1USVA

The structure of the complex between aha1 and hsp90
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
255
structure length
251
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
total genus 73
structure length 251
sequence length 255
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1usvA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usvA02
5FWKA 2IOPA 2O1TA 1Y4SA 2CG9A 2O1VA 3PRYA 1USVA 1USUA 2O1UA 1Y4UA 1HK7A 2IOQA 2GQ0A 2CGEA 3HJCA 3Q6MA 1Y6ZA 3Q6NA 2O1WA
chains in the Genus database with same CATH superfamily
4BNMA 1JNXX 1YR3A 4KFTA 4U00A 2OK7A 3KLOA 2X8BA 1FYEA 2VNJA 1I3MA 3AUKA 5IYZA 3G23A 3B9QA 3VOBA 4N7JA 3UMYA 4RHXA 4F9EA 1F3OA 2FFAA 3PGLA 3ZEIA 4EA6A 4EBBA 1Q91A 3AM3A 3DULA 5C8YF 2LPMA 3WA7A 4XEHA 4NECA 1U4SA 2O8BA 4KQHA 2NQ2C 2Z5CA 2AQIA 3T95A 3NDPA 1V95A 2XDYA 3KKPA 4DSAA 3F7NA 4G09A 1JU3A 2EGUA 4E1VA 1HLFA 2JARA 1GU0A 1H0KA 5ARCA 3AEQA 4XD7A 3R8FA 3F2VA 3VC1A 5KYKA 3VR6D 1WP9A 2IELA 2QU7A 2OBFA 3S5JA 1DXYA 1P2BA 4DQXA 2HMAA 1FJHA 4ZXFA 5B12A 2DQSA 3PDUA 1MQ8B 4AJIA 4DJTA 1X8XA 2C5AA 2OKGA 5KTTA 2ES4A 2KPOA 4R05A 1ZIXA 3AEZA 3OE1A 4B0PA 1OROA 2JLQA 4MUEA 4A8JA 4DG9A 1P91A 1SVMA 3FPHA 3ZYZA 5JDCC 4QAJA 2FWAA 3O7MA 1A4IA 4N6OA 5F7ZA 1NX9A 3KTDA 2GXUA 3BRWA 2VDVE 1KJYA 4Q9IA 2HXYA 2X4IA 4FYIA 4RGVA 1M1YE 3B6MA 3QKSB 1B00A 3MRXA 2RHLA 1TJNA 3ZY5A 1JG7A 2HU5A 2JFVA 2RGXA 1ZNYA 3OJCA 4L5IA 1ZD2P 2YS6A 3FGPA 5EWLA 4IIJA 3T4PA 2GTHA 4EDFA 1TKCA 1Y1RA 3PQEA 3TE7A 3N8HA 4DR1B 2PMWB 4HDNB 5EYPB 3GZTB 3MJFA 1QP7A 3KT8A 4RDXA 2IYRA 1EUYA 4JLAA 1QX4A 3E4CA 5C0XF 4RTSA 4KK3A 1Y5LA 2XLCA 1VA5A 1I2ZA 2C77A 2R3VA 4IO0A 4MIEA 2JFXA 1QGDA 4DR6B 4FUTA 2P35A 1A1VA 3DXXA 2RGAA 1C4XA 1P5HA 2NZ8A 4G4IA 4PZZA 1KI6A 4RH1A 1OYPA 1DMSA 1HURA 3BH7A 5EHQA 4IQGA 5LB2A 3TL3A 4DR7B 1EWYA 5LUBA 2VZ0A 3I3SR 2BZSA 3AFGA 4M9QA 5BQ3A 1PT8A 2WJGA 1IB0A 3SR0A 3NWPA 1MD9A 1MG0A 2QX9A 3ABIA 4GP9A 5JBNA 5KNDH 4I3FA 1UPFA 3GBSA 2UU9E 4JLPA 2ADMA 3Q8XB 2EZTA 3PPVA 3SIRA 1DFIA 1I80A 2CC2A 1YQXA 2BMEA 2GK7A 2ZUUA 3DHYA 2EFHB 3DT9A 5AKGA 3UO8B 5IHXA 3THYA 4ETNA 3BC1A 4E31A 2JLAA 1HUQA 3B89A 3CG0A 3IQHX 2JFYA 4HB4A 4WBSA 1KMMA 1ENOA 1W87A 2C92A 2O6HA 1OHHD 1J8MF 3K6KA 4KWCA 2XI4A 3VZQA 5IC4A 1SC9A 1N33B 4L6CA 1Y42X 3OO1A 3D1VA 3UGQA 2HV9A 3PD0A 3R0JA 4LF6E 1E18A 3FNHA 3N0VA 4ZQIA 5A3VA 2Q4BA 3W9UA 3L7NA 3IUJA 3NM4A 1VZ3A 1XD2B 2O50A 3HUFA 4PRZA 1RLMA 1VL6A 2NO7A 1A9XB 4BJ6A 2Z5CB 2DHQA 3UJAA 3FOWA 1X19A 4DV5B 2TMGA 1V0JA 3OUZA 4F91B 2DCUA 3QVVA 3AOEA 2NTYC 1HNWB 2XODA 3D8RA 5EIBD 3RC9A 1LSUA 3HDGA 5KSOA 4LI3X 4OI2A 2BFBA 2NUBA 5DTJA 4P8RA 2DPLA 2H7XA 2BKLA 1Z33A 2EBWA 3KTFA 4H1VA 2F3PA 3AJ8A 4LXTA 521PA 1PWZA 4BCCA 3HJFA 3PA8A 3R9IA 2UYGA 2P30A 3DMPA 4QXQA 4YB8A 3EVNA 5JO0A 4JJKA 2GZ1A 3K31A 3NLLA 3AESA 2NZUG 3TLEA 4XRGA 4R41A 2PNZB 3PI7A 4LDZA 2FHSA 2FZWA 4LYEA 4M1MA 3DZ8A 3BAFA 1D4OA 1TKRA 4GPBA 3HP4A 3ZOKA 2J6HA 1KDPA 4NSNA 3DD6A 2VSNA 3K0KA 2YWBA 4MTLA 4UXHA 1I4OA 3ZZUA 1EWRA 2J33A 3U80A 1YVDA 4JC5A 3IP8A 4MCHA 4H15A 4AM8A 5M7EA 1DFGA 1EUCA 4MKXA 5ED4A 2X8JA 4DPUA 3PC2A 4UDNA 8ATCA 5ECYA 2FQYA 1WVGA 2FMUA 3JALB 3ZV6A 2PPLA 5AD1A 5EZQA 3E2MA 4TWAA 5FCDA 3GDOA 1ZN8A 2AE8A 2WP8B 3ZJ5A 5C5DA 4KLRA 3GJQA 2A2ZA 2HN9A 3GMSA 2AW3A 4N7BA 2J4DA 3SYMA 1CS4C 3IESA 5KTPA 3IDQA 3B6IA 4MP3A 1THZA 4QHTA 4X91A 4MDFA 3ND6A 3ZOZA 3FGOA 1WD7A 5AIBA 4AZ3A 5HIIA 4ZZ3A 2GTPA 4ZYXA 2H8KA 3DNMA 2DHEA 3TQSA 4B2PA 4BLVA 2MDTA 3GN1A 4RLFA 5EP2A 5J59A 2HJHA 4IY1A 4AJLA 1Q95A 5AOCA 3KAQA 1VMAA 1K5GA 4DLRA 4Y2RA 1CJMA 4TPKA 4IH9A 3LBFA 2VHQA 3KQHA 2PWPA 4KRGA 1VE1A 1ZI6A 4HZGA 2B1RA 3AYXB 2WFLB 2WSLA 2I6TA 3C1AA 4DWWA 2N1MA 5CDTA 4R9NA 3W1WA 1C7RA 2GYWA 2WIGA 4FEGA 4TLMB 3S6JA 3HR7A 4TKUB 4ZO9A 3L0SA 1W96A 3EUFA 2HMVA 1DCFA 5B55A 3LUHA 2CLCX 2Z98A 4GKAA 4RQAA 4RD2A 3R6DA 2OD7A 1D9XA 4KX3A 2JJ1A 4UUMA 2FF5A 4TS9A 4A8JC 1DXQA 3ZC3A 3P9RA 2I76A 3QG5A 4MR9A 5KVCA 1V6SA 3AILA 3FGNA 1FP4B 3DUFA 1DIRA 3W6OA 2NO6A 5JD5A 3CDIA 1XJ5A 3MJTA 4RFSB 5I4KA 3QI7A 3T3EA 2XF2A 1J0AA 4Q3OA 3OTOE 1NW7A 4P3XA 1LPMA 1LSOA 5CX4A 1U7WA 5U1PA 4XCQA 1E0KA 4HTFA 4WK2B 3RT9A 4Y6SA 1CCWA 2Y6VA 2MSWA 2NSJA 2QYOA 1VG8A 2CXPA 4AQYE 1B6RA 1YIDA 2QRVB 2PNMA 5C8DA 4EG3A 4D1YA 2D6FA 1WBDA 4MRAA 2FRDC 3E61A 5AUOB 5IYZF 1JEJA 4XB2A 1XFAA 5A2QC 2AXPA 1CLUA 4IQ8A 2B7CA 4YJ2F 3W1EA 4MA0A 4RSMA 3E2IA 5KNCA 4CQNA 1MAVA 2WF8A 1P33A 5AKLA 3FLBA 2ORWA 2XCOA 1RXEA 3UMJA 4PBRA 4BIIA 3B8HA 1FVOA 1GD1O 2PJUA 2V7WA 3BDAA 1R0LA 4ZOAA 4JIMA 1GTL1 1KIFA 1I9CA 3TUIC 4WUCA 2ECOA 4PAGA 2DOKA 3GRFA 1E4VA 3KPWA 1L9KA 2PUWA 5K8VA 2GBPA 1UFOA 2JLWA 2B0CA 4ZQGA 3TFQA 4PQEA 3SLKA 1R00A 1N2CB 2HBQA 3C8DA 3WJ1A 2HRDA 2V7BA 3OJOA 4G5GA 2GFQA 1OYRA 3EUWA 4K6KA 1X7WB 1Z82A 5CLHA 3V7WA 4OQFA 4B45A 3COPA 4IP0A 3FCOA 1HNNA 4HO1X 1JSCA 2XHZA 2QRLA 1FLDA 3ODGA 1B8UA 1ZD9A 4HFNA 1TTPB 2R2GA 5DK6A 2XBUA 5KTKA 4JT9A 3K1ZA 2R68A 2I6XA 3OPMA 1L1EA 5ER9A 4KMRA 1NLYA 2OCGA 2B4KA 2ON6A 4CKWA 3MWEA 2UUCE 1DHTA 1R9NA 2DBZA 3RPEA 2OKCA 4IKEA 1MABB 4BQSA 4YASA 2JLUA 1WDLA 2J08A 4LF5B 4POOA 3PPXA 2COEA 4XTRA 1KYTA 5CBPB 2GAAA 1YVEI 5FXMA 1OYVA 