2ZM6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2zm6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2zm6E02
4YY3I 4DR6I 4LFCI 4AQYI 4PRXA 1N34I 3B8HA 4UT4A 1A6FA 2L2KB 1ZBTA 1N0UA 2L33A 4M1KA 1ZM3A 4DPWA 2WW4A 4MYUA 1RR9A 2ZBKB 4WYQB 4DV6I 4DR1I 1EA6A 4KHPI 1FJGE 4JI6I 2OI2A 4ED4A 4DPYA 4JG4A 2UXBE 2BV3A 4DUYI 4DXLA 4LF8E 1IBKE 1FNMA 4JI7I 4DV1E 5FLXC 4DV3I 1XMQE 1B63A 1J5EI 3LLHA 2DEJA 1KTVA 5GMDA 2HKEA 2CPNA 4DUZI 2BM1A 4DV0E 1HNWE 2L3CA 4DR4I 2Q2EB 3CWVA 4DV4I 2UUCE 1HNZE 2NUEA 2VQEI 1KIJA 2IHR1 3WU3A 4JYAE 1EKZA 5LL6R 1N32E 4JV5E 2HFSA 2ZM6I 3P1XA 4JI1I 2F4VE 3T1YE 4DR7E 3V5RA 1UILA 3ADLA 4K0KI 1ELOA 1ZM2A 2LJPA 3J7Yp 5FLXQ 3J7AG 1XNQI 4HY1A 2UU9E 4X8WA 4JI0I 3QT8A 4JI3I 2VQFE 4DKKA 1H7UA 5IWAE 1Z0BA 4DPUA 3D4JA 1PKPA 2HHHE 1WHQA 4FWGA 3ZM7A 3QT5A 4EMDA 1IBLE 1QZRA 4B3SE 1UHZA 4JI4E 1GQEA 4LF9I 4OOGC 4DU7A 1XMOE 4DV7E 4HACB 4OX9I 1KKHA 1Z5CA 2KHXA 4URLA 1U2RA 1FKAE 4JI2I 2YT4A 2LJHA 5L3JA 4JYAI 2X36A 4JV5I 2RS7A 5LMNE 3WU5A 4JI5E 4PRVA 4B3TI 3LPSA 2A2DA 2X7IA 3ZKBA 2R3VA 4GKKE 1N33E 1PIEA 3ZZ0A 4Z7CA 4FW9A 3Q1QA 4MYTA 3T1HE 1HNXI 3HTXA 5A2QC 2E5LI 1WHNA 4DV2E 1HR0I 2MDRA 3HULA 1RQ0A 4R1FA 2N3HA 1Z0VA 4DR5I 1N36E 2UXCI 2CZ9A 5BR8I 1X49A 4JI8I 1O0WA 4LF5I 4M2ZA 4X66E 4DV7I 4B3RE 3VYXA 3J81C 4M30A 2J7KA 1RREA 4WFTA 2UUAE 1DARA 2LTSA 4YHHE 4WUDA 1IBMI 1OJ4A 4HYMA 4B3MI 2NUFA 1FWKA 3ZZUA 4LF4E 4X65E 3T1HI 2B7VA 1T4OA 3J7AM 4Z7YA 4LFBI 4PU9A 2V34A 1S4EA 2DEIA 4NXMI 1K47A 4UTGA 3PYGA 3J80C 2UUBE 4LFAE 1NHIA 4LF7E 3ZKDA 4DR2E 5LMUE 4FWDA 3ADJA 1ZXNA 3J81Q 1NHJA 4X64E 3V2UC 2UXDE 4P52A 1FJGI 2B7TA 4X62E 1H74A 4WUCA 1YZ9A 2UXBI 4LF8I 1IBKI 3H4LA 4GKJE 1XNRE 2E1RA 1XHKA 4DV1I 1XMQI 3B82A 1FWLA 1PVGA 1X48A 1S16A 4DV0I 2R42A 2LTRA 1EI1A 2EFGA 3WU6A 1HNWI 2V8PA 4DR3E 2BM0A 1YYOA 1Z0GA 4DR2I 2UUCI 2DIXA 1HNZI 1I94E 2RSMA 4XTJA 4YY3E 1MX0A 4DR6E 4LFCE 4AQYE 1N34E 1N32I 1ZM4A 4DPXA 1B62A 4P7AA 3B78A 2F4VI 3T1YI 4DR7I 4DV6E 4DR1E 4KHPE 2AJ4A 3M6AA 2NPFA 4WUBA 2UU9I 4RPFA 2NUGA 2DMYA 2ZITA 4DU8A 4DUYE 4JI7E 2VQFI 3JAMC 5IWAI 3WU4A 3OTOE 1RC7A 4FWHA 2HHHI 2V2ZA 3LTOA 3ADIA 1IBLI 4B3SI 4DV3E 4JI4I 1J5EE 1T4LB 1XMOI 3ADGA 1Z0TA 4DUZE 2N3GA 2GS8A 2L2NA 3QT6A 4DR4E 3VYYA 1NHHA 3ZZTA 5LMNI 2HKJA 4DV4E 4JI5I 2DB2A 2VQEE 4GKKI 1N33I 1ZM9A 1UEKA 4NXNE 5A2QQ 2JVAA 2ZM6E 1KVKA 4JI1E 3JAMQ 1NZ0A 1J26A 3C4TA 2JY9A 4DV5E 4K0KE 4DV2I 2L2MA 4HACA 5CFFE 2LUQA 1H73A 1MU5A 1ZXMA 1XNQE 1N36I 3OTOI 3LNUA 4JI0E 4JI3E 4ZVIA 2A2CA 4X66I 4KQVA 4USMA 2RTXA 4B3RI 1T4NA 1QU6A 2HK2A 4FN5A 1WUUA 1FI4A 4LF6E 4LF9E 2UUAI 2LBSB 1D6TA 2EZ6A 4OX9E 4YHHI 3C4BA 2VF3A 5IT9C 4NXNI 4JI2E 1Z5AA 2V2VA 4LF4I 4X65I 2LUPB 3K17A 1VISA 2HFUA 4B3TE 3PYFA 3J80Q 4DV5I 1H7SA 1BKNA 1N0VC 1HNXE 2UUBI 4LFAI 2B3TB 4LF7I 5LMUI 2RS6A 2E5LE 1YYWA 1HR0E 4USKA 5GMEA 1X47A 4I3HA 4X64I 1STUA 1MG7A 4DR5E 2UXCE 2UXDI 4X62I 2LRSA 5BR8E 1Z5BA 4JI8E 4DPTA 4LF5E 4LF6I 3PYDA 2XEXA 5IT9Q 2NA2A 4JI6E 3QT7A 1YYKA 4GKJI 1Z59A 3PYEA 1XNRI 1IBME 3F0NA 2L3JA 1H72C 4B3ME 1Z0WA 1Z0EA 4HXZA 1Z0CA 3GONA 4DR3I 2V2QA 2HK3A 4LFBE 1I94I 3K1JA 1DI2A 4NXME
chains in the Genus database with same CATH superfamily
1R6MA 4FW7A 4F9BB 4YY3I 4DR6I 4LFCI 4AQYI 1USUA 4PRXA 1N34I 2YTGA 3C6MA 3B8HA 2EMHA 4UT4A 5KL5A 1Y4SA 1A6FA 2JEBB 1IQSA 2CT1A 2EOEA 1ZBTA 2EM2A 2L2KB 2L33A 1N0UA 2FTXB 1ZM3A 4M1KA 5DRRA 4DPWA 2WW4A 1PDAA 4MU4A 4IFDC 4MYUA 1RR9A 2YZTA 2ZBKB 4WYQB 4DV6I 1HK7A 2LV2A 4DR1I 1EA6A 2R76A 1T38A 5DRPA 4KHPI 1FJGE 1MEYC 1Y6ZA 3BGHA 4JI6I 4L8NA 2OI2A 1F2IG 2EN6A 4ED4A 4BC7A 4QNJA 4DPYA 3KWRA 2DRPA 4AM3A 2BR2A 4JG4A 4QNKA 2UXBE 5JEAE 2EN2A 1B69A 2BV3A 4DUYI 4GQUA 3IWDA 4LF8E 1IBKE 3K6QA 1FNMA 1A1FA 2H36X 3L7ZB 4DXLA 4JI7I 2EPOA 2ENCA 4N4RB 2Z5BA 4DV1E 5FLXC 2PO2A 4DV3I 2EMKA 1YUIA 1XMQE 2EMLA 2DSYA 3KZZA 2I9IA 4FK5C 1B63A 2BA0D 1J5EI 2NN6A 3GMEA 3Q6NA 3LLHA 2DEJA 1KTVA 5GMDA 2JOXA 3UK3C 2A25A 2HKEA 2CPNA 4DUZI 2BM1A 4DV0E 2PO0A 2Q8UA 1HNWE 2L3CA 5KL3A 2E72A 1MGTA 4WPYA 4DR4I 3HQ1A 2EN8A 2PRTA 2O3ZA 4LOMA 4LF4I 2Q2EB 4BS9A 4LCHA 2YPNA 4O24A 3CWVA 5ADZA 5JEAA 4DV4I 3BBGA 2UUCE 1HNZE 3C6KA 4U3BA 1Y4UA 3F6HA 2NUEA 4F54A 2VQEI 1KIJA 3U1YA 2IHR1 3WU3A 2MC5A 4IZJA 5DNLA 3JTZA 4NZVA 4JYAE 2YTJA 5LL6R 2EOZA 1EKZA 1N32E 4JV5E 4OKGA 2YU8A 5DRQA 5JEAF 2HFSA 2WBSA 2ZM6I 2YWQA 4Q35B 3P1XA 4JI1I 