3OTOI

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3otoI00
2E5LI 5A2QQ 4LFBI 1RREA 3ZKDA 5LMNI 4JI0I 5LL6R 1A6FA 4GKKE 3QT7A 2NPFA 2VQEI 4LF9E 1S16A 2ZITA 2OI2A 1XMQI 2DEIA 4DPXA 4X65E 4JI6E 1MG7A 2A2CA 3OTOI 4DR5E 4B3TI 4JI4E 2X36A 1IBME 1EI1A 3H4LA 3LTOA 4JI8E 1Z0BA 4UTGA 3WU3A 4JI7E 1DARA 2HFUA 2BM1A 4DV6I 4DR2E 1MU5A 4HACA 1Z0WA 2R3VA 2HHHI 3F0NA 1XMOE 4LF8E 1I94E 1B62A 1ZM4A 3WU4A 4HY1A 2UXBI 2UUCI 2E1RA 4DR5I 3ZM7A 1Z5BA 2UUBI 4DV1I 4X62I 3V2UC 3PYDA 4DV4I 3T1HI 1HNZE 2LJPA 4DV3E 1Z0GA 4FWDA 2UUAE 2HK2A 1PVGA 4DUYI 3D4JA 3CWVA 1FJGE 4GKJE 3PYGA 4B3RE 4JI0E 1H72C 1H74A 4JI2I 2HKJA 2V34A 4LF4E 4R1FA 4HYMA 1HNXE 3LPSA 2XEXA 4YY3E 1HR0I 4GKJI 4DUZE 3QT5A 4B3RI 5IWAE 4JI3E 4DPYA 1D6TA 1HNZI 4JI4I 4DV3I 1ZXNA 4JI6I 2UXDE 1QZRA 4YHHE 4UT4A 4X62E 1PKPA 3ZKBA 4KHPE 4DV4E 3WU5A 3J7AG 5LMNE 1XNRE 4DR3E 4DR7I 1J5EI 3Q1QA 4HXZA 3T1YE 4JI1E 3WU6A 2UXCE 4JV5E 1NZ0A 1Z0TA 4AQYI 4URLA 3K17A 4MYTA 1N36I 1U2RA 1XMOI 4AQYE 1ZM3A 4DV7E 4WUBA 2UU9I 1KVKA 1EA6A 4JI8I 4B3MI 4USMA 3HULA 4JI5E 3OTOE 4B3TE 1IBLE 4FWHA 1FJGI 1Z59A 4X65I 4RPFA 4M1KA 2UUAI 4Z7CA 4Z7YA 3ZZTA 4ED4A 2UXDI 4DR6I 4JG4A 4LF6E 5LMUI 2VQFI 2AJ4A 2A2DA 5IWAI 4JI3I 2UXBE 4DPUA 1BKNA 4B3SI 3JAMQ 4X66E 4NXNE 1FWLA 4DV7I 3PYFA 2HHHE 2J7KA 4DPWA 1N36E 4DV5E 4I3HA 2CZ9A 4JI7I 1H73A 4DV1E 3ZZ0A 4FW9A 4DR3I 3QT8A 1FI4A 2UUCE 5LMUE 1N32E 2HK3A 4WUDA 3J80C 3V5RA 1S4EA 2VQEE 4X64I 4DPTA 4DV5I 5A2QC 5GMEA 1ZM9A 4KHPI 4P7AA 4DR4E 1Z5AA 4FWGA 5IT9C 4B3ME 2BV3A 1HNXI 4LFBE 4JI2E 1KIJA 1FKAE 5BR8E 1PIEA 2E5LE 4OX9E 1NHIA 4B3SE 1Z0VA 1HR0E 4JYAE 2R42A 3B8HA 4HACB 2F4VI 1NHJA 1ZM2A 1IBMI 4DR6E 2GS8A 5L3JA 1MX0A 2UUBE 1XMQE 1K47A 4DR7E 4MYUA 4PRXA 1N0UA 5FLXQ 2V2QA 4FN5A 4JI5I 4DXLA 1ELOA 2X7IA 4LF5E 2HKEA 4EMDA 1FNMA 4LFCE 4YHHI 4ZVIA 1I94I 4LF7I 4WUCA 2VF3A 3J81Q 4LF8I 4P52A 4DV6E 4DR2I 1H7UA 1J5EE 4LF4I 3J7AM 1WUUA 4LFAI 5IT9Q 4X66I 4LF5I 2BM0A 1XHKA 1KKHA 4NXMI 1XNRI 1H7SA 4LF6I 2WW4A 2Q2EB 1ZXMA 