1USVA

The structure of the complex between aha1 and hsp90
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
255
structure length
251
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 73
structure length 251
sequence length 255
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1usvA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usvA02
2O1VA 2CGEA 3Q6MA 1Y4SA 5FWKA 1HK7A 1Y6ZA 1USVA 3PRYA 1Y4UA 1USUA 2O1TA 2IOQA 2O1UA 2GQ0A 3Q6NA 3HJCA 2O1WA 2IOPA 2CG9A
chains in the Genus database with same CATH superfamily
3BWEA 1U0TA 1T4DA 2PX4A 1M34A 4P7BA 1PZGA 5C1BA 4OMUA 2D5AA 3NASA 4P1ZA 1RRKA 1N3BA 3IJEB 4MB6A 4HJXA 1G4HA 1K47A 3EGCA 1I2BA 3NEYA 3U4GA 4HB0A 3JQQA 5K0SA 1QO0D 2KW5A 2WP0A 2HU7A 3HCWA 4H9GA 2Y1GA 3EIWA 3K70B 2XYGA 5CT8A 2VESA 4V1CA 3RGWS 4P4LA 1ZMBA 5M7EA 4AUMA 3EVDA 1QYIA 1IYZA 2R97A 2ZAGA 3EPRA 4LZLA 4RPIA 5JASA 3A9SA 4MUBA 1VKJA 2JKVA 3DP7A 5B2EA 3G9TA 1LV7A 1XU7A 1J22A 2YWDA 2JD0A 3GUCA 5AK6A 5H4HA 3NANA 3TE6A 3HWRA 4DYVA 5EUBA 3ASZA 4B3MI 4M1TA 1LTQA 1NVGA 1IUNA 1BCSB 2AX4A 1NLYA 2G6BA 2BVNA 2O2HA 4IFDE 4UTGA 2HWWA 2FW6A 2Z9DA 1W48A 3EHDA 2F59A 3K35A 4L9SA 1N9ZA 1DKPA 1IY1A 2FZEA 1NJFA 2QAIA 2XKAA 4WDRA 3UXEA 1KRWA 2Q9CA 5FPTA 4EKDA 5T67A 3ZHXA 1BD3A 5KWEA 1N34E 3PYLA 2BGTA 3SFTA 2XVAA 4QREA 4JT9A 5EKSA 1ISSA 1T26A 1XMIA 3FM9A 3VU0A 4ZYZA 1JFLA 1TT5B 1T2DA 4WLFA 5GIPE 3VGJA 2VK2A 3PPWA 3VH1A 4A8JC 4F91B 3KO8A 5HIKA 1ZMXA 4PCVA 1UK8A 2JIMA 3M3HA 4HS4A 1M0WA 1I4LD 4S2UA 1JV2B 3WSVA 3MTJA 5EJ7A 1I94I 1I51A 4ZAGA 2W42A 1NLUA 1W4CA 3U4IA 3VU3A 1KFCB 4XJVA 1XJ0A 2NPIA 2XSZD 2DULA 4MVJE 3O8NA 5CURA 4OD0A 4RAQA 3T1QA 2VHYA 5DP1A 2EG5A 5IXJA 2YWGA 1VHQA 2E4AA 2NUPB 1SO8A 1GILA 5E1MA 1JTFA 5EZYA 5CDFE 2FWBA 4NEGA 3M1AA 3HBNA 1SJ9A 3LQKA 4G5GA 3FTDA 3KWFA 3W6OA 2BMJA 2FR8A 4R2JA 4US2R 1RWPA 4C1BA 3D6AA 3AOGA 2VRWA 1XVUA 4KGXA 2NO6A 4RHEA 4WLVA 2XTZA 4XM2A 4YJFA 4CG3A 4CIDA 4BJHB 2ZRGA 1V71A 5CA1A 1KJ9A 1VI7A 1NE2A 3EUFA 4GD3Q 3FOAA 3RFFA 3TG2A 5J5AA 2IXTA 1JFTA 4CE6A 1NM5C 1LK0A 3KS9A 4DJFC 4KK3A 1QZRA 1J5EE 1SELA 4B35A 2OHHA 2DWCA 2I03A 3DTTA 1NPYA 4NZYA 3WNVA 2AN5A 2RI0A 3IJPA 1X80B 1QO7A 3IBTA 3PEUA 4J7CA 4AJNA 4Q4HB 1QFXA 4M6WB 2VQ6A 2YXBA 4LF8E 3I0NA 7ADHA 4QBIA 4J16C 1UMBA 4ZAVA 1JDJA 3CM0A 4DQUA 2XIJA 1H1TA 4IPTA 4JR1A 2PUCA 1UMCA 4MR9B 5H8WA 1N8NA 1LPNA 2JRLA 2A5LA 3ZHTA 5IZCC 1X9GA 1ZEJA 1OXTA 5BSRA 2R1ZA 1CU1A 2PWPA 1PE0A 5HS4A 2UXDE 2O8DA 5FTKA 1QXSA 4M7OA 4Q6BA 2BFDB 4R41A 2OHGA 2SKCA 3E3AA 2OORA 5C0XA 2PZJA 2AOXA 5JZMA 3SC6A 1UDXA 3TFWA 1WX1A 1YZKA 2VUTA 1P73A 1D8AA 2W5UA 3I6ZA 4K40A 4W82A 1GLNA 1I3NA 4F3YA 3L8MA 4Z4QA 2IZ1A 1I2MA 1Y1PA 3LLUA 4ZT3A 1XX6A 1E98A 5EPEA 2DYKA 5BQ5A 2DLCX 3G5TA 5H4GA 1YQDA 4RVSA 2H4JA 13PKA 2AI1A 3GFFA 3N8IA 4QDJA 5AKGA 1WDMA 4Y6LA 5CVUA 1WZEA 1XGKA 2E0IA 3REQB 1FRZA 1CVRA 1KU6A 5SYNA 1X1TA 5EIWA 1SC3A 2WMYA 1XNJA 4DE5A 1XHEA 5KHLB 1D0IA 4RANA 2X15A 3J80C 1RBQA 1XZFA 4NMLA 1JKIA 4IFDF 2EW2A 4M87A 5CB4A 2C4KA 4G67A 1WBJB 2PFKA 4ZOEA 3RS2A 3SHQA 1AQNA 1UH5A 4QUJA 5B58C 1RE1A 2JIZD 2BFMA 2E4WA 1NWCA 1ULHA 4DR5I 1XD9A 2PSSA 2ZB3A 5LOVA 4LZAA 3C3XA 2ID8A 4GEGA 1Z7BA 2QTWB 4ZVUA 1FCJA 1KE1A 4S1WA 3HZRA 1V7CA 2PKWA 2XXBA 2DH5A 1EE9A 2F1OA 5AK5A 4YRJA 4PYRA 1GVNB 2FI1A 3KOZA 1J99A 4OYRA 5HPYB 4OLHA 3U6BA 2I7DA 1BC5A 2FZVA 3KVYA 5LXTF 5ICEA 4BMOB 2EZTA 4MAAA 2XECA 3HULA 4MVJF 4YK7A 5TGDA 3S40A 1RXSA 4LUCA 1JHDA 4AL4A 4DIFA 1JKJB 5BSEA 2CVZA 4M53A 1JG7A 4XAQA 1IPEA 1YKFA 1M1XB 5JEEA 1V9CA 1X8JA 2V4MA 3H2YA 3QVMA 3ZI7A 5EL0A 1MG0A 4KKXB 1WD7A 2WA1A 3K9QO 3T3NA 4Y3UA 1P60A 3H5RA 3OBBA 1UKCA 4BVLA 3WGVA 1OX6A 3G0OA 4NXME 1SCUA 1WR8A 2VN8A 4IIBA 4KMMA 2ATVA 3C3BA 2RCYA 3N2LA 5F2EA 3QSYA 1MOPA 3FPBA 1NBMD 2XF2A 3KHSA 3ZWCA 3WU4A 3LC7O 3CW9A 3R0IA 1A0OA 1QIKA 1PTJA 1RM3A 2G82A 2HX1A 3LP8A 3TX2A 1C1XA 1N6HA 3AKYA 1NMSA 3NR2A 4M83A 4RGBA 1QANA 1BWSA 1VMDA 4JI2E 2G36A 3UT0A 1PJCA 3AFMA 3ZKBA 3B6JA 4RA6B 1O95C 1JFRA 2IU4A 3QLEA 2VJKA 1DWPA 4A91A 1AKQA 2B2NA 4M0UA 2NUAB 1R4MB 2A88A 2IFTA 4Z2YA 4A6EA 3PS3A 4A8TA 1RQGA 3ILVA 2CL5A 4M89A 4ZZ0A 1OZFA 3A58B 2VAVA 3DOJA 4TL9A 1MG5A 3OY7A 1QF7A 3L8EA 3T5TA 3VJLA 1ZG3A 4B4UA 1E4YA 4BU0A 4DC0A 1NBME 1ORWA 2O52A 4IWXA 1A98A 4PFQA 5F52A 1T0HB 2A6PA 2P2GA 3DNMA 2AZTA 1Z2CA 1JDZA 2GCOB 1MH1A 1DTSA 1XQ1A 4DA4A 1HDGO 2OCAA 3IQWA 1ECLA 3L6UA 2BC9A 1GZ6A 1N2IA 3STVA 1T5LA 1H94A 4FZVA 1CUCA 3R9IA 3BXZA 4QKQA 2G09A 3PUKA 2XF8A 1FLAA 2GJKA 4JL6A 4CVNA 3KYCA 5DLEA 5I6DA 1JDPA 2UAGA 4RK1A 1RABA 2R8RA 3P2MA 3C1OA 4A73A 1U0EA 2JGDA 3GARA 4H7EA 4I8XA 5EHXA 2VK8A 2PRSA 1G6OA 3IOMA 2FRDA 4UU8A 3KQTA 3AVTA 4OQFA 1G6HA 5HDQA 1M0SA 2KE5A 2CHGA 3FMIA 1ADGA 2KI5A 4WA7A 3E58A 3WGKA 4IH1A 1BH6A 4BVHA 1K92A 2Y77A 4FCTA 4YUYA 2J3LA 1C4WA 3VDXA 4HNRA 3L8CA 1RI2A 4UVHA 3IJ5A 3FB4A 3KUDA 1MO3A 4KQ2A 4V02A 5DYIA 2IV7A 5I7FA 4YGXB 3KB2A 2QLNA 4B3XA 3LT4A 4QPNA 5EL9A 1QFYA 2VJMA 3RT1A 5A04A 2XXJA 3L1KA 4K9QA 1US8B 3ZHOA 8OHMA 1ATZA 4ZC1A 1P74A 2QUZA 4DN6A 3F9CA 2CD9A 1JX6A 2Q1SA 1RJEA 2X23A 2OL4A 3K0CC 4FDUA 1LBEA 1W46A 3I1YA 3WMXA 2ZRHA 3OQHA 2VXOA 1P6XA 2A1UB 5LL6P 1VG8A 