2ZM6E

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2zm6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2zm6E02
2B7VA 5LMUE 2BV3A 3ZZTA 4RPFA 1O0WA 3M6AA 3K17A 1FWLA 1QZRA 3ADGA 4X64I 2XEXA 4DR1E 4DV0I 3H4LA 3CWVA 1X49A 3VYYA 1NHHA 4LFCI 4GKJI 1IBLE 1IBMI 2YT4A 4DUZI 4UTGA 4LF5E 3LLHA 1B63A 2BM1A 4X62I 3ADLA 3T1HE 4DR2I 4I3HA 1S16A 3QT8A 4WYQB 2B3TB 4P52A 4LF7E 4LFAE 1RC7A 2HFSA 1YYWA 1ZXNA 1UILA 4X66E 2VQEE 2V2VA 5IWAI 2HHHE 2X36A 4DV1E 2UUBE 4JI1E 1Z0GA 4DR4E 1HNWI 4FW9A 2N3HA 1ZM9A 2JY9A 2OI2A 3T1YE 4JI8E 1H73A 2E5LI 2RTXA 4DXLA 4ED4A 5BR8I 1YYKA 2HKEA 2RS7A 3OTOI 4DR6E 4FWGA 3C4BA 4MYTA 4Z7CA 4DU7A 4PRVA 4B3SI 1EI1A 1T4NA 3PYGA 1WUUA 3J81Q 2KHXA 2MDRA 4DV4I 3WU5A 4NXMI 5A2QC 1MX0A 4P7AA 5LMUI 4USMA 2LUPB 1X47A 2L2NA 4DR1I 1N36E 4K0KE 1FJGI 2HKJA 4JG4A 3J7AM 1Z0TA 4LF4I 2ZITA 5IT9C 1FI4A 3PYEA 2HK2A 4LF5I 4JYAI 4LF9I 4JI4E 1YYOA 2UXCI 5GMDA 1XNRI 2L2KB 4DPUA 5FLXQ 3J7Yp 4LF7I 4LFAI 4MYUA 1VISA 4YY3E 4NXNE 2UXDE 1MU5A 1RREA 5GMEA 4X66I 1GQEA 2VQEI 4DPTA 4DKKA 2R42A 2HHHI 4JI3E 1T4LB 3K1JA 1KIJA 1Z0BA 3Q1QA 4DV1I 2UUBI 4B3RE 2UU9E 4JI1I 2CPNA 4DR4I 2JVAA 3LTOA 5CFFE 3VYXA 1KVKA 3JAMC 1FNMA 2CZ9A 4JI8I 1IBKE 4LF8E 1ZM2A 4HYMA 1HNXE 2X7IA 2LJHA 3QT7A 3ZKBA 1D6TA 4B3TE 4EMDA 3PYDA 2UXBI 4M2ZA 1HR0E 4GKKE 1HNZE 4DV3E 4JI6I 1WHQA 4JI5E 3J80Q 1YZ9A 2WW4A 4DV2I 1NHJA 4OOGC 5LMNE 4LF6I 1MG7A 1T4OA 2NUGA 1Z0EA 1UHZA 2NA2A 1U2RA 2ZBKB 1Z0WA 1PIEA 4JI2I 3WU6A 2VQFE 2LTSA 1N36I 4HACB 4K0KI 1BKNA 4OX9E 2UUAI 1X48A 5L3JA 2UUCI 4DR5E 1N0UA 1XMQE 4JI4I 4YHHE 4JI7I 1N32E 3ZKDA 4PU9A 2E1RA 1ZM4A 1A6FA 1ZXMA 2EFGA 1WHNA 4NXNI 4DV6E 4FWDA 2NUFA 4DPXA 3J7AG 2DEJA 2RS6A 3LNUA 2DMYA 4R1FA 4JI3I 2IHR1 4USKA 4DR3E 3B78A 2UU9I 2Q2EB 2LJPA 1J5EE 1Z5AA 4DR7E 1B62A 1KKHA 1HNXI 1H7UA 3WU4A 4DR2E 1IBLI 4B3TI 1EKZA 4DPWA 4WUBA 4X8WA 1HR0I 4GKKI 1HNZI 4DV7E 1Z0VA 1NZ0A 3T1HI 1N33E 1I94E 4JI5I 2ZM6E 3V5RA 4X65E 3D4JA 1H7SA 5LMNI 1DI2A 1Z5CA 1STUA 2A2CA 3QT6A 2NUEA 1OJ4A 3P1XA 2LBSB 2DB2A 4WFTA 4WUCA 4KQVA 5A2QQ 4DR5I 1N34E 2A2DA 3T1YI 2N3GA 2GS8A 4B3SE 3ZZUA 1N32I 4LFBE 4DV5E 4JV5E 4M30A 4DR6I 1DARA 2L33A 4NXME 1EA6A 4DV6I 5IT9Q 4JI0E 2RSMA 4HY1A 4FWHA 1XNQE 4DR3I 3ADJA 4B3ME 4AQYE 3WU3A 1FJGE 1J5EI 1NHIA 4DR7I 4XTJA 2NPFA 3LPSA 1N0VC 4LF4E 4HXZA 2BM0A 4JYAE 1K47A 4LF9E 3J81C 2F4VE 1UEKA 2UXCE 4HACA 2LUQA 1XNRE 3B82A 5LL6R 4KHPE 1KTVA 2V2QA 2EZ6A 4DV7I 3ADIA 3V2UC 3ZZ0A 4DUYE 2HK3A 3JAMQ 1N33I 1I94I 1XMOE 3F0NA 2ZM6I 4X65I 1XHKA 2J7KA 4YY3I 4UT4A 2DIXA 2V8PA 2UXDI 4PRXA 2VF3A 4B3RI 4X64E 1ELOA 2DEIA 4DV0E 4ZVIA 5FLXC 1Z59A 3PYFA 2AJ4A 4LFCE 1ZM3A 1N34I 4GKJE 1IBME 4DUZE 2UXBE 3QT5A 1IBKI 4LF8I 1QU6A 1FWKA 2L3JA 2HFUA 4WUDA 4DV5I 4LFBI 4JI6E 2L2MA 3C4TA 4JV5I 4X62E 1H74A 2LRSA 4DV2E 1Z5BA 3HULA 4LF6E 4DV3I 2V2ZA 4JI0I 1XNQI 1FKAE 5IWAE 4JI2E 4B3MI 4AQYI 2LTRA 4URLA 2L3CA 1RQ0A 4DU8A 2UUAE 2VQFI 1PKPA 2UUCE 1HNWE 1J26A 4FN5A 1PVGA 1H72C 2B7TA 3J80C 2F4VI 4M1KA 1RR9A 2E5LE 4JI7E 3B8HA 1Z0CA 1S4EA 5BR8E 2R3VA 4OX9I 4KHPI 3ZM7A 3OTOE 3GONA 1XMQI 4DUYI 4YHHI 1XMOI 3HTXA 1ZBTA 4Z7YA 4DV4E 4DPYA 2V34A
chains in the Genus database with same CATH superfamily
3MSWA 5DNXA 2O1VA 2B7VA 5LMUE 1A1GA 4ZYHA 2BV3A 4GQUA 1O0WA 3M6AA 3K17A 2EMHA 4RPFA 2EM2A 3ZZTA 2DLQA 3NZKA 2JT2A 3HQ1A 1FWLA 1QZRA 4OO1E 3ADGA 4X64I 2XEXA 2EOJA 5IXMB 2DLKA 4DR1E 4IFDD 1X6HA 3H4LA 4DV0I 2CSHA 2M7QA 1X49A 4ZYEA 3CWVA 5JEAC 3UK3C 1X6EA 3VYYA 1JK1A 5DRPA 1NHHA 1Y4UA 4LFCI 3HKMA 4GKJI 1IBLE 1IBMI 2ENAA 2YT4A 2VE7C 4DUZI 4WSGA 4WXCA 1Y5YA 2YU8A 2Z5BB 1E3PA 4UTGA 4LF5E 2YSOA 3LLHA 4OO1C 1B63A 5F3WA 4RHBB 2BM1A 4O5GA 5A6BA 2Z5BA 4X62I 3ADLA 3T1HE 4DR2I 2EPUA 4I3HA 1S16A 1A1LA 3QT8A 2WP8A 4WYQB 3FIGA 2EPPA 2B3TB 1G2DC 1EH8A 5JEAA 4P52A 2EOXA 5KL7A 4LF7E 4LFAE 1RC7A 2EOSA 2HFSA 1YYWA 1ZXNA 2YTJA 2GQ0A 1G2FC 1UILA 4X66E 2VQEE 2V2VA 1YFHA 2HHHE 3PS2A 5IWAI 1RHYA 2GPIA 2X36A 4DV1E 2UUBE 2WZOA 1A1HA 4MU0A 3JU0A 4JI1E 1Z0GA 4DR4E 1R6LA 2EPAA 2E72A 2EM0A 2C38B 3IWCA 4KZSA 5C0XF 4BHCA 1PDAA 1HNWI 2MKDA 4FW9A 3OMLA 5A6AA 2N3HA 2C38A 1LLMC 3CDIA 3HPSA 3JTZA 1ZM9A 2JY9A 3P3EA 2YTQA 2LMZA 5AE1A 3T1YE 4JI8E 2BR2B 2OI2A 3Q6MA 1H73A 5K36F 2I13A 2E5LI 2RTXA 4DXLA 4ED4A 5BR8I 1YYKA 2V86A 4JI2I 2HKEA 4NZVA 5AE2A 2RS7A 1WXRA 3U1KA 4DR6E 4WPYA 4FWGA 2WCC3 3OTOI 1WRJA 3C4BA 4MYTA 