA 2G9ZA 5AXAA 5SYMA 1JB1A 1PU2A 4HX2A 3RU9A 5BSEA 3BB1A 3NHPA 5E1MA 5FOUA 5HJ2A 1UDXA 4NAUA 3BDVA 1LTHR 2QSJA 3P9CA 3GJQA 5CA0B 4GI1A 1W4LA 3ANLA 2DSNA 2IDKA 4FHFA 1UDAA 2HK9A 3A6LA 2JB9A 5I4BA 1ECFA 1BE6A 3NDRA 3UGQA 3AVXA 2I78A 3PUWA 1DJLA 4JYAE 1N6HA 1T2AA 4O3FA 4TQGA 1QH0A 5EZYA 3TRKA 1GEEA 2E5LE 1JJIA 2QRQA 4KLCA 4AJ2A 4F85A 3ESCA 5CX1B 5IPFA 4LAFA 4R2KA 3N1UA 3F96A 5GJCA 1ANKA 2GBLA 3V2UA 5A1TA 2H63A 1BS1A 1UXJA 5IWAE 1CUDA 4LVNA 5MGBA 1G63A 3DXXA 1A0OA 1YFJA 3MBIA 4JJFA 2FRXA 2QUJA 4WTOA 5E6UB 4AN1A 4CMEC 5AQ1A 3OPVA 2JLUA 4FSXA 5JTTA 2X0FA 1DIBA 2P7HA 2G1PA 1J2RA 1G4AE 1LXCA 5L40A 2IIPA 2HZ7A 3ITEA 2OCBA 2H1VA 3JD2A 4H6XA 2R65A 4HYTA 3ND7A 4II7A 4DMKA 3TD2A 3QUSA 4AY4A 3CZMA 4O2BB 3DZGA 1BG6A 2CSUA 4G8CA 1QFXA 4DHWA 1Y4UA 3BMCB 2QV0A 4KQHA 4C29A 1KTVA 1SVLA 2JFPA 2CNWD 4FWBA 2X42A 3JYHA 1FI4A 1RSZA 1AGYA 3F8TA 4M0LA 2BDUA 5CPBA 3URMA 1JQ3A 3DO8A 4TS3A 3ER8A 4Z5XA 4DA4A 1RXCA 1EVLA 4O8CA 1N34I 1QJ4A 3CDIA 2H8GA 1Q44A 3RKSA 3HUUA 2WYIA 3A05A 3WK9A 1FU4A 3H87A 4X66B 4YUVA 1N36E 1V1MA 2NUPA 2QT0A 2XLCA 2HUNA 2YHIB 3GEIA 4K46A 2VQEE 1X1SA 5DCUA 2GKOA 4DBVO 5CA1B 3GYBA 3L1VA 2R4QA 3Q7QA 4GDMA 3MUFA 4F6RA 3ZWOA 1IN8A 2GVNA 2VAVA 2XNDA 3RAJA 3SK0A 5CFRA 4N5HX 2UZ4A 1QB8A 1AKRA 5LYJF 1XZIA 3IAS6 2G67A 2YHBA 4C43A 4F9GA 3K20A 1MTOA 5G1NA 3JSXA 2MSEB 3H9JA 1JR3E 2CVEA 1PR2A 3KEMA 1IOZA 4GZ5A 4DW8A 4LF8E 1OASA 1BSVA 2C4UA 3KJXA 3RC1A 3MJRA 4UOEA 4TLAA 2OGUA 4YH1A 1OXVA 4YY3I 4BXOB 1B6SA 1I24A 3KKZA 2VK1A 4IKOA 4N3CA 4RA6A 2PVPA 4UVGA 1FWLA 4PR3A 3P97A 1QYWA 5LMNE 1T4GA 2FZWA 1ZN8A 4IPTA 3IEKA 4R7TA 4QOSA 3THXA 1A98A 3WGKA 4MTCA 3S4YA 2GF0A 3I52A 1BA3A 2VUIB 5KC8A 1ICEA 3H99A 1AV6A 4NBSA 3UWSA 3TE6A 2VYND 4TLCA 3PQFA 4ZVKA 4PNEA 1PJAA 2FGKA 2Q2VA 2NSYA 4WOJA 3SLKA 4G09A 4IIJB 3OO0A 2GNPA 5J2UA 4FEYA 2QMYA 1T6XA 2Q5EA 3VVMA 4FK8A 3U49A 3OUUA 1VCOA 1ZUIA 4H4DA 1Z0EA 1LK0A 2A9OA 3JVEA 4E5YA 1N4AA 1W93A 3RRNA 1YR3A 3G9ZA 1SIWA 1OH7A 4HDCA 2LDBA 4FSHA 3EAQA 4BV2A 2NGRA 2XUGA 1WB6A 3IQIX 5C51B 4L5AA 4JZYA 5JYDA 1XNHA 1SXQA 1P62B 4WFIA 1XXLA 1KL7A 1ULSA 2F9LA 3J80C 1UM9A 4WDRA 4YRTA 3NXSA 4JHXA 5IAJA 4KYTA 1GQSA 4OQEA 3PNMA 4HAZA 4DA8A 1XAGA 3WV5A 1PUXA 2NVOA 2YXPX 1IBME 4IFDD 3WKDA 1Z0GA 2JKVA 1M9NA 1NXQA 3GNTA 3RS5A 3ZKDA 1B0PA 1YXMA 2WP8J 4KXXA 4X6LA 3TOVA 1OAOA 1XMOI 3S6JA 1Q84A 4CTKA 3RAPR 4HRAA 5CB4A 1B6RA 3BWXA 1UDNA 2QRZA 3S55A 4RNDB 1WXEA 2R47A 3WWZA 3HYNA 4G5XA 3OJFA 4YMSA 5F3RA 2PL5A 4Y2JA 4B82A 3ED1A 1ZVVA 3M9LA 1ADFA 5KREA 3P0IA 4B8WA 5ALGA 4JI5B 1QQ7A 2ZT8A 1LK7A 3DVLA 3B1JA 5HF6A 3HLTA 5JY6A 2EKBA 2ZBFA 3KCQA 3MMSA 3PA6A 1KF0A 2FETA 4MCAA 1Z0AA 4QOEA 1MF7A 3W8EA 1DAHA 4JC5A 4LCBA 3J81C 3CF4G 3FN4A 1RHJA 2PV7A 1IHYA 3K30A 3MGAA 1D2NA 3N0WA 3PDIA 3OHPA 1WD5A 1K4KA 3PKZA 5AI8A 3ACCA 5AK3A 5AKKA 