2F4VE 3T1YE 4DR7E 3V5RA 1BBGA 1UILA 2EPAA 1A1GA 3ADLA 3GLLA 4K0KI 3EPJA 1ELOA 1JK1A 5AC5A 1ZM2A 2EL6A 2EPPA 2J7JA 3J7Yp 1EH6A 2LJPA 4O5GA 4HTGA 2DGCA 1TF6A 1YSAC 3J7AG 5FLXQ 1XNQI 4HY1A 3HXLA 2YTIA 4IFDB 2UU9E 2EE8A 4X8WA 3VHTB 2EMIA 4JI0I 1SFEA 3UHMA 1UBDC 3EPKA 3M99B 4R2EA 3QT8A 2GO4A 4JI3I 2VQFE 4DKKA 1H7UA 3KRNA 2IOPA 5IWAE 1Z0BA 4DPUA 2EMWA 3D4JA 1PKPA 2HHHE 1WHQA 1X6EA 2JP9A 3QT5A 2EPZA 4FWGA 3ZM7A 4EMDA 1BB8A 1AH5A 2DLKA 1IBLE 1RMDA 1QZRA 3THNA 4J3DA 4B3SE 4LCFA 4FW3A 1UHZA 4JI4E 1GQEA 4LF9I 4OOGC 4IZKB 4DU7A 2JE6A 1XMOE 3K85A 4DV7E 2EOSA 1T39A 4HACB 4OX9I 4R2PA 2EMYA 1KKHA 2JEAA 1Z5CA 2ENAA 2KHXA 1PJQA 5AE1A 1KYQA 4URLA 4R2DA 5C0XE 2EQ1A 2ODRD 4KWYA 1U2RA 1FKAE 4JI2I 2YT4A 2LJHA 4R8OA 5L3JA 1PJTA 2X36A 3B4TA 4JV5I 4JYAI 2RS7A 5LMNE 1YH8A 3EQ1A 1E3PA 3WU5A 4JI5E 4PRVA 4B3TI 3LPSA 2RSIA 2A2DA 3JU0A 2X7IA 5DNYA 3ZKBA 2R3VA 4GKKE 1N33E 1TF3A 2C38B 1PIEA 5C0XF 4LTYA 3ZZ0A 2LMZA 4MU1A 4Z7CA 1L4SA 4FW9A 3Q1QA 4MYTA 3T1HE 4L5NC 4OO1A 1HNXI 5ELWA 2YTDA 4X9JA 2K4VA 2NABA 4F9AB 3PS2A 3HPSA 3HTXA 5A2QC 5KL7A 2J65A 2E5LI 1WHNA 4DV2E 1HR0I 5A6AA 4BC9A 2PNZA 2MDRA 2EOQA 3HULA 1RQ0A 4OO1F 4R1FA 2N3HA 1Z0VA 1P42A 4IZJD 4DR5I 1N36E 2WCC3 2YTPA 2UXCI 2CZ9A 4KZSA 5BR8I 1X49A 4Q28A 2HJJA 4O4KA 1UDOA 4JI8I 2EWLA 1O0WA 4LF5I 4M2ZA 2WZOA 5AE3A 4X66E 2EM3A 4MDTA 4DV7I 2HC5A 4B3RE 2PNMA 3FIGA 3J81C 3VYXA 4M30A 1OYSA 2J7KA 2Z5CB 4BA1B 5K36A 1RREA 1A1HA 4WFTA 1Z1BA 4BCAA 2ELYA 2UUAE 4F6MA 1DARA 2EMBA 5A69A 2LTSA 2YU5A 4YHHE 2C39B 5DNXA 5K36F 3MHSC 5A6JA 4WUDA 1AAYA 1IMUA 1IBMI 1OJ4A 4HYMA 1KJKA 4B3MI 4GZNC 2NUFA 2FGGA 1FWKA 3MHHC 4LF4E 3ZZUA 4X65E 2O1VA 2NN6E 2ODRC 3T1HI 2EL4A 4P78A 2B7VA 2EM0A 2K7IA 2EN3A 4ZYGA 1T4OA 3J7AM 4Z7YA 4LFBI 2BA0G 4R2AA 2V87A 3DF6A 4MLQA 2V34A 4PU9A 1S4EA 1OYRA 2EPNA 2YTOA 3MSWA 2L6MA 2DEIA 2NN6C 4NXMI 1K47A 2EOHA 4M9VC 3PYGA 2C37B 4UTGA 2NN6F 3DJWA 3J80C 2EOYA 2UUBE 4LFAE 1NHIA 4BA2B 4LF7E 3ZKDA 5C0XD 4DR2E 5C0XB 5LMUE 2KOUA 4MQYA 5DROA 4FWDA 3ADJA 2YRKA 1ZXNA 2Z5EA 3P3GA 3J81Q 4O43A 2EOJA 1NHJA 2LJUA 4X64E 2V83A 2EPRA 5JEAC 2EOOA 3V2UC 2UXDE 2YTFA 2PO1B 4P52A 1FJGI 2B7TA 4X62E 2WBUA 1QNTA 2GHFA 1H74A 4WUCA 1YZ9A 2WNRA 2UXBI 4FW4A 4LF8I 1IBKI 2MDGA 2MKDA 3H4LA 2EN7A 2BA1D 2YTNA 4GKJE 4GEQB 3CDJA 3L00A 1X5WA 1XNRE 2WBTA 2E1RA 1XHKA 4DV1I 2EMCA 1Y60A 2JEBA 2LVHA 4BHBA 4DMIA 1VI7A 1XMQI 3B82A 2EPLX 1YPNA 3GCMA 1A1JA 1FWLA 1SR9A 1WXRA 1PVGA 1X48A 3P76A 1S16A 2KONA 4WSGA 4DV0I 4R2CA 2R42A 2LTRA 5A6KA 1EI1A 2EFGA 3WU6A 1HNWI 2V8PA 4BHCA 2CTDA 4DR3E 1A1KA 1NCSA 2CG9A 2VF1A 4F2JC 1X6FA 2BR2B 2BM0A 1YYOA 3EPLA 3AV0A 1Z0GA 3M85D 4DR2I 2UUCI 2DIXA 2I13A 1HNZI 4BMJA 2EPKX 1I94E 3L7ZA 3BF2A 1WRJA 1LLMC 2RSMA 4XTJA 4YY3E 1MX0A 4DR6E 2EMXA 4LFCE 4AQYE 5TSEA 1N34E 1IQOA 4LCGA 1N32I 2EMFA 1ZM4A 4DPXA 2Z5BB 1B62A 2PO2B 2MKNA 2GQ0A 1EH8A 1ZBQA 2ENHA 4RH8A 4AIMA 4P7AA 3B78A 4ZYHA 2F4VI 3T1YI 2NN6D 2NN6B 4DR7I 5C0XC 1YFHA 4DV6E 4OO1E 4ISAA 4DR1E 2YTQA 3P3CA 2M4IA 3PS3A 2PO0B 4KHPE 3M7ND 2E1MA 1G2FC 2HGHA 4RHBB 2AJ4A 2V85A 3M6AA 2NPFA 3IWCA 4WUBA 1NEIA 2R1FA 2EP3A 5AE2A 1X6HA 2UU9I 2JR1A 4RPFA 2NUGA 3P06A 4WXDA 5JEAD 3CDIA 3AUZA 5JEAB 2DMYA 2B9DA 2ZITA 1XXEA 5IXMB 4DUYE 4DU8A 4OO1C 4JI7E 2VQFI 3ZOQB 3JAMC 2EOFA 2ADRA 5IWAI 4IZJB 3WU4A 3OTOE 1RC7A 4FWHA 2HHHI 2JT2A 1UDQA 2V2ZA 3LTOA 5FWKA 3ADIA 1IBLI 4J8ZA 5KL4A 4B3SI 4DV3E 2YSOA 4JI4I 2JOBA 3HPZA 1J5EE 1T4LB 2BB8A 2EJ4A 1XMOI 2EMZA 5K36E 3ADGA 1Z0TA 3P3EA 4DUZE 2N3GA 3VK6A 2GS8A 2L2NA 4ZYDA 2BBGA 1BBOA 3QT6A 4DR4E 4F6NA 2D9HA 2EN4A 3VYYA 4IFDA 1NHHA 5K36C 3ZZTA 2O1TA 5LMNI 2HKJA 4DV4E 4JI5I 4LU9A 2JPAA 2DB2A 2WP8A 4U3DA 2YSPA 2EM6A 2L92A 2VQEE 4GKKI 1N33I 2F8BA 1ZM9A 1UEKA 2EQ3A 4F9CB 4R2QA 4NXNE 4NBQA 1PJSA 4IFDF 5A2QQ 1N3GA 2JVAA 2CVEA 4IS9A 3HJCA 2VE7C 2ZM6E 1KVKA 2GPIA 5LLQA 4JI1E 3JAMQ 2JE6B 5AASA 2FV4B 1NZ0A 1J26A 3Q6MA 3C4TA 1DQ3A 4IZKA 1P47A 2YTEA 2JY9A 4DV5E 4K0KE 1RHYA 4DV2I 2JEAB 2L2MA 4HACA 2JWOA 2EM4A 5CFFE 3PS1A 2IERA 1A1IA 2LUQA 1H73A 1MU5A 4LPFA 1ZXMA 1XNQE 1N36I 2EL5A 3OTOI 2N8XA 3LNUA 4BBYA 2YRHA 4R2SA 2CSHA 2MC6A 2EPXA 1WJPA 2EPCA 2JYAA 1GTKA 3ECRA 5A6BA 4IS1C 4JI3E 4ZVIA 2A2CA 1ZR9A 4X66I 1ZAAC 1YUJA 2ELZA 4KQVA 3HKMA 4MU0A 4USMA 2RTXA 4B3RI 1T4NA 2C38A 4JI0E 2V89A 1QU6A 2HK2A 4FW6A 4OZEA 4FN5A 4TUGA 4OO1B 1GZ6A 4OO1D 1WUUA 1UDSA 1FI4A 