1Z0EA 3J80Q 4DU7A 4DV2I 1IBKI 4XTJA 3LNUA 2ZM6E 4DR1E 4GKKI 1IBLI 1KTVA 4LF9I 4OX9I 1N33E 1Z0CA 2EFGA 3M6AA 3J81C 1FWKA 2DEJA 4LFAE 4PU9A 4K0KE 1N33I 4DUZI 1RR9A 1N34E 1VISA 4K0KI 1B63A 5BR8I 2UU9E 1Z5CA 4DUYE 3B82A 3PYEA 3B78A 3QT6A 4X64E 4DR4I 2VQFE 1XNQI 4USKA 4PRVA 4DV0E 2ZM6I 3JAMC 3K1JA 4DR1I 4KQVA 1HNWE 3T1HE 4JV5I 4JI1I 2V2ZA 3GONA 4LFCI 5FLXC 4DV2E 1IBKE 5GMDA 1UEKA 1N0VC 4NXME 2V8PA 2V2VA 1N32I 2HFSA 1NHHA 4DU8A 1OJ4A 4DV0I 4NXNI 1HNWI 4LF7E 4JYAI 2F4VE 1N34I 2ZBKB 1XNQE 2UXCI 3T1YI 4YY3I 3ZZUA
chains in the Genus database with same CATH superfamily
2E5LI 5A2QQ 4LFBI 1RREA 4BA1B 2GO4A 3ZKDA 1Y5YA 5LMNI 4JI0I 5LL6R 2C37B 1A6FA 2JE6A 2PO0B 4GKKE 3QT7A 2NPFA 2VQEI 4LF9E 1S16A 3GMEA 2ZITA 2IOQA 2OI2A 3GCMA 1XMQI 5C0XC 2DEIA 4DPXA 4X65E 4JI6E 1MG7A 2A2CA 3OTOI 4DR5E 4B3TI 4JI4E 4OO1E 2X36A 3CDJA 1IBME 1EI1A 3H4LA 3LTOA 4AM3A 4JI8E 1Z0BA 2O1VA 4UTGA 3WU3A 4JI7E 2HFUA 1DARA 1VI7A 2BM1A 2C38B 2Z5CB 3PS1A 1P42A 1MU5A 4HACA 4DV6I 4DR2E 1Z0WA 4N3OA 2R3VA 2HHHI 3F0NA 1XMOE 5JEAC 4LF8E 2Z5EA 1I94E 1B62A 1ZM4A 3WU4A 4HY1A 4MU4A 2UXBI 2NN6F 3PS2A 2UUCI 2E1RA 4DR5I 3ZM7A 1Z5BA 2BR2B 3NZKA 2AE8A 2NN6C 2UUBI 4FW6A 4DV1I 2JE6B 4X62I 3V2UC 3PYDA 4DV4I 3T1HI 4MDTA 1HNZE 2LJPA 1R6MA 4DV3E 4IFDB 1Z0GA 4FWDA 2UUAE 2HK2A 1PVGA 4MU0A 3D4JA 3CWVA 4QNJA 4DUYI 1FJGE 4GKJE 2PO2B 3PYGA 3Q6MA 4B3RE 1Y6ZA 2WNRB 1H72C 4JI0E 1H74A 2BA0G 5JEAD 4JI2I 2HKJA 2V34A 4LF4E 4R1FA 4HYMA 1HNXE 3LPSA 2XEXA 4YY3E 1HR0I 4GKJI 4DUZE 2PO2A 3QT5A 4B3RI 4IFDC 5IWAE 4JI3E 4LPFA 4BA2A 2C38A 3KRNA 4DPYA 3M85G 1D6TA 1HNZI 4JI4I 4DV3I 1ZXNA 4JI6I 2UXDE 1QZRA 4YHHE 4UT4A 4X62E 1PKPA 1E3PA 3ZKBA 4KHPE 2O1UA 5JEAA 4DV4E 3WU5A 2BA1G 4J3DA 3J7AG 2JEBB 3HJCA 3PRYA 5ELWA 5LMNE 4U3DA 1XNRE 5K36E 1OYSA 4FW7A 4DR3E 4IFDA 5EL9A 4DR7I 1J5EI 3Q1QA 2JEAB 4HXZA 3T1YE 4JI1E 1Y60A 3WU6A 1OYPA 2UXCE 4JV5E 1NZ0A 1Z0TA 4AQYI 4URLA 3K17A 4GQUA 1UDSA 4MYTA 1N36I 4IFDD 1U2RA 1XMOI 3P3CA 1R6LA 4AQYE 1ZM3A 4DV7E 