1USVA

The structure of the complex between aha1 and hsp90
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
255
structure length
251
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
total genus 73
structure length 251
sequence length 255
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1usvA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usvA02
1Y4SA 2O1UA 1USUA 3Q6NA 1USVA 1Y6ZA 1Y4UA 2O1TA 2O1VA 3HJCA 1HK7A 2O1WA 3PRYA 3Q6MA 2CG9A 5FWKA 2IOPA 2CGEA 2IOQA 2GQ0A
chains in the Genus database with same CATH superfamily
4GPIB 5KVCA 4DPUA 3B9PA 3MGAA 1KJZA 3LNTA 3E84A 4O4JA 4MH0R 1IY2A 1U4OA 3VUEA 2PSDA 2Q0XA 4KWIA 4Y6SA 2JJ1D 4RKYA 5IT0A 1ZSNA 2ZAOA 3EEIA 1N2HA 2IXBA 2R4UA 1EUQA 2XR1A 4IF4A 4KW7A 1MBZA 4CE6A 3CVVA 3JYQA 1CIVA 3OIFA 2ZYDA 5KOJA 3K0HA 4O4IF 4OQFA 3LYHA 3I23A 1K7FB 3ITNA 1T3SA 5E4FA 5E4JA 5HEKA 4KI7A 5GMOA 1J07A 1GPAA 1U2QA 2O7NA 3D3WB 3EIEA 2FQYA 2GZ1A 3DAHA 1GQ2A 3K92A 4LYFA 4K1LA 4RZSA 4C0AC 4NCNA 3IKMB 2HCRA 3GH3A 4NCXA 4PFSA 4TV8A 5KI6A 4C0LA 4D96A 4ZI7B 1KIAA 2DBVO 3ZZTA 1Y4ZA 1MAVA 2HV8A 1KI6B 3LBFA 3V8MA 4BMYA 1AY0A 2RB5A 3M9WA 2CL7X 4DC9A 4BV9A 4FFRA 1NN5A 1OUMA 2HLPA 2JCXA 2N9UA 2OUKA 3ENNA 3GFFA 3HDQA 4NHEA 3U26A 4ZJYA 2V8PA 1XXHB 4HRAA 4MYRA 2WSLA 2BE9A 5JH7A 1XNRE 1E6MA 2W6IA 2WIDA 4BFTA 5HJ5A 3Q10A 1N2SA 1UK8A 3ON5A 4CM8A 4TVSA 4ZQFA 3Q88A 2Z08A 4ME6A 3K09A 1OVGA 4KN5A 3AR8A 2EOAA 4QFCA 4OXRA 3UJPA 4IMJB 3WLAA 4PICA 1E3DA 4TXHA 4GOLD 3Q2KA 3PR3A 1TW3A 1U31A 2E5WA 3A2MA 3RS5A 2PBRA 3SAJA 5ER9A 3U1KA 3EUAA 4OUKX 4PG6A 2NZXA 4FU0A 3WZMA 3B6EA 4EP1A 5C9ZA 2O5VA 1M1UA 5J58A 4ZVVA 3A1WA 5CG1A 2MYNA 3DVRX 4PTZA 3E22B 3AYXB 4XA8A 1DTWA 1UBJS 3S5UA 1EUYA 2ZUTA 4JY7A 5ETJA 3UOAB 2GPSA 1YRLA 2D0DA 4EMBA 2IJGX 2P79A 4QJ5A 1FTSA 1DUSA 1X14A 1AZLA 2NO0A 2WG1A 1MAWA 1N78A 5AVRA 2X0KA 2VQSA 2WSSD 2C58A 5CDTA 5LXTA 1VPTA 2O0HA 1SHZA 3CSUA 3KHSA 4Q0MA 3IR6A 2J59A 5ECGC 1RRKA 2OOSA 3RBXA 5JBIA 3QBVA 4LZJA 4UHHA 3OESA 1ID1A 3K9WA 3SKYA 3WIOA 4I99A 2PHZA 2YFQA 4IFDB 4HWOA 5BOVA 3B1JA 2AV6A 2K7ZA 2R5WA 1G5TA 2O7SA 4KPUA 4KVZA 5AOVA 5UKDA 4JDUA 3T9FA 2PH3A 3DLTA 4ABYA 1JJFA 2PN1A 2FPSA 3B70A 3EDQA 4XQ9A 4DE5A 2GT1A 3N0TA 5ILOA 4QD3A 4DJFC 1H85A 2YWCA 1WVIA 4DNOA 1O5TA 3DVAA 3NR2A 1PFQA 4QGFA 3R3WA 4RHEA 2DOKA 2Z8XA 3VKWA 3VTAA 2O5CA 4L8WB 4GR9A 5TQVA 2Q21A 1Z22A 1VXOA 2OXEA 1MF7A 2H0RA 3GBPA 4HY3A 3TLMA 2W2VA 4II3A 1ZQ9A 4CT4B 1ZA1A 4MGZR 2BONA 1IRXA 3IL2A 3FW1A 4IZHA 2QV7A 1HT2E 5BSWA 1CJTC 1SXJD 1UH5A 2LKCA 2ZWVA 3H11A 3IBSA 2APJA 4XFJA 1I7PA 4XFKA 4P4GA 3GP8A 3IPXA 2OLEA 5D1NA 4FEYA 4WK4B 5M29A 3X2FA 2JBAB 2JLBA 4S1OA 5T4FA 5I3CA 1P73A 3JSXA 1W52X 3K72B 3UVEA 1QFYA 1S8OA 4GDMA 4PN3A 3RUFA 5MGNA 4YRDA 4DPYA 2EQ5A 5JLJA 4B87A 1VSUA 5E9JA 1P7PA 4BC1A 5KNBD 2XZPA 4AF6A 4ZI2A 1T15A 1LBHA 4DCPA 4HRXA 3QKRB 2BDTA 2EG9A 4RK0A 3DC2A 3RSFA 2UVPB 2ZDGA 3DHVA 4JHXA 1E3QA 2F1JA 2XQFA 2DE0X 3GVCA 3DDCA 3ICCA 3JYPA 3UYKA 1HNWE 1RPJA 3T1YB 1L0BA 5CB0A 5L40A 1Q7GA 1I4EB 5EKTA 3D0RA 5PGMA 2QSUA 4XDZA 1XL1A 4D3XA 1A97A 1DRVA 1E1RA 2JA2A 2EWVA 1FF9A 3F78A 3N6RA 4KYIB 1H1TA 3WQHA 1E5VA 4K3UA 4M0PA 2QMOA 4BFYA 1VG1A 3W6PA 2H7XA 4XGKA 1JAHA 3FSEA 5TQ2B 3KAPA 4DRZA 2OQIA 3AJDA 5T6MA 3RSHA 3V8VA 4YAIA 4UM9B 5EP2A 5FPYA 1L4YA 5EEGA 1FDRA 2NSDA 3PC6A 3L6CA 1E3IA 2PV0A 4CG2A 4US2R 1WETA 1Z0EA 5M04A 4V0MA 1CUJA 3OTQA 3A9VA 4HGPA 3DFFA 1XZLA 1CJKC 2GO1A 2RH9B 2UZ4A 4CEJB 3TTXA 1EM8B 4RK7A 1G42A 2XB4A 5M2QA 1ZXMA 1NW3A 3RVRA 3DJYA 1KE1A 1S4QA 5DT9A 2BV3A 2DBZA 3OQIB 4BRSA 1EBBA 3NHRA 4E88A 5HQTA 1I2BA 1NVEA 4ZCIA 2OXIA 1Z3CA 2F1KA 2Y68A 3R5TA 3LVRE 1A2BA 2H51A 3PVSA 4RH3A 4GUAA 4B3SB 4LPFA 2VEDA 3FLBA 3ESRA 3PFCA 2XSZD 2NSJA 3HKMA 1E79D 2H2AA 3PGA1 1PYGA 1UDXA 4D9CA 2O3RA 3S2ZA 2CWDA 2FE4A 3R9XB 3BBLA 3B9RA 5DW0A 4R51A 3VKFA 4AZ3B 4WESB 3BD8A 2WWYA 4F4HA 2YJ6A 2BA0G 2XAAA 2XQGA 1X7WB 4YFYA 5HCIA 3E1KA 5KAPA 4YRGA 4ML3A 5EIWA 1A1VA 3A6PC 1SK8A 3NKLA 1FVOA 3QUSA 3F90A 4O2BF 1WSBA 1V1RB 1EK5A 1FS5A 2FSPA 1QTRA 2PLFA 3D3JA 3BCUA 1D09A 1E77A 3DGFC 2H9AA 1MQ8B 4N9WA 2FGKA 1PAUA 4FOLA 3PSAA 1J2EA 3S1LA 2JCBA 5DYGA 2H1CA 3E2MA 5AR1A 3A70A 2GDZA 3U60B 4E5UA 4KOAA 3U4QB 3LP6A 2ZIEA 5T8KA 2G09A 2Z3WA 1A96A 4DMLA 1YT5A 1RHRA 2BFAA 2EJCA 4JUBA 2H1LA 3JZFA 3LHSA 3NM6B 4JI1I 3PGLA 1MC8A 2Z3ZA 3M2TA 2DX7A 1O89A 3LXUX 4BKMA 4UEJA 1M33A 5HTKA 5DM60 2NO7A 3L6UA 1QPZA 1QIMA 4OGFA 3SXJA 3ZI7A 1ZOLA 2C2OA 4MICA 3RK4A 5JISA 3DMPA 1V11A 1EAMA 3VPGA 1WQ1R 4IIJF 5CYPA 3WB2A 4B5LA 4YX9A 2QMYA 2ZRIA 3ETJA 2ZQYA 1TEVA 1PV1A 3O26A 3OBIA 2Z5CA 3PNMA 4DV5E 3OUUA 3C1AA 4A5OA 1V43A 4DCTA 3RRNA 1ZM4A 3I1JA 2VPYA 3LG2A 3WU4A 2IDZA 2ZIFA 1JHDA 2A9PA 3LF1A 3ERCA 2R00A 3QHQA 3SZGA 2GK4A 4AQYB 1TM1E 3UJ9A 2AD1A 1UBSB 4BXOA 1OXVA 4P4SB 1FJGI 3UUEA 3NALA 4F9TA 3P76A 4ZQBA 1FVXA 1Y81A 4NESA 2FJ0A 2PD3A 3KD2A 3LQ1A 4Q3EA 3DKIA 1X19A 1FI4A 1IOVA 3IVRA 4RCVA 4RMJA 3WGIA 1JJAA 1JEQA 2II6A 3A3YA 4LDAA 4UHBA 4YBZA 4HS4A 1GHTA 5FBLB 1N4DA 3OEYA 4CMKA 5IKEA 2UXDB 1LBIA 3BJIC 4OMUA 3ZV3A 3X0DA 4ZN6A 2PH7A 1E1RD 3L1KA 3PYFA 3KSMA 3I1YA 1DWUA 2TYSB 1NLMA 2V4ZA 2XJ9A 3BJZA 3HLKA 