1NZ0A 1U3UA 4AMVA 5HR5A 1PUXA 3FSGD 2HBRA 1Z63A 4ENSA 4OKGA 2KS6A 4Q1FA 5LQJA 1IBLI 4JV5I 1EGAA 2GAIA 1XEXA 2W11A 3BZWA 3M5DA 5D5QA 4A8HA 5EJ5A 1H2BA 2G83A 3PSHA 4MQYA 1E9VA 1NTRA 3CKMA 3QJ5A 4F06A 5BRAA 2L42A 4V03A 3Q8WA 2HA6A 4N3OA 1WW8A 3BDAA 3ZHRA 1KK1A 1WCYA 4WK2B 4RELA 1OWMA 2RH4A 1CYEA 3G0IA 4EUHA 3UGJA 3Q2OA 4ZI7F 4MQFA 4BLSA 1UBGA 3HJGA 1JG1A 1ACLA 2DF8A 2MU1A 4IGIA 3RH0A 3TTVA 4Z1MD 4ZALA 5KO2A 4XQ0A 2F4VB 5F2OA 1RYZA 1Q1AA 4IDBA 3LW8A 5L6LB 1UXHA 4MSUA 3ROEA 2B92A 1GUBA 1ULAA 1Z4OA 2BT4A 2YV2A 1U2GC 1NMYA 4G0UA 3EVEA 5EJ2A 1YC2A 4AJPA 3Q6NA 1Z0KA 3ZZ1A 3FBTA 3VYVA 1OFTA 2O2SA 4P9NA 3QV1A 1IXZA 3EZFA 4E4YA 3CLSD 3O2QB 4ZFNA 1LBIA 4CZ2A 3HGQA 2JKYA 4C07A 3PUVA 2AIRA 2J5BA 2OBYA 4JYAB 5FR2A 1JLKA 4MNTA 5EE3A 2L82A 2ZVQX 2WTEA 3QPDA 1KIFA 3QVSA 3P9SA 3UK2A 2HNAA 3QV2A 1XD2B 2R6GA 1XZGA 2ID4A 3U7JA 4MW5A 2HIMA 3KPYA 1C8BA 1KDRA 5E9QA 1IXKA 2B99A 4GBJA 3HP4A 1DV2A 4KZPA 3IBCA 2LD4A 2HMTA 1BAPA 5C34B 4TMVA 3UK7A 2JHGA 2N3ZA 3HLYA 3SJAA 1IY2A 2P9QA 1G20B 1EZZA 4UFOA 1PYOA 1KDTA 2PBLA 1ADJA 4CF4A 1T5IA 1JG3A 1YQGA 1MEJA 1V39A 1QMGA 3RU3A 4HV4A 1Y63A 2GCPA 2BW0A 3TH5A 3PYFA 2GO4A 4GPEA 3ZZTA 1RHUA 1Z6YA 3C43A 3NCHA 4X24A 4OH1A 5C8VA 2DMRA 4MVJG 1CJMA 1XTTA 3KOUA 4KWHA 4OXKA 4QBTA 4RHXA 4TWZA 1TQ8A 4L9RA 1E1DA 3UTDA 4XGRA 3GNLA 3Q15C 3R5TA 4MGIR 1TVMA 3OZIA 2J0QA 1AXGA 3HR7A 3HA5A 1T8PA 3UWSA 4B87A 3LLSA 1NLFA 2RDMA 1ZITA 3GT7A 3HA7A 3OT4A 4LYFA 5I7AA 3T3EA 1QS0B 2FN8A 3QU5A 3EGWA 3SZGA 1RWXA 2CYCA 1P2TA 1Z8DA 3W04A 3AXTA 1R9NA 3R3YA 3ETEA 1T1RA 1W88A 4NABA 4AMZA 3CE6A 2O9JA 1HR0E 1TM7E 1U1EA 3LLVA 5BSVA 4U2DA 1PEKE 2G80A 1TF7A 2VT7A 3EDYA 3A37A 2QR5A 5ED0A 4TRNA 5J2TF 1HNNA 3PHCA 3TF5A 5F7OA 4H15A 3HDJA 3V1TC 2YYSA 2IH5A 2IT1A 3FZEA 1DRKA 3OAAA 1QPZA 1ZUNB 1XMXA 3GBVA 1MPTA 4YY3I 1LI5A 2XUGA 3WMGA 3KXPA 1HNZB 4U2KA 1CEEA 1E2BA 5ECGC 1YI1A 4CMJA 3VC7A 4PHGA 5K03A 4NCHA 3N2GA 1CQWA 2HSDA 3WRXC 2CNDA 2G04A 4F1JA 4USMA 1IDN1 2D0DA 2G7ZA 5JYCA 5FPPA 2VAMA 3KEFA 1M5UA 3DKIA 3FCEA 3PR1A 1MJGM 2CXPA 5L9AA 3PC3A 2BRUC 4UJ5A 4BNVA 3TZKA 5I7HA 2QROA 3V8RA 2XCLA 1E3SA 2IHYA 4XSHA 1T1JA 5IEJA 4IGEA 2AV6A 2NU9B 3CZ9A 1V7PC 3F5MA 2B21A 3WWPA 5K3CA 4IL5A 4WLOA 1KOGA 1KZYC 1CY7A 3I0ZA 1UUFA 1KSFX 4JUIA 3MWGA 1DWOA 3VR3A 1P7YA 1AKNA 3AU9A 1YB2A 5EQTA 1IBKB 1BJRE 1VHJA 2GO1A 2UUAE 3VI4B 2ZZKA 1E2HA 2O20A 4M8NE 3X1WA 1CFZA 3NIGB 4R68A 1MG7A 4C0KA 3PRKE 4UHEA 2JJYA 5K99A 1BN6A 3E53A 5I9TA 5FHRA 3V4ZA 3O74A 4UEOA 5EP3A 3VOAA 4ITVA 4IILA 2GS8A 1WCV1 2DQSA 1NWHA 3CLTD 2ADOA 1JBEA 3CZPA 4OFWA 4UHCA 3DXZA 1BKSB 2QPOA 3NBQA 1TCCA 2JS7A 3DMYA 5JROA 3P96A 2UYGA 1UM9A 4PG6A 4QEKA 1Z45A 3EPLA 1DIHA 3OA2A 3P76A 2JJQA 1N2HA 1T13A 4JLOA 1J06A 1VJTA 2RBGA 4YPFA 1THMA 2EHDA 4XOIA 2ODBA 4HF7A 5KSZA 1DCTA 4XOUA 1YHYA 1ECFA 3JU3A 5JWOA 1J8MF 1PFKA 1TZJA 3LGXA 4PNPA 4C4TA 4WW0A 3AFGA 3VOBA 3NT5A 1Y5NA 3IPYA 3KYIB 3TLKA 4QDOA 4DCPA 4DL9A 1MHTA 2BUBA 2H54A 3KAKA 1T43A 3OOSA 2CLSA 3VDMA 2JDIA 4NBRA 1YACA 1HQYE 1GTSA 2CL6X 4G0YA 3VZPA 1VZ3A 3OTWA 4BVGA 4BEJA 1JIUA 3O90A 3D7RA 2ERXA 3NT2A 5LSAA 2ZU6A 3DV2A 3CX6A 5KWSA 2JEBB 4BLWA 2P2YA 4H08A 1I7SB 4AQYI 4CL2A 4AK9A 2H1FA 3N3BC 3C6QA 4ZXPA 4FYYA 4CL8A 4YJ2A 1KGDA 3DG9A 5FPQA 1O5OA 1SCAA 4O0MA 2YOHA 3ZWBA 4OUDA 4UUQA 2XNHA 3GB9A 3LH5A 3WKBA 1ZMOA 3TQCA 1UJ2A 2VSFA 3FGPA 5H81A 1G3MA 3T06B 2J4DA 1DX4A 1MTOA 3LFTA 3Q3CA 5EJ9A 1W36B 3A1EA 4FD2A 3ES9A 2IYLD 5FLXQ 4LWPA 3N6VA 1P29A 3I61A 3PGA1 2BFBA 3PHLA 1KC1A 3W4KA 1RWOA 3U7RA 4KYUA 1P4RA 1ZJWA 3WB9A 1VG1A 2F3UA 3W5SA 1XMOE 5CX1B 4MX8A 2V5VA 3SQLA 1E77A 4BMPB 1DVRA 1RP1A 3HR4A 3EYWA 5AMXA 1V9LA 1X1RA 4JYPA 3NS7A 1L5WA 1TKAA 3OJFA 3STUA 1NVTA 4Z4FA 3JQAA 3NYQA 3IIKA 4AFNA 5JVDA 3K96A 4PG4A 5CBPA 4I19A 2V9ZA 3I04A 1LS1A 4DDHA 1FFCA 1UANA 2HIAA 4LK2A 5JQGB 3IKJA 1J56A 3ORHA 4EMTA 1BROA 2GZ3A 2QN8A 1SVWA 1IVNA 3P3GA 2HUNA 3I9V1 4RVHA 1UJ4A 3DHWC 4U2EA 2WM9B 4O4JB 1K3TA 4F5ZA 2RI6A 3EPPA 4X1OA 2M6SA 2BCJQ 2C31A 3D9QX 4MZXA 3RIMA 5JAMA 2JFYA 3GLFE 3F1KA 3GLGA 2UXCE 4KXFB 5C35A 3FZNA 1P9OA 2ZG6A 4CMHA 2BA1D 2ZYWX 1IG0A 1BU8A 1BVUA 2XAAA 3VH2A 4CNBA 1IWOA 5CHYA 3I9LA 2JLWA 1YR3A 1QX4A 3FKSD 3KE8A 5C5EA 3DOOA 4QX6A 1WE2A 2BLNA 1VISA 2XZLA 4TRJA 2H1SA 1KPIA 1NBIA 1XF1A 4EPYA 4N39A 1PFWA 3ULKA 1ZH8A 1GGFA 3OG9A 1PK9A 1TUEA 1KAHA 3A4MA 2VLIA 4HACB 1G8GA 4R05A 5EXXA 4ASUD 3SNHA 3A0UA 4HGNA 4X97A 1EBFA 4IFDB 1RZ3A 1Y0BA 5IJXA 5EFOA 4FGKA 3RVBA 3MS7A 4G5OA 3ZHCA 2PO0A 4RTPA 3FMFA 1DO2A 4CLOA 1N34B 1USVA 1HLGA 2R9VA 4FR5A 1V4NA 3GEHA 4PYIA 5TARA 2A4MA 1UDWA 3HYLA 2OUKA 2VBGA 1M66A 3K4PA 1U2EA 2VDWB 2C1XA 2E9SA 1IOZA 2QK4A 2NN6D 2QZZA 2WWIA 3GF4A 4M9SA 5JTTA 4G1FA 2F8TA 1LRLA 3HO8A 2X2FA 1B0ZA 1RLMA 2X14A 4H4CA 3PICA 4WA8A 4YI5A 3CWZA 4PC6A 2D1SA 3OURA 4LDPA 5LXTB 2YJ4A 5IUNC 1PFVA 2B5VA 3OKAA 1ENYA 1W0KD 1P2VA 3WQBA 1E6KA 1ZIYA 2VAXA 3CWQA 4BEWA 2O2IA 3EA0A 1N6IA 1YNSA 2WIKA 2ZUCA 2OO3A 1U8UA 2Z09A 4AKSA 1U0SY 3F5FA 1U2RA 2HU8A 2UYOA 5CDUA 3LKDA 4QSHA 1UP6A 4CIBA 3FJYA 2YY5A 1B6SA 4LOIA 4UKDA 1LLCA 1E79D 2Q1TA 1DMRA 5A9SB 4DUZB 2W4MA 3T1HI 4GVXA 4INOA 3BBPA 1PEDA 3TEFA 3DDOA 