3DD6A 4IZJB 3P3EA 2WNRA 4IZJD 4OO1B 2NN6D 2GQ0A 4WUBA 2UU9I 4ISAA 2GO3A 1KVKA 1EA6A 4JI8I 4B3MI 4USMA 3HULA 4JI5E 3OTOE 4B3TE 4IS9A 4NBQA 2PNZB 1IBLE 4FWHA 4BA2B 1FJGI 1Z59A 4X65I 4RPFA 4M1KA 2UUAI 2O1WA 4Z7CA 2CGEA 4Z7YA 3ZZTA 1UDQA 4LOMA 4LCHA 4ED4A 5C0XF 2UXDI 2O1TA 4DR6I 2IOPA 2PO1A 4JG4A 4LCGA 4LF6E 5LMUI 3U1KA 2VQFI 2AJ4A 2A2DA 5IWAI 4JI3I 2CVEA 2UXBE 4DPUA 1BKNA 4B3SI 3JAMQ 3L7ZB 2Z5BB 4X66E 2IESA 2BR2A 4NXNE 1FWLA 4DV7I 3HKMA 3M7ND 1Y4UA 1OYRA 5DRQA 3PYFA 2C39A 2HHHE 2J7KA 2PNLA 4DPWA 1N36E 4DV5E 4I3HA 2CZ9A 4JI7I 1H73A 4DV1E 3ZZ0A 4FW9A 2NN6E 4DR3I 3QT8A 3UHMA 4MU3A 1FI4A 2IERA 3U1YA 2UUCE 4BA1A 1USVA 5LMUE 3M85D 1N32E 2HK3A 4WUDA 3J80C 3V5RA 2O3ZA 1S4EA 4IZKB 2VQEE 4QNKA 4OKGA 4X64I 2NN6A 4DPTA 4DV5I 1USUA 5A2QC 5GMEA 1ZM9A 4KHPI 4P7AA 4DR4E 1Z5AA 4FWGA 5IT9C 2PO1B 4IFDE 5JEAB 1E3HA 4B3ME 2PNMA 5K36A 2BV3A 1HNXI 5C0XA 2JEBA 4LFBE 5C0XE 4JI2E 1KIJA 3GLLA 1FKAE 5BR8E 1PIEA 2E5LE 5JEAE 4OX9E 1NHIA 4B3SE 1Z0VA 1HR0E 4JYAE 2R42A 3B8HA 4HACB 1Y4SA 2F4VI 3P3GA 1NHJA 1ZM2A 1IBMI 4DR6E 2GS8A 2C37A 2WP8B 5L3JA 1MX0A 2UUBE 1XMQE 1K47A 4FW4A 4DR7E 2Z5BA 2VESA 4PRXA 4MYUA 5K36F 1N0UA 5FLXQ 4AIMA 2V2QA 4IZKA 4FN5A 5EKWA 4JI5I 4DXLA 2C39B 1ELOA 2X7IA 4LF5E 2HKEA 4EMDA 1FNMA 4FW3A 5DRPA 4LFCE 4YHHI 4LCFA 2Z5CA 4ZVIA 1I94I 4LF7I 2JT2A 3PS3A 2BA1D 4WUCA 2VF3A 4U3BA 3J81Q 4LF8I 4P52A 4DV6E 4DR2I 2BA0D 4MQYA 4MU1A 1H7UA 1J5EE 4LF4I 3J7AM 1WUUA 4LFAI 2CG9A 4X66I 4LF5I 5IT9Q 1UDOA 2BM0A 1XHKA 1KKHA 4NXMI 1XNRI 1H7SA 3CDIA 4LF6I 2WW4A 2Q2EB 1ZXMA 1Z0EA 3J80Q 4DU7A 4DV2I 1IBKI 5K36C 4XTJA 1RHYA 3LNUA 1HK7A 1YHCA 3L7ZA 4OO1C 2ZM6E 4DR1E 4GKKI 5DNXA 1IBLI 1KTVA 4LF9I 4OX9I 1N33E 1Z0CA 4IZJA 2EFGA 3M6AA 2WP8A 3J81C 1FWKA 2DEJA 4OO1A 4LFAE 4PU9A 4K0KE 4AIDA 1N33I 4DUZI 1YH8A 1RR9A 5C0XD 1N34E 1VISA 4K0KI 2F1DA 1B63A 5BR8I 2UU9E 1XXEA 2JEAA 3M7NG 1Z5CA 4DUYE 3K85A 3B82A 3PYEA 3B78A 3QT6A 4X64E 4DR4I 2VQFE 1XNQI 4USKA 4PRVA 4DV0E 3H1CA 4OO1F 2ZM6I 3JAMC 3K1JA 