2ZM6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2zm6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2zm6E02
2IHR1 2LRSA 4K0KE 2VF3A 5FLXQ 1KTVA 2ZM6E 2CZ9A 4DR7E 1Z0EA 4WUCA 2UUAI 1MG7A 4DV1I 4UT4A 2YT4A 4JI4E 4DUZI 1H72C 1FKAE 1NHJA 4FWDA 4K0KI 2L3CA 2V2ZA 1H7UA 3PYGA 4UTGA 4DR7I 1Z0TA 4LF6I 3ADGA 4HYMA 2V34A 4DV7I 3J7Yp 1NHIA 3F0NA 5A2QQ 1ZXNA 4JI6I 4DV0E 4JI7E 3WU5A 3V2UC 4ZVIA 2LJHA 1IBLI 2JVAA 4LF5E 1Z5CA 5FLXC 4DPTA 1FWLA 1DI2A 4PRXA 1EKZA 1J5EI 2HFUA 1UILA 5IWAE 1DARA 4RPFA 1BKNA 2HHHE 1FI4A 1IBKE 4DV0I 1QZRA 4USKA 4X64I 4JI7I 5L3JA 1FNMA 1X48A 4DR6E 2DEJA 4DV3I 4HXZA 4DXLA 3LPSA 2E1RA 4WYQB 2RS7A 1XHKA 4LF5I 3ADJA 4I3HA 1OJ4A 1N34I 4YY3E 5IWAI 5LL6R 4LFAE 2HHHI 3HULA 1X47A 1HNWE 2N3HA 4B3TI 3VYYA 4DR6I 1ZBTA 1XMQE 1N33E 3QT6A 2LUPB 1FJGE 5A2QC 4YY3I 1I94E 1UEKA 2R3VA 1J26A 1KIJA 3WU4A 4JI1E 4HACB 1XMQI 3B78A 1NHHA 4PRVA 4LF9E 1Z5BA 2UUBE 1FJGI 4GKKI 1Z0GA 2UU9I 3Q1QA 1KVKA 2NA2A 1I94I 4OX9I 3H4LA 2LBSB 2B7VA 4DPYA 4JI1I 3D4JA 1K47A 4EMDA 4DPXA 4M30A 4LF6E 1YYOA 1ELOA 2NUFA 2DMYA 4LF9I 3LTOA 4X65I 2UUBI 4B3MI 1O0WA 1UHZA 4DV7E 1EI1A 4DU8A 1RREA 3QT7A 3WU6A 1PIEA 4ED4A 4JI6E 4JI2E 3K1JA 4JV5E 1T4NA 1IBLE 4P52A 3ADIA 1N0UA 2L3JA 1EA6A 2DEIA 4MYTA 1XNQI 1J5EE 1HNZE 4B3SI 1B63A 1ZM4A 4DR2E 3ZM7A 3T1YI 3K17A 3PYFA 2B7TA 4JI2I 4X64E 2V2QA 4DU7A 2UXCE 4JV5I 4DV3E 1N32I 4LF7E 1A6FA 1MU5A 3WU3A 4M2ZA 2N3GA 4HY1A 1PKPA 1WHQA 3C4BA 1HNZI 1N34E 4DR2I 1X49A 5GMDA 4Z7CA 2V2VA 4B3TE 4DR1I 4KHPI 2UXBE 2UXCI 3ZZ0A 1Z0BA 4LF7I 1STUA 3PYEA 2BV3A 2X7IA 3M6AA 1FWKA 4DV2I 1RQ0A 2L2KB 4LFCE 4DUYI 2HKEA 1H7SA 1HNXE 1ZM9A 2LTSA 4JI5I 3CWVA 4FWHA 4JG4A 1Z0VA 3OTOI 2L2NA 2F4VI 2L33A 2GS8A 2ZBKB 2UXBI 1D6TA 1GQEA 2HKJA 4LF4E 4HACA 2VQFI 3QT8A 1QU6A 4LFCI 5GMEA 1HNXI 4GKKE 2UU9E 2X36A 3T1HI 2MDRA 1WHNA 4OX9E 4JI3I 4MYUA 3HTXA 3LLHA 4LF4I 4PU9A 4LFBE 4X65E 2L2MA 2A2CA 4NXNE 2R42A 3LNUA 4B3ME 1N36E 1H73A 4DR3E 2LTRA 4DV6E 4NXMI 4FWGA 1U2RA 1S16A 4DR4E 1ZXMA 4JI8E 1N0VC 4LFBI 3V5RA 2EZ6A 2EFGA 2Q2EB 2UUCE 4DR5E 3VYXA 4NXNI 4OOGC 1YYWA 1N36I 1XNQE 1NZ0A 2DB2A 3GONA 4DR3I 4B3SE 4X8WA 4XTJA 4DV6I 3T1YE 2E5LE 4WUBA 4DR4I 3PYDA 2NUGA 4JI8I 4FW9A 4FN5A 1N32E 2J7KA 5LMUI 5CFFE 4YHHE 3J7AM 2VQEE 2UUCI 4DR5I 1HR0E 1KKHA 4Z7YA 4X66E 1RC7A 2NPFA 4USMA 2ZM6I 2E5LI 2RS6A 3P1XA 4KQVA 4WUDA 3J7AG 1YZ9A 4DR1E 5LMNE 4LF8E 2LUQA 4KHPE 2KHXA 4YHHI 4JI4I 2VQEI 4R1FA 3ZKBA 1MX0A 4DV2E 1HR0I 4DUYE 2XEXA 1XNRE 4X66I 1Z59A 4DV5E 4JI5E 2AJ4A 1RR9A 2WW4A 3OTOE 2F4VE 4URLA 4LF8I 5LMNI 4M1KA 5IT9Q 1Z0CA 3JAMQ 3J81Q 3ZZTA 3B8HA 2VQFE 3ZZUA 2HK2A 3J80Q 4AQYE 1S4EA 4DV4E 2RTXA 5BR8E 2LJPA 1XNRI 2A2DA 1ZM3A 1YYKA 3T1HE 4DV5I 4B3RE 1H74A 4JI3E 4WFTA 2OI2A 2UXDE 1T4OA 1VISA 1IBME 3C4TA 4AQYI 4DV4I 5BR8I 4P7AA 2BM0A 3ZKDA 1XMOE 1Z0WA 2ZITA 4B3RI 1IBKI 2B3TB 3QT5A 4NXME 1Z5AA 3B82A 2CPNA 1ZM2A 2UXDI 1PVGA 1IBMI 2RSMA 4X62E 4JYAE 4GKJE 4JI0E 1B62A 1XMOI 4LFAI 5IT9C 2DIXA 3JAMC 2JY9A 3J81C 1HNWI 4DPUA 2NUEA 4DPWA 1WUUA 2V8PA 3J80C 4DKKA 5LMUE 1N33I 2BM1A 2HFSA 2UUAE 2HK3A 4DV1E 4X62I 4DUZE 1T4LB 4JYAI 4GKJI 4JI0I 3ADLA
chains in the Genus database with same CATH superfamily
2IHR1 3GLLA 2LRSA 4K0KE 4WXDA 4Q35B 2DLQA 2VF3A 5FLXQ 1KTVA 2EMGA 3THNA 4LPFA 2ZM6E 2CZ9A 4QNKA 5JEAB 2YSPA 2BBGA 2LCEA 1GZ6A 4DR7E 1Z0EA 2JT2A 3M7NG 5DRPA 4WUCA 4BA2A 3P3EA 2UUAI 1MG7A 2DLKA 3JTZA 4DV1I 4UT4A 2YT4A 2E72A 4JI4E 2GO4A 1H72C 4DUZI 2PO1B 4WPYA 2EM9A 2PNMA 4AIDA 4LTYA 3MSWA 1FKAE 2WNRA 2PNZB 2YPNA 3M99B 1NHJA 2GHFA 4FWDA 4K0KI 2L3CA 3KZZA 1A1GA 2V2ZA 4LCHA 2EN1A 2EPXA 1H7UA 3EPLA 5ADZA 3B4TA 1OYSA 4O24A 2JOXA 3PYGA 4U3BA 4UTGA 4DR7I 2EWLA 3PS2A 1Z0TA 4IFDB 2J65A 3M85G 2ELYA 2C39B 2JE6B 3HXLA 1A1LA 2EMKA 4O5GA 2CSHA 1DQ3A 2IERA 3P76A 4FW5A 4QNJA 4LF6I 2HC5A 3ADGA 1OYPA 4OO1F 2YTNA 5AC5A 2WBTA 4NHRA 3CDJA 2PRTA 4HYMA 2EL6A 2V34A 1P42A 3J7Yp 4DV7I 2I13A 2J7JA 2NN6F 1NHIA 3F0NA 2CGEA 4MU4A 5A2QQ 2EE8A 1TF3A 1X6EA 1ZXNA 3Q6NA 4DV0E 1Y6ZA 2ENCA 3DF6A 1P47A 2V83A 2WZOA 4JI7E 1A1KA 5K36F 3IWBA 2EMLA 3WU5A 2M1SA 2CTDA 4OO1B 2EPKX 1YUJA 2EJ4A 3V2UC 1LLMC 3L7ZA 4ZVIA 2LJHA 3U1KA 1G2DC 5C0XD 1IBLI 5AASA 3EQ1A 2PO2A 2JVAA 4LF5E 1Z5CA 3PS1A 4BA1A 4IZJB 5FLXC 4DPTA 3IWCA 2NN6B 1FWLA 2EPLX 4R2EA 3UK3C 1EKZA 1DI2A 1UDSA 5DNYA 4PRXA 1J5EI 2HFUA 1UILA 2JR1A 5A6BA 1Y60A 5IWAE 