3WGTA 4MWGA 4CF6A 1AKVA 4D9KA 4ED9A 4HD8A 1HQKA 4FVTA 4RK5A 4WL0A 5AJVB 3CEMA 2FX2A 4BEBA 2EKQA 1L0BA 3K71B 2ZZKA 3ROGA 3U16A 1UWLA 3S2EA 5EPUA 4LHEA 2Q41A 5FI3A 3TOXA 1ZNXA 1NY5A 4LYEA 1H2YA 1QH9A 5DM4A 2C9ZA 3QU7A 1UMBA 4GO1A 5IBRA 1FP4A 4KXWA 5KJFA 2HRDA 2AQHA 2EJVA 1GR0A 2PKYX 4D46A 2D0DA 1KC3A 2BTQB 4GAEA 4JMPA 4KWCA 1PVOA 2C37A 2JT2A 2RHMA 1DKRA 1T2CA 1PIEA 1U6KA 1SU4A 1XA4A 3DM9B 3F4LA 3NBAA 4W8OA 5DMXA 2ACWA 5JYBA 3BUSA 1M8GA 3UT0A 4UFNA 4TKLA 3WNVA 1OYWA 4KHPI 1N9GA 2XBLA 1RQRA 4OEHA 3M82A 3QFRA 3WKAA 2UYCA 3B5IA 3AOGA 3DZBA 1NMXA 1ZSYA 2P2GA 4A0HA 3I8SA 1BQEA 1Y89A 5A5FA 5KCZA 4C0KA 3MG9A 4BX2A 2F17A 2W0MA 5K4AA 3KB6A 2QSYA 5DZSA 2PLWA 1ZGZA 4F3CA 4OM7A 4NV1A 2W37A 4YRPA 4JJEA 2UYQA 1ULHA 4EO9A 5FEUA 4KQGA 4BA1B 4E31A 4O59O 4P4SA 4RPLA 2ZJFA 3NHUA 3QXXA 3H1FA 2R1TA 4TWRA 3OP4A 3OZSA 4H08A 5EZYB 2BRUA 2VWPA 3U7QA 5IDYA 4ZYWA 4V38A 4YYEA 1T1JA 4OQNA 2IUUA 4B3SB 1FSPA 2PG3A 3OESA 4NZ9A 1D4ZA 4LQLA 1J1ZA 1ZGGA 4KB5A 5EMMA 2NQTA 2VDKB 2GJKA 1FUUA 4QUAA 1UKEA 2BA1G 1ZZGA 4QEDA 4A82A 4Y67A 1PZGA 3K9FC 5K51A 4HXEB 3KQLA 2WU3A 5B6JA 1QE0A 3MIZA 3ZLVA 5EJ2A 4BRUA 5LU8A 2D00A 1N6RA 2B4AA 1V45E 1X7YA 2JD1A 2XRFA 1Z62A 3MFQA 3OEYA 3ZIUA 1OQAA 1QMPA 1V0JA 1UBNA 4B4KA 4C0QC 1Y8QA 2DHEA 3U09A 5FBWB 1CUAA 1PSZA 2Q49A 2HTFA 3VJRA 2HY7A 2PFGA 2IPAB 2FPUA 1JQKA 4F3YA 2DCMA 4JN6B 2QRNA 4AX4A 4RZXA 2CV2A 3AU9A 2H1SA 3EMDA 4UEQA 1J00A 2VAXA 4OIFA 2Q0SA 1JXQA 3V4FA 1Z13A 2RK6A 3DKRA 3PNBA 4GSLA 4RUKA 5ESDA 3UAOA 4F04A 4BQQA 1LBIA 2AK2A 4NZPA 3TSWA 3R44A 3WOHA 3ZQJA 2OZEA 4ENWA 4AZWA 3IBTA 4LGCA 1G21E 3ZVRA 3BBPA 4QYTA 3ZR4B 1T2DA 1U11A 1VJ5A 1X7XA 3SZOA 3T7KA 5HW0A 2F8TA 4KQKA 3SYMA 1KDPA 4GPBA 5BNZA 5EIEA 1JDPA 2NUPB 1V1MB 4B2YA 3FPLA 3FVVA 4MWOA 3HKEA 3DEFA 3S8EA 2FX3A 4F6RB 2OFPA 1XMPA 3LNUA 2I99A 3C5CA 4FILA 2M6KA 3RSHA 3LHIA 4EUSA 1F2VA 1VXOA 2E85A 2OZPA 4FMDB 4RHUA 3T5BA 4A9AA 5JBNA 4AQ7A 4ZZ3A 2YJ3A 2ODTX 3PI7A 4M1MA 2HU7A 2LCIA 3HL0A 1P72A 4GKBA 1EVEA 2RB4A 3EVZA 4XQGA 4I5EA 3L7BA 1YI0A 3C6MA 5FOTA 3EF0A 3HYTA 1U0EA 3MAGA 1G98A 4U6SA 2HFSA 1LPNA 2L18A 2WKQA 4LIPD 4MGYR 2WKSA 3VHXA 4BNIA 4EUFA 4PX3A 3CRVA 2FXVA 5ALZA 1TJNA 3H97A 3AGPA 3IUQA 3MOGA 1J9GA 4JYMA 3NHFA 4UJ5A 4CTOA 4ME6A 3DV9A 4RA6B 3HJBA 4A2CA 1QFZA 3QUQA 3ABSB 4UPDA 2Q1TA 4BFZA 1NF3A 2WP0A 2GD0A 5JJLA 1YWGO 2QQEA 2QJRA 1PVVA 4ZQCB 1AU9A 2PM8A 3THXB 2VL7A 3D64A 1TM5E 1RI4A 1Y5LA 1SCDA 5B1DA 3NAQA 1OZFA 1SCBA 2FZCA 4GOLD 4TWBA 1Z7YA 3FB4A 5I7EA 5I7AA 1RP1A 2XDWA 1YDEA 2ALJA 2IE8A 2QN6A 4UAVA 4B2LA 4C0HA 2P9JA 1C2TA 4A8JA 5J2UB 1Z5BA 3OPMA 3GJ6A 4H27A 1GDDA 2TECE 4JKYA 1VCNA 3MS2A 2QLFA 1P5FA 2AKYA 4KE7A 2L82A 4PIMA 5IUNC 2X76A 2OYSA 2ZI9A 3ZW8A 1U6IA 4IQGA 5CCDA 1YFLA 4ZKEA 1CZOA 1GGMA 1SXJA 1PYOA 4MW6A 5L6MB 2E4WA 2V5UA 1GKKA 1SCUA 4PCVA 