4K03A 1G8FA 2NN6E 3FNHA 3QYJA 4C87A 4LZZA 1KZ4A 3NBAA 4IDEA 4TN5A 3QY0A 2XIQA 1QP4A 5K3AA 1JJAA 2JLVA 4L5BA 5I7OA 1TLFA 4P3KA 2GXQA 2CNNA 3PR3A 1G5HA 4Z53A 2QG4A 4RPCA 2JJMA 1Z3IX 2G9UA 3EW9A 5L7YA 1J5EB 1TYCA 1W8DA 1MLDA 3WQQA 2B4RO 3ZI0A 4MPDA 5CVDA 4FW5A 1RCFA 3QEJA 4PEVA 4FM9A 2Y1DA 5HZMA 3OE1A 1A5SB 4IXWA 4XVRA 4DYHA 3EZ6A 1YVPA 1LH0A 1OBOA 2D1RA 4ZCMA 1U2DA 1U8YA 2VDOB 1LK5A 1HETA 1LPMA 3CB2A 2FPSA 3QWFA 2OQRA 2LCIA 3BGWA 3K9CA 1EFPA 3G8YA 3U4QB 4HQFA 4GMDA 4TTSA 1S2LA 5DCLA 1ZXNA 1IJBA 3W3AD 5EJGA 3D0QA 3CWCA 2FWRA 4JWTA 3B6ZA 1SOUA 4R6WA 1DCMA 1NV8A 4DIOA 1FTNA 4X90A 2UXDB 1EFLA 1FDVA 5D1HA 2WVGA 4URXR 5BNIA 2G17A 3L01A 2CHVA 1DO0A 5B58T 1EXMA 1OX4A 1QFMA 2J45A 3V4PB 1ST2A 1R0YA 1T6NA 4RIEA 4KPUA 3S1AB 2XGOA 4MEAA 1HQCA 3DTVD 1AS3A 2HH9A 3LL4A 5IWCA 1UJMA 4TTRA 1UKBA 2LWIA 4HNAA 4OHOA 3UT5A 2OI2A 1Z5BA 4MVXA 4P4NA 1YKSA 1R8XA 2VRBA 1YE8A 2ZYVX 3EC7A 4UU1A 3HNPA 3IQGX 1PSDA 4CQMD 3PNKA 2ZJ1A 5CG2A 4NYIR 3OJEA 5AVWA 4MLPA 2R00C 4EL0A 5TIIA 4ZVKA 3R9XB 4ZPJA 3AGPA 2X5XA 1WB5A 2BGMA 4B79A 2A1IA 5JXIA 4IFDC 3I6QA 2XUOA 3BJRA 1C7QA 1I01A 4JFRA 2GCGA 5DT9A 5EQJB 3O1IC 5CK5A 5DTEA 4IDCA 2R4TA 4C43A 1M2OA 4RD1A 1LC0A 4ON9A 3U3JA 4Q37A 4KQMA 3CH4B 3JWPA 4IFIA 1L3CA 1PG2A 1ZCFA 1V47A 3ASYA 2NP7A 1KKMA 3HYCA 4OXXA 2R7MA 4PC2A 4R7ZA 2AHOA 1B2RA 1Z5WA 5LQRA 3Q10A 2Y0EA 4F21A 3VHXB 5TE9A 4HFJA 5DWVA 2O23A 3GRCA 3ILHA 2CJFA 4S1NA 1KHHA 3AQIA 4ZPXA 3HFGA 4FCCA 2WJHA 5BSWA 4PZDA 3RVKA 1XKXA 1G9SA 3GGDA 3OQIB 3PWZA 2YKGA 2P9TA 1G60A 4EHNA 1TT7A 1BDMA 5TEWA 2EKLA 3NWEA 3HU2A 3LS2A 4FKZA 4UXJA 5EN4A 4DADA 2HHJA 2HCJB 4EYEA 5A3JA 1DKNA 5C51B 2PUBA 2C0CA 4PHFA 1CUBA 2QLLA 2J31A 1KO7A 4FFMA 1JZTA 4GQBA 2OFFA 3TAHA 3JD4A 4EHDA 1XDDA 5E4JA 4LRQA 3KR0A 4DYDA 1DNPA 2WJ6A 2X9QA 3CRW1 4IQFA 4DR3E 1U2ZA 3ADPA 1GFWA 4MV7A 2HBZA 3E9RA 4R9NA 4NXMB 2NN6F 3GDFA 4LSZA 3QW4B 1X7WB 2OC4A 3E8SA 1C81A 3CONA 5DVZA 4ZI7B 1U7ZA 2F6RA 3BE4A 3GX1A 3M6IA 4ZT6A 3ZV7A 1Z4KA 4FWGA 4OHKA 4AURA 4BFZA 1XTIA 4V0QA 3HACA 4PLPA 3RK0A 1R6LA 4TV9F 2WZBA 2ZRKA 5LB2A 5J4KA 3QFRA 3H65A 3CVXA 4JI2B 7MHTA 3GO4A 3D8UA 4CTMA 1DXQA 2YXNA 3GUZA 3SXJA 3IEVA 1OJLA 3H5AA 1SCQA 2V97A 4C88A 1FTSA 2XVMA 3EGXB 4G01B 4U0KA 1P1FA 3PD0A 3X0DA 1C30A 3H0CA 4ND7A 3MD0A 5EA2A 4ATNA 3PD7A 1CJTC 2J65A 1W4LA 3N2YA 4JROA 3WYEA 1Y8QB 1IZ9A 2C8LA 3IVCA 3MUFA 4PINA 2FGJA 3TDMA 5A4IS 2X0JA 3A6JA 2QMZA 3C16C 4CIVA 1S2IA 1V1MA 2IYYA 2KLHA 3MGGA 4CF6A 4YRTA 1OCEA 1NQUA 1ZIPA 1RHYA 3ASVA 1Z6AA 1KI9A 1UINA 3VPDA 2YMPA 2JGLA 3KB8A 1QP0A 1G41A 3ZDDA 3COJA 1Q3TA 3LF2A 1Y6GA 4I4TA 1QIFA 1WUJS 2WFLB 4TYYA 2AF4C 3IAEA 3N2KA 3D7LA 5JNLA 4FC7A 5E1OA 4YJHA 2VYVA 5KSWB 5JI2E 4D6PA 3QUBA 3IQEA 4NS4A 3E7XA 4JYZA 3BAZA 2DXIA 1UWCA 3BX1A 2GHIA 1H2HA 1LBQA 1D07A 3QZUA 5L51A 2WM3A 3VR0A 5BUSA 4BY9E 1WXFA 4W63A 1EWVA 2Z8XA 1C9NA 3HJAA 1CY6A 4PZ9A 3ICEA 4Q9HA 5G40A 4HZIA 4BB6A 1IWBB 2WJPA 4QYTA 4QGSA 2FW0A 2WWYA 1ZDMA 1NYTA 3TCKA 3ER9A 3GCZA 1HDCA 2VH2A 2PEZA 4J0CA 4LXTA 3LOPA 2VYNA 1HE8B 3OPYI 1L5MA 4L1KA 4LV5B 4PQFA 1OBFO 3I01A 3PVSA 2XCIA 2YVLA 1Y4AE 3TR5A 2QWXA 3P5BA 2SICE 1F60A 1YVDA 4QYMA 5IAOA 5ILGA 5J47A 2CV0A 2J3KA 1BGWA 3DMHA 3I53A 2IF0A 3KQWA 4HBGA 4IKOA 3GRFA 4LJ6A 4MCHA 5JZSA 2CJWA 2WIDA 3CR7A 4LRXA 3OLCX 4DLBA 3KFLA 3LWNA 2DR2A 4YDQA 1PRYA 1OBHA 3UFXA 5J2TB 1T9GR 1QGUA 2VP0A 3K4QA 2BFPA 1EK0A 4PPQA 2PS3A 1L1FA 4ABTA 1GGNA 5DMHA 1EJBA 1X86B 2WUVA 4FR2A 3E9YA 4JSTA 2WOJA 1CZUA 1PL6A 3N7TA 3V97A 2H7VA 3TECE 1KJYA 1KOFA 2GEVA 2R7LA 3SHVA 5JRDS 2UUOA 2QYTA 5CJPA 5DHSA 1ZYUA 1Q44A 4DV4I 3N8KA 2CVEA 5GQSA 1QIGA 4FGUA 4FOPA 3SMVA 3VPHA 3LUFA 3R3SA 4KPFC 2EFEB 2EJVA 3L4EA 1WXQA 2H0QA 3KU1A 5EVJA 2CL7X 4GI1A 1H2XA 4EAAA 2DLNA 5K8UA 4Y0NA 1E3JA 2I1VB 5IYZF 3BUSA 2JGNA 1RKXA 5DNDA 5T8KC 5EXDA 2EFHB 3R7BA 1DRJA 4CM4B 5GINE 4UAVA 3OTQA 2C2MA 4FFBA 4IIDA 3WYDA 1ISPA 2JANA 1ONPA 1R16A 1VLLA 1UT6A 4CTOA 5CRIA 1JAIA 3HPRA 3LWBA 1OA0A 1Y7LA 2BZSA 2VHWA 3SR4A 3D1VA 4KXUA 3N5CA 4KAJA 1U9IA 1ZH4A 2O7SA 1RAFA 1JI0A 2QTCA 2W90A 1GT6A 5DROA 3A4VA 3NKFA 4ERNA 1FL9A 1KQ3A 1BNCA 2YDXA 3UWOA 5KPDA 1EUQA 1H66A 1FX1A 2O5EA 2OQVA 4NHOA 1QUEA 3NYWA 3OQMA 4ER7A 1DG9A 2OECA 3BIOA 3IESA 2NM0A 3T1YI 4Y0VA 2FPLA 5JJCA 2BP7B 4N8EA 5ALRA 5C5CA 4AQ7A 1A8UA 4IHQA 3TZEA 2ZM5A 2H1RA 3KXIA 4KSBA 1B6GA 2PZMA 3BWBA 3U3ZA 2P2DA 3NTXA 2RHOA 1JEYB 1N33E 2PWBA 1WUTA 4L9AA 1GUAA 5B3JC 1E9AA 3JS5A 2C57A 2O1SA 1S3IA 1MJFA 1ZKDA 1CR6A 2I34A 2X86A 3QRWA 2DBRA 1KMNA 2BA1G 3FVVA 2QE7D 5CH3A 1VL6A 5EZ6B 5TPZD 1BX3A 4KTTE 4JEMA 3HK2A 1ONNA 2PRJA 1ELOA 1M73E 2OHOA 4YCSA 3VR5D 1XV5A 3UEOA 4LJSA 4B8WA 2HJWA 5IM4A 1CS4C 3NHAA 4Y2PA 3UA4A 2FRXA 3GVHA 5ALFA 2QQGA 1HNZI 3GLTA 1A82A 1QPBA 2QUBA 3OX4A 4X7PA 5COQA 4CIAA 1DADA 2GPJA 1NNUA 5EZSA 1YRWA 3VUEA 5KNCD 2QF7A 2WHQA 2WYUA 3L7NA 4FLMA 4P33A 1L4KA 1OVMA 2E4VA 2IY7A 3J7AG 2I7TA 3NI2A 5JXWA 2FOXA 1LUAA 4YTEA 6YASA 5A5EA 2HV8A 2QY9A 5E6SB 3O91A 1V35A 2RD2A 1QB7A 1E62A 1JN0A 5TEVA 4HAIA 2V2QA 5B1HA 2V03A 3LSYA 2I80A 4FW6A 1Y7PA 4KUHA 1ORHA 1QU2A 3THOA 3QE9Y 1DRWA 3R6LA 4IIXA 4AZSA 1YFKA 1A72A 3LXMA 4ERXA 5A3QA 4EG1A 4BO1A 