4MPPA 4OP2A 4P3OA 4PIPA 3PJRA 4PQYA 3T7JA 3CC8A 4M0DA 1E8NA 2QBYB 4RSGA 4B4WA 1UXGA 10MHA 1MZPA 1MT0A 4R1NA 5CT8A 1DOZA 2R85A 3MPOA 1BE1A 2FJUA 1SOWA 4OPMA 1NYRA 3HYLA 4PTLA 5IAAA 1WZUA 3FA2A 3PGVA 3PKJA 1OXXK 2G76A 2YZ2A 5AVJA 1I0ZA 2ZJBA 3IAHA 2E21A 5FPSA 3HXQA 3RC9A 4E46A 1RXWA 1L5NA 4YUAA 1NNUA 2IF0A 2NTNA 5AXDA 2E2WA 4BMCA 1TRKA 1YIAA 3K70B 1JPNA 3BGIA 5JS6A 4ZRDA 3KJNA 3PQ3A 3OLZA 5KTKA 2CZGA 3CSSA 2AR9A 5J5AA 5F9HA 3OPXA 2HWYA 3HSYA 4QQ8A 1X13A 1OLOA 3SZRA 4BU1A 1YS6A 3HN2A 1IM2A 4D4LA 4OO3A 1EXVA 1MC5A 2ERCA 5BWMA 1PLLA 2YYZA 3TK1A 5ICCA 4YT5A 2Q28A 4QU0A 4OD0A 3O03A 2QE7D 2FB9A 3Q0TA 4EMUA 2HA4A 1GEEA 3S1AB 5A9SB 5H4GA 2NM0A 1J49A 1LI5A 1WJGA 1X8KA 4I1YA 2CYAA 2J87A 5FPQA 1I94B 2JJQA 2GF2A 1J0XO 1M0TA 3G2PA 4U3BA 3ST7A 1CB7A 1LSSA 1OXSC 3M4YA 1JIUA 4LF8I 1T24A 2CLMB 4ZWNA 1OTXA 2OCKA 2CLSA 2Y1DA 5DWQA 1HDRA 4YP6A 4EG3A 4RY0A 5IJZA 4RA9B 1JG3A 4UHJA 5C34B 4QYWA 5C4GB 4AJIA 1MX0A 1EFVB 1U2EA 4NU6A 4PCLA 3EWSA 1NMZA 2Z4TA 4KWTA 3WRXA 1G20E 1WXHA 2AA3A 2LD4A 4MI6A 4YMVA 1H2FA 2XDAA 4B4OA 4YIKA 4MS3A 3T5BA 4NKRA 3GVPA 2W70A 1KY5A 1IK4A 1AKEA 4QUAA 4ZGGA 5M7EA 3N7UA 3CRRA 2PVCA 3THXB 1Y82A 1G2QA 3SSOA 1E3HA 5BY2A 1ULZA 4XPIA 5EHIA 3STXA 1BDMA 1VYTA 4ARAA 4BJ6A 2EF1A 3NRJA 3AVYA 4H7DA 2C20A 1S9HA 3OE4A 1UPXA 3TQFA 4B3BA 5JSZA 3D0QA 1QMPA 4IIJB 4OLHA 5F3WB 3S2IA 4F86A 2OXRA 1K88A 2XE7A 3UBTA 3VQTA 4BO9A 2GFIA 2DQYA 2VYVA 4FFBB 3U4HA 1LF5A 5LMZA 2FQXA 4UDXX 1YS4A 4DANA 4B3SE 1H23A 4ZVUA 4KGXA 5IJ0B 1CQIA 1CR6A 2K87A 2V34A 1H65A 4K6MA 4N12A 4B35A 4Z6KA 2FDRA 1I32A 4QNMA 2MSWA 1RYEA 3EWNA 1E2PA 3PNQA 5KDLA 1WUHS 3DZGA 4ENUA 5AFSA 1XFDA 5FTWA 1RWKA 4PANA 1OT3A 4O4JF 1E7SA 5E1MA 3RH0A 4GW3A 1B6GA 2J8ZA 2HDOA 4W5HA 3SJAA 5AVXA 4IIFA 2W71A 2J08A 1GPH1 3V8BA 3PEEA 3H4LA 2IEBA 5DNVA 1DXYA 1F8UA 1I4LD 3C14C 3UB3A 4BMXA 5EJ6A 2ECQA 4QVKA 5D2CA 5HQJA 1OB5A 4AY2A 4RH1A 4D4KA 1A27A 4FHDA 2YNMD 3LQQA 4JVOA 1T43A 3HU3A 3UO8B 3BWMA 4YBRA 1JT9A 5JNUA 3U5ZB 5EI5A 2EQAA 3FCYA 3N2IA 4EA8A 5I4CA 3M9XA 3TZKA 5LYJF 2JFZA 1D0IA 3EWAA 4W8HA 5HYVA 1AMOA 1Z36A 2P35A 3A1TA 4HNHA 3GK3A 2HMAA 4QG7A 3CXRA 4BA1B 4G36A 1PJLA 1ISPA 1T3LA 1ZMXA 3TSCA 4JLOA 4F06A 1L4HA 1BROA 1THTA 1FSPA 4BPBA 3PRJA 5BSTA 4F5DA 4AO8A 2VWPA 4KR0A 3USCS 1LX7A 2JBHA 4XIIA 3LQYA 1U0OC 4I1PA 3A6FA 1GPLA 1J8MF 1Y8RB 1NULA 2Q9UA 4H15A 5AUOB 1E3JA 1GTMA 4NOKA 5EY5B 5IJ9B 3F3SA 3RTBA 5JRJA 1ZINA 4HAIA 4IQ0A 1BQ3A 5ALIA 3JASB 4CMJA 3WU3A 1TTPB 4OBWA 5F64A 1UMBA 3R44A 4WVLA 3SPXA 3TLGA 4DT1A 3KKQA 2A5DA 4TUYB 5KHAA 1JECA 4ZPXA 2Q6KA 4BNIA 1UF9A 2G9VA 3WWOA 4BPRA 4D0GA 3H0CA 4O4IB 1ATIA 4KR9A 3TFWA 1Z07A 4MIKA 4B83A 2QVYX 3RODA 4BN0A 4NZOA 3M85G 4EGAA 2FN4A 2ORIA 4FTWA 4J16C 2ZI7A 3I0NA 3Q12A 4JU8A 1C8KA 1N1MA 4MUMA 1U5BA 5IP5A 3VH2A 4YXFA 3Q9NA 5KDOA 4KPYA 1YE8A 2Y92A 2WDPA 2ZKIA 4FWTA 4F6RA 2G1PA 4Y0NA 4FHGA 2GRUA 5D3ZA 3RTEA 4HD8A 3H42B 5FWXA 3CH7A 4KBYA 5CM8B 4I3GA 3G2LA 3SR0A 3UNXA 3GLQA 4WN9B 3OU7A 2VAXA 3B5JA 4OQMA 4JK3A 3E7DA 3W2FA 2LE0A 3QEJA 4LOAA 3NWOA 1FFDA 2ZVDA 3BMOB 1DP4A 3OF5A 4MR8B 4UOEA 4IFDD 2XVXA 1H8HD 3KZMA 2QTGA 5P8WA 4YR7A 2JLVA 3RVQA 1VG8A 3IO3A 2YIJA 3N76A 4I1RA 2EYQA 3OM9A 2C9BA 4KE9A 3HVKA 5EJMA 5FR2A 5NLLA 5DM1A 5EL0A 3EFHA 1Q0SA 3QPCA 2PQ0A 3HACA 1YR6A 3WGMA 3ZDQA 5K05A 1Y3IA 3DT9A 5JVDB 3FFXA 3NDIA 4UHCA 2A5FA 1WDLA 2OCYC 1NNSA 4D9KA 5JSHA 4P80A 4CKWA 4P53A 5JD4A 1CIJA 1XMOE 2E4YA 2WAYA 1EGAA 3BICA 1YQUA 5CNMA 1IBKI 1ZOPA 1U0NA 4E2FA 3CRZA 2BKEA 1N6IA 4KE8A 2NU7B 4MGYR 2I76A 2XKAA 5BNIA 5K8UA 1NSTA 1A0OA 1BE6A 1CJCA 1UMCA 4AURA 2BGRA 2R8XA 3MD0A 4J8PA 1GQYA 4NULA 1Y3BE 2IF2A 3V1MA 5E9WA 1YO6A 5CYFA 4HDNB 2ZYSA 3B1ZA 4B5KA 3ZJUA 3LO5A 2HA0A 3DP7A 1JEAA 1PDWA 1H3FA 3JPWA 3JYNA 3NOVA 1R4MB 4RYDA 5F73A 1NIPA 5K99A 1OPXA 2C0QA 4HDSB 2MDTA 3QW4B 4FCWA 4E08A 5IU6A 3F8WA 3IUQA 2OKCA 4ARUA 4BGUA 4M1EA 3AHGA 1P3DA 4QFDA 1QE3A 1V5FA 1CD5A 4J0JA 1JQ3A 4DV3E 3FYUA 4QTXA 4D8YA 2XZDA 3HUDA 4LEIA 4YRPA 1BQEA 1X0VA 4TTJA 4E51A 4PLHA 1ABEA 1SKQA 4PYQA 3UKDA 1UP6A 2CNOA 2C97A 5BSUA 2V6JA 4R1TA 4A16A 2W6JD 1MO5A 3AEKB 3EAGA 4WT7A 3KOZA 2JD0A 2JAOA 2OPHA 2IKSA 2HCJB 4Q7MB 1M7BA 2VDPB 3QXXA 1G21A 2V4UA 4UAGA 3VC1A 4NXNE 3PHLA 5C8VA 3A9CA 5T5QA 4OK5A 5LJLA 2XVZA 1J97A 3ZE1B 5JBNA 5JDIC 1ZUNB 2AMVA 3NWPA 4E4RA 4G84A 4QM7A 4BEBA 3N2KA 4GX5A 5EN4A 1VL0A 1CBUA 1Q14A 2XCIA 1RP7A 2EF0A 4MZDA 5D00A 4QPPA 1KS2A 1ZNXA 2GR9A 4JA0A 4EW6A 4RA9A 3I5YA 3J81k 1ZA2A 5A5DA 3SYTA 2XYGA 5E3JA 4WNAB 1LSOA 4G0YA 3GF4A 4GEKA 4O2RA 3IIIA 2DPHA 1C9EA 1W1UA 2ZYRA 2VZ8A 3NBXX 5I7AA 3TTTA 3RJZA 3USES 1IZZA 5CVJA 4BRZA 4BP9A 5JS2A 2EXXA 2ZSJA 3I9KA 2J5KA 3OP1A 1L8LA 3F0NA 1Z39A 3DEIA 3QH4A 4GAEA 5CH3A 2PRSA 1YF3A 2C4VA 3E1GA 4LQ4A 1E3LA 1OV6A 2AJ8A 4DUYB 4Y2XA 3OH8A 2UUCB 1J00A 1KPHA 3GOQA 4X6YA 4CKYA 4M9SA 4HZIA 3GX1A 5F5LA 5A1JA 4OFWA 1CS0B 1G66A 3KBBA 2HRQA 3ZK8A 3FYSA 4LTNA 1ECPA 3F6SA 3QXJA 4K88A 3TMAA 3O5AA 1BMTA 4Q4AA 4QLBA 4H1WA 1WDTA 3CKYA 4L1KA 3T38A 3W5JA 1H5NA 4NNPA 4CM7A 2XKJE 2DPMA 3UMVA 3UMMA 2C4WA 3VR5A 4DYHA 4RHXA 4I4TF 4Y9SA 3VSBA 1ADFA 4LF8E 3DAOA 4A0QA 5I47A 3FNHA 4YJDA 5CU7A 5C3UA 