4LF6E 4LF9E 4P7DA 5KL2A 1TN9A 2UUAI 3RMPA 2LBSB 1D6TA 2EZ6A 4OX9E 2AE8A 4YHHI 5KL6A 2PNZB 3C4BA 2V8QB 5AC4A 2M7QA 2O1WA 2VF3A 4AIDA 2GLIA 2G7HA 1UN6B 5IT9C 2LO3A 2BA1G 4JI2E 2EM9A 1Z5AA 2V2VA 4R03A 4NXNI 2IOQA 2RPCA 4X65I 5EL9A 1JK2A 2LUPB 3K17A 4FW5A 3U1KA 2M9AA 2VRDA 1VISA 2HFUA 2EOMA 4B3TE 3TQMA 3PYFA 2EQ0A 1USVA 1A1LA 3J80Q 2F1DA 2VESA 1UDNA 4DV5I 5K36D 5K36B 2EOXA 2Z5CA 2V86A 1H7SA 4BA1A 1BKNA 1N0VC 1HNXE 1E3HA 2UUBI 4LFAI 2B3TB 3EPHA 2O1UA 2DMIA 4LF7I 2EPMX 4IFDD 5LMUI 2LCEA 5IV8B 5EKWA 2RS6A 2M1SA 2E5LE 1HR0E 1YYWA 4USKA 5GMEA 2EMGA 3M85G 2C39A 2WP8B 1X47A 3H09A 4I3HA 3IWBA 4X64I 3F6GA 3DD6A 4NHRA 1STUA 1MG7A 3THOB 2EORA 4DR5E 2UXCE 2UXDI 2EN1A 4X62I 2LRSA 5BR8E 2GO3A 3LMLA 1Z5BA 2EOIA 3QG5C 5T6JA 4JI8E 1ZU1A 4DPTA 4LF5E 3BIDA 2DLQA 4LF6I 3PYDA 1Y5YA 2XEXA 4ZYEA 5IT9Q 4WX9A 1YHCA 2JXPA 2NA2A 4R2RA 2IESA 2EM7A 4WXCA 2EM5A 1X3CA 2EPUA 2V88A 4JI6E 2CGEA 3QT7A 1R6LA 1DGCA 2RQLA 1YYKA 4GKJI 1Z59A 2C37A 3M7NG 3PRYA 4M0VA 4BA2A 5F3WA 3PYEA 1XNRI 5C0XA 2EMAA 4MU3A 4N3OA 3OMLA 5A6BD 2EM8A 4MLVA 1IBME 1OYPA 4TUIA 1EH7A 3F0NA 2LE2A 2L3JA 1H72C 2YRMA 4HEIA 1G2DC 4B3ME 2PNLA 2PO1A 2LT7A 1Z0WA 1Z0EA 4HXZA 1Z0CA 4I8OA 2L8TA 3GONA 4DR3I 2V2QA 2WNRB 2HK3A 3NZKA 4LFBE 3H1CA 4IJDA 1I94I 3K1JA 3KZYA 1DI2A 4IFDE 4NXME 4WSPA
chains in the Genus database with same CATH topology
4F9BB 4YY3I 4DR6I 4LFCI 4AQYI 1USUA 4PRXA 1N34I 3B8HA 4UT4A 1Y4SA 1A6FA 2L2KB 1ZBTA 1N0UA 2L33A 4M1KA 2FTXB 1ZM3A 4DPWA 2WW4A 4MYUA 1RR9A 2YZTA 2ZBKB 4WYQB 4DV6I 1HK7A 4DR1I 1EA6A 4KHPI 1FJGE 1Y6ZA 4JI6I 4L8NA 2OI2A 4ED4A 4BC7A 4DPYA 3KWRA 4JG4A 2UXBE 2BV3A 4DUYI 3IWDA 4LF8E 1IBKE 3K6QA 1FNMA 4DXLA 2H36X 4JI7I 2Z5BA 4DV1E 5FLXC 4DV3I 1XMQE 1B63A 2DSYA 1J5EI 3Q6NA 3LLHA 2DEJA 1KTVA 5GMDA 2JOXA 2HKEA 2CPNA 4DUZI 2BM1A 4DV0E 1HNWE 2L3CA 4DR4I 4WPYA 3HQ1A 2Q2EB 4BS9A 3CWVA 5ADZA 4DV4I 2UUCE 1HNZE 1Y4UA 3F6HA 2NUEA 4F54A 2VQEI 1KIJA 2IHR1 3WU3A 2MC5A 4IZJA 3JTZA 4JYAE 1EKZA 5LL6R 1N32E 4JV5E 2HFSA 2ZM6I 3P1XA 4JI1I 2F4VE 3T1YE 4DR7E 3V5RA 1UILA 3ADLA 4K0KI 1ELOA 1ZM2A 2LJPA 3J7Yp 3J7AG 5FLXQ 1XNQI 4HY1A 3HXLA 2UU9E 4X8WA 4JI0I 3QT8A 4JI3I 2VQFE 4DKKA 1H7UA 2IOPA 5IWAE 1Z0BA 4DPUA 3D4JA 1PKPA 2HHHE 1WHQA 4FWGA 3ZM7A 3QT5A 4EMDA 1IBLE 1QZRA 4B3SE 1UHZA 4JI4E 1GQEA 4LF9I 4OOGC 4IZKB 4DU7A 1XMOE 3K85A 4DV7E 4HACB 4OX9I 1KKHA 1Z5CA 2KHXA 5AE1A 4URLA 2ODRD 1U2RA 1FKAE 4JI2I 2YT4A 2LJHA 4R8OA 5L3JA 4JYAI 2X36A 4JV5I 2RS7A 5LMNE 3WU5A 4JI5E 4PRVA 4B3TI 3LPSA 2A2DA 3JU0A 2X7IA 5DNYA 3ZKBA 2R3VA 4GKKE 1N33E 1PIEA 4LTYA 3ZZ0A 2LMZA 4Z7CA 4FW9A 3Q1QA 4MYTA 3T1HE 4L5NC 1HNXI 2K4VA 4F9AB 3HPSA 3HTXA 5A2QC 2E5LI 1WHNA 4DV2E 1HR0I 4BC9A 2MDRA 3HULA 1RQ0A 4R1FA 2N3HA 1Z0VA 4IZJD 4DR5I 1N36E 2UXCI 2CZ9A 4KZSA 5BR8I 1X49A 4Q28A 4JI8I 2EWLA 1O0WA 4LF5I 4M2ZA 2WZOA 5AE3A 4X66E 4DV7I 4B3RE 2PNMA 3FIGA 3J81C 3VYXA 4M30A 2J7KA 2Z5CB 1RREA 4WFTA 4BCAA 2UUAE 1DARA 2LTSA 4YHHE 4WUDA 1IBMI 1OJ4A 4HYMA 4B3MI 2NUFA 2FGGA 1FWKA 3ZZUA 4LF4E 4X65E 2O1VA 2ODRC 3T1HI 4P78A 2B7VA 1T4OA 3J7AM 4Z7YA 4LFBI 2V87A 3DF6A 4PU9A 2V34A 1S4EA 2DEIA 3MSWA 4NXMI 2L6MA 1K47A 4UTGA 3PYGA 3DJWA 3J80C 2UUBE 4LFAE 1NHIA 4LF7E 3ZKDA 4DR2E 5LMUE 2KOUA 4FWDA 3ADJA 1ZXNA 2Z5EA 3J81Q 1NHJA 4X64E 2V83A 3V2UC 2UXDE 4P52A 1FJGI 2B7TA 4X62E 1H74A 4WUCA 1YZ9A 2UXBI 4LF8I 1IBKI 3H4LA 4GKJE 4GEQB 1XNRE 2E1RA 1XHKA 4DV1I 4DMIA 1XMQI 3B82A 1FWLA 1SR9A 1WXRA 1PVGA 1X48A 1S16A 2KONA 4DV0I 2R42A 2LTRA 1EI1A 2EFGA 3WU6A 1HNWI 2V8PA 4DR3E 2CG9A 2VF1A 2BM0A 1YYOA 1Z0GA 3AV0A 4DR2I 2UUCI 2DIXA 1HNZI 4BMJA 1I94E 2RSMA 4XTJA 4YY3E 1MX0A 4DR6E 4LFCE 4AQYE 1N34E 1N32I 1ZM4A 4DPXA 2Z5BB 1B62A 2GQ0A 1ZBQA 4P7AA 3B78A 2F4VI 3T1YI 4DR7I 4DV6E 4DR1E 2M4IA 4KHPE 2E1MA 2AJ4A 2V85A 3M6AA 2NPFA 3IWCA 4WUBA 5AE2A 2UU9I 2JR1A 4RPFA 2NUGA 3P06A 3AUZA 2DMYA 2B9DA 2ZITA 4DU8A 4DUYE 4JI7E 2VQFI 3ZOQB 3JAMC 5IWAI 4IZJB 3WU4A 3OTOE 1RC7A 4FWHA 2HHHI 2V2ZA 3LTOA 5FWKA 3ADIA 1IBLI 4J8ZA 4B3SI 4DV3E 4JI4I 2JOBA 3HPZA 1J5EE 1T4LB 1XMOI 3ADGA 1Z0TA 4DUZE 2N3GA 3VK6A 2GS8A 2L2NA 3QT6A 4DR4E 3VYYA 1NHHA 3ZZTA 2O1TA 5LMNI 2HKJA 4DV4E 4JI5I 4LU9A 2DB2A 2L92A 2VQEE 4GKKI 1N33I 2F8BA 1ZM9A 1UEKA 4NXNE 4F9CB 5A2QQ 2JVAA 3HJCA 2VE7C 2ZM6E 1KVKA 4JI1E 3JAMQ 5AASA 2FV4B 1NZ0A 1J26A 3Q6MA 3C4TA 1DQ3A 4IZKA 2JY9A 4DV5E 4K0KE 4DV2I 2L2MA 4HACA 2JWOA 