4DR1I 4KQVA 5DRRA 1HNWE 3T1HE 4OZEA 4JV5I 4JI1I 2V2ZA 3GONA 4LFCI 5FLXC 4DV2E 1IBKE 5GMDA 5K36B 1UEKA 2PO0A 5K36D 5C0XB 2NN6B 1N0VC 4FW5A 4NXME 4OO1D 2V8PA 2V2VA 1N32I 2HFSA 1NHHA 2PNZA 4DU8A 3B4TA 5DROA 1OJ4A 1UDNA 3P76A 4IFDF 4DV0I 4NXNI 1HNWI 3Q6NA 4LF7E 4JYAI 3P06A 5DNLA 2F4VE 1N34I 2ZBKB 1XNQE 2J65A 2UXCI 5JEAF 3T1YI 4YY3I 3ZZUA 5FWKA
chains in the Genus database with same CATH topology
2E5LI 5A2QQ 4LFBI 1RREA 3ZKDA 5LMNI 4JI0I 5LL6R 1A6FA 4GKKE 3QT7A 2NPFA 2VQEI 4LF9E 1S16A 2ZITA 2IOQA 2OI2A 1XMQI 2DEIA 4DPXA 4X65E 4JI6E 1MG7A 2A2CA 3OTOI 4DR5E 4B3TI 4JI4E 2X36A 1IBME 1EI1A 3H4LA 3LTOA 4JI8E 1Z0BA 2O1VA 4UTGA 3WU3A 4JI7E 1DARA 2HFUA 2Z5CB 2BM1A 4DV6I 4DR2E 1MU5A 4HACA 1Z0WA 4N3OA 2R3VA 2HHHI 3F0NA 1XMOE 4LF8E 2Z5EA 1I94E 1B62A 1ZM4A 3WU4A 4HY1A 2UXBI 2UUCI 2E1RA 4DR5I 3ZM7A 1Z5BA 2UUBI 4DV1I 4X62I 3V2UC 3PYDA 4DV4I 3T1HI 1HNZE 2LJPA 4DV3E 1Z0GA 4FWDA 2UUAE 2HK2A 1PVGA 4DUYI 3D4JA 3CWVA 1FJGE 4GKJE 3PYGA 3Q6MA 4B3RE 1Y6ZA 4JI0E 1H72C 1H74A 4JI2I 2HKJA 2V34A 4LF4E 4R1FA 4HYMA 1HNXE 3LPSA 2XEXA 4YY3E 1HR0I 4GKJI 4DUZE 3QT5A 4B3RI 5IWAE 4JI3E 4DPYA 1D6TA 1HNZI 4JI4I 4DV3I 1ZXNA 4JI6I 2UXDE 1QZRA 4YHHE 4UT4A 4X62E 1PKPA 3ZKBA 4KHPE 2O1UA 4DV4E 3WU5A 3J7AG 3HJCA 3PRYA 5LMNE 1XNRE 4DR3E 4DR7I 1J5EI 3Q1QA 4HXZA 3T1YE 4JI1E 3WU6A 2UXCE 4JV5E 1NZ0A 1Z0TA 4AQYI 4URLA 3K17A 4MYTA 1N36I 1U2RA 1XMOI 4AQYE 1ZM3A 4DV7E 4IZJB 4IZJD 2GQ0A 4WUBA 2UU9I 1KVKA 1EA6A 4JI8I 4B3MI 4USMA 3HULA 4JI5E 3OTOE 4B3TE 1IBLE 4FWHA 1FJGI 1Z59A 4X65I 4RPFA 4M1KA 2UUAI 2O1WA 4Z7CA 2CGEA 4Z7YA 3ZZTA 4ED4A 2UXDI 2O1TA 4DR6I 2IOPA 4JG4A 4LF6E 5LMUI 2VQFI 2AJ4A 2A2DA 5IWAI 4JI3I 2UXBE 4DPUA 1BKNA 4B3SI 3JAMQ 2Z5BB 4X66E 4NXNE 1FWLA 4DV7I 1Y4UA 3PYFA 2HHHE 2J7KA 2PNLA 4DPWA 1N36E 4DV5E 4I3HA 2CZ9A 4JI7I 1H73A 4DV1E 3ZZ0A 4FW9A 4DR3I 3QT8A 1FI4A 2UUCE 1USVA 5LMUE 1N32E 2HK3A 4WUDA 3J80C 3V5RA 1S4EA 4IZKB 2VQEE 4X64I 4DPTA 4DV5I 1USUA 5A2QC 5GMEA 1ZM9A 4KHPI 4P7AA 4DR4E 1Z5AA 