4TXMA 4LZOA 2VDKB 2YN0A 1T4MA 4Y7CA 3BQ9A 2BFEB 4X64B 721PA 1M2HA 1QZUA 2A58A 2H4HA 1E1CB 1PW5A 2O8VA 4RVOA 4ZO4A 2WY2D 3ZZUA 1F2DA 3X1DA 1PN3A 2FHPA 4HV4A 2C0CA 2ZSEA 3QOFA 3WGYA 3PXAA 5LKRA 3DMYA 2C37B 4BB9A 1JGTA 4QPCA 1LCIA 5D5QA 5IVIA 4DSTA 4EEKA 4N8SA 1PS9A 3AMVA 1QYVA 3MB8A 1REQA 3QM1A 4ZD6A 5LP6C 4FZVA 5A4FS 5F51A 1EFKA 2X5XA 3GY0A 2J07A 2ZRJA 2IZ6A 2M6LA 2AXPA 4JI2I 3D0KA 1XU9A 4RTPA 1BC5A 4M7PA 1YH8A 5JAIA 4DV4B 3PUJA 1EWVA 4MKZA 4AKHA 2VUTA 3GNSA 4CKXA 3K5WA 4Q37A 1UPTA 1K92A 3PDWA 1ZHOA 4TGLA 2IUTA 5TGTA 2WE8A 2JFNA 2EFYA 4X8MA 5DBHX 4GKJB 2R8OA 4IDBA 3GRUA 3T5DA 5EC8A 4IINA 4KDRA 2XECA 1RHJA 4EPYA 2FUCA 4V3CA 4G0XA 5IUJC 2XUJA 4Z7QB 1AHIA 4G01B 3A2KA 2AQ8A 4M88A 3DZ8A 4WNCA 4Z99A 2IEDA 4OYRA 1T13A 4OO1E 2ZYAA 2GM4A 1BFDA 2LUOA 3R75A 2A14A 3DPUA 1WCXA 3WL7A 4K0KB 2K2WA 3M5PA 1ISGA 2UDPA 1F8GA 3VU1A 1GZSA 2A9VA 4P3XA 3G5MA 1J23A 1OKKA 4OV6B 3DL2A 2WICA 2XHZA 1J06A 1QV6A 3CDIA 3P2KA 4QGSA 3QY0A 2YMQA 5JQGB 4FOTA 5KMGA 3PEWA 3ESXA 2A67A 3L7IA 2GAFA 4D9NA 1AG9A 1DQZA 4Y6PA 4Q9IA 2GUWA 3UHPA 4Q15A 2E87A 4R1SA 3KR2A 5J4LA 3CM0A 1QHHA 4GXQA 1GCGA 1YULA 3AT1A 1IYZA 4Y2GA 5B2FA 5HSGA 1M0WA 2ECOA 5JSZB 2GO3A 4L5AA 4DUGA 3LFUA 1DAHA 1HXHA 3W2HA 1V6SA 2ZCVA 3D3EA 1AXGA 3V1YA 1AOXA 7REQB 2PIAA 2AC4A 3F1KA 3GGSA 3ROZA 4BFWA 4ZQHA 1FLDA 2B9EA 4MJ7A 5C1BA 2WP8J 3W3ZB 2RARA 2Z57A 3KJXA 5C53B 3ICEA 1I1QB 5IJ0A 4IXNA 1ZL2A 1B43A 2ZWPA 2ZYTX 3B2QA 2YCBA 4G0ZA 3DD6A 5EZ6B 1UJMA 3BFPA 5FA6A 1ODTC 1FSZA 2FPIB 4Z9BA 2VJYA 1MVOA 4OJTA 1H66A 2Q46A 3PD0A 4I19A 3SJBA 4DTCA 1YDWA 1BMDA 2BA0D 2BVNA 2FPGA 2IUYA 1ENZA 1R0WA 3CJQA 1Z74A 3HVUA 3O21A 3QQPA 4GP7A 1Z38A 4IEFB 3R76A 4ZODA 4CQLA 5CA1A 1EBFA 2I67A 5FWYB 1B1CA 1LGYA 3U16A 3G2KA 3I39X 5H81A 4A36A 1H0SA 4NJEA 1TK2A 1L7DA 1VJ5A 1KY2A 3V9PA 1DPFA 2PGOA 4OKNA 3CLTC 4BNDA 4BA2A 4GVXA 3P9RA 1ZK4A 4WZAB 3SX2A 2I80A 1FRZA 3PS3A 2TMYA 4ZA2A 3ASZA 1BXRB 5LYYA 3CE6A 3DAPA 5ECWA 1GA4A 1O6BA 2J3HA 3IOCA 3GAMA 1IATA 2C3UA 1R7RA 4MLCA 1M76A 2A2CA 5ALRA 3GEBA 4G1MB 4LCFA 1JHVA 3HMQA 5EXXA 3TZQA 3ZJ4A 3BSWA 1NVDA 4FPXA 5LSAA 1UZNA 2DH5A 3E03A 1RRMA 4ITRC 4ARZB 2ZJ7A 2QTZA 4IS2A 2BIFA 3EYWA 4KQMA 5LNK6 1AGXA 1K27A 1P60A 3NATA 4BLOA 2A0UA 2P2GA 3DZFA 5DMHA 3LUKA 4O4JB 3B7WA 4JBYA 4AS3A 2YNMA 1GO2A 5K3AA 4NXNB 5HOEA 2GCIA 2RGAA 2W6JA 4MV0A 2CMGA 2TECE 1N34E 3C85A 4IQ8A 5DGIA 3VR0A 3VXKA 1TQDA 5BUCA 1ZJJA 5AVVA 3LS2A 4BLPA 2JLAA 5E6UB 5FOUA 4AS2A 2GNOA 4HDSA 4ALKA 2AG8A 1WD5A 4WBNB 3H5TA 2WF7A 3JV7A 2H48A 4TOIA 1BA2A 1TIPA 2B36A 2FKNA 2XUZA 4XGIA 3GD5A 5SZJA 2ES4A 1TW2A 1PNQA 2WF6A 2WM2A 2B82A 5EMMA 1YZTA 4J6FA 3AM5A 2Z0MA 1SKMA 2IZ5A 3STWA 3N59A 2AE1A 2G5CA 2M32A 3FCCA 3EGWA 1JEYA 1IY8A 3KJHA 4DQDA 2WZBA 1PFKA 3EE6A 4AO6A 3IAEA 2XH8A 3V4VB 2RONA 3AR3A 4I4CA 5AKJA 3K70C 1DAFA 1QF9A 3A1CA 4IXTA 1U28C 4MWZA 1M9NA 3BK7A 5EESA 1ML4A 5LDGA 3DM5A 4JUFA 3WB1A 4BB5A 1KK0A 1PZFA 4Q1VA 3PNSA 1JB1A 2J3IA 3C3XA 3PXBA 3HY3A 1W5FA 3WP0A 1SU6A 1FE8A 1Z5BA 2XCSB 1X7GA 1AKRA 1LK5A 2JCSA 3R7LA 3QNUA 3COSA 2FZKA 1JHPA 4GI1A 4LXYA 3ZHTA 4RU1A 4DLVA 1XN1A 2I7XA 3O8NA 4MUXA 5H68A 1C1XA 2CXNA 3M9LA 3ZYZA 1VSTA 4X66B 3L7JA 4BTVA 3GPIA 2FW7A 3DS8A 3DF9A 4W1QA 4AQDA 3LOUA 1DHTA 5HILA 4DIMA 3B3AA 2JI7A 2QTWB 2OBYA 2WU0A 1M34E 3JWJA 2UXDE 2HWKA 5JNLA 1BSVA 1JAYA 1AS0A 1L3IA 1H1LA 3QU7A 1X7DA 5K6AC 1L5MA 1SKUA 1D2NA 2D5IA 2AVNA 4EO4A 1QGUA 2VXYA 2W5UA 1DRJA 2O1SA 3GFQA 1OTHA 1JA1A 3NBAA 3PJGA 4R68A 5CX1B 2GXSA 1XWWA 3PWZA 1GT91 1O4VA 1L7QA 2QLNA 3A58B 3CLUD 4G9EA 4GI5A 1H8HA 4M54A 4V0NA 3LQKA 5DRPA 3JD4A 2YBEA 2P68A 2UXCI 3AESB 2PO1A 3P9SA 2H1OA 1NJ5A 2PWAA 1TA0A 2NTEA 3A4IA 1LK0A 1VLMA 1T3TA 3AX6A 4LHWA 2ETXA 2P3QA 2XGGA 1Q0TA 3G88A 4JI5E 3HJRA 1NQOA 5FBZA 1FMJA 3VU0A 1OIWA 1D6SA 1DIRA 1XD2A 1NHHA 5KEIA 2EVWX 4OMDA 4WHMA 3TN7A 5IWAB 4AJHA 2ZG6A 4X92A 3DFUA 4I8XA 1S89A 3AHEA 1O8BA 4KHPI 2YHUA 2QRQA 4FKZA 4NRDA 2O8DA 2JIZA 1ESMA 1CEEA 3HR8A 2ZW9A 5JD3A 1PP4A 4NBUA 1LDYA 2F3PA 3TQSA 1N5KA 2RGYA 3S0JA 1J2YA 3PDHA 4UU7A 2VDOB 5CMLA 4QUHA 4B3MB 3N28A 2XNHA 1V0JA 3EY4A 1TTTA 3WY9A 4BNKA 3DGEC 2Q2EB 3H5WA 2Q4OA 3ZUPA 4BBZA 3ODGA 1E2LA 3L46A 3ONEA 4ZI3A 3OWXA 1KAMA 3IAAA 3ND6A 4MB6A 4QDUA 5FI5A 4JI6B 4HDOB 2J3EA 2WSIA 4KQ2A 1RU3A 5A2QA 1Y9EA 2BFOA 2UYHA 3ITDA 3DMGA 2CVQA 1C3EA 1XTQA 2G28A 3QVGA 5KU1A 2UXBI 2CZQA 1XTTA 1P9WA 2YWXA 1TMYA 5FEMA 1SVUA 1MX9A 2ZE6A 4G5HA 1UBTS 3WQQA 4B3JA 4WKBA 4TWJA 3OAAA 4HMQA 1QB8A 1IZ9A 4MP6A 4MMZB 4YLGA 4D80A 2YXPX 3TLKA 1YCDA 2OGZA 3LQFA 2PV7A 1Q7EA 3THWA 2XXAB 3I6QA 4CDMA 2H06A 1MQSA 1GPDG 1PI3A 1VMEA 3FBTA 2J46A 2ZTLA 4JJEA 1CKEA 3HJBA 6PFKA 3H2GA 2AI1A 3DWGA 4LI3X 4EF6A 4MGKR 3LP5A 1UT8A 5AHOA 3I0MA 3UMYA 2RK3A 2FMUA 3PFWO 4P9NA 1TE2A 3WSWA 5J47A 3TSOA 1O1YA 3VC2A 1DKQA 1GSAA 1P0IA 4GNKA 3D31A 3LUHA 3SQNA 3TSAA 3URKA 2AUMA 4NSNA 2RIPA 1JILA 3QLVA 4CKZA 4OY3A 4X65E 1NLUA 1PFVA 1GSOA 4XAQA 2UUCI 1KTIA 4BFSA 9GPBA 2B21A 4M37A 3O3OB 2HBYA 5FL7A 4DBVO 5JAUA 1QQAA 1KEEB 1ONNA 5TXGA 4MU1A 1K7SN 1P2TA 4URZR 4WZAE 1XTUA 1T29A 2VNAA 1U04A 3JWHA 3BE8A 3OCUA 3V4LA 2EZ4A 4JI8I 1CJUC 2B5VA 3VNQA 2EARA 5K3OA 3R8FA 