2WP8B 1DARA 5DNLA 2EMHA 5K36B 2WBSA 1ZBQA 2Z5CA 5KL5A 1BKNA 4RPFA 2HHHE 2JEAB 1FI4A 4IZKB 4MQYA 1IBKE 4DV0I 1PJQA 2ELZA 4F6NA 1QZRA 4USKA 4X64I 4JI7I 5L3JA 2L92A 1FNMA 1X48A 4DR6E 2DEJA 4DV3I 4HXZA 4DXLA 2DSYA 2EP3A 3LPSA 2O3ZA 3C6MA 1UBDC 4HTGA 2E1RA 4WYQB 2RS7A 1XHKA 2IOQA 2PNLA 1AH5A 3P06A 4LF5I 3ADJA 5TSEA 4I3HA 3HPZA 4WSPA 2EOXA 2EM7A 1OJ4A 4FW4A 1N34I 4YY3E 2VESA 5IWAI 2YRMA 2EL4A 2MDGA 4R2DA 2NABA 5LL6R 2EMZA 4LFAE 2HHHI 2PO0A 4OZEA 3HULA 2EOOA 2R76A 1X47A 5ELWA 1HNWE 2N3HA 4L5NC 4BMJA 1IQOA 4B3TI 3VYYA 4LCGA 2BA0D 2VRDA 4N3OA 3KRNA 4DR6I 1ZBTA 2F8BA 1XMQE 2EOIA 1N33E 2RPCA 2MKNA 3QT6A 3PS3A 2EPMX 2LUPB 4J3DA 2V86A 1FJGE 5A2QC 1IQSA 1TN9A 4YY3I 3C6KA 4IFDD 1I94E 4N4RB 2Z5BA 3EPHA 1F2IG 1TF6A 1UEKA 2R3VA 5KL7A 2BA1G 1J26A 1KIJA 2E1MA 2EOYA 2EOMA 2BR2A 3WU4A 5JEAA 2EMAA 4JI1E 2EMCA 4HACB 2IOPA 1XMQI 4MLQA 3MHHC 5KL6A 2EOEA 1AAYA 3B78A 1NHHA 4PRVA 4LF9E 2K4VA 5FWKA 1Z5BA 2EM6A 2K7IA 3M7ND 5DRQA 2HJJA 1ZU1A 2DMIA 2UUBE 5F3WA 3Q6MA 1RHYA 4ISAA 2PO1A 2EMYA 2JYAA 1FJGI 4GKKI 3F6HA 1Z0GA 2PNZA 2UU9I 3LMLA 2YTFA 1USUA 3P3CA 2EPAA 1KVKA 3Q1QA 2NA2A 1I94I 2M4IA 3HQ1A 1R6LA 4OKGA 4DMIA 4OX9I 3H4LA 2LBSB 2KOUA 4WX9A 2B7VA 4DPYA 3OMLA 4JI1I 5A69A 3D4JA 1K47A 4TUIA 4EMDA 2C39A 2O1UA 4DPXA 4M30A 4LF6E 1YYOA 1ELOA 2NUFA 2DMYA 4LF9I 2WCC3 3LTOA 4X65I 3DJWA 2UUBI 2EPNA 1MEYC 3M85D 4B3MI 2FTXB 3VHTB 1UDQA 1O0WA 1UHZA 4DV7E 1EI1A 2FGGA 4ZYHA 2GQ0A 4DU8A 1RREA 3QT7A 3WU6A 1PIEA 4AIMA 4JI6E 2WBUA 4ED4A 1SR9A 4JI2E 2EN3A 2EMFA 2L8TA 4WSGA 5AE3A 2EOJA 2V8QB 3K1JA 4LOMA 1NCSA 1A1IA 4JV5E 1X6FA 1KYQA 2EN6A 4OO1A 2JWOA 4KZSA 3AV0A 2EM8A 1T4NA 1IBLE 2EMWA 4OO1D 4P52A 3ADIA 4R2PA 1PDAA 1N0UA 2L3JA 1EA6A 2DEIA 4MYTA 2ODRD 1J5EE 1HNZE 4IZJA 2NN6A 3ZOQB 4JI6I 1XNQI 2C38B 1B69A 2EN2A 1B63A 4F9AB 4DR2E 1ZM4A 4IZJD 2Q8UA 4B3SI 4R2RA 2CG9A 2NN6D 3ZM7A 3T1YI 1N3GA 2EQ0A 3UHMA 3HPSA 3K17A 3PYFA 2B7TA 4GQUA 4JI2I 4X64E 2V2QA 2CT1A 4DU7A 5KL3A 5K36D 2UXCE 2D9HA 4R03A 4DV3E 4JV5I 1N32I 5C0XA 2ENHA 2EN7A 4LF7E 1A6FA 1MU5A 2EN4A 2EPCA 2V85A 4TUGA 2GO3A 3WU3A 4R8OA 4M2ZA 5AC4A 2N3GA 4HY1A 5JEAE 1X6HA 1PKPA 1GTKA 1WHQA 5IXMB 1UDOA 3C4BA 1HNZI 1EH8A 2LJUA 1N34E 2EM5A 4DR2I 1X49A 5GMDA 2YRKA 3K6QA 4Z7CA 2YSOA 2JPAA 2V2VA 4B3TE 4DR1I 4KHPI 2UXBE 2UXCI 4IS1C 2ENAA 2DGCA 1YHCA 3CDIA 3ZZ0A 5IV8B 4BC9A 1Z0BA 2JEBB 5C0XC 4LF7I 4MU1A 2EM3A 1ZR9A 2YTPA 4RHBB 1STUA 2EL5A 1WRJA 3PYEA 2BV3A 2X7IA 3M6AA 1FWKA 4DV2I 1RQ0A 1X5WA 2L2KB 4LFCE 1A1JA 4DUYI 1HK7A 1H7SA 1HNXE 1ZM9A 2HKEA 3QG5C 3THOB 2LTSA 4MU3A 3BBGA 2B9DA 4FK5C 3K85A 4JI5I 4M9VC 1USVA 2O1VA 4O43A 2YTJA 4WXCA 3CWVA 4FWHA 4JG4A 1Z0VA 3OTOI 2L2NA 1UDNA 2F4VI 2L33A 2Z5EA 2GS8A 2ZBKB 2UXBI 3MHSC 4BCAA 1D6TA 1GQEA 3L7ZB 2HKJA 4LF4E 2EOHA 2V89A 2VE7C 4HACA 2VQFI 3QT8A 2YU5A 1QU6A 2BA1D 1Y5YA 1DGCA 2EQ3A 1Z1BA 3RMPA 4LFCI 1Y4SA 3NZKA 5GMEA 1HNXI 4IFDA 4GKKE 2FV4B 2C37B 2G7HA 5A6KA 2UU9E 2EOQA 3KZYA 2X36A 2MDRA 1WHNA 4F9CB 2EORA 2YTDA 2LE2A 3P3GA 3T1HI 5A6JA 4OX9E 4JI3I 2YTGA 4MYUA 3HTXA 1BB8A 4F54A 1XXEA 4MLVA 3LLHA 2NN6E 4LF4I 1RMDA 4PU9A 4LFBE 4X65E 2L2MA 1YFHA 2A2CA 1Y4UA 2R1FA 2V88A 4NXNE 2A25A 2R42A 3LNUA 4B3ME 3JU0A 1JK1A 1N36E 1H73A 3PRYA 5C0XE 2EQ1A 1G2FC 4DR3E 2LTRA 5DROA 2GLIA 4DV6E 4NXMI 4FWGA 5JEAC 1U2RA 2MC5A 4R2SA 1ZAAC 4DR4E 4JI8E 1N0VC 1S16A 1ZXMA 5JEAF 1PJTA 2EM0A 4FW6A 1SFEA 4R2QA 2YRHA 2JE6A 5AE1A 4LFBI 3V5RA 2JOBA 1MGTA 2EZ6A 2EFGA 2Q2EB 2EM4A 2UUCE 2LT7A 4DR5E 3VYXA 1EH6A 3BGHA 3BIDA 4OOGC 1YYWA 2EOSA 1KJKA 4NXNI 5EKWA 4J8ZA 1N36I 4BHBA 2YTOA 1XNQE 1NZ0A 3EPJA 2DB2A 4IJDA 2Z5BB 3GONA 2YZTA 4B3SE 4DR3I 4X8WA 2BR2B 4XTJA 4DV6I 4R2AA 3T1YE 2E5LE 2C38A 1YH8A 2YTIA 1OYRA 4AM3A 4P78A 4WUBA 1QNTA 4DR4I 3PYDA 2NUGA 4JI8I 4FW9A 4FN5A 2O1TA 4GZNC 4ZYDA 2I9IA 1N32E 2J7KA 4NBQA 5LMUI 2GPIA 5CFFE 2YTQA 4YHHE 1JK2A 2YU8A 1X3CA 3J7AM 2VQEE 2UUCI 4MDTA 4DR5I 2H36X 1VI7A 2M9AA 1HR0E 1KKHA 4Z7YA 2LV2A 1YPNA 4X66E 4FW3A 5LLQA 1RC7A 2NPFA 4USMA 2WP8A 2ZM6I 3P1XA 2RS6A 2E5LI 4ZYEA 4KWYA 4LCFA 4KQVA 3J7AG 4WUDA 2EOZA 4BA2B 5K36A 2L6MA 1YZ9A 2JEAA 4IZKA 5T6JA 5LMNE 2JXPA 2LUQA 4DR1E 2EPRA 2RSIA 5KL2A 4LF8E 4KHPE 4IFDE 2KHXA 1YUIA 3AUZA 4BS9A 4F2JC 4P7DA 4OO1C 4YHHI 2EN8A 4JI4I 4X9JA 2JEBA 2WNRB 2VQEI 4L8NA 4R1FA 1EH7A 4F6MA 3ZKBA 2ODRC 4DV2E 4R2CA 1MX0A 1HR0I 2MKDA 4DUYE 2XEXA 1XNRE 4X66I 2NN6C 