3FTEA 1P2GA 2QL7A 3SJAA 2CHUA 3F6RA 1DWPA 3B9PA 1G6KA 1DKPA 2EJWA 2QTWB 1FSSA 3AB3A 3DB1A 3OOYA 1JKFA 4I2VA 4Q4HA 4FKBA 1PVOA 3DPUA 2CVPA 2EX1A 2QJRA 3HN6A 1FVXA 2QTRA 2R62A 2PQ2A 4PGFA 3TPCA 4V1CI 2WINI 2ZRKA 1FUKA 5T6BA 3OZCA 3E8MA 5J40A 2BSQA 3GZ4A 1G3QA 2OOKA 2B21A 5JCPA 3EIEA 5IWAI 1TVKB 1UQTA 2J8ZA 2LZ0A 2O3UA 3P2MA 3PFIA 4EMSA 4AY3A 4B3JA 2CYBA 3DOJA 2PCLA 1IHXA 1OHHA 2QVYX 2PZ8A 5A9TA 2VRCD 2C2KA 3PXAA 5KNBD 1UT6A 2XTZA 1FP4A 2A9RA 1ZVVA 4GBED 4R8VA 1KOLA 1J56A 4KFRA 5LFAA 1P9WA 4PW0A 3ITDA 2JRLA 3B6JA 1SXJB 1RWWA 2BGTA 2GK4A 4D3FA 4D6PA 2OYSA 1IU9A 1NR5A 3PHGA 2WE8A 4LJKA 3EWSA 2N47A 2XRMA 3N39C 4JEUA 2JASA 3GROA 3LLUA 5I9TA 5EIXA 4ZT6A 1DJMA 5CLIA 1NJSA 3LT5A 2C31A 3O8LA 2IZ1A 4IO1A 4Q3BA 4EA8A 2X5XA 3HN7A 3BF7A 3PUIA 4G5XA 4WD3A 5JLJA 4DUGA 3K0SA 2ZU6A 4KP7A 2AS0A 1ZVQA 2CEKA 4P86A 5SYAA 2GM5A 5G4LA 2P4QA 1FB5A 1T8PA 2XQVA 4J91A 4KVFA 3MCZA 4Z7NB 3JCZA 3A4YA 1AXRA 2JF0A 1JJVA 3E7DA 5JUWA 1AKRA 3U1KA 3P0JA 1KEZA 1QV9A 1PS8A 1CQJB 3QE2A 4KGZA 5DEOA 5HMMA 5C32A 4O02B 3G17A 2G0TA 3FUWA 4PIPA 5ALZA 1CVIA 2BP7B 2J46A 1JWLA 1RHQA 3LPSA 4ZXPA 4C06A 5KZMB 5DLYA 4GVPA 2WVJA 4XVUA 5BWCA 2I1WA 4ZOCA 3DBOB 1D2HA 2P67A 2H07A 1JWBB 3C3EA 1BDHA 2JGRA 1MJ5A 4E5YA 5KJCA 4M89A 3H17A 4PC1A 3TWOA 1A27A 1HYGA 1P6QA 3MELA 3ZJYA 2FX2A 3WI7A 1ZMXA 4HB2A 4WZAA 4P7JA 1BH6A 2E49A 2XT6A 2IBTA 3AI2A 3CEMA 4YCMA 4Y2TA 1C7QA 1LK5A 4DMGA 4OJQA 1KYWA 1Y4AE 1SG0A 3IXQA 3USZA 4XYMA 3KSAC 1IZYA 3E23A 1EVKA 3MTAA 1WOYA 4H4EA 3BGIA 3MTDA 4OHOA 4JKOA 1F2VA 2EKDA 2YIMA 3OPNA 3VKGA 4C22A 4B81A 4ESVA 1NBMA 2D5AA 2IDZA 3LL4A 7REQA 3WDLA 3GDGA 5LKAA 2XZOA 4OO1D 1E58A 1XK7A 4BMVA 1UAGA 5H3LA 1UUFA 4DYDA 5KNBA 4IL5A 4QJ4A 4QOJA 4C0HA 4C6TA 1EUDA 1NX6A 5H82A 1T26A 1E9DA 3VMMA 2UXDB 3RROA 1A5AB 2GARA 1OREA 2PJZA 1QC5B 3W3AH 3ESYA 4AS1A 2A5LA 2L19A 5J9FA 3KS9A 1SGWA 5DPMA 4NH4A 2OHFA 2QT1A 5T6MA 4DN6A 1P1HA 1IPFA 2ZJ7A 1V41E 2NUAA 2FPRA 3OLQA 4UHCA 3VHRA 4F5EA 1IOLA 3HVKA 2DWCA 2IGBA 2QMEA 3GLVA 3PNYA 3BREA 4GRDA 3AM1A 3FSGD 4QYIA 3H1PA 2NYVA 2XA9A 4PYLA 4C7OB 2IP2A 1HR0B 1F6BA 4TZTA 1SR8A 2HUNA 1POXA 1MO5A 4JOCA 5J5VA 2ZUWA 2GBLC 3RV4A 4MWCA 4PHGA 1MB0A 4BZWA 1CUIA 2WZCA 1YKSA 3S7TA 1K2WA 1F1BA 4RGBA 3EVAA 2XVMA 3CRW1 1BFDA 4G97A 5BSRA 5JNVA 4KPUB 1ZA1A 3V8PA 4CM8A 2G76A 1O9BA 1X15A 2IIBA 1WQ4A 4MULA 2UXBI 3HYLA 3R7NA 3BGVA 4EYOA 5BYJA 1EAMA 3BS4A 1ABEA 1LVUA 2I78A 1S89A 1KEVA 2KI5A 4KW7A 3KJZA 4G25A 4NU8X 3ZIAD 4G9BA 3CRNA 4Y98A 3TZKA 4DLWA 1EM8B 3GEIA 2XMDA 1SKMA 4PRLA 5THXA 1PAUA 1YOBA 5DSZA 4EWLA 3U19A 3WOVA 1PW5A 2HPVA 3NX4A 5BVGA 1ULUA 3G89A 4TSRA 1Z9BA 3UPUA 1YOVB 4CF5A 4X1IA 2RGBA 1KBZA 1ISIA 1JF8A 4FDUA 3MBKA 3L7CA 1N6NA 5KMGA 1ZXMA 1O6ZA 2ZEJA 1FUIA 3OMLA 3BMOA 2EQAA 1ZX1A 3LXRA 2JI4A 1KZ4A 1N5KA 2Q5LA 4ZO6A 1U0FA 4BB5A 4CF6A 3EQ8A 3T0IA 3IV7A 1SCIA 3PNLA 4OMCA 1X80A 2DHCA 2XNKA 2GBCA 2HIMA 1QIMA 2VP0A 3LO5A 1HNWE 5ALUA 3TSOA 2C9OA 3P32A 4YONB 3VDNB 4BO0A 4FFLA 5KYTA 5ES4B 4EUSA 1UEJA 2WAXA 2FW8A 1AS2A 2CDCA 3LX5A 4ID3A 2C9BA 4A0QA 2DUWA 1CETA 1CIVA 3K9LA 3REQB 2HA3A 2GEBA 1Y6GA 3CS3A 4DLNA 2OWEA 1NVKA 3DL2A 4JITA 2A0UA 1D6JA 1HZZC 3T3DA 5A9SB 1VE5A 5SZHB 3PQ4A 1MPXA 4S12A 2GX6A 4PTLA 3WMRA 1FX0A 1ZISA 2WA1A 2H2DA 2V74B 2R96A 1HG1A 3OURA 1TJ3A 1V4NA 2I55A 3PQ3A 5AHXA 3QT8A 3DUWA 1OT3A 5EUBA 4OOFA 2BFDB 3SM9A 3ETNA 3UWDA 5MN5A 4PO3X 2OZLB 3SLRA 1F5SA 1PSDA 3C4VA 1HY3A 3ADBA 2PO7A 3F3YA 4NPCA 1VLVA 4IIUA 2BP7A 1FWKA 3E9DA 2QDKA 3GLUA 2CLMB 3KPVA 4HLNA 5H80A 4BE9A 4ZYWA 4FR5A 1PJTA 5EHNA 4GOND 1AZTA 1G18A 3TXAA 1NMEA 1QH8A 1TK2A 3NYIA 3I61A 1OTHA 1VJ5A 2QA5A 3UJNA 1TYCA 4FYVA 3R8CA 1DUSA 1XNGA 2H9IA 1G5IA 4YP0A 1VLHA 1I5EA 4LXGA 4OCZA 2D2XA 3IKLA 5JE8A 2K2WA 4WNIA 2YFQA 5E9WA 4C3OB 3OG9A 1KL7A 5AIAA 8OHMA 2PMFA 1XEFA 1WMBA 2FPIB 5PGMA 2FPGA 3QUSA 2EVWX 3GFQA 4TMWA 1OIVA 2B69A 1WOMA 4UHEA 1J2RA 1EK6A 2FFRA 3UPDA 3VNAA 2VKTA 1TU3A 3RIHA 2AE1A 2PKQP 2VHTA 4BS9A 1NZ0A 3K70C 4BVFA 1ATZA 4H0NA 1GLNA 4NJEB 4UNIA 3G1UA 4YUYA 4OO1E 4ZAZA 2N75A 2R1TB 5F64A 1U7XA 1U3UA 2OV2A 4XARA 4DF3A 3WP0A 1T8YA 3DWEX 1OLOA 5K3BA 3TJZA 3P96A 1KJ9A 1VYHA 5AW3A 1HEYA 5BSTA 4QC2A 3V46A 4GM0A 4JKIA 1JDTA 2X7XA 4JI5E 4ZI2A 4EKYA 4FE7A 3QFTA 4XIYA 1CUSA 5E7IA 4DV4I 5B64A 4HDNA 4BV8A 3HQ4O 3MRTA 3V5RA 2G09A 2PS0A 5F7XA 1K4YA 2FYTA 4W5NA 4CTOA 5G0TA 4OKNA 1JT9A 1OXMA 3T34A 4E08A 1IZ8A 1MW9X 1G2OA 2Y99A 3WBBA 2WJHA 4Z8YA 1U2ZA 2V3VA 4X90A 3L49A 3PQ5A 1P6XA 1KEPA 4J0IA 7AT1A 1Y6JA 3S70A 4PHFA 4JYAE 3HBFA 1EINA 4RXMA 1C0PA 1U7ZA 3LECA 1EBFA 4JAVC 4L6IA 2HUPA 4JQOA 3LKBA 5IAGA 3F71A 4G5SA 4TKMA 5DM1A 4URVR 4LRWA 4LE0A 3M4YA 1XJQA 3QKRA 4GVLA 4RORA 3ZX5A 2I71A 2E89A 2ARKA 1EZ1A 4IJVA 1HKUA 2MSNA 4UZEA 3EZ9A 3ZJTA 3MBOA 1E1NA 3FFTA 1FXUA 2HX1A 3PFWO 1GHTA 2X1HA 1VHJA 2WSBA 3FCSB 4DCNA 3EPJA 1U0TA 1VBKA 3HDJA 4M21A 4MRPA 2BEVB 2AR0A 1XHEA 2HBRA 1VIVA 3RIMA 1FJXA 5CEFA 1S5PA 1EP3B 1YE5A 5JRZA 5IANA 3GPCA 3UT5B 5F4ZA 5KX5F 1ORWA 4HUTA 1X7WA 2AKAB 4BYMA 3DOUA 4IZJD 2ZIVB 2QQ0A 4JS0A 3BJEA 1TIKA 1OWPA 3PXXA 4NHOA 4XOIA 3B9RA 4DA0A 4DIOA 3ZWNA 1Z2EA 1DZIA 4D9FA 3PGA1 1WTCA 1XEXB 4UNPA 4Y1GA 