5CFFE 2LUQA 1H73A 1MU5A 1ZXMA 1XNQE 1N36I 3OTOI 3LNUA 4BBYA 4JI0E 2MC6A 4JI3E 4ZVIA 2A2CA 4X66I 4KQVA 4USMA 2RTXA 4B3RI 1T4NA 2V89A 1QU6A 2HK2A 4FN5A 4TUGA 1GZ6A 1WUUA 1FI4A 4LF6E 4LF9E 4P7DA 2UUAI 3RMPA 2LBSB 1D6TA 2EZ6A 4OX9E 4YHHI 3C4BA 2V8QB 2M7QA 2O1WA 2VF3A 2G7HA 5IT9C 4NXNI 4JI2E 1Z5AA 2V2VA 4R03A 4LF4I 2IOQA 4X65I 2LUPB 3K17A 1VISA 2HFUA 4B3TE 3PYFA 1USVA 3J80Q 4DV5I 2Z5CA 2V86A 1H7SA 1BKNA 1N0VC 1HNXE 2UUBI 4LFAI 2B3TB 2O1UA 4LF7I 5LMUI 2RS6A 1YYWA 2M1SA 1HR0E 2E5LE 4USKA 5GMEA 1X47A 3H09A 4I3HA 3IWBA 4X64I 3F6GA 1STUA 1MG7A 4DR5E 2UXCE 2UXDI 4X62I 2LRSA 5BR8E 3LMLA 1Z5BA 5T6JA 4JI8E 4DPTA 4LF5E 4LF6I 3PYDA 2XEXA 5IT9Q 2NA2A 4JI6E 3QT7A 2V88A 2CGEA 1YYKA 4GKJI 1Z59A 3PRYA 4M0VA 5F3WA 3PYEA 1XNRI 4N3OA 3OMLA 1IBME 4TUIA 3F0NA 2LE2A 2L3JA 1H72C 4B3ME 2PNLA 1Z0WA 1Z0EA 4HXZA 1Z0CA 4I8OA 2L8TA 3GONA 4DR3I 2V2QA 2HK3A 4LFBE 1I94I 3K1JA 1DI2A 4NXME 4WSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 I;  4DR6 I;  4LFC I;  4AQY I;  4PRX A;  1N34 I;  3B8H A;  4UT4 A;  1A6F A;  2L2K B;  1ZBT A;  1N0U A;  2L33 A;  4M1K A;  1ZM3 A;  4DPW A;  2WW4 A;  4MYU A;  1RR9 A;  2ZBK B;  4WYQ B;  4DV6 I;  4DR1 I;  1EA6 A;  4KHP I;  1FJG E;  4JI6 I;  2OI2 A;  4ED4 A;  4DPY A;  4JG4 A;  2UXB E;  2BV3 A;  4DUY I;  4DXL A;  4LF8 E;  1IBK E;  1FNM A;  4JI7 I;  4DV1 E;  5FLX C;  4DV3 I;  1XMQ E;  1B63 A;  1J5E I;  3LLH A;  2DEJ A;  1KTV A;  5GMD A;  2HKE A;  2CPN A;  4DUZ I;  2BM1 A;  4DV0 E;  1HNW E;  2L3C A;  4DR4 I;  2Q2E B;  3CWV A;  4DV4 I;  2UUC E;  1HNZ E;  2NUE A;  2VQE I;  1KIJ A;  2IHR 1;  3WU3 A;  4JYA E;  1EKZ A;  5LL6 R;  1N32 E;  4JV5 E;  2HFS A;  2ZM6 I;  3P1X A;  4JI1 I;  2F4V E;  3T1Y E;  4DR7 E;  3V5R A;  1UIL A;  3ADL A;  4K0K I;  1ELO A;  1ZM2 A;  2LJP A;  3J7Y p;  5FLX Q;  3J7A G;  1XNQ I;  4HY1 A;  2UU9 E;  4X8W A;  4JI0 I;  3QT8 A;  4JI3 I;  2VQF E;  4DKK A;  1H7U A;  5IWA E;  1Z0B A;  4DPU A;  3D4J A;  1PKP A;  2HHH E;  1WHQ A;  4FWG A;  3ZM7 A;  3QT5 A;  4EMD A;  1IBL E;  1QZR A;  4B3S E;  1UHZ A;  4JI4 E;  1GQE A;  4LF9 I;  4OOG C;  4DU7 A;  1XMO E;  4DV7 E;  4HAC B;  4OX9 I;  1KKH A;  1Z5C A;  2KHX A;  4URL A;  1U2R A;  1FKA E;  4JI2 I;  2YT4 A;  2LJH A;  5L3J A;  4JYA I;  2X36 A;  4JV5 I;  2RS7 A;  5LMN E;  3WU5 A;  4JI5 E;  4PRV A;  4B3T I;  3LPS A;  2A2D A;  2X7I A;  3ZKB A;  2R3V A;  4GKK E;  1N33 E;  1PIE A;  3ZZ0 A;  4Z7C A;  4FW9 A;  3Q1Q A;  4MYT A;  3T1H E;  1HNX I;  3HTX A;  5A2Q C;  2E5L I;  1WHN A;  4DV2 E;  1HR0 I;  2MDR A;  3HUL A;  1RQ0 A;  4R1F A;  2N3H A;  1Z0V A;  4DR5 I;  1N36 E;  2UXC I;  2CZ9 A;  5BR8 I;  1X49 A;  4JI8 I;  1O0W A;  4LF5 I;  4M2Z A;  4X66 E;  4DV7 I;  4B3R E;  3VYX A;  3J81 C;  4M30 A;  2J7K A;  1RRE A;  4WFT A;  2UUA E;  1DAR A;  2LTS A;  4YHH E;  4WUD A;  1IBM I;  1OJ4 A;  4HYM A;  4B3M I;  2NUF A;  1FWK A;  3ZZU A;  4LF4 E;  4X65 E;  3T1H I;  2B7V A;  1T4O A;  3J7A M;  4Z7Y A;  4LFB I;  4PU9 A;  2V34 A;  1S4E A;  2DEI A;  4NXM I;  1K47 A;  4UTG A;  3PYG A;  3J80 C;  2UUB E;  4LFA E;  1NHI A;  4LF7 E;  3ZKD A;  4DR2 E;  5LMU E;  4FWD A;  3ADJ A;  1ZXN A;  3J81 Q;  1NHJ A;  4X64 E;  3V2U C;  2UXD E;  4P52 A;  1FJG I;  2B7T A;  4X62 E;  1H74 A;  4WUC A;  1YZ9 A;  2UXB I;  4LF8 I;  1IBK I;  3H4L A;  4GKJ E;  1XNR E;  2E1R A;  1XHK A;  4DV1 I;  1XMQ I;  3B82 A;  1FWL A;  1PVG A;  1X48 A;  1S16 A;  4DV0 I;  2R42 A;  2LTR A;  1EI1 A;  2EFG A;  3WU6 A;  1HNW I;  2V8P A;  4DR3 E;  2BM0 A;  1YYO A;  1Z0G A;  4DR2 I;  2UUC I;  2DIX A;  1HNZ I;  1I94 E;  2RSM A;  4XTJ A;  4YY3 E;  1MX0 A;  4DR6 E;  4LFC E;  4AQY E;  1N34 E;  1N32 I;  1ZM4 A;  4DPX A;  1B62 A;  4P7A A;  3B78 A;  2F4V I;  3T1Y I;  4DR7 I;  4DV6 E;  4DR1 E;  4KHP E;  2AJ4 A;  3M6A A;  2NPF A;  4WUB A;  2UU9 I;  4RPF A;  2NUG A;  2DMY A;  2ZIT A;  4DU8 A;  4DUY E;  4JI7 E;  2VQF I;  3JAM C;  5IWA I;  3WU4 A;  3OTO E;  1RC7 A;  4FWH A;  2HHH I;  2V2Z A;  3LTO A;  3ADI A;  1IBL I;  4B3S I;  4DV3 E;  4JI4 I;  1J5E E;  1T4L B;  1XMO I;  3ADG A;  1Z0T A;  4DUZ E;  2N3G A;  2GS8 A;  2L2N A;  3QT6 A;  4DR4 E;  3VYY A;  1NHH A;  3ZZT A;  5LMN I;  2HKJ A;  4DV4 E;  4JI5 I;  2DB2 A;  2VQE E;  4GKK I;  1N33 I;  1ZM9 A;  1UEK A;  4NXN E;  5A2Q Q;  2JVA A;  2ZM6 E;  1KVK A;  4JI1 E;  3JAM Q;  1NZ0 A;  