2ZM6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2zm6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2zm6E02
2NPFA 2DEIA 1X48A 4WUBA 2UXBI 2NA2A 1N34E 4LF8E 5LMNE 4PRVA 1N36I 2V2VA 4LFCE 2F4VE 4P7AA 2LUQA 4YHHI 1X49A 4B3TI 4HY1A 1H72C 2R42A 1FWLA 3J7AM 2UU9I 3B8HA 3LNUA 4LF9E 3ZKDA 2VQFE 3F0NA 4DV3E 2L33A 3JAMQ 4DV2E 2UUCI 4MYUA 3J81C 1OJ4A 4LF4I 1PKPA 4YY3E 1STUA 1HNZE 3PYEA 4DPWA 1FJGI 4DV6E 2VQFI 4X66I 2A2DA 4DUZI 1T4NA 1H73A 2MDRA 5L3JA 4X65I 4DUYI 4GKKE 1FI4A 2IHR1 4M2ZA 4NXNI 4DU8A 4DV4I 4LFBE 3T1HI 4DR7I 4DPYA 2RSMA 1U2RA 3T1HE 4DR7E 2A2CA 4DV5I 4XTJA 4I3HA 4PU9A 1HNWI 1HR0I 1DI2A 4EMDA 2E5LI 2DEJA 3QT5A 3PYDA 1B63A 1Z5CA 2NUFA 1KVKA 1N33E 2LTSA 4JI7E 2X7IA 4UTGA 4KQVA 1N34I 1HNZI 3J80C 2V34A 4LF5I 4X62I 2UXDI 4WFTA 4JI8E 5GMEA 4KHPE 3M6AA 2LTRA 4LF4E 2DB2A 1NZ0A 4DV3I 4AQYE 1IBKI 4X62E 2UXDE 4LF6E 1Z5AA 4GKJE 1QZRA 2L3CA 4JI7I 1KIJA 4DR3I 1RC7A 4WUDA 5FLXC 4JI1E 4JI6E 1J26A 3C4BA 3ZZUA 3Q1QA 2RS6A 4JI3E 4B3ME 1RQ0A 4DR1I 1EI1A 4DR4E 3PYGA 2BM0A 1YYOA 4LFBI 1Z0EA 2F4VI 1O0WA 4DR2E 1WHNA 1I94E 5LMUI 1NHJA 3P1XA 1FKAE 4FWHA 3ADLA 1Z0BA 4DU7A 1HNXI 2OI2A 1S4EA 4USMA 1FJGE 2RTXA 4JG4A 4DPTA 4HACA 1X47A 1GQEA 2AJ4A 2YT4A 1D6TA 3ZM7A 3OTOI 4LFAE 1YYKA 3CWVA 2UUCE 3HULA 5IT9Q 3WU3A 5GMDA 3ADIA 4NXME 1K47A 2E1RA 1Z0TA 1MG7A 4X64I 4FWGA 3HTXA 2CPNA 1B62A 3H4LA 2E5LE 1XMQE 1I94I 1T4LB 5A2QC 2UXCE 2UU9E 1H74A 4MYTA 1KKHA 4JI0E 3ADGA 1IBME 1PIEA 4LFCI 3JAMC 1N36E 3B82A 5CFFE 4NXNE 1XMQI 4JI1I 4OOGC 4DXLA 4X65E 4DUYE 1NHHA 4JYAI 1ZM4A 5BR8E 4HYMA 4DV6I 4LF7E 1T4OA 2ZITA 4LF6I 1IBLI 5IWAE 2WW4A 2UUAI 4FN5A 4URLA 1EKZA 1RREA 3V5RA 2UUBE 1NHIA 4FWDA 3PYFA 1ZBTA 3T1YI 4B3SI 1BKNA 1XMOI 1Z0VA 4WUCA 2L3JA 2JVAA 1MX0A 3J7AG 4DV0I 4DV7E 5LMUE 4USKA 1Z59A 3J80Q 4B3RE 1ELOA 2HKEA 4M1KA 1N32E 4JI6I 1J5EE 4DV0E 4JI5E 2JY9A 5LMNI 4JV5I 3ADJA 4LF8I 4UT4A 4X64E 1UEKA 1FWKA 1XMOE 3VYXA 1H7SA 2LRSA 3K1JA 3T1YE 3WU4A 2HKJA 1Z5BA 4LFAI 2UUAE 4KHPI 1XNRI 1QU6A 4OX9I 2LUPB 2XEXA 4JI2I 1VISA 2KHXA 5BR8I 1N0VC 2HK3A 4P52A 1J5EI 2Q2EB 2HK2A 1HR0E 1UHZA 1H7UA 3LTOA 4DV5E 2BV3A 4B3RI 4JI0I 2HHHE 1ZM2A 4JI3I 4DV4E 3ZZTA 3WU6A 1A6FA 3C4TA 2N3GA 4DUZE 4PRXA 2DIXA 2VQEI 4YY3I 2LJHA 1WUUA 1ZXMA 4B3SE 2CZ9A 4NXMI 4Z7CA 2BM1A 2HFUA 2B3TB 1ZXNA 4JI8I 1DARA 3K17A 4DR5E 5IWAI 2X36A 2DMYA 4M30A 3LPSA 3J7Yp 2NUEA 4DKKA 2VQEE 2L2KB 1YYWA 1ZM3A 2LJPA 1EA6A 2J7KA 1HNXE 4JV5E 1UILA 3GONA 3QT8A 4JI5I 4JYAE 4DV1I 4LF9I 4DR2I 3ZZ0A 4DR6I 1IBMI 5FLXQ 2L2NA 4DR4I 2RS7A 1YZ9A 2HHHI 2V8PA 4DR1E 4B3MI 2UXCI 4ZVIA 4DR6E 4WYQB 5LL6R 4DV1E 4Z7YA 4GKKI 4DV7I 4R1FA 1Z0WA 2B7TA 4DR3E 4JI2E 1N0UA 1ZM9A 5A2QQ 4HXZA 4FW9A 3QT6A 2UXBE 2ZM6E 4K0KE 2VF3A 4GKJI 1Z0GA 4DR5I 1IBKE 1FNMA 1XNRE 1MU5A 4AQYI 2GS8A 2UUBI 4RPFA 2L2MA 3OTOE 2ZBKB 2NUGA 1IBLE 5IT9C 4LF5E 4K0KI 1Z0CA 3J81Q 3B78A 2ZM6I 4LF7I 1N33I 1WHQA 1KTVA 1XHKA 3ZKBA 1N32I 4JI4E 2V2QA 2V2ZA 1HNWE 3D4JA 2B7VA 2EZ6A 4B3TE 4YHHE 4X8WA 3QT7A 4DPUA 2EFGA 4JI4I 3WU5A 1PVGA 1S16A 4X66E 3LLHA 4OX9E 3VYYA 2R3VA 1RR9A 2HFSA 4DPXA 4HACB 1XNQI 2N3HA 4ED4A 4DV2I 2LBSB 3V2UC 1XNQE
chains in the Genus database with same CATH superfamily
2NPFA 2CG9A 2DEIA 1X48A 2VRDA 1DQ3A 2LMZA 4WUBA 2NA2A 4LU9A 1N34E 3L7ZA 2UXBI 2EMKA 2FV4B 4LF8E 5C0XF 1E3PA 5LMNE 4PRVA 5EKWA 1E3HA 4KZSA 3EQ1A 4N4RB 4O5GA 4AIDA 1N36I 2ADRA 2V2VA 4LFCE 2F4VE 2JEBA 3DJWA 2JP9A 2I9IA 2ELZA 4P7AA 2LUQA 4F6MA 2DSYA 5F3WA 1UBDC 1X49A 4YHHI 4B3TI 3BF2A 5A6BD 4HY1A 4AM3A 2EPUA 1H72C 2R42A 2EQ3A 1FWLA 2UU9I 3B8HA 3LNUA 3TQMA 3J7AM 2F1DA 3AUZA 4LF9E 3H1CA 2BR2A 3L00A 4GQUA 1XXEA 4J8ZA 1ZBQA 2LVHA 2PO2A 4IFDC 1NCSA 5KL4A 2EPNA 2BA0G 3ZKDA 2JR1A 2M9AA 3HPZA 2VQFE 2CSHA 3BIDA 2EM7A 3F0NA 2JPAA 5A69A 2EMYA 1UN6B 4R2QA 1X5WA 2YTFA 4FW4A 2DLKA 4U3BA 4DV3E 1PJQA 4TUGA 5AASA 1G2DC 2L33A 4LPFA 3OMLA 4MU1A 3JAMQ 2DGCA 4DV2E 2UUCI 4MYUA 3J81C 1OJ4A 2YTPA 4MLQA 4IZKA 2YZTA 3P3EA 4LF4I 4R8OA 4ISAA 3M7NG 1PKPA 2EPZA 3LMLA 4YY3E 1STUA 1HNZE 3PYEA 4DPWA 1FJGI 2KONA 4DV6E 5DRPA 2VQFI 4X66I 2A2DA 2JXPA 4DUZI 4HEIA 1T4NA 2YTIA 1H73A 1UDQA 2MDRA 4MDTA 5L3JA 2CVEA 1LLMC 1JK2A 4GKKE 1FI4A 1OYPA 4X65I 2IHR1 4M2ZA 1A1IA 4NXNI 4DU8A 3K6QA 4DV4I 1R6MA 2NN6D 4LFBE 2M1SA 2EPRA 1L4SA 3PRYA 4P7DA 1RHYA 3T1HI 4DR7I 4OO1E 4DPYA 2RSMA 4NBQA 1U2RA 4FW6A 3T1HE 4DR7E 2A2CA 2EPLX 