2O8VA 1DUVG 2YUTA 3AY3A 4C9BA 4URYR 1XZAA 4WKCA 4D9BA 1Y4DE 2AE8A 1UM9B 4PZZA 1C81A 4Z99A 2JIZA 4BC1A 3JZAA 3VJKA 1OXKB 3UAZA 1A9YA 2C2GA 2FFQA 4KQ6A 1XQ1A 3HY3A 4LMRA 3SYNA 4DJTA 3RJZA 4BJ6A 3O8CA 4G5GA 1RMYA 5ITZA 4PCAA 2QAJA 3GDOA 3TCKA 3IIIA 4PM4A 5BQXA 2QX9A 1QGZA 5CB4B 2HT1A 1E7QA 2R86A 1V39A 4JR1A 4QBGB 2C59A 3UH0A 5C8DA 4IIYA 4MUKA 5AVJA 2BKAA 4Y2TA 3P8ZA 4KQWA 2ZRQA 4IZJD 2YW2A 4JU8A 3HKCA 1HWYA 1XJCA 3AG5A 4EW1A 4JOCA 2H1OA 4D8YA 4ZVNA 1EDEA 3NBMA 4CIBA 1F2DA 4YO8A 3B85A 1NW4A 3IIEA 3LDAA 2DERA 1C0IA 5LNK1 3T3EA 3Q6MA 2Y4NA 1UK9A 2VLIA 2ABWA 2VPQA 4LDZA 1E6WA 3QT5A 1E1RD 1SG9A 1X1EA 2CB9A 4KDRA 3WGQA 1NDHA 1NP6A 1I32A 1HEUA 3MWLA 1I6LA 1G1MA 3PDIB 4HVCA 4Q1VA 5DISB 2C82A 4B6JA 5DTRA 1MO4A 1DAKA 3AR5A 1MRZA 3FHLA 3RUCA 2CBXA 4DJAA 5H3LA 1D8AA 2VTKA 4ESOA 3OMXA 3AESA 5FORA 4DVGA 3HDGA 2JF0A 3AVQA 4R3WA 4PN7A 3B78A 4BZXA 3W06A 3QBEA 1MFZA 4GPIB 4P58A 1N33B 1V47A 4EYSA 2NLOA 2HMUA 3C4QA 2B1IA 4FN5A 1JSRA 1UMBB 2P0YA 1FP4B 3FVRA 5DHAA 1SY7A 1WSWA 3C3BA 4QGHA 4ALJA 4AMUA 4QPCA 3P71T 4A0QA 2BBWA 2IOYA 4LYGA 4BNGA 2D3WA 2AR7A 4YBZA 5K0ZA 1S9HA 1DB3A 3T1VA 3VR3D 1TL7C 4IV0A 4UAJA 2OQRA 3DC2A 2E9SA 3QPUA 1N9GB 5P21A 3HCOA 4WA7A 4RKWA 3HACA 2H1IA 3KTAA 2FWRA 3OH8A 3MJSA 2UDPA 4MDYA 4DWVA 5EFZA 3FUWA 4IOLA 1YQGA 2VA9A 5EJAA 4LF6I 3TH5A 2LIPA 3PNYA 3UMYA 1NSYA 2JFXA 5CFZA 2D0IA 4DLRA 3GLIE 1F5NA 2YFYA 4X97A 5K36E 4ZEWA 4YROA 2ZZMA 1KFCB 4P4SB 4PQRA 1R3DA 2M32A 3W7BA 1VGQA 2ECFA 5L45A 2HHHB 1D2GA 4KR2A 1TW3A 1I9CA 3BILA 4TTJA 2VP0A 2R1TB 3I0NA 5D00A 4BWGA 5ITVA 4G5FA 3U7QB 4ZZIA 5JCJD 4FWDA 1TA9A 1N3YA 4FFNA 4AJNA 1KYYA 2VNJA 5IP5A 3D7RA 3WHPA 2BSXA 2ZM5A 5J2TF 2Z2ZA 3EEOA 1I8TA 1XWFA 1EAMA 2ZT7A 2HKJA 3KZVA 3AR8A 2FW7A 3ZV7A 4D2IA 4GRDA 2OVBA 1SN7A 3LY8A 4CV3A 5A0VA 1ZJ4A 4EYOA 1YHCA 1J8MF 4D82A 2WVHA 4NONA 4BVLA 3DEIA 4INJA 4QYSA 4XGRA 1M1ZA 1ZRMA 3E3MA 2VT3A 3PQCA 3T7DA 3WA6A 3ER9A 4YRBA 1X7YB 4DSTA 1P31A 1SCIA 2ZJ7A 4EA8A 2EG9A 1E3JA 1WW3A 4RJKA 4CF3A 4QEZA 1Y8QB 5DB4A 2AJ8A 5EC8A 2XXAA 3L6CA 3P3GA 1XEWY 4C1BA 4FQ8A 5B4TA 2ENWA 4IHJF 4TMWA 3Q7SA 5LQUA 1NG9A 4YIKA 4MVJF 2J3IA 4JBNA 2D74A 4YPOA 1YZUA 3MTEA 3S70A 3LW7A 5D7BA 5AJHA 2IJGX 2XMSA 2JIRA 3FYUA 3IOMA 4EJ0A 1XEAA 2E49A 1K8YB 3C4VA 1GYQA 3EVAA 1BU8A 4NLLA 1EJ0A 3A4LA 1O58A 1X7XB 3ZDQA 4AP6A 2PBLA 2AZXA 4ZVOA 3EUEA 1JAZA 4YP5A 4CN9A 3SF8A 1GRQA 1ZONA 4KMOA 4EF5A 3OCXA 1QR2A 3HKEB 1YUNA 2J7KA 1FFSA 3MWDA 3EOBI 3H5IA 4DPYA 1Y81A 2R3SA 1WCWA 3HYLA 4LOIA 2ZJBA 3AM4A 3RVPA 1Q74A 1X1QA 1EHCA 3EULA 4RVSA 5JCOA 4G0OA 1ZN2A 1W4CA 2JS7A 4PYMA 5CNIA 1XAHA 2YCBA 3ZW7A 4LDAA 1AQNA 2ZSJA 2NXJA 2ZK7A 1VMAA 4DPUA 1A8QA 1EFRD 1WLSA 2GFQA 4DA6A 5C35A 5JBIA 2FN8A 3VHXB 1MXHA 1RKXA 1G20A 3GO4A 2ODAA 4HRVA 2X3YA 1YS7A 4OQZA 3N2KA 1WPGA 5LQSA 3LX4A 1E2EA 2RHHA 