1J26 A;  3C4T A;  2JY9 A;  4DV5 E;  4K0K E;  4DV2 I;  2L2M A;  4HAC A;  5CFF E;  2LUQ A;  1H73 A;  1MU5 A;  1ZXM A;  1XNQ E;  1N36 I;  3OTO I;  3LNU A;  4JI0 E;  4JI3 E;  4ZVI A;  2A2C A;  4X66 I;  4KQV A;  4USM A;  2RTX A;  4B3R I;  1T4N A;  1QU6 A;  2HK2 A;  4FN5 A;  1WUU A;  1FI4 A;  4LF6 E;  4LF9 E;  2UUA I;  2LBS B;  1D6T A;  2EZ6 A;  4OX9 E;  4YHH I;  3C4B A;  2VF3 A;  5IT9 C;  4NXN I;  4JI2 E;  1Z5A A;  2V2V A;  4LF4 I;  4X65 I;  2LUP B;  3K17 A;  1VIS A;  2HFU A;  4B3T E;  3PYF A;  3J80 Q;  4DV5 I;  1H7S A;  1BKN A;  1N0V C;  1HNX E;  2UUB I;  4LFA I;  2B3T B;  4LF7 I;  5LMU I;  2RS6 A;  2E5L E;  1YYW A;  1HR0 E;  4USK A;  5GME A;  1X47 A;  4I3H A;  4X64 I;  1STU A;  1MG7 A;  4DR5 E;  2UXC E;  2UXD I;  4X62 I;  2LRS A;  5BR8 E;  1Z5B A;  4JI8 E;  4DPT A;  4LF5 E;  4LF6 I;  3PYD A;  2XEX A;  5IT9 Q;  2NA2 A;  4JI6 E;  3QT7 A;  1YYK A;  4GKJ I;  1Z59 A;  3PYE A;  1XNR I;  1IBM E;  3F0N A;  2L3J A;  1H72 C;  4B3M E;  1Z0W A;  1Z0E A;  4HXZ A;  1Z0C A;  3GON A;  4DR3 I;  2V2Q A;  2HK3 A;  4LFB E;  1I94 I;  3K1J A;  1DI2 A;  4NXM E; 
#chains in the Genus database with same CATH topology
 1R6M A;  4FW7 A;  4F9B B;  4YY3 I;  4DR6 I;  4LFC I;  4AQY I;  1USU A;  4PRX A;  1N34 I;  2YTG A;  3C6M A;  3B8H A;  2EMH A;  4UT4 A;  5KL5 A;  1Y4S A;  1A6F A;  2JEB B;  1IQS A;  2CT1 A;  2EOE A;  1ZBT A;  2EM2 A;  2L2K B;  2L33 A;  1N0U A;  2FTX B;  1ZM3 A;  4M1K A;  5DRR A;  4DPW A;  2WW4 A;  1PDA A;  4MU4 A;  4IFD C;  4MYU A;  1RR9 A;  2YZT A;  2ZBK B;  4WYQ B;  4DV6 I;  1HK7 A;  2LV2 A;  4DR1 I;  1EA6 A;  2R76 A;  1T38 A;  5DRP A;  4KHP I;  1FJG E;  1MEY C;  1Y6Z A;  3BGH A;  4JI6 I;  4L8N A;  2OI2 A;  1F2I G;  2EN6 A;  4ED4 A;  4BC7 A;  4QNJ A;  4DPY A;  3KWR A;  2DRP A;  4AM3 A;  2BR2 A;  4JG4 A;  4QNK A;  2UXB E;  5JEA E;  2EN2 A;  1B69 A;  2BV3 A;  4DUY I;  4GQU A;  3IWD A;  4LF8 E;  1IBK E;  3K6Q A;  1FNM A;  1A1F A;  2H36 X;  3L7Z B;  4DXL A;  4JI7 I;  2EPO A;  2ENC A;  4N4R B;  2Z5B A;  4DV1 E;  5FLX C;  2PO2 A;  4DV3 I;  2EMK A;  1YUI A;  1XMQ E;  2EML A;  2DSY A;  3KZZ A;  2I9I A;  4FK5 C;  1B63 A;  2BA0 D;  1J5E I;  2NN6 A;  3GME A;  3Q6N A;  3LLH A;  2DEJ A;  1KTV A;  5GMD A;  2JOX A;  3UK3 C;  2A25 A;  2HKE A;  2CPN A;  4DUZ I;  2BM1 A;  4DV0 E;  2PO0 A;  2Q8U A;  1HNW E;  2L3C A;  5KL3 A;  2E72 A;  1MGT A;  4WPY A;  4DR4 I;  3HQ1 A;  2EN8 A;  2PRT A;  2O3Z A;  4LOM A;  4LF4 I;  2Q2E B;  4BS9 A;  4LCH A;  2YPN A;  4O24 A;  3CWV A;  5ADZ A;  5JEA A;  4DV4 I;  3BBG A;  2UUC E;  1HNZ E;  3C6K A;  4U3B A;  1Y4U A;  3F6H A;  2NUE A;  4F54 A;  2VQE I;  1KIJ A;  3U1Y A;  2IHR 1;  3WU3 A;  2MC5 A;  4IZJ A;  5DNL A;  3JTZ A;  4NZV A;  4JYA E;  2YTJ A;  5LL6 R;  2EOZ A;  1EKZ A;  1N32 E;  4JV5 E;  4OKG A;  2YU8 A;  5DRQ A;  5JEA F;  2HFS A;  2WBS A;  2ZM6 I;  2YWQ A;  4Q35 B;  3P1X A;  4JI1 I;  2F4V E;  3T1Y E;  4DR7 E;  3V5R A;  1BBG A;  1UIL A;  2EPA A;  1A1G A;  3ADL A;  3GLL A;  4K0K I;  3EPJ A;  1ELO A;  1JK1 A;  5AC5 A;  1ZM2 A;  2EL6 A;  2EPP A;  2J7J A;  3J7Y p;  1EH6 A;  2LJP A;  4O5G A;  4HTG A;  2DGC A;  1TF6 A;  1YSA C;  3J7A G;  5FLX Q;  1XNQ I;  4HY1 A;  3HXL A;  2YTI A;  4IFD B;  2UU9 E;  2EE8 A;  4X8W A;  3VHT B;  2EMI A;  4JI0 I;  1SFE A;  3UHM A;  1UBD C;  3EPK A;  3M99 B;  4R2E A;  3QT8 A;  2GO4 A;  4JI3 I;  2VQF E;  4DKK A;  1H7U A;  3KRN A;  2IOP A;  5IWA E;  1Z0B A;  4DPU A;  2EMW A;  3D4J A;  1PKP A;  2HHH E;  1WHQ A;  1X6E A;  2JP9 A;  3QT5 A;  2EPZ A;  4FWG A;  3ZM7 A;  4EMD A;  1BB8 A;  1AH5 A;  2DLK A;  1IBL E;  1RMD A;  1QZR A;  3THN A;  4J3D A;  4B3S E;  4LCF A;  4FW3 A;  1UHZ A;  4JI4 E;  1GQE A;  4LF9 I;  4OOG C;  4IZK B;  4DU7 A;  2JE6 A;  1XMO E;  3K85 A;  4DV7 E;  2EOS A;  1T39 A;  4HAC B;  4OX9 I;  4R2P A;  2EMY A;  1KKH A;  2JEA A;  1Z5C A;  2ENA A;  2KHX A;  1PJQ A;  5AE1 A;  1KYQ A;  4URL A;  4R2D A;  5C0X E;  2EQ1 A;  2ODR D;  4KWY A;  1U2R A;  1FKA E;  4JI2 I;  2YT4 A;  2LJH A;  4R8O A;  5L3J A;  1PJT A;  2X36 A;  3B4T A;  4JV5 I;  4JYA I;  2RS7 A;  5LMN E;  1YH8 A;  3EQ1 A;  1E3P A;  3WU5 A;  4JI5 E;  4PRV A;  4B3T I;  3LPS A;  2RSI A;  2A2D A;  3JU0 A;  2X7I A;  5DNY A;  3ZKB A;  2R3V A;  4GKK E;  1N33 E;  1TF3 A;  2C38 B;  1PIE A;  5C0X F;  4LTY A;  3ZZ0 A;  