4ZYGA 1Z59A 4DV5E 2KONA 4JI5E 2AJ4A 4IS9A 2EPOA 1A1HA 1RR9A 2WW4A 5DNXA 2V87A 1BBGA 3OTOE 4MU0A 5K36C 2F4VE 4URLA 4LF8I 5LMNI 4M1KA 2IESA 3IWDA 1Z0CA 2EPPA 5DRRA 5IT9Q 3FIGA 3JAMQ 2M7QA 1UN6B 3J81Q 3ZZTA 3B8HA 2VQFE 5C0XF 2EPZA 1NEIA 3ZZUA 2HK2A 3J80Q 4AQYE 3GMEA 4BC7A 1S4EA 4DV4E 2RTXA 4M0VA 3ECRA 5BR8E 2LJPA 1XNRI 2A2DA 1BBOA 2LVHA 1ZM3A 1YYKA 2CVEA 3T1HE 4DV5I 2C37A 5A6BD 4HEIA 4B3RE 2DRPA 1H74A 2RQLA 2JP9A 4JI3E 3H09A 1E3HA 5C0XB 4BHCA 4WFTA 3DD6A 2OI2A 4U3DA 2UXDE 1T4OA 1VISA 2PO2B 1WJPA 4FW7A 1IBME 3C4TA 1E3PA 4BA1B 4AQYI 4DV4I 2EMBA 5BR8I 2N8XA 4P7AA 2BM0A 1T39A 2Z5CB 3ZKDA 2LO3A 3U1YA 1XMOE 2BB8A 1T38A 4OO1E 3GCMA 1Z0WA 2ZITA 4BBYA 4B3RI 1IBKI 3L00A 2B3TB 2EOFA 3QT5A 3EPKA 4NXME 1Z5AA 3B82A 2CPNA 3HJCA 2VF1A 1IMUA 3TQMA 4I8OA 1ZM2A 2UXDI 3BF2A 4RH8A 2EM2A 1PJSA 2HGHA 1PVGA 1IBMI 2YWQA 2RSMA 5KL4A 4X62E 5K36E 4JYAE 1WXRA 3HKMA 1A1FA 4GKJE 4JI0E 4IFDC 4LU9A 1B62A 2AE8A 4NZVA 2BA0G 3H1CA 4IFDF 1XMOI 2LMZA 2PO0B 2MC6A 5EL9A 4Q28A 4LFAI 3KWRA 2EMIA 5IT9C 2DIXA 3F6GA 3JAMC 2JY9A 3J81C 1HNWI 4DPUA 2EMXA 2NUEA 2ADRA 4DPWA 1WUUA 2V8PA 4F9BB 5JEAD 3J80C 5AE2A 4DKKA 5LMUE 1N33I 2BM1A 2F1DA 2HFSA 2UUAE 5A6AA 2HK3A 2EPUA 4DV1E 1YSAC 2O1WA 4O4KA 4X62I 4DUZE 1T4LB 1R6MA 1L4SA 4JYAI 3VK6A 4GKJI 4JI0I 2YTEA 3ADLA 4GEQB
chains in the Genus database with same CATH topology
2IHR1 2LRSA 4K0KE 2VF3A 5FLXQ 1KTVA 2ZM6E 2CZ9A 1GZ6A 4DR7E 1Z0EA 4WUCA 2UUAI 1MG7A 3JTZA 4DV1I 4UT4A 2YT4A 4JI4E 4DUZI 1H72C 4WPYA 2PNMA 4LTYA 3MSWA 1FKAE 1NHJA 4FWDA 4K0KI 2L3CA 2V2ZA 1H7UA 5ADZA 3PYGA 2JOXA 4UTGA 4DR7I 2EWLA 1Z0TA 3HXLA 1DQ3A 4LF6I 3ADGA 4HYMA 2V34A 4DV7I 3J7Yp 1NHIA 3F0NA 2CGEA 5A2QQ 1ZXNA 3Q6NA 4JI6I 4DV0E 1Y6ZA 3DF6A 2V83A 2WZOA 4JI7E 3IWBA 3WU5A 2M1SA 3V2UC 4ZVIA 2LJHA 1IBLI 5AASA 2JVAA 4LF5E 1Z5CA 4IZJB 5FLXC 4DPTA 3IWCA 1FWLA 1DI2A 4PRXA 1EKZA 5DNYA 1J5EI 2HFUA 1UILA 2JR1A 5IWAE 1DARA 1ZBQA 2Z5CA 4RPFA 1BKNA 2HHHE 1FI4A 4IZKB 1IBKE 4DV0I 1QZRA 4USKA 4X64I 4JI7I 5L3JA 2L92A 1FNMA 1X48A 4DR6E 2DEJA 4DV3I 4HXZA 4DXLA 2DSYA 3LPSA 2E1RA 4WYQB 2RS7A 1XHKA 2IOQA 2PNLA 3P06A 4LF5I 3ADJA 4I3HA 3HPZA 4WSPA 1OJ4A 1N34I 4YY3E 5IWAI 5LL6R 4LFAE 2HHHI 3HULA 1X47A 1HNWE 2N3HA 4L5NC 4BMJA 4B3TI 3VYYA 4N3OA 4DR6I 1ZBTA 2F8BA 1XMQE 1N33E 3QT6A 2LUPB 2V86A 1FJGE 5A2QC 4YY3I 1I94E 2Z5BA 1UEKA 2R3VA 1J26A 1KIJA 2E1MA 3WU4A 4JI1E 4HACB 2IOPA 1XMQI 3B78A 1NHHA 4PRVA 4LF9E 2K4VA 5FWKA 1Z5BA 2UUBE 5F3WA 3Q6MA 1FJGI 4GKKI 3F6HA 1Z0GA 2UU9I 3LMLA 3Q1QA 1USUA 1KVKA 2NA2A 1I94I 2M4IA 3HQ1A 4DMIA 4OX9I 3H4LA 2LBSB 2KOUA 2B7VA 4DPYA 3OMLA 4JI1I 3D4JA 1K47A 4TUIA 4EMDA 2O1UA 4DPXA 4M30A 4LF6E 1YYOA 1ELOA 2NUFA 2DMYA 4LF9I 3LTOA 4X65I 3DJWA 2UUBI 4B3MI 2FTXB 1O0WA 1UHZA 4DV7E 1EI1A 2FGGA 2GQ0A 4DU8A 1RREA 3QT7A 3WU6A 1PIEA 4ED4A 4JI6E 1SR9A 4JI2E 2L8TA 5AE3A 2V8QB 3K1JA 4JV5E 2JWOA 4KZSA 3AV0A 1T4NA 1IBLE 4P52A 3ADIA 1N0UA 2L3JA 1EA6A 2DEIA 4MYTA 2ODRD 1J5EE 1HNZE 4IZJA 1XNQI 3ZOQB 4B3SI 1B63A 1ZM4A 4F9AB 4DR2E 4IZJD 2CG9A 3ZM7A 3T1YI 3HPSA 3K17A 3PYFA 2B7TA 4JI2I 4X64E 2V2QA 4DU7A 2UXCE 4JV5I 4R03A 4DV3E 1N32I 4LF7E 1A6FA 1MU5A 2V85A 4TUGA 3WU3A 4R8OA 4M2ZA 2N3GA 4HY1A 1PKPA 1WHQA 3C4BA 1HNZI 1N34E 4DR2I 1X49A 5GMDA 3K6QA 4Z7CA 2V2VA 4B3TE 4DR1I 4KHPI 2UXBE 2UXCI 3ZZ0A 4BC9A 1Z0BA 4LF7I 1STUA 3PYEA 2BV3A 2X7IA 3M6AA 1FWKA 4DV2I 1RQ0A 2L2KB 4LFCE 4DUYI 1HK7A 1H7SA 1HNXE 1ZM9A 2HKEA 2LTSA 2B9DA 3K85A 4JI5I 1USVA 2O1VA 3CWVA 4FWHA 4JG4A 1Z0VA 3OTOI 2L2NA 2F4VI 2L33A 2Z5EA 2GS8A 2ZBKB 2UXBI 4BCAA 1D6TA 1GQEA 2HKJA 4LF4E 2V89A 2VE7C 4HACA 2VQFI 3QT8A 1QU6A 3RMPA 4LFCI 1Y4SA 5GMEA 1HNXI 4GKKE 2FV4B 2G7HA 2UU9E 2X36A 3T1HI 2MDRA 1WHNA 4F9CB 2LE2A 4OX9E 4JI3I 4MYUA 3HTXA 4F54A 3LLHA 4LF4I 4PU9A 4LFBE 4X65E 2L2MA 2A2CA 1Y4UA 2V88A 4NXNE 2R42A 3LNUA 4B3ME 3JU0A 3PRYA 1N36E 1H73A 4DR3E 2LTRA 4DV6E 4NXMI 4FWGA 1U2RA 2MC5A 4DR4E 1S16A 1ZXMA 4JI8E 1N0VC 5AE1A 4LFBI 3V5RA 2JOBA 2EZ6A 2EFGA 2Q2EB 2UUCE 4DR5E 3VYXA 4NXNI 4OOGC 1YYWA 4J8ZA 1N36I 1XNQE 1NZ0A 2DB2A 3GONA 2Z5BB 4DR3I 2YZTA 4B3SE 4X8WA 4XTJA 4DV6I 3T1YE 2E5LE 4P78A 4WUBA 4DR4I 3PYDA 2NUGA 4JI8I 4FW9A 4FN5A 2O1TA 1N32E 2J7KA 5LMUI 5CFFE 4YHHE 3J7AM 2VQEE 2UUCI 4DR5I 2H36X 1HR0E 1KKHA 4Z7YA 4X66E 1RC7A 2NPFA 4USMA 2ZM6I 2E5LI 3P1XA 2RS6A 4KQVA 3J7AG 4WUDA 2L6MA 1YZ9A 4IZKA 5T6JA 5LMNE 4DR1E 2LUQA 