2EOIA 3ZOQB 3UK3C 4XTJA 4U3DA 4PU9A 4I3HA 4Q28A 2PRTA 4DV5I 2R1FA 1HNWI 1HR0I 1DI2A 4MU4A 4EMDA 2BA1G 2DEJA 2E5LI 3QT5A 4DUYI 3PYDA 1B63A 1Z5CA 4F9AB 4X9JA 1YSAC 2NUFA 1IMUA 1KVKA 2WP8B 1YHCA 2NABA 1N33E 2LTSA 4JI7E 2X7IA 4UTGA 4GZNC 4KQVA 5JEAB 1N34I 1HNZI 3J80C 3DF6A 2V34A 4LF5I 4X62I 2UXDI 4WFTA 4JI8E 3GCMA 3GLLA 2EMWA 4KHPE 5GMEA 2YTNA 3M6AA 2JT2A 2LTRA 4WXCA 4LF4E 2DB2A 4AIMA 2PNZA 3PS2A 1NZ0A 3QG5C 1YH8A 4FK5C 3GMEA 2YU5A 2YTGA 5C0XB 4IS1C 1P47A 4AQYE 4DV3I 4IFDA 5K36E 3M85G 1IBKI 2PO1A 4X62E 2UXDE 1BBGA 4LF6E 1Z5AA 2EMFA 5AE1A 4GKJE 1QZRA 2EM5A 4NZVA 2L3CA 2IOQA 2EMBA 2JE6B 2JYAA 1KIJA 4JI7I 2WP8A 3DD6A 4P78A 2L92A 3HPSA 4DR3I 1RC7A 5JEAE 1TF3A 4WUDA 5FLXC 4BHCA 3KRNA 4JI1E 2VE7C 4JI6E 1J26A 3C4BA 3ZZUA 3Q1QA 2RS6A 2V89A 2O1VA 2EP3A 4JI3E 4B3ME 1DGCA 2ODRD 1RQ0A 2PO0A 5DROA 5EL9A 3F6HA 4DR1I 4F9BB 1EI1A 4LCFA 4DR4E 4L8NA 2NN6F 3PYGA 2LJUA 2BM0A 1YYOA 4LFBI 1Z0EA 2NN6E 2F4VI 2EOHA 1O0WA 4DR2E 1UDSA 1WHNA 1I94E 2EOZA 5LMUI 4IZJB 4R2DA 1NHJA 3P1XA 1FKAE 2EOQA 4FWHA 3ADLA 1Z0BA 4DU7A 4F54A 1HNXI 1A1LA 2OI2A 1KYQA 1S4EA 1PJTA 2EMIA 3P76A 4USMA 2E72A 1FJGE 2RTXA 1UDNA 3IWDA 4HACA 4JG4A 2EPAA 4DPTA 1X47A 1GQEA 2AJ4A 3IWCA 2YT4A 3CDIA 1USVA 1D6TA 1AH5A 5DRQA 2V8QB 3ZM7A 5IXMB 4LFAE 2V83A 1YYKA 3OTOI 3MSWA 1BB8A 2M4IA 2UUCE 2GQ0A 2JE6A 3CWVA 3HULA 5IT9Q 4LCHA 3WU3A 5GMDA 3ADIA 2MDGA 4NXME 1K47A 2HJJA 2E1RA 5DNLA 4GEQB 1Z0TA 2PNZB 4WXDA 1MG7A 4BS9A 5AC4A 4KWYA 4R2PA 4X64I 5K36A 1PDAA 4FWGA 3HTXA 2L6MA 2EOSA 3U1YA 5DNXA 2CPNA 1B62A 2PO0B 4R2SA 2EN6A 2LT7A 3H4LA 2E5LE 1XMQE 2EN2A 2EM2A 1I94I 1YPNA 2EE8A 2EJ4A 4BBYA 5A2QC 4R2RA 1T4LB 2BR2B 2UXCE 2YTQA 2UU9E 1H74A 4MYTA 4OO1B 2B9DA 1A1GA 1WJPA 1WXRA 4OO1A 1KKHA 4JI0E 3ADGA 2WNRA 2LE2A 2V87A 5LLQA 4WSPA 1G2FC 1IBME 1PIEA 4MLVA 4LFCI 3JAMC 4F9CB 1N36E 3B82A 5CFFE 4NXNE 1XMQI 4JI1I 4OOGC 4R2AA 4X65E 4DUYE 1NHHA 4DXLA 4JYAI 1ZU1A 1ZM4A 5BR8E 1QNTA 4BCAA 4HYMA 3K85A 4IFDB 3EPLA 1UDOA 4DV6I 3JU0A 4LF7E 3JTZA 1T4OA 2V88A 4WSGA 2ZITA 3ECRA 4LF6I 2J65A 1IBLI 5A6KA 5IWAE 3M7ND 2WW4A 2E1MA 1JK1A 4FN5A 4URLA 2UUAI 1EKZA 4MU0A 4FW5A 1RREA 3V5RA 2GO3A 4R03A 2UUBE 1NHIA 4FWDA 2EM4A 1X6EA 5C0XE 3PYFA 1ZBTA 3T1YI 4B3SI 2G7HA 2VESA 3Q6MA 1BKNA 1IQSA 2GPIA 2EQ1A 2C39B 1XMOI 2CT1A 1Z0VA 3AV0A 2JWOA 5JEAD 5A6BA 4WUCA 2Z5CB 1X6FA 2L3JA 2ENCA 2WBTA 2FTXB 2JVAA 1MX0A 3PS3A 3J7AG 4DV0I 4BMJA 4DV7E 5LMUE 4USKA 2EMLA 2YTOA 1Z59A 2LCEA 3EPHA 4ZYHA 2CGEA 4WX9A 2J7JA 4QNKA 4BA1A 3J80Q 2MC6A 5FWKA 1IQOA 2ODRC 2EPOA 1F2IG 4B3RE 1ELOA 2EM6A 3MHHC 2HKEA 4M1KA 4HTGA 4RH8A 1Y5YA 2EPKX 1EH6A 1N32E 2EMHA 4JI6I 1J5EE 1T39A 1Y4SA 4DV0E 1VI7A 2JOBA 4JI5E 2Z5CA 4IZKB 2JY9A 4OO1C 1A1HA 5LMNI 4JV5I 3ADJA 4LF8I 4N3OA 4DMIA 4UT4A 4BHBA 2EOOA 4X64E 1UEKA 2JEBB 1FWKA 3M85D 1XMOE 3VYXA 1H7SA 3P3CA 2LRSA 3K1JA 2EL4A 3T1YE 2EPCA 2GHFA 3F6GA 3VHTB 5DNYA 3WU4A 4IFDF 3L7ZB 3P06A 4OKGA 2EOMA 2HKJA 2EWLA 1Z5BA 5K36C 2MKNA 1AAYA 4LFAI 2UUAE 4KHPI 2MKDA 2Q8UA 1XNRI 2VF1A 1QU6A 4O43A 5JEAC 2V85A 5KL5A 4IS9A 2YRMA 4NHRA 4OX9I 4O4KA 5KL2A 5C0XD 2EMXA 5KL3A 2LUPB 2XEXA 1WRJA 4JI2I 1VISA 2KHXA 5BR8I 2F8BA 1N0VC 4OO1D 2HK3A 4P52A 2O3ZA 2PNMA 2EORA 2HK2A 2Q2EB 1HR0E 1J5EI 1UHZA 2EOFA 2DLQA 2EPXA 1H7UA 4LOMA 2EOXA 4ZYDA 3LTOA 4DV5E 3KZYA 2BV3A 4B3RI 4JI0I 2HHHE 1ZM2A 2IESA 3EPKA 5IV8B 4BA2B 2EN7A 2RSIA 2NN6C 3CDJA 2MC5A 2EPPA 3IWBA 4M9VC 3BGHA 4JI3I 4DV4E 1ZR9A 2ENAA 4M0VA 2IOPA 4MU3A 5K36B 3ZZTA 3WU6A 1A6FA 2K4VA 4I8OA 2EMCA 2N3GA 3C4TA 4DUZE 4PRXA 2N8XA 1N3GA 2C37A 4IFDE 2DIXA 1Y4UA 3THOB 5C0XC 2C38A 2EOJA 2YTJA 2ENHA 2VQEI 4ZYGA 3RMPA 4YY3I 2EM0A 2LJHA 1WUUA 1ZXMA 5DRRA 4OZEA 2WBUA 3HXLA 3VK6A 5K36D 4B3SE 2CZ9A 4NXMI 4Z7CA 2BM1A 2HFUA 5AE2A 3M99B 2B3TB 2M7QA 1OYRA 3EPJA 3B4TA 3THNA 2AE8A 1ZXNA 3HKMA 4JI8I 1KJKA 1DARA 3H09A 4DR5E 1TF6A 3K17A 5IWAI 2X36A 2EPMX 2WBSA 2DMYA 4M30A 2NN6B 2PNLA 4FW7A 2YRHA 3BBGA 3LPSA 4IJDA 2EM3A 3FIGA 4DKKA 3J7Yp 2L2KB 2VQEE 1YYWA 2NUEA 1ZM3A 1EA6A 2C37B 2LJPA 2J7KA 1HNXE 4JV5E 4IFDD 1UILA 3GONA 4J3DA 3QT8A 1X3CA 4JI5I 5ELWA 2Z5EA 3KWRA 4JYAE 2PO2B 1MEYC 4DV1I 3HQ1A 2WZOA 2EN8A 1B69A 4LF9I 2YSPA 2BA1D 4DR2I 3ZZ0A 4DR6I 5KL6A 4BA2A 1IBMI 3MHSC 5AC5A 3PS1A 5FLXQ 4OO1F 2L2NA 4DR4I 2LO3A 2RS7A 2GLIA 1ZAAC 2L8TA 1YZ9A 3Q6NA 2HHHI 1R6LA 2V8PA 2EN4A 4DR1E 2K7IA 2EQ0A 4B3MI 2O1WA 4ZVIA 4DR6E 