3GCMA 4Z7CA 4DU7A 4PRVA 2FGGA 2GO4A 4R2RA 4B3SI 1VI7A 1EI1A 1T4NA 3PYGA 2L6MA 1UDNA 2EOHA 2NABA 1WUUA 3J81Q 2CTDA 2NN6E 2PO0A 1B69A 2EN3A 2KHXA 2YTIA 1USUA 2MDRA 4DV4I 3WU5A 2EOIA 4F2JC 4NXMI 2JP9A 5A2QC 1MX0A 1UDSA 2O1UA 4P7AA 2EPMX 5LMUI 2BB8A 3VK6A 2Z5CB 5A69A 2LUPB 1X47A 2L2NA 3L7ZA 4USMA 2H36X 1T38A 4IFDF 2NN6C 2Z5CA 3HJCA 4DR1I 1N36E 4FW5A 4K0KE 4LCGA 1FJGI 4IZJB 2HKJA 4JG4A 4IJDA 2YPNA 2C37B 3J7AM 1Z0TA 4TUGA 5TSEA 2ZITA 4LF4I 3TQMA 2JWOA 5IT9C 1FI4A 2C37A 3PYEA 5DRQA 2HK2A 4LF5I 3WU6A 2ELZA 3DF6A 5IV8B 4LF9I 1X6FA 2EPCA 4ZYDA 4JYAI 2WBSA 1HK7A 4JI4E 1N3GA 1YYOA 2UXCI 5GMDA 2EL6A 1XNRI 2KOUA 2MKNA 5ELWA 2L2KB 4DPUA 2EMZA 5DRRA 5FLXQ 3J7Yp 4LF7I 2EN2A 2RSIA 2YSPA 4LFAI 4MYUA 1VISA 4YY3E 3P3GA 4OZEA 5AC5A 4NXNE 2JEBA 2N8XA 2UXDE 1MU5A 2V87A 1RREA 5GMEA 4X66I 1GQEA 2VQEI 2BA1G 2ADRA 4DPTA 4DKKA 2R42A 2HHHI 1PJSA 2LE2A 4JI3E 1T4LB 3IWBA 3K1JA 1KIJA 1USVA 1Z0BA 2IOPA 4DV1I 2UUBI 3Q1QA 3ECRA 4B3RE 1NCSA 5C0XB 2UU9E 4JI1I 2CPNA 2EM6A 5JEAE 4DR4I 4LPFA 4M0VA 2C39A 2EMFA 2G7HA 2JVAA 5C0XA 2V85A 3LTOA 2EN7A 4F9BB 5CFFE 3KRNA 4BA1B 3VYXA 5T6JA 1KVKA 2M1SA 4R2AA 5K36B 4Q28A 2DSYA 3JAMC 1FNMA 2CZ9A 3BBGA 4N3OA 1QNTA 4JI8I 1IBKE 5K36A 4LF8E 2EOYA 1ZM2A 2VESA 4HYMA 1HNXE 2DGCA 2X7IA 2PO2B 3IWDA 2LJHA 2BA1D 2J65A 3QT7A 3ZKBA 3BIDA 1D6TA 4B3TE 5A6BD 3EPLA 2PO2A 4EMDA 3PYDA 2UXBI 4M2ZA 2J7JA 1HR0E 4BBYA 4GKKE 1HNZE 4DV3E 1IQSA 5JEAD 4JI6I 2A25A 1WHQA 1YPNA 2LV2A 2D9HA 4O43A 4ZYGA 5AE3A 5A6JA 2DRPA 4JI5E 1YZ9A 3J80Q 2WW4A 4DV2I 2YRHA 4BMJA 2EQ0A 1NHJA 1OYRA 1BBGA 4OOGC 5LMNE 4GZNC 4LF6I 4Q35B 1MG7A 4IFDB 1T4OA 2NUGA 1ZR9A 4OO1D 2LJUA 2AE8A 2ENCA 1Z0EA 1AAYA 1UHZA 2HGHA 2NA2A 2EMWA 1U2RA 2ZBKB 3C6KA 1Z0WA 4X9JA 2ODRC 2BBGA 2VQFE 1PIEA 4U3BA 1PJTA 2LTSA 1YHCA 2EPNA 3P06A 4HACB 4FW6A 1N36I 2EPKX 4K0KI 5DNYA 2YTDA 2M9AA 1BKNA 4MDTA 5EKWA 4OX9E 3GMEA 2UUAI 1X48A 5L3JA 2UUCI 4DR5E 1YSAC 2JYAA 2EMLA 1A1IA 1N0UA 1XMQE 4JI4I 2EORA 1UN6B 4YHHE 5DROA 4JI7I 1N32E 4I8OA 3ZKDA 4PU9A 2BR2A 2E1RA 3KWRA 2LT7A 4FW7A 1ZM4A 2F1DA 1A6FA 1ZXMA 3EPHA 2EFGA 1WHNA 4NXNI 2EL4A 2EOMA 2V8QB 4DV6E 4FWDA 1MGTA 2NUFA 2EMKA 3J7AG 4DPXA 1YUJA 2RS6A 2DEJA 3LNUA 2DMYA 2O1TA 4R1FA 1P42A 4F54A 4JI3I 2IHR1 4USKA 4DR3E 3B78A 3L00A 2UU9I 2Q2EB 3THNA 5A6KA 3DD6A 2HJJA 4KWYA 1J5EE 2LJPA 4QNJA 1IQOA 1OYPA 4DR7E 1Z5AA 1B62A 3HXLA 2BA0G 3GLLA 3BF2A 2VRDA 2CT1A 2YTFA 5KL2A 1KKHA 1SFEA 1HNXI 3M99B 2YWQA 2EQ1A 4L5NC 4R2EA 3RMPA 2WBUA 1H7UA 3WU4A 2EP3A 5C0XE 4DR2E 1IBLI 2YTEA 2V88A 4R8OA 4IZJA 1EKZA 4B3TI 2EQ3A 5AC4A 4R2CA 3KZZA 4DPWA 4WUBA 2NN6D 4X8WA 3ZOQB 1HR0I 4GKKI 1HNZI 1NEIA 4DV7E 1EH7A 1Z0VA 2EMBA 2HC5A 1NZ0A 3LMLA 3T1HI 1N33E 2JXPA 1I94E 2BA0D 4JI5I 2V89A 2ZM6E 3V5RA 3QG5C 4X65E 3D4JA 3P3CA 5C0XC 2JEAB 2EMIA 4M9VC 1H7SA 2DMIA 1TN9A 2R76A 3EPJA 5LMNI 4OO1F 2GLIA 4R2DA 3AUZA 1DI2A 1X5WA 1Z5CA 1DQ3A 4BHBA 1STUA 2A2CA 1Y6ZA 2JE6B 4QNKA 5K36C 1YH8A 2EMXA 2CVEA 3QT6A 2EM4A 2VF1A 2NUEA 1BB8A 1SR9A 2EN6A 4LU9A 1OJ4A 3L7ZB 1KJKA 3P1XA 1KYQA 2LBSB 4O24A 4DMIA 2DB2A 2EJ4A 4WFTA 2EPLX 2EWLA 4LCFA 4WUCA 2PO1B 2LVHA 3MHSC 2WNRB 1PJQA 4KQVA 4IS1C 5A2QQ 2EMGA 4DR5I 2EOEA 2YU5A 2EM3A 1N34E 5KL4A 2PO1A 2V34A 2WNRA 4P78A 2A2DA 2YTGA 2EE8A 2EL5A 4BA1A 3T1YI 2N3GA 2EMCA 2GS8A 2L8TA 4B3SE 2PNZB 1OYSA 3ZZUA 1N32I 2IERA 3EPKA 2L92A 4LFBE 3MHHC 4DV5E 4MU3A 4JV5E 4WSPA 3PRYA 3M7NG 4M30A 5KL5A 4DR6I 3AV0A 2EM5A 3HPZA 1TF3A 1DARA 1ZBQA 4IFDC 3K85A 2L33A 3DJWA 4NXME 1EA6A 1Z1BA 2EMAA 2KONA 4R03A 2EOFA 4DV6I 5IT9Q 4JI0E 4AM3A 2RSMA 4HY1A 4FWHA 3H09A 4HTGA 2MC5A 5ADZA 1T39A 2K4VA 1XNQE 1A1KA 4DR3I 3ADJA 4B3ME 4AQYE 3WU3A 1FJGE 1UDQA 1J5EI 2EPXA 1NHIA 4DR7I 4BC7A 5AASA 5DNLA 4NHRA 3PS1A 4IZKB 4XTJA 2NPFA 3LPSA 3VHTB 1N0VC 3M7ND 4IFDA 5LLQA 4LF4E 2K7IA 4LTYA 2EPOA 4MLVA 1GZ6A 4FW3A 1Y4SA 4IZKA 4HXZA 2BM0A 2MC6A 3J81C 4JYAE 4LF9E 1K47A 2EOOA 4LOMA 2WP8B 4WX9A 2F4VE 1UEKA 2LUQA 2UXCE 4HACA 5JEAB 5LL6R 1XNRE 3EQ1A 3B82A 4FK5C 2NN6F 4F9CB 2ODRD 4KHPE 4R2SA 2PNLA 1EH6A 1KTVA 2EN8A 2V2QA 2EZ6A 2GO3A 4DV7I 4ISAA 3ADIA 3V2UC 3ZZ0A 4DUYE 2HK3A 1F2IG 3KZYA 3JAMQ 4OO1B 1N33I 1I94I 1XMOE 3F0NA 2FV4B 2ZM6I 4WXDA 4X65I 2YRKA 4OO1A 1L4SA 2WBTA 1XHKA 2J7KA 4MU4A 4U3DA 4P7DA 5EL9A 4F9AB 4YY3I 4UT4A 2V83A 2DIXA 2V8PA 2UXDI 1YUIA 2EPRA 4PRXA 2LCEA 2VF3A 4R2QA 2EM8A 2Q8UA 4R2PA 3P76A 5KL3A 2EM7A 