2B25A 3GFPA 2IKQA 3PZBA 1XCJA 4LOJA 4UBKA 1JQBA 5DK4A 3Q5DA 5FOQA 2DRIA 4ROTA 2G9ZA 2VKQA 3A25A 4TMFA 3WK5A 4B6PA 5AKZA 1K3FA 2J0UA 1HR0B 5A4DA 1TIKA 3P4UA 1KL7A 4B40A 2C04A 4MH0R 1IJFA 4NARA 5EHQA 3O1LA 1E9FA 2NYUA 2ZBPA 3GR6A 1EI9A 2BKVA 1XEFA 3M4JA 3IUEA 1ENZA 1MRZA 1YKGA 4V0LA 3BICA 1KF0A 1Y9ZA 2QL6A 5JEAD 2QY6A 2WVHA 2C9OA 1WZNA 1AUPA 1P2FA 4PO3X 3TLXA 4MV1A 3DZBA 4WHMA 3M6AA 3BPSA 5ITSA 2BTOA 2RGRA 3HVUA 9LDTA 2BUAA 1QJCA 1KH3A 4U7FA 2GLUA 2LBPA 4KNVA 4MR8A 1TI7A 4G89A 3RVRA 3HWX1 3W6ZA 4EFLA 1CXZA 3CUSA 1R5JA 2PX2A 3OD5A 1Q1BA 2ODPA 4AJ1A 1ONBA 5C8ZA 2VF7A 3EQ6A 3RHTA 1MR3F 2PT5A 2PTHA 2PL5A 2PS0A 3DPUA 4H3SA 1A8HA 3N1UA 4F4IA 2HSZA 3AMVA 4G8CA 4K0RA 1IZ0A 3UJHA 3C6KA 3MF4A 2QN1A 2Q6VA 4BWGA 4JQSA 4WKBA 2NZYA 4MIKA 1YB6A 3EIOA 5JEAE 2I4RA 3ICVA 3IE2A 4MYDA 4DVJA 2UUAB 4NZPA 1DXHA 3LLCA 4QAJA 2OHFA 1QRDA 4TS9A 5AJXA 3X1YA 5LQDA 1J70A 4EJSA 1PSWA 4Q34A 1JSRA 1AIPA 1NTOA 3GW8A 2L2QA 3FTCA 3R6GA 3KB6A 3P8ZA 4Y1FA 3S29A 3DZIA 1IU9A 1JQKA 1BEZA 1X7ZA 1GM5A 3F47A 1M5TA 4HXZA 1PUIA 2AMFA 1VKHA 4C01A 3I5XA 3RU9A 5G53C 3AG6A 1Z08A 1ISIA 2D4HA 4UNNA 4U5QA 2HRCA 2I2XB 1MRNA 4CU2A 2H29A 4WBXC 4HP8A 1EAYA 3OLZA 3RW9A 3SHWA 3OBIA 4JUCA 4LF6E 1Z2PX 1JFFA 1T34A 1PGPA 5HM8A 4JJ6A 3OU7A 4QELA 4WNYA 5B2FA 3K31A 4X71A 3EA4A 3WWZA 3IUYA 4MKXA 3SHTA 3ZGLA 5CG1A 2P2SA 4FW7A 3OE4A 5DNUA 5MN5A 3WZMA 2MYTA 4MUKA 1NP3A 2GH1A 4YAFA 1X7YB 3WK4A 1QQ5A 4C05A 4DLSA 3F8TA 3GJ3A 1V5GA 2ZIXA 4JVLA 4Q1EA 4QFDA 3ZWOA 4E7PA 7REQB 5DNLA 2LRHA 4RSHA 2DFLA 1YUNA 1L4FA 2CZGA 4GI5A 2JLBA 4HDSB 1U5BA 4YAOA 4CCYA 2QM7A 1FUIA 3QKRB 1Q1GA 1MO5A 4NCKA 3BGDA 3GRYA 5EIOA 5IAJA 4B2PA 4JI1E 1GYRA 3OZRA 2AOUB 4TLEA 3NJ8A 5JCPA 4ITUA 2QRMA 3DPSA 2R1VA 3JRNA 5CCDA 4BMCA 3WGJA 4E5NA 4FW3A 2R96A 5BN5B 1CYDA 3G5LA 3KJEA 3QLUC 1G21A 3WL5A 4AKTA 4YV0A 3WNBA 3RFUA 4A36A 1T5OA 3VPCA 1WY7A 2OPBA 4RMIA 4X8MA 3D4BA 2D5LA 2EXXA 4R31A 4XM0A 2BWJA 1IUPA 1EWKA 3KT3A 4W5HA 1K5HA 4ED4A 2ZS9A 4M0DA 4NMXB 1N2GA 4AJ4A 3DUWA 1O57A 4Q3BA 1BH2A 1I5OA 1FP6A 3CZMA 1O3YA 3DT8A 3PWTA 5CT6A 1L5LA 5LYJF 2PG3A 3DWEX 1AKMA 1HG0A 1RJGA 1N5MA 1RQNA 1S5PA 3A1WA 3RVQA 1XMOB 2IZOA 1DOAA 2ZE7A 2FUKA 5BYJA 5CYGA 1VJ1A 4B7XA 4ZAZA 2FMUA 2JAOA 3QVLA 3QWIA 5LP6F 1VSUA 2EHJA 3HBAA 4XQ9A 1E0DA 4NK4A 1M5RA 1QAQA 3QLVC 5K8TA 3WDSA 5T6MA 4OJKA 5EP1A 2A0YA 3SY8A 1PR6A 2G9QA 2CK3D 4IYJA 1NQXA 5DHAA 5ICSA 1JZSA 1N34I 4BGEA 4Z9YA 4HGQA 5FA5A 5KC8A 2PGLA 2YZKA 4G5YA 5DYYA 1A8PA 1WM1A 3FUXA 4EJ6A 1ZCAA 4JOBA 1M6WA 4EFKA 4UDYX 1UDBA 3GLFB 4EVIA 1D6TA 3I72A 721PA 2AG1A 2Z2JA 4BB9A 1YJAA 2NVBA 5JANA 2UXCB 1RFLA 4P7KA 1YBMA 3SX4A 2DPMA 3FOFC 4KI7A 1JBQA 4RTLA 4QDXA 4HSEA 1E3PA 3IEIA 5EMLA 3IOBA 5JEAF 1MXFA 1Z5VA 1YOVB 4JI3E 1C50A 1FUKA 1PQ4A 1KWKA 2BEWB 1Y8RB 3IGFA 1K1EA 4MW4A 5BW4A 1MGOA 5DHUA 3P9PA 1T2FA 4D3ZA 3HMQA 5JSYA 3JWIA 4MS1A 3QY9A 1CERA 2JI7A 2SBTA 2J9FA 1YFZA 3FWPA 4M9XA 3VZQA 5EHZA 5LPNA 3IHWA 4C0HA 4IIHA 4DUZI 2PPLA 4M60A 4WXHA 3ZM7A 4FFPA 5E7JA 3EIXA 4MMZB 2HMYB 1WKBA 2VT6A 1KS9A 3QFCA 4BZWA 2P41A 3UMMA 3M0EA 1I7NA 2PQ0A 4X66I 1Y4ZA 3C87A 3V1KA 2C7PA 4WH0A 2DT8A 2EATA 1G7SA 3AEKA 3TMKA 4H1TA 1WPQA 4WN9B 5DJ5A 1E1CB 4B2YA 3CUKA 1L5SA 3L0DA 3S4YA 3EUEA 1ZI6A 4UM9D 1SBZA 3RAJA 3KKKA 1JNYA 4C5AA 5JYEA 4BWVA 1W9HA 4NYIQ 1FXSA 1KVQA 5AWFC 1Z75A 1P4SA 2V7PA 5REQB 3U81A 1ZGAA 1KIAA 1W2GA 2W2XA 1PJQA 4GP9A 4ZEWA 3BB4A 3OIDA 4REQA 2VHVA 2GEJA 1WABA 1NW5A 2DTEA 3OLWA 5LLDA 4AW9A 1IQUA 3H9UA 5EWLA 4C6TA 1WP9A 4IZJA 4PBRA 4DBZA 3OOJA 5TF0A 2O1UA 1TUBA 3PS9A 2BE7A 2HM7A 4F4UA 1KK3A 3W77A 3IP6A 3WLEA 4WD3A 4C6SA 5ALEA 2B8NA 2BPOA 3LKBA 5F21A 3KQKA 1IB0A 1BHO1 1T9BA 3U40A 2C88A 2HMUA 4HMQA 1X7GA 121PA 2DWPA 4MULA 4DA8A 4KQVA 4PV7A 1PKPA 3GGSA 3K0BA 3K2BA 1K66A 4KVAA 4WOCA 1VXRA 3I73A 2Q3JA 3FH0A 4UUPA 4TT3D 4IKEA 2FE4A 4BGUA 3WP1B 5KQGA 2NN6B 1ISJA 4KHZA 1T36B 2BFFA 4NZZA 4FHEA 2GTIA 4IOJA 2WDPA 5MN4A 4RULA 5LD2C 2WP8B 2AK3A 3TK1A 2XEXA 4TTVA 2WU1A 5MDHA 4Q03A 4WCFB 1VE7A 2Q27A 5KOHB 2IC5A 2AZMA 4Q05A 1R18A 1ZXBA 4TV9B 3HA2A 3WMEA 4X8LA 5D7NA 2K2QB 4D5GA 2RI1A 4YV2A 3B3JA 3LPNA 1ENOA 2JLQA 1UDNA 4UFPA 3QUCA 4EHAA 1ZD2P 4QGGA 5ALSA 4E09A 2V5AA 1V11A 1L4EA 4JI0I 1JDVA 1N7GA 4D6YA 1F1BA 1U2SA 2A2ZA 3NRCA 3RC2A 1NJGA 3UICA 4UTOA 1RWKA 5MGBA 2QMYA 5BW5A 3C3AA 5U9CA 2DJIA 2VJAA 3ZGZA 3V8PA 1QHYA 2C8KA 2WJ4A 2Y71A 3B1VA 1JR3D 1E89A 3OM8A 4BV8A 4HYQA 5J1SB 3IVRA 1RBMA 1VLVA 1Z5GA 2VK1A 521PA 3SLGA 2FZ4A 3DMFA 5GAJA 1HF3A 1ULTA 1EINA 4DMUB 3E84A 3NAZA 2ILTA 2AB0A 3AM1A 4JODA 2LR0A 1VPLA 2V0CA 1U8FO 4N5LA 2FYTA 3RLFA 4B3SE 3V32A 2WIJA 3D54D 3T5BA 1RHKA 3A11A 5JY6A 2AC2A 3MHTA 4I1IA 2I55A 3HYTA 5DE3A 2IW3A 2J3HA 4L4YA 4MYUA 3IT1A 3FCUB 4DB4A 2JHAA 1TZ2A 1BA2A 1R10A 3JD0A 4R9RA 5E4FA 1S1CA 2W2NA 1K86A 4XVHA 3W7AA 3IE1A 1AKVA 1F6BA 1NQVA 4J0QA 4YXFA 1FJXA 1GQ2A 1JR3E 3BKXA 1FXUA 1SUIA 3EOAI 1XHLA 2ILVA 1QGOA 1AKWA 5HRAA 4MP8A 2XB9A 4L6AA 1L8QA 3G82C 1GLVA 1NVBA 4LE1A 3A06A 1HKUA 1KAEA 3VKWA 4D92A 4GPTA 1EUZA 1SHKA 4Q16A 1XQYA 3DTVB 1Z83A 1PDWA 3I39X 1DAIA 2AA3A 2IHVA 2GN9A 3CZ4A 4DNQA 5KYTA 4OGGA 2ENUA 5IXYA 3NBXX 5YASA 3W5BA 1GL7A 