3G02A 3LQYA 3Q10A 2EW1A 3ROXA 1RXSA 5KNCD 1VRWA 3C5WP 3E9CA 4V1CA 5JI3E 5FL7D 2VQ3A 2XXBA 3O83A 4N41A 3BGDA 3M9XA 3WGOA 4F2HA 5CAEA 4JI0E 3NH9A 5AWFC 4FB5A 2GN9A 1ZVMA 3QY9A 3WLTA 2AL7A 1GNTA 3LQQA 4QTZA 2PBFA 5IJAA 3ZCQA 3SG0A 4BHTA 3E5HA 1HTBA 3CIFA 1PFYA 2Z1MA 3VZDA 1NW5A 2DSTA 5DT9A 3LT4A 4A8JB 4LTNA 1NLMA 4G1BA 3B6MA 5KJCA 2AIRA 3IDOA 5I5EA 2UXBB 3I05A 3KYIB 2Q1XA 4HQOA 3BWEA 1EU1A 1NRWA 1ZMRA 3IR5A 5FA5A 3ZKWA 2YV1A 2EFGA 4QODA 4Q3KA 4U7WA 4AUMA 4Z4HA 4XEHA 5TJHA 1SCUB 3PL1A 2OK7A 1OZAA 2QD5A 2YN4A 3RBAA 2C84A 1JLSA 3AHHA 5EUCA 1QVZA 3IUMA 4HWPA 2ZBVA 3TK1A 1EBFA 4UCWA 1Z7EA 1XMQE 2REQA 2J8ZA 4UEJA 5KMGB 3LF2A 5BV7A 1GAJA 3P4XA 3LCRA 3KKLA 3HCEA 3L0YA 2PKQO 2B98A 2YWEA 5ITZB 1X0VA 2PR7A 1RWXA 4U2FA 3AO0B 1FSGA 3NDIA 5BPFA 1K2WA 5H4GA 5HBGA 2I71A 4D0SA 1FU7A 1C30A 1OT5A 4I8XA 2D2XA 1U65A 1YDFA 2CVQA 2JAUA 2TS1A 3GH1A 1ENYA 3GLTA 3HKCB 2RGXA 4ZT7A 3W6PA 2O7NA 4NULA 1XMSA 5FNVF 4QOIA 1CUFA 3KJNA 5J4HA 4DV7B 3ZK7A 4CV0A 5K36C 4FEGA 4C7OA 2BKLA 3OIGA 5BURA 2YV5A 2W6QA 4QUEA 5C2JB 3AKYA 4CBVA 1Z5UA 3LU1A 3NEPX 1XWWA 2YQ5A 1F17A 3JRXA 4KFUA 2PJRA 4ZCMA 4PLZA 4EB0A 3ZM7A 3PENA 1IY0A 1U7UA 3LYUA 3VUEA 3HBLA 5CFOA 4CLDA 5KVVA 3F71A 1U98A 3AESB 3HSSA 2W70A 5AJZA 2IQ5A 4BCBA 2HR1A 3P76A 1N6PA 1MEOA 2ADMA 4FGJA 4WZAE 3HB7A 4XH9B 3RVOA 1QF7A 4DJFC 5AFSA 5L95A 4ZVTA 4FE7A 4IAOA 5LYJA 3DKIA 1C3EA 2WVGA 5AW8A 1GZSA 3REFA 4TVBA 4UBNA 4YHHB 1W6UA 4ZV9A 3IA2A 4X0EA 1JKFA 1XUOA 1N2EA 1JG2A 1FYDA 2G04A 3MGGA 4HX5A 4UMFA 2DQYA 4P7KA 1L4YA 4LKOA 4XLLA 5SY6A 2Q1UA 4A26A 4MV5A 5AKYA 2I67A 3IIJA 3KUUA 2FAXA 3EQZA 1VL0A 3NGXA 3DDSA 3KTAB 1D0VA 1Y9DA 5DM2A 3AVYA 1E9VA 1UADA 3GN1A 4ACAA 2PMCA 3C48A 1JQBA 3S29A 3ZTWA 1NQXA 5JPDA 1JA0A 2NVUA 3UJBA 4MAFA 1NAHA 3A70A 3ZDZB 2ZR8A 3MA0A 2P9TA 4S2UA 3OOHA 1FPMA 1MVLA 1O5TA 3P3EA 2CNOA 3U3JA 3DCIA 3MGKA 2AFIB 3HL4A 1MC8A 1Z0IA 2R8RA 1JLHA 1T0BA 4B7ZA 2QRUA 4K87A 3EZFA 1U7HA 1W36C 4E1AA 1A5TA 3ICOA 5DM0A 5JEAF 2MIIA 4HFNA 3TEJA 1CUBA 2WQ6A 1B3RA 3I42A 2DWOA 1II9A 4MROA 5EERA 1W5FA 5FOWA 1KDYA 2V0NA 4C7XA 5EE9A 3QBVA 1A7AA 3KOMA 4UU8A 1AQLA 2NVBA 4P3PA 1KKLA 2RI6A 1JNYA 1PT8A 3A4NA 4ZAVA 3RWMB 4DY6A 4UVIA 5ALWA 3UA3A 1XAIA 3B48A 1YGYA 2RH9B 5J4VA 5JY1A 3ZDDA 1COWD 1VSUA 2R8YA 4K86A 4NY1A 1DC4A 4JYAI 4RIGA 4PNHA 5LDDC 3SKYA 3D3JA 3O75A 4TSKA 2E5LI 3E2IA 4FM9A 4RA9A 2XXAB 1OPXA 3HG7A 2NN6F 4PLYA 3F97A 1Q3KA 2I0FA 2OC9A 2FSIA 1I0LA 1G19A 3COVA 1YJXA 4CM9A 1F6DA 1THMA 3INYA 3SXJA 3PLNA 1OYPA 2COKA 5IWAI 4X7RA 2QMZA 3H9UA 3KL2A 4HF7A 4X24A 3QEAZ 2CC2A 2YQZA 4ND1A 1QIEA 3FNRA 3TVDA 3OE4A 3WSWA 5DJ5A 2HA0A 3A8TA 1HNXI 3GJXC 4HRYA 3N5KA 4Z4CA 3FYUB 5KTTA 1CW2B 5GOZA 2H9IA 3HI6A 3AUSA 4U8HA 5CR9A 3BFPA 3MBOA 3VR4H 2HJGA 1J1IA 4PANA 4NDAA 2N75A 2F3TA 5EIAA 4P7BA 3E4CA 3SF8B 2NO7A 3WB0A 2JC3A 