4YMLA 5DRRA 2W6OA 3DDHA 4O63O 3DL7A 1RFGE 4B7UA 5PNTA 1TYBE 3CBGA 4UOEA 1EJ6A 1XTKA 1RKXA 2E4ZA 3KRNA 4AAYA 1H4QA 2IV3A 4NENA 1YJAA 1H94A 4V0OA 4Z0PA 2W2LD 4NWIA 4IRUB 1RI3A 4CMGA 3TIXB 3HZOA 2ZVDA 1EP9A 1U1CA 4B17A 4MTCA 2AD5A 4NOLA 1Q1EA 3GGGA 3INRA 3QFHA 3R4CA 4EX7A 4M6WB 1T5BA 2Q9UA 2QENA 1OZ0A 3EZNA 3H5TA 3I01A 3G5MA 2V6BA 4FWTA 5FTNA 1C7FA 2F9LA 3I9V1 3WAJA 3VO1A 4UVEA 4J1TA 3QWFA 3DC2A 4HNRA 5BR8B 3PC4A 1V1RA 1U8TA 3TLYA 2EWWA 5HRAA 1N32I 1QQAA 2G0AA 3E5NA 1RLOA 2YV5A 5AHOA 2B7BA 2G71A 2AX4A 3ENKA 4JP3A 2AZMA 3U3DA 4EI7A 1N7GA 4E4TA 5BYKA 4QULA 4XKJA 3CNOA 1H2AS 1FU8A 4BMPB 5CGQB 3TR6A 3RVRA 1E5DA 3H9CA 1W88B 16PKA 1F8GA 4GBJA 3WNCA 5DNYB 2ZITA 2RI1A 3UGTA 4HNQA 2C7QA 2VRBA 2CHFA 2BKXA 1JS1X 3L8HA 1CQPA 3A25A 1JUDA 4CKBB 1C3EA 1DEKA 1G1MA 1DWQA 2QX7A 4K2AA 3UM9A 3EA0A 3W6PA 3GLKA 3ADDA 3P06A 1KQ3A 2X41A 2VTEA 3OQIB 4YPOA 2FSVA 5IT0A 2QTVB 4AN1A 2OY0A 2PG3A 3H5IA 3M8KA 4KMSA 4OATA 4WLEA 1ZK4A 2WPNA 5KNCH 1P4HA 5JNTA 3V4RA 3WLSA 4BO8A 4MS4B 1O94C 4LY3A 3PGVA 4I50B 1UC8A 1X42A 4QTTB 5IHPA 5LMNB 5CG1A 1VIYA 4UVHA 4DREA 3AUXA 5FUMA 3K5WA 4YO8A 3WKDA 3GA7A 1AHNA 4PZEA 4EY6A 4BMOB 1KI8A 4A3SA 3KYBA 3HB9A 2HZ7A 1EM6A 3NTUA 4MJXA 3GFTA 4YAUA 1N2XA 5B3LA 4CTKA 2H1RA 2IP1A 4INPA 1WULS 2PQ6A 3AEUA 4R98A 4OB7A 2O23A 5B7QA 1AMNA 2KWIA 2WI8A 3T52A 5JZ9A 1MNAA 2C61A 4M8NE 4EG5A 1KVTA 5SZIA 4D6YA 1D5WA 4JKYA 3U31A 2F1IA 1RI4A 3FHTA 4GG1A 3V33A 4PNHA 5DP1A 5EUQB 4FW4A 4MPJA 4PQRA 2XD9A 3CNHA 3DDUA 4E03A 5B4TA 5BV2P 2O7NA 4MI3A 1J0BA 3IUYA 4PSAA 1P17A 5HDBB 2IF0A 3JS5A 1Y1PA 4RADA 7ADHA 3T1TA 1ZD4A 4G1EB 3GFSA 1TAHA 1N78A 2HL6A 2WJYA 3NVAA 3WKEA 2HRQA 4ENQA 3ER9A 3MA0A 1FCJA 1CRPA 5AOAA 4PZPA 1XMQE 2O52A 2VZ9A 4FKZA 1V1MA 4BLOA 1QCZA 1RTKA 4B1FA 3U3JA 2F43B 2CY0A 2FOIA 3H2YA 3JQ8A 4G4GA 4LMPA 2BDTA 3LFUA 4NBSA 4CZ2A 4EHLA 2TMKA 2Q0XA 5JVDB 4GKKB 2HT6A 1K98A 4Y7CA 1GO2A 1GGNA 4BO6A 3W3ZB 1MEEA 1CT9A 3OJXA 4TQ9A 1ZUHA 4K0KB 1NNI1 4A6PA 4DV5I 1M1UA 2NLOA 4LCBA 4CTNA 2VCEA 3VVBA 4C9BA 2WIFA 1HFKA 2QNIA 2W6MA 3O75A 3ILHA 2Q50A 1L4YA 1O03A 1P1RA 3ANTA 1W1IA 1NQXA 1G66A 4X3PA 5EHIA 5EE1A 3STYA 2WTBA 3EZ2A 1CUEA 1X1TA 3LQ4A 2ZSFA 5F4BA 5AM2A 2NZXA 4MWBA 4CGZA 2R5NA 4F8EA 621PA 4OHYA 4UE2A 3E5RA 2ECPA 4D4JA 2ZXUA 1NZJA 1UINA 2YR0A 4PSVA 1AUVA 2PBRA 4Q9AA 4XJXA 4Q3NA 4RDCA 5DDIP 1ZVJA 2GPSA 2XUGA 4KXLA 4QFDA 2C8JA 1W94A 3HG7A 3OIVA 1T2FA 1UBRS 2K6GA 3DWFA 1AKVA 4MV3A 4OH7A 1GNTA 4B3TI 4A8TA 5JS6A 3FOCA 4DMMA 2NPIA 3PKZA 2XH8A 5FHRA 4BFYA 2E9SA 2CCKA 4LZAA 3BULA 2PVCA 1R0ZA 2CXTA 3BL5A 3KV1A 4JCCA 2WMNB 4LF7E 3WMXA 2QV0A 4K9DA 4X66E 4LJYA 3K0CA 4HNSA 4ZV9A 1JQ5A 4FFMA 2ZRIA 2BDUA 4QQ8A 3GVXA 3IRVA 1E2NA 2A9JA 4WXRA 4DR1I 4LV8B 5F1OA 3U5ZB 2HFUA 1KO1A 2VYND 2X6QA 3GQBA 4M8IA 2RJNA 4N12A 1E9EA 1K8RA 1XYGA 2PPVA 1CEYA 5J2TF 1RREA 4ARUA 1SHLA 1DJLA 3F7TA 1L7DA 1NVAA 1R6DA 2E4WA 4OQNA 4RJLA 1JLHA 2YMMA 5JAZA 5KMGB 1N9GA 1R0SA 1GQFA 4N8SA 3LY9A 5L53A 1KFBB 3TDMA 4OJYA 2DWPA 3LVFO 5DRPA 3VPDA 4IQ0A 4Q7LA 1L4HA 3PP8A 2OCAA 3PF9A 4QICA 3TG2A 4LFBE 2PZLA 4ZVOA 2P2YA 3WLMA 4KYVA 4HKTA 4TTVA 4IDEA 3LCMA 1WXIA 2O0HA 4PC6A 3WJ2A 1GADO 3HLKA 1XN4A 1UC9A 4PLWA 3N0WA 1JR3D 4UNQA 5I9IA 1REQA 2ENWA 4DEVA 3GLFB 3N28A 5F2EA 1WPQA 2V3CC 7MHTA 4CEHB 1XAGA 1DJNA 3BJIC 2PYDA 2GT1A 5DHUA 3WB1A 5JYEA 3INTA 5DH9A 1PFKA 4XGIA 4XIIA 3TD9A 1UIRA 2ZJZA 3TRDA 3MJSA 3BZBA 2GCEA 3BDIA 2XNSA 3I2KA 4U2DA 3VX3A 3G8AA 4PBSA 3A0RB 5TMEA 5J3JA 4YYZA 4JWKA 2ID7A 2BE9A 4EQ6A 4YV2A 5CUQA 5U4XA 4U4AA 5A4AA 3QPAA 1G3UA 5HUHA 1NMSA 3FIJA 1S96A 2BFPA 3JSAA 3P20A 1ULSA 1T34A 1USWA 3BD9A 4JLKA 4JR0A 3DH0A 4M0FA 4MRNA 5SV2A 4YCNA 4WBNF 2WWYA 4P38A 3AEYA 3DG9A 4K8OA 4UZFA 2CCGA 1SPXA 4L57A 2JFNA 3KE9A 1LDYA 1JI0A 2ETXA 1L1QA 1YZVA 3GLQA 3WLNA 5HJ5A 5JEEA 1CUZA 2WF9A 3AJDA 4OJKA 4S04A 1BN6A 4BFVA 5A4JA 4HBGA 2MINB 1MO4A 3GMTA 4C3UA 2B8JA 3WGHA 2OV4A 4L2IB 1KQPA 2XGMA 1QFYA 1MO2A 1E2LA 2G4CA 4E7PA 5CD1A 1E64A 2XMRA 4TMXA 1JXMA 1QO9A 2XVXA 1L7QA 1WF3A 3AP2A 2WYHA 1G8YA 2BI4A 4I4TF 3VKHA 4QEZA 1LXCA 3RTEA 1RKQA 1QCDA 2X1LA 1H2EA 4L5JA 1G3IA 1MF7A 2XWJI 3HRKA 1XZDA 3GT0A 3R09A 2MYUA 4KOAA 5EMKA 1NFQA 4QGAA 2D2IA 4X3OA 2HW8A 2XUKA 4JI0I 3KPYA 2VWHA 1IBCA 4REMA 1UJ6A 2NVUB 4J7CA 4KNYA 4TM7A 4W8GA 2H17A 2HA6A 2VRNA 4N5DA 4FYHA 3GJ8A 1T3LA 4DOMA 3QPBA 4G0MA 1US8A 4HAVA 1GA1A 1H8HD 1YL7A 4KQ6A 4EQ6B 1KY4A 4GKJI 2AFHA 2MYPA 4IV5A 3FUCA 3PYEA 4WINA 1VJCA 4OF4A 3QKIA 2DLNA 4A8HA 1Y1QA 2JEAB 1IUKA 1KIMA 1NQWA 1XZPA 4QQNA 4E5DA 4FMBB 3UPTA 2NO0A 4PCLA 1ISFA 3QQ5A 3HA5A 3IDZA 5FLXQ 4EHAA 5IZCC 1VSBA 1WHTA 4RYDA 2WSYB 3GLHE 4PG7A 1L4BA 5CFZA 4B32A 2AOXA 3PFBA 5DKFA 2FWMX 3NASA 5ICFA 2BM8A 1HK7A 3TW6A 1REQB 4BGEA 4F3RA 3THSA 3O0DA 3I0ZA 3MT8A 4JYAB 1ZUNB 1CR0A 2FW6A 1Y4DE 2WG0A 2YFHA 4YUAA 3V00A 1BYIA 1WB9A 2QX6A 3DT8A 1JG3A 3ORSA 3D4JA 1UOQA 4IEIA 4F4IA 1EVZA 5LLTA 2V7GA 2RI0A 2WYOA 4RK5A 1ZH8A 2AN9A 3WLJA 2C4TA 1CRWG 1K27A 1YRQA 2VVTA 3R9XB 4RA9A 4W1PA 1SXHA 2OXIA 5H81A 4D7AA 3LS2A 1UJNA 2V5UA 3ULKA 3ZDFA 3GYBA 5KOYA 3NB0A 4F4CA 2ZIXB 1QV6A 2WUWE 2IBSA 3ETEA 5LQDA 2ZJ2A 2LV8A 4MR7A 4WFQA 1BWPA 1NZDA 2NGRA 