4M37A 3CLUC 1CRWG 4CQMB 3FY4A 1MTZA 1SXJD 2OLKA 2Z1MA 4DCNA 4DT1B 5HOQA 2Z95A 1VQ1A 3GFTA 1WXHA 3L7DA 1AVTA 2IHNA 1Y5MA 2D1TA 3SC3A 3GPDG 3MFQA 1HMPA 1YRBA 3T35A 3VAZA 3OFJA 2FZWA 4P35A 3K2IA 3I9NA 3EXFA 5IDVA 2VATA 4HHEA 3OICA 2C99A 2PX8A 4K3UA 2ZDQA 4GKAA 5AQ1A 1MAHA 1ZIXA 3G2JA 3HUEA 4AULA 3GD5A 1YVUA 1BOFA 3QU2A 4HN9A 1ZNWA 3EMKA 3NFRA 5FBKA 5CDYA 5EQFA 1JFSA 1FIUA 5KNBD 1TYZA 4R2XA 3RT7A 1XK7A 2DWUA 4YMHA 4ZCIA 1SOWA 4TLCA 4MKZA 1U0LA 3OJOA 4M9CA 5JQGF 1YJCA 4OO1A 4MWOA 5JZ9A 3VC2A 4LI0A 3VFDA 3I23A 2CF5A 3UB4A 4B85A 4FIDA 5IF9A 1SXJE 3MJHA 1KDOA 5FO1A 2GCEA 2MYNA 3L05A 3MIZA 4Y8VA 5IJ9B 3TW8A 5JCXA 1L7DA 4G09A 2V8BA 3CT4A 4QU5A 3UJBA 3N53A 5IYZB 4K2HA 1EH5A 1TF2A 1VZ2A 5F51A 3M6VA 3TPCA 1A04A 4K6CA 2XD4A 2I62A 1RAIA 4ZO9A 1TEVA 3R3ZA 1PFYA 4WKOA 2O05A 4Q02A 3MCTA 1MAUA 1A4XA 1I1HA 4QOHA 2BLLA 4RPLA 3L79A 5D3MA 4X45A 2W2OA 1DBVO 1V37A 1XVTA 1CRQA 2QX9A 5MHTA 5DASA 2CKMA 2NAPA 1YA4A 3TW6A 3WLOA 5L3QA 1KYYA 5IM5A 2ZUFA 3RUDA 4JY7A 4KQEA 3EVBA 1CKEA 1FQKA 2XA2A 3K0FB 1H8ED 4QFCA 1RHMA 1UM8A 1WTCA 2COKA 4X3OA 3B12A 3CVJA 3D6TB 1EHIA 4WXYB 3RKRA 2B36A 4LYGA 4RDIA 4FGLA 1P2SA 1JLLB 3MB8A 4BRWA 3DHNA 3UUGA 3FOZA 1JHAA 3O26A 4MVYA 2C5FA 2DR0A 2GT1A 3VNSA 5C1OA 3CEMA 1XLWA 2OM6A 3KKMA 4RWEA 2P9HA 5CXUA 1GKLA 1QHXA 3FDFA 3KVRA 4EPVA 4TKVA 1FF9A 4X1IA 1SVSA 1NI3A 4GSKA 3O8OA 2O48X 4DV5E 2WVJA 3ET5A 1VG9B 4JOQA 3UHAA 1KY2A 4S35A 3ZW9A 2YNMA 2ABWA 1W29A 1QIIA 2JBHA 3CNOA 1O94A 3A6EA 3OU6A 3QVJA 4MPTA 4NBWA 2ONZA 4LGVA 4UZFA 2AFIA 2EX1A 4B34A 4CI9A 2WAOA 2C3PA 2LDXA 4EOGA 5FI5A 3I6BA 4RTRA 1DIGA 3KHTA 3LX8A 5IASA 4B6JA 4LCJA 4P81A 5BT9A 4B5KA 4AECA 1KFJB 3AHGA 4UD6A 2Q21A 3FCAA 3OZXA 1QKKA 4FNMA 1LF0A 2HCRA 3GLRA 3B9QA 1YCDA 5I5EA 2NUBA 1GPUA 4L5YA 2VSNA 4XVUA 3GMEA 1LPSA 1VYTA 3CPHA 3E9CA 2ANBA 1GD1O 4M8IA 2P2ZA 4OXQA 3G5AA 2INGX 2D1QA 3IA2A 1C3OA 1V8DA 1MV8A 3WGNA 2WZQA 5ELWA 5C4MA 3F8SA 2YZ2A 3H4VA 1IN6A 3OEYA 1PJAA 4TUYA 3P9QA 3KD3A 3IS3A 5BR8I 1DC6A 1YH3A 1YZQA 2F3SA 3N59A 3EVGA 4H4DA 4X64I 3BB1A 4I8DA 1UZNA 2MR5A 5JLAA 3V1YA 2I2DA 4BMNA 3KSAC 4U4AA 2AH5A 1ONOA 1PCXA 4YLGA 3C5CA 3A05A 4U2GA 5LIRA 2P0EA 4A9AA 2XMRA 3OH8A 5AW1A 1QM5A 1PK8A 2COEA 1FJ2A 1ESDA 4NQZA 5F7XA 3KAQA 3GT4A 3SKYA 3DBRB 2ZKLA 1J24A 2HA3A 1KPHA 2GASA 2II6A 2PMDA 3B1WA 3LQYA 4Q4AB 2VBCA 4GMGA 1FUUA 1TC2A 5K0EA 4YT5A 4BMDA 1WQ4A 5CM9C 1CJVC 3W4IA 1NZDA 1FFBA 1O9HA 1WY5A 2NVUB 1XAGA 1QVZA 3LC0A 4LE2A 4C7XA 4FZ5A 1PD0A 1RXEA 5BN4B 3AYXB 1B0UA 4JA0A 1N7JA 1WKCA 1QC5B 1X6VA 4OKNA 3RB8A 4E03A 2OSVA 3ZDYB 1KR2A 2ZSKA 3VZDA 1OW3B 3I05A 1FW6A 1U28A 1GN8A 2FV8A 1Y9DA 3CIOA 3KQUA 1P7CA 4PCUA 5AJYA 4E51A 3GLKA 1A9RA 1RM0A 3IXMA 4QM6A 4DUPA 4DV2I 1R6VA 4KWCA 1SVUA 2ZPTX 1GRQA 4DCGA 3NHWA 4KAXA 4WADA 5KVVA 3OTOI 1E69A 2GPNA 3C41J 3OEED 4Y2SA 2Z1DA 3WIUA 4AF8A 3T9AA 4TYQA 2HCTA 4HVLA 3JTMA 3TIGA 1PW7A 3I6YA 4R9UC 2D1YA 3TSAA 3WLHA 1GTVA 2H2FA 4BXOB 2APJA 4MUIA 3TVYA 1NC3A 1GR1A 1XF9A 2AD5A 4QGBA 1XWIA 1M6VA 3QF7A 5B4UA 3NKVA 4QJIA 3T1TA 2H1OA 3RR2A 1RI3A 1RXUA 2OXEA 4GGPA 4QNMA 4ENRA 2VXBA 2CCGA 4CMIB 5KUTA 1N33B 1JR6A 4URFA 4BA2B 3CBQA 1PJBA 3G68A 3TZ6A 1YR1A 3ZJTA 5A2QC 3GA5A 3ND6A 3KLOA 3Q4GA 4US0R 5FO0A 3HGMA 2IK8A 3PR2B 5JUWA 1W94A 3M49A 1AA6A 1AGPA 3R4CA 4D3YA 5AJHA 5FWYB 5K2MA 2G9RA 4AMYA 4F60A 4F84A 2X2PA 3IP1A 3T1VA 1E3WB 3UJ8A 3H2ZA 3LHSA 1TO1E 4IUDS 4YJGB 2QJOA 3ZXSA 5L3ZA 4D8UA 4GQIA 4P7FA 3LZ6A 1G19A 2GYWA 4YHBA 2FWMX 2C61A 5DM2A 4G0VA 2PJZA 5TGTA 5EMJA 4B46A 2IXAA 4IXDA 5IT9C 2PKQP 2BD0A 4B3DA 4GXRA 4ZZ3A 2R62A 3KQNA 4RFSA 5BOSA 5C8XA 1BCSA 1OFVA 1YMUA 2GPTA 4N03A 5FUYA 3WLPA 1Y4SA 1JDBC 1OD6A 2J4CA 2NVOA 2WU0A 4B33A 2CV1A 1I3LA 2HBQA 1NFQA 4P08A 4CG0A 1G5QA 1XU9A 2PV7A 3MNFA 1N9GB 1XMQE 1NVMB 5EZYF 2CHEA 1FDUA 4R1SA 3OESA 3C14C 1TT5A 3A4TA 4HMOA 4LHVA 5TS3A 1C4XA 1TYBE 3T5PA 2AE1A 4RHFA 4B7ZA 3U9SA 2IPAB 3QLJA 3WL4A 1N5DA 3F7NA 1EP9A 3ECSA 2UUAI 1BXGA 4ZN6A 3GNQA 4N47A 2C2GA 1JTEA 1PR5A 3JALA 1J00A 3A9TA 1EDOA 4TL7A 1EGQA 2WABA 4NPHA 2MR6A 4A0QA 1RACA 1ZJ6A 1Q74A 4V0MA 3P5SA 2AQIA 4GF5A 3IUNA 2OXRA 4M8KA 3V3KA 2BGLA 2V0NA 3HUTA 4OOFA 1DJNA 2G25A 4AX4A 2R86A 5LP6B 1ZAYA 4E5MA 3ICPA 3PKZA 1J8YF 1GPLA 2B1RA 4R8MA 3RC1A 1E7YA 2ZRDA 3AB7A 3Q3VA 4GYWA 2BFCA 4Q39A 4LBZA 2HZBA 3JWGA 4G0MA 3W5JA 4PG5A 2OFXA 5AVZA 3WGOA 2R6JA 2VZ0A 3CBGA 3CNNA 3T15A 3ZQUA 4N0QA 3RARA 3K94A 2FOIA 3JW8A 2O2ZA 1HFEL 1YA8A 3QBJA 3SGLA 2I99A 2RONA 2Q3FA 2VHTA 4IRXA 1LSJA 3VKVA 2NU7A 1TF5A 2NLOA 3LYAA 3W9UA 3HXOA 3NGMA 4ML3A 5K6RA 3PDHA 4ZV7A 1K9SA 3LFUA 8AT1A 1FRVA 1KWGA 1OWLA 1PNVA 5DU2A 1U2TA 1NW8A 5H59A 1X80A 3QT6A 2CYAA 1YIOA 1OXKB 1CC1S 1VPEA 5B7PA 5CD9A 2ZIUB 4QL3A 4Q4HA 3TOVA 5JEAB 1Q1ZA 4M6WA 2QZ9A 3TTXA 3W8DA 1NUQA 2DBZA 2H3EA 2XDWA 3E61A 4MITA 2IYNA 4A3SA 4DSOA 4YCLA 3A6FA 4KXYA 2H4FA 4MR9A 3QKSA 4ILKA 4U8GA 3RASA 5JMOA 4IS9A 3KU4A 4QPDA 3QP9A 1EYZA 2Q5FA 4MUNA 5AK3A 5J9FA 4EA7A 1VSVA 2WNIA 4I1PA 2R6CA 1TTHA 3T1NA 5GMDA 1EWTA 1ZNZA 4BO5A 4C2UA 5ADHA 4M0CA 1ODIA 1NX6A 4U02A 3FNGA 4BNKA 2GCIA 4M9RA 4WUVA 1AKEA 3TCNA 2CLDX 1NKTA 2OQ2A 3BTUA 1P91A 3ISTA 4J0FA 3SHFA 1A8IA 4LF6B 