1E9VA 3KZ1E 3KR0A 4WJLA 1D4OA 3LL4A 1FFBA 3UK0A 1P2UA 3PQ7A 3IT3A 1Z6AA 5JMOA 2P8JA 4IKEA 1NAHA 1RIFA 1SG9A 4FKMA 1UKZA 4LF6I 2HRZA 3FPSA 2GASA 3Q0IA 4BTLA 3R2JA 1KIJA 3K6KA 3ETDA 2I65A 1UBNA 1XLTC 2PY6A 1E9AA 4YJHA 3B2EA 3RVJA 1KF0A 4TL8A 5LWHA 3CPHA 3LCCA 3EXHA 5IVHA 3RAJA 5CK5A 4JEMA 2NX2A 3D8BA 3WL4A 4EI8A 5TRTA 5AJVB 1Z2OX 4CM3A 3GRPA 5DGDA 5A3VA 4F96A 1NLFA 3KQYA 2OV1A 4UMFA 5EKDA 1AGPA 3GJRA 4JC4A 5ARCA 1NYQA 3IS3A 1IMOA 4TV8B 2W2KA 1UXJA 2L19A 1SXJA 1JT2A 3E5MA 4RK5A 3ZCVA 1ZIXA 5ICEA 4IRXA 4DLWA 4E1VA 3ID6C 2ST1A 4ONEA 4I14A 1T2CA 5LQDA 3AB3A 1KYIA 2OG2A 3ENQA 1FDOA 2F8SA 3GYBA 4O2AB 4DPMA 4EKEA 4ZIRB 1J2JA 3UAYA 4DCUA 2N75A 3E9QA 5AICA 1S2MA 4A2QA 1P5FA 3V2GA 3B3JA 3B9QA 3R0IA 2ZM5A 2XT6A 5FOWA 3QBTA 2VJAA 3VMFA 4DA8A 4XLZA 1IPHA 1DE0A 4PZLA 1ZCAA 1MPXA 1OI2A 1WUUA 4UCXA 3HABA 4ARIA 4A2PA 2IH2A 3JWGA 4BVKA 3F3YA 4RM3A 3WKCA 4R3UC 1P1JA 2ZS9A 3LCUA 4PBTA 1OC2A 3C41J 4Q48A 4ZO6A 2G08A 1O97D 1W5SA 3ZI4A 5KYYA 2AX4A 5F12A 2N0SA 4MWEA 2I54A 3Q4GA 2EHJA 4RF2A 1U3DA 2HU8A 3DEYX 3NC1C 4R2MA 1F3OA 4HVAA 3WADA 5BSHA 2A88A 3GAAA 3INTA 1U94A 2R00C 4YP7A 1T9HA 3AV3A 3CONA 3HVHA 4DDWA 2JGLA 1FNBA 3R77A 4JJKA 1X70A 2Q4BA 2J0SA 4DBLE 2BP7A 5AD1A 1RM5A 2VF5X 5ADVA 2X0FA 4C4YA 4PXSA 3QPWA 1QGOA 4FMDB 1NBHA 1ZLYA 4UE3S 3AI2A 2Q1UA 4MWSA 4X97A 4DCGA 3EVNA 3H6KA 3ENZA 5EQJB 1AKYA 1Y7TA 3GRFA 3E4DA 3HA2A 4RS3A 4W8GA 5C51B 4XDGA 4BFLA 1FCJA 4YJ3A 1T0IA 2H1FA 3ZXXA 4UZSA 3VVMA 4LDNA 4L9SA 4DILA 2WJ6A 5AKKA 2PANA 1NWCA 2J9FB 2HMYB 3FTQA 2YXNA 3NV7A 4I6JA 3C6YA 4TYQA 4OQPA 4RACA 1SB9A 3EXFA 4IF6A 4F0JA 1YZKA 3L92A 1E1MA 1B63A 4UBJA 1P31A 2A4KA 1XYYA 1PT7A 3CLUC 2VUSA 1TGVA 1VIVA 1A9XA 2WVAA 3FCXA 3WIEA 4IJ6A 3X1KA 4N8DA 4JAVC 3GJ6A 4HYYA 3DZJA 1VP9A 3EGXB 4CDNA 3U7JA 1G20A 4WCFB 4EX7A 5LMCA 1U2GC 3SBDA 1E2KA 1YWGO 2JVIA 1WX1A 1CNEA 3E9EA 4IWYA 3CDJA 4ICIA 3UK7A 1PYDA 3QJ5A 4JI2B 3CBGA 1TO6A 2Q6OA 2XQVA 1R18A 4J0HA 4EKIA 3EMBA 3A1NA 3HMKA 1Q91A 1UFOA 2OPBA 3KT0A 2FW8A 1R0BA 4Z7CA 2PO1B 2PRZA 2GZAA 3U0VA 2ATXA 3ER8A 4WUTA 4BBAA 4PXAA 1RBQA 4LOIA 5EXPA 2BEKA 3VPFA 5B2EA 3I3SR 1I10A 2H54A 1FMCA 4NYMQ 1K7CA 3NTVA 3TUJC 5EJ8A 1Q77A 1YA6A 1FA9A 1XEXA 3BCHA 1K63A 1ZM3A 4NL4H 2NADA 3I01A 4QEDA 3G1UA 3V33A 4CM1A 4N0DA 2EL9A 1GYPA 4AJLA 3NHBA 4EYEA 1WXXA 4G5YA 4JKYA 5A9TA 4HHEA 5EUBA 1M34A 3K4QA 2ZLBA 4WBNA 1H72C 4DCCA 2PPLA 1LQ2A 4P0QB 1F06A 4FFDA 4F56A 3T9DA 1RWPA 2RI1A 5JAHA 4FBGA 4WXHA 2IGTA 5GV8A 3FPAA 2EW1A 1VZ2A 3OLQA 3WYEA 1DWPA 3O1IC 4Q1AA 1I4WA 4AIIA 2CL5A 1SHUX 2ZPAA 3QU5A 4MIEA 4ZHQF 1U9IC 5K36C 1Z4LA 3H6GA 4OHXA 3V5NA 5HM6A 2DHEA 3FNEA 2BGNA 2BKXA 4UATA 4Q3LA 4BDSA 3USZA 3ZIDA 4AICA 3ADCA 1ULSA 1MC1A 3P20A 4QGHA 4D26A 1CY8A 1R3UA 1YOVB 4X65B 1G8HA 3T5CA 4J16A 4CQMB 3RG8A 1E2GA 1QRDA 3IB3A 4J0CA 1GG5A 4D97A 1YS1X 4E5NA 4JDPA 1SPXA 1J0DA 2P9ZA 2XGMA 2XOXA 1EDBA 2PX0A 3NDPA 4W6ZA 5EIBC 3ZY5A 1M67A 2HSDA 2OA0A 4ZI7F 3AVUA 1UEKA 2O0JA 1QMGA 1MIOA 4E5VA 1KP2A 2Q8QA 3OUZA 1Y9AA 5A4JA 1SVKA 4DQ0A 6ABPA 1S7GA 1TUBA 3R40A 5DRRA 2VN8A 4RHCA 1L7AA 1UDWA 3T0GA 2ZBFA 1BXKA 4FOSA 4BP8A 1C4KA 1MH1A 4ND8B 1OAKA 1MX1A 3SYLA 1UC4B 3WMGA 1G8GA 1P5HA 1P5ZB 1KP9A 2GB4A 2MHCA 5HJEA 2IQIA 2IE8A 2EX0A 2P9TA 2QN7A 5H16A 1CCWA 3CV3A 3MAGA 3JQEA 5DISB 3R7FA 5KVSA 3JZAA 2JGIA 2WAAA 2TSYB 1IQ0A 1N6RA 4UZEA 1X0XA 2H5JA 1JMVA 5IBPA 4AO7A 2YL2A 1J09A 4INPA 4E3WA 1MOPA 1DKPA 3MWEB 1D2EA 2W2LA 2C2ZA 1XJCA 4M22A 4RMHA 3M33A 1KO4A 4DV3I 2H4YA 3OJXA 4JU9A 3U44A 4ZJZA 4GX1A 1QR6A 4WBSA 2JE6B 5SZKB 4WLEA 3BTSA 1WOYA 2AJTA 1GY8A 1ODJA 4LJ8A 4OIFA 3WR5A 1E6WA 1AXRA 1YUMA 3UWKA 5E2AA 2YW2A 5B3JA 2QD2A 3SF8A 2AIRA 5GZ1A 4NXNI 3SJZA 1Q0QA 1Y48E 5HFAA 3A25A 1YJCA 3RTAA 3RG2A 3W4JA 5B7PA 4R2KA 4CWAA 3MELA 4OH7A 5IG2A 5JG7A 2E1PA 3OEED 1QFXA 4CCYA 2VDQB 4LCGA 2C82A 3HY4A 4X1YA 1EXDA 1M8PA 3QPDA 4CIAA 1C4XA 1ZW1A 3PXXA 4RXUA 4CDGA 7GPBA 2QMEA 1XF9A 3QXCA 4PSKA 2QTMA 3PLNA 2WYHA 4D9FA 4I9UA 1JLKA 2WB4A 1YMUA 2C96A 2KM1A 4FX5A 4UTXA 4F8YA 2ADMA 1JYEA 1AV6A 2PUAA 3DOCA 3VDXA 1BU8A 1FRVA 2VRBA 1NP6A 4K9QA 4BYGA 1AB5A 4E7PA 3IB6A 4MQEA 1CK4A 5DHSA 1G4UR 5F2NA 1AQ6A 1Z59A 1XB2A 1LRKA 1S3SA 1W30A 1W25A 2FK7A 3DOOA 5YASA 3W6NA 1DJMA 4UQOA 2JFHA 3U3XA 5BNTA 4KPFC 5ES4B 2Q5HA 2Z2KA 5I7HA 2XKKA 3B1XA 1SCQA 1E4EA 1OFGA 2IPOA 4ISCA 5IJXA 3VHXA 3EVAA 3KV3O 1XPOA 5LMUE 5CVEA 3D0OA 3LX4A 4FE7A 2DEIA 4GH5A 5ALYA 1A7AA 4ZU3A 3FBWA 4I55B 4DM7A 3FOEC 2CZCA 2OO7A 1P61B 2A9KA 4J0IA 1X7WA 1M2OB 4WASA 1TA9A 1ZD3A 3WNVA 1QUFA 1XD9A 4INAA 4FFVA 1NXXA 3V97A 1W8DA 3LLMA 3A3KA 1UQUA 3P7MA 3ZKWB 4LJ4A 5KSWB 1PUIA 3P2OA 4Q24A 2WU1A 1ZK1A 1Z33A 4FCTA 1S2NA 4GZ5A 1PGJA 2XYVA 4PTYA 3U4AA 5EPEA 2HHCA 1WS6A 5T6BA 4F5WA 3ZTTA 1SHKA 4WWHA 2YASA 3WVNA 4BFUA 4CIVA 4L16A 3RC7A 4EUSA 4O3FA 5FJJA 5G0SA 4UEQA 5JC8A 5IPFA 1QZZA 4CU5A 1UDAA 4KXVA 1GLGA 1DC7A 2Q3EA 4HQ0A 1L4LA 4TLLB 1F4PA 3P71T 5DTRA 4LK3A 1CR0A 3OP4A 3FOAA 1KSGA 3K9QO 4TS1A 3BGSA 2BISA 2NYVA 4MKFA 1A5BB 1T34A 3BFXA 3DM9B 5K51A 1HR0B 3U7FB 4CYMA 4PVDA 1VBNA 4C06A 4C6RA 1VJRA 1WB4A 2PR2A 1BO6A 4D6PA 4FXOA 2QI9F 5G41A 3DTYA 2G72A 1QQ6A 1YL5A 2DWQA 2FUG6 4MVJM 