4B3RI 2YTOA 2PNMA 4X64E 2CGEA 1ELOA 2DEIA 4DV0E 4ZVIA 2EN1A 1A1JA 5FLXC 3K6QA 4F6MA 1Z59A 3PYFA 2AJ4A 1BBOA 2PRTA 4LFCE 1R6MA 1RMDA 1ZM3A 2EPZA 3BGHA 4RH8A 4GKJE 1N34I 1IBME 4BC9A 3PS3A 4DUZE 3F6GA 3Q6NA 2UXBE 2YTPA 3QT5A 4NBQA 4IZJD 1IBKI 4LF8I 2JOXA 1JK2A 1QU6A 4MLQA 1FWKA 2L3JA 2HFUA 2PO0B 4WUDA 4DV5I 4LFBI 4JI6E 5KL6A 2L2MA 3C4TA 1UDOA 4X62E 5FWKA 4JV5I 2B9DA 1H74A 2LRSA 1P47A 4DV2E 2JR1A 1ZU1A 4GEQB 4J8ZA 1Z5BA 3HULA 4LF6E 5JEAF 4DV3I 2EM9A 2V2ZA 4JI0I 4BA2B 4HEIA 1XXEA 5K36E 4LCHA 2LO3A 2EOZA 3M85G 3U1YA 2E1MA 1XNQI 3UHMA 4BA2A 3H1CA 1FKAE 5IWAE 4JI2E 4B3MI 4AQYI 2LTRA 1GTKA 2JOBA 4URLA 2ENHA 2YRMA 2L3CA 2YZTA 1IMUA 2JEAA 1WJPA 4AIMA 1RQ0A 3C6MA 1DGCA 2GHFA 3B4TA 2O1WA 2IESA 4N4RB 1AH5A 2MDGA 4DU8A 2UUAE 2VQFI 2JPAA 1PKPA 2UUCE 1HNWE 1J26A 4FN5A 2RPCA 1TF6A 1PVGA 2JE6A 2O3ZA 5C0XD 1H72C 2NN6B 2ELYA 2CG9A 2B7TA 2EOQA 3J80C 2F4VI 4M1KA 1E3HA 2EN4A 1RR9A 2E5LE 4JI7E 2Z5EA 1Z0CA 1UBDC 2NN6A 3THOB 1S4EA 2EMYA 3B8HA 5BR8E 3M85D 5K36D 2I9IA 2R3VA 4OX9I 4KHPI 1X3CA 2JEBB 1ZAAC 3ZM7A 3OTOE 4IFDE 2F8BA 1MEYC 4MQYA 4OKGA 3CDJA 1Y60A 1A1FA 2FTXB 4F6NA 3GONA 2RQLA 1XMQI 4DUYI 4YHHI 2IOQA 2M4IA 2R1FA 4O4KA 3F6HA 1XMOI 3HTXA 4J3DA 4TUIA 4FW4A 4L8NA 1ZBTA 4MU1A 2PNZA 4AIDA 2C39B 4IS9A 4Z7YA 4BS9A 2YTNA 4DV4E 4DPYA 4BCAA
chains in the Genus database with same CATH topology
3MSWA 2O1VA 2B7VA 5LMUE 2BV3A 3ZZTA 4RPFA 1O0WA 3M6AA 3K17A 3HQ1A 1FWLA 1QZRA 3ADGA 4X64I 2XEXA 4DR1E 4DV0I 3H4LA 2M7QA 1X49A 3CWVA 3VYYA 1NHHA 1Y4UA 4LFCI 4GKJI 1IBLE 1IBMI 2YT4A 2VE7C 4DUZI 2Z5BB 4UTGA 4LF5E 3LLHA 1B63A 5F3WA 2BM1A 2Z5BA 4X62I 3ADLA 3T1HE 4DR2I 4I3HA 1S16A 3QT8A 4WYQB 3FIGA 2B3TB 4P52A 4LF7E 4LFAE 1RC7A 2HFSA 1YYWA 1ZXNA 2GQ0A 1UILA 4X66E 2VQEE 2V2VA 5IWAI 2HHHE 2X36A 4DV1E 2UUBE 2WZOA 3JU0A 4JI1E 1Z0GA 4DR4E 3IWCA 4KZSA 1HNWI 4FW9A 3OMLA 2N3HA 3HPSA 3JTZA 1ZM9A 2JY9A 2LMZA 5AE1A 3T1YE 4JI8E 2OI2A 3Q6MA 1H73A 2E5LI 2RTXA 4DXLA 4ED4A 5BR8I 1YYKA 2V86A 2HKEA 5AE2A 2RS7A 1WXRA 3OTOI 4DR6E 4WPYA 4FWGA 3C4BA 4MYTA 4Z7CA 4DU7A 4PRVA 2FGGA 4B3SI 1EI1A 1T4NA 3PYGA 2L6MA 1WUUA 3J81Q 2KHXA 1USUA 2MDRA 4DV4I 3WU5A 4NXMI 5A2QC 1MX0A 2O1UA 4P7AA 5LMUI 3VK6A 2Z5CB 4USMA 2LUPB 1X47A 2L2NA 2H36X 2Z5CA 3HJCA 4DR1I 1N36E 4K0KE 1FJGI 4IZJB 2HKJA 4JG4A 3J7AM 1Z0TA 4TUGA 2ZITA 4LF4I 5IT9C 2JWOA 1FI4A 3PYEA 2HK2A 4LF5I 3DF6A 4JYAI 4LF9I 1HK7A 4JI4E 1YYOA 2UXCI 5GMDA 1XNRI 2KOUA 2L2KB 4DPUA 5FLXQ 3J7Yp 4LF7I 4LFAI 4MYUA 1VISA 4YY3E 4NXNE 2UXDE 1MU5A 2V87A 1RREA 5GMEA 4X66I 1GQEA 2VQEI 4DPTA 4DKKA 2R42A 2HHHI 2LE2A 4JI3E 1T4LB 3IWBA 3K1JA 1KIJA 1USVA 1Z0BA 2IOPA 4DV1I 2UUBI 3Q1QA 4B3RE 2UU9E 4JI1I 2CPNA 4DR4I 4M0VA 2G7HA 2JVAA 2V85A 3LTOA 4F9BB 5CFFE 3VYXA 5T6JA 1KVKA 2M1SA 4Q28A 2DSYA 3JAMC 1FNMA 2CZ9A 4N3OA 4JI8I 1IBKE 4LF8E 1ZM2A 4HYMA 1HNXE 2X7IA 3IWDA 2LJHA 3QT7A 3ZKBA 1D6TA 4B3TE 4EMDA 3PYDA 2UXBI 4M2ZA 1HR0E 4BBYA 4GKKE 1HNZE 4DV3E 4JI6I 1WHQA 5AE3A 4JI5E 3J80Q 1YZ9A 2WW4A 4DV2I 4BMJA 1NHJA 4OOGC 5LMNE 4LF6I 1MG7A 1T4OA 2NUGA 1Z0EA 1UHZA 2NA2A 1U2RA 2ZBKB 1Z0WA 1PIEA 2ODRC 3WU6A 2VQFE 4JI2I 2LTSA 3P06A 4HACB 1N36I 4K0KI 5DNYA 1BKNA 4OX9E 2UUAI 1X48A 5L3JA 2UUCI 4DR5E 1N0UA 1XMQE 4JI4I 4YHHE 4JI7I 1N32E 4I8OA 3ZKDA 4PU9A 2E1RA 3KWRA 1ZM4A 1A6FA 1ZXMA 2EFGA 1WHNA 4NXNI 2V8QB 4DV6E 4FWDA 2NUFA 4DPXA 3J7AG 2RS6A 2DEJA 3LNUA 2DMYA 2O1TA 4R1FA 4JI3I 4F54A 2IHR1 4USKA 4DR3E 3B78A 2UU9I 2Q2EB 2LJPA 1J5EE 1Z5AA 4DR7E 1B62A 3HXLA 1KKHA 1HNXI 4L5NC 3RMPA 1H7UA 3WU4A 4DR2E 1IBLI 2V88A 4R8OA 4IZJA 1EKZA 4B3TI 4DPWA 4WUBA 4X8WA 3ZOQB 1HR0I 4GKKI 1HNZI 4DV7E 1Z0VA 1NZ0A 3LMLA 3T1HI 1N33E 1I94E 4JI5I 2V89A 2ZM6E 3V5RA 4X65E 3D4JA 1H7SA 5LMNI 3AUZA 1DI2A 1Z5CA 1DQ3A 1STUA 2A2CA 1Y6ZA 3QT6A 2VF1A 2NUEA 1SR9A 4LU9A 1OJ4A 3P1XA 2LBSB 4DMIA 2DB2A 4WFTA 2EWLA 4WUCA 4KQVA 5A2QQ 4DR5I 1N34E 2V34A 4P78A 2A2DA 3T1YI 2N3GA 2GS8A 2L8TA 4B3SE 3ZZUA 1N32I 2L92A 4LFBE 4DV5E 4JV5E 4WSPA 3PRYA 4M30A 4DR6I 3AV0A 3HPZA 1DARA 1ZBQA 3K85A 2L33A 3DJWA 4NXME 1EA6A 2KONA 4R03A 4DV6I 5IT9Q 4JI0E 2RSMA 4HY1A 4FWHA 3H09A 2MC5A 5ADZA 1XNQE 2K4VA 4DR3I 3ADJA 4B3ME 4AQYE 3WU3A 1FJGE 1J5EI 1NHIA 4DR7I 4BC7A 5AASA 4IZKB 4XTJA 2NPFA 3LPSA 1N0VC 4LF4E 4LTYA 1GZ6A 4IZKA 1Y4SA 4HXZA 2BM0A 2MC6A 3J81C 4JYAE 4LF9E 1K47A 2F4VE 1UEKA 2UXCE 2LUQA 4HACA 5LL6R 1XNRE 3B82A 4F9CB 2ODRD 4KHPE 