4LF8E 4KHPE 2KHXA 3AUZA 4BS9A 4P7DA 4YHHI 4JI4I 2VQEI 4L8NA 4R1FA 3ZKBA 2ODRC 4DV2E 1MX0A 1HR0I 4DUYE 2XEXA 1XNRE 4X66I 1Z59A 4DV5E 2KONA 4JI5E 2AJ4A 1RR9A 2WW4A 2V87A 3OTOE 2F4VE 4URLA 4LF8I 5LMNI 4M1KA 5IT9Q 3IWDA 1Z0CA 3FIGA 3JAMQ 2M7QA 3J81Q 3ZZTA 3B8HA 2VQFE 3ZZUA 2HK2A 3J80Q 4AQYE 4BC7A 1S4EA 4DV4E 2RTXA 4M0VA 5BR8E 2LJPA 1XNRI 2A2DA 1ZM3A 1YYKA 3T1HE 4DV5I 4B3RE 1H74A 4JI3E 3H09A 4WFTA 2OI2A 2UXDE 1T4OA 1VISA 1IBME 3C4TA 4AQYI 4DV4I 5BR8I 4P7AA 2BM0A 3ZKDA 2Z5CB 1XMOE 1Z0WA 2ZITA 4BBYA 4B3RI 1IBKI 2B3TB 3QT5A 4NXME 1Z5AA 3B82A 2CPNA 3HJCA 2VF1A 4I8OA 1ZM2A 2UXDI 1PVGA 1IBMI 2RSMA 4X62E 4JYAE 1WXRA 4GKJE 4JI0E 4LU9A 1B62A 1XMOI 2LMZA 2MC6A 4Q28A 4LFAI 3KWRA 5IT9C 2DIXA 3F6GA 3JAMC 2JY9A 3J81C 1HNWI 4DPUA 2NUEA 4DPWA 1WUUA 2V8PA 4F9BB 3J80C 5AE2A 4DKKA 5LMUE 1N33I 2BM1A 2HFSA 2UUAE 2O1WA 2HK3A 4DV1E 4X62I 4DUZE 1T4LB 4JYAI 3VK6A 4GKJI 4JI0I 3ADLA 4GEQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHR 1;  2LRS A;  4K0K E;  2VF3 A;  5FLX Q;  1KTV A;  2ZM6 E;  2CZ9 A;  4DR7 E;  1Z0E A;  4WUC A;  2UUA I;  1MG7 A;  4DV1 I;  4UT4 A;  2YT4 A;  4JI4 E;  4DUZ I;  1H72 C;  1FKA E;  1NHJ A;  4FWD A;  4K0K I;  2L3C A;  2V2Z A;  1H7U A;  3PYG A;  4UTG A;  4DR7 I;  1Z0T A;  4LF6 I;  3ADG A;  4HYM A;  2V34 A;  4DV7 I;  3J7Y p;  1NHI A;  3F0N A;  5A2Q Q;  1ZXN A;  4JI6 I;  4DV0 E;  4JI7 E;  3WU5 A;  3V2U C;  4ZVI A;  2LJH A;  1IBL I;  2JVA A;  4LF5 E;  1Z5C A;  5FLX C;  4DPT A;  1FWL A;  1DI2 A;  4PRX A;  1EKZ A;  1J5E I;  2HFU A;  1UIL A;  5IWA E;  1DAR A;  4RPF A;  1BKN A;  2HHH E;  1FI4 A;  1IBK E;  4DV0 I;  1QZR A;  4USK A;  4X64 I;  4JI7 I;  5L3J A;  1FNM A;  1X48 A;  4DR6 E;  2DEJ A;  4DV3 I;  4HXZ A;  4DXL A;  3LPS A;  2E1R A;  4WYQ B;  2RS7 A;  1XHK A;  4LF5 I;  3ADJ A;  4I3H A;  1OJ4 A;  1N34 I;  4YY3 E;  5IWA I;  5LL6 R;  4LFA E;  2HHH I;  3HUL A;  1X47 A;  1HNW E;  2N3H A;  4B3T I;  3VYY A;  4DR6 I;  1ZBT A;  1XMQ E;  1N33 E;  3QT6 A;  2LUP B;  1FJG E;  5A2Q C;  4YY3 I;  1I94 E;  1UEK A;  2R3V A;  1J26 A;  1KIJ A;  3WU4 A;  4JI1 E;  4HAC B;  1XMQ I;  3B78 A;  1NHH A;  4PRV A;  4LF9 E;  1Z5B A;  2UUB E;  1FJG I;  4GKK I;  1Z0G A;  2UU9 I;  3Q1Q A;  1KVK A;  2NA2 A;  1I94 I;  4OX9 I;  3H4L A;  2LBS B;  2B7V A;  4DPY A;  4JI1 I;  3D4J A;  1K47 A;  4EMD A;  4DPX A;  4M30 A;  4LF6 E;  1YYO A;  1ELO A;  2NUF A;  2DMY A;  4LF9 I;  3LTO A;  4X65 I;  2UUB I;  4B3M I;  1O0W A;  1UHZ A;  4DV7 E;  1EI1 A;  4DU8 A;  1RRE A;  3QT7 A;  3WU6 A;  1PIE A;  4ED4 A;  4JI6 E;  4JI2 E;  3K1J A;  4JV5 E;  1T4N A;  1IBL E;  4P52 A;  3ADI A;  1N0U A;  2L3J A;  1EA6 A;  2DEI A;  4MYT A;  1XNQ I;  1J5E E;  1HNZ E;  4B3S I;  1B63 A;  1ZM4 A;  4DR2 E;  3ZM7 A;  3T1Y I;  3K17 A;  3PYF A;  2B7T A;  4JI2 I;  4X64 E;  2V2Q A;  4DU7 A;  2UXC E;  4JV5 I;  4DV3 E;  1N32 I;  4LF7 E;  1A6F A;  1MU5 A;  3WU3 A;  4M2Z A;  2N3G A;  4HY1 A;  1PKP A;  1WHQ A;  3C4B A;  1HNZ I;  1N34 E;  4DR2 I;  1X49 A;  5GMD A;  4Z7C A;  2V2V A;  4B3T E;  4DR1 I;  4KHP I;  2UXB E;  2UXC I;  3ZZ0 A;  1Z0B A;  4LF7 I;  1STU A;  3PYE A;  2BV3 A;  2X7I A;  3M6A A;  1FWK A;  4DV2 I;  1RQ0 A;  2L2K B;  4LFC E;  4DUY I;  2HKE A;  1H7S A;  1HNX E;  1ZM9 A;  2LTS A;  4JI5 I;  3CWV A;  4FWH A;  4JG4 A;  1Z0V A;  3OTO I;  2L2N A;  2F4V I;  2L33 A;  2GS8 A;  2ZBK B;  2UXB I;  1D6T A;  1GQE A;  2HKJ A;  4LF4 E;  4HAC A;  2VQF I;  3QT8 A;  1QU6 A;  4LFC I;  5GME A;  1HNX I;  4GKK E;  2UU9 E;  2X36 A;  3T1H I;  2MDR A;  1WHN A;  4OX9 E;  4JI3 I;  4MYU A;  3HTX A;  3LLH A;  4LF4 I;  4PU9 A;  4LFB E;  4X65 E;  2L2M A;  2A2C A;  4NXN E;  2R42 A;  3LNU A;  4B3M E;  1N36 E;  1H73 A;  4DR3 E;  2LTR A;  4DV6 E;  4NXM I;  4FWG A;  1U2R A;  1S16 A;  4DR4 E;  1ZXM A;  4JI8 E;  1N0V C;  4LFB I;  3V5R A;  2EZ6 A;  2EFG A;  2Q2E B;  2UUC E;  4DR5 E;  3VYX A;  4NXN I;  4OOG C;  1YYW A;  1N36 I;  1XNQ E;  1NZ0 A;  2DB2 A;  3GON A;  4DR3 I;  4B3S E;  4X8W A;  4XTJ A;  4DV6 I;  3T1Y E;  2E5L E;  4WUB A;  4DR4 I;  3PYD A;  2NUG A;  4JI8 I;  4FW9 A;  4FN5 A;  1N32 E;  2J7K A;  5LMU I;  5CFF E;  4YHH E;  3J7A M;  2VQE E;  2UUC I;  4DR5 I;  1HR0 E;  1KKH A;  4Z7Y A;  4X66 E;  1RC7 A;  2NPF A;  4USM A;  2ZM6 I;  2E5L I;  2RS6 A;  3P1X A;  4KQV A;  4WUD A;  3J7A G;  1YZ9 A;  4DR1 E;  