1YHCA 4F2WA 5JAOA 2AKAB 2XTAA 2P0YA 4I36A 5FLXC 1OASA 3N75A 1R1DA 4PVCA 3T4PA 2N42A 1Y8QB 4K9PA 3A9UA 4TRRA 4BO7A 4NAHA 4OVKA 4XWAA 1QO7A 1MGPA 3D2BA 3E48A 4JR1A 4DMMA 4DWWA 1MO2A 4OX9Y 3RU2A 1WXDA 2OZLB 4NOMA 1VXRA 4BLSA 4BGVA 4EJMA 3UAZA 1CE8B 1W5AA 5A5VA 1EXWA 3HB4X 1Y9DA 5C81A 1ZAYA 3L84A 4G1UC 3HK2A 2LW7A 3GWGA 3O0TA 2CC2A 2FR1A 3A6ZA 4XWTA 1KVTA 1HE8B 2QYSA 2BKUA 1P72A 2UUAI 1UWVA 2W2LD 1DLJA 3DH0A 3M34A 2J67A 1FL9A 2RH8A 3MLBA 4M9CA 3FYUC 4KXFB 1DEKA 3FXAA 4ND2A 3ZEIA 4KDFA 5L3VA 1F8FA 1MG5A 1JPJA 2CB0A 4DV0E 3HEAA 4BQNA 2UYCA 3EF3A 2AUNA 3EZ2A 5KPDA 1QX4A 4KQXA 4RLSA 3KE9A 1L9KA 3NP7A 2ZRQA 3JAMC 4HDRB 4OEHA 4ZV7A 1U5BB 2A2DA 3KC2A 3RJTA 1SWWA 3ONNA 5ALMA 3PIDA 4KMOA 1RXCA 1TQ2A 4R1PA 4PYLA 1EDZA 2HSJA 3SQWA 2ZJ3A 3IC5A 4YYEA 3PUXA 4RABA 4MWBA 4ARVA 5TVKA 5F2KA 1FP1D 3UAOA 1J24A 1Y1PA 1CUCA 4NABA 1NI4B 5JSYA 2MR6A 1PSWA 1Z6XA 1E3WA 1DO2A 1ORDA 4W7HA 1JF8A 3CKMA 3W5BA 4IWXA 1O94A 2PX4A 2Z04A 4XIJA 1BJKA 3IPCA 1OU4A 1KC3A 5IUNC 4QO7A 5A6VA 1MG0A 4JX8A 5ECYA 1C8BA 1ZJYA 1XXLA 4ZHQB 4EB3A 3KM0A 4BAUA 4PX5A 3P4UA 5CCDA 2QD3A 3LZDA 1KQOA 1TQHA 3DF7A 4S1VA 1BKYA 2R1VA 3O8QA 5K0FA 4TZ6A 3KQNA 1X1TA 4P81A 3NONA 1YB4A 3VJMA 4Q03A 4XSHA 2HHJA 4MB2A 4O8ZA 1VJ1A 3OX3A 4JX9A 4TQGA 5CA0A 2AE2A 3UGTA 4BASA 4PSAA 2R0QC 4MQ4A 2F1DA 4W5NA 5IAOA 4IGFA 1GFZA 1HTWA 1NW8A 3KQPA 3OHSX 1PL7A 1ZOIA 5EYPB 4EYGA 2JL1A 3U2QA 4XFDA 3O8OB 3O75A 3G2IA 3PT5A 5DHFA 3U3ZA 1BKDR 3JR7A 1U0TA 2RAPA 3G82C 3M4ZA 2A57A 2MTBA 4KI0A 1Q17A 2GK6A 1V95A 2JHGA 3LIPA 3Q3GE 4B3HA 3QUBA 1R50A 4FJ1A 4MJXA 2X8JA 1M6NA 1TUBB 3SS7X 2PZKA 4NATA 4WZZA 1XMOI 4DN6A 4DV7B 4DKJA 2XWPA 3NH9A 3U6BA 1U4NA 4LBZA 1AVTA 4O25A 2I4OA 1NJ8A 4C30A 4EHBA 1F7UA 4YRIA 4QEKA 4UM5A 4YMUA 1FSSA 3HVJA 4HFRA 1C4WA 4BE9A 1ENOA 4M1WA 5CITA 5I3ZA 3DTVB 1E2HA 1USVA 3QYPA 3GOHA 3IVXA 3JASA 1EE2A 4WJKB 3BZBA 1FNNA 3EGDB 5DX8A 4ARBA 4DYDA 1JFRA 2QGZA 4PU0A 5LQAA 1ORTA 3N8DA 5K36F 2IYTA 2X5NA 3Q8KA 1Y3CE 1GNLA 1EGVB 3AGQA 3CUVA 3PVZA 2M2IA 4XD7D 1NURA 2VP5A 4GP9A 1X2EA 1IIBA 1X42A 2VJMB 3CIFA 1ZH0A 3N0VA 4G5GA 3C1TA 1UCFA 2GHQA 2VQDA 2QN2A 3IP8A 1AGNA 4HAWA 2YDYA 4MA5A 2ZP1A 1CLEA 3OQ1A 4OQDA 4Z7JA 4FSXA 1NVVQ 4TLCA 1IBLI 4G1BA 4I6EA 5AK0A 4LYJA 4HLNA 4Z4EA 1G5FA 1YIOA 3IV7A 5DYNA 4B43A 2ZSIA 4ND6A 1PQUA 3R1IA 3E7XA 4GHWA 2E5LI 4CCYB 5K0JA 1RRFA 4MS4B 2WF8A 3BMOA 4DA7A 3K6SA 1OYWA 5LXTF 1XMQB 3IHLA 3Q7QA 4Q9AA 3RVKA 2EV9A 4X61A 2X0NA 3MGCA 1Z2CA 3AUAA 4IZKB 4O1HA 3RTGA 3E5NA 3SI7A 3TLEA 5K20A 2I9KA 2CNDA 3CEAA 3O3NB 4LI0A 3ZCPA 1F9AA 1NQWA 1BGVA 3CZRA 4H59A 4LNUA 5SYMA 3HVIA 5FORA 5HXAA 2H65A 4FONA 3UOGA 5LL6R 3BFJA 2PH5A 4OHOA 3FZYA 2IYNA 3GQVA 3HXLA 4Z1MA 4Q9LA 2UXDI 3VPSA 2I6TA 1NATA 1N0WA 1XTZA 2HD4A 2G5PA 1U3GA 3P32A 4LRSB 1GUYA 4QTYA 2PKWA 2COUA 1VCMA 3JTEA 4PSCA 4H7KA 1UIMA 5CVUA 5FIUA 2M6KA 4A0FA 4EZIA 4IOJA 4N5IX 3D2AA 3BD7A 3CINA 2JG3A 4A23A 2Q3HA 2GETA 3T3EA 3VTFA 4RIHA 2CD7A 1LLUA 2R2AA 5T64A 3RUPA 4H2DA 1Z5OA 1WBJB 1NOIA 4URFA 4M8SA 5LP6B 4B8YA 1MRZA 4YUYA 1NQVA 4YROA 2XF2A 1CY0A 2GPTA 5HWSA 5DBGA 5IXJA 2GZ2A 2BBWA 4GPEA 2VZ0A 4MPTA 3J7TA 3M4NA 2CYCA 3OCCA 2ONYA 3R3YA 1IHYA 4OXNA 2QENA 2TMDA 3OJLA 1UDBA 6Q21A 1KXJA 1EFCA 3E61A 4J2OA 1PUXA 1LVGA 2H5EA 4IHJF 3THYB 1OCEA 2JAUA 4PLTA 4TN5A 1TF7A 1YJQA 4RWEA 5GY7A 3UJ3X 2VDWB 2A3NA 4B34A 5BVHB 3RR2A 4G56A 2OOKA 5JXGA 2FWMX 4P32A 3GDWA 4MINA 5B1YA 1A77A 3TLJA 3ESDA 3ZWVA 1B0PA 1M2WA 3AG5A 4E14A 2AOTA 2QVCA 4YAJA 3JQ9A 2DWCA 5KWSA 1FZTA 4LCBA 3L93A 4R54A 2ROQA 1NPDA 3GEDA 3UJ7A 3HGMA 1M8GA 1IHDA 4Q19A 4NBLA 3R8XA 3S2FA 2AWOA 5AI6A 3WMEA 3ENVA 2FFBA 3D81A 3G17A 2WAOA 5KYGA 5JS7A 2PRJA 1X1AA 1IWBB 5L7WA 4KJZA 5CLIA 3OX1A 2BMJA 3PD7A 3W9YA 3X43A 2RFLA 1OJLA 1RWNA 1AX9A 5KOIA 3K6RA 4L6CA 2EG5A 1B23P 1MU5A 4Q6BA 2GN8A 4PPYA 3VI3B 1WUTA 5JHGB 1MEOA 4USKA 2KHZA 3Q11A 3D8TA 1M6EX 2B37A 4MKGA 3S4YA 1ADJA 1MTOA 2R62A 5DNWA 1V37A 3A2LA 4ZO7A 1KBOA 3BHMA 2P9GA 2QLBA 4UNQA 2R7AA 1N6OA 2NUTB 3DMTC 1GAWA 2X86A 4UCFA 5JXWA 2XTJA 4DA4A 3P9IA 5L7TA 1PQPA 2IH5A 1JAZA 4LJAA 3I2GA 4ZCRA 5AVKA 1VQ1A 1VPEA 3LOQA 2C4MA 3LYLA 5G0UA 4YCMA 5JNWA 4QDXA 5KC9A 5KTNA 1U2SA 2VA9A 5AOAA 4MNTA 3TCNA 1PU2A 1OXKB 3OZGA 1F17A 3A0RB 4OJYA 1JR6A 5E4YA 1D1QA 1B8PA 1JVBA 4A8PA 2XMDA 3BDAA 3U39A 4FYYA 5JRZA 4I7EA 1XHFA 4NVRA 1R6XA 2JATA 4Q3NA 4DCMA 3C6BA 4IPTA 1PJAA 3JQAB 2PKYX 4WXEA 4DR6B 4C01A 4DF3A 1NR1A 4QUGA 2AHRA 1U3FA 4B7ZA 5C8XA 1Z0JA 4F4DA 3RYFB 4M99A 1NMYA 2HHAA 1T2UA 1PTJA 1XMJA 2I66A 2PO5A 2ZJOA 3T12A 1KDPA 1DLIA 2QQ0A 4OOEA 2CJXA 1BMQA 3W5DA 2C99A 3AJ9A 1E64A 2ZYWX 4MQMA 5ALKA 2V4MA 4D9BA 4QQNA 1E7MA 1GFWA 4JMPA 2QZZA 5FEUA 2XT0A 4ZZ2A 3K94A 3K9LA 3V7NA 2ONCA 4AMGA 2OM2A 3JARB 1RYHA 5H3CA 3U1VA 3CMMA 1IG0A 1YBVA 4A1FA 4ZHQA 4MVCA 1TMOA 3JVIA 2BZGA 3TXYA 1HNZI 1FIUA 3QWIA 3K1ZA 4H77A 2VTVA 4R9SA 4C5AA 1NHIA 4QUJA 4LCHA 4F2DA 4YACA 5AI9A 5A4IS 4RPGA 4BB0A 1GIAA 2YQ5A 3ZW8A 4CF6A 2YXEA 3K0AA 4FYJA 3VYSB 1I2AA 3QQ5A 5EP4A 1ZFNA 1DMRA 1NX9A 2V0GA 3KG2A 2FAXA 4QQRA 5BV7A 1K6EA 3ETNA 1OLXB 1VECA 3DL7A 3GP3A 4PC7A 3TQTA 4HPJB 2H16A 4KDEA 2IH4A 3IVAA 1Z5PA 1K6MA 5I51A 2C1ZA 