2PNLA 1KTVA 2V2QA 2EZ6A 4DV7I 3ADIA 3V2UC 3ZZ0A 4DUYE 2HK3A 3JAMQ 1N33I 1I94I 1XMOE 3F0NA 2FV4B 2ZM6I 4X65I 1XHKA 2J7KA 4P7DA 4F9AB 4YY3I 4UT4A 2V83A 2DIXA 2V8PA 2UXDI 4PRXA 2VF3A 4B3RI 2PNMA 4X64E 2CGEA 1ELOA 2DEIA 4DV0E 4ZVIA 5FLXC 3K6QA 1Z59A 3PYFA 2AJ4A 4LFCE 1ZM3A 1N34I 4GKJE 1IBME 4BC9A 4DUZE 3F6GA 3Q6NA 2UXBE 3QT5A 1IBKI 4LF8I 4IZJD 2JOXA 1QU6A 1FWKA 2L3JA 2HFUA 4WUDA 4DV5I 4LFBI 4JI6E 2L2MA 3C4TA 5FWKA 4X62E 4JV5I 2B9DA 1H74A 2LRSA 4DV2E 2JR1A 4GEQB 4J8ZA 1Z5BA 3HULA 4LF6E 4DV3I 2V2ZA 4JI0I 2E1MA 1XNQI 1FKAE 5IWAE 4JI2E 4B3MI 4AQYI 2LTRA 2JOBA 4URLA 2L3CA 2YZTA 1RQ0A 2O1WA 4DU8A 2UUAE 2VQFI 1PKPA 2UUCE 1HNWE 1J26A 4FN5A 1PVGA 1H72C 2CG9A 2B7TA 3J80C 2F4VI 4M1KA 1RR9A 2E5LE 4JI7E 2Z5EA 1Z0CA 3B8HA 1S4EA 5BR8E 2R3VA 4OX9I 4KHPI 3ZM7A 3OTOE 2F8BA 2FTXB 3GONA 1XMQI 4DUYI 4YHHI 2IOQA 2M4IA 3F6HA 1XMOI 3HTXA 4TUIA 4L8NA 1ZBTA 4Z7YA 4BS9A 4DV4E 4DPYA 4BCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7V A;  5LMU E;  2BV3 A;  3ZZT A;  4RPF A;  1O0W A;  3M6A A;  3K17 A;  1FWL A;  1QZR A;  3ADG A;  4X64 I;  2XEX A;  4DR1 E;  4DV0 I;  3H4L A;  3CWV A;  1X49 A;  3VYY A;  1NHH A;  4LFC I;  4GKJ I;  1IBL E;  1IBM I;  2YT4 A;  4DUZ I;  4UTG A;  4LF5 E;  3LLH A;  1B63 A;  2BM1 A;  4X62 I;  3ADL A;  3T1H E;  4DR2 I;  4I3H A;  1S16 A;  3QT8 A;  4WYQ B;  2B3T B;  4P52 A;  4LF7 E;  4LFA E;  1RC7 A;  2HFS A;  1YYW A;  1ZXN A;  1UIL A;  4X66 E;  2VQE E;  2V2V A;  5IWA I;  2HHH E;  2X36 A;  4DV1 E;  2UUB E;  4JI1 E;  1Z0G A;  4DR4 E;  1HNW I;  4FW9 A;  2N3H A;  1ZM9 A;  2JY9 A;  2OI2 A;  3T1Y E;  4JI8 E;  1H73 A;  2E5L I;  2RTX A;  4DXL A;  4ED4 A;  5BR8 I;  1YYK A;  2HKE A;  2RS7 A;  3OTO I;  4DR6 E;  4FWG A;  3C4B A;  4MYT A;  4Z7C A;  4DU7 A;  4PRV A;  4B3S I;  1EI1 A;  1T4N A;  3PYG A;  1WUU A;  3J81 Q;  2KHX A;  2MDR A;  4DV4 I;  3WU5 A;  4NXM I;  5A2Q C;  1MX0 A;  4P7A A;  5LMU I;  4USM A;  2LUP B;  1X47 A;  2L2N A;  4DR1 I;  1N36 E;  4K0K E;  1FJG I;  2HKJ A;  4JG4 A;  3J7A M;  1Z0T A;  4LF4 I;  2ZIT A;  5IT9 C;  1FI4 A;  3PYE A;  2HK2 A;  4LF5 I;  4JYA I;  4LF9 I;  4JI4 E;  1YYO A;  2UXC I;  5GMD A;  1XNR I;  2L2K B;  4DPU A;  5FLX Q;  3J7Y p;  4LF7 I;  4LFA I;  4MYU A;  1VIS A;  4YY3 E;  4NXN E;  2UXD E;  1MU5 A;  1RRE A;  5GME A;  4X66 I;  1GQE A;  2VQE I;  4DPT A;  4DKK A;  2R42 A;  2HHH I;  4JI3 E;  1T4L B;  3K1J A;  1KIJ A;  1Z0B A;  3Q1Q A;  4DV1 I;  2UUB I;  4B3R E;  2UU9 E;  4JI1 I;  2CPN A;  4DR4 I;  2JVA A;  3LTO A;  5CFF E;  3VYX A;  1KVK A;  3JAM C;  1FNM A;  2CZ9 A;  4JI8 I;  1IBK E;  4LF8 E;  1ZM2 A;  4HYM A;  1HNX E;  2X7I A;  2LJH A;  3QT7 A;  3ZKB A;  1D6T A;  4B3T E;  4EMD A;  3PYD A;  2UXB I;  4M2Z A;  1HR0 E;  4GKK E;  1HNZ E;  4DV3 E;  4JI6 I;  1WHQ A;  4JI5 E;  3J80 Q;  1YZ9 A;  2WW4 A;  4DV2 I;  1NHJ A;  4OOG C;  5LMN E;  4LF6 I;  1MG7 A;  1T4O A;  2NUG A;  1Z0E A;  1UHZ A;  2NA2 A;  1U2R A;  2ZBK B;  1Z0W A;  1PIE A;  4JI2 I;  3WU6 A;  2VQF E;  2LTS A;  1N36 I;  4HAC B;  4K0K I;  1BKN A;  4OX9 E;  2UUA I;  1X48 A;  5L3J A;  2UUC I;  4DR5 E;  1N0U A;  1XMQ E;  4JI4 I;  4YHH E;  4JI7 I;  1N32 E;  3ZKD A;  4PU9 A;  2E1R A;  1ZM4 A;  1A6F A;  1ZXM A;  2EFG A;  1WHN A;  4NXN I;  4DV6 E;  4FWD A;  2NUF A;  4DPX A;  3J7A G;  2DEJ A;  2RS6 A;  3LNU A;  2DMY A;  4R1F A;  4JI3 I;  2IHR 1;  4USK A;  4DR3 E;  3B78 A;  2UU9 I;  2Q2E B;  2LJP A;  1J5E E;  1Z5A A;  4DR7 E;  1B62 A;  1KKH A;  1HNX I;  1H7U A;  3WU4 A;  4DR2 E;  1IBL I;  4B3T I;  1EKZ A;  4DPW A;  4WUB A;  4X8W A;  1HR0 I;  4GKK I;  1HNZ I;  4DV7 E;  1Z0V A;  1NZ0 A;  3T1H I;  1N33 E;  1I94 E;  4JI5 I;  2ZM6 E;  3V5R A;  4X65 E;  3D4J A;  1H7S A;  5LMN I;  1DI2 A;  1Z5C A;  1STU A;  2A2C A;  3QT6 A;  2NUE A;  1OJ4 A;  3P1X A;  2LBS B;  2DB2 A;  4WFT A;  4WUC A;  4KQV A;  5A2Q Q;  4DR5 I;  1N34 E;  2A2D A;  3T1Y I;  2N3G A;  2GS8 A;  4B3S E;  3ZZU A;  1N32 I;  4LFB E;  4DV5 E;  4JV5 E;  4M30 A;  4DR6 I;  1DAR A;  2L33 A;  4NXM E;  1EA6 A;  4DV6 I;  5IT9 Q;  4JI0 E;  2RSM A;  4HY1 A;  4FWH A;  1XNQ E;  4DR3 I;  3ADJ A;  4B3M E;  4AQY E;  3WU3 A;  1FJG E;  1J5E I;  1NHI A;  4DR7 I;  4XTJ A;  2NPF A;  3LPS A;  1N0V C;  4LF4 E;  4HXZ A;  2BM0 A;  4JYA E;  1K47 A;  4LF9 E;  3J81 C;  2F4V E;  1UEK A;  2UXC E;  4HAC A;  2LUQ A;  