3LP8A 4PPGA 2BI4A 5U4QA 5BYKA 3MWDB 3VNSA 1JHVA 3ZYZA 2C78A 4FFBA 4QICA 2O0LA 3A1SA 1Q14A 1BMTA 3Q3JB 3BSWA 4YVFA 5EZQA 4NIMA 1OT3A 1IIBA 4HYEA 3WKBA 3I4LA 3SBOA 3R09A 4ZP1A 4NF2A 4ITRC 4R81A 1TQ6A 3O8DA 5CW1A 5A5DA 4BNVA 2O1TA 5GP1A 2AN3A 1WVIA 2OG2A 3UY4A 3WYDA 5IXSA 1RZRA 1JW9B 1YHNA 2QI9C 4Q5IA 3U3KA 5EPOA 1N36I 1G20B 3OZAA 4IDNA 4ZOBA 5AVSA 2VQEI 1A5BB 3N2KB 1SJ9A 1YBHA 2BFAA 4O1IA 5IT5A 2BGWA 3DOHA 4OUDA 3EBLA 4V1CB 2FQWA 4LZOA 4DLWA 1JEJA 1FXWF 1O4WA 1QONA 5A6SA 4RY2A 2PUBA 3OTOE 2G4VA 4RD3A 3E27A 2OQIA 5CAEB 2WWHA 3NHYA 4HGNA 5AVUA 3L9WA 1Z5AA 2GZ2A 2H4XA 2BAGA 1XZEA 1CUSA 3PQ3A 3I32A 3PDWA 2F48A 2JW5A 3NYRA 4UQLA 4LF8I 4MVJG 4C0JA 4R0MA 1DJOA 3EXEA 5A4KA 1TZMA 2WJWA 1NDQA 3CLUD 3FR8A 2IXBA 2YV3A 2ZM6E 4KKVA 1SVMA 1DE0A 1KI7A 2BMAA 2ISSD 4F8JA 3BGIA 2ROQA 4G65A 2HLNA 3EXIA 2CBZA 2OTCA 3GB9A 3E58A 3ZKWB 1WW8A 3L0DA 2O57A 5DM70 1ZC3A 1THGA 1SXJD 1NLYA 1BXKA 1RE1A 3PZRA 4MLCA 5C52B 1TT7A 2ODQA 2AOUA 2G77B 5HF5A 1E9SA 2E6KA 1QGDA 4N0MA 3LOUA 2ST1A 4DEYA 2ACVA 3OJLA 2REQB 2YBEA 2WTBA 3IPRA 2I3BA 4KLZA 5CB8A 4EZIA 4WKGA 1TB4A 3NFRA 1GAEO 2YRWA 2Z9BA 1R88A 4WEQA 4XQCA 5T8KC 5AVWA 1ML4A 3CZRA 4E5KA 1IVSA 1DBVO 4H4CA 3VC3A 1N8SA 3DD1A 4YX9A 5NULA 2ZRFA 2PU7A 5D1HA 1C30B 5JXGA 3KJGA 4HYMA 1TF2A 2Z6VA 3PP8A 3WLQA 3P2JA 2I8LA 2BA0G 1PS9A 2JARA 1QLWA 3OAAA 4XE5A 1U2ZA 1L7BA 3RBXA 3KKNA 3ORSA 3R3ZA 4XJXA 5ILOA 5KYTA 4OJTA 1IBMI 2OECA 3DCNA 1D3AA 5EKSA 3Q72A 1LQUA 2Z8ZA 5HOQA 5GM1A 1V71A 1E2DA 1UIRA 4C7OB 1VDZA 3U62A 4CJXA 1C4WA 1W4BA 2HPVA 4H4EA 1NE2A 3DM5A 2VHVA 2FYTA 4WXPA 2IYOA 1W29A 3L8HA 5E9WA 3AZOA 4MYCA 5JZSA 3FYDA 3ODGA 3WMRA 3B3AA 3GMEA 2KI5A 2VJYA 4ITUA 5T3YA 3TLBA 5J1TB 1PQ4A 4RD0A 3EG5A 4F7DA 3L93A 2ZUBA 1I1OA 3RT9A 4C4AA 1UWCA 4QU8A 2CGEA 4LMAA 2J65A 2MSDB 3ROMA 3UJDA 4IMRA 3ZZTA 2LCFA 1Y7HA 1GV1A 2RH4A 2IBTA 3T0FA 4NXNB 3QXJA 1Y3HA 3KC2A 5IT9A 2V4UA 2EEZA 1CNFA 1T8UA 3EODA 1B74A 4JNKA 3WICA 5LZ9A 3QX9A 2C99A 1UBLS 5LYJB 2B9EA 3RSCA 1R4MA 5CP8A 1X2BA 5CK4A 1XPRA 4MVWA 4Z7OB 1M72A 1C3XA 4MZXA 2P8JA 1XPUA 2A9KA 3M7NG 3FZYA 3WU4A 1CS0A 2XZTA 4PGAA 1CLUA 1SXHA 1NVXQ 3MQFA 2IPOA 4J4BA 3ZCRA 1XTIA 4B3CA 3WQSB 3OZTA 2PS3A 3LYAA 3MCTA 3R3XA 3ZZNA 421PA 1GUFA 1C4XA 3R7AA 2JFVA 4JD5A 5ALYA 3TYXA 3OD5A 3FBGA 2NVUB 4BLWA 1NY6A 5SV2A 4IRMA 1Z73A 1IQRA 2QG4A 2R62A 1Z12A 3ENVA 3KHUA 4OCZA 3WP0A 1D2MA 4MQ6A 2FG7C 2P78A 1T3HA 3E4DA 4C7KA 1Y60A 4ZODA 3GLFA 4JVLA 3MPUA 4BLVA 1FP1D 1W49A 1Z06A 2X0IA 4WOPA 1BNCA 4HI0E 1QVRA 2O5RA 3NTRA 4XGQA 1A9OA 1ECGA 3HFRA 5IDWA 2FG5A 4IDBA 4W99A 5SZHB 5A4IS 1ZI8A 5B7NA 4MV6A 1ILEA 4GQUA 1B0AA 1JRLA 1P2TA 5HR5A 2EFYA 1TLTA 1Z0SA 1VKOA 3BK2A 2E37A 3O73A 2O2EA 2ZJYA 3ETHA 4JLUA 5C7LO 5SY4A 1FYWA 2Z9CA 4K88A 4LWQA 5I48A 5JNWA 2AOWA 4XX1A 4OPMA 1Q3TA 2XA2A 4ES6A 4HBZA 3D8TA 