4LFBE 2QZPA 3WS7A 5HGXA 4ECEA 2HY7A 1W19A 4YRIA 1DKOA 1HDEA 1T3GA 3TTWA 1AZLA 2B69A 2WB4A 3IPRA 3DEKA 4TTAA 1LLFA 1MRSA 3V2IA 3ZU3A 1I5RA 3E5HA 2WW4A 3MW8A 1J6UA 4U2BA 1XMOI 4R8RA 1P77A 4LWOA 4CDGA 4Q3OA 1GADO 2JZCA 3K7EA 2EFYA 2MMGA 2O3TA 4JJFA 2GD6A 4IF4A 4OYLA 5FL7A 2NXJA 4IDFA 2OXFA 2F9FA 4CQNA 4WXRA 2GLTA 1VPDA 2DHDA 4JI1B 4C9BA 1ABFA 2Q46A 5BVHB 3EDOA 3WSTA 3NUZA 2DWQA 3FDZB 4E33A 3DDCA 2ALJA 2NQTA 3QWAA 4JWKA 3UJAA 5KDDA 3C98A 1F1JA 3DB2A 4MDHA 821PA 3I8OA 4OL0A 1GGEA 2FWJA 1E0KA 2XITA 2JFNA 1QIDA 5KSPA 2P5UA 3M2TA 3AJ8A 1CEYA 3HN2A 4KDFA 1H4TA 2VHEA 4BNLA 2HBYA 2WTMA 4KYIB 3PHGA 1HL3A 5K51A 1ZW1A 3GCDA 4LJAA 3RE1A 5AHRA 1VMIA 2QRPA 3WLKX 4I3FA 2YYAA 2HQOA 4NL4H 1B14A 1EIZA 9LDBA 1WZCA 2ES4A 2KYRA 1DAPA 1CJCA 2W71A 4FHFA 3K1ZA 4HATA 4WVLA 3ZDEA 2O0MA 1VSTA 3I5MA 3OEHD 4GOOD 2ENWA 3MXTA 2BMFA 4J1TC 4TSFD 4WKCA 5E2IA 2AEFA 3GJYA 3JQFA 1KAQA 2IA5A 2ZDHA 2CVOA 2BFEB 3MCVA 4YA6A 2P78A 3L6DA 4RQBA 4DCVA 3ZXIA 4EZIA 5JAUA 4EATA 3NPMA 3DGEC 1Z5NA 1BE6A 1JPVA 4EPXA 3EEQA 2VDPB 4IGAA 4YB8A 1JQAA 3T7RA 3FPCA 3OHMA 3RYTC 5HZKA 3DO8A 1A27A 2B4KA 3ESRA 4PANA 3MINA 4HX5A 2J07A 3TFQA 3RVMA 5KYXB 2FSGA 2HK7A 4YMSA 2FPGB 2Q5EA 3NOQA 3TIIA 3AVQA 2NZUG 1NBAA 1B3RA 1QIHA 5AM0A 4R1PA 4RA6A 4C7OA 2XDYA 1Z0SA 3PQDA 1WXXA 5EP2A 1M67A 2P9GA 1KEEB 2KWIA 2OO7A 3FBWA 5EIBD 1AA9A 3RSZA 4JI3B 1R4MA 1WRBA 1LNSA 2J33A 2RBEA 3MWLA 4RUKA 5JRZA 2HUPA 4Q1AA 3L0YA 2OFWA 3LUCA 1GG8A 2QSYA 4WZBA 3T3PB 3K5WA 4ALLA 3LE8A 1P62B 3ODGA 3SDSA 1WETA 5JTUA 1TA0A 2E4ZA 1D04A 3V8QA 1KO5A 1QDUA 2DHQA 2Q5JA 2XWQA 4FEAA 4H27A 4Q6WA 5TT1A 3V7NA 4BL5A 4WBNF 5HJEA 3FOEC 3BRCA 1WBDA 4K0KE 5JXHA 4NRDA 4Q4JB 4HB2A 2EWMA 3M1YA 4Z1OA 2CDBA 3UCFA 4CKCB 4M9UA 3G0GA 4YAWA 2AF3C 4JGBA 4JU9A 2WLTA 4YRAA 4II2A 2YHUA 3ADKA 5C7YA 3NLLA 3Q12A 1XEAA 4R1QA 4Y1GA 4HXGA 4F04A 5DX0A 3B1FA 5A2GA 3OQVA 4J2HA 3FPFA 3UWKA 4BGVA 1N1GA 4PSAA 3DB1A 2Q29A 4A8JB 4YASA 3GOHA 4BNZA 4JDUA 2R8YA 2VAWA 4UU0A 1GUZA 5H9WA 1W6RA 1H4QA 4EZBA 2QU7A 4BQPA 3JAWA 4EG6A 2DFPA 3CW2A 4Q47A 1VB5A 3UUWA 2WJ3A 1T8YA 3BRQA 3E2IA 5BNZA 4LFCI 1O58A 1VSBA 1ZY2A 4HGYA 3V7YA 1FVXA 5LQSA 1B0PA 4M0PA 4LDQA 4XX0A 1U99A 3DHYA 1XUOA 4JLAA 1DEAA 2YMLA 3UK0A 3WGYA 2PX0A 4MI6A 4NZNA 3DBLB 4OEHA 5I5GA 3OY2A 2SCUB 3NUQA 3S5UA 3O3NB 4UM9B 4JXJA 4KGDA 1C0KA 1US8A 1VE6A 2O0LA 3AR6A 3LVRE 3WB0A 4EQZA 3LNTA 1J0CA 2V7BA 1JIIA 1JQJC 1C7RA 3Q0IA 4NCIA 3HS3A 4A0SA 1KMQA 3I64A 4XTJA 3SM3A 3AWIA 1XPRA 1P80A 3P27A 5GPBA 4N0MA 3FB1A 2A1UA 1E2FA 1LFAA 1ZNQO 2ZU0C 3IAM6 4KW7A 5ALTA 2OWEA 5H16A 1P61B 5AW7A 1GPH1 5KTNA 5AM3A 1GPAA 3QWBA 2C07A 3D2BA 3V7UA 3WIVA 2HQRA 1OF1A 1M2KA 4RDHA 2Q7OE 3EZXA 4FFRA 4Q93A 3DWIA 3RAEC 3EXHC 2J3EA 4YECA 1C41A 3IPXA 1HGXA 3DXFA 4NP6A 3LT2A 1RXYA 3UVEA 1B16A 4PICA 4GI3A 4X7MA 3V7WA 1R0CA 5I9SA 1F06A 1L7VC 3GBSA 3WTBA 4J29A 2YV5A 3OD1A 1RQPA 2HREA 4ZMSA 4TKUB 4BVBA 2PT9A 3SYRA 4Y6GB 3PLRA 3RS5A 2W2LA 1IN7A 2C3OA 4HLCA 4CMBA 3PNPA 2PR7A 2Z3ZA 1EXWA 3E8MA 1DT5A 2I6XA 5ALDA 3GIDA 5F76A 3FMOB 4Q9LA 4XCVA 1USUA 3JTEA 1CJKC 1JMVA 4B3SB 4MAFA 3JASB 3EF3A 1NHJA 1UR5A 4NAUA 5D85A 4LPKA 3U7HB 2B8WA 1UPAA 1JEJA 4HL6A 1SG0A 3GRRA 3BCRA 1H7SA 4H16A 1YDFA 3ERCA 4ZGGA 4EEZA 1L5HB 4CLXA 1FS5A 2C00A 5JFGA 4PZUA 4PR3A 1YB7A 1EGVB 2ZIZA 3C8MA 2M1XA 2V5UA 3EB9A 1V9SA 4KWEA 5B1SA 3W5AA 4QYIB 3O82A 3DFFA 2XCQA 3NP9A 1XALA 3EIEA 2GXAA 2WWRA 2FKNA 4FW4A 1XD2A 4DEYA 5ELLA 3ZDQA 1WF3A 4Q1CA 4KRXA 1OXSC 1QWOA 3AP1A 1J39A 4N3CA 2XD9A 2ZRLA 3AEXA 2VYCA 1M2JA 3PA8A 5KX5A 3P2OA 4PAMA 3AOEC 5CB0A 4NMHA 1M1NB 4RQAA 5DYTA 5C53B 1YB1A 1ZOPA 2CFRA 1M1YE 1SVLA 1UBEA 3JWJA 4X0EA 3JQAD 4H6XA 1VBNA 4ALNA 3GPCA 5A0TA 2PUHA 2XT6A 4JL5A 2O3ZA 2XPCA 2CXHA 1QGZA 1Q1EA 4UT4A 1CPYA 4JP1A 3LDHA 1RYYA 1N32E 3QPCA 4LW8A 4F6CA 5KTOA 4H7DA 3O4JA 5GZ1A 3KJQA 1XZPA 4TL6A 2WG1A 2XUDA 2XWBF 3CX8A 3QVVA 1XTUA 1ISFA 1MQAA 1Y1QA 4XQGA 3MJRA 3U4DA 2O8FB 4CFYA 1LXCA 4YVFA 3RODA 3NTRA 1R4AA 1U7DA 2WRZA 3ESDA 5ER6A 2GF0A 2H2WA 4OFBA 3MGBA 2QGNA 3K2EA 1L5FA 2Z5GA 2WJWA 3CPJB 4YRSA 5KYUB 2QT0A 1J1UA 3ZI4A 2G4VA 4KI0A 2QUKA 2X6RA 4WESB 4JBWA 4X3PA 1RMTA 5SZKB 4B9AA 1UK7A 1RCTE 2OK7A 1OV4A 3SX2A 3EGDA 2PLAA 2ARKA 4X1KB 2H92A 4PPYA 1SXJB 2EBWA 3ZNPA 2O5CA 1GQYA 2XNDD 3RSQA 5ALGA 4O5AA 3CGWA 2ZS7A 4OGFA 3COSA 1G2PA 1WQ3A 1ECGA 4NK5A 5B1IA 4I4LA 4ZI5A 3SF8A 1E2GA 3CLRC 4FB5A 3MOIA 2I78A 3OWOA 4ZVQA 1NQAO 2PAAA 1VJ0A 2VNJA 4JBNA 1MHPA 3MRTA 5BXYA 4KIWA 4FYHA 4NJOA 3W8RA 5JSUA 2XYRA 2PVPA 1KARA 4DR2E 2W48A 4C06A 4U8HA 3TSWA 5DNWA 4C29A 1P17A 5CNMA 1ZUNA 3L7KA 4QDTA 5FH9A 1GKIA 3EWAA 3TSYA 1FFAA 3CVOA 1NDHA 3CG4A 4PXYA 4UFNA 5F7ZA 3RBAA 4LFAE 3UK6A 4V1CB 1J0AA 3GPIA 4OJYA 3SXPA 4DWWA 1UK6A 4QECA 1IONA 1W93A 1M2VB 3M81A 4P4TA 1W5BA 2EDCA 3VTKA 1XN1A 2ZJFA 3UM9A 2C4TA 2VEDA 3UAGA 4J49A 3Q1KA 5LNK6 4URHA 4DV1I 1N6KA 1MDFA 2FN4A 4I55F 4LMAA 4NCXA 3FLMA 3L8DA 4Q7JB 4XTCS 2R6AA 4Y1RA 5FI3A 3N58A 4IZKA 2IBSA 4ZQCB 4W4TA 3NYRA 1WVIA 4A1OA 2G63A 2V3VA 1XDBA 2VIIA 5BWBA 5IT5A 2P0YA 1F8UA 4YR9A 2BMEA 1S2MA 5IUJC 4OBEA 2ZT8A 1VCMA 3B52X 3OPXA 5G02A 3VGPA 2O59A 1V7ZA 1Y9EA 3NBUA 4I9GA 5JSKA 2XOEA 