2UXCI 4WYQB 5LL6R 2JEAB 2BB8A 4TUIA 2WNRB 2I13A 4DV1E 1Z1BA 3P3GA 4Z7YA 4DV7I 2LV2A 2JEAA 4GKKI 2O1UA 4BC7A 2D9HA 4R1FA 3UHMA 1Z0WA 2B7TA 4DR3E 2BBGA 4JI2E 1N0UA 1ZM9A 4IZJD 2JOXA 4F6NA 3KZZA 5AE3A 4HXZA 2YPNA 5A2QQ 2HC5A 4FW9A 4RHBB 2DRPA 2ZM6E 2UXBE 3QT6A 2PO1B 4K0KE 2VF3A 4GKJI 1X6HA 1Z0GA 1GTKA 2EM8A 1IBKE 1FNMA 1XNRE 4DR5I 1MU5A 4AQYI 2GO4A 3U1KA 1YFHA 2WCC3 2CTDA 2GS8A 2UUBI 4F2JC 2EMAA 4RPFA 5JEAA 2L2MA 5K36F 3NZKA 5A6JA 2ELYA 3OTOE 1A1FA 2ZBKB 2NUGA 4BC9A 2EL6A 2YWQA 1EH8A 5IT9C 1IBLE 2YRKA 4ZYEA 4LF5E 1P42A 4K0KI 5TSEA 2YU8A 1Z0CA 3J81Q 1Y60A 1HK7A 3B78A 2ZM6I 4LF7I 1A1KA 1N33I 2EOYA 2YTEA 2IERA 1SFEA 2A25A 1WHQA 1MGTA 5JEAF 2KOUA 1KTVA 1XHKA 2Z5BA 3ZKBA 4R2EA 1A1JA 2V86A 2BA0D 2EN1A 2EMZA 2EM9A 2YSOA 5KL7A 1PJSA 2C38B 4MQYA 4JI4E 1N32I 1BBOA 1GZ6A 5T6JA 2V2QA 2V2ZA 1HNWE 3D4JA 4QNJA 2YTDA 2B7VA 2EZ6A 3HJCA 1YUIA 1SR9A 1T38A 4IZJA 4B3TE 2EL5A 2FGGA 2R76A 4YHHE 4X8WA 3QT7A 4BA1B 4DPUA 4WPYA 2EFGA 4JI4I 4L5NC 1TN9A 3C6KA 1USUA 1Y6ZA 2NN6A 2Z5BB 5A6AA 2EN3A 3WU5A 1PVGA 4O24A 4LCGA 1RMDA 1S16A 2RQLA 4FW3A 4X66E 3LLHA 4OX9E 2C39A 1YUJA 3VYYA 1NEIA 5ADZA 3C6MA 2R3VA 1RR9A 2HFSA 4DPXA 4HACB 4LTYA 1XNQI 2N3HA 1OYSA 1EH7A 4ED4A 2H36X 4Q35B 2RPCA 4DV2I 2LBSB 2DMIA 4R2CA 3V2UC 5C0XA 2HGHA 2EMGA 2O1TA 1XNQE 2EOEA
chains in the Genus database with same CATH topology
2NPFA 2CG9A 2DEIA 1X48A 1DQ3A 2LMZA 4WUBA 2NA2A 4LU9A 1N34E 2UXBI 2FV4B 4LF8E 5LMNE 4PRVA 4KZSA 1N36I 2V2VA 4LFCE 2F4VE 3DJWA 4P7AA 2LUQA 2DSYA 5F3WA 4YHHI 1X49A 4B3TI 4HY1A 1H72C 2R42A 1FWLA 3J7AM 2UU9I 3B8HA 3LNUA 3AUZA 4LF9E 4J8ZA 1ZBQA 3ZKDA 2JR1A 3HPZA 2VQFE 3F0NA 4DV3E 4TUGA 5AASA 2L33A 3OMLA 3JAMQ 4DV2E 2UUCI 4MYUA 3J81C 1OJ4A 4IZKA 4LF4I 2YZTA 4R8OA 1PKPA 3LMLA 4YY3E 1STUA 1HNZE 3PYEA 4DPWA 1FJGI 2KONA 4DV6E 2VQFI 4X66I 2A2DA 4DUZI 1T4NA 1H73A 2MDRA 5L3JA 4X65I 4DUYI 4GKKE 1FI4A 2IHR1 4M2ZA 4NXNI 4DU8A 3K6QA 4DV4I 4LFBE 2M1SA 3PRYA 4P7DA 3T1HI 4DR7I 4DPYA 2RSMA 1U2RA 3T1HE 4DR7E 2A2CA 4DV5I 3ZOQB 4XTJA 4I3HA 4PU9A 1HNWI 4Q28A 1HR0I 1DI2A 4EMDA 2E5LI 2DEJA 3QT5A 3PYDA 1B63A 1Z5CA 4F9AB 2NUFA 1KVKA 1N33E 2LTSA 4JI7E 2X7IA 4UTGA 4KQVA 1N34I 1HNZI 3J80C 3DF6A 2V34A 4LF5I 4X62I 2UXDI 4WFTA 4JI8E 5GMEA 4KHPE 3M6AA 2LTRA 4LF4E 2DB2A 1NZ0A 4DV3I 4AQYE 1IBKI 4X62E 2UXDE 4LF6E 1Z5AA 4GKJE 5AE1A 1QZRA 2L3CA 2IOQA 4JI7I 1KIJA 4P78A 2L92A 3HPSA 4DR3I 1RC7A 4WUDA 5FLXC 4JI1E 2VE7C 4JI6E 1J26A 3C4BA 3ZZUA 3Q1QA 2RS6A 2V89A 2O1VA 4JI3E 4B3ME 2ODRD 1RQ0A 4DR1I 3F6HA 4F9BB 1EI1A 4DR4E 4L8NA 3PYGA 2BM0A 1YYOA 4LFBI 1Z0EA 2F4VI 1O0WA 4DR2E 1WHNA 1I94E 5LMUI 4IZJB 1NHJA 3P1XA 1FKAE 4FWHA 3ADLA 1Z0BA 4DU7A 4F54A 1HNXI 2OI2A 1S4EA 4USMA 1FJGE 2RTXA 4JG4A 3IWDA 4HACA 4DPTA 1X47A 1GQEA 2AJ4A 3IWCA 2YT4A 1USVA 1D6TA 3ZM7A 2V8QB 3OTOI 4LFAE 2V83A 1YYKA 3MSWA 3CWVA 2M4IA 2UUCE 2GQ0A 3HULA 5IT9Q 3WU3A 5GMDA 3ADIA 4NXME 1K47A 2E1RA 4GEQB 1Z0TA 1MG7A 4BS9A 4X64I 4FWGA 3HTXA 2L6MA 2CPNA 1B62A 3H4LA 2E5LE 1XMQE 1I94I 1T4LB 5A2QC 4BBYA 2UXCE 2UU9E 1H74A 4MYTA 2B9DA 1WXRA 1KKHA 4JI0E 3ADGA 2LE2A 2V87A 4WSPA 1IBME 1PIEA 4LFCI 3JAMC 4F9CB 1N36E 3B82A 5CFFE 4NXNE 1XMQI 4JI1I 4OOGC 4DXLA 4X65E 4DUYE 1NHHA 4JYAI 1ZM4A 5BR8E 4BCAA 4HYMA 3K85A 4DV6I 3JU0A 4LF7E 3JTZA 1T4OA 2V88A 2ZITA 4LF6I 1IBLI 5IWAE 2WW4A 2E1MA 2UUAI 4FN5A 4URLA 1EKZA 1RREA 3V5RA 4R03A 2UUBE 1NHIA 4FWDA 3PYFA 1ZBTA 3T1YI 4B3SI 2G7HA 3Q6MA 1BKNA 1XMOI 1Z0VA 3AV0A 2JWOA 4WUCA 2Z5CB 2L3JA 2FTXB 2JVAA 1MX0A 3J7AG 4DV0I 4BMJA 4DV7E 5LMUE 4USKA 1Z59A 2CGEA 3J80Q 2MC6A 5FWKA 2ODRC 4B3RE 1ELOA 2HKEA 4M1KA 1N32E 4JI6I 1J5EE 1Y4SA 4DV0E 2JOBA 4JI5E 2Z5CA 4IZKB 2JY9A 5LMNI 4JV5I 3ADJA 4LF8I 4N3OA 4DMIA 4UT4A 4X64E 1UEKA 1FWKA 1XMOE 3VYXA 1H7SA 2LRSA 3K1JA 3T1YE 3WU4A 3F6GA 5DNYA 3P06A 2HKJA 2EWLA 1Z5BA 4LFAI 2UUAE 4KHPI 1XNRI 2VF1A 1QU6A 2V85A 4OX9I 2LUPB 2XEXA 4JI2I 1VISA 2KHXA 5BR8I 2F8BA 1N0VC 2HK3A 4P52A 2PNMA 1J5EI 2Q2EB 2HK2A 1HR0E 1UHZA 1H7UA 3LTOA 4DV5E 2BV3A 4B3RI 4JI0I 2HHHE 1ZM2A 2MC5A 3IWBA 4JI3I 4DV4E 4M0VA 2IOPA 3ZZTA 3WU6A 1A6FA 2K4VA 4I8OA 3C4TA 2N3GA 4DUZE 4PRXA 2DIXA 1Y4UA 2VQEI 3RMPA 4YY3I 2LJHA 1WUUA 1ZXMA 3HXLA 3VK6A 4B3SE 2CZ9A 4NXMI 4Z7CA 2BM1A 2HFUA 5AE2A 2M7QA 2B3TB 1ZXNA 4JI8I 1DARA 3H09A 4DR5E 3K17A 5IWAI 2X36A 2PNLA 2DMYA 4M30A 3LPSA 3J7Yp 3FIGA 4DKKA 2VQEE 2L2KB 1YYWA 2NUEA 1ZM3A 