4FWGA 5IT9C 4B3ME 2PNMA 2BV3A 1HNXI 4LFBE 4JI2E 1KIJA 1FKAE 5BR8E 1PIEA 2E5LE 4OX9E 1NHIA 4B3SE 1Z0VA 1HR0E 4JYAE 2R42A 3B8HA 4HACB 1Y4SA 2F4VI 1NHJA 1ZM2A 1IBMI 4DR6E 2GS8A 5L3JA 1MX0A 2UUBE 1XMQE 1K47A 4DR7E 2Z5BA 4MYUA 4PRXA 1N0UA 5FLXQ 2V2QA 4IZKA 4FN5A 4JI5I 4DXLA 1ELOA 2X7IA 4LF5E 2HKEA 4EMDA 1FNMA 4LFCE 4YHHI 2Z5CA 4ZVIA 1I94I 4LF7I 4WUCA 2VF3A 3J81Q 4LF8I 4P52A 4DV6E 4DR2I 1H7UA 1J5EE 4LF4I 3J7AM 1WUUA 4LFAI 2CG9A 4X66I 4LF5I 5IT9Q 2BM0A 1XHKA 1KKHA 4NXMI 1XNRI 1H7SA 4LF6I 2WW4A 2Q2EB 1ZXMA 1Z0EA 3J80Q 4DU7A 4DV2I 1IBKI 4XTJA 3LNUA 1HK7A 2ZM6E 4DR1E 4GKKI 1IBLI 1KTVA 4LF9I 4OX9I 1N33E 1Z0CA 4IZJA 2EFGA 3M6AA 3J81C 1FWKA 2DEJA 4LFAE 4PU9A 4K0KE 1N33I 4DUZI 1RR9A 1N34E 1VISA 4K0KI 1B63A 5BR8I 2UU9E 1Z5CA 4DUYE 3K85A 3B82A 3PYEA 3B78A 3QT6A 4X64E 4DR4I 2VQFE 1XNQI 4USKA 4PRVA 4DV0E 2ZM6I 3JAMC 3K1JA 4DR1I 4KQVA 1HNWE 3T1HE 4JV5I 4JI1I 2V2ZA 3GONA 4LFCI 5FLXC 4DV2E 1IBKE 5GMDA 1UEKA 1N0VC 4NXME 2V8PA 2V2VA 1N32I 2HFSA 1NHHA 4DU8A 1OJ4A 4DV0I 4NXNI 1HNWI 3Q6NA 4LF7E 4JYAI 3P06A 2F4VE 1N34I 2ZBKB 1XNQE 2UXCI 3T1YI 4YY3I 3ZZUA 5FWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L I;  5A2Q Q;  4LFB I;  1RRE A;  3ZKD A;  5LMN I;  4JI0 I;  5LL6 R;  1A6F A;  4GKK E;  3QT7 A;  2NPF A;  2VQE I;  4LF9 E;  1S16 A;  2ZIT A;  2OI2 A;  1XMQ I;  2DEI A;  4DPX A;  4X65 E;  4JI6 E;  1MG7 A;  2A2C A;  3OTO I;  4DR5 E;  4B3T I;  4JI4 E;  2X36 A;  1IBM E;  1EI1 A;  3H4L A;  3LTO A;  4JI8 E;  1Z0B A;  4UTG A;  3WU3 A;  4JI7 E;  1DAR A;  2HFU A;  2BM1 A;  4DV6 I;  4DR2 E;  1MU5 A;  4HAC A;  1Z0W A;  2R3V A;  2HHH I;  3F0N A;  1XMO E;  4LF8 E;  1I94 E;  1B62 A;  1ZM4 A;  3WU4 A;  4HY1 A;  2UXB I;  2UUC I;  2E1R A;  4DR5 I;  3ZM7 A;  1Z5B A;  2UUB I;  4DV1 I;  4X62 I;  3V2U C;  3PYD A;  4DV4 I;  3T1H I;  1HNZ E;  2LJP A;  4DV3 E;  1Z0G A;  4FWD A;  2UUA E;  2HK2 A;  1PVG A;  4DUY I;  3D4J A;  3CWV A;  1FJG E;  4GKJ E;  3PYG A;  4B3R E;  4JI0 E;  1H72 C;  