2PVPA 1QCCA 3DMYA 3MRSA 4RAOA 1DRUA 1P3DA 5K0SA 4W1QA 4UUBA 5F2NA 4WLNA 1L3CA 1TIBA 1ZRMA 4MUXA 3J7TA 4TKVB 4Y2XA 3VOSA 5BXYA 5KYYA 1VKHA 1AGNA 1IY8A 2RCNA 5CX1B 2ZBQA 3B2QA 4JEHA 4X41A 3ETHA 3COVA 2UVPB 4TVBA 3R3UA 4EHJA 3RWOA 4QDXA 4RXTA 1O77A 4I5EA 3N8DA 2AOTB 3OO0A 4IJKA 1JW9B 4IXTA 4REQB 1L5RA 3SBOA 2JD0A 4KUHA 3C15C 3NQ41 3VMFA 1T4CB 3FDZB 3VRHA 3BEDA 2VYQA 4F2PA 3VR4A 3HA2A 5HKLA 1YZLA 2PZJA 5DEIA 1WMAA 2JCVA 2CZ9A 2AD1A 3AH8A 5TX7A 1XOIA 2IDKA 3O4FA 5JH7F 3A9TA 4KHPI 4JLMA 1U81A 1AZLA 2ODNA 2IZZA 3RE1A 4OHXA 4B3FX 4YMUA 4DKJA 2XEDA 4YCCA 3AVYA 4C76A 1EUQA 4RULA 2I1LA 4JYMA 5HJEA 3AMVA 2PU5A 1R6MA 1EFLA 4DPYA 2PO0B 3JWJA 3RYFB 4QU5A 1I4EB 1BQEA 1Q7BA 2HMUA 5AKZA 2NXNA 3VU9B 4HXGA 2HEGA 2C03A 2Q0QA 2Q62A 4ENVA 3PGXA 2W11A 3OT1B 4S1WA 2CHEA 3JZMA 4L7VA 4LCGA 4UEOA 5EPUA 5TPWA 3TI7A 5A3JA 2IYEA 3K53A 1P9OA 3UKOA 1B62A 3T9DA 1YS9A 1LV8A 2BBSA 3WYBA 4E88A 3ICEA 4LVUA 4WOKA 1WXDA 3LUPA 2VPPA 4MV5A 4QRDA 2P4UA 3ZN2A 4C4TA 5LQKA 1J7KA 4R40A 1NYTA 2AFIA 2DULA 6ABPA 2YZNA 2HREA 1I3LA 5BOSA 3I34X 1E7MA 2C1XA 2Y4NA 3O4HA 3QE0A 4MU4A 1SVWA 3JAWA 2FLKA 3L5OA 3OLZA 3GP3A 1NMXA 1ENYA 4QDKA 1BW9A 5AHKA 1N34B 2IIQA 2XD4A 2YDYA 4FFSA 4WEQA 2BBOA 4PRYA 3I04M 4Y18A 4EF4A 5JJ5A 2NN3C 1T8SA 1XMVA 3O84A 1EHIA 1SD2A 2FG6C 5DTRA 2IUUA 1T91A 2L2QA 1KDZA 2OO3A 4C6SA 1P1JA 4FJ0A 5BY2A 4D0LB 2XB9A 2PRZA 2IYAA 4YP7A 2ZWIA 2JRCA 1G7CA 3Q15C 3GUUA 2B61A 4CIBA 2XTJA 3AQIA 2ZG6A 4B74A 2AGVA 3TR0A 5HKAA 3D8SA 1V45E 4HTFB 4Q9NA 5JEAB 1C9EA 1OXBB 4FIZA 3VPXA 3MGAA 4KNWA 2MTBA 2PO1B 2VA9A 4KN8A 1U1EA 1YFZA 3T5GA 3FCYA 5KTRA 3KU4A 2C98A 2PO1A 1SG9A 2V6FA 4BVJA 1NVDA 4LF7B 1AH2A 4BFZA 3K9NA 3KSBC 3FGZA 4FM9A 3URMA 3PXCX 3P0RA 5EESA 4DRZA 5AI9A 1SHZA 4US1R 1B14A 2FV8A 2ZUSA 4L02A 2OYRA 3PYDA 4ZVVA 3QBTA 1RPTA 2AN3A 3QENA 2A94A 1K7CA 1XMSA 4MW5A 1GUAA 3CRQA 1YIOA 3HCDA 1OH8A 1OXVA 3BBPA 5JW6A 1FJGE 4DUZE 3SNHA 1KAHA 4WOPA 2F7SA 1L5SA 3NBMA 2F8TA 1QB7A 2CLOB 1L7MA 5JBIA 5ETJA 4YECA 4F2GA 2HHHB 4M0DA 1VL1A 3TOVA 2BZ1A 1ZAKA 3UK0A 4RL6A 1YAJA 1II0A 4XPZA 4BMNA 3MAAC 4BO3A 1ULTA 3F7MA 4JLNA 1IONA 3HUDA 2JAQA 1OKKD 1I4WA 1LPSA 2RSLA 3E84A 4IVNA 5EAIA 4GE0A 4DV4E 4W1RA 3OX3A 5G1OA 2ZSBA 4TWBA 3U9SA 2W2NA 3NBXX 1GKLA 3I5MA 3KD3A 4DAEA 4USKA 4RF4A 3ZDBA 2YMLA 1TZMA 2O7QA 2VYFA 2C83A 1GTMA 1PU2A 1W0KD 2I4IA 1NHJA 4R2WA 4G41A 1CY7A 1EE2A 4ND8A 2C37A 3SU8A 1CV2A 1O7JA 3K72B 4CKBA 5A06A 1L7AA 1OOEA 2Z9CA 3HHEA 3LZ6A 4OHPA 5AW8A 4C21A 3I2YX 2I80A 4R69A 3T5BA 4EA7A 4EUEA 2PO2B 1LC0A 2G9RA 3JASA 3NWBA 2QMYA 3V6MA 5BSEA 1RHKA 1BVRA 1G8FA 2CHQA 3D0KA 1QQTA 4Q9JA 5GZ3A 1QBKC 2ZOSA 1EFPA 2EL7A 2PK3A 3GJ0A 5AJWA 4AZWA 2ZR8A 1V7QA 3UGJA 4PYIA 2AG1A 2NV0A 2PLNA 3TD2A 4JASB 2UVQA 4NE9A 4M88A 3UAOA 2P2CA 4N48A 5DNAA 4DVJA 4E13A 4ERXA 4ZIRB 3PE6A 3K7EA 2AN1A 2J4CA 3AIIA 4CL8A 5CEEA 4DU7A 3PENA 4LNUB 1Z4OA 4N1AA 4PE5B 5FI5A 1GEEA 4F5YA 1YF3A 1YTUA 2W6PA 3MCUA 3PZBA 4YRJA 1NC3A 4XX0A 4WJLA 1FQWA 2R8OA 2RGRA 2H29A 1BXRA 3ZBQA 2BFBB 2VYCA 3KQYA 2ZTSA 4NTZA 3JX9A 2V7UA 5IUKC 5AJZA 4EGJA 4ZYLA 2O0JA 1YK1A 2OXCA 4HMQA 5LYJB 1QHXA 3LWZA 3TM5A 4CM9A 4YRMA 1YR9A 2R7KA 2AKEA 1HE2A 3AJ9A 5FH9A 1Z16A 3QY9A 4HPWA 4II3A 1Q15A 4EPXA 1J70A 4HXFB 2HA2A 3OPQA 4F3NA 1M2WA 3T1YE 4LSZA 2ATCA 4S24A 4BMZA 2MR5A 2Z8XA 2X22A 1IY2A 2JB9A 2ZB4A 1ZW1A 1J22A 1WXXA 3OKFA 2RHBA 5KYWB 1GTJ1 2PFSA 1QK4A 5A3RA 3PJEA 1PR6A 1MB2A 4AMYA 4Z51A 3UKJA 5F7OA 2QAJA 1OTYA 2X14A 1M5TA 4PXAA 1Z37A 3BOSA 3MSXA 3GIDA 1M34E 4L76A 3WHKA 5B6PA 1JZSA 1C30A 1FDSA 1YA4A 1WABA 2QE7D 1L5QA 1KNXA 2DFPA 2FQXA 4HDRB 4F6CA 4HEHA 3HYNA 3CWQA 3KJQA 2IE8A 3HWSA 2QYHA 3C7KA 4OAOA 2IPOA 3T5PA 1ZL0A 1EFHA 5DWQA 1YA6A 4KX5A 3BXEA 1DX4A 4GZ3A 4OFZA 4NE7A 4XUEA 1HR0E 3NPMA 4MA4A 1JMYA 2O5RA 4LRXA 4BEJA 2H5IA 2IJGX 3ROQA 5SICE 5KO2A 1E2JA 2IOQA 1ZAYA 1G8PA 5B53A 1X7GA 2VJNA 4LFBI 4QKQA 3UZUA 3MBIA 3KBOA 2WLTA 3OY7A 5ITSA 3MTBA 1VL2A 3U26A 1WZUA 1WXQA 2GZAA 1L7VC 1LZLA 2FUKA 4LXUA 1M75A 3ZKWB 3PPIA 4URYR 3LUFA 1J7JA 2QAGB 2EJCA 1KPIA 2EP8A 3ONEA 3VZSA 4OP2A 2RJOA 2JS7A 3TSCA 3IERA 5CVEA 3R7LA 2O8DA 2HLDA 1KHHA 1XT6A 2OZKA 1JGTA 3OEHA 3QLEA 4MVCA 3L02A 4MRRA 3I64A 3LKDA 1NQTA 4JLSA 4M0MA 4LJRA 1Y7PA 2ASEA 3KCNA 4LJ5A 3T1NA 5KNLA 4YN3A 4WVLA 2YUTA 4K46A 1TKBA 1C1YA 3B1ZA 3Q1KA 1XSEA 4MWOA 2RHGB 5EIWA 2JLBA 3PXUA 1IBLE 3OCVA 5BURA 5JATA 2Q49A 3X1XA 5JHHB 2Y0CA 1EFKA 1DUVG 3GNLA 1BS9A 3I8SA 1EJ2A 3OFKA 1E66A 2F9FA 3BUSA 3NVDA 4YRLA 2XGSA 1Z08A 3V32A 4NU6A 1GV0A 4RUKA 4YR9A 3AEQB 3U61B 2OFFA 4ZVUA 4EDHA 1IBKE 1E7RA 1UEIA 2VUSA 3G0IA 2IHUA 2IS4A 3M6LA 1FLVA 1PGOA 1FZQA 2EGHA 2FUG1 3A37A 3H8WA 3IPRA 2JI9A 4YRDA 1M7BA 3RARA 1H3EA 1DC4A 2Q5IA 4CDGA 4JI3I 3QX8A 3OPYA 2BHNA 3IHLA 1TE2A 3LPNA 2O0MA 1IN4A 2ZRBA 2CK3A 3NW9A 2HI0A 4TXLA 2QTFA 3S40A 1NF2A 3T9CA 2IGTA 4QAQA 1VQ1A 3TTWA 4BNVA 4KN9S 3R3VA 3R0VA 3SR4A 5I7HA 1G3RA 2AR9A 3AHEA 1Y7TA 4UD2A 1CJTC 2K87A 2AQ8A 1W35A 2ZVPX 3QNUA 4H35A 1E9VA 4RK0A 5F2OA 4MKZA 3SD7A 1NLUA 3WGYA 4U0KA 3FCCA 5K3FA 5CB8A 2QJWA 2OENG 4IKOA 1XXHE 4OK6A 1DEXA 2UV8A 2HA5A 4FEAA 4C0JA 1TADA 1MT0A 2WRZA 4AB1A 2V7VA 3JRWA 2CVOA 1JBQA 