1TXGA 1PVOA 4H7FA 2DKOA 3MBKA 1WSDA 1Z0UA 4DV5B 2P40A 1QUFA 5IJZA 1MW9X 2BGRA 2O6LA 3QVWA 1SRRA 4P83A 1ICIA 5TVGA 4B6FA 1CK4A 1HORA 3K0SA 1ZXLA 2Y93A 3C3JA 2PUDA 1ONSA 4H6PA 1CTQA 4WV3A 3KPWA 4HAWA 1NVVR 2GZMA 1G4UR 1YZVA 3IR6A 4KWTA 4NECA 1IHOA 3QXCA 4S3MA 3IQFA 2Y0PA 4ZCSA 1BWQA 2A0FA 3JQBC 1BCRA 4QLOA 1QHGA 2Q4OA 5A0VA 2OCXA 3AF3A 3K85A 1J0BA 2WWFA 4YJ2F 1QLHA 4LS3A 4D3SA 2BSXA 4PSVA 3S0JA 3G9XA 3IHLA 1PT6A 1XZQA 2ZVPX 3MGKA 3GRAA 1QSGA 2QUIA 4ND3A 5EZYB 1OU4A 4M2LA 1GTJ1 2WE7A 5BWCA 5I4BA 4YAUA 1WXWA 3PUIA 1SOAA 3JR7A 2QTMA 2EKZA 1T6BY 1GDHA 5IMSA 3FR7A 2D8AA 2WKQA 4GKJE 4PGFA 4JUAA 2NIPA 2IVFA 1JPNA 4YJFB 3M89A 4PYKA 2GPSA 4LC0A 2V6BA 1ZIOA 2B98A 1Q14A 1MC5A 3WJ2A 1QG4A 4AT1A 2FPXA 4B4KA 4QEDA 3NG1A 1I6KA 5KNDD 4ZARA 2RHGB 3RQSA 1GCUA 1JVSA 1R88A 3VISA 1T4BA 1Y3DE 4PYJA 3NQ41 2JEBA 2X0DA 4BLRA 3LP5A 5JYDA 2PMEA 1IAQA 3PEVA 2VDNB 1R0WA 2GYVA 4EDFA 4ESVA 3BA1A 2MIIA 3PX3A 3AJAA 1SXJC 2HU5A 2ZT6A 1NAHA 1VRVA 3X1KA 3SR3A 4RV4A 3K8YA 2IIPA 4RPJA 4ZVPA 2ONJA 5JVDF 2DB3A 1UMCB 4EF4A 4BMZA 2O7RA 4GLOA 3D0OA 4OXYA 1VFNA 3RIXA 4ZD6A 3ZQKA 4O08A 4BP8A 1PZEA 3RF6A 4RH1A 2YYYA 3AF1A 5DX1A 4DWOA 5BSFA 5K8LA 1EVQA 5CCBA 1OLSA 2O8DB 3H86A 4JJAA 2XJ4A 4AF6A 2AI3A 4KFRA 2UUBI 3A4NA 2P65A 2DSTA 5CX1A 1UXIA 5E2BA 1TJYA 2WQZA 1YU9A 3R20A 1GYPA 5AVVA 2E85A 4Y9SA 3ZE0B 2QG9A 2X1LA 2LZ0A 2O57A 2LP4Y 1E7WA 2ATIA 3QUTA 4GG1A 4LMBA 1U1GA 4XUGB 2OXIA 1ZL0A 2X4GA 2ISQA 2VXYA 4WXEA 1VBFA 5G0VA 4JQCA 3BJIC 4JLVA 2JFQA 2R11A 2HFJA 4DR6E 4TSRA 4ZDIA 2DERA 3DTYA 1QOZA 2XUKA 2HK6A 2TMYA 3E27A 3OC6A 3P7MA 3LBIA 4IZHA 2DLDA 1FEZA 4Q21A 4AUEA 2IHZA 2AR9A 2OAP1 5A71A 1F8XA 1VKOA 5I9MA 3NTLA 4KO8A 1XP5A 4P31A 5LP1A 2XB4A 4JHXA 3EMDA 3VV3A 3CLVA 3OIGA 1U1CA 1SRQA 3K0EA 4X00A 2B8JA 2V8PA 2V9PA 2YC2C 5JOQA 5LOVB 1TTPB 1TKRA 2XUAA 4QFMA 1N5KA 1E6CA 2NPOA 3DAFA 2HRRA 2GZDA 5BSMA 1TM3E 2W83A 3DBIA 4EYSA 1N2OA 3Q7EA 1U1DA 2V59A 4G0QA 4KR2A 1POXA 1UP7A 4IIGA 2ZSAA 4HDQB 4BFSA 4JLWA 2PXHA 3Q88A 4IXTA 3SQNA 3O2SB 4C4YA 2HFKA 3ZWYA 1FUEA 4A15A 1Z0EA 3AXSA 5AXCA 3BK7A 5C18A 4RGVA 4ZTZB 1QHHB 1G5PA 1MVOA 3QFSA 5JYBA 5FBLB 1QO0A 3LY7A 2VJDA 1XMQB 2HLDD 2F1DA 1N3LA 2DECA 2VJCA 3AF5A 3LUAA 3OA0A 4Q12A 1U6JA 2ZB7A 2FR8C 1HNWE 4IJVA 4MJ7A 4I50F 2BDEA 2VDWA 1SCUB 1KXJA 1E60A 3N87A 1OSNA 3NIBA 4MV5A 4DR1I 2O8CA 4CMEA 2FUNB 3ILSA 2FDCA 5HYVA 1G8YA 1Q3KA 2JASA 2VL7A 1D2AA 1GEEA 2DR3A 4B81A 1SD1A 2VO1A 2WPDA 2VSQA 1D4OA 1WO8A 3MJDA 2ECQA 2J87A 5ESXA 1FS6A 1LB1B 3DHVA 1KGSA 4QDKA 3L7IA 4MJXA 4MRNA 1FU7A 2QTHA 4KRYA 3DL0A 2C96A 1DQSA 2E4UA 1DZ3A 1NUPA 3HI4A 1J7JA 3CO5A 4IDPA 5HWSA 1E9CA 1K6XA 4DSNA 5AESA 3R40A 5CDFA 3WLIA 3V2UA 5A9SA 5KX5F 3FHJA 2IGBA 1L6RA 1W1UA 2XUZA 5CLLA 3D3KA 4FHCA 2I6UA 2C7BA 4AI6A 3SSOA 3BT7A 3AHJA 1UFVA 3QNWA 3WU3A 4MW7A 5FEMA 2RSLA 2YRXA 3TSOA 2F2TA 1Y4DE 3EWIA 4ZCLA 4BVFA 1LWOA 3ZD7A 5DNXA 5JNRA 1DCFA 4JA2A 5IWAE 1JB1A 1UBMS 1UKVY 2C3UA 2OORC 3QW2A 1OR8A 1KRHA 2XW6A 3C5EA 5C0XC 3F6EX 3U1VA 1DWUA 1NXWA 2YZNA 2N1MA 1FU8A 2ZYSA 3SYKA 4NJMA 2PD4A 3ZCSA 2ZRJA 3GFRA 4ZDJA 2DEUA 4JR0A 1ZXXA 2ZEJA 3A9UA 2D1FA 3GFOA 4MQBA 4EUKA 1NUTA 1A9PA 5CVCA 3KRNA 3AIIA 5A5GA 4B32A 4ZP1A 3KYCB 4EHKA 4IH4A 3DLBA 3ZY6A 3U4QA 1FFGA 1N57A 3W5DA 1M7BA 4XD7D 1E61A 2QEQA 4NOJA 1OXMA 2QQ0A 3W9YA 4P7JA 4ZMRA 5KYNA 3THWB 1K3UB 4L22A 4ESHA 1JECA 3OTGA 4EG7A 2ZVJA 1YRHA 4FMCF 3BCHA 2E18A 4WBNB 2OQIA 3VVLA 3T4UA 3C8ZA 2E3JA 4GGOA 4BGIA 2I9KA 2O50A 3D2CA 2NTYC 3OKCA 1QCCA 5AXAA 3IDSA 1AS0A 4LVOA 2RARA 3INNA 3M2PA 1UFQA 3HM9A 4PLGA 4LFBB 3IKLA 1IZZA 3KK0A 3IR5A 2HYIC 3V2GA 3ENWA 1TA9A 4FEGA 3J7TA 1QTRA 1J1ZA 5JH7F 3SM9A 2Y1FA 1M0EA 1FRQA 3TAUA 3B1KA 1Q6YA 4PX2A 2X42A 3TI7A 4DMLA 1WCXA 3LRXA 3WGQA 2CFCA 4C76A 3I8SA 1JB9A 5HUQA 3PQ7A 1CJUC 5LDGA 4NOMA 1G7TA 4EHHA 1P81A 4WFJA 3R9XA 3U44A 4BNMA 1E6LA 1TAQA 1YR6A 1U80A 3DOFA 2X76A 3IXQA 3KPVA 3IT2A 1XYVA 1Z74A 4B3TI 2GOYA 3VOSA 1Z0GA 2BR2A 3W3ZB 4OLBA 3IB6A 3GMDA 5LN1A 5L40A 4ZQBA 1H72C 2ODTX 4DCJA 5FIUA 1XEXB 3A6GA 3R0ZA 4D6XA 3C97A 4DDWA 4EY4A 5B7GA 4DCUA 3A1NA 5BT8A 2V7UA 3MIIA 1S4MA 4RSRA 3G2NA 4F7WA 3GN2A 2QLBA 1L2TA 3W2IA 4D8WA 2JEYA 1PTJC 3FSRA 1Y81A 3C2QA 2HC9A 2P6PA 3HKCB 3PNBA 1OI4A 2R6R1 1UBUS 2V7QA 4NF2A 2JH9A 3PL5A 4NE7A 2FW7A 5THKA 4X41A 4PIPA 1XZLA 3K17A 3R0QA 3E2PA 2V34A 5JNUA 1W8IA 3EDCA 3ZHBA 2C39B 4LF9I 2P0AA 3UJ9A 3ZHYA 1Z4JA 2HAEA 3OZEA 1UBJS 1ZWKA 2VWPA 4BO3A 2JIZA 2HKIA 2G0AA 3DEJA 3DKVA 4DDKA 4UMDA 1XRPA 1NJ5A 1G5FA 4YQYA 3R0XA 4C03A 2XTJA 4Z6KA 1KEKA 3HO1A 1PN3A 1NNLA 2CF6A 2HL6A 1IB6A 3NTOA 4RK4A 4REMA 2ACEA 4QSMA 2H4XA 1UQRA 2POCA 4RJLA 2HWXA 5CMLA 2WJJA 3ELWA 4OQ4A 2B0JA 3P19A 5CK4A 5ALUA 3TLCA 3ZBPA 4HRXA 4P80A 1CUUA 4CPDA 1NC1A 3HTXA 2WKWA 4KU4A 3Q7RA 1PJTA 4I4IA 4INAA 4U7HA 3WV5A 4PSDA 1IRIA 4PXAA 3WXMA 4XSVA 1SD2A 3KLNA 3ZWMA 4OLAA 5AI0A 5CM2Z 3R3XA 1PV4A 4I4TF 2Q2NA 3EGXA 4OJNA 3DAGA 2GM3A 3WC4A 1UL1X 4AP5A 2ZE8A 2HF2A 2WW8A 3BTOA 2OBFA 1GPMA 1NYLA 4YUWA 2BSAA 4EJFA 5L4LA 1R8YA 3TAXA 1V5EA 2BFAA 2FRDC 1Y8AA 1TCUA 1Y8QA 1ODSA 4KFCA 3HG7A 3WL6A 3F3YA 3TPFA 5JBNA 1NBMA 5FV7A 1J49A 2HYDA 1WOMA 4YRNA 1B8VA 1NBOA 