1H74 A;  4JI2 I;  2HKJ A;  2V34 A;  4LF4 E;  4R1F A;  4HYM A;  1HNX E;  3LPS A;  2XEX A;  4YY3 E;  1HR0 I;  4GKJ I;  4DUZ E;  3QT5 A;  4B3R I;  5IWA E;  4JI3 E;  4DPY A;  1D6T A;  1HNZ I;  4JI4 I;  4DV3 I;  1ZXN A;  4JI6 I;  2UXD E;  1QZR A;  4YHH E;  4UT4 A;  4X62 E;  1PKP A;  3ZKB A;  4KHP E;  4DV4 E;  3WU5 A;  3J7A G;  5LMN E;  1XNR E;  4DR3 E;  4DR7 I;  1J5E I;  3Q1Q A;  4HXZ A;  3T1Y E;  4JI1 E;  3WU6 A;  2UXC E;  4JV5 E;  1NZ0 A;  1Z0T A;  4AQY I;  4URL A;  3K17 A;  4MYT A;  1N36 I;  1U2R A;  1XMO I;  4AQY E;  1ZM3 A;  4DV7 E;  4WUB A;  2UU9 I;  1KVK A;  1EA6 A;  4JI8 I;  4B3M I;  4USM A;  3HUL A;  4JI5 E;  3OTO E;  4B3T E;  1IBL E;  4FWH A;  1FJG I;  1Z59 A;  4X65 I;  4RPF A;  4M1K A;  2UUA I;  4Z7C A;  4Z7Y A;  3ZZT A;  4ED4 A;  2UXD I;  4DR6 I;  4JG4 A;  4LF6 E;  5LMU I;  2VQF I;  2AJ4 A;  2A2D A;  5IWA I;  4JI3 I;  2UXB E;  4DPU A;  1BKN A;  4B3S I;  3JAM Q;  4X66 E;  4NXN E;  1FWL A;  4DV7 I;  3PYF A;  2HHH E;  2J7K A;  4DPW A;  1N36 E;  4DV5 E;  4I3H A;  2CZ9 A;  4JI7 I;  1H73 A;  4DV1 E;  3ZZ0 A;  4FW9 A;  4DR3 I;  3QT8 A;  1FI4 A;  2UUC E;  5LMU E;  1N32 E;  2HK3 A;  4WUD A;  3J80 C;  3V5R A;  1S4E A;  2VQE E;  4X64 I;  4DPT A;  4DV5 I;  5A2Q C;  5GME A;  1ZM9 A;  4KHP I;  4P7A A;  4DR4 E;  1Z5A A;  4FWG A;  5IT9 C;  4B3M E;  2BV3 A;  1HNX I;  4LFB E;  4JI2 E;  1KIJ A;  1FKA E;  5BR8 E;  1PIE A;  2E5L E;  4OX9 E;  1NHI A;  4B3S E;  1Z0V A;  1HR0 E;  4JYA E;  2R42 A;  3B8H A;  4HAC B;  2F4V I;  1NHJ A;  1ZM2 A;  1IBM I;  4DR6 E;  2GS8 A;  5L3J A;  1MX0 A;  2UUB E;  1XMQ E;  1K47 A;  4DR7 E;  4MYU A;  4PRX A;  1N0U A;  5FLX Q;  2V2Q A;  4FN5 A;  4JI5 I;  4DXL A;  1ELO A;  2X7I A;  4LF5 E;  2HKE A;  4EMD A;  1FNM A;  4LFC E;  4YHH I;  4ZVI A;  1I94 I;  4LF7 I;  4WUC A;  2VF3 A;  3J81 Q;  4LF8 I;  4P52 A;  4DV6 E;  4DR2 I;  1H7U A;  1J5E E;  4LF4 I;  3J7A M;  1WUU A;  4LFA I;  5IT9 Q;  4X66 I;  4LF5 I;  2BM0 A;  1XHK A;  1KKH A;  