2LJPA 1EA6A 2J7KA 1HNXE 4JV5E 1UILA 3GONA 3QT8A 4JI5I 2Z5EA 3KWRA 4JYAE 4DV1I 3HQ1A 2WZOA 4LF9I 4DR2I 3ZZ0A 4DR6I 1IBMI 5FLXQ 2L2NA 4DR4I 2RS7A 1YZ9A 2L8TA 3Q6NA 2HHHI 2V8PA 4DR1E 4B3MI 2O1WA 4ZVIA 4DR6E 2UXCI 4WYQB 5LL6R 4TUIA 4DV1E 4Z7YA 4GKKI 4DV7I 2O1UA 4BC7A 4R1FA 1Z0WA 2B7TA 4DR3E 4JI2E 1N0UA 1ZM9A 4IZJD 2JOXA 5A2QQ 5AE3A 4HXZA 4FW9A 3QT6A 2UXBE 2ZM6E 4K0KE 2VF3A 4GKJI 1Z0GA 4DR5I 1IBKE 1FNMA 1XNRE 1MU5A 4AQYI 2GS8A 2UUBI 4RPFA 2L2MA 3OTOE 2ZBKB 2NUGA 4BC9A 1IBLE 5IT9C 4LF5E 4K0KI 1Z0CA 3J81Q 3B78A 1HK7A 2ZM6I 4LF7I 1N33I 1WHQA 2KOUA 1KTVA 1XHKA 2Z5BA 3ZKBA 2V86A 1N32I 4JI4E 1GZ6A 5T6JA 2V2QA 2V2ZA 1HNWE 3D4JA 2B7VA 2EZ6A 3HJCA 1SR9A 4IZJA 4B3TE 2FGGA 4YHHE 4X8WA 3QT7A 4DPUA 4WPYA 2EFGA 4JI4I 4L5NC 1USUA 1Y6ZA 2Z5BB 3WU5A 1PVGA 1S16A 4X66E 3LLHA 4OX9E 3VYYA 5ADZA 2R3VA 1RR9A 2HFSA 4DPXA 4HACB 4LTYA 1XNQI 2N3HA 4ED4A 2H36X 4DV2I 2LBSB 3V2UC 2O1TA 1XNQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPF A;  2DEI A;  1X48 A;  4WUB A;  2UXB I;  2NA2 A;  1N34 E;  4LF8 E;  5LMN E;  4PRV A;  1N36 I;  2V2V A;  4LFC E;  2F4V E;  4P7A A;  2LUQ A;  4YHH I;  1X49 A;  4B3T I;  4HY1 A;  1H72 C;  2R42 A;  1FWL A;  3J7A M;  2UU9 I;  3B8H A;  3LNU A;  4LF9 E;  3ZKD A;  2VQF E;  3F0N A;  4DV3 E;  2L33 A;  3JAM Q;  4DV2 E;  2UUC I;  4MYU A;  3J81 C;  1OJ4 A;  4LF4 I;  1PKP A;  4YY3 E;  1STU A;  1HNZ E;  3PYE A;  4DPW A;  1FJG I;  4DV6 E;  2VQF I;  4X66 I;  2A2D A;  4DUZ I;  1T4N A;  1H73 A;  2MDR A;  5L3J A;  4X65 I;  4DUY I;  4GKK E;  1FI4 A;  2IHR 1;  4M2Z A;  4NXN I;  4DU8 A;  4DV4 I;  4LFB E;  3T1H I;  4DR7 I;  4DPY A;  2RSM A;  1U2R A;  3T1H E;  4DR7 E;  2A2C A;  4DV5 I;  4XTJ A;  4I3H A;  4PU9 A;  1HNW I;  1HR0 I;  1DI2 A;  4EMD A;  2E5L I;  2DEJ A;  3QT5 A;  3PYD A;  1B63 A;  1Z5C A;  2NUF A;  1KVK A;  1N33 E;  2LTS A;  4JI7 E;  2X7I A;  4UTG A;  4KQV A;  1N34 I;  1HNZ I;  3J80 C;  2V34 A;  4LF5 I;  4X62 I;  2UXD I;  4WFT A;  4JI8 E;  5GME A;  4KHP E;  3M6A A;  2LTR A;  4LF4 E;  2DB2 A;  1NZ0 A;  4DV3 I;  4AQY E;  1IBK I;  4X62 E;  2UXD E;  4LF6 E;  1Z5A A;  4GKJ E;  1QZR A;  2L3C A;  4JI7 I;  1KIJ A;  4DR3 I;  1RC7 A;  4WUD A;  5FLX C;  4JI1 E;  4JI6 E;  1J26 A;  3C4B A;  3ZZU A;  3Q1Q A;  2RS6 A;  4JI3 E;  4B3M E;  1RQ0 A;  4DR1 I;  1EI1 A;  4DR4 E;  3PYG A;  2BM0 A;  1YYO A;  4LFB I;  1Z0E A;  2F4V I;  1O0W A;  4DR2 E;  1WHN A;  1I94 E;  5LMU I;  1NHJ A;  3P1X A;  1FKA E;  4FWH A;  3ADL A;  1Z0B A;  4DU7 A;  1HNX I;  2OI2 A;  1S4E A;  4USM A;  1FJG E;  2RTX A;  4JG4 A;  4DPT A;  4HAC A;  1X47 A;  1GQE A;  2AJ4 A;  2YT4 A;  1D6T A;  3ZM7 A;  3OTO I;  4LFA E;  1YYK A;  3CWV A;  2UUC E;  3HUL A;  5IT9 Q;  3WU3 A;  5GMD A;  3ADI A;  4NXM E;  1K47 A;  2E1R A;  1Z0T A;  1MG7 A;  4X64 I;  4FWG A;  3HTX A;  2CPN A;  1B62 A;  3H4L A;  2E5L E;  1XMQ E;  1I94 I;  1T4L B;  5A2Q C;  2UXC E;  2UU9 E;  1H74 A;  4MYT A;  1KKH A;  4JI0 E;  3ADG A;  1IBM E;  1PIE A;  4LFC I;  3JAM C;  1N36 E;  3B82 A;  5CFF E;  4NXN E;  1XMQ I;  4JI1 I;  4OOG C;  4DXL A;  4X65 E;  4DUY E;  1NHH A;  4JYA I;  1ZM4 A;  5BR8 E;  4HYM A;  4DV6 I;  4LF7 E;  1T4O A;  2ZIT A;  4LF6 I;  1IBL I;  5IWA E;  2WW4 A;  2UUA I;  4FN5 A;  4URL A;  1EKZ A;  1RRE A;  3V5R A;  2UUB E;  1NHI A;  4FWD A;  3PYF A;  1ZBT A;  3T1Y I;  4B3S I;  1BKN A;  1XMO I;  1Z0V A;  4WUC A;  2L3J A;  2JVA A;  1MX0 A;  3J7A G;  4DV0 I;  4DV7 E;  5LMU E;  4USK A;  1Z59 A;  3J80 Q;  4B3R E;  1ELO A;  2HKE A;  4M1K A;  1N32 E;  4JI6 I;  1J5E E;  4DV0 E;  4JI5 E;  2JY9 A;  5LMN I;  4JV5 I;  3ADJ A;  4LF8 I;  4UT4 A;  4X64 E;  1UEK A;  1FWK A;  1XMO E;  3VYX A;  1H7S A;  2LRS A;  3K1J A;  3T1Y E;  3WU4 A;  2HKJ A;  1Z5B A;  4LFA I;  2UUA E;  4KHP I;  1XNR I;  1QU6 A;  4OX9 I;  2LUP B;  2XEX A;  4JI2 I;  1VIS A;  2KHX A;  5BR8 I;  1N0V C;  2HK3 A;  4P52 A;  1J5E I;  2Q2E B;  2HK2 A;  1HR0 E;  1UHZ A;  1H7U A;  3LTO A;  4DV5 E;  2BV3 A;  4B3R I;  4JI0 I;  2HHH E;  1ZM2 A;  4JI3 I;  4DV4 E;  3ZZT A;  3WU6 A;  1A6F A;  3C4T A;  2N3G A;  4DUZ E;  4PRX A;  2DIX A;  2VQE I;  4YY3 I;  2LJH A;  1WUU A;  1ZXM A;  4B3S E;  2CZ9 A;  4NXM I;  4Z7C A;  2BM1 A;  2HFU A;  2B3T B;  1ZXN A;  4JI8 I;  1DAR A;  3K17 A;  4DR5 E;  5IWA I;  2X36 A;  2DMY A;  4M30 A;  3LPS A;  3J7Y p;  2NUE A;  