1XNR E;  3B82 A;  5LL6 R;  4KHP E;  1KTV A;  2V2Q A;  2EZ6 A;  4DV7 I;  3ADI A;  3V2U C;  3ZZ0 A;  4DUY E;  2HK3 A;  3JAM Q;  1N33 I;  1I94 I;  1XMO E;  3F0N A;  2ZM6 I;  4X65 I;  1XHK A;  2J7K A;  4YY3 I;  4UT4 A;  2DIX A;  2V8P A;  2UXD I;  4PRX A;  2VF3 A;  4B3R I;  4X64 E;  1ELO A;  2DEI A;  4DV0 E;  4ZVI A;  5FLX C;  1Z59 A;  3PYF A;  2AJ4 A;  4LFC E;  1ZM3 A;  1N34 I;  4GKJ E;  1IBM E;  4DUZ E;  2UXB E;  3QT5 A;  1IBK I;  4LF8 I;  1QU6 A;  1FWK A;  2L3J A;  2HFU A;  4WUD A;  4DV5 I;  4LFB I;  4JI6 E;  2L2M A;  3C4T A;  4JV5 I;  4X62 E;  1H74 A;  2LRS A;  4DV2 E;  1Z5B A;  3HUL A;  4LF6 E;  4DV3 I;  2V2Z A;  4JI0 I;  1XNQ I;  1FKA E;  5IWA E;  4JI2 E;  4B3M I;  4AQY I;  2LTR A;  4URL A;  2L3C A;  1RQ0 A;  4DU8 A;  2UUA E;  2VQF I;  1PKP A;  2UUC E;  1HNW E;  1J26 A;  4FN5 A;  1PVG A;  1H72 C;  2B7T A;  3J80 C;  2F4V I;  4M1K A;  1RR9 A;  2E5L E;  4JI7 E;  3B8H A;  1Z0C A;  1S4E A;  5BR8 E;  2R3V A;  4OX9 I;  4KHP I;  3ZM7 A;  3OTO E;  3GON A;  1XMQ I;  4DUY I;  4YHH I;  1XMO I;  3HTX A;  1ZBT A;  4Z7Y A;  4DV4 E;  4DPY A;  2V34 A; 
#chains in the Genus database with same CATH topology
 3MSW A;  5DNX A;  2O1V A;  2B7V A;  5LMU E;  1A1G A;  4ZYH A;  2BV3 A;  4GQU A;  1O0W A;  3M6A A;  3K17 A;  2EMH A;  4RPF A;  2EM2 A;  3ZZT A;  2DLQ A;  3NZK A;  2JT2 A;  3HQ1 A;  1FWL A;  1QZR A;  4OO1 E;  3ADG A;  4X64 I;  2XEX A;  2EOJ A;  5IXM B;  2DLK A;  4DR1 E;  4IFD D;  1X6H A;  3H4L A;  4DV0 I;  2CSH A;  2M7Q A;  1X49 A;  4ZYE A;  3CWV A;  5JEA C;  3UK3 C;  1X6E A;  3VYY A;  1JK1 A;  5DRP A;  1NHH A;  1Y4U A;  4LFC I;  3HKM A;  4GKJ I;  1IBL E;  1IBM I;  2ENA A;  2YT4 A;  2VE7 C;  4DUZ I;  4WSG A;  4WXC A;  1Y5Y A;  2YU8 A;  2Z5B B;  1E3P A;  4UTG A;  4LF5 E;  2YSO A;  3LLH A;  4OO1 C;  1B63 A;  5F3W A;  4RHB B;  2BM1 A;  4O5G A;  5A6B A;  2Z5B A;  4X62 I;  3ADL A;  3T1H E;  4DR2 I;  2EPU A;  4I3H A;  1S16 A;  1A1L A;  3QT8 A;  2WP8 A;  4WYQ B;  3FIG A;  2EPP A;  2B3T B;  1G2D C;  1EH8 A;  5JEA A;  4P52 A;  2EOX A;  5KL7 A;  4LF7 E;  4LFA E;  1RC7 A;  2EOS A;  2HFS A;  1YYW A;  1ZXN A;  2YTJ A;  2GQ0 A;  1G2F C;  1UIL A;  4X66 E;  2VQE E;  2V2V A;  1YFH A;  2HHH E;  3PS2 A;  5IWA I;  1RHY A;  2GPI A;  2X36 A;  4DV1 E;  2UUB E;  2WZO A;  1A1H A;  4MU0 A;  3JU0 A;  4JI1 E;  1Z0G A;  4DR4 E;  1R6L A;  2EPA A;  2E72 A;  2EM0 A;  2C38 B;  3IWC A;  4KZS A;  5C0X F;  4BHC A;  1PDA A;  1HNW I;  2MKD A;  4FW9 A;  3OML A;  5A6A A;  2N3H A;  2C38 A;  1LLM C;  3CDI A;  3HPS A;  3JTZ A;  1ZM9 A;  2JY9 A;  3P3E A;  2YTQ A;  2LMZ A;  5AE1 A;  3T1Y E;  4JI8 E;  2BR2 B;  2OI2 A;  3Q6M A;  1H73 A;  5K36 F;  2I13 A;  2E5L I;  2RTX A;  4DXL A;  4ED4 A;  5BR8 I;  1YYK A;  2V86 A;  4JI2 I;  2HKE A;  4NZV A;  5AE2 A;  2RS7 A;  1WXR A;  3U1K A;  4DR6 E;  4WPY A;  4FWG A;  2WCC 3;  3OTO I;  1WRJ A;  3C4B A;  4MYT A;  3GCM A;  4Z7C A;  4DU7 A;  4PRV A;  2FGG A;  2GO4 A;  4R2R A;  4B3S I;  1VI7 A;  1EI1 A;  1T4N A;  3PYG A;  2L6M A;  1UDN A;  2EOH A;  2NAB A;  1WUU A;  3J81 Q;  2CTD A;  2NN6 E;  2PO0 A;  1B69 A;  2EN3 A;  2KHX A;  2YTI A;  1USU A;  2MDR A;  4DV4 I;  3WU5 A;  2EOI A;  4F2J C;  4NXM I;  2JP9 A;  5A2Q C;  1MX0 A;  1UDS A;  2O1U A;  4P7A A;  2EPM X;  5LMU I;  2BB8 A;  3VK6 A;  2Z5C B;  5A69 A;  2LUP B;  1X47 A;  2L2N A;  3L7Z A;  4USM A;  2H36 X;  1T38 A;  4IFD F;  2NN6 C;  2Z5C A;  3HJC A;  4DR1 I;  1N36 E;  4FW5 A;  4K0K E;  4LCG A;  1FJG I;  4IZJ B;  2HKJ A;  4JG4 A;  4IJD A;  2YPN A;  2C37 B;  3J7A M;  1Z0T A;  4TUG A;  5TSE A;  2ZIT A;  4LF4 I;  3TQM A;  2JWO A;  5IT9 C;  1FI4 A;  2C37 A;  3PYE A;  5DRQ A;  2HK2 A;  4LF5 I;  3WU6 A;  2ELZ A;  3DF6 A;  5IV8 B;  4LF9 I;  1X6F A;  2EPC A;  4ZYD A;  4JYA I;  2WBS A;  1HK7 A;  4JI4 E;  1N3G A;  1YYO A;  2UXC I;  5GMD A;  2EL6 A;  1XNR I;  2KOU A;  2MKN A;  5ELW A;  2L2K B;  4DPU A;  2EMZ A;  5DRR A;  5FLX Q;  3J7Y p;  4LF7 I;  2EN2 A;  2RSI A;  2YSP A;  4LFA I;  4MYU A;  1VIS A;  4YY3 E;  3P3G A;  4OZE A;  5AC5 A;  4NXN E;  2JEB A;  2N8X A;  2UXD E;  1MU5 A;  2V87 A;  1RRE A;  5GME A;  4X66 I;  1GQE A;  2VQE I;  2BA1 G;  2ADR A;  4DPT A;  4DKK A;  2R42 A;  2HHH I;  1PJS A;  2LE2 A;  4JI3 E;  1T4L B;  3IWB A;  3K1J A;  1KIJ A;  1USV A;  1Z0B A;  2IOP A;  4DV1 