1M3SA 1TVCA 1SWVA 1E6UA 4G84A 3IXLA 1TM5E 3RR2A 1T8TA 3IAAA 1L5KA 5I7FA 1DBWA 3QLVA 2PS3A 1D2GA 2V59A 1E1DA 3R3XA 5EJMA 1OC2A 4EUHA 3JAMC 4DDUA 1Q0PA 4JUFA 3IULA 3NI2A 5K0LA 1XMOE 3WV4A 4RESA 1LLFA 4YRIA 4HB0A 1L9XA 1SHKA 5EP3A 1JEYA 1GLVA 3W2IA 3NFYA 5KTNA 3BMOB 2GTIA 4FZ5A 3EJ6A 4V1CB 5HE9A 1GA6A 3KBBA 5DJ5A 2Z5BB 3IODA 3CSDA 4I4NA 4KQ2A 1NSTA 4D57A 4IIJB 3VI4B 4F5WA 4PR3A 4IDCA 3IKJA 3QFSA 3DYVA 3V1KA 1W44A 4DLBA 2QI9C 5AW7A 1X1DA 1GFZA 4BFWA 1OUMA 3CONA 4I6JA 1V39A 5BW4A 4GW3A 4L85A 1HG0A 2IERA 3R3JA 1QJCA 2FWPA 1JDNA 1XALA 3V3TA 2KLHA 4E6PA 3OTOI 1F5NA 2FFJA 1I7QB 4HDMB 4HDRA 4CLEA 5IT9Q 1JFTA 3TOSA 3P9KA 3CNNA 3JQGA 4W63A 2ISQA 1E7QA 5E7QA 4ZAGA 1ELOA 4NKRA 2I7CA 1GL3A 2FSGA 5T8KA 2YKGA 2BDEA 5EJ4A 1U3TA 3HS3A 4PZAA 2X76A 1YR7A 4EB6A 3GDHA 4C4SA 4KQFA 4F4JA 5E7MA 4DCVA 1HGXA 3F49S 2XXAA 5CDFA 2FEMA 3HABA 4J03A 2RGGA 4LYDA 1N1GA 1RKVA 3HWRA 1HLGA 2JIQA 4J9VA 4O4IA 1AK2A 2D1SA 2PU7A 5DGHA 3UXMA 1SUBA 1NMQA 1TVEA 1T2NA 2G88A 3Q0IA 2LDBA 1QYWA 2DF8A 3O6VA 1UDQA 4GYYA 2C5FA 1ODCA 3GJ3A 3K09C 4O25A 2I6UA 1JJAA 3TAHA 3TL6A 3WAGA 4HX9A 3MWDA 2HRBA 4CI0B 4D9CA 5DNWA 3WGIA 4BATA 3KQVA 1P73A 1H93A 1WR8A 2YWHA 3S81A 5EI5A 4U3JA 5CK4A 3WO1A 4TMVA 1ZM3A 1N5MA 2R1VB 3O83A 4HQ6A 3OOJA 4YJ3B 2NP6A 4MW7A 1GU7A 1QDEA 1U0EA 4FMDF 4RGQA 2FRXA 3KNZA 1H4VB 2DFDA 3EXHB 2XKAA 3WKBA 3T5MA 3U4QB 2ZZNA 2BZ0A 1YZNA 2WMDA 1JR2A 1NAIA 1A4XA 1SCJA 1ULZA 3A1CA 4MPTA 2F1HA 3PQDA 2F43A 2ZTUA 5IMSA 1ZCAA 1DX6A 1T4DA 3KXIA 5LIRA 1E2GA 1HSZA 3AUFA 3C4JA 2ZPUA 4O8CA 5BT9A 3EEFA 3G2HA 4IGAA 4KO2S 2GD1O 3OFND 2XDWA 1WPRA 1B42A 1R9MA 2NTNA 1XTTA 2FRDA 3NETA 2OL4A 2GCOB 1M2JA 3QG1A 4PU0A 5AXDA 3T7IA 3ZBTA 1GGVA 2VJYA 2WHRA 4HACA 2ZI5A 3NIFB 4JVNA 2MYNA 3JPYA 3URKA 1UXHA 2A1TS 2SNIE 2ZSHA 1B41A 3F46A 4FX2A 1ADJA 3NORA 4YT2A 3O8OB 1DBIA 2W6ID 1L4EA 3RUEA 2PX8A 3LFHA 2BFEB 3ESXA 3R8XA 2OUIA 3E22B 1T3HA 3BE6A 1V71A 2NU9A 1SCUA 2A0XA 2ADFA 3P2KA 4FI3C 5E3JA 4M1ZA 2ID8A 3R0XA 4J3DA 4PPFA 2VZEA 4B0OA 1A4RA 4W82A 4MU1A 4ZVSA 1NDQA 1SOVA 2JNWA 5ALSA 3EX7C 3FNIA 1XB2A 2CDNA 4FHCA 4MVYA 2JCBA 3S2YA 2HGSA 3B5JA 3GVIA 4U5XA 1C30B 2JBWA 4LRUA 1PZHA 2QRQA 2VDKB 4GOXA 2FR0A 1OI7A 3VTAA 3PLNA 3KC2A 1E2DA 3W6NA 5H9WA 2I6GA 5IRCD 1XDDA 3EC1A 4O33A 1G7SA 1KGSA 1G98A 4WGFA 3ZWDA 4BE7B 1S2GA 1KKLA 2AHRA 3AHIA 5G1PA 2HAEA 1CIJA 1WM1A 3MAJA 4G3XA 5K3AA 4U7PB 1TPYA 2C00A 2F9MA 5KYVA 5GWXA 3T06B 5AM3A 1MAUA 1ND6A 2JFHA 3SHQA 1DT3A 1J2EA 1QAMA 4EOGA 4RHEA 4Y2YA 3A1VA 1SC3A 2H6EA 3VYTB 3QMWA 1RPZA 1UFRA 2JFUA 2IODA 1Y7LA 5ALRA 1KS2A 1I6KA 5K4HA 2ZBRA 3GD7A 3H16A 1YQ9A 1OT5A 2HDHA 2OLKA 2H2FA 1P0FA 2YIJA 2Y1CA 3BIOA 4CIXA 1QXSA 3GJ4A 2ODBA 3D6TB 4MYUA 2ILVA 3ITEA 1LDEA 1XVTA 2UYOA 3OTGA 4XAQA 2YOHA 5FUYA 1CK4A 2SBTA 2R8EA 4HC4A 1K7SN 2VUIB 3KXDA 1U4NA 3ODPA 5GP1A 2GLUA 1VPLA 4M6WA 2AI1A 4NFSA 1HQCA 2WV9A 4QRIA 4OIMA 3IVGA 5KNBH 4M0UA 4C3VA 4COOA 2NIPA 3K05A 1XC7A 3STHA 2CCJA 4D3ZA 4O2AB 4J1TC 4U7HA 2FPOA 2B30A 3G49A 2IEIA 4KTVE 5FFMA 1AU9A 3M1YA 2EWVA 1OWMA 4G0ZA 1XFDA 4G26A 5GONB 5BVHB 3DR3A 4QODA 5E6SB 5FNVA 3HFJA 1TF7A 5KHAA 1JMVA 3QV2A 4CIVA 2JI8A 2GSDA 4PIMA 1PJLA 2YWCA 5LWQA 3PNKA 3LBIA 3ZWVA 3D02A 2CVQA 1E6WA 2GEDA 2JVJA 2PKRA 3T3IA 3N8GA 3VTKA 2P91A 2ZQ5A 3G2QA 4PWZA 4ZCTA 4NCBA 3EFHA 3K6JA 1WF6A 3RU3A 3VH3A 5IKEA 1ZL2A 2IUEA 2Q8PA 1HNXE 3D3WA 4OV6B 5KWIA 3J80C 1CZOA 1QIJA 1V5GA 3QLUC 4DCGA 4NG4A 4XTJA 2WWIA 3EGIA 1TZJA 2FSVC 4HEJA 4B9AA 2ZYHA 5EIAA 1Z0DA 4ZCLA 1UFQA 1EX7A 2VP5A 3ZWKA 1MO6A 5B4VA 4HX2A 1NP3A 1TRHA 4IGKA 4DR7E 1G19A 1ZMBA 1D8TA 4AUEA 3C3DA 1JDPA 5JSHA 1QP0A 3BYZA 4H6XA 4JSTA 1HDXA 2HNAA 3JV7A 3KUKA 2OCBA 4INZA 4Z4GA 5K45A 1E4YA 4KSCA 5CTJA 3VR6A 3OM8A 1BQ3A 1FDVA 4O4HA 1T29A 2IVZA 1DE0A 3CF4G 3OZIA 1XL1A 3RUIA 2NPFA 4FX5A 5L3QA 1RIIA 1KK2A 2HLHA 1I1QB 1G4UR 1PYOA 4AD8A 4GI1A 4NAVA 1D6TA 3BKWA 3UHMA 4HDKB 2VIIA 2BA0G 1HDRA 1ODKA 4BQOA 1RHUA 4MDHA 5JAMA 1YQTA 2QRVA 2IU4A 1BEUB 3W8RA 3ZDQA 2IDMA 2UVPA 1FMCA 1POWA 2JC3A 1GEGA 2YJNA 3F8WA 3H4LA 3WWCA 1EP2B 4JVOA 4FP9A 1Y9AA 4YCAA 2PLRA 4N7RA 3WRYC 1W5EA 4EJ6A 1CB0A 4Z7YA 3OWXA 1VJTA 1T5TA 1N77A 4AIMA 2XSZD 2HLNA 1JEYB 1MJNA 4KJZA 1N2OA 1QLWA 2AKYA 4WL0A 5LDGA 5CFMA 1G2QA 2DXIA 4FJ1A 1EVEA 1T5LA 2DX7A 2I99A 1O4WA 2HLPA 4HZUA 1IYZA 3ZGOA 4TMTA 5EZYF 2CNOA 2I7TA 3C5EA 3D7RA 3M6UA 2IQIA 2JD1A 3DV0A 4HK4A 3NTOA 1ZP6A 4YHHI 3VYVA 4BX8A 1IXKA 1DI0A 1YQUA 4IHKA 3A7EA 3RGWS 2IU0A 1TQ8A 1PTJA 3HADA 5HFNA 4XSVA 1ZK0A 3G0BA 2F62A 3ZWBA 5GM2A 1FFEA 4C87A 4P81A 5A5FA 9ATCA 1CP3A 3AF1A 4XVRA 4Y0NA 5E4JA 1T3GA 4UU1A 1D2RA 3VAAA 3IB3A 2OCLA 4UM5A 4ZAYA 4C7VA 5BYAA 1KJWA 2GWHA 4OI1A 3IT2A 3ZD9A 5HXAA 2QL5A 4TT8A 3K9CA 4K88A 4QE3A 1XNRB 3IJEB 1KMHB 4RELA 3RS0A 5ULLA 1G8HA 2BHTA 3RKUA 2D7DA 4KXXA 3RD5A 2A3NA 3MIIA 4I5GA 4R9VA 4OU4A 2YNMA 3S28A 1H73A 3UAYA 4CF3A 3TZEA 1CU1A 2O9JA 4BL5A 2ATIA 3UJPA 4GL2A 3A04A 1UPUA 4Q02A 2QGZA 1UM8A 1O97C 3AUUA 2OO5A 2OZPA 2J07A 4RA6A 2WHPB 1DKUA 1B4DA 1G21E 1G8JA 1NKVA 1OSNA 1DKQA 3WU5A 1JKXA 3EVEA 1Z2CA 1GKIA 4MWDA 4XYEA 5FWXA 2Q8QA 3REOA 3RSOA 4CL3A 3L7IA 1RU3A 3HDQA 1GUBA 4FOTA 2O1TA 5ILOA 4RO0A 