5BNFA 4GKVA 4PRKA 4RAOA 1WR8A 4RD1A 4HUTA 1EFAA 3AESA 5ESDA 3ZXUB 2V5VA 4ETNA 4C7OA 4Y8VA 3AM1A 1R74A 2RH4A 1NJ6A 5EIAA 1YVEI 3X2EA 1U2RA 4N49A 1ZCZA 2ZYUX 3B78A 1BVUA 3NHAA 4LXTA 3ER9A 2AZTA 4HB2A 1MH9A 1L5SA 4DWJA 1UJ5A 3OE5A 4XKJA 2OGTA 1JR2A 4C43A 5EPOA 1NSYA 4UAVA 2XUPA 3LFHA 1VDZA 2JH3A 2WYUA 3GW8A 3EGDA 1FJ2A 4BNTA 1TGYA 1UFQA 2HWUA 4EM6A 1P91A 5CFZA 1V3QE 2G6TA 2GJSA 5AOBA 4AX8A 4XR4A 2XVAA 1SQFA 3N8IA 1PZMA 4I50F 2GESA 4AP9A 1BCSB 2BEVA 3Q7SA 4DLLA 1SBZA 4DGSA 5A0FA 4KWHA 3TLBA 2XEDA 3DHEA 4U6QA 1KBQA 3H16A 2H1RA 4JBNA 4Q93A 2QUKA 1NVTA 2W2MA 1IULA 1IY1A 2HRBA 3QITA 3QVGB 4GRDA 4P4LA 4DWVA 1Z0ZA 5I01A 3H2KA 1YC2A 2BLNA 1NFRA 3F3KA 4HGRA 4KVFA 4XOIA 5IT9C 5E4TA 2P4EA 4CFSA 3WBJA 3A9RA 1GYRA 1TX4B 4RPIA 4W1RA 2QY6A 1B3RA 5EE1A 4IMRA 1CTQA 3RB8A 4TMVA 1M1XB 4OKSA 3A04A 2PO0B 2V7BA 4PQFA 4WW0A 1TQ8A 2R7KA 3D1JA 3NNNA 5TY0A 5JJCA 1HQYE 1V1MB 1C41A 5C5CA 3KJZA 1CDOA 2IKQA 4TMFA 2JGKA 3CEHA 3LKDA 3UHAA 2GHTA 2WU4A 1CJBA 1TCUA 3OOYA 4DCNA 4F6LA 1PDOA 4RGQA 5HFNA 4DLXA 5GINE 1CZRA 1U9JA 3EZFA 4C0XA 5C0XD 2B1GA 1WCIA 4UTZA 2AW3A 1I3MA 1USUA 5KYXA 1AA6A 1ZI6A 2VCEA 3OQPA 3ASYA 4D5EA 1EK2A 1F6DA 1A69A 1F5NA 4IV8A 5FYQA 1XMQE 2PGNA 3QFCA 2CYBA 1GG2A 1WPGA 2R1TB 4F45A 1U8XX 4LZZA 2V7QD 4YEDA 1WQ3A 2L69A 4MDTA 1QRRA 1E92A 4R8KA 3CF6R 3U9SA 3VSAA 5JQWA 5MFZA 4AY6A 3WB9A 1ECCA 1G41A 2FR8A 4IDHA 3SGLA 4YV0A 1YKGA 1XMPA 5KSZA 1VJCA 3I5UA 1EJ2A 3B1FA 1Z2DA 2OSVA 1J2RA 3NBKA 1IZ0A 3EUFA 4FW4A 4QXMA 5A6SA 4DRXA 5JECA 4PLGA 1GP2A 1V2GA 1F0PA 1XTRA 1MKYA 4WZBA 2AGVA 3RM3A 2IY9A 1ZRSA 5I48A 1JKIA 2P40A 5G3ZA 1ZXBA 4EVRA 3MXOA 2IS6A 4CKCB 3TTUA 4DV7I 1NBIA 5ENDA 2X8WA 4HDKB 5KCMA 3TTVA 2CK3A 4DR3B 1PDVA 5ISMA 5CT4A 2GK7A 3GELA 1Z5GA 4XW2A 2WYIA 1UOEA 4FQ7A 3TDMA 4LNHA 4Q9KA 4ZEOA 4R3NA 3CX7A 3AEZA 1YK1A 1YQTA 2IITA 3KQTA 2AMYA 4HNAB 4KIUA 2J1LA 3ACBA 4B3DA 1FUUA 4NU5A 3QBJA 2CBXA 3K7EA 3M3HA 3K31A 5C0XA 2ZJ4A 1IVSA 3T3NA 4BMSA 3HI6A 3IP7A 1OREA 3ZK7A 1DHRA 3HP7A 3P0IA 1CERA 1VIDA 1TIBA 3NX4A 5C0XF 3TLZA 1SURA 3K9BA 4J0KA 2O7RA 2O8EA 2V58A 1U90A 1BU5A 4D0SA 3UPDA 3A37A 3AY0A 1G17A 5EIXA 4B6OA 3ADBA 1C2YA 3HU2A 1XWFA 1HFEL 4V39A 2P7IA 1N2JA 2NNLD 2RJOA 3DDZX 1UPFA 1JHAA 1HDZA 1QONA 4KAXA 5CXSA 2C5AA 3C4QA 1ZHFA 3KKNA 1RJ9A 5L8VA 1TM2A 4Y1RB 3FZNA 3LRPA 3D8RA 1AF7A 2WIJA 5AKIA 3ZK9A 1MRNA 1KKMA 1C3LA 1C14A 3SIPA 1GSIA 4AVYA 7MHTA 3OO1A 4EH1A 1N1GA 4ZZ0A 1KOGA 4AC9A 4ZVKA 2HTEA 4Q7LA 3OTOI 4LSZA 2VPPA 4CQLB 5CA1B 1K7EB 2FZGA 4LDQA 4RKFA 1A9TA 4B75A 3IQIX 2ZUUA 2C3OA 1U5AA 1V39A 2HF7A 2ZBVA 1CUIA 3L7YA 1WUYA 1HL7A 1F60A 1Z13A 2QA5A 3H2ZA 3IJRA 2WI8A 3MWFA 4J91A 5JNVA 5K0TA 1WMSA 5K36B 2DWUA 3B7GA 2FEKA 3D8SA 1GJRA 4Q4CA 2PUTA 3LCRA 4MHOA 4FW5A 1E99A 3LL7A 1G6HA 2NVUA 1BDJA 1JHQA 1JZQA 3D1LA 1WDMA 3FVQA 5JCJA 1IBKB 2YC2C 3D6NB 3JQAA 1I30A 4J0GA 3TQQA 3HFSA 1WBBA 4JEUA 1GKUB 1CIPA 2HK7A 1V96A 4YDHB 1L5QA 1OH6A 3WKDA 2E4UA 1N7HA 2ZIZA 1C9JA 4L8VA 1F2TA 4QPDA 3KB8A 2C57A 4YWHA 4JI1B 1U2DC 4ARZA 2HBZA 5HQ3A 3WQRA 1U7DA 3PA8A 1YA4A 4LWPA 4DEXA 4CPDA 1M6HA 1ZIPA 4K6FA 3TFQA 2OD7A 1L4FA 3N0XA 3E9MA 3W0LB 4BRWA 1JLRA 2P5TB 1XQWA 2ORWA 2ZBQA 3BCSA 3F9IA 3U17A 1KPGA 3CB4A 4BNGA 1IBMB 3R7BA 1GL7A 1ZVKA 3RW9A 4ZT2A 4YCSA 3IAS1 3VSCA 2G1AA 5LQKA 2VXBA 4LJ9A 3ES9A 1T6BY 3J7AM 1LPSA 4MWTA 3HWWA 4F5YA 2PSHA 2GYWA 3QE9Y 1FLVA 2BUBA 4PE5B 4O1MA 2X1HA 1KIFA 4F21A 4IJ5A 3ZQ6A 3NM4A 4JL5A 4NCHA 4L57A 4Q1DA 3R3UA 4DJAA 3MHPA 3SCZA 1C81A 4WOPA 3OLYA 5ALVA 3DKVA 2XUKA 3PIIA 4KWEA 4YI5A 2DTDA 3WO0A 4K9KA 1VL8A 4G67A 5THXA 2WC1A 3ANLA 4Y2SA 3L4SO 1L5WA 1PHPA 2NU8A 4CV3A 1E9FA 2WINI 3H19A 4FBLA 3U4IA 4C3UA 5B6IA 3FKJA 3NGXA 4X85A 3CH4B 2DH6A 2P2ZA 4BRUA 2G3YA 2XADA 3L0SA 4MB0A 2CB9A 3GXOA 4P31A 4POAA 1A5ZA 1SH7A 2AMFA 2X7IA 3B12A 3G1WA 4XYMA 5DCYA 4P36A 5FWAA 5LMUI 1C1XB 4HQNA 4QODA 4UMVA 1Q74A 2G06A 2PQ2A 2BGJA 3DUWA 3UATA 3BERA 3P45A 2FXIA 1PFYA 4MQBA 4JSTA 3GVHA 3R0XA 1RHUA 4HVTA 1DG1G 4R8RA 2C04A 4YMIA 3RK1A 1L7VC 2QN9A 5BQOA 3S99A 4DR4I 3PGXA 1QH8A 2ZR8A 3PNOA 3G6KA 4TRNA 5I7EA 2C07A 4N5NA 2OAP1 2XMGA 3PV0A 4JJIA 4HNRA 1XZKA 4XX1A 5EINA 4DM4A 3ED5A 3H6HA 4PY2A 1PR6A 5JZ9A 1E1NA 3CSDA 4FD2A 2PTHA 5B3AA 2CSXA 1YQDA 4G8JA 2P5YA 1ID8A 1A3CA 1VL2A 4MO2A 4RVUA 3W5IA 1QM5A 2FTKE 4CM9D 4J4HA 2VESA 3KXDA 5DGXA 3KQVA 5B7NA 4WFKA 1FQWA 2Y0PA 1SBCA 3KHTA 2BGWA 3AZPA 2Z83A 2CNBA 4IV5A 4R0MA 4A7PA 1XAIA 2LWIA 1N6NA 4IH9A 2HSZA 4JIMA 1PW7A 1CRPA 4HNSA 3EGIA 4UEOA 1H4SA 2GMWA 2NPFA 1OT5A 2PZMA 5LZ8A 3FGZA 4LRWA 4XVCA 2WMNB 1RVV1 3A3OA 3HJGA 4MUAA 1VCIA 3FI0A 4TT8A 3ZDEA 1ILEA 2X3FA 4HX5A 1FQJA 1E2UA 3H5IA 4P92A 2WJHA 5FV7A 1QU2A 1RC0A 3R5KA 1UPCA 5KYKA 4BJ3A 1ZK3A 1UKYA 2WWWA 3HBJA 2UAGA 4RVDA 2BE7A 5I4KA 4BWFB 4KU4A 5FBRB 1O54A 1M7HA 2XDYA 4JXJA 1V5GA 4XE5A 3TZ6A 1CUDA 1M74A 3GFTA 4YO8A 3T9BA 4DQUA 4FN5A 1PE0A 4L22A 3WQBA 4KQIA 3CN9A 3GBSA 4IZ6A 5JQGF 3UMGA 2MYUA 3MWEA 3CUWA 1EG7A 4MI1A 3DBLA 1YSCA 1F0NA 3KDSE 1J1IA 3KSUA 1B16A 2CMKA 2MIIA 3QVTA 5A6SB 4BVLA 2G88A 2W8BA 4YY3I 2P78A 2YXDA 4MJ3A 2RBGA 4MVJH 1SOAA 2QU7A 4WE3A 5JSUA 5KYWA 1HNNA 2QRKA 3NXKA 3PNPA 1EX6A 4QPJC 5B1HA 3WKBA 