1TMGE 4K0KB 1BIFA 1N4AA 4CM8B 1O97D 3KTFA 3QEAZ 1J20A 3GD7A 3H5LA 4PS0A 4ZODA 2DG2A 5ENZA 2KB0A 2FZKA 3RADC 1JEDA 1HX7A 3HVKA 1AXRA 1N0HA 2I6GA 4J3DA 3AVPA 4HNTA 2NVWA 3HKBB 3NHKA 2WFLA 3K3PA 2G88A 2WMOB 1DC3A 1VGVA 3F4BA 3NB0A 4L8FA 1D7OA 1MT3A 1KDVA 3PGJA 4DA0A 1LDGA 2RHRA 1TFUA 3NAGA 1P72A 4KN6A 3ZGVA 4DRXB 1U0RA 5AR1A 1KOJA 2FFQA 3FKJA 4JBGA 3WWYA 3EDRA 4HQLA 1R4NB 4MWTA 4U00A 2JI9A 1W88B 3F73A 4EG8A 3LK7A 1NT4A 1AV6A 4B4OA 2B5WA 3NBFA 2E82A 1S2OA 2VPYA 3B3FA 4RZQA 5EJAA 1H0HA 1JFVA 1OC2A 2DUMA 4LQ4A 2P35A 4C2AA 1PWXA 1MAWA 4ARAA 4JJ8A 3CUUA 4PPFA 3NVDA 2QIOA 4D96A 5KTMA 4RPHA 4BMSA 4IICA 3ESXA 1R4ZA 2QN6A 2WWWA 3OJXA 4HTFA 4R8LA 2L69A 2ZM6I 2FAXA 3MQFA 4RXMA 2P5TB 3N2GB 3RVOA 1GGJA 2WNRB 4UOQA 4H0NA 2FZGA 3H1CA 4N6OA 5CLQA 4PLHA 4RF5A 3FTPA 1P2GA 1VSQA 1L7MA 5KVQA 2XMGA 4TWBA 2QVXX 3G02A 1HSOA 3IURA 3DUFA 1EXVA 1QQAA 2ZJ0A 2PR2A 4MKIA 1D8TA 1F4VA 2XHZA 1MX1A 3N3AC 2H0RA 5JWHA 4EG3A 5ITZB 4DR4I 4ER6A 2PNZB 2OP1A 2WF9A 3L8GA 3T5GA 4UASA 5J2TA 3HNOA 4DILA 3IILA 4JLPA 4X65E 1NN3A 2CLLB 1SZCA 3SSAA 4LF8B 2FMKA 2XE8A 3OT1B 4KLRA 3U1TA 3V6MA 4EY7A 1JJ7A 4LVCA 3RKUA 3G9ZA 4YAGA 3FWZA 4L75A 4PLVA 4U1RA 1GEGA 5LM3A 3GH3A 3W1VA 4KVGA 3PC2A 4I55B 4TQ9A 4RK7A 4RFLA 2REQB 4FHGA 4D1YA 2KHZA 3FTFA 4G1EB 1N36E 1Z0DA 5FF9A 2ETVA 1Z2OX 2IP2A 3LCCA 1UM9B 1LBTA 5I7EA 1BWPA 3UXHA 1QOQB 3KEGA 1XXEA 2R8XA 2VQEI 1VYUA 3L6CA 1OYWA 1W1IA 1JIJA 4GYJA 4AX8A 4EB3A 2JARA 1OGIA 3PKJA 4HQ0A 2ZIEA 4OU4A 5TPWA 4XRGA 4OX9E 1XDGA 3TDKA 1X38A 4E31A 3TLAA 4IQ8A 1DZIA 1JEEA 4V0KA 3B8HA 1FDRA 1CY0A 2ZBKB 4BVEA 1LI7A 2D7CA 3QKIA 1RPJA 4EY6A 3L7ZB 1O08A 4UJ3A 3NZKA 1HSZA 3H9QA 4IX1A 3BIXA 3Q3EA 3N2ZB 4Q3KA 5IM4F 1Q1QA 2A78A 1CE8A 2BJVA 2BP7A 3GFGA 1AK1A 1UPFA 2TS1A 4JQOA 4K6HA 4L07A 4PZYA 3TB6A 4JI5I 3HY4A 3SQDA 4G0OA 5CGZA 5LCXA 4R40A 3ROTA 4YRDA 3JQ9A 4I6JA 1E92A 5K3FA 1Z5AA 1AB6A 1R0BA 2L18A 2R47A 4B9EA 4CKZA 4WECA 2VTVA 2XMPA 4YJ2B 5T4BA 4YROA 4YBRA 1B15A 3B36A 2GYUA 3TXYA 5B4VA 2ZSBA 1RIIA 1M1YB 3KJFA 5CIWA 3NVKI 2BEVA 4R8VA 1PDVA 2E5LI 3KELA 4RO0A 5C3MA 1ZOSA 4OHYA 2B1GA 1RZUA 1VJRA 2N75A 1N32B 4K26A 3QKUA 2W8ZA 1SY7A 1BHJA 4HEA6 4KMOA 5BV2P 2GPYA 3KQVA 2ATEA 2OCGA 1DJOA 2BFBB 1IJKA 2EEZA 2YQ4A 4KXNA 3S1SA 2C8JA 4KWIA 4WOKA 3OE7D 4JYMA 5ALKA 4HXYA 5IK2D 5KU1A 1PWEA 2H2GA 1T35A 2HLHA 2ID7A 2FDXA 5I7WA 4NV3A 1Z16A 2PFSA 2PGXA 1K08A 2HMSA 1FWKA 2J5XA 4LXIA 1SBIA 2OBMA 3A6KA 4RY2A 3RREA 3T5MA 4QHYA 4DHEA 5DEOA 3JQAB 3ZS9A 5TJHA 4P4SB 1TO2E 5JVDB 4DCTA 2JLRA 2FZ5A 5JR3A 3GJ4A 4PLCA 3QKWA 5BO5A 3FIJA 3QTLA 2O7NA 2E87A 1BMTA 1ZGBA 2ZRNA 1FSZA 1J2EA 1W5EA 2P79A 4W5RA 1UJ5A 3MQ4A 4KUEA 4ZJUA 3THYA 4DKXA 3R3VA 5H1YA 1F0YA 4K2AA 3N5KA 4F4HA 1D2GA 1JI3A 2Q0SA 4S12A 5BXQC 1N1EA 4YV7A 2QXTA 1I2DA 4RH0A 4DR2B 3BB3A 3ENVA 3WO1A 4X54A 2YHIB 5P21A 3AM3A 4P2BA 1CVIA 1TKBA 2V7WA 2WNSA 4JBHA 1R00A 3PNLA 4LFAB 4YP6A 3OQJA 2PSJA 4KP7A 3QOXA 2C9ZA 1GA6A 1A50B 3AUXA 3RSOA 4G0NA 3HQ4O 1YU6A 3HYRA 1QVVA 2AXQA 3QMWA 5F2NA 5GVRA 2HWUA 1I80A 2H7YA 3IAS1 1O7JA 3NJ4A 3O8BA 2M32A 5KVAA 3CURA 3RTGA 1GZVA 1HBJA 3Q3GE 1U6IA 1NVFA 1KIJA 1SUDA 1AHPA 4KE6A 3FPAA 3PFIA 5C4GB 5IDYA 4JI7I 3ST7A 1ZUD1 3R7AA 2HHHI 3CKYA 2WYIA 3WGMA 4BJ1A 2QRNA 1N0UA 3OUTA 5C46F 1S4QA 5D3QA 3G8BA 4N0DA 1DOZA 4ZT2A 4WASA 1CEXA 4LJ8A 5GONA 1E20A 4BZPA 4E5PA 5IAEA 4GS5A 3D6UA 4XPIB 4GGMX 5I7VA 2YV1A 1C4OA 4CI0B 4QASA 2VC2B 1A2QA 3L1HA 4LHWA 2AI2A 4BLQA 1VE1A 2FGKA 4HEQA 2P68A 1R5OA 2W0MA 1W85B 2RGBA 4MYCA 5HFJA 4EKNB 4YCNA 3P9CA 4IXNA 4A10A 2Z6AA 1ECPA 4Q7LA 3ABIA 2MINB 4Y9UA 3J81C 4PRXA 4PLWA 4DWJA 4B17A 3VPSA 2XOXA 3C8UA 2FK8A 2IY9A 3LNUA 4D45A 3DL4A 4RV5A 4DLZA 1NHIA 3SBDA 5IS2A 1HLFA 1H05A 5EKWA 2R85A 1I30A 3PG5A 2Y0CA 4U0JA 4LHSA 1E1QD 5DRQA 3AHEA 4YDHB 4I50B 4AVYA 4CR8A 4K9PA 3A28A 3RUPA 3COZA 1PKEA 1X7YA 2IRWA 2XYHA 2PVCA 3LIIA 1OPXA 3MERA 1L9XA 1NXOA 1T6XA 1LGYA 2GYYA 3QXJA 4RIHA 4AS3A 3GGCA 4GVLA 3BULA 5F78A 5BYKA 4KACA 7REQA 3HKEA 4GEKA 2PL9A 4F72A 1DC8A 2R79A 2ROQA 1WXDA 3QKRA 1EZ4A 3IPAA 2BBWA 3DMTA 2Q6OA 3RBXA 4CT5A 1OB5A 5CJJA 1GQOA 1EP1B 1I1NA 2CCKA 5KVCA 2RKOA 5GTDA 4Z4GA 1V8FA 3THXB 5HIJA 2F48A 4RY0A 4ZRMA 2DPGA 5KX5B 4ZQHA 2ODAA 1SU8A 4W5OA 1ST3A 1LTKA 1EFPB 2FSSA 3PEFA 2PUVA 4M1MA 5JW6A 3JAMA 3BE6A 4YACA 4AIMA 3D4OA 1UJ6A 5C0OE 4DC1A 2JIOA 4E88A 3EXEB 2J5RA 5KPJA 2PUWA 3OFKA 5FTJA 4JI8E 4HQRA 4N8DA 1RM4A 1YR8A 2QTFA 1ADBA 2MYPA 3BD8A 3G2IA 5ALIA 2H06A 3RK1A 3DDHA 3CZCA 2IYSA 5FLYA 3T1HB 3JQGA 1A9XB 1OX4B 2XE7A 1VE5A 4H3VA 1JT2A 4MU1A 2WUWE 3D7KA 4A0GA 2WKSA 3PXXA 1B8OA 1XA4A 2AYXA 4FZRA 1DLIA 2VQ3A 4N5MA 4NDZA 4NZMA 1IE3A 4M98A 3LYHA 1ML4A 2FUG6 2VP4A 2EYUA 3K6JA 2PZ8A 4HNAB 1FDWA 1OIVA 2WE8A 3TNLA 4FYJA 3QEMB 4ZOBA 1PBTA 1Z34A 2GWHA 4M1OA 4EKYA 4DR6B 4EYKA 5D6NA 1ZWLA 3R23A 5T6BA 3PJEA 1A5BB 1LFDB 5JJLA 2UVDA 3BC1A 1XMQI 4FMCB 3KHUA 4A2WA 2XUFA 5GZ3A 1PFGA 3ZHVA 4XIIA 4LHYA 2EZ9A 3BFJA 3GLFA 2QNRA 2WAYA 6AT1A 1P1HA 1QH1A 3O7WA 1TLLA 1JHYA 1BRTA 3F67A 2RKBA 1U4SA 1UP4A 3HP7A 3KT8A 3QBVA 4PGHA 1MABB 4TWIA 1PLJA 5JH7B 1YOVA 2PH1A 5AI5A 1XMSA 2OM2A 2WVAA 4HNSA 2BEWA 4WEOA 3DOHA 1G2IA 1NU6A 4BNFA