4DKK A;  2VQE E;  2L2K B;  1YYW A;  1ZM3 A;  2LJP A;  1EA6 A;  2J7K A;  1HNX E;  4JV5 E;  1UIL A;  3GON A;  3QT8 A;  4JI5 I;  4JYA E;  4DV1 I;  4LF9 I;  4DR2 I;  3ZZ0 A;  4DR6 I;  1IBM I;  5FLX Q;  2L2N A;  4DR4 I;  2RS7 A;  1YZ9 A;  2HHH I;  2V8P A;  4DR1 E;  4B3M I;  2UXC I;  4ZVI A;  4DR6 E;  4WYQ B;  5LL6 R;  4DV1 E;  4Z7Y A;  4GKK I;  4DV7 I;  4R1F A;  1Z0W A;  2B7T A;  4DR3 E;  4JI2 E;  1N0U A;  1ZM9 A;  5A2Q Q;  4HXZ A;  4FW9 A;  3QT6 A;  2UXB E;  2ZM6 E;  4K0K E;  2VF3 A;  4GKJ I;  1Z0G A;  4DR5 I;  1IBK E;  1FNM A;  1XNR E;  1MU5 A;  4AQY I;  2GS8 A;  2UUB I;  4RPF A;  2L2M A;  3OTO E;  2ZBK B;  2NUG A;  1IBL E;  5IT9 C;  4LF5 E;  4K0K I;  1Z0C A;  3J81 Q;  3B78 A;  2ZM6 I;  4LF7 I;  1N33 I;  1WHQ A;  1KTV A;  1XHK A;  3ZKB A;  1N32 I;  4JI4 E;  2V2Q A;  2V2Z A;  1HNW E;  3D4J A;  2B7V A;  2EZ6 A;  4B3T E;  4YHH E;  4X8W A;  3QT7 A;  4DPU A;  2EFG A;  4JI4 I;  3WU5 A;  1PVG A;  1S16 A;  4X66 E;  3LLH A;  4OX9 E;  3VYY A;  2R3V A;  1RR9 A;  2HFS A;  4DPX A;  4HAC B;  1XNQ I;  2N3H A;  4ED4 A;  4DV2 I;  2LBS B;  3V2U C;  1XNQ E; 
#chains in the Genus database with same CATH topology
 2NPF A;  2CG9 A;  2DEI A;  1X48 A;  2VRD A;  1DQ3 A;  2LMZ A;  4WUB A;  2NA2 A;  4LU9 A;  1N34 E;  3L7Z A;  2UXB I;  2EMK A;  2FV4 B;  4LF8 E;  5C0X F;  1E3P A;  5LMN E;  4PRV A;  5EKW A;  1E3H A;  4KZS A;  3EQ1 A;  4N4R B;  4O5G A;  4AID A;  1N36 I;  2ADR A;  2V2V A;  4LFC E;  2F4V E;  2JEB A;  3DJW A;  2JP9 A;  2I9I A;  2ELZ A;  4P7A A;  2LUQ A;  4F6M A;  2DSY A;  5F3W A;  1UBD C;  1X49 A;  4YHH I;  4B3T I;  3BF2 A;  5A6B D;  4HY1 A;  4AM3 A;  2EPU A;  1H72 C;  2R42 A;  2EQ3 A;  1FWL A;  2UU9 I;  3B8H A;  3LNU A;  3TQM A;  3J7A M;  2F1D A;  3AUZ A;  4LF9 E;  3H1C A;  2BR2 A;  3L00 A;  4GQU A;  1XXE A;  4J8Z A;  1ZBQ A;  2LVH A;  2PO2 A;  4IFD C;  1NCS A;  5KL4 A;  2EPN A;  2BA0 G;  3ZKD A;  2JR1 A;  2M9A A;  3HPZ A;  2VQF E;  2CSH A;  3BID A;  2EM7 A;  3F0N A;  2JPA A;  5A69 A;  2EMY A;  1UN6 B;  4R2Q A;  1X5W A;  2YTF A;  4FW4 A;  2DLK A;  4U3B A;  4DV3 E;  1PJQ A;  4TUG A;  5AAS A;  1G2D C;  2L33 A;  4LPF A;  3OML A;  4MU1 A;  3JAM Q;  2DGC A;  4DV2 E;  2UUC I;  4MYU A;  3J81 C;  1OJ4 A;  2YTP A;  4MLQ A;  4IZK A;  2YZT A;  3P3E A;  4LF4 I;  4R8O A;  4ISA A;  3M7N G;  1PKP A;  2EPZ A;  3LML A;  4YY3 E;  1STU A;  1HNZ E;  3PYE A;  4DPW A;  1FJG I;  2KON A;  4DV6 E;  5DRP A;  2VQF I;  4X66 I;  2A2D A;  2JXP A;  4DUZ I;  4HEI A;  1T4N A;  2YTI A;  1H73 A;  1UDQ A;  2MDR A;  4MDT A;  5L3J A;  2CVE A;  1LLM C;  1JK2 A;  4GKK E;  1FI4 A;  1OYP A;  4X65 I;  2IHR 1;  4M2Z A;  1A1I A;  4NXN I;  4DU8 A;  3K6Q A;  4DV4 I;  1R6M A;  2NN6 D;  4LFB E;  2M1S A;  2EPR A;  1L4S A;  3PRY A;  4P7D A;  1RHY A;  3T1H I;  4DR7 I;  4OO1 E;  4DPY A;  2RSM A;  4NBQ A;  1U2R A;  4FW6 A;  3T1H E;  4DR7 E;  2A2C A;  2EPL X;  2EOI A;  3ZOQ B;  3UK3 C;  4XTJ A;  4U3D A;  4PU9 A;  4I3H A;  4Q28 A;  2PRT A;  4DV5 I;  2R1F A;  1HNW I;  1HR0 I;  1DI2 A;  4MU4 A;  4EMD A;  2BA1 G;  2DEJ A;  2E5L I;  3QT5 A;  4DUY I;  3PYD A;  1B63 A;  1Z5C A;  4F9A B;  4X9J A;  1YSA C;  2NUF A;  1IMU A;  1KVK A;  2WP8 B;  1YHC A;  2NAB A;  1N33 E;  2LTS A;  4JI7 E;  2X7I A;  4UTG A;  4GZN C;  4KQV A;  5JEA B;  1N34 I;  1HNZ I;  3J80 C;  3DF6 A;  2V34 A;  4LF5 I;  4X62 I;  2UXD I;  4WFT A;  4JI8 E;  3GCM A;  3GLL A;  2EMW A;  4KHP E;  5GME A;  2YTN A;  3M6A A;  2JT2 A;  2LTR A;  4WXC A;  4LF4 E;  2DB2 A;  4AIM A;  2PNZ A;  3PS2 A;  1NZ0 A;  3QG5 C;  1YH8 A;  4FK5 C;  3GME A;  2YU5 A;  2YTG A;  5C0X B;  4IS1 C;  1P47 A;  4AQY E;  4DV3 I;  4IFD A;  5K36 E;  3M85 G;  1IBK I;  2PO1 A;  4X62 E;  2UXD E;  1BBG A;  4LF6 E;  1Z5A A;  2EMF A;  5AE1 A;  4GKJ E;  1QZR A;  2EM5 A;  4NZV A;  2L3C A;  2IOQ A;  2EMB A;  2JE6 B;  2JYA A;  1KIJ A;  4JI7 I;  2WP8 A;  3DD6 A;  4P78 A;  2L92 A;  3HPS A;  4DR3 I;  1RC7 A;  5JEA E;  1TF3 A;  4WUD A;  5FLX C;  4BHC A;  3KRN A;  4JI1 E;  2VE7 C;  4JI6 E;  1J26 A;  3C4B A;  3ZZU A;  3Q1Q A;  2RS6 A;  2V89 A;  2O1V A;  2EP3 A;  4JI3 E;  4B3M E;  1DGC A;  2ODR D;  1RQ0 A;  2PO0 A;  5DRO A;  5EL9 A;  3F6H A;  4DR1 I;  4F9B B;  1EI1 A;  4LCF A;  4DR4 E;  4L8N A;  2NN6 F;  3PYG A;  2LJU A;  2BM0 A;  1YYO A;  4LFB I;  1Z0E A;  2NN6 E;  