5LMN E;  4LF8 E;  2LUQ A;  4KHP E;  2KHX A;  4YHH I;  4JI4 I;  2VQE I;  4R1F A;  3ZKB A;  1MX0 A;  4DV2 E;  1HR0 I;  4DUY E;  2XEX A;  1XNR E;  4X66 I;  1Z59 A;  4DV5 E;  4JI5 E;  2AJ4 A;  1RR9 A;  2WW4 A;  3OTO E;  2F4V E;  4URL A;  4LF8 I;  5LMN I;  4M1K A;  5IT9 Q;  1Z0C A;  3JAM Q;  3J81 Q;  3ZZT A;  3B8H A;  2VQF E;  3ZZU A;  2HK2 A;  3J80 Q;  4AQY E;  1S4E A;  4DV4 E;  2RTX A;  5BR8 E;  2LJP A;  1XNR I;  2A2D A;  1ZM3 A;  1YYK A;  3T1H E;  4DV5 I;  4B3R E;  1H74 A;  4JI3 E;  4WFT A;  2OI2 A;  2UXD E;  1T4O A;  1VIS A;  1IBM E;  3C4T A;  4AQY I;  4DV4 I;  5BR8 I;  4P7A A;  2BM0 A;  3ZKD A;  1XMO E;  1Z0W A;  2ZIT A;  4B3R I;  1IBK I;  2B3T B;  3QT5 A;  4NXM E;  1Z5A A;  3B82 A;  2CPN A;  1ZM2 A;  2UXD I;  1PVG A;  1IBM I;  2RSM A;  4X62 E;  4JYA E;  4GKJ E;  4JI0 E;  1B62 A;  1XMO I;  4LFA I;  5IT9 C;  2DIX A;  3JAM C;  2JY9 A;  3J81 C;  1HNW I;  4DPU A;  2NUE A;  4DPW A;  1WUU A;  2V8P A;  3J80 C;  4DKK A;  5LMU E;  1N33 I;  2BM1 A;  2HFS A;  2UUA E;  2HK3 A;  4DV1 E;  4X62 I;  4DUZ E;  1T4L B;  4JYA I;  4GKJ I;  4JI0 I;  3ADL A; 
#chains in the Genus database with same CATH topology
 2IHR 1;  3GLL A;  2LRS A;  4K0K E;  4WXD A;  4Q35 B;  2DLQ A;  2VF3 A;  5FLX Q;  1KTV A;  2EMG A;  3THN A;  4LPF A;  2ZM6 E;  2CZ9 A;  4QNK A;  5JEA B;  2YSP A;  2BBG A;  2LCE A;  1GZ6 A;  4DR7 E;  1Z0E A;  2JT2 A;  3M7N G;  5DRP A;  4WUC A;  4BA2 A;  3P3E A;  2UUA I;  1MG7 A;  2DLK A;  3JTZ A;  4DV1 I;  4UT4 A;  2YT4 A;  2E72 A;  4JI4 E;  2GO4 A;  1H72 C;  4DUZ I;  2PO1 B;  4WPY A;  2EM9 A;  2PNM A;  4AID A;  4LTY A;  3MSW A;  1FKA E;  2WNR A;  2PNZ B;  2YPN A;  3M99 B;  1NHJ A;  2GHF A;  4FWD A;  4K0K I;  2L3C A;  3KZZ A;  1A1G A;  2V2Z A;  4LCH A;  2EN1 A;  2EPX A;  1H7U A;  3EPL A;  5ADZ A;  3B4T A;  1OYS A;  4O24 A;  2JOX A;  3PYG A;  4U3B A;  4UTG A;  4DR7 I;  2EWL A;  3PS2 A;  1Z0T A;  4IFD B;  2J65 A;  3M85 G;  2ELY A;  2C39 B;  2JE6 B;  3HXL A;  1A1L A;  2EMK A;  4O5G A;  2CSH A;  1DQ3 A;  2IER A;  3P76 A;  4FW5 A;  4QNJ A;  4LF6 I;  2HC5 A;  3ADG A;  1OYP A;  4OO1 F;  2YTN A;  5AC5 A;  2WBT A;  4NHR A;  3CDJ A;  2PRT A;  4HYM A;  2EL6 A;  2V34 A;  1P42 A;  3J7Y p;  4DV7 I;  2I13 A;  2J7J A;  2NN6 F;  1NHI A;  3F0N A;  2CGE A;  4MU4 A;  5A2Q Q;  2EE8 A;  1TF3 A;  1X6E A;  1ZXN A;  3Q6N A;  4DV0 E;  1Y6Z A;  2ENC A;  3DF6 A;  1P47 A;  2V83 A;  2WZO A;  4JI7 E;  1A1K A;  5K36 F;  3IWB A;  2EML A;  3WU5 A;  2M1S A;  2CTD A;  4OO1 B;  2EPK X;  1YUJ A;  2EJ4 A;  3V2U C;  1LLM C;  3L7Z A;  4ZVI A;  2LJH A;  3U1K A;  1G2D C;  5C0X D;  1IBL I;  5AAS A;  3EQ1 A;  2PO2 A;  2JVA A;  4LF5 E;  1Z5C A;  3PS1 A;  4BA1 A;  4IZJ B;  5FLX C;  4DPT A;  3IWC A;  2NN6 B;  1FWL A;  2EPL X;  4R2E A;  3UK3 C;  1EKZ A;  1DI2 A;  1UDS A;  5DNY A;  4PRX A;  1J5E I;  2HFU A;  1UIL A;  2JR1 A;  5A6B A;  1Y60 A;  5IWA E;  2WP8 B;  1DAR A;  5DNL A;  2EMH A;  5K36 B;  2WBS A;  1ZBQ A;  2Z5C A;  5KL5 A;  1BKN A;  4RPF A;  2HHH E;  2JEA B;  1FI4 A;  4IZK B;  4MQY A;  1IBK E;  4DV0 I;  1PJQ A;  2ELZ A;  4F6N A;  1QZR A;  4USK A;  4X64 I;  4JI7 I;  5L3J A;  2L92 A;  1FNM A;  1X48 A;  4DR6 E;  2DEJ A;  4DV3 I;  4HXZ A;  4DXL A;  2DSY A;  2EP3 A;  3LPS A;  2O3Z A;  3C6M A;  1UBD C;  4HTG A;  2E1R A;  4WYQ B;  2RS7 A;  1XHK A;  2IOQ A;  2PNL A;  1AH5 A;  3P06 A;  4LF5 I;  3ADJ A;  5TSE A;  4I3H A;  3HPZ A;  4WSP A;  2EOX A;  2EM7 A;  1OJ4 A;  4FW4 A;  1N34 I;  4YY3 E;  2VES A;  5IWA I;  2YRM A;  2EL4 A;  2MDG A;  4R2D A;  2NAB A;  5LL6 R;  2EMZ A;  4LFA E;  2HHH I;  2PO0 A;  4OZE A;  3HUL A;  2EOO A;  2R76 A;  1X47 A;  5ELW A;  1HNW E;  2N3H A;  4L5N C;  4BMJ A;  1IQO A;  4B3T I;  3VYY A;  4LCG A;  2BA0 D;  2VRD A;  4N3O A;  3KRN A;  4DR6 I;  1ZBT A;  2F8B A;  1XMQ E;  2EOI A;  1N33 E;  2RPC A;  2MKN A;  3QT6 A;  3PS3 A;  2EPM X;  2LUP B;  4J3D A;  2V86 A;  1FJG E;  5A2Q C;  1IQS A;  1TN9 A;  4YY3 I;  3C6K A;  4IFD D;  1I94 E;  4N4R B;  2Z5B A;  3EPH A;  1F2I G;  1TF6 A;  1UEK A;  2R3V A;  5KL7 A;  2BA1 G;  1J26 A;  1KIJ A;  2E1M A;  2EOY A;  2EOM A;  2BR2 A;  3WU4 A;  5JEA A;  2EMA A;  4JI1 E;  2EMC A;  4HAC B;  2IOP A;  1XMQ I;  4MLQ A;  3MHH C;  5KL6 A;  2EOE A;  1AAY A;  3B78 A;  1NHH A;  4PRV A;  4LF9 E;  2K4V A;  5FWK A;  1Z5B A;  