1SUCA 3GCGA 3JD0A 5A71A 3THWB 1EI9A 3ORRA 2RHMA 4XIFA 3GGJA 2EW2A 1IWPB 1WF3A 2XIQA 2V7PA 3AEUB 2FSSA 3QBDA 4GVPA 3EIUA 2D5BA 4YCBA 1CZNA 3TRDA 2IYAA 4QU8A 5JY6A 1TO1E 3WGVA 5B64A 1W36C 3CX6A 1Y89A 2AF4C 3H2SA 3MT8A 3C4JA 2QG6A 3CJRA 4M6WA 1QJCA 1XAJA 1NTRA 5EVJA 1DFHA 1LPPA 2HH9A 2GD6A 1VCOA 1N92A 1N6KA 4LHSA 3GB9A 1VP3A 1CQJB 2D8MA 1QCCA 2G9QA 3A10A 3O93A 3RUHA 4DMUB 1EP2B 4RK1A 3HBLA 5BW4A 2BELA 3HKDB 2C3YA 1RJWA 1U7XA 5DHTA 2AQHA 2XE4A 1RFGE 2XGJA 4FVTA 4IFDE 4DQKA 3S8EA 5BMVF 1WU7A 2Q41A 3QGMA 4C6HA 5AJTA 4QWWA 5CXUA 4TS3A 4JVLA 4BYMA 3BMNA 1JXAA 3TNJA 1TKAA 1E2QA 1OH5A 1YBHA 2H7YA 3LGAA 3OF3A 2PKXA 4LSGA 4UCQA 2AN9A 2OCXA 3P2JA 3ZWYA 3EFEA 4A8JA 2FLKA 1SIBE 1QZTA 4MKRA 3RSOA 1P18A 4IXDA 4N7MA 5I9NA 1RQGA 1MB9A 2HY7A 5J4KA 4P4TA 4KQCA 2NN3C 4RMGA 2J9XB 2YOFA 3T5GA 4YALA 4Q82A 3V32A 1SD1A 2QZPA 5BOSA 3CVXA 1WHSB 3FROA 1TNDA 2NO9A 1LSUA 3NU1A 3VR1A 3VYVA 1MEEA 2O4UX 3FMIA 3UKOA 5LFAA 3J81A 1M2OA 3SFVA 4DZRA 1VOTA 4CLOA 4BAZA 2IDMA 1CJSA 1YHYA 4YJFA 3ZY3A 2Z6VA 3DA8A 3CVUA 5HKLA 4X54A 2WSSA 2J9RA 2EBHX 5DHRA 2GS9A 2B35A 2X5JO 4UUMA 3WYGA 4MR7A 1ZWLA 1L8OA 4OLAA 1M10A 1ZMRA 4HWTA 4GC9A 3L3BA 4GBMA 5AXAA 4DV5I 3REOA 1MG7A 1NG9A 3NC4A 5K36D 2OTCA 2VWHA 2HBRA 3IUJA 4FYKA 2PUVA 2GD1O 1EVKA 4BN4A 1Y63A 1IAVA 2CV1A 4MV9A 2UUAB 4I5IA 1MX5A 3N5KA 4WCVA 4J7AA 1TMGE 4WZBB 3ILVA 4CT5A 4TL9A 5CLFA 4I4NA 4F91B 1H4QA 4NBKA 1UWCA 4LF7I 4G1CA 3EAFA 3HU5A 5A2GA 2XCTB 2PUHA 1KVSA 1GGHA 3M6WA 1K1EA 2W6ID 3MSCA 1AUPA 2J09A 3IYLW 3MTAA 3PHHA 5K0LA 3I73A 1YR1A 1G4AE 3JX9A 4L0MA 1QG4A 2O8NA 2AUTA 3F97A 2RI0A 1T4DA 2RK6A 1J2TA 2FCAA 2XNKA 3D6FA 4MWDA 5DFAA 3JATA 1CEXA 1TJ4A 1HPLA 4HAXA 3WNBA 1GARA 3HC7A 2CJPA 5CG2A 2YH2A 3EGCA 1FYEA 1O58A 2AJLI 4W63A 3BRWA 4BQEA 3J7AC 1Z5AA 3IP3A 2X1LA 4A92A 3C3PA 1Q3TA 5BQFA 3UHMA 4F84A 1NJ1A 1ZVMA 3JYLA 4DR7B 2UXBB 1GL9B 1KZ7B 3E35A 4HEHA 3BE5A 1P2GA 1VPVA 2WJYA 5JEAA 3BK1A 2NN6D 4X7RA 5L3QA 1JHZA 1LPNA 1IEQA 2E49A 4WFJA 2HQRA 2VJKA 2ZRKA 3K9CA 4C04A 1RPTA 2AZ4A 2BSAA 1Z75A 1HUQA 1VI2A 2H4JA 4IS9A 3D7SA 4MCJA 4PSUA 5DASA 5GOTA 3ZDFA 1VHLA 2YWFA 1QYWA 2W2OA 1PJCA 5DSTA 4BQRA 2WJIA 4ZYYA 1W19A 3AEQA 4GEGA 1XQ9A 4DPTA 1IZYA 1EFUA 2H59A 3I04M 1R64A 2IELA 4JT9A 4RIFA 3PC3A 3WLSA 2AXNA 3IESA 2ZTSA 3X1ZA 1MHTA 2QT1A 2MSEB 3TD2A 2IYOA 2RHHA 2VEOA 2HIHA 2R6FA 4MDEA 4P08A 1KSHA 4HAYA 4NEHB 1FX0B 1GPUA 3SSNA 5JCOC 3UT6A 4CMIB 5GZ3A 5A2QC 1Z63A 3ZCQA 1Y9JA 5A0VA 2JEAB 2D3TA 3TDKA 2FSVC 3EGXA 1WXGA 3TI9A 4E94A 3DBRA 2WFAA 3MCUA 3OLCX 5DNYB 1RCFA 2LIPA 1OJ7A 3U48A 5AMXA 3K5IA 4ALIA 1Z5ZA 4OQZA 3WFZA 4LNAA 1GL3A 3FFBA 1A50B 1RWMA 3HSSA 4OO1B 1XKQA 3CLKA 2DU8A 2VPZA 4JQOA 4OXYA 2AKYA 1W5EA 3SD7A 1N5MA 1B26A 1C0LA 1C9YA 2ZS7A 2GEUA 3V1LA 5FUMA 1A2KC 4N7BA 5HFJA 4LRXA 2BEJA 5KNDA 2XCRB 2ADFA 1Y3FE 4B6JA 5CUQA 1KQGA 4JI4B 5EJFA 3F98A 4WY5A 3RVOA 1IZ8A 4IDGA 4RLHA 4LJ6A 3GA0A 4HT3B 1SCNE 5AJXA 1K8QA 2EEZA 1GRRA 2JF0A 4G25A 4ERXA 4KHPB 8ADHA 2XSZA 1FJGB 1XRLA 3OMXA 2HT1A 3IUNA 4PX3A 4M9XA 2YQZA 4NENB 4Y6LA 3NANA 2NAFA 4A8HA 4RVHA 4JWKA 3ZH9B 2X7HA 2HHHE 2O2DA 5E1BA 3FDXA 2F1RA 4RAQA 2NO1A 4KAJA 1IEVA 4DXHA 1F9EA 2ZAMA 3DKRA 3PJFA 5IVDA 5B7GA 3T7DA 1GU0A 4EARA 5LA6B 3KJEA 3ROTA 1ZXLA 5IHPA 2I6UA 2VXOA 3DAGA 5K8JB 4IG9A 2JARA 1Z0IA 1RQ7A 1YNSA 2OCIA 3KSDO 1CP3A 1MJGA 1EWTA 3IUYA 3NOQA 3RHFA 4YVFA 3ZWOA 2JBAA 1CR4A 2ZJAA 2FX2A 4FD3A 5CH8A 1F6BA 1ZEJA 1UEJA 3DDHA 4G0NA 4NECA 4NQZA 1VMKA 2OR3A 5DGCA 3GCWA 1K97A 4IW3B 2IU4A 1L5VA 3I6BA 4KB5A 4ZQCB 2P4QA 4ZCSA 5IC4A 1HLFA 3SYRA 3F5FA 4RS4A 2BGGA 1UJCA 4NV3A 5DHQA 3KCQA 5DTQA 1LQTA 3FUXA 3OM1A 4MUYA 3SZOA 2FKAA 5C8YA 2KX7A 1KYZA 2JIRA 3EVBA 4D81A 1LW6E 2G7MC 4ENTA 2A0KA 3SG0A 2HO4A 5EQFA 4LFAE 4F8EA 3K2IA 1P9RA 3EFBA 1J5XA 4KE6A 4RELA 3QLUC 2HA6A 4WH0A 4WKOA 5CP8A 5CRIA 1DVRA 1ZO8A 2W93A 4JP8A 1EUDB 4L4ZA 4KQVA 1HNWB 1DCMA 2ECKA 4EB8A 5GIOE 1E5QA 1N25A 2CHEA 1CUGA 3MMZA 4R5MA 1H8EA 2PMEA 4KXMA 1TU3A 3SC2A 1N5RA 2C78A 4KEAA 4EFDA 5CB4A 4HNTA 1HF3A 5BN3A 4ER6A 3W5VA 3QFFA 1WNTA 1ZAKA 3OTIA 4ISAA 3NDBB 5DPMA 1YXMA 2H07A 5CIWA 4HTFB 3P0FA 3H4VA 1E9CA 1P7WA 1UKEA 2M1XA 3RABA 2HQBA 3IDAA 3UHOA 2Z2ZA 3FSJX 4XJXA 4EG4A 2YJGA 2BR2A 3OPMA 5C7YA 2JEOA 4YAEA 1NZDA 1LPAB 3ZNQA 1C50A 4I9FA 821PA 2G36A 1HDCA 2D5AA 3LP8A 1I24A 1CDDA 3BZUA 3OJOA 4A91A 1SXJC 5BWBA 5I7RA 2QM0A 4X1KB 1KMQA 4BDTA 1Z4OA 4D3FA 4ZQIA 2ZRMA 1N34B 4HZUA 4QNRA 1KI9A 2PLRA 5IH3A 1UADA 4CG0A 2VK2A 5JDCC 3N8KA 2KLBA 3CNEA 1KVKA 1YFKA 4LCEA 4UTPA 1T5DX 4GMGA 3ABOB 3GAFA 2JE6A 3WK9A 4D3ZA 5A4AA 3ZDYB 5J63A 2HK8A 3WS7A 1FJHA 1GNSA 5F98A 1SCKA 1U2DA 1K6JA 1I3LA 3P0JA 1WMEA 4HN4B 2B1QA 2JAHA 4EI7A 4ND5A 3FMGA 4AUMA 4HRYA 4N5HX 2JD2A 2OC9A 3L02A 4TTRA 3SBEA 3C3DA 4EGJA 1JL3A 1P6QA 3I1FA 1MABB 3LC7O 3MJTA 3S29A 1JSCA 1QP4A 3LYAA 1JDSA 1MPTA 5F2OA 1HQDA 1JZSA 2EJBA 4RZ3A 4WXMA 4RPFA 1QPGA 3QELA 4Q5IA 3R8CA 4BL5A 3DDWA 5CDSA 4REOA 3RJMA 4QT0A 1JNXX 4AIMA 1WHTA 3L5OA 4FYHA 5FHQA 3T0FA 4OYHA 3SNKA 2AEJA 2R60A 4EZBA 1ZIOA 1GTG1 1VSBA 1VZ3A 2PT9A 3NHKA 4JYCA 1PV2A 2RKWA 3EXIB 5TR9A 1E5DA 2WZDA 5DNEA 3C7CB 1EGMB 4BFCA 1XXHA 3L1JA 1W34A 2D74A 