2LMZ A;  4MU1 A;  4Z7C A;  1L4S A;  4FW9 A;  3Q1Q A;  4MYT A;  3T1H E;  4L5N C;  4OO1 A;  1HNX I;  5ELW A;  2YTD A;  4X9J A;  2K4V A;  2NAB A;  4F9A B;  3PS2 A;  3HPS A;  3HTX A;  5A2Q C;  5KL7 A;  2J65 A;  2E5L I;  1WHN A;  4DV2 E;  1HR0 I;  5A6A A;  4BC9 A;  2PNZ A;  2MDR A;  2EOQ A;  3HUL A;  1RQ0 A;  4OO1 F;  4R1F A;  2N3H A;  1Z0V A;  1P42 A;  4IZJ D;  4DR5 I;  1N36 E;  2WCC 3;  2YTP A;  2UXC I;  2CZ9 A;  4KZS A;  5BR8 I;  1X49 A;  4Q28 A;  2HJJ A;  4O4K A;  1UDO A;  4JI8 I;  2EWL A;  1O0W A;  4LF5 I;  4M2Z A;  2WZO A;  5AE3 A;  4X66 E;  2EM3 A;  4MDT A;  4DV7 I;  2HC5 A;  4B3R E;  2PNM A;  3FIG A;  3J81 C;  3VYX A;  4M30 A;  1OYS A;  2J7K A;  2Z5C B;  4BA1 B;  5K36 A;  1RRE A;  1A1H A;  4WFT A;  1Z1B A;  4BCA A;  2ELY A;  2UUA E;  4F6M A;  1DAR A;  2EMB A;  5A69 A;  2LTS A;  2YU5 A;  4YHH E;  2C39 B;  5DNX A;  5K36 F;  3MHS C;  5A6J A;  4WUD A;  1AAY A;  1IMU A;  1IBM I;  1OJ4 A;  4HYM A;  1KJK A;  4B3M I;  4GZN C;  2NUF A;  2FGG A;  1FWK A;  3MHH C;  4LF4 E;  3ZZU A;  4X65 E;  2O1V A;  2NN6 E;  2ODR C;  3T1H I;  2EL4 A;  4P78 A;  2B7V A;  2EM0 A;  2K7I A;  2EN3 A;  4ZYG A;  1T4O A;  3J7A M;  4Z7Y A;  4LFB I;  2BA0 G;  4R2A A;  2V87 A;  3DF6 A;  4MLQ A;  2V34 A;  4PU9 A;  1S4E A;  1OYR A;  2EPN A;  2YTO A;  3MSW A;  2L6M A;  2DEI A;  2NN6 C;  4NXM I;  1K47 A;  2EOH A;  4M9V C;  3PYG A;  2C37 B;  4UTG A;  2NN6 F;  3DJW A;  3J80 C;  2EOY A;  2UUB E;  4LFA E;  1NHI A;  4BA2 B;  4LF7 E;  3ZKD A;  5C0X D;  4DR2 E;  5C0X B;  5LMU E;  2KOU A;  4MQY A;  5DRO A;  4FWD A;  3ADJ A;  2YRK A;  1ZXN A;  2Z5E A;  3P3G A;  3J81 Q;  4O43 A;  2EOJ A;  1NHJ A;  2LJU A;  4X64 E;  2V83 A;  2EPR A;  5JEA C;  2EOO A;  3V2U C;  2UXD E;  2YTF A;  2PO1 B;  4P52 A;  1FJG I;  2B7T A;  4X62 E;  2WBU A;  1QNT A;  2GHF A;  1H74 A;  4WUC A;  1YZ9 A;  2WNR A;  2UXB I;  4FW4 A;  4LF8 I;  1IBK I;  2MDG A;  2MKD A;  3H4L A;  2EN7 A;  2BA1 D;  2YTN A;  4GKJ E;  4GEQ B;  3CDJ A;  3L00 A;  1X5W A;  1XNR E;  2WBT A;  2E1R A;  1XHK A;  4DV1 I;  2EMC A;  1Y60 A;  2JEB A;  2LVH A;  4BHB A;  4DMI A;  1VI7 A;  1XMQ I;  3B82 A;  2EPL X;  1YPN A;  3GCM A;  1A1J A;  1FWL A;  1SR9 A;  1WXR A;  1PVG A;  1X48 A;  3P76 A;  1S16 A;  2KON A;  4WSG A;  4DV0 I;  4R2C A;  2R42 A;  2LTR A;  5A6K A;  1EI1 A;  2EFG A;  3WU6 A;  1HNW I;  2V8P A;  4BHC A;  2CTD A;  4DR3 E;  1A1K A;  1NCS A;  2CG9 A;  2VF1 A;  4F2J C;  1X6F A;  2BR2 B;  2BM0 A;  1YYO A;  3EPL A;  3AV0 A;  1Z0G A;  3M85 D;  4DR2 I;  2UUC I;  2DIX A;  2I13 A;  1HNZ I;  4BMJ A;  2EPK X;  1I94 E;  3L7Z A;  3BF2 A;  1WRJ A;  1LLM C;  2RSM A;  4XTJ A;  4YY3 E;  1MX0 A;  4DR6 E;  2EMX A;  4LFC E;  4AQY E;  5TSE A;  1N34 E;  1IQO A;  4LCG A;  1N32 I;  2EMF A;  1ZM4 A;  4DPX A;  2Z5B B;  1B62 A;  2PO2 B;  2MKN A;  2GQ0 A;  1EH8 A;  1ZBQ A;  2ENH A;  4RH8 A;  4AIM A;  4P7A A;  3B78 A;  4ZYH A;  2F4V I;  3T1Y I;  2NN6 D;  2NN6 B;  4DR7 I;  5C0X C;  1YFH A;  4DV6 E;  4OO1 E;  4ISA A;  4DR1 E;  2YTQ A;  3P3C A;  2M4I A;  3PS3 A;  2PO0 B;  4KHP E;  3M7N D;  2E1M A;  1G2F C;  2HGH A;  4RHB B;  2AJ4 A;  2V85 A;  3M6A A;  2NPF A;  3IWC A;  4WUB A;  1NEI A;  2R1F A;  2EP3 A;  5AE2 A;  1X6H A;  2UU9 I;  2JR1 A;  4RPF A;  2NUG A;  3P06 A;  4WXD A;  5JEA D;  3CDI A;  3AUZ A;  5JEA B;  2DMY A;  2B9D A;  2ZIT A;  1XXE A;  5IXM B;  4DUY E;  4DU8 A;  4OO1 C;  4JI7 E;  2VQF I;  3ZOQ B;  3JAM C;  2EOF A;  2ADR A;  5IWA I;  4IZJ B;  3WU4 A;  3OTO E;  1RC7 A;  4FWH A;  2HHH I;  2JT2 A;  1UDQ A;  2V2Z A;  3LTO A;  5FWK A;  3ADI A;  1IBL I;  4J8Z A;  5KL4 A;  4B3S I;  4DV3 E;  2YSO A;  4JI4 I;  2JOB A;  3HPZ A;  1J5E E;  1T4L B;  2BB8 A;  2EJ4 A;  1XMO I;  2EMZ A;  5K36 E;  3ADG A;  1Z0T A;  3P3E A;  4DUZ E;  2N3G A;  3VK6 A;  2GS8 A;  2L2N A;  4ZYD A;  2BBG A;  1BBO A;  3QT6 A;  4DR4 E;  4F6N A;  2D9H A;  2EN4 A;  3VYY A;  4IFD A;  1NHH A;  5K36 C;  3ZZT A;  2O1T A;  5LMN I;  2HKJ A;  4DV4 E;  4JI5 I;  4LU9 A;  2JPA A;  2DB2 A;  2WP8 A;  4U3D A;  2YSP A;  2EM6 A;  2L92 A;  2VQE E;  4GKK I;  1N33 I;  2F8B A;  1ZM9 A;  1UEK A;  2EQ3 A;  4F9C B;  4R2Q A;  4NXN E;  4NBQ A;  1PJS A;  4IFD F;  5A2Q Q;  1N3G A;  2JVA A;  2CVE A;  4IS9 A;  3HJC A;  2VE7 C;  2ZM6 E;  1KVK A;  2GPI A;  5LLQ A;  4JI1 E;  3JAM Q;  2JE6 B;  