2EM6 A;  2K7I A;  3M7N D;  5DRQ A;  2HJJ A;  1ZU1 A;  2DMI A;  2UUB E;  5F3W A;  3Q6M A;  1RHY A;  4ISA A;  2PO1 A;  2EMY A;  2JYA A;  1FJG I;  4GKK I;  3F6H A;  1Z0G A;  2PNZ A;  2UU9 I;  3LML A;  2YTF A;  1USU A;  3P3C A;  2EPA A;  1KVK A;  3Q1Q A;  2NA2 A;  1I94 I;  2M4I A;  3HQ1 A;  1R6L A;  4OKG A;  4DMI A;  4OX9 I;  3H4L A;  2LBS B;  2KOU A;  4WX9 A;  2B7V A;  4DPY A;  3OML A;  4JI1 I;  5A69 A;  3D4J A;  1K47 A;  4TUI A;  4EMD A;  2C39 A;  2O1U A;  4DPX A;  4M30 A;  4LF6 E;  1YYO A;  1ELO A;  2NUF A;  2DMY A;  4LF9 I;  2WCC 3;  3LTO A;  4X65 I;  3DJW A;  2UUB I;  2EPN A;  1MEY C;  3M85 D;  4B3M I;  2FTX B;  3VHT B;  1UDQ A;  1O0W A;  1UHZ A;  4DV7 E;  1EI1 A;  2FGG A;  4ZYH A;  2GQ0 A;  4DU8 A;  1RRE A;  3QT7 A;  3WU6 A;  1PIE A;  4AIM A;  4JI6 E;  2WBU A;  4ED4 A;  1SR9 A;  4JI2 E;  2EN3 A;  2EMF A;  2L8T A;  4WSG A;  5AE3 A;  2EOJ A;  2V8Q B;  3K1J A;  4LOM A;  1NCS A;  1A1I A;  4JV5 E;  1X6F A;  1KYQ A;  2EN6 A;  4OO1 A;  2JWO A;  4KZS A;  3AV0 A;  2EM8 A;  1T4N A;  1IBL E;  2EMW A;  4OO1 D;  4P52 A;  3ADI A;  4R2P A;  1PDA A;  1N0U A;  2L3J A;  1EA6 A;  2DEI A;  4MYT A;  2ODR D;  1J5E E;  1HNZ E;  4IZJ A;  2NN6 A;  3ZOQ B;  4JI6 I;  1XNQ I;  2C38 B;  1B69 A;  2EN2 A;  1B63 A;  4F9A B;  4DR2 E;  1ZM4 A;  4IZJ D;  2Q8U A;  4B3S I;  4R2R A;  2CG9 A;  2NN6 D;  3ZM7 A;  3T1Y I;  1N3G A;  2EQ0 A;  3UHM A;  3HPS A;  3K17 A;  3PYF A;  2B7T A;  4GQU A;  4JI2 I;  4X64 E;  2V2Q A;  2CT1 A;  4DU7 A;  5KL3 A;  5K36 D;  2UXC E;  2D9H A;  4R03 A;  4DV3 E;  4JV5 I;  1N32 I;  5C0X A;  2ENH A;  2EN7 A;  4LF7 E;  1A6F A;  1MU5 A;  2EN4 A;  2EPC A;  2V85 A;  4TUG A;  2GO3 A;  3WU3 A;  4R8O A;  4M2Z A;  5AC4 A;  2N3G A;  4HY1 A;  5JEA E;  1X6H A;  1PKP A;  1GTK A;  1WHQ A;  5IXM B;  1UDO A;  3C4B A;  1HNZ I;  1EH8 A;  2LJU A;  1N34 E;  2EM5 A;  4DR2 I;  1X49 A;  5GMD A;  2YRK A;  3K6Q A;  4Z7C A;  2YSO A;  2JPA A;  2V2V A;  4B3T E;  4DR1 I;  4KHP I;  2UXB E;  2UXC I;  4IS1 C;  2ENA A;  2DGC A;  1YHC A;  3CDI A;  3ZZ0 A;  5IV8 B;  4BC9 A;  1Z0B A;  2JEB B;  5C0X C;  4LF7 I;  4MU1 A;  2EM3 A;  1ZR9 A;  2YTP A;  4RHB B;  1STU A;  2EL5 A;  1WRJ A;  3PYE A;  2BV3 A;  2X7I A;  3M6A A;  1FWK A;  4DV2 I;  1RQ0 A;  1X5W A;  2L2K B;  4LFC E;  1A1J A;  4DUY I;  1HK7 A;  1H7S A;  1HNX E;  1ZM9 A;  2HKE A;  3QG5 C;  3THO B;  2LTS A;  4MU3 A;  3BBG A;  2B9D A;  4FK5 C;  3K85 A;  4JI5 I;  4M9V C;  1USV A;  2O1V A;  4O43 A;  2YTJ A;  4WXC A;  3CWV A;  4FWH A;  4JG4 A;  1Z0V A;  3OTO I;  2L2N A;  1UDN A;  2F4V I;  2L33 A;  2Z5E A;  2GS8 A;  2ZBK B;  2UXB I;  3MHS C;  4BCA A;  1D6T A;  1GQE A;  3L7Z B;  2HKJ A;  4LF4 E;  2EOH A;  2V89 A;  2VE7 C;  4HAC A;  2VQF I;  3QT8 A;  2YU5 A;  1QU6 A;  2BA1 D;  1Y5Y A;  1DGC A;  2EQ3 A;  1Z1B A;  3RMP A;  4LFC I;  1Y4S A;  3NZK A;  5GME A;  1HNX I;  4IFD A;  4GKK E;  2FV4 B;  2C37 B;  2G7H A;  5A6K A;  2UU9 E;  2EOQ A;  3KZY A;  2X36 A;  2MDR A;  1WHN A;  4F9C B;  2EOR A;  2YTD A;  2LE2 A;  3P3G A;  3T1H I;  5A6J A;  4OX9 E;  4JI3 I;  2YTG A;  4MYU A;  3HTX A;  1BB8 A;  4F54 A;  1XXE A;  4MLV A;  3LLH A;  2NN6 E;  4LF4 I;  1RMD A;  4PU9 A;  4LFB E;  4X65 E;  2L2M A;  1YFH A;  2A2C A;  1Y4U A;  2R1F A;  2V88 A;  4NXN E;  2A25 A;  2R42 A;  3LNU A;  4B3M E;  3JU0 A;  1JK1 A;  1N36 E;  1H73 A;  3PRY A;  5C0X E;  2EQ1 A;  1G2F C;  4DR3 E;  2LTR A;  5DRO A;  2GLI A;  4DV6 E;  4NXM I;  4FWG A;  5JEA C;  1U2R A;  2MC5 A;  4R2S A;  1ZAA C;  4DR4 E;  4JI8 E;  1N0V C;  1S16 A;  1ZXM A;  5JEA F;  1PJT A;  2EM0 A;  4FW6 A;  1SFE A;  4R2Q A;  2YRH A;  2JE6 A;  5AE1 A;  4LFB I;  3V5R A;  2JOB A;  1MGT A;  2EZ6 A;  2EFG A;  2Q2E B;  2EM4 A;  2UUC E;  2LT7 A;  4DR5 E;  3VYX A;  1EH6 A;  3BGH A;  3BID A;  4OOG C;  1YYW A;  2EOS A;  1KJK A;  4NXN I;  5EKW A;  4J8Z A;  1N36 I;  4BHB A;  2YTO A;  1XNQ E;  1NZ0 A;  3EPJ A;  2DB2 A;  4IJD A;  2Z5B B;  3GON A;  2YZT A;  4B3S E;  4DR3 I;  4X8W A;  2BR2 B;  4XTJ A;  4DV6 I;  4R2A A;  3T1Y E;  2E5L E;  2C38 A;  1YH8 A;  2YTI A;  1OYR A;  4AM3 A;  4P78 A;  4WUB A;  1QNT A;  4DR4 I;  3PYD A;  2NUG A;  4JI8 I;  4FW9 A;  4FN5 A;  2O1T A;  4GZN C;  4ZYD A;  2I9I A;  1N32 E;  2J7K A;  4NBQ A;  5LMU I;  2GPI A;  5CFF E;  2YTQ A;  4YHH E;  1JK2 A;  2YU8 A;  1X3C A;  