2H31A 5LZ7A 4UARA 4B3DA 4C6TB 4YAGA 1HYHA 2X2EA 3CMCO 4M4SA 1IL0A 1FNNA 2XYQA 3CWCA 4WUTA 4FMCB 4UTGA 3O2QB 4X64B 5A4DA 4HH3C 5KI6A 4NAUA 2WVAA 4ZTBA 1XD8A 4D9EA 2Q5QA 2VJMA 5KIAA 4Y6RA 3HK2A 1BX3A 1EFVB 1WMSA 1YS1X 1XKQA 1P72A 2VPWA 1MORA 2X5JO 3FH0A 4WK6A 3JQBA 3RLIA 5LBIA 3HCNA 5I7UA 1P1FA 2HR1A 4M49A 3NXKA 4BFUA 3DMHA 4YT8A 3DAGA 4Q9LA 3V7UA 3EK2A 4P6VF 5CX1A 3GIWA 1H74A 2AWNA 4IIXA 3Q8MA 2BCJQ 2FXVA 1UAAA 4OFWA 3PQFA 4NXMI 4INAA 1D6MA 3MFYA 2ZTLA 1U2TA 3RANA 4IDHA 4X62I 2H2AA 1ZXXA 1F0NA 4U02A 4JV5E 1BMDA 3FDJA 3MIZA 2CJWB 3V4LA 3EA5A 1KBQA 1X7YA 3SMQA 4BWVA 4EB8A 5CDSA 1RJEA 1XZEA 4LHVA 1ZO8A 2H4XA 1F0YA 4ZD6A 1DBSA 1T6YA 2ANCA 3C2QA 1PL7A 4WDRA 4BDTA 4PV7A 3R77A 4R1QA 4JBYA 4TYPA 4P3KA 3K4PA 1FDTA 1K1EA 1O94D 1Q1BA 1XU7A 2NG1A 2G5TA 2XA1A 3X3HA 4QUHA 1QAOA 4GICA 1QRTA 1Z0GA 2HDNB 1W5FA 4L16A 2QMUA 3P2EA 4J4BA 3BIWA 4DPMA 3CX7A 4H27A 1JX6A 1T5SA 5CH3A 4AZVA 1XVLA 4AUNA 5LN1A 2EZ9A 1SZCA 2B34A 4UASA 1XLVA 2MHCA 3NWOA 3DBHA 3EF3A 5DFAA 3A31A 1TECE 4O4IF 4PRXA 1XKXA 1TC1A 4FHEA 3TTTA 3R9WA 1BROA 1C9NA 1K7YA 4Z9XA 3DE5X 2FZVA 3ZQJA 1SXJA 2PKCA 2H5JA 4HWKA 4KYTA 1PDWA 4FN4A 3W2FA 3DOEA 4DV1I 4R71A 4MUGA 4IFDA 1US8B 2FWNA 2GCNA 4AIDA 1DRVA 4UT4A 4C20A 5TIIA 4JI1E 4LW8A 3CVXA 3BICA 1EFRA 1UBFA 3F74A 4GZMA 3CUSA 4NYMQ 5IJ0A 2A35A 2QK4A 1EK2A 3RUAA 3NHSA 1NXVA 1KIAA 2W71A 4PGGA 1GAWA 2IYYA 3UIEA 2JW5A 3HDHA 4PWYA 4P32A 5DTMA 1KO7A 3HO6A 3GHHA 1SURA 3OE7A 4DT1B 4FYPA 3E1KA 3R5KA 1EJBA 2XQGA 7YASA 5DI9A 5I9MA 3AUTA 3N9IA 4CKEA 4EHNA 3WK4A 5IU6A 1CQIB 4CEIB 4JJGA 4XX0B 4AY2A 2IS1A 5AP9A 3GGSA 1NM5C 2EJBA 4RK6A 3VSBA 1JVSA 3EZGA 1T4GA 4PRKA 4Q1VA 4CL2A 1RWXA 2BTQB 1U8CB 1ZYUA 1M74A 2RK6A 3KDSE 4UHBA 3RSQA 4E46A 1P3Y1 2WYIA 1LPPA 1FTWA 1SU4A 1ZNXA 2FG7C 3QVGB 4O4HB 1C1DA 4UTZA 2DWOA 2NOAA 5AI4A 4DV6B 2KX7A 1YK0A 3MZ0A 1PEKE 2FZ5A 3GOHA 3QI2A 1QJ4A 1ZJ6A 3VAYA 1ML3A 1F14A 3FRJA 3LIIA 3H2ZA 2B2NA 1KOFA 4MGYR 5I7WA 1U65A 4FSXA 3VISA 1J5EE 3SP1A 4KN6A 5KREA 2PO2A 2H9AA 2HJSA 3WZMA 2CXRA 5JFTA 2L69A 4BAUA 5J4YA 1IEWA 1Z5ZA 2W0SA 1O6BA 5BN3A 1XRRA 4DG8A 4DRXB 2F4NA 1J9EA 5F9MA 1U8XX 2O3RA 2DU8A 3D3NA 3MOSA 4H7IA 4I1IA 3NNNA 2J9ZB 4N0MA 1XRNA 1XWIA 1RYYA 3BD6A 1SQ0A 1T36B 3GG2A 2QQEA 5CK5A 2R8ZA 4F1WA 5BRAA 4Y2QA 5CB4B 5JCJD 5A1TA 4QSHA 1N2CA 3JD3A 2DTDA 2P9YA 4HVTA 1FRQA 2PMDA 3BWEA 5IF3A 1CUHA 5A4KA 3JWEA 3ROPA 3G2IA 4DV1B 4CBVA 1YS6A 1Z6TA 2UYHA 1QLHA 2FN4A 3K71B 2NP7A 4MWGA 5G53C 4CEHA 3EXG1 3ZGYA 5I5GA 3PS2A 5GONA 2FY8A 1CY4A 2L0XA 1TC2A 3GJRA 1MQSA 1Q2UA 1OPRA 3GPDG 4M7RA 4QOIA 5EE5B 4C08A 3PYFA 5LU8A 2J9RA 2GNAA 2QD3A 3ACDA 3H3JA 4EHIA 4EYKA 4GSKA 4KWTA 5JAPA 2BGKA 3C3YA 3MJHA 4X8OA 1P9RA 1ZUWA 1HYQA 1FS5A 3H75A 3HXLA 3PS9A 4YT5A 5FLYA 2X0DA 1CEEA 1ZRHA 5K8UA 3FOZA 3QVSA 1KVRA 3IAHA 3J7AM 1NFRA 1Z6ZA 4B43A 1PW7A 5A5DA 2PGJA 4J7AA 4AI6A 3D6MA 3A6ZA 3LPAA 5E2BA 3MQ2A 2Y1KA 3W2EA 2JAWA 4EBFA 4P82A 4YQFA 1MC8A 3KQLA 3C14C 1UBEA 3RLFA 2FNAA 4LWQA 2JD2A 3FVTA 3NUGA 4PPNA 3LDFA 4D0SA 1M6VA 2OMEA 1HNXB 1VB5A 2YQ4A 5IDXA 3T5AA 5LD2B 1M8KA 1U7UA 1DLIA 3JYOA 4QTZA 2PL9A 3LZDA 4XCXA 4XUCA 3N2GB 4RZSA 4RVNA 4XGRA 2QYSA 2Y0BA 4FK8A 1PLJA 4AM3A 3CG4A 2GASA 1DTSA 2J9FA 4MR9B 1XL0A 1FDRA 4NXMB 3C3WA 1D7AA 1KC3A 4URHA 3PC8C 1N8TA 2W4MA 3D9QX 3OVMA 4P5DA 3MJVA 2C4NA 4OYYA 4DBVO 3NUZA 1HC7A 1V5IA 1W48A 2FN9A 2C3PA 1M7HA 2REXB 2WFAA 3PC3A 2XPCA 3NHLA 3LHFA 5HKBA 2G67A 4UPVA 1Y8QA 4L4ZA 3A9RA 3ENNA 4OB8A 5BR1A 1UP4A 1Z06A 1Y1SA 2BMDA 2V45A 3BD7A 3KTAB 2F1DA 1YJQA 1LJ8A 3D1JA 3PRHA 3L43A 4LSWA 2GBLA 1ZOIA 2AW5A 2ZETA 3D8BA 2VBIA 3DLCA 3HXMA 2HK8A 1L4UA 3NIWA 4Q4LA 1YL5A 1Y6RA 1E1CB 3QU4A 4P2BA 3F4KA 2BGLA 4WADA 1G59A 2C1ZA 1M9NA 3MMZA 4N4AA 3ZTTA 1V16B 1OGYA 4UD6A 4A82A 2B1JA 4Q12A 2W6QA 3OQNA 5I8WA 4CMKA 4DADA 4JGIA 3YASA 3ZV3A 1HQYE 3G6KA 1PIEA 4LYFA 3UMGA 2ESRA 4JVMA 4Q21A 3KK0A 3ZCQA 5L3ZA 4E5VA 4CEJA 2EG5A 1TAQA 5KVSA 5FI3A 4B80A 4UVGA 2R6AA 3D5QA 4TLDA 3UV6A 3ICOA 4FI3F 2UDPA 2PRSA 2XY4A 5AW2A 2JATA 1KNQA 3E6AA 3Q7RA 4EYGA 1XLUA 3ICQB 1V4VA 3G2PA 1J5PA 4MUIA 4EL0A 4YMHA 1QYVA 2H57A 721PA 1T9AA 4JUBA 2PKWA 2DQ4A 4U3DA 3FA2A 1AKTA 1DPGA 3IPLA 2QSZA 5AICA 5E6SA 3ONVA 4B6OA 2BWJA 4OLJA 1IEQA 2EBFX 1BRTA 4ZI5A 4KO3S 3M5WA 3L1IA 1PD1A 1YJCA 2AOUB 2VK8A 3CPHA 3GRYA 1NXTA 2GDJA 1TYDE 1RQPA 3QW2A 2C2WA 2JH3A 4DHWA 4ER5A 5JXGA 5CR9A 1Z59A 2PNZA 1IXSB 5TGTA 1AQLA 1ZC4A 2DFTA 2IZ7A 4IVRA 4I4CA 1MH9A 5ESRA 3F8SA 3OJEA 1KDYA 4NMLA 4MHOA 1IC6A 1H7UA 3CU5A 5AVJA 4KGVA 4N0DA 2HCJB 4L50A 1JG2A 1WZIA 1XEXA 4GX0A 5GAJA 1UR5A 1E8MA 1ES9A 2NQTA 3OESA 1V3QE 3CCFA 1TK9A 3BH6A 5ALIA 1NQ5A 2QUJA 4YJ3A 3WGNA 1PR5A 5TARA 2AJDA 4BNHA 3OTOB 3QK7A 4IVQA 1J0CA 3SDZA 3NC4A 3PWKA 3W7VA 4DA7A 3KYCB 3KKQA 4K86A 3SG0A 2G25A 4QQKA 4MV6A 2PNJA 5IJWA 4LYGA 1T6NA 1A9XA 4B3TE 1KI4A 2NV6A 5AO9A 2ONKA 2ALJA 1B3BA 2I3AA 4NNPA 5I6DA 3U3MA 4ER0A 3EUAA 3D8UA 4OXNA 3MHTA 1KY3A 2WDPA 5JQGA 3K9QO 1AA6A 2XMZA 1EIWA 1G64A 4G1BA 4J7UA 5K3CA 3K17A 1DC7A 1QE3A 4ZQBA 3ZIUA 3B70A 5ELWA 1XTZA 1Z4IA 4HYEA 4OXRA 1U2DA 4BLPA 1FTNA 3LQYA 2AR7A 3RSGA 2G83A 3IQGX 2ZXFA 4DB4A 3VC7A 5LQRA 3UUGA 4OGKA 4ZCIA 1WPGA 