1RAIA 2ZIXA 4BNHA 1U7WA 1VA5A 2W2PA 3KE8A 4WBNA 3NAMA 1KGDA 2BMWA 4M8LA 4POAA 1AA9A 2RFLA 3CPHA 1QNFA 4RA9B 2VR1A 3ODPA 4EBFA 4MINA 3PWKA 4MUIA 5CLIA 3SQMA 3WLPA 1O9BA 3VC7A 1RXWA 4LFBE 3CXUA 2PRJA 4FUQA 3Q3IA 2EF0A 4JEIA 1OILA 3DOJA 3QZUA 1U02A 2ZANA 3FB1A 5KTNA 1ODCA 1BWRA 1E3PA 4PRXA 2VHUA 2AYZA 1TKBA 5EI5A 5EJEA 4MGIR 1NHIA 1SVSA 3C98A 3OPNA 4DE5A 1S7GA 3JX9A 5LP1A 3WTCA 2ZRLA 1ONPA 3U61B 4LXIA 3N39C 4Q9NA 3QKUA 1R10A 2AC4A 4L3WA 5AW3A 1H9CA 2Q1YA 2JFYA 3QRWA 1GU0A 4W5OA 1MPXA 3CG4A 1JILA 3HH8A 4FFBB 4PC3A 1V6AA 4NDNE 1J7KA 5IARA 5BUSA 4OQDA 1T3TA 1U0TA 1IOVA 1K3FA 2CXNA 2GTIA 3RW9A 3NTXA 3SAJA 3ZHCA 5JJIA 4E7PA 1GL3A 3IILA 3N7UA 2YXEA 3AT1A 2VTEA 3S2IA 5HWSA 5B1EA 1JP7A 2GO1A 2F4VB 5IXJA 3H86A 5AVQA 4BO4A 5KQLA 4GOJA 4L27A 4Z7YA 1WW2A 3ZJ4A 2RI0A 4F6CA 5BSVA 1IB0A 2CMDA 1WDLA 2GNAA 4IS3A 5AVOA 1U0JA 1YVUA 3L4BA 5BVGA 4FFOA 4EEKA 5AK0A 1TI7A 1PNTA 1GQQA 4OUDB 4Z9AA 3L6DA 4YP6A 3OIYA 5LBUA 4EDFA 4Q7QA 5IU6A 5JAIA 3MOSA 5HZKA 1CFJA 4CIWA 3TEFA 3PEVA 2ZJ2A 3EZ2A 5JJBA 4ZQHA 3D81A 1JZQA 4PC2A 1U0FA 3WDMA 3W79A 2O3RA 1V8BA 4J0GA 4C3OB 3N2GA 5BUZA 4F96A 4NBTA 4AIDA 5F3DA 3TKLA 5C5DA 4JS0A 4MHOA 4PSAA 4ARUA 4DABA 3DAGA 3EXEB 1J1UA 3EH1A 4ZANA 4DU8A 1AGPA 1ENZA 2AQKA 4ZAZA 3VZBA 5LR6A 1M0WA 3G0HA 2P0AA 2PZ8A 4FW9A 3WDSA 5EA2A 3I5MA 2XH8A 4JJ6A 4G2TA 1GFSA 3RDPA 1VL8A 3EXIB 3COZA 4BMNA 1LS1A 3QKIA 5LL6R 4JI1B 2FEWB 3T7SA 4JJKA 1SOVA 4I1RA 4FIZA 2QJOA 4WNYA 1G5RA 1T2UA 1U94A 4YJHA 4MICA 5CYGA 1JEYA 3KCNA 2H5IA 1R0YA 2AOUB 3ANMA 3BRCA 3ZDAA 4ANFA 4A1OA 1S2MA 4FLFA 5C8ZA 1Z7WA 2YC4C 3AHGA 1NYLA 3FZEA 4DIOA 4DMHA 4E32A 1ZPDA 2BGTA 3K16A 3P96A 4MVCA 5DMHA 2R1ZA 3PU6A 2FTKE 3FNIA 1GL9B 2OZLA 3B7WA 5G0TA 3SZ3A 4IR7A 3H8JA 1ONBA 9ABPA 3PEYA 4YREA 2Y99A 3THRA 1KKHA 2NXNA 1DAOA 1ZLYA 3EIXA 2V1UA 1NI3A 2ECKA 3D2LA 2X9VA 4HBGA 4LKRA 4Y2RA 4F4IA 4LC0A 1FYFA 4MAMA 3ZBPA 2QX7A 2FMIA 3GLVA 4YUAA 1VB5A 1K9SA 1X6VA 3K9CA 3P2IA 3RIXA 3DYIA 3ZCTA 1EUYA 2DTXA 3NM4A 3TIFA 5I3ZA 4B3TB 4JQZA 4XI9A 2QMOA 1E98A 4FCTA 3GX1A 3L0OA 3EYWA 1VE1A 4BA2A 4IHJA 2CXQA 3WNCA 4W82A 3ZV6A 3HCPA 4LXYA 2QK4A 4A4DA 1NC3A 1UDRA 2RD2A 1ZL0A 2BFWA 3DJFA 3KBBA 4MVJA 3WYFA 2HDWA 1BOFA 4UT4A 4F45A 3AOEC 4EZBA 1QJCA 1ULUA 2QE7A 4HUJA 4DV3E 2C38A 3P9SA 5EXPA 5C53B 2PJUA 1Y48E 4EHFA 3UICA 2NU7A 4BFXA 1KERA 1NMQA 3NOXA 4CKWA 4R2IA 3QG5A 4CZ2A 1QH8A 1OOEA 3MJDA 3K70B 3ANSA 5DM1A 4FWTA 3AKEA 3FOCA 1PR0A 4OI2A 1Q83A 2AE2A 3H3JA 3QF7A 2YRXA 3FDZA 4LS3A 4PG7A 5DHPA 3SS8A 3DBIA 3N6VA 3D8UA 3V4ZA 1R4MB 2H59A 4UUPA 3SI7A 3U48A 4M8SA 1AH2A 1MX3A 4S3MA 1J2YA 4QM6A 1ZOOA 3MTQA 4KTTE 4LZZA 1CUEA 1CS0B 1IOWA 1KVQA 2DFPA 3K9LA 3ZDXB 3ZCPA 4ZCRA 5C9ZA 1DBWA 5D3MB 4AS1A 4C7MA 1GG8A 1OYVA 4MWZA 4YV0A 5BORA 5TMPA 1BKNA 3IE0A 1RIFA 3HCBA 5F51A 3AYZB 1BX0A 4TSFA 3WBFA 