2F4V I;  2EOH A;  1O0W A;  4DR2 E;  1UDS A;  1WHN A;  1I94 E;  2EOZ A;  5LMU I;  4IZJ B;  4R2D A;  1NHJ A;  3P1X A;  1FKA E;  2EOQ A;  4FWH A;  3ADL A;  1Z0B A;  4DU7 A;  4F54 A;  1HNX I;  1A1L A;  2OI2 A;  1KYQ A;  1S4E A;  1PJT A;  2EMI A;  3P76 A;  4USM A;  2E72 A;  1FJG E;  2RTX A;  1UDN A;  3IWD A;  4HAC A;  4JG4 A;  2EPA A;  4DPT A;  1X47 A;  1GQE A;  2AJ4 A;  3IWC A;  2YT4 A;  3CDI A;  1USV A;  1D6T A;  1AH5 A;  5DRQ A;  2V8Q B;  3ZM7 A;  5IXM B;  4LFA E;  2V83 A;  1YYK A;  3OTO I;  3MSW A;  1BB8 A;  2M4I A;  2UUC E;  2GQ0 A;  2JE6 A;  3CWV A;  3HUL A;  5IT9 Q;  4LCH A;  3WU3 A;  5GMD A;  3ADI A;  2MDG A;  4NXM E;  1K47 A;  2HJJ A;  2E1R A;  5DNL A;  4GEQ B;  1Z0T A;  2PNZ B;  4WXD A;  1MG7 A;  4BS9 A;  5AC4 A;  4KWY A;  4R2P A;  4X64 I;  5K36 A;  1PDA A;  4FWG A;  3HTX A;  2L6M A;  2EOS A;  3U1Y A;  5DNX A;  2CPN A;  1B62 A;  2PO0 B;  4R2S A;  2EN6 A;  2LT7 A;  3H4L A;  2E5L E;  1XMQ E;  2EN2 A;  2EM2 A;  1I94 I;  1YPN A;  2EE8 A;  2EJ4 A;  4BBY A;  5A2Q C;  4R2R A;  1T4L B;  2BR2 B;  2UXC E;  2YTQ A;  2UU9 E;  1H74 A;  4MYT A;  4OO1 B;  2B9D A;  1A1G A;  1WJP A;  1WXR A;  4OO1 A;  1KKH A;  4JI0 E;  3ADG A;  2WNR A;  2LE2 A;  2V87 A;  5LLQ A;  4WSP A;  1G2F C;  1IBM E;  1PIE A;  4MLV A;  4LFC I;  3JAM C;  4F9C B;  1N36 E;  3B82 A;  5CFF E;  4NXN E;  1XMQ I;  4JI1 I;  4OOG C;  4R2A A;  4X65 E;  4DUY E;  1NHH A;  4DXL A;  4JYA I;  1ZU1 A;  1ZM4 A;  5BR8 E;  1QNT A;  4BCA A;  4HYM A;  3K85 A;  4IFD B;  3EPL A;  1UDO A;  4DV6 I;  3JU0 A;  4LF7 E;  3JTZ A;  1T4O A;  2V88 A;  4WSG A;  2ZIT A;  3ECR A;  4LF6 I;  2J65 A;  1IBL I;  5A6K A;  5IWA E;  3M7N D;  2WW4 A;  2E1M A;  1JK1 A;  4FN5 A;  4URL A;  2UUA I;  1EKZ A;  4MU0 A;  4FW5 A;  1RRE A;  3V5R A;  2GO3 A;  4R03 A;  2UUB E;  1NHI A;  4FWD A;  2EM4 A;  1X6E A;  5C0X E;  3PYF A;  1ZBT A;  3T1Y I;  4B3S I;  2G7H A;  2VES A;  3Q6M A;  1BKN A;  1IQS A;  2GPI A;  2EQ1 A;  2C39 B;  1XMO I;  2CT1 A;  1Z0V A;  3AV0 A;  2JWO A;  5JEA D;  5A6B A;  4WUC A;  2Z5C B;  1X6F A;  2L3J A;  2ENC A;  2WBT A;  2FTX B;  2JVA A;  1MX0 A;  3PS3 A;  3J7A G;  4DV0 I;  4BMJ A;  4DV7 E;  5LMU E;  4USK A;  2EML A;  2YTO A;  1Z59 A;  2LCE A;  3EPH A;  4ZYH A;  2CGE A;  4WX9 A;  2J7J A;  4QNK A;  4BA1 A;  3J80 Q;  2MC6 A;  5FWK A;  1IQO A;  2ODR C;  2EPO A;  1F2I G;  4B3R E;  1ELO A;  2EM6 A;  3MHH C;  2HKE A;  4M1K A;  4HTG A;  4RH8 A;  1Y5Y A;  2EPK X;  1EH6 A;  1N32 E;  2EMH A;  4JI6 I;  1J5E E;  1T39 A;  1Y4S A;  4DV0 E;  1VI7 A;  2JOB A;  4JI5 E;  2Z5C A;  4IZK B;  2JY9 A;  4OO1 C;  1A1H A;  5LMN I;  4JV5 I;  3ADJ A;  4LF8 I;  4N3O A;  4DMI A;  4UT4 A;  4BHB A;  2EOO A;  4X64 E;  1UEK A;  2JEB B;  1FWK A;  3M85 D;  1XMO E;  3VYX A;  1H7S A;  3P3C A;  2LRS A;  3K1J A;  2EL4 A;  3T1Y E;  2EPC A;  2GHF A;  3F6G A;  3VHT B;  5DNY A;  3WU4 A;  4IFD F;  3L7Z B;  3P06 A;  4OKG A;  2EOM A;  2HKJ A;  2EWL A;  1Z5B A;  5K36 C;  2MKN A;  1AAY A;  4LFA I;  2UUA E;  4KHP I;  2MKD A;  2Q8U A;  1XNR I;  2VF1 A;  1QU6 A;  4O43 A;  5JEA C;  2V85 A;  5KL5 A;  4IS9 A;  2YRM A;  4NHR A;  4OX9 I;  4O4K A;  5KL2 A;  5C0X D;  2EMX A;  5KL3 A;  2LUP B;  2XEX A;  1WRJ A;  4JI2 I;  1VIS A;  2KHX A;  5BR8 I;  2F8B A;  1N0V C;  4OO1 D;  2HK3 A;  4P52 A;  2O3Z A;  2PNM A;  2EOR A;  2HK2 A;  2Q2E B;  1HR0 E;  1J5E I;  1UHZ A;  2EOF A;  2DLQ A;  2EPX A;  1H7U A;  4LOM A;  2EOX A;  4ZYD A;  3LTO A;  4DV5 E;  3KZY A;  2BV3 A;  4B3R I;  4JI0 I;  2HHH E;  1ZM2 A;  2IES A;  3EPK A;  5IV8 B;  4BA2 B;  2EN7 A;  2RSI A;  2NN6 C;  3CDJ A;  2MC5 A;  2EPP A;  3IWB A;  4M9V C;  3BGH A;  4JI3 I;  4DV4 E;  1ZR9 A;  2ENA A;  4M0V A;  2IOP A;  4MU3 A;  5K36 B;  3ZZT A;  3WU6 A;  1A6F A;  2K4V A;  4I8O A;  2EMC A;  2N3G A;  3C4T A;  4DUZ E;  4PRX A;  2N8X A;  1N3G A;  2C37 A;  4IFD E;  2DIX A;  1Y4U A;  3THO B;  5C0X C;  2C38 A;  2EOJ A;  2YTJ A;  2ENH A;  2VQE I;  4ZYG A;  3RMP A;  4YY3 I;  2EM0 A;  2LJH A;  1WUU A;  1ZXM A;  5DRR A;  4OZE A;  2WBU A;  3HXL A;  3VK6 A;  5K36 D;  4B3S E;  2CZ9 A;  4NXM I;  4Z7C A;  2BM1 A;  2HFU A;  5AE2 A;  3M99 B;  2B3T B;  2M7Q A;  1OYR A;  3EPJ A;  3B4T A;  3THN A;  2AE8 A;  1ZXN A;  3HKM A;  4JI8 I;  1KJK A;  1DAR A;  3H09 A;  4DR5 E;  1TF6 A;  3K17 A;  5IWA I;  2X36 A;  