2FN8A 5IASA 5EEHA 4X5OA 2I33A 2ZE7A 2QVCA 2JBAA 4YUWA 1XPOA 1Z36A 1E6MA 4A0FA 1CZRA 1S8NA 5HE8A 4DJAA 2Y9PB 1KIJA 1B0PA 1MOZA 4R01A 4W9MC 2XAUA 4IS2A 3FI9A 1VBNA 1WUJS 4FBMA 3LP8A 4Q24A 1GPDG 4GKKI 1DJPA 3TINA 1VXOA 1N33E 4IW3B 4KQWA 3PK0A 1QGYA 4M0CA 4XQEA 1RE0A 1DIGA 3ZWAA 3TS1A 4AJ4A 4CMCA 4PZDA 3RNLA 1DU4A 1NJFA 2AN4A 2IHYA 5TT1A 3BL8A 3OHMA 3RHSA 3V3KA 1J00A 2POQX 4JJAA 1UMBB 2WP8A 1QHGA 3AR5A 1UK8A 3ANMA 2X3UA 1N0WA 4H1HA 5BR4A 3MT9A 2P3QA 5FWKA 1C7JA 1IATA 3EB9A 1K7EB 4IBOA 3WVNA 1N36I 2LE0A 4AWAA 3BRSA 3PUKA 3FJYA 4H6VA 3T3PB 4NPHA 5G0WA 4P58A 3IBGA 4U2BA 1BSVA 1NDUA 2A0YA 3Q98A 3E58A 3UB3A 4HWTA 5T4BA 4FLMA 1LBQA 3DZKA 3R3SA 1P0IA 1AVTA 2ORVA 2YASA 1QQ6A 5AVKA 3TVTA 3NHKA 3SEQA 1DAPA 1W52X 1PP4A 3FTPA 3TGLA 1UBLS 2JANA 5JNUA 3P3CA 2FEPA 3CT4A 5C3MA 4JB0A 3IC5A 4RCYA 4C4OA 5BW8A 1I51A 2B94A 2H5LA 4OJMX 4QTUB 2VSYA 4MCAA 3A2KA 1IVYA 1LBSA 4WRRA 3KZKA 1PQUA 1P1KA 5WRFA 1W4RA 4BNWA 1PNRA 2QVLA 3C6MA 3N0XA 2I7XA 2HHHE 2QT9A 4QXPA 3AF4A 2OGTA 5CB4A 3NFRA 1PYDA 4UJ5A 2DEJA 4TSFD 1U31A 4R8RA 3VOAA 1YR2A 2R65A 3LXUX 4OQEA 2Q5CA 3A4MA 4D3SA 2H3EA 1Z0AA 2A9PA 2SKCA 1GILA 3GUCA 3L01A 3M34A 4H7PA 4LZZA 4OEHA 1F2UB 4OXKA 4LXIA 4S0ZA 3FMFA 2BI8A 1JU4A 4QG3A 2HFJA 2OP1A 1W36D 5HCUA 1TVMA 4O1IA 3LI2A 3PZRA 3JXEA 3ZVNA 4CFSA 5KQLA 1DRKA 5M3BA 1XQ6A 3FB4A 3UAZA 3CH5A 4QOHA 5J4HA 2WU4A 3DTVD 1E2HA 4WERA 1XA3A 4HG2A 4CLOB 2GKGA 1N32E 4ATNA 5ECWA 2C4HA 4JP2A 4CT4B 2OORA 3HU5A 3LCVB 3DEHA 1HETA 1QVRA 3JARA 4F06A 5LZ9A 2WJJA 5IN5A 2DKOA 3GC6A 1R88A 5C31A 5HJ2A 1C41A 5FA6A 1Z5BA 1C8LA 1VL0A 2J09A 4IJQA 3I0MA 4JXKA 5K0GA 2O3QA 1EUZA 3ESBA 3RM3A 4ZZ2A 2GJAA 2NUPB 3ZKWA 3BMCA 4HRXA 2CBGA 5K0EA 1QS0B 3FNEA 3R3YA 1C2YA 4I19A 3NV9A 1R6VA 1SCAA 3PX3A 4PANA 3WRXA 1W0CA 3QVUA 4GRAA 1L5MA 3GWZA 5IJ0B 3BJZA 3AZOA 2PSHA 1UANA 2W98A 3HCCA 5K0NA 4IRMA 4G1FA 4Y0VA 3TDKA 3DM9B 2VJBA 1RRFA 2WFMA 3UMSA 3ZQKA 3EZFA 3KJEA 1P8JA 3I4CA 3L06A 4TQUS 1G38A 2VHYA 3GCGA 1GKUB 4C1BA 5BWBA 1GTSA 1JHMA 1LKZA 4TV8A 3AJAA 3ZXSA 2DEUA 4C4PA 1ZZGA 2VL7A 2QROA 5TV2A 3IP9A 4DWOA 5IH3A 4A8JB 1JQBA 1UBOS 5K0BA 3B1JA 3H2KA 1IM5A 5AVXA 3GEBA 3LKVA 4P1ZA 1F2TA 2H4ZA 4R0VA 9LDBA 4V03A 3IUPA 1D2CA 1L4MA 5K0TA 4HAOA 4JI1I 2G1JA 1ABFA 1YHYA 4GQBA 4YCDA 5COBA 2PE5A 4RLQA 4FWIB 3EGWA 1TYEB 4XPIA 1M2OA 5GJVC 3X1ZA 1TKAA 1USIA 1XLTA 3BFXA 3OZRA 5LYYA 1P4RA 3BB1A 1YIAA 1Z29A 4Z9FA 4XVCA 3N3AC 2YZ7A 4ZI7A 1WE2A 4QU9A 2C59A 4I1PA 1LRJA 4QJ3A 3O8QA 1HX7A 1X7ZB 3DW1X 4N3OA 3BGDA 1AGXA 2IVFA 5EL0A 3WYGA 3VQTA 4O3MA 1NQOA 1ZHFA 3W04A 3D5TA 1MAWA 3VR5H 2BFDA 1NU6A 3A05A 2ZYSA 4IOMA 5NLLA 4OUDA 4QHYA 4IOLA 3FZQA 4CDMA 4MYCA 2OQ2A 1EDZA 4OQDA 5BN3B 1FX0B 3QPWA 4JYZA 1VHTA 2YCBA 2WKSA 4N8DA 1FTYA 1QVZA 2Y1FA 1VA4A 4JT4A 1CULC 4KC0A 4P3PA 4PBTA 3KVNA 4YAJA 3KSZO 4P7BA 1D2EA 1O95C 1PBTA 1TM1E 3NHFA 1UXJA 4TV9F 4FILA 1NRXA 4UATA 4FB4A 3GCWA 1GQQA 2JE6B 1SA0A 1K6JA 2Z2ZA 3PICA 2ID9A 3R7WB 1P2TA 1Z2NX 1XKTA 4UTOA 5E6UB 4DIUA 5D84A 4UBJA 5K05A 3L0IB 3UHFA 1PJBA 3H1FA 1S1CA 3UAVA 5A62A 4H6PA 4UDYX 1I7PA 3I9JA 5B6IA 4NCIA 2WDZA 1OWNA 1FBNA 1R0KA 1S3IA 3VU1A 4JJ8A 1OY1A 1TXGA 1NASA 3NT2A 1Z5CA 3TRJA 3QKTA 4DUPA 1R8YA 3LYHA 3TFWA 1P29A 1V8PA 3SXJA 3TH5A 3UNXA 4YNBA 4RLSA 4QBFA 3VO9A 2QP4A 1W4LA 1LGYA 4QNRA 4RM3A 4A8PA 3H9EO 5LMCA 3TIFA 5TJ9A 1EM8A 1UBHS 1W19A 4URUR 5IJXA 3RABA 2QTNA 1I24A 4K9KA 1VRCA 4RVGA 3LBYA 3TLJA 4B3SE 3VDRA 2ONCA 4EHFA 3HJBA 3V42A 5LMZA 5AWFC 5CLJA 5C8ZA 3TW4A 4GMGA 5B7PA 1QBGA 4M36A 3KAPA 4HNTA 4B40A 5KX5A 1AS3A 1Y8QB 2I65A 3DE2X 1R15A 3IIEA 3KVYA 5FUWA 3UV7A 3HGTA 1Y37A 4JU9A 3OQIA 4TN1A 2X5KO 4DPLA 1OBCA 2JI6A 1E7YA 5IG2A 2H4YA 4GMXA 3DS8A 5AJXA 1YB1A 2GHRA 1X7DA 1YJXA 2AI3A 3OZVA 4KZPA 3B13B 2RDMA 1AJEA 1MDFA 1H2WA 2YN2A 2XLBA 3EBPA 3V8VA 2QJFA 2CNWA 3OIWA 3VKVA 2VHXA 1P7ZA 3CKYA 3QPCA 1W25A 1ZU4A 1H72C 1KI7A 2HA7A 3EVZA 1NVGA 4FHDA 4JI3B 3WR5A 1T8WA 1RI5A 4GPD1 5G41A 4BAZA 1OJ7A 4DV6I 1QANA 2C8KA 3DOHA 3LGSA 4Y9UA 1J4AA 1MNQA 3BSFA 1ZNQO 1OYOA 3FFXA 3KT0A 1K3UB 4CKCB 3DDCA 3R1IA 2GSWA 1TZ2A 3R3HA 4JNKA 1F6WA 4JA2A 1CDDA 1UC5B 3FYSA 4GC9A 4AJ2A 2CVEA 1EU1A 2YV4A 2Z5EA 1GZ7A 3ESDA 2PGNA 3Q85A 2F48A 3NIGB 4CWAA 4RTNA 4HDKA 4AX4A 4OX9B 3NMUF 2YJZA 1OFHA 2OB1A 5FOWA 4TVSA 5L4LA 1IHYA 3FF4A 3RHFA 3VPAA 4ZOEA 4N47A 3LFTA 3GRRA 5I51A 1CQZA 2DTEA 3KETA 3V1LA 4DUYB 1CZUA 5EZ5A 3OOHA 5KHOC 2HKJA 2ATVA 4WCFB 4AUKA 4JV5B 3SSMA 4RDIA 1GL7A 2A3RA 4MICA 2NAPA 1KS9A 3TNYA 4ACBA 2JLRA 1ECBA 4DV1E 2DY0A 1DDGA 2PD4A 3EDOA 5FR1A 2LJPA 4M60A 5HEKA 4YPFA 5CU7A 4OHKA 1O9GA 3COWA 3KB2A 4QEDA 5E2IA 4E5NA 4FONA 3OPYI 4JI7B 1PK9A 3A3YA 1FVFA 4M9SA 4HSGA 4JWTA 3WGOA 1YULA 2D2EA 2O1EA 3K0HA 1ISPA 3QX7A 3WICA 2J7PA 2ZR0A 3ZWMA 2AMFA 4KQ1A 1V5EA 3ZGLA 1YUBA 3WHLA 3RIYA 3EHDA 1I01A 1MGPA 2CLFB 3ZCTA 3FN4A 1ZCJA 2ABWA 1Q3TA 1UT8A 3IDFA 4J49A 4JZYA 4F21A 5CXUA 2QRJA 2DUJA 5I4BA 1U1IA 4DIKA 3TM4A 5IBCA 3M83A 4XDHA 3GPLA 3WWDA 4H3HB 2V8OA 1Y7HA 2OT3B 2NZYA 2RH5A 1BOOA 2XB8A 3I30X 3JVUA 4ZVKA 1NIJA 4XQ0A 3RK1A 1RXIA 1E6EA 1EQAA 2P77A 1T0IA 4MMYB 2POCA 2B3DA 4LFAB 4JI8B 4A1FA 2OLJA 5CFNA 2FWRA 4LECA 4NXNI 4WCFA 