3TXAA 1NI4A 1KMIY 3SWWA 4DUZE 3UGTA 2TMGA 1U0NA 1XXEA 2QTMA 5CH3A 3TI7A 1R5JA 2WUEA 3CSSA 4BVHA 2PKRA 5KI6A 1DTWA 1FQOA 1EIWA 1PZEA 3GLFB 3GJ5A 1NRIA 2HH9A 5LD2C 3WIOA 5JJ5A 4UVEA 1AN9A 1IZ9A 4DF3A 2FHPA 2Q6LA 4U5QA 1TK9A 2VSOA 2OO5A 3E9YA 2ZQ5A 4IDFA 3E7DA 2Q1WA 5TMDA 4QQFA 1C7EA 2FPLA 5FFFA 1D09A 1J99A 1OXTA 2J45A 3CLRC 3EWAA 3KLPX 4PX2A 5BV2P 4IVQA 4C6RA 4RTQA 2HBRA 3ROKA 2WT8A 2R0QC 1KARA 2H8KA 4OLJA 1TLLA 2X9QA 3OJOA 2D13A 3ETJA 3OZCA 4RF4A 4CKXA 2J9GA 1G6KA 1NU6A 3N8NA 5B4VA 2UU9E 1F3LA 2A3RA 3QW2A 4KZKA 3F3YA 5BNWA 4INPA 3WKEA 2QUHA 4RMJA 4KPEC 4HH3C 4IS9A 1U04A 4E08A 2ZIXB 3HKBA 4P4TA 4XGNA 3O9VA 4G0UA 3H4MA 3W2IA 1EP3B 2WKPA 4WBNB 3K72B 3PPXA 2PZJA 1E79A 1NKTA 4XVRA 2A30A 2GO4A 1ZK3A 3U4GA 5KVSA 4PYQA 1CZRA 1VOTA 2V7WA 4CM9D 3AKCA 3FX2A 1IN7A 3NBYC 4FI3F 5FFMA 1V6CA 5EXSA 4B9EA 2QDKA 4BOYA 1VE7A 4D26A 4J7CA 4P36A 5K6TA 5EIBD 4J1NA 5HTKA 2XHEA 1L5HA 2F43A 5IT9Q 1SHZA 2PUVA 1WSDA 3N2ZB 3PUVA 1P44A 3JQFA 2IHVA 1U8XX 4BX0A 3LZ6A 3EA0A 4DR4I 3CF0A 3OQIA 1ABEA 2C94A 3QBJA 5FNVA 1A8HA 1UJMA 5DWDA 2BLLA 3INRA 1AKWA 2VUHB 3MOIA 4IDOA 4XARA 3I34X 1P2SA 1G6HA 2YV2A 3KUKA 1GQOA 4JV5B 4YJFA 1G9SA 2BKVA 2DYKA 3CLTC 3JQ9A 2JA1A 3D7NA 4PYRA 1FP7A 2NNWB 4GLBA 1G8AA 1OBFO 2H48A 3JQCA 5CHYA 3S2SA 3W2TA 2GCNA 4BFVA 1WUIS 1ZYUA 1PYGA 5ETJA 2H17A 2BD0A 2QROA 1JJ7A 3FVTA 3RSOA 2GASA 3AVPA 4EB6A 4UFPA 1XJWA 2BI7A 2A0YA 2HLDA 4R8SA 2TMKA 3TECE 4IP0A 1NV8A 5TV2A 3E3AA 1AMNA 3PGA1 1GGFA 2XOKD 5GIPE 1RZRD 5EY5B 1IULA 5ERXA 2G09A 2E5FA 3M70A 3EGIA 4QEKA 2GBFA 3VR4A 3ZCUA 3ASZA 2VTBA 2GAIA 5BVGB 4D6XA 3PFFA 4GOKA 2XTNA 4FKZA 2FOIA 4QM7A 1VBMA 1IL0A 1U3UA 1V5IA 4R40A 4ENSA 3M8KA 2JJMA 3H83A 4RMIA 1N5KA 2DUWA 4R16A 2JE6A 2FZ5A 5JSKA 3PNSA 4PC6A 3V1UA 2QM3A 1PRYA 1K47A 1PTJC 2VP9A 4C3VA 1YR1A 4TM8A 1ATZA 2P35A 2ZUSA 4HAIA 3G13A 3N2GB 4MO2A 4ZT3A 4B3HA 1I36A 1BKSB 1PQYA 5FTMA 2RJ3A 4KVFA 4D9HA 4MW2A 2AFRA 1KBZA 2C5LA 4TROA 1UZNA 4MW5A 1DV1A 4N6NA 1ZM7A 1XTSA 1M2GA 3AI1A 4ZVSA 2ZCJA 5DV9A 2P4SA 4K2AA 2VPPA 4Q3LA 2O0HA 3GFRA 3SR3A 3UV3A 4JI6B 3FKJA 2WQZA 1GGKA 3LDFA 4JI0I 1YBMA 3P4UA 3R23A 4G0QA 4YJHB 5FRDA 3SDBA 1JEYB 1VHJA 3CR7A 3OLWA 1QRDA 1WY7A 2BVNA 3QVUA 3T6KA 1Z8DA 1SGWA 1J20A 4G1MB 1WG8A 3GFPA 2GN6A 3DXZA 2YYSA 5JEAA 2IXEA 3G8CA 1DO0A 5J2TB 2OZLB 1A6FA 5BMOA 4DU7A 4JEUA 3AVVA 3UJCA 2C2OA 4DV2E 2EBUA 4G4GA 5DLYA 2PUDA 4CFZA 3UJ7A 3OA0A 2RHGB 2ZE7A 1I94B 3C8UA 2VA8A 2KLHA 5JAOA 3P5BA 4FZJA 1QMGA 3REOA 9GPBA 5A4DA 4UULA 3O5AA 3U2QA 1Y37A 4ZMBA 4DA9A 1WEKA 2NN6A 3H8VA 2Z2YA 1ADCA 4TPKA 2FMHA 3WRYA 3WLIA 1XMQI 3FLMA 2V6MA 5EQTA 4BA2B 1FSFA 3PEFA 3QFHA 2PEZA 4IHJB 3V80A 3CTMA 4N7JA 4Z4FA 1MRSA 1FTGA 3EPHA 3I45A 2J3HA 3NHJA 3S68A 1SVUA 1YRAA 1DI0A 1JPJA 2Q5QA 4MDHA 1T5HX 2VC2B 1M5TA 1KI1A 4QGGA 1QVWA 2WM2A 2C38B 1YL6A 2CCJA 