I;  2UUB I;  3Q1Q A;  3ECR A;  4B3R E;  1NCS A;  5C0X B;  2UU9 E;  4JI1 I;  2CPN A;  2EM6 A;  5JEA E;  4DR4 I;  4LPF A;  4M0V A;  2C39 A;  2EMF A;  2G7H A;  2JVA A;  5C0X A;  2V85 A;  3LTO A;  2EN7 A;  4F9B B;  5CFF E;  3KRN A;  4BA1 B;  3VYX A;  5T6J A;  1KVK A;  2M1S A;  4R2A A;  5K36 B;  4Q28 A;  2DSY A;  3JAM C;  1FNM A;  2CZ9 A;  3BBG A;  4N3O A;  1QNT A;  4JI8 I;  1IBK E;  5K36 A;  4LF8 E;  2EOY A;  1ZM2 A;  2VES A;  4HYM A;  1HNX E;  2DGC A;  2X7I A;  2PO2 B;  3IWD A;  2LJH A;  2BA1 D;  2J65 A;  3QT7 A;  3ZKB A;  3BID A;  1D6T A;  4B3T E;  5A6B D;  3EPL A;  2PO2 A;  4EMD A;  3PYD A;  2UXB I;  4M2Z A;  2J7J A;  1HR0 E;  4BBY A;  4GKK E;  1HNZ E;  4DV3 E;  1IQS A;  5JEA D;  4JI6 I;  2A25 A;  1WHQ A;  1YPN A;  2LV2 A;  2D9H A;  4O43 A;  4ZYG A;  5AE3 A;  5A6J A;  2DRP A;  4JI5 E;  1YZ9 A;  3J80 Q;  2WW4 A;  4DV2 I;  2YRH A;  4BMJ A;  2EQ0 A;  1NHJ A;  1OYR A;  1BBG A;  4OOG C;  5LMN E;  4GZN C;  4LF6 I;  4Q35 B;  1MG7 A;  4IFD B;  1T4O A;  2NUG A;  1ZR9 A;  4OO1 D;  2LJU A;  2AE8 A;  2ENC A;  1Z0E A;  1AAY A;  1UHZ A;  2HGH A;  2NA2 A;  2EMW A;  1U2R A;  2ZBK B;  3C6K A;  1Z0W A;  4X9J A;  2ODR C;  2BBG A;  2VQF E;  1PIE A;  4U3B A;  1PJT A;  2LTS A;  1YHC A;  2EPN A;  3P06 A;  4HAC B;  4FW6 A;  1N36 I;  2EPK X;  4K0K I;  5DNY A;  2YTD A;  2M9A A;  1BKN A;  4MDT A;  5EKW A;  4OX9 E;  3GME A;  2UUA I;  1X48 A;  5L3J A;  2UUC I;  4DR5 E;  1YSA C;  2JYA A;  2EML A;  1A1I A;  1N0U A;  1XMQ E;  4JI4 I;  2EOR A;  1UN6 B;  4YHH E;  5DRO A;  4JI7 I;  1N32 E;  4I8O A;  3ZKD A;  4PU9 A;  2BR2 A;  2E1R A;  3KWR A;  2LT7 A;  4FW7 A;  1ZM4 A;  2F1D A;  1A6F A;  1ZXM A;  3EPH A;  2EFG A;  1WHN A;  4NXN I;  2EL4 A;  2EOM A;  2V8Q B;  4DV6 E;  4FWD A;  1MGT A;  2NUF A;  2EMK A;  3J7A G;  4DPX A;  1YUJ A;  2RS6 A;  2DEJ A;  3LNU A;  2DMY A;  2O1T A;  4R1F A;  1P42 A;  4F54 A;  4JI3 I;  2IHR 1;  4USK A;  4DR3 E;  3B78 A;  3L00 A;  2UU9 I;  2Q2E B;  3THN A;  5A6K A;  3DD6 A;  2HJJ A;  4KWY A;  1J5E E;  2LJP A;  4QNJ A;  1IQO A;  1OYP A;  4DR7 E;  1Z5A A;  1B62 A;  3HXL A;  2BA0 G;  3GLL A;  3BF2 A;  2VRD A;  2CT1 A;  2YTF A;  5KL2 A;  1KKH A;  1SFE A;  1HNX I;  3M99 B;  2YWQ A;  2EQ1 A;  4L5N C;  4R2E A;  3RMP A;  2WBU A;  1H7U A;  3WU4 A;  2EP3 A;  5C0X E;  4DR2 E;  1IBL I;  2YTE A;  2V88 A;  4R8O A;  4IZJ A;  1EKZ A;  4B3T I;  2EQ3 A;  5AC4 A;  4R2C A;  3KZZ A;  4DPW A;  4WUB A;  2NN6 D;  4X8W A;  3ZOQ B;  1HR0 I;  4GKK I;  1HNZ I;  1NEI A;  4DV7 E;  1EH7 A;  1Z0V A;  2EMB A;  2HC5 A;  1NZ0 A;  3LML A;  3T1H I;  1N33 E;  2JXP A;  1I94 E;  2BA0 D;  4JI5 I;  2V89 A;  2ZM6 E;  3V5R A;  3QG5 C;  4X65 E;  3D4J A;  3P3C A;  5C0X C;  2JEA B;  2EMI A;  4M9V C;  1H7S A;  2DMI A;  1TN9 A;  2R76 A;  3EPJ A;  5LMN I;  4OO1 F;  2GLI A;  4R2D A;  3AUZ A;  1DI2 A;  1X5W A;  1Z5C A;  1DQ3 A;  4BHB A;  1STU A;  2A2C A;  1Y6Z A;  2JE6 B;  4QNK A;  5K36 C;  1YH8 A;  2EMX A;  2CVE A;  3QT6 A;  2EM4 A;  2VF1 A;  2NUE A;  1BB8 A;  1SR9 A;  2EN6 A;  4LU9 A;  1OJ4 A;  3L7Z B;  1KJK A;  3P1X A;  1KYQ A;  2LBS B;  4O24 A;  4DMI A;  2DB2 A;  2EJ4 A;  4WFT A;  2EPL X;  2EWL A;  4LCF A;  4WUC A;  2PO1 B;  2LVH A;  3MHS C;  2WNR B;  1PJQ A;  4KQV A;  4IS1 C;  5A2Q Q;  2EMG A;  4DR5 I;  2EOE A;  2YU5 A;  2EM3 A;  1N34 E;  5KL4 A;  2PO1 A;  2V34 A;  2WNR A;  4P78 A;  2A2D A;  2YTG A;  2EE8 A;  2EL5 A;  4BA1 A;  3T1Y I;  2N3G A;  2EMC A;  2GS8 A;  2L8T A;  4B3S E;  2PNZ B;  1OYS A;  3ZZU A;  1N32 I;  2IER A;  3EPK A;  2L92 A;  4LFB E;  3MHH C;  4DV5 E;  4MU3 A;  4JV5 E;  4WSP A;  3PRY A;  3M7N G;  4M30 A;  5KL5 A;  4DR6 I;  3AV0 A;  2EM5 A;  3HPZ A;  1TF3 A;  1DAR A;  1ZBQ A;  4IFD C;  3K85 A;  2L33 A;  3DJW A;  4NXM E;  1EA6 A;  1Z1B A;  2EMA A;  2KON A;  4R03 A;  2EOF A;  4DV6 I;  5IT9 Q;  4JI0 E;  4AM3 A;  2RSM A;  4HY1 A;  4FWH A;  3H09 A;  4HTG A;  2MC5 A;  5ADZ A;  1T39 A;  2K4V A;  1XNQ E;  1A1K A;  4DR3 I;  3ADJ A;  4B3M E;  4AQY E;  3WU3 A;  1FJG E;  1UDQ A;  1J5E I;  2EPX A;  1NHI A;  4DR7 I;  4BC7 A;  5AAS A;  5DNL A;  4NHR A;  3PS1 A;  4IZK B;  4XTJ A;  2NPF A;  3LPS A;  3VHT B;  1N0V C;  3M7N D;  4IFD A;  5LLQ A;  4LF4 E;  2K7I A;  4LTY A;  2EPO A;  4MLV A;  1GZ6 A;  4FW3 A;  1Y4S A;  4IZK A;  4HXZ A;  2BM0 A;  2MC6 A;  3J81 