5LSAA 3UF0A 4UHFA 1QUEA 4RJTA 4LY0A 1UMCA 1N6KA 4LIPD 4NEGA 3WP1B 4ID9A 1PS0A 1WTAA 4TL9A 4EFMA 3X1MA 2PV7A 3EIXA 3EOBI 4BWFB 4RK1A 4WBNB 1A8IA 5F9FA 1TYZA 2TS1A 1TAUA 1EHYA 3WC4A 4RMIA 3HUTA 1O0CA 2XSZA 2GILA 4EKEA 2CGEA 3D59A 4R1PA 4BLUA 4P7AA 2QBYB 4FZRA 4A73A 3O21A 2R6CA 1OGJA 3ZS9A 1AKUA 4GWKA 2W8BB 3ORYA 1PK8A 3GFBA 1UXKA 3OZWA 4DV2E 2DQZA 3B1YA 1LNZA 1TVKA 4RFSA 5ICMA 5JVDF 5JWOA 3D31A 4HZIA 4RLHA 5JH7A 4CXMA 1U3CA 2FMIA 2G17A 5BV7A 1WVIA 1YH8A 2WNIA 4LZLA 3SBDA 1VMIA 3A7DA 3K70B 1RBQA 1NXWA 6YASA 3D3EA 3GAAA 4DC0A 4ERNA 1TCUA 1SOAA 3J81A 3WQSB 3FPJA 4QO7A 1S2OA 2CHGA 3EGEA 4RV9A 2HADA 4G85A 1QRAA 1QTQA 2HHJA 4AYXA 1IAQA 1H1LB 2R8RA 2WJ4A 1S2DA 3JZAA 5BUSA 4D25A 1AV6A 2HBZA 3RTDA 2WFLA 4RSGA 1RJ9B 3E3AA 4JFAA 1IVNA 1QG4A 1F38A 1IUNA 1O6FA 2P78A 1KEWA 4LDRA 2YJGA 4QECA 5CMLA 2OB2A 3USES 5KU1A 3TQFA 1N0HA 4M1TA 4N3AA 3ZW9A 4X20A 3UJ7A 1RLJA 4L1KA 1YTLA 3WL5A 1JLRA 2BMAA 2HMTA 2QD5A 3JSXA 5HKKD 3OSUA 1ONSA 3AEKA 2XEXA 3FE2A 1EESA 3UYLA 2GAJA 1CF2O 2YYZA 3O1IC 4JLJA 3SSNA 4CQLA 4TT3D 1ZMTA 3MTJA 3L7KA 5F78A 4ZU1X 4S1VA 3F6BX 5G0VA 4BMDA 1N57A 1N8KA 3HY3A 3HWX1 1VI7A 3TF5A 5TDHA 1NBHA 1MX9A 4GXTA 2EXXA 1FP6A 2W4IA 1T1GA 3CLSD 3GPIA 3HBLA 2IU6A 5FO1A 5SY4A 5CA0B 2VT7A 3DZCA 5BMVF 2DWQA 1C29B 2F17A 3JQ7B 3K6SA 4B6GA 4IZOA 5JDIA 4EF6A 5KJEA 4NP6A 1J9GA 1LJLA 4RY9A 4KKXB 1IBLI 4PVDA 4N41A 5B6JA 3A1SA 2QG4A 3A1EA 4KDEA 4GGMX 5C81A 1IBMI 1AQYA 4LK2A 1AO0A 4TTQA 1E9AA 2EX0A 4YXWD 1IXYA 4U2EA 1BN7A 3NBKA 5TSDA 4UM9D 1TF2A 3M1IA 3VM6A 1YQDA 4WNAA 3QNMA 3SKVA 4KREA 3DZHA 2FDRA 4MZDA 1ONBA 4Q4CA 3SYLA 4F4DA 2COUA 4NBLA 2WTNA 4IJMA 2C29D 4KQXA 2W6JD 3EVDA 3QOWA 4TSFA 3VYRB 3WRYA 4GKVA 3A9CA 3KHTA 3ZHCA 2PEZA 4IHJF 4CKEB 3A6GA 4O08A 3SF8B 3WLEA 5A2QA 4V3CA 1Z13A 3D7NA 2D2FA 2Z95A 5P8WA 2WM2A 1PUJA 1KMIY 3FRHA 1U28A 3M82A 4AJPA 4BX2A 1XAJA 1FW6A 1XPUA 1Z25A 3PUXA 3EIUA 3GF4A 3P4XA 2J59A 3VGJA 4RVCA 1M66A 2MSEB 3HXTA 3ZK9A 3DUFB 1DV1A 3L9WA 5BVGB 3PR1A 4WZZA 3EGDA 2VAXA 3ER6A 4M8KA 2H08A 2PWAA 2ZAOA 3CVJA 2W90A 1TIPA 2YJ5A 3GCZA 3GU3A 5C7YA 3A2LA 4INOA 1QU2A 3N53A 1U8AA 2RMKA 1CUBA 2NTVA 4DSZA 1Z0BA 3EVCA 3B78A 1ORIA 2PKEA 5HKKA 2O5CA 2OHVA 3OIYA 5JRDS 5BXQC 3V7YA 5CA1B 1QIHA 5FNVF 5BN5A 2VSFA 3G2JA 3GUHA 3SYKA 2I66A 1G6Q1 4ZVMA 3VVMA 1WLSA 4DXAA 1SH7A 1IB6A 1YBAA 2VPXA 4X7PA 4YRZA 1CW2B 1LFDB 3Q9SA 1X0XA 1P7VA 1P7CA 1N0IA 1Z6PA 3GQVA 3LDHA 5GMDA 5L3SB 1IPHA 1ZWLA 2V58A 3O9MA 1CZKA 1H65A 3LY5A 5ALGA 2QJOA 3H6HA 3FYUC 3PNQA 3SYTA 4ZI7F 5KOJB 4P33A 5TS2A 3VPCA 4NBTA 3S29A 4C29A 4POAA 1RQRA 1E79A 1AHIA 4I99A 4TL7A 4AMUA 4IICA 2D4HA 3L0ZA 5U4QA 1KMQA 3T4EA 2CJWA 4ILEA 1VJRA 3V4FA 1A5BB 1RWPA 1WJGA 3OZBA 4J76A 2NUAB 4DJFC 1V48A 3DLTA 4BJ5A 4B46A 5TQ0A 1Y5YA 1SQ6A 2HHAA 1LNSA 1PJ8A 2FDXA 5JEAD 2VAWA 4PZ0A 3HTXA 1OZFA 4HVCA 3D8NA 3W1VA 4ZV7A 2D1RA 1N7JA 2KBFA 4DIDA 4L4RA 3VC2A 5LXTF 4QQFA 3RH0A 2BUAA 3V2IA 4O4HF 1KYZA 5FAKA 2H92A 2WHEA 3S2SA 1CSEE 4OX9I 4Z4CA 2E5WA 3K30A 4JYCA 1SC1A 4YCLA 5KBYA 1UWCA 1JN0A 5ABPA 3B7PA 2HMSA 1EJ0A 3PA6A 1IJEA 1MX5A 2C5SA 2QN3A 3DZJA 4KE9A 4LOAA 4U9HS 3GRZA 5AI5A 4W5TA 2WU1A 1K3TA 1ONNA 4E21A 4BFTA 1SK9A 2HNKA 2LGJA 3IEXA 5C0XE 5LWHA 5FLKA 1V7ZA 3PCXA 4L8WB 3I5XA 1QIIA 2CB9A 3L6EA 4MARA 4R5MA 2Q27A 1RI2A 4QXMA 1Z7WA 3EFOB 4Y9DA 3M6WA 3M6VA 5FYDA 4EFNA 3F73A 1KVSA 1LF5A 3E0QA 2IXAA 3DFMA 5DVZA 5A3SA 3HEBA 5LP6C 5JC8A 2A84A 3G9XA 4LFCE 3GFFA 1RKBA 1X9GA 3FMPB 1VB3A 1G21B 3DWGA 1N32B 3GLIB 5TVGA 2EHDA 1Q11A 2A5DA 3L41A 4ER7A 3SEZA 1UEKA 1AZSC 1OWLA 3LBAA 4TLBA 5JMPA 2I3BA 2QRNA 1VMDA 3SJUA 1OFVA 4DEXA 3BK7A 1EDDA 4YLGA 1GYRA 1RAFA 5E1MA 3TB4A 4DW8A 4ZO7A 2ZBKB 1D1SA 1XJ0A 5REQA 5K8LA 1T9ZA 3QFRA 1IK4A 1DMRA 2IYZA 2PR2A 1TD9A 3EC2A 4G5QA 3U1TA 3P2OA 3C3JA 3FDFA 1FSGA 1XXHA 2D06A 2WMYA 4F56A 2C78A 4DWJA 2Y6UA 1ZZEA 1P42A 2IY9A 2J0EA 2X86A 3ORHA 5EWMA 3T12A 3TQOA 4B79A 3W2GA 1H5UA 2VEDA 3MTEA 4RETA 5IAEA 4JYAI 4NEHB 3WNBA 3UJ3X 1VE9A 3FLMA 3G2MA 3D2CA 4M99A 4GXRA 4I7EA 5F1PA 2VUUA 3IMEA 3ZU5A 5C7OO 1C9MA 5IXYA 3Q3IA 1L5OA 2EX4A 3N2EA 2YY6A 5D1HA 5FBVB 1FUUA 2YHAA 2ZJYA 2WSIA 2FZGA 3CFYA 3LZCA 4PEVA 5CPBA 5CLQA 1M8FA 1GRCA 1KXJA 1U7OA 4WXYB 2GAOA 4FMPA 3ABRB 2BR2A 1QWOA 4TMZA 3PJRA 1E2MA 1F6DA 5ELXA 4DIBA 3CUWA 5KYXB 1K8ZB 1DL5A 2AC7A 2MOKA 2Q2WA 1H42A 3K6RA 1JTEA 3LCUA 2EFGA 2H1SA 3ZDEA 3LBHA 1DAIA 3BMNA 5HQJA 1RSZA 1CHDA 3KJGA 2W37A 1HORA 3GT7A 2Q7DA 1XE3A 3JARB 1E0DA 4G0NA 4U8HA 2VXCA 4JVSB 5ALOA 3KRTA 5FBZA 2IXEA 5AKEA 3B52X 1KSGA 3L6UA 4XWOA 1JALA 2G1PA 3MILA 2VESA 3DL4A 2O2JA 3ASYA 4J9UE 3GLLA 2G82A 1U3WA 4MEBA 1K0UA 2GDZA 3FTDA 2CNLA 1YS7A 5EJIA 4DCOA 4PINA 4DM4A 3W2HA 1L6IA 3W78A 4BC1A 3BVPA 2ZS9A 3PNBA 5E0KB 4HAYA 4FFBA 4URLA 2V6GA 2VLIA 3B3FA 3MWFA 2YWXA 3DE7X 4RVHA 4RJIA 3I4LA 1ZD3A 1RWBA 1X9HA 2R1UA 4QUJA 3SS7X 5K09A 1XMOB 1XELA 3JWGA 2WQZA 4ON9A 4UJ3A 5AKXA 3O4RA 3IP3A 3OA2A 2ECKA 1ZGGA 3H5VA 1RPJA 4P31A 1JEQA 3KSRA 3CLKA 3FZGA 3L1HA 4XE5A 5F3RA 3ZKDA 3SOZA 4CRWB 5EL9A 4QZVA 4PCAA 2P90A 1Z18A 1HNZE 1OD6A 3WL3A 5HUJA 3KYCA 1MA3A 3T7RA 1PVDA 4Q4AA 2IOFK 4ARAA 3U1YA 4FINA 1BHQ1 4U9UA 4BMXA 4Z54A 1XXLA