3GJ0A 5B36A 1Z4NA 1WUUA 2FW0A 2HXYA 3N76A 2NU7B 1TEHA 1N2IA 4ZD6A 3I92A 1L5KA 2RKWA 3CVJA 4Q34A 1GD1O 2X6QA 3KKEA 1FOEB 1QH8B 4OHPA 4OLFA 3C8HA 3D0OA 5PGMA 1PFKA 5J43A 4ZJZA 1LSUA 2XIQA 2YDXA 3FDZB 3EOAI 1EXNA 4LEIA 2Y6VA 4EKGA 4EG5A 3GJ7A 1PFWA 1J2UA 2H1LA 3WNZA 2YWJA 1I30A 1E59A 2PV0A 2MSCB 2I03A 1PT5A 2B3TA 1N7JA 2M2IA 2WTEA 5JJKA 4OHZA 1V8DA 4HO1X 1JT9A 2CXTA 4OQMA 3TUIC 2XDYA 3HDVA 4JBHA 4XDGA 3LHKA 2G1AA 1DDOA 2H54A 1EBBA 3LMKA 3GC6A 1DPGA 1P61B 2Z30A 1SUDA 1YMUA 5A3SA 4DEVA 4B34A 1EXDA 3R0VA 1TIPA 3C7KA 3EG9A 2P6RA 4JL6A 2IYXA 1FXWA 3IAM1 1NI4B 4NG5A 1Z82A 1VJRA 3COPA 4ZPJA 5G53C 3DMGA 2X8AA 2AS0A 4GR5A 5EWMA 3RIHA 2QTNA 5FR2A 3PJRA 4MS1A 1DTWB 2UUAE 1X7ZA 1V5FA 3PFKA 1Q0RA 1XB2A 4I9NA 4LSGA 2PNJA 1NNEA 1IPHA 1ND5A 4HGOA 1KTIA 4G5SA 3B5JA 5F78A 3WQRA 2F7SA 2FSPA 4FOPA 2QSZA 1EM6A 2Z5VA 1W4ZA 4YI3A 3O82A 3W77A 4GX5A 1T9GR 3U9TA 3CSUA 5HPYB 1RREA 4LHZA 3FDFA 4WXYB 4YGXB 4IQ4A 4BMDA 3IQXA 3DTVD 4A5SA 2K5UA 4FFRA 2WJGA 3C2QA 2V7GA 2QP4A 2F8SA 4IJKA 1LBTA 4NNOA 1L7OA 1HE3A 4OOEA 3TLYA 1LA2A 2AG5A 3C3YA 1NGSA 1EINA 3FMFA 3WGZA 3O03A 1UPBA 3EQ6A 3HKBB 3M3HA 3GWZA 2DP4E 5ESRA 1FRQA 3WJ1A 3HZZA 4CEIA 3FKSA 2LIVA 1IZ8A 1SULA 4X6XA 2VF2A 4UARA 2FMTA 2A9JA 4HDRA 5BW8A 2BH2A 3FUXA 5F7XA 1LJ8A 5CXSA 4UDOA 1OLSA 1XQ6A 5ELWA 1L7AA 1WY5A 2CEKA 2X36A 1NW9B 1KPHA 4HEA1 1L5HB 1WMFA 4LISA 2F43B 4ZYZA 2YHSA 4KQVA 4YQYA 1BJRE 1E61A 2VZLA 1RKUA 1S2DA 1W5SA 3P9KA 3PKIA 4MRVA 3WX0A 5DIFA 3MRVA 3DL0A 3OQIB 4X85A 5FNVB 3UUGA 1ESNA 1WDWB 2DXIA 3NYWA 4DR3B 3WB9A 2NXCA 2ZYTX 5F4BA 4GQIA 2HIMA 1TEZA 4YJFB 1H2ZA 3EPRA 1ISSA 5IH7A 3TFOA 3IULA 1QFSA 1P7WA 3ZU5A 5K8VA 3FGPA 5CD9A 4IGKA 4JLOA 1OTYA 3H2HA 2WWWA 1RRVA 2O50A 1Q6YA 2CF6A 3CCCA 3X1DA 3EYAA 4UCXA 5KQGA 3ZCXA 3QU5A 4ZDWA 4EB6B 1IBKB 1YB4A 4EFMA 3TX2A 1XZBA 2Q4EA 5M29A 3R0JA 4XVQA 1T1IA 1TF5A 4PHFA 4AO6A 1NT2A 3BRWD 4EY5A 4OHYA 3V34A 2E2WA 5JAPA 2C54A 1V16A 3V8RA 2VTBB 2HIAA 1VJGA 2WHYA 1NP7A 1GNRA 2XUHA 2OMKA 3M6MD 4K40A 1W0JD 3M6LA 4BO3A 5K0BA 3B8HA 4UXHA 3LSTA 2JE6B 4YQFA 4L6IA 2FWIA 2IYRA 2Z4RA 3R24A 4JI7E 1GPYA 1II0A 4MWTA 4L73A 2OPHA 3Q5GA 4DSOA 4UXJA 5IUJC 1MQAA 1W5BA 2VNAA 3IQGX 3R4VA 2JGDA 5L4SA 1IEWA 2J87A 3TSAA 5LIPA 4C2AA 5KNDH 4DQUA 1QNLA 4N7BA 2HDHA 2XVYA 4S24A 3A9VA 4AROA 3HQ4O 3LCCA 1KNXA 2JL1A 2OFOA 5H5JA 1JHPA 2H2AA 4Z1OA 5KS2A 2F67A 1HDXA 4R68A 4RACA 3JQ7A 1GOTA 4Y6QA 2VJKA 3OTOI 1UC4B 4Q1BA 4UBKA 5I7SA 5IFKA 3BHIA 1P91A 4RK0A 4JJ8A 4UE2A 1ZW6A 4NXMB 4TL7A 2Q0QA 3G2HA 4P92A 3EEIA 5L3ZA 2E18A 1BS2A 3BTVA 2NT4A 1CUWA 4H2DA 3UHMA 3U81A 2B1GA 1TRKA 1P0MA 3JALA 4FYVA 4LDQA 1E2PA 1T3LA 4LHVA 2GM3A 5JEAB 2W0SA 2ZM6I 1IMOA 5BNTA 4BFCA 1YB1A 3PIIA 3KKQA 2H06A 1Z8FA 1YJ5A 1J21A 2X4DA 4QXAA 2JLWA 4EP1A 4OL0A 4PICA 3CBQA 1IE3A 3SSAA 2UXDE 2DZDA 2QXUA 1KZHA