5AAS A;  2FV4 B;  1NZ0 A;  1J26 A;  3Q6M A;  3C4T A;  1DQ3 A;  4IZK A;  1P47 A;  2YTE A;  2JY9 A;  4DV5 E;  4K0K E;  1RHY A;  4DV2 I;  2JEA B;  2L2M A;  4HAC A;  2JWO A;  2EM4 A;  5CFF E;  3PS1 A;  2IER A;  1A1I A;  2LUQ A;  1H73 A;  1MU5 A;  4LPF A;  1ZXM A;  1XNQ E;  1N36 I;  2EL5 A;  3OTO I;  2N8X A;  3LNU A;  4BBY A;  2YRH A;  4R2S A;  2CSH A;  2MC6 A;  2EPX A;  1WJP A;  2EPC A;  2JYA A;  1GTK A;  3ECR A;  5A6B A;  4IS1 C;  4JI3 E;  4ZVI A;  2A2C A;  1ZR9 A;  4X66 I;  1ZAA C;  1YUJ A;  2ELZ A;  4KQV A;  3HKM A;  4MU0 A;  4USM A;  2RTX A;  4B3R I;  1T4N A;  2C38 A;  4JI0 E;  2V89 A;  1QU6 A;  2HK2 A;  4FW6 A;  4OZE A;  4FN5 A;  4TUG A;  4OO1 B;  1GZ6 A;  4OO1 D;  1WUU A;  1UDS A;  1FI4 A;  4LF6 E;  4LF9 E;  4P7D A;  5KL2 A;  1TN9 A;  2UUA I;  3RMP A;  2LBS B;  1D6T A;  2EZ6 A;  4OX9 E;  2AE8 A;  4YHH I;  5KL6 A;  2PNZ B;  3C4B A;  2V8Q B;  5AC4 A;  2M7Q A;  2O1W A;  2VF3 A;  4AID A;  2GLI A;  2G7H A;  1UN6 B;  5IT9 C;  2LO3 A;  2BA1 G;  4JI2 E;  2EM9 A;  1Z5A A;  2V2V A;  4R03 A;  4NXN I;  2IOQ A;  2RPC A;  4X65 I;  5EL9 A;  1JK2 A;  2LUP B;  3K17 A;  4FW5 A;  3U1K A;  2M9A A;  2VRD A;  1VIS A;  2HFU A;  2EOM A;  4B3T E;  3TQM A;  3PYF A;  2EQ0 A;  1USV A;  1A1L A;  3J80 Q;  2F1D A;  2VES A;  1UDN A;  4DV5 I;  5K36 D;  5K36 B;  2EOX A;  2Z5C A;  2V86 A;  1H7S A;  4BA1 A;  1BKN A;  1N0V C;  1HNX E;  1E3H A;  2UUB I;  4LFA I;  2B3T B;  3EPH A;  2O1U A;  2DMI A;  4LF7 I;  2EPM X;  4IFD D;  5LMU I;  2LCE A;  5IV8 B;  5EKW A;  2RS6 A;  2M1S A;  2E5L E;  1HR0 E;  1YYW A;  4USK A;  5GME A;  2EMG A;  3M85 G;  2C39 A;  2WP8 B;  1X47 A;  3H09 A;  4I3H A;  3IWB A;  4X64 I;  3F6G A;  3DD6 A;  4NHR A;  1STU A;  1MG7 A;  3THO B;  2EOR A;  4DR5 E;  2UXC E;  2UXD I;  2EN1 A;  4X62 I;  2LRS A;  5BR8 E;  2GO3 A;  3LML A;  1Z5B A;  2EOI A;  3QG5 C;  5T6J A;  4JI8 E;  1ZU1 A;  4DPT A;  4LF5 E;  3BID A;  2DLQ A;  4LF6 I;  3PYD A;  1Y5Y A;  2XEX A;  4ZYE A;  5IT9 Q;  4WX9 A;  1YHC A;  2JXP A;  2NA2 A;  4R2R A;  2IES A;  2EM7 A;  4WXC A;  2EM5 A;  1X3C A;  2EPU A;  2V88 A;  4JI6 E;  2CGE A;  3QT7 A;  1R6L A;  1DGC A;  2RQL A;  1YYK A;  4GKJ I;  1Z59 A;  2C37 A;  3M7N G;  3PRY A;  4M0V A;  4BA2 A;  5F3W A;  3PYE A;  1XNR I;  5C0X A;  2EMA A;  4MU3 A;  4N3O A;  3OML A;  5A6B D;  2EM8 A;  4MLV A;  1IBM E;  1OYP A;  4TUI A;  1EH7 A;  3F0N A;  2LE2 A;  2L3J A;  1H72 C;  2YRM A;  4HEI A;  1G2D C;  4B3M E;  2PNL A;  2PO1 A;  2LT7 A;  1Z0W A;  1Z0E A;  4HXZ A;  1Z0C A;  4I8O A;  2L8T A;  3GON A;  4DR3 I;  2V2Q A;  2WNR B;  2HK3 A;  3NZK A;  4LFB E;  3H1C A;  4IJD A;  1I94 I;  3K1J A;  3KZY A;  1DI2 A;  4IFD E;  4NXM E;  4WSP A; 
#chains in the Genus database with same CATH homology
 4F9B B;  4YY3 I;  4DR6 I;  4LFC I;  4AQY I;  1USU A;  4PRX A;  1N34 I;  3B8H A;  4UT4 A;  1Y4S A;  1A6F A;  2L2K B;  1ZBT A;  1N0U A;  2L33 A;  4M1K A;  2FTX B;  1ZM3 A;  4DPW A;  2WW4 A;  4MYU A;  1RR9 A;  2YZT A;  2ZBK B;  4WYQ B;  4DV6 I;  1HK7 A;  4DR1 I;  1EA6 A;  4KHP I;  1FJG E;  1Y6Z A;  4JI6 I;  4L8N A;  2OI2 A;  4ED4 A;  4BC7 A;  4DPY A;  3KWR A;  4JG4 A;  2UXB E;  2BV3 A;  4DUY I;  3IWD A;  4LF8 E;  1IBK E;  3K6Q A;  1FNM A;  4DXL A;  2H36 X;  4JI7 I;  2Z5B A;  4DV1 E;  5FLX C;  4DV3 I;  1XMQ E;  1B63 A;  2DSY A;  1J5E I;  3Q6N A;  3LLH A;  2DEJ A;  1KTV A;  5GMD A;  2JOX A;  2HKE A;  2CPN A;  4DUZ I;  2BM1 A;  4DV0 E;  1HNW E;  2L3C A;  4DR4 I;  4WPY A;  3HQ1 A;  2Q2E B;  4BS9 A;  3CWV A;  5ADZ A;  4DV4 I;  2UUC E;  1HNZ E;  1Y4U A;  3F6H A;  2NUE A;  4F54 A;  2VQE I;  1KIJ A;  2IHR 1;  3WU3 A;  2MC5 A;  4IZJ A;  3JTZ A;  4JYA E;  1EKZ A;  5LL6 R;  1N32 E;  4JV5 E;  2HFS A;  2ZM6 I;  3P1X A;  4JI1 I;  2F4V E;  3T1Y E;  4DR7 E;  3V5R A;  1UIL A;  3ADL A;  4K0K I;  1ELO A;  1ZM2 A;  2LJP A;  3J7Y p;  3J7A G;  5FLX Q;  1XNQ I;  4HY1 A;  3HXL A;  2UU9 E;  4X8W A;  4JI0 I;  3QT8 A;  4JI3 I;  2VQF E;  4DKK A;  1H7U A;  2IOP A;  5IWA E;  1Z0B A;  4DPU A;  3D4J A;  1PKP A;  2HHH E;  1WHQ A;  4FWG A;  3ZM7 A;  3QT5 A;  4EMD A;  1IBL E;  1QZR A;  4B3S E;  1UHZ A;  4JI4 E;  1GQE A;  4LF9 I;  4OOG C;  4IZK B;  4DU7 A;  1XMO E;  3K85 A;  4DV7 E;  4HAC B;  4OX9 I;  1KKH A;  1Z5C A;  2KHX A;  5AE1 A;  4URL A;  2ODR D;  1U2R A;  1FKA E;  4JI2 