3J7A M;  2VQE E;  2UUC I;  4MDT A;  4DR5 I;  2H36 X;  1VI7 A;  2M9A A;  1HR0 E;  1KKH A;  4Z7Y A;  2LV2 A;  1YPN A;  4X66 E;  4FW3 A;  5LLQ A;  1RC7 A;  2NPF A;  4USM A;  2WP8 A;  2ZM6 I;  3P1X A;  2RS6 A;  2E5L I;  4ZYE A;  4KWY A;  4LCF A;  4KQV A;  3J7A G;  4WUD A;  2EOZ A;  4BA2 B;  5K36 A;  2L6M A;  1YZ9 A;  2JEA A;  4IZK A;  5T6J A;  5LMN E;  2JXP A;  2LUQ A;  4DR1 E;  2EPR A;  2RSI A;  5KL2 A;  4LF8 E;  4KHP E;  4IFD E;  2KHX A;  1YUI A;  3AUZ A;  4BS9 A;  4F2J C;  4P7D A;  4OO1 C;  4YHH I;  2EN8 A;  4JI4 I;  4X9J A;  2JEB A;  2WNR B;  2VQE I;  4L8N A;  4R1F A;  1EH7 A;  4F6M A;  3ZKB A;  2ODR C;  4DV2 E;  4R2C A;  1MX0 A;  1HR0 I;  2MKD A;  4DUY E;  2XEX A;  1XNR E;  4X66 I;  2NN6 C;  4ZYG A;  1Z59 A;  4DV5 E;  2KON A;  4JI5 E;  2AJ4 A;  4IS9 A;  2EPO A;  1A1H A;  1RR9 A;  2WW4 A;  5DNX A;  2V87 A;  1BBG A;  3OTO E;  4MU0 A;  5K36 C;  2F4V E;  4URL A;  4LF8 I;  5LMN I;  4M1K A;  2IES A;  3IWD A;  1Z0C A;  2EPP A;  5DRR A;  5IT9 Q;  3FIG A;  3JAM Q;  2M7Q A;  1UN6 B;  3J81 Q;  3ZZT A;  3B8H A;  2VQF E;  5C0X F;  2EPZ A;  1NEI A;  3ZZU A;  2HK2 A;  3J80 Q;  4AQY E;  3GME A;  4BC7 A;  1S4E A;  4DV4 E;  2RTX A;  4M0V A;  3ECR A;  5BR8 E;  2LJP A;  1XNR I;  2A2D A;  1BBO A;  2LVH A;  1ZM3 A;  1YYK A;  2CVE A;  3T1H E;  4DV5 I;  2C37 A;  5A6B D;  4HEI A;  4B3R E;  2DRP A;  1H74 A;  2RQL A;  2JP9 A;  4JI3 E;  3H09 A;  1E3H A;  5C0X B;  4BHC A;  4WFT A;  3DD6 A;  2OI2 A;  4U3D A;  2UXD E;  1T4O A;  1VIS A;  2PO2 B;  1WJP A;  4FW7 A;  1IBM E;  3C4T A;  1E3P A;  4BA1 B;  4AQY I;  4DV4 I;  2EMB A;  5BR8 I;  2N8X A;  4P7A A;  2BM0 A;  1T39 A;  2Z5C B;  3ZKD A;  2LO3 A;  3U1Y A;  1XMO E;  2BB8 A;  1T38 A;  4OO1 E;  3GCM A;  1Z0W A;  2ZIT A;  4BBY A;  4B3R I;  1IBK I;  3L00 A;  2B3T B;  2EOF A;  3QT5 A;  3EPK A;  4NXM E;  1Z5A A;  3B82 A;  2CPN A;  3HJC A;  2VF1 A;  1IMU A;  3TQM A;  4I8O A;  1ZM2 A;  2UXD I;  3BF2 A;  4RH8 A;  2EM2 A;  1PJS A;  2HGH A;  1PVG A;  1IBM I;  2YWQ A;  2RSM A;  5KL4 A;  4X62 E;  5K36 E;  4JYA E;  1WXR A;  3HKM A;  1A1F A;  4GKJ E;  4JI0 E;  4IFD C;  4LU9 A;  1B62 A;  2AE8 A;  4NZV A;  2BA0 G;  3H1C A;  4IFD F;  1XMO I;  2LMZ A;  2PO0 B;  2MC6 A;  5EL9 A;  4Q28 A;  4LFA I;  3KWR A;  2EMI A;  5IT9 C;  2DIX A;  3F6G A;  3JAM C;  2JY9 A;  3J81 C;  1HNW I;  4DPU A;  2EMX A;  2NUE A;  2ADR A;  4DPW A;  1WUU A;  2V8P A;  4F9B B;  5JEA D;  3J80 C;  5AE2 A;  4DKK A;  5LMU E;  1N33 I;  2BM1 A;  2F1D A;  2HFS A;  2UUA E;  5A6A A;  2HK3 A;  2EPU A;  4DV1 E;  1YSA C;  2O1W A;  4O4K A;  4X62 I;  4DUZ E;  1T4L B;  1R6M A;  1L4S A;  4JYA I;  3VK6 A;  4GKJ I;  4JI0 I;  2YTE A;  3ADL A;  4GEQ B; 
#chains in the Genus database with same CATH homology
 2IHR 1;  2LRS A;  4K0K E;  2VF3 A;  5FLX Q;  1KTV A;  2ZM6 E;  2CZ9 A;  1GZ6 A;  4DR7 E;  1Z0E A;  4WUC A;  2UUA I;  1MG7 A;  3JTZ A;  4DV1 I;  4UT4 A;  2YT4 A;  4JI4 E;  4DUZ I;  1H72 C;  4WPY A;  2PNM A;  4LTY A;  3MSW A;  1FKA E;  1NHJ A;  4FWD A;  4K0K I;  2L3C A;  2V2Z A;  1H7U A;  5ADZ A;  3PYG A;  2JOX A;  4UTG A;  4DR7 I;  2EWL A;  1Z0T A;  3HXL A;  1DQ3 A;  4LF6 I;  3ADG A;  4HYM A;  2V34 A;  4DV7 I;  3J7Y p;  1NHI A;  3F0N A;  2CGE A;  5A2Q Q;  1ZXN A;  3Q6N A;  4JI6 I;  4DV0 E;  1Y6Z A;  3DF6 A;  2V83 A;  2WZO A;  4JI7 E;  3IWB A;  3WU5 A;  2M1S A;  3V2U C;  4ZVI A;  2LJH A;  1IBL I;  5AAS A;  2JVA A;  4LF5 E;  1Z5C A;  4IZJ B;  5FLX C;  4DPT A;  3IWC A;  1FWL A;  1DI2 A;  4PRX A;  1EKZ A;  5DNY A;  1J5E I;  2HFU A;  1UIL A;  2JR1 A;  5IWA E;  1DAR A;  1ZBQ A;  2Z5C A;  4RPF A;  1BKN A;  2HHH E;  1FI4 A;  4IZK B;  1IBK E;  4DV0 I;  1QZR A;  4USK A;  4X64 I;  4JI7 I;  5L3J A;  2L92 A;  1FNM A;  1X48 A;  4DR6 E;  2DEJ A;  4DV3 I;  4HXZ A;  4DXL A;  2DSY A;  3LPS A;  2E1R A;  4WYQ B;  2RS7 A;  1XHK A;  2IOQ A;  2PNL A;  3P06 A;  4LF5 I;  3ADJ A;  4I3H A;  3HPZ A;  4WSP A;  1OJ4 A;  1N34 I;  4YY3 E;  5IWA I;  5LL6 R;  4LFA E;  2HHH I;  3HUL A;  1X47 A;  1HNW E;  2N3H A;  4L5N C;  4BMJ A;  4B3T I;  3VYY A;  4N3O A;  4DR6 I;  1ZBT A;  2F8B A;  1XMQ E;  1N33 E;  3QT6 A;  2LUP B;  2V86 A;  1FJG E;  5A2Q C;  4YY3 I;  1I94 E;  2Z5B A;  1UEK A;  2R3V A;  1J26 A;  1KIJ A;  2E1M A;  3WU4 A;  4JI1 E;  4HAC B;  2IOP A;  1XMQ I;  3B78 A;  1NHH