C;  4JYA E;  4LF9 E;  1K47 A;  2EOO A;  4LOM A;  2WP8 B;  4WX9 A;  2F4V E;  1UEK A;  2LUQ A;  2UXC E;  4HAC A;  5JEA B;  5LL6 R;  1XNR E;  3EQ1 A;  3B82 A;  4FK5 C;  2NN6 F;  4F9C B;  2ODR D;  4KHP E;  4R2S A;  2PNL A;  1EH6 A;  1KTV A;  2EN8 A;  2V2Q A;  2EZ6 A;  2GO3 A;  4DV7 I;  4ISA A;  3ADI A;  3V2U C;  3ZZ0 A;  4DUY E;  2HK3 A;  1F2I G;  3KZY A;  3JAM Q;  4OO1 B;  1N33 I;  1I94 I;  1XMO E;  3F0N A;  2FV4 B;  2ZM6 I;  4WXD A;  4X65 I;  2YRK A;  4OO1 A;  1L4S A;  2WBT A;  1XHK A;  2J7K A;  4MU4 A;  4U3D A;  4P7D A;  5EL9 A;  4F9A B;  4YY3 I;  4UT4 A;  2V83 A;  2DIX A;  2V8P A;  2UXD I;  1YUI A;  2EPR A;  4PRX A;  2LCE A;  2VF3 A;  4R2Q A;  2EM8 A;  2Q8U A;  4R2P A;  3P76 A;  5KL3 A;  2EM7 A;  4B3R I;  2YTO A;  2PNM A;  4X64 E;  2CGE A;  1ELO A;  2DEI A;  4DV0 E;  4ZVI A;  2EN1 A;  1A1J A;  5FLX C;  3K6Q A;  4F6M A;  1Z59 A;  3PYF A;  2AJ4 A;  1BBO A;  2PRT A;  4LFC E;  1R6M A;  1RMD A;  1ZM3 A;  2EPZ A;  3BGH A;  4RH8 A;  4GKJ E;  1N34 I;  1IBM E;  4BC9 A;  3PS3 A;  4DUZ E;  3F6G A;  3Q6N A;  2UXB E;  2YTP A;  3QT5 A;  4NBQ A;  4IZJ D;  1IBK I;  4LF8 I;  2JOX A;  1JK2 A;  1QU6 A;  4MLQ A;  1FWK A;  2L3J A;  2HFU A;  2PO0 B;  4WUD A;  4DV5 I;  4LFB I;  4JI6 E;  5KL6 A;  2L2M A;  3C4T A;  1UDO A;  4X62 E;  5FWK A;  4JV5 I;  2B9D A;  1H74 A;  2LRS A;  1P47 A;  4DV2 E;  2JR1 A;  1ZU1 A;  4GEQ B;  4J8Z A;  1Z5B A;  3HUL A;  4LF6 E;  5JEA F;  4DV3 I;  2EM9 A;  2V2Z A;  4JI0 I;  4BA2 B;  4HEI A;  1XXE A;  5K36 E;  4LCH A;  2LO3 A;  2EOZ A;  3M85 G;  3U1Y A;  2E1M A;  1XNQ I;  3UHM A;  4BA2 A;  3H1C A;  1FKA E;  5IWA E;  4JI2 E;  4B3M I;  4AQY I;  2LTR A;  1GTK A;  2JOB A;  4URL A;  2ENH A;  2YRM A;  2L3C A;  2YZT A;  1IMU A;  2JEA A;  1WJP A;  4AIM A;  1RQ0 A;  3C6M A;  1DGC A;  2GHF A;  3B4T A;  2O1W A;  2IES A;  4N4R B;  1AH5 A;  2MDG A;  4DU8 A;  2UUA E;  2VQF I;  2JPA A;  1PKP A;  2UUC E;  1HNW E;  1J26 A;  4FN5 A;  2RPC A;  1TF6 A;  1PVG A;  2JE6 A;  2O3Z A;  5C0X D;  1H72 C;  2NN6 B;  2ELY A;  2CG9 A;  2B7T A;  2EOQ A;  3J80 C;  2F4V I;  4M1K A;  1E3H A;  2EN4 A;  1RR9 A;  2E5L E;  4JI7 E;  2Z5E A;  1Z0C A;  1UBD C;  2NN6 A;  3THO B;  1S4E A;  2EMY A;  3B8H A;  5BR8 E;  3M85 D;  5K36 D;  2I9I A;  2R3V A;  4OX9 I;  4KHP I;  1X3C A;  2JEB B;  1ZAA C;  3ZM7 A;  3OTO E;  4IFD E;  2F8B A;  1MEY C;  4MQY A;  4OKG A;  3CDJ A;  1Y60 A;  1A1F A;  2FTX B;  4F6N A;  3GON A;  2RQL A;  1XMQ I;  4DUY I;  4YHH I;  2IOQ A;  2M4I A;  2R1F A;  4O4K A;  3F6H A;  1XMO I;  3HTX A;  4J3D A;  4TUI A;  4FW4 A;  4L8N A;  1ZBT A;  4MU1 A;  2PNZ A;  4AID A;  2C39 B;  4IS9 A;  4Z7Y A;  4BS9 A;  2YTN A;  4DV4 E;  4DPY A;  4BCA A; 
#chains in the Genus database with same CATH homology
 3MSW A;  2O1V A;  2B7V A;  5LMU E;  2BV3 A;  3ZZT A;  4RPF A;  1O0W A;  3M6A A;  3K17 A;  3HQ1 A;  1FWL A;  1QZR A;  3ADG A;  4X64 I;  2XEX A;  4DR1 E;  4DV0 I;  3H4L A;  2M7Q A;  1X49 A;  3CWV A;  3VYY A;  1NHH A;  1Y4U A;  4LFC I;  4GKJ I;  1IBL E;  1IBM I;  2YT4 A;  2VE7 C;  4DUZ I;  2Z5B B;  4UTG A;  4LF5 E;  3LLH A;  1B63 A;  5F3W A;  2BM1 A;  2Z5B A;  4X62 I;  3ADL A;  3T1H E;  4DR2 I;  4I3H A;  1S16 A;  3QT8 A;  4WYQ B;  3FIG A;  2B3T B;  4P52 A;  4LF7 E;  4LFA E;  1RC7 A;  2HFS A;  1YYW A;  1ZXN A;  2GQ0 A;  1UIL A;  4X66 E;  2VQE E;  2V2V A;  5IWA I;  2HHH E;  2X36 A;  4DV1 E;  2UUB E;  2WZO A;  3JU0 A;  4JI1 E;  1Z0G A;  4DR4 E;  3IWC A;  4KZS A;  1HNW I;  4FW9 A;  3OML A;  2N3H A;  3HPS A;  3JTZ A;  1ZM9 A;  2JY9 A;  2LMZ A;  5AE1 A;  3T1Y E;  4JI8 E;  2OI2 A;  3Q6M A;  1H73 A;  2E5L I;  2RTX A;  4DXL A;  4ED4 A;  5BR8 I;  1YYK A;  2V86 A;  2HKE A;  5AE2 A;  2RS7 A;  1WXR A;  3OTO I;  4DR6 E;  4WPY A;  4FWG A;  3C4B A;  4MYT A;  4Z7C A;  4DU7 A;  4PRV A;  2FGG A;  4B3S I;  1EI1 A;  1T4N A;  3PYG A;  2L6M A;  1WUU A;  3J81 Q;  2KHX A;  1USU A;  2MDR A;  4DV4 I;  3WU5 A;  4NXM I;  5A2Q C;  1MX0 A;  2O1U A;  4P7A A;  5LMU I;  3VK6 A;  2Z5C B;  4USM A;  2LUP B;  1X47 A;  2L2N A;  2H36 X;  2Z5C A;  3HJC A;  4DR1 I;  1N36 E;  4K0K E;  1FJG I;  4IZJ B;  2HKJ A;  4JG4 A;  3J7A M;  1Z0T A;  4TUG A;  2ZIT A;  4LF4 I;  5IT9 C;  2JWO A;  1FI4 A;  3PYE A;  2HK2 A;  4LF5 I;  3DF6 A;  4JYA I;  4LF9 I;  1HK7 A;  4JI4 E;  1YYO A;  2UXC I;  5GMD