1E62A 2A78A 3KEMA 5F77A 3UAGA 5DNLA 4OXKA 2PSFA 4FGWA 1E2IA 1QHSA 2GEJA 3QKSB 4N9QA 3L6DA 4HYQA 1JI0A 3L05A 5JSKA 2J7PA 4LS3A 3NVMB 1GGFA 1CHNA 4FN4A 4JUAA 4X91A 4ZVLA 4ZEXA 3REQB 3T5TA 3H5OA 5B3JC 4LZAA 1WZEA 1YB6A 1ZMOA 3BXOA 4MU3A 1W2GA 4YAOA 3VHXB 1KZYC 1W4AA 3R7DA 1UBKS 1LXCA 1ADBA 1PIEA 3BIOA 2G04A 3CLVA 3NJ8A 4Y2TA 5ALOA 5ADUS 4DR2E 1ACLA 2IVFA 3IXLA 4MVJG 5ALHA 2QXUA 3K17A 1H2BA 1XZBA 1RTKA 4MR8A 4M1TA 4A6DA 2EWWA 3L9XA 4UD2A 2F48A 5LOVB 3AVXA 4G37A 3TSYA 3AR9A 3SHTA 4X8LA 4NMXB 2G40A 1EM6A 2FQWA 2OQRA 2I6GA 1L4BA 3E4CA 4NAUA 4BBPA 2WIAA 1L2TA 4KV7A 2NPIA 1IBLE 3MBIA 4I5FA 4BZXA 4IQ4A 5E8RA 1LC3A 1Q21A 1TD9A 3LVFO 4EQ6A 3PP8A 1NVBA 2P4HX 4KQFA 4OFBA 4S3MA 2IX3A 2J6HA 1U7ZA 3UWOA 1CF2O 2XMSA 3D2LA 2QD1A 1R10A 1EMDA 1WEKA 1XLUA 4M7OA 4PZUA 4KPUB 3VBCA 3CUKA 4C7XA 4LW8A 4JCCA 4PN7A 1JBQA 2Y6UA 2AG5A 4JI7I 2OBFA 1MW8X 1XCOA 3K16A 1Z82A 4Z9FA 4MUHA 5AKEA 3AKZA 3I92A 1E9BA 3E70C 4RJLA 2JJ1A 5BSRA 1IM8A 4LWOA 3VPHA 4RQBA 4B32A 3CNBA 2LRHA 4OQNA 3MUEA 1BKSB 2HJHA 3FWZA 3I8OA 1GVHA 4GWLA 1DAPA 4LY9A 4UMDA 5EWMA 5HMLA 4I46A 1Z0GA 4DSOA 3Q15C 4IXWA 3SEQA 1MP0A 1H2ZA 1NF3A 1TA4A 2CKDA 4QIHA 4KSBA 3E8XA 2OHOA 4NZZA 4CMIA 5TPWA 1W1IA 5ALGA 3DKKA 2H6EA 3T1YE 2FWPA 3RS3A 2OV6A 4JYAE 1ISJA 4JL6A 4Y0VA 4CEIB 3GDOA 4K6OA 4F4FA 5IAEA 4Q66C 4PRVA 1EX9A 1VIAA 4TN1A 4CV2A 4ZMBA 5JJIA 3MSXA 2CXHA 4P7AA 2ZE8A 3H04A 4NARA 4D4JA 3JARA 3HCRA 1I2ZA 2X6QA 1YFZA 2H17A 2IESA 2R96A 1MLDA 2M9MA 3M5DA 5AW8A 1IHPA 2EU8A 1NXWA 4C1BA 2WQ7A 2LGJA 1DUVG 1XNQI 5L4NA 2JS7A 1L8QA 4RE6A 1EEHA 2E1RA 2BF7A 1NI5A 1JEDA 1N0IA 1H1DA 3E9NA 2I1LA 4OOFA 1RLIA 4UQPA 2IYLD 3WIVA 2IPLA 2PNLA 1B3BA 4OAPA 4XGNA 4Y6RA 3AB8A 2GJ9A 1KJQA 3VH4A 5CB8A 3UHJA 4D99A 2YV1A 2Z5VA 2PWZA 3QMVA 3ZEAA 3QVXA 1GZVA 1HC7A 2YVUA 3U3RA 4BKPA 4DR5E 3U5TA 1CZOA 4AZ0A 3T4XA 2EFCB 3L82B 1HMYA 3RADC 3ICQB 4MXDA 2NN6F 2WVGA 3H1CA 3UWSA 2F3UA 2ZTVA 3IOYA 4RJIA 4ECEA 4DR6I 3DBOB 3FE2A 4LFCE 1GCIA 1NI4A 4IHJA 5EKSA 3TNYA 1ONSA 3PHCA 4OI0A 1LFDB 3GGGA 2PA3A 1BH2A 3NTUA 3DNMA 3R4CA 4LYHA 4EMDA 3BJMA 2E3JA 3DLIA 1YZLA 4HDCA 4K87A 2CFTA 1W73A 1ESNA 3KWFA 1YZGA 3GLHA 1N2CB 5GWXA 4MVYA 5CB4B 2PUCA 5L3RA 4EG5A 2NUTA 1FYXA 3GI1A 2GSDA 3Q7IA 2BHTA 1MQAA 2BSXA 1AMUA 4BCBA 1JIXA 1JHMA 2R1ZA 4OQ4A 3VX4A 4G0QA 3ZKBA 1SVWA 4PC1A 5JFTA 1L4EA 4G85A 4ILKA 5ILGA 4EB6A 2YWBA 5AVYA 1I5OA 1JVNA 1EHCA 1XMVA 4DV4E 1GA1A 1FFEA 2PE5A 3FNGA 1FDTA 3DEAA 3MXTA 2VDUE 1BCSA 3VC7A 4P38A 1G4HA 1YVUA 4DIBA 1BQ4A 4RIGA 2VHQA 3P97A 4PGAA 1RKVA 2F43B 3H87A 3BHJA 4ZANA 3O8OA 3HCCA 2N1MA 3B5EA 4LFBE 3BD9A 3UIEA 4PCUA 2ZZMA 2ATCA 3H1TA 4ZYVA 4DR3E 1X7XB 4Q21A 4KQGA 2A59A 5JANA 4JUCA 2ZJ0A 5KTOA 3IULA 1AZTA 4X1OA 1J0AA 1GUZA 3RPEA 3LLSA 4A8JC 1XOIA 3A4MA 4EFNA 4F1JA 1JQ5A 1V7QA 5C4MA 3F73A 2QBYA 4ZJUA 3SOZA 5HBGA 1W0JA 4TROA 2R86A 2JGDA 1R9GA 3KB2A 4L72A 4YRAA 5HKKA 5JI3E 3LC1O 3SMQA 4AIRA 2H1VA 4QAJA 2I3GA 5EMKA 1V1RA 4RY9A 3ETEA 4RKWA 2P67A 4UPVA 4AQYI 2D7CA 1U0BB 3PDJA 3DTVA 2HL6A 3GNQA 3GJTA 1FW8A 4LRTB 5IJAA 3PNVA 1U8CB 2OYSA 4UFPA 5E7IA 3JQ7B 4KXNA 5FBQB 3HB7A 9ABPA 1LS6A 2PL9A 5CFOA 3FPJA 3CZ5A 4QUKA 2Q1YA 1FDWA 2ZBKB 1BJRE 1Y1QA 2VATA 2HQOA 2OBMA 1LD3A 3KEOA 3Q98A 5DTMA 2ZBGA 3SEFA 3ZVRA 1CY1A 3TNDA 1PT8A 1SKAA 2I71A 4OLJA 1RKUA 1MN6A 5D85A 2WNRB 1XZPA 4PZCA 5DK6A 1E20A 1KORA 4X7PA 4C7VA 3T7CA 1N9GA 3PUZA 4HQOA 4LGVA 1JFLA 2WD7A 2QQ5A 2JVJA 3IALA 3S40A 4KUHA 4D0RA 3GP5A 3E7WA 3QLTA 2V7QA 1AV7A 4M83A 5CFPA 2PX2A 1KMCA 4CNBA 1T2DA 5K6TA 3D7MA 1D8TA 4Z8XA 4DIDA 1EFPB 4LF9I 4MVJP 1AZSC 1CUSA 4E2YA 2WKRA 4HWRA 1LWOA 4ZO9A 4M2LA 1RCTE 2FEXA 1TJ3A 1VLVA 3QT7A 4WKNA 3UXEA 4E13A 4P83A 3QOYA 1K9SA 4EECA 2LV8A 5AXBA 1TVKB 5ALZA 3C5CA 4JNKA 2Q5LA 4WECA 1Q83A 2HXYA 1YMQA 3RKRA 2PLWA 3UUGA 1C0EA 3UENA 2JI4A 4ZYZA 1EA5A 2COEA 4YPFA 3WHKA 3L8GA 4YRTA 1Z2PX 2RHDA 2X2EA 5B7QA 2CV2A 3M6FA 1U3CA 3KALA 4BX8A 5DX1A 3ZW7A 1CDEA 1J42A 4IRUB 1G2PA 3N2LA 1BWPA 2DT5A 2X4LA 4AG6A 1ZMBA 3ZDRA 3TPZA 2HT6A 1NNLA 3N2GB 1UDSA 4FGLA 3PFHA 1B62A 4M0LA 4YR9A 1GAEO 1UC8A 3GCXA 4JZKA 1LBTA 4KGZA 5AM0A 4YPVA 1N77A 3OCYA 4I1VA 1C7RA 5TMEA 4BP3A 3DXYA 3I9V6 2O6HA 5A9RA 5FWXB 3EODA 3KQQA 1CQIB 4F93B 3PS1A 3AY7A 1TT5A 1BW9B 4Z3DA 4KV9A 5FT9A 4AJ1A 2I4RA 2V03A 5BMOA 3ZGOA 4FFOA 4Z4GA 1J20A 1E5XA 3AIMA 4NCAA 4EI2A 2RE8A 1OXUA 2GD2A 2GBGA 3B85A 3TZEA 3CTMA 4AJEA 3EG5A 1YJAA 4LGCA 2XLBA 3EHDA 4TSKA 3ZG6A 3JQ9C 3AI3A 1KQ3A 2Q7XA 3R6TA 5ENVA 1V4NA 4FHZA 1IMJA 4NX2A 3AZQA 1QOZA 3V1UA 1J25A 4L73A 5E6SA 4K9SA 1A8QA 5EGSA 3NC0C 3KYCB 4UEKA 1CY4A 1IVNA 3MJEA 3UXYA 1E6CA 3C8UA 4F11A 4ER5A 3PSHA 2AOTB 3GJSA 1N34I 5K36A 1B8OA 1UP7A 1W88B 1XVIA 4QE3A 3I2HA 3SNHA 2X15A 5L3SB 1LEHA 2WHQA 1GUDA 2VIIA 5CK4A 3TKLA 2VDJA 3MWJA 1W4LA 2NUPA 1Q0UA 2AD5A 5DYYA 4HRVA 1BEZA 1ODSA 2WPNA 1NVMB 3BIFA 4KG7A 1SD5A 4RANA 2BH2A 3I6IA 4CJXA 3I61A 4P7KA 4CIWA 3TLCA 1IXKA 5K09A 4QOHA 1ZIYA 3WV4A 3MWKA 2JLWA 2ID9A 4WAUA 4IFEA 3LX8A 2NXWA 3L0BA 1JIIA 3NYIA 4I4TB 3HV2A 3MFQA 5ERGB 3I6ZA 2G9RA 4D45A 3JWIA 2HFUA 2Q8NA 1AJEA 2Q4DA 3O47A 3ZU4A 3L06A 5ALQA 4NE9A 1XN4A 3GPBA 2AEMA 2UUBB 1DBWA 2FRDC 3QE2A 1Z8FA