I;  2YT4 A;  2LJH A;  4R8O A;  5L3J A;  4JYA I;  2X36 A;  4JV5 I;  2RS7 A;  5LMN E;  3WU5 A;  4JI5 E;  4PRV A;  4B3T I;  3LPS A;  2A2D A;  3JU0 A;  2X7I A;  5DNY A;  3ZKB A;  2R3V A;  4GKK E;  1N33 E;  1PIE A;  4LTY A;  3ZZ0 A;  2LMZ A;  4Z7C A;  4FW9 A;  3Q1Q A;  4MYT A;  3T1H E;  4L5N C;  1HNX I;  2K4V A;  4F9A B;  3HPS A;  3HTX A;  5A2Q C;  2E5L I;  1WHN A;  4DV2 E;  1HR0 I;  4BC9 A;  2MDR A;  3HUL A;  1RQ0 A;  4R1F A;  2N3H A;  1Z0V A;  4IZJ D;  4DR5 I;  1N36 E;  2UXC I;  2CZ9 A;  4KZS A;  5BR8 I;  1X49 A;  4Q28 A;  4JI8 I;  2EWL A;  1O0W A;  4LF5 I;  4M2Z A;  2WZO A;  5AE3 A;  4X66 E;  4DV7 I;  4B3R E;  2PNM A;  3FIG A;  3J81 C;  3VYX A;  4M30 A;  2J7K A;  2Z5C B;  1RRE A;  4WFT A;  4BCA A;  2UUA E;  1DAR A;  2LTS A;  4YHH E;  4WUD A;  1IBM I;  1OJ4 A;  4HYM A;  4B3M I;  2NUF A;  2FGG A;  1FWK A;  3ZZU A;  4LF4 E;  4X65 E;  2O1V A;  2ODR C;  3T1H I;  4P78 A;  2B7V A;  1T4O A;  3J7A M;  4Z7Y A;  4LFB I;  2V87 A;  3DF6 A;  4PU9 A;  2V34 A;  1S4E A;  2DEI A;  3MSW A;  4NXM I;  2L6M A;  1K47 A;  4UTG A;  3PYG A;  3DJW A;  3J80 C;  2UUB E;  4LFA E;  1NHI A;  4LF7 E;  3ZKD A;  4DR2 E;  5LMU E;  2KOU A;  4FWD A;  3ADJ A;  1ZXN A;  2Z5E A;  3J81 Q;  1NHJ A;  4X64 E;  2V83 A;  3V2U C;  2UXD E;  4P52 A;  1FJG I;  2B7T A;  4X62 E;  1H74 A;  4WUC A;  1YZ9 A;  2UXB I;  4LF8 I;  1IBK I;  3H4L A;  4GKJ E;  4GEQ B;  1XNR E;  2E1R A;  1XHK A;  4DV1 I;  4DMI A;  1XMQ I;  3B82 A;  1FWL A;  1SR9 A;  1WXR A;  1PVG A;  1X48 A;  1S16 A;  2KON A;  4DV0 I;  2R42 A;  2LTR A;  1EI1 A;  2EFG A;  3WU6 A;  1HNW I;  2V8P A;  4DR3 E;  2CG9 A;  2VF1 A;  2BM0 A;  1YYO A;  1Z0G A;  3AV0 A;  4DR2 I;  2UUC I;  2DIX A;  1HNZ I;  4BMJ A;  1I94 E;  2RSM A;  4XTJ A;  4YY3 E;  1MX0 A;  4DR6 E;  4LFC E;  4AQY E;  1N34 E;  1N32 I;  1ZM4 A;  4DPX A;  2Z5B B;  1B62 A;  2GQ0 A;  1ZBQ A;  4P7A A;  3B78 A;  2F4V I;  3T1Y I;  4DR7 I;  4DV6 E;  4DR1 E;  2M4I A;  4KHP E;  2E1M A;  2AJ4 A;  2V85 A;  3M6A A;  2NPF A;  3IWC A;  4WUB A;  5AE2 A;  2UU9 I;  2JR1 A;  4RPF A;  2NUG A;  3P06 A;  3AUZ A;  2DMY A;  2B9D A;  2ZIT A;  4DU8 A;  4DUY E;  4JI7 E;  2VQF I;  3ZOQ B;  3JAM C;  5IWA I;  4IZJ B;  3WU4 A;  3OTO E;  1RC7 A;  4FWH A;  2HHH I;  2V2Z A;  3LTO A;  5FWK A;  3ADI A;  1IBL I;  4J8Z A;  4B3S I;  4DV3 E;  4JI4 I;  2JOB A;  3HPZ A;  1J5E E;  1T4L B;  1XMO I;  3ADG A;  1Z0T A;  4DUZ E;  2N3G A;  3VK6 A;  2GS8 A;  2L2N A;  3QT6 A;  4DR4 E;  3VYY A;  1NHH A;  3ZZT A;  2O1T A;  5LMN I;  2HKJ A;  4DV4 E;  4JI5 I;  4LU9 A;  2DB2 A;  2L92 A;  2VQE E;  4GKK I;  1N33 I;  2F8B A;  1ZM9 A;  1UEK A;  4NXN E;  4F9C B;  5A2Q Q;  2JVA A;  3HJC A;  2VE7 C;  2ZM6 E;  1KVK A;  4JI1 E;  3JAM Q;  5AAS A;  2FV4 B;  1NZ0 A;  1J26 A;  3Q6M A;  3C4T A;  1DQ3 A;  4IZK A;  2JY9 A;  4DV5 E;  4K0K E;  4DV2 I;  2L2M A;  4HAC A;  2JWO A;  5CFF E;  2LUQ A;  1H73 A;  1MU5 A;  1ZXM A;  1XNQ E;  1N36 I;  3OTO I;  3LNU A;  4BBY A;  4JI0 E;  2MC6 A;  4JI3 E;  4ZVI A;  2A2C A;  4X66 I;  4KQV A;  4USM A;  2RTX A;  4B3R I;  1T4N A;  2V89 A;  1QU6 A;  2HK2 A;  4FN5 A;  4TUG A;  1GZ6 A;  1WUU A;  1FI4 A;  4LF6 E;  4LF9 E;  4P7D A;  2UUA I;  3RMP A;  2LBS B;  1D6T A;  2EZ6 A;  4OX9 E;  4YHH I;  3C4B A;  2V8Q B;  2M7Q A;  2O1W A;  2VF3 A;  2G7H A;  5IT9 C;  4NXN I;  4JI2 E;  1Z5A A;  2V2V A;  4R03 A;  4LF4 I;  2IOQ A;  4X65 I;  2LUP B;  3K17 A;  1VIS A;  2HFU A;  4B3T E;  3PYF A;  1USV A;  3J80 Q;  4DV5 I;  2Z5C A;  2V86 A;  1H7S A;  1BKN A;  1N0V C;  1HNX E;  2UUB I;  4LFA I;  2B3T B;  2O1U A;  4LF7 I;  5LMU I;  2RS6 A;  1YYW A;  2M1S A;  1HR0 E;  2E5L E;  4USK A;  5GME A;  1X47 A;  3H09 A;  4I3H A;  3IWB A;  4X64 I;  3F6G A;  1STU A;  1MG7 A;  4DR5 E;  2UXC E;  2UXD I;  4X62 I;  2LRS A;  5BR8 E;  3LML A;  1Z5B A;  5T6J A;  4JI8 E;  4DPT A;  4LF5 E;  4LF6 I;  3PYD A;  2XEX A;  5IT9 Q;  2NA2 A;  4JI6 E;  3QT7 A;  2V88 A;  2CGE A;  1YYK A;  4GKJ I;  1Z59 A;  3PRY A;  4M0V A;  5F3W A;  3PYE A;  1XNR I;  4N3O A;  3OML A;  1IBM E;  4TUI A;  3F0N A;  2LE2 A;  2L3J A;  1H72 C;  4B3M E;  2PNL A;  1Z0W A;  1Z0E A;  4HXZ A;  1Z0C A;  4I8O A;  2L8T A;  3GON A;  4DR3 I;  2V2Q A;  2HK3 A;  4LFB E;  1I94 I;  3K1J A;  1DI2 A;  4NXM E;  4WSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...