2EPM X;  2WBS A;  2DMY A;  4M30 A;  2NN6 B;  2PNL A;  4FW7 A;  2YRH A;  3BBG A;  3LPS A;  4IJD A;  2EM3 A;  3FIG A;  4DKK A;  3J7Y p;  2L2K B;  2VQE E;  1YYW A;  2NUE A;  1ZM3 A;  1EA6 A;  2C37 B;  2LJP A;  2J7K A;  1HNX E;  4JV5 E;  4IFD D;  1UIL A;  3GON A;  4J3D A;  3QT8 A;  1X3C A;  4JI5 I;  5ELW A;  2Z5E A;  3KWR A;  4JYA E;  2PO2 B;  1MEY C;  4DV1 I;  3HQ1 A;  2WZO A;  2EN8 A;  1B69 A;  4LF9 I;  2YSP A;  2BA1 D;  4DR2 I;  3ZZ0 A;  4DR6 I;  5KL6 A;  4BA2 A;  1IBM I;  3MHS C;  5AC5 A;  3PS1 A;  5FLX Q;  4OO1 F;  2L2N A;  4DR4 I;  2LO3 A;  2RS7 A;  2GLI A;  1ZAA C;  2L8T A;  1YZ9 A;  3Q6N A;  2HHH I;  1R6L A;  2V8P A;  2EN4 A;  4DR1 E;  2K7I A;  2EQ0 A;  4B3M I;  2O1W A;  4ZVI A;  4DR6 E;  2UXC I;  4WYQ B;  5LL6 R;  2JEA B;  2BB8 A;  4TUI A;  2WNR B;  2I13 A;  4DV1 E;  1Z1B A;  3P3G A;  4Z7Y A;  4DV7 I;  2LV2 A;  2JEA A;  4GKK I;  2O1U A;  4BC7 A;  2D9H A;  4R1F A;  3UHM A;  1Z0W A;  2B7T A;  4DR3 E;  2BBG A;  4JI2 E;  1N0U A;  1ZM9 A;  4IZJ D;  2JOX A;  4F6N A;  3KZZ A;  5AE3 A;  4HXZ A;  2YPN A;  5A2Q Q;  2HC5 A;  4FW9 A;  4RHB B;  2DRP A;  2ZM6 E;  2UXB E;  3QT6 A;  2PO1 B;  4K0K E;  2VF3 A;  4GKJ I;  1X6H A;  1Z0G A;  1GTK A;  2EM8 A;  1IBK E;  1FNM A;  1XNR E;  4DR5 I;  1MU5 A;  4AQY I;  2GO4 A;  3U1K A;  1YFH A;  2WCC 3;  2CTD A;  2GS8 A;  2UUB I;  4F2J C;  2EMA A;  4RPF A;  5JEA A;  2L2M A;  5K36 F;  3NZK A;  5A6J A;  2ELY A;  3OTO E;  1A1F A;  2ZBK B;  2NUG A;  4BC9 A;  2EL6 A;  2YWQ A;  1EH8 A;  5IT9 C;  1IBL E;  2YRK A;  4ZYE A;  4LF5 E;  1P42 A;  4K0K I;  5TSE A;  2YU8 A;  1Z0C A;  3J81 Q;  1Y60 A;  1HK7 A;  3B78 A;  2ZM6 I;  4LF7 I;  1A1K A;  1N33 I;  2EOY A;  2YTE A;  2IER A;  1SFE A;  2A25 A;  1WHQ A;  1MGT A;  5JEA F;  2KOU A;  1KTV A;  1XHK A;  2Z5B A;  3ZKB A;  4R2E A;  1A1J A;  2V86 A;  2BA0 D;  2EN1 A;  2EMZ A;  2EM9 A;  2YSO A;  5KL7 A;  1PJS A;  2C38 B;  4MQY A;  4JI4 E;  1N32 I;  1BBO A;  1GZ6 A;  5T6J A;  2V2Q A;  2V2Z A;  1HNW E;  3D4J A;  4QNJ A;  2YTD A;  2B7V A;  2EZ6 A;  3HJC A;  1YUI A;  1SR9 A;  1T38 A;  4IZJ A;  4B3T E;  2EL5 A;  2FGG A;  2R76 A;  4YHH E;  4X8W A;  3QT7 A;  4BA1 B;  4DPU A;  4WPY A;  2EFG A;  4JI4 I;  4L5N C;  1TN9 A;  3C6K A;  1USU A;  1Y6Z A;  2NN6 A;  2Z5B B;  5A6A A;  2EN3 A;  3WU5 A;  1PVG A;  4O24 A;  4LCG A;  1RMD A;  1S16 A;  2RQL A;  4FW3 A;  4X66 E;  3LLH A;  4OX9 E;  2C39 A;  1YUJ A;  3VYY A;  1NEI A;  5ADZ A;  3C6M A;  2R3V A;  1RR9 A;  2HFS A;  4DPX A;  4HAC B;  4LTY A;  1XNQ I;  2N3H A;  1OYS A;  1EH7 A;  4ED4 A;  2H36 X;  4Q35 B;  2RPC A;  4DV2 I;  2LBS B;  2DMI A;  4R2C A;  3V2U C;  5C0X A;  2HGH A;  2EMG A;  2O1T A;  1XNQ E;  2EOE A; 
#chains in the Genus database with same CATH homology
 2NPF A;  2CG9 A;  2DEI A;  1X48 A;  1DQ3 A;  2LMZ A;  4WUB A;  2NA2 A;  4LU9 A;  1N34 E;  2UXB I;  2FV4 B;  4LF8 E;  5LMN E;  4PRV A;  4KZS A;  1N36 I;  2V2V A;  4LFC E;  2F4V E;  3DJW A;  4P7A A;  2LUQ A;  2DSY A;  5F3W A;  4YHH I;  1X49 A;  4B3T I;  4HY1 A;  1H72 C;  2R42 A;  1FWL A;  3J7A M;  2UU9 I;  3B8H A;  3LNU A;  3AUZ A;  4LF9 E;  4J8Z A;  1ZBQ A;  3ZKD A;  2JR1 A;  3HPZ A;  2VQF E;  3F0N A;  4DV3 E;  4TUG A;  5AAS A;  2L33 A;  3OML A;  3JAM Q;  4DV2 E;  2UUC I;  4MYU A;  3J81 C;  1OJ4 A;  4IZK A;  4LF4 I;  2YZT A;  4R8O A;  1PKP A;  3LML A;  4YY3 E;  1STU A;  1HNZ E;  3PYE A;  4DPW A;  1FJG I;  2KON A;  4DV6 E;  2VQF I;  4X66 I;  2A2D A;  4DUZ I;  1T4N A;  1H73 A;  2MDR A;  5L3J A;  4X65 I;  4DUY I;  4GKK E;  1FI4 A;  2IHR 1;  4M2Z A;  4NXN I;  4DU8 A;  3K6Q A;  4DV4 I;  4LFB E;  2M1S A;  3PRY A;  4P7D A;  3T1H I;  4DR7 I;  4DPY A;  2RSM A;  1U2R A;  3T1H E;  4DR7 E;  2A2C A;  4DV5 I;  3ZOQ B;  4XTJ A;  4I3H A;  4PU9 A;  1HNW I;  4Q28 A;  1HR0 I;  1DI2 A;  4EMD A;  2E5L I;  2DEJ A;  3QT5 A;  3PYD A;  1B63 A;  1Z5C A;  4F9A B;  2NUF A;  1KVK A;  1N33 E;  2LTS A;  4JI7 E;  2X7I A;  4UTG A;  4KQV A;  1N34 I;  1HNZ I;  3J80 C;  3DF6 A;  2V34 A;  4LF5 I;  4X62 I;  2UXD I;  4WFT A;  4JI8 E;  5GME A;  4KHP E;  3M6A A;  2LTR A;  4LF4 E;  2DB2 A;  1NZ0 A;  4DV3 I;  4AQY E;  1IBK I;  4X62 E;  2UXD E;  4LF6 E;  1Z5A A;  4GKJ E;  5AE1 A;  1QZR A;  2L3C A;  2IOQ A;  4JI7 I;  1KIJ A;  4P78 A;  2L92 A;  3HPS A;  4DR3 I;  1RC7 A;  4WUD A;  5FLX