A;  4PRV A;  4LF9 E;  2K4V A;  5FWK A;  1Z5B A;  2UUB E;  5F3W A;  3Q6M A;  1FJG I;  4GKK I;  3F6H A;  1Z0G A;  2UU9 I;  3LML A;  3Q1Q A;  1USU A;  1KVK A;  2NA2 A;  1I94 I;  2M4I A;  3HQ1 A;  4DMI A;  4OX9 I;  3H4L A;  2LBS B;  2KOU A;  2B7V A;  4DPY A;  3OML A;  4JI1 I;  3D4J A;  1K47 A;  4TUI A;  4EMD A;  2O1U A;  4DPX A;  4M30 A;  4LF6 E;  1YYO A;  1ELO A;  2NUF A;  2DMY A;  4LF9 I;  3LTO A;  4X65 I;  3DJW A;  2UUB I;  4B3M I;  2FTX B;  1O0W A;  1UHZ A;  4DV7 E;  1EI1 A;  2FGG A;  2GQ0 A;  4DU8 A;  1RRE A;  3QT7 A;  3WU6 A;  1PIE A;  4ED4 A;  4JI6 E;  1SR9 A;  4JI2 E;  2L8T A;  5AE3 A;  2V8Q B;  3K1J A;  4JV5 E;  2JWO A;  4KZS A;  3AV0 A;  1T4N A;  1IBL E;  4P52 A;  3ADI A;  1N0U A;  2L3J A;  1EA6 A;  2DEI A;  4MYT A;  2ODR D;  1J5E E;  1HNZ E;  4IZJ A;  1XNQ I;  3ZOQ B;  4B3S I;  1B63 A;  1ZM4 A;  4F9A B;  4DR2 E;  4IZJ D;  2CG9 A;  3ZM7 A;  3T1Y I;  3HPS A;  3K17 A;  3PYF A;  2B7T A;  4JI2 I;  4X64 E;  2V2Q A;  4DU7 A;  2UXC E;  4JV5 I;  4R03 A;  4DV3 E;  1N32 I;  4LF7 E;  1A6F A;  1MU5 A;  2V85 A;  4TUG A;  3WU3 A;  4R8O A;  4M2Z A;  2N3G A;  4HY1 A;  1PKP A;  1WHQ A;  3C4B A;  1HNZ I;  1N34 E;  4DR2 I;  1X49 A;  5GMD A;  3K6Q A;  4Z7C A;  2V2V A;  4B3T E;  4DR1 I;  4KHP I;  2UXB E;  2UXC I;  3ZZ0 A;  4BC9 A;  1Z0B A;  4LF7 I;  1STU A;  3PYE A;  2BV3 A;  2X7I A;  3M6A A;  1FWK A;  4DV2 I;  1RQ0 A;  2L2K B;  4LFC E;  4DUY I;  1HK7 A;  1H7S A;  1HNX E;  1ZM9 A;  2HKE A;  2LTS A;  2B9D A;  3K85 A;  4JI5 I;  1USV A;  2O1V A;  3CWV A;  4FWH A;  4JG4 A;  1Z0V A;  3OTO I;  2L2N A;  2F4V I;  2L33 A;  2Z5E A;  2GS8 A;  2ZBK B;  2UXB I;  4BCA A;  1D6T A;  1GQE A;  2HKJ A;  4LF4 E;  2V89 A;  2VE7 C;  4HAC A;  2VQF I;  3QT8 A;  1QU6 A;  3RMP A;  4LFC I;  1Y4S A;  5GME A;  1HNX I;  4GKK E;  2FV4 B;  2G7H A;  2UU9 E;  2X36 A;  3T1H I;  2MDR A;  1WHN A;  4F9C B;  2LE2 A;  4OX9 E;  4JI3 I;  4MYU A;  3HTX A;  4F54 A;  3LLH A;  4LF4 I;  4PU9 A;  4LFB E;  4X65 E;  2L2M A;  2A2C A;  1Y4U A;  2V88 A;  4NXN E;  2R42 A;  3LNU A;  4B3M E;  3JU0 A;  3PRY A;  1N36 E;  1H73 A;  4DR3 E;  2LTR A;  4DV6 E;  4NXM I;  4FWG A;  1U2R A;  2MC5 A;  4DR4 E;  1S16 A;  1ZXM A;  4JI8 E;  1N0V C;  5AE1 A;  4LFB I;  3V5R A;  2JOB A;  2EZ6 A;  2EFG A;  2Q2E B;  2UUC E;  4DR5 E;  3VYX A;  4NXN I;  4OOG C;  1YYW A;  4J8Z A;  1N36 I;  1XNQ E;  1NZ0 A;  2DB2 A;  3GON A;  2Z5B B;  4DR3 I;  2YZT A;  4B3S E;  4X8W A;  4XTJ A;  4DV6 I;  3T1Y E;  2E5L E;  4P78 A;  4WUB A;  4DR4 I;  3PYD A;  2NUG A;  4JI8 I;  4FW9 A;  4FN5 A;  2O1T A;  1N32 E;  2J7K A;  5LMU I;  5CFF E;  4YHH E;  3J7A M;  2VQE E;  2UUC I;  4DR5 I;  2H36 X;  1HR0 E;  1KKH A;  4Z7Y A;  4X66 E;  1RC7 A;  2NPF A;  4USM A;  2ZM6 I;  2E5L I;  3P1X A;  2RS6 A;  4KQV A;  3J7A G;  4WUD A;  2L6M A;  1YZ9 A;  4IZK A;  5T6J A;  5LMN E;  4DR1 E;  2LUQ A;  4LF8 E;  4KHP E;  2KHX A;  3AUZ A;  4BS9 A;  4P7D A;  4YHH I;  4JI4 I;  2VQE I;  4L8N A;  4R1F A;  3ZKB A;  2ODR C;  4DV2 E;  1MX0 A;  1HR0 I;  4DUY E;  2XEX A;  1XNR E;  4X66 I;  1Z59 A;  4DV5 E;  2KON A;  4JI5 E;  2AJ4 A;  1RR9 A;  2WW4 A;  2V87 A;  3OTO E;  2F4V E;  4URL A;  4LF8 I;  5LMN I;  4M1K A;  5IT9 Q;  3IWD A;  1Z0C A;  3FIG A;  3JAM Q;  2M7Q A;  3J81 Q;  3ZZT A;  3B8H A;  2VQF E;  3ZZU A;  2HK2 A;  3J80 Q;  4AQY E;  4BC7 A;  1S4E A;  4DV4 E;  2RTX A;  4M0V A;  5BR8 E;  2LJP A;  1XNR I;  2A2D A;  1ZM3 A;  1YYK A;  3T1H E;  4DV5 I;  4B3R E;  1H74 A;  4JI3 E;  3H09 A;  4WFT A;  2OI2 A;  2UXD E;  1T4O A;  1VIS A;  1IBM E;  3C4T A;  4AQY I;  4DV4 I;  5BR8 I;  4P7A A;  2BM0 A;  3ZKD A;  2Z5C B;  1XMO E;  1Z0W A;  2ZIT A;  4BBY A;  4B3R I;  1IBK I;  2B3T B;  3QT5 A;  4NXM E;  1Z5A A;  3B82 A;  2CPN A;  3HJC A;  2VF1 A;  4I8O A;  1ZM2 A;  2UXD I;  1PVG A;  1IBM I;  2RSM A;  4X62 E;  4JYA E;  1WXR A;  4GKJ E;  4JI0 E;  4LU9 A;  1B62 A;  1XMO I;  2LMZ A;  2MC6 A;  4Q28 A;  4LFA I;  3KWR A;  5IT9 C;  2DIX A;  3F6G A;  3JAM C;  2JY9 A;  3J81 C;  1HNW I;  4DPU A;  2NUE A;  4DPW A;  1WUU A;  2V8P A;  4F9B B;  3J80 C;  5AE2 A;  4DKK A;  5LMU E;  1N33 I;  2BM1 A;  2HFS A;  2UUA E;  2O1W A;  2HK3 A;  4DV1 E;  4X62 I;  4DUZ E;  1T4L B;  4JYA I;  3VK6 A;  4GKJ I;  4JI0 I;  3ADL A;  4GEQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...