A;  1XNR I;  2KOU A;  2L2K B;  4DPU A;  5FLX Q;  3J7Y p;  4LF7 I;  4LFA I;  4MYU A;  1VIS A;  4YY3 E;  4NXN E;  2UXD E;  1MU5 A;  2V87 A;  1RRE A;  5GME A;  4X66 I;  1GQE A;  2VQE I;  4DPT A;  4DKK A;  2R42 A;  2HHH I;  2LE2 A;  4JI3 E;  1T4L B;  3IWB A;  3K1J A;  1KIJ A;  1USV A;  1Z0B A;  2IOP A;  4DV1 I;  2UUB I;  3Q1Q A;  4B3R E;  2UU9 E;  4JI1 I;  2CPN A;  4DR4 I;  4M0V A;  2G7H A;  2JVA A;  2V85 A;  3LTO A;  4F9B B;  5CFF E;  3VYX A;  5T6J A;  1KVK A;  2M1S A;  4Q28 A;  2DSY A;  3JAM C;  1FNM A;  2CZ9 A;  4N3O A;  4JI8 I;  1IBK E;  4LF8 E;  1ZM2 A;  4HYM A;  1HNX E;  2X7I A;  3IWD A;  2LJH A;  3QT7 A;  3ZKB A;  1D6T A;  4B3T E;  4EMD A;  3PYD A;  2UXB I;  4M2Z A;  1HR0 E;  4BBY A;  4GKK E;  1HNZ E;  4DV3 E;  4JI6 I;  1WHQ A;  5AE3 A;  4JI5 E;  3J80 Q;  1YZ9 A;  2WW4 A;  4DV2 I;  4BMJ A;  1NHJ A;  4OOG C;  5LMN E;  4LF6 I;  1MG7 A;  1T4O A;  2NUG A;  1Z0E A;  1UHZ A;  2NA2 A;  1U2R A;  2ZBK B;  1Z0W A;  1PIE A;  2ODR C;  3WU6 A;  2VQF E;  4JI2 I;  2LTS A;  3P06 A;  4HAC B;  1N36 I;  4K0K I;  5DNY A;  1BKN A;  4OX9 E;  2UUA I;  1X48 A;  5L3J A;  2UUC I;  4DR5 E;  1N0U A;  1XMQ E;  4JI4 I;  4YHH E;  4JI7 I;  1N32 E;  4I8O A;  3ZKD A;  4PU9 A;  2E1R A;  3KWR A;  1ZM4 A;  1A6F A;  1ZXM A;  2EFG A;  1WHN A;  4NXN I;  2V8Q B;  4DV6 E;  4FWD A;  2NUF A;  4DPX A;  3J7A G;  2RS6 A;  2DEJ A;  3LNU A;  2DMY A;  2O1T A;  4R1F A;  4JI3 I;  4F54 A;  2IHR 1;  4USK A;  4DR3 E;  3B78 A;  2UU9 I;  2Q2E B;  2LJP A;  1J5E E;  1Z5A A;  4DR7 E;  1B62 A;  3HXL A;  1KKH A;  1HNX I;  4L5N C;  3RMP A;  1H7U A;  3WU4 A;  4DR2 E;  1IBL I;  2V88 A;  4R8O A;  4IZJ A;  1EKZ A;  4B3T I;  4DPW A;  4WUB A;  4X8W A;  3ZOQ B;  1HR0 I;  4GKK I;  1HNZ I;  4DV7 E;  1Z0V A;  1NZ0 A;  3LML A;  3T1H I;  1N33 E;  1I94 E;  4JI5 I;  2V89 A;  2ZM6 E;  3V5R A;  4X65 E;  3D4J A;  1H7S A;  5LMN I;  3AUZ A;  1DI2 A;  1Z5C A;  1DQ3 A;  1STU A;  2A2C A;  1Y6Z A;  3QT6 A;  2VF1 A;  2NUE A;  1SR9 A;  4LU9 A;  1OJ4 A;  3P1X A;  2LBS B;  4DMI A;  2DB2 A;  4WFT A;  2EWL A;  4WUC A;  4KQV A;  5A2Q Q;  4DR5 I;  1N34 E;  2V34 A;  4P78 A;  2A2D A;  3T1Y I;  2N3G A;  2GS8 A;  2L8T A;  4B3S E;  3ZZU A;  1N32 I;  2L92 A;  4LFB E;  4DV5 E;  4JV5 E;  4WSP A;  3PRY A;  4M30 A;  4DR6 I;  3AV0 A;  3HPZ A;  1DAR A;  1ZBQ A;  3K85 A;  2L33 A;  3DJW A;  4NXM E;  1EA6 A;  2KON A;  4R03 A;  4DV6 I;  5IT9 Q;  4JI0 E;  2RSM A;  4HY1 A;  4FWH A;  3H09 A;  2MC5 A;  5ADZ A;  1XNQ E;  2K4V A;  4DR3 I;  3ADJ A;  4B3M E;  4AQY E;  3WU3 A;  1FJG E;  1J5E I;  1NHI A;  4DR7 I;  4BC7 A;  5AAS A;  4IZK B;  4XTJ A;  2NPF A;  3LPS A;  1N0V C;  4LF4 E;  4LTY A;  1GZ6 A;  4IZK A;  1Y4S A;  4HXZ A;  2BM0 A;  2MC6 A;  3J81 C;  4JYA E;  4LF9 E;  1K47 A;  2F4V E;  1UEK A;  2UXC E;  2LUQ A;  4HAC A;  5LL6 R;  1XNR E;  3B82 A;  4F9C B;  2ODR D;  4KHP E;  2PNL A;  1KTV A;  2V2Q A;  2EZ6 A;  4DV7 I;  3ADI A;  3V2U C;  3ZZ0 A;  4DUY E;  2HK3 A;  3JAM Q;  1N33 I;  1I94 I;  1XMO E;  3F0N A;  2FV4 B;  2ZM6 I;  4X65 I;  1XHK A;  2J7K A;  4P7D A;  4F9A B;  4YY3 I;  4UT4 A;  2V83 A;  2DIX A;  2V8P A;  2UXD I;  4PRX A;  2VF3 A;  4B3R I;  2PNM A;  4X64 E;  2CGE A;  1ELO A;  2DEI A;  4DV0 E;  4ZVI A;  5FLX C;  3K6Q A;  1Z59 A;  3PYF A;  2AJ4 A;  4LFC E;  1ZM3 A;  1N34 I;  4GKJ E;  1IBM E;  4BC9 A;  4DUZ E;  3F6G A;  3Q6N A;  2UXB E;  3QT5 A;  1IBK I;  4LF8 I;  4IZJ D;  2JOX A;  1QU6 A;  1FWK A;  2L3J A;  2HFU A;  4WUD A;  4DV5 I;  4LFB I;  4JI6 E;  2L2M A;  3C4T A;  5FWK A;  4X62 E;  4JV5 I;  2B9D A;  1H74 A;  2LRS A;  4DV2 E;  2JR1 A;  4GEQ B;  4J8Z A;  1Z5B A;  3HUL A;  4LF6 E;  4DV3 I;  2V2Z A;  4JI0 I;  2E1M A;  1XNQ I;  1FKA E;  5IWA E;  4JI2 E;  4B3M I;  4AQY I;  2LTR A;  2JOB A;  4URL A;  2L3C A;  2YZT A;  1RQ0 A;  2O1W A;  4DU8 A;  2UUA E;  2VQF I;  1PKP A;  2UUC E;  1HNW E;  1J26 A;  4FN5 A;  1PVG A;  1H72 C;  2CG9 A;  2B7T A;  3J80 C;  2F4V I;  4M1K A;  1RR9 A;  2E5L E;  4JI7 E;  2Z5E A;  1Z0C A;  3B8H A;  1S4E A;  5BR8 E;  2R3V A;  4OX9 I;  4KHP I;  3ZM7 A;  3OTO E;  2F8B A;  2FTX B;  3GON A;  1XMQ I;  4DUY I;  4YHH I;  2IOQ A;  2M4I A;  3F6H A;  1XMO I;  3HTX A;  4TUI A;  4L8N A;  1ZBT A;  4Z7Y A;  4BS9 A;  4DV4 E;  4DPY A;  4BCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...