C;  4JI1 E;  2VE7 C;  4JI6 E;  1J26 A;  3C4B A;  3ZZU A;  3Q1Q A;  2RS6 A;  2V89 A;  2O1V A;  4JI3 E;  4B3M E;  2ODR D;  1RQ0 A;  4DR1 I;  3F6H A;  4F9B B;  1EI1 A;  4DR4 E;  4L8N A;  3PYG A;  2BM0 A;  1YYO A;  4LFB I;  1Z0E A;  2F4V I;  1O0W A;  4DR2 E;  1WHN A;  1I94 E;  5LMU I;  4IZJ B;  1NHJ A;  3P1X A;  1FKA E;  4FWH A;  3ADL A;  1Z0B A;  4DU7 A;  4F54 A;  1HNX I;  2OI2 A;  1S4E A;  4USM A;  1FJG E;  2RTX A;  4JG4 A;  3IWD A;  4HAC A;  4DPT A;  1X47 A;  1GQE A;  2AJ4 A;  3IWC A;  2YT4 A;  1USV A;  1D6T A;  3ZM7 A;  2V8Q B;  3OTO I;  4LFA E;  2V83 A;  1YYK A;  3MSW A;  3CWV A;  2M4I A;  2UUC E;  2GQ0 A;  3HUL A;  5IT9 Q;  3WU3 A;  5GMD A;  3ADI A;  4NXM E;  1K47 A;  2E1R A;  4GEQ B;  1Z0T A;  1MG7 A;  4BS9 A;  4X64 I;  4FWG A;  3HTX A;  2L6M A;  2CPN A;  1B62 A;  3H4L A;  2E5L E;  1XMQ E;  1I94 I;  1T4L B;  5A2Q C;  4BBY A;  2UXC E;  2UU9 E;  1H74 A;  4MYT A;  2B9D A;  1WXR A;  1KKH A;  4JI0 E;  3ADG A;  2LE2 A;  2V87 A;  4WSP A;  1IBM E;  1PIE A;  4LFC I;  3JAM C;  4F9C B;  1N36 E;  3B82 A;  5CFF E;  4NXN E;  1XMQ I;  4JI1 I;  4OOG C;  4DXL A;  4X65 E;  4DUY E;  1NHH A;  4JYA I;  1ZM4 A;  5BR8 E;  4BCA A;  4HYM A;  3K85 A;  4DV6 I;  3JU0 A;  4LF7 E;  3JTZ A;  1T4O A;  2V88 A;  2ZIT A;  4LF6 I;  1IBL I;  5IWA E;  2WW4 A;  2E1M A;  2UUA I;  4FN5 A;  4URL A;  1EKZ A;  1RRE A;  3V5R A;  4R03 A;  2UUB E;  1NHI A;  4FWD A;  3PYF A;  1ZBT A;  3T1Y I;  4B3S I;  2G7H A;  3Q6M A;  1BKN A;  1XMO I;  1Z0V A;  3AV0 A;  2JWO A;  4WUC A;  2Z5C B;  2L3J A;  2FTX B;  2JVA A;  1MX0 A;  3J7A G;  4DV0 I;  4BMJ A;  4DV7 E;  5LMU E;  4USK A;  1Z59 A;  2CGE A;  3J80 Q;  2MC6 A;  5FWK A;  2ODR C;  4B3R E;  1ELO A;  2HKE A;  4M1K A;  1N32 E;  4JI6 I;  1J5E E;  1Y4S A;  4DV0 E;  2JOB A;  4JI5 E;  2Z5C A;  4IZK B;  2JY9 A;  5LMN I;  4JV5 I;  3ADJ A;  4LF8 I;  4N3O A;  4DMI A;  4UT4 A;  4X64 E;  1UEK A;  1FWK A;  1XMO E;  3VYX A;  1H7S A;  2LRS A;  3K1J A;  3T1Y E;  3WU4 A;  3F6G A;  5DNY A;  3P06 A;  2HKJ A;  2EWL A;  1Z5B A;  4LFA I;  2UUA E;  4KHP I;  1XNR I;  2VF1 A;  1QU6 A;  2V85 A;  4OX9 I;  2LUP B;  2XEX A;  4JI2 I;  1VIS A;  2KHX A;  5BR8 I;  2F8B A;  1N0V C;  2HK3 A;  4P52 A;  2PNM A;  1J5E I;  2Q2E B;  2HK2 A;  1HR0 E;  1UHZ A;  1H7U A;  3LTO A;  4DV5 E;  2BV3 A;  4B3R I;  4JI0 I;  2HHH E;  1ZM2 A;  2MC5 A;  3IWB A;  4JI3 I;  4DV4 E;  4M0V A;  2IOP A;  3ZZT A;  3WU6 A;  1A6F A;  2K4V A;  4I8O A;  3C4T A;  2N3G A;  4DUZ E;  4PRX A;  2DIX A;  1Y4U A;  2VQE I;  3RMP A;  4YY3 I;  2LJH A;  1WUU A;  1ZXM A;  3HXL A;  3VK6 A;  4B3S E;  2CZ9 A;  4NXM I;  4Z7C A;  2BM1 A;  2HFU A;  5AE2 A;  2M7Q A;  2B3T B;  1ZXN A;  4JI8 I;  1DAR A;  3H09 A;  4DR5 E;  3K17 A;  5IWA I;  2X36 A;  2PNL A;  2DMY A;  4M30 A;  3LPS A;  3J7Y p;  3FIG A;  4DKK A;  2VQE E;  2L2K B;  1YYW A;  2NUE A;  1ZM3 A;  2LJP A;  1EA6 A;  2J7K A;  1HNX E;  4JV5 E;  1UIL A;  3GON A;  3QT8 A;  4JI5 I;  2Z5E A;  3KWR A;  4JYA E;  4DV1 I;  3HQ1 A;  2WZO A;  4LF9 I;  4DR2 I;  3ZZ0 A;  4DR6 I;  1IBM I;  5FLX Q;  2L2N A;  4DR4 I;  2RS7 A;  1YZ9 A;  2L8T A;  3Q6N A;  2HHH I;  2V8P A;  4DR1 E;  4B3M I;  2O1W A;  4ZVI A;  4DR6 E;  2UXC I;  4WYQ B;  5LL6 R;  4TUI A;  4DV1 E;  4Z7Y A;  4GKK I;  4DV7 I;  2O1U A;  4BC7 A;  4R1F A;  1Z0W A;  2B7T A;  4DR3 E;  4JI2 E;  1N0U A;  1ZM9 A;  4IZJ D;  2JOX A;  5A2Q Q;  5AE3 A;  4HXZ A;  4FW9 A;  3QT6 A;  2UXB E;  2ZM6 E;  4K0K E;  2VF3 A;  4GKJ I;  1Z0G A;  4DR5 I;  1IBK E;  1FNM A;  1XNR E;  1MU5 A;  4AQY I;  2GS8 A;  2UUB I;  4RPF A;  2L2M A;  3OTO E;  2ZBK B;  2NUG A;  4BC9 A;  1IBL E;  5IT9 C;  4LF5 E;  4K0K I;  1Z0C A;  3J81 Q;  3B78 A;  1HK7 A;  2ZM6 I;  4LF7 I;  1N33 I;  1WHQ A;  2KOU A;  1KTV A;  1XHK A;  2Z5B A;  3ZKB A;  2V86 A;  1N32 I;  4JI4 E;  1GZ6 A;  5T6J A;  2V2Q A;  2V2Z A;  1HNW E;  3D4J A;  2B7V A;  2EZ6 A;  3HJC A;  1SR9 A;  4IZJ A;  4B3T E;  2FGG A;  4YHH E;  4X8W A;  3QT7 A;  4DPU A;  4WPY A;  2EFG A;  4JI4 I;  4L5N C;  1USU A;  1Y6Z A;  2Z5B B;  3WU5 A;  1PVG A;  1S16 A;  4X66 E;  3LLH A;  4OX9 E;  3VYY A;  5ADZ A;  2R3V A;  1RR9 A;  2HFS A;  4DPX A;  4HAC B;  4LTY A;  1XNQ I;  2N3H A;  4ED4 A;  2H36 X;  4DV2 I;  2LBS B;  3V2U C;  2O1T A;  1XNQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...