4NXM I;  1XNR I;  1H7S A;  4LF6 I;  2WW4 A;  2Q2E B;  1ZXM A;  1Z0E A;  3J80 Q;  4DU7 A;  4DV2 I;  1IBK I;  4XTJ A;  3LNU A;  2ZM6 E;  4DR1 E;  4GKK I;  1IBL I;  1KTV A;  4LF9 I;  4OX9 I;  1N33 E;  1Z0C A;  2EFG A;  3M6A A;  3J81 C;  1FWK A;  2DEJ A;  4LFA E;  4PU9 A;  4K0K E;  1N33 I;  4DUZ I;  1RR9 A;  1N34 E;  1VIS A;  4K0K I;  1B63 A;  5BR8 I;  2UU9 E;  1Z5C A;  4DUY E;  3B82 A;  3PYE A;  3B78 A;  3QT6 A;  4X64 E;  4DR4 I;  2VQF E;  1XNQ I;  4USK A;  4PRV A;  4DV0 E;  2ZM6 I;  3JAM C;  3K1J A;  4DR1 I;  4KQV A;  1HNW E;  3T1H E;  4JV5 I;  4JI1 I;  2V2Z A;  3GON A;  4LFC I;  5FLX C;  4DV2 E;  1IBK E;  5GMD A;  1UEK A;  1N0V C;  4NXM E;  2V8P A;  2V2V A;  1N32 I;  2HFS A;  1NHH A;  4DU8 A;  1OJ4 A;  4DV0 I;  4NXN I;  1HNW I;  4LF7 E;  4JYA I;  2F4V E;  1N34 I;  2ZBK B;  1XNQ E;  2UXC I;  3T1Y I;  4YY3 I;  3ZZU A; 
#chains in the Genus database with same CATH topology
 2E5L I;  5A2Q Q;  4LFB I;  1RRE A;  4BA1 B;  2GO4 A;  3ZKD A;  1Y5Y A;  5LMN I;  4JI0 I;  5LL6 R;  2C37 B;  1A6F A;  2JE6 A;  2PO0 B;  4GKK E;  3QT7 A;  2NPF A;  2VQE I;  4LF9 E;  1S16 A;  3GME A;  2ZIT A;  2IOQ A;  2OI2 A;  3GCM A;  1XMQ I;  5C0X C;  2DEI A;  4DPX A;  4X65 E;  4JI6 E;  1MG7 A;  2A2C A;  3OTO I;  4DR5 E;  4B3T I;  4JI4 E;  4OO1 E;  2X36 A;  3CDJ A;  1IBM E;  1EI1 A;  3H4L A;  3LTO A;  4AM3 A;  4JI8 E;  1Z0B A;  2O1V A;  4UTG A;  3WU3 A;  4JI7 E;  2HFU A;  1DAR A;  1VI7 A;  2BM1 A;  2C38 B;  2Z5C B;  3PS1 A;  1P42 A;  1MU5 A;  4HAC A;  4DV6 I;  4DR2 E;  1Z0W A;  4N3O A;  2R3V A;  2HHH I;  3F0N A;  1XMO E;  5JEA C;  4LF8 E;  2Z5E A;  1I94 E;  1B62 A;  1ZM4 A;  3WU4 A;  4HY1 A;  4MU4 A;  2UXB I;  2NN6 F;  3PS2 A;  2UUC I;  2E1R A;  4DR5 I;  3ZM7 A;  1Z5B A;  2BR2 B;  3NZK A;  2AE8 A;  2NN6 C;  2UUB I;  4FW6 A;  4DV1 I;  2JE6 B;  4X62 I;  3V2U C;  3PYD A;  4DV4 I;  3T1H I;  4MDT A;  1HNZ E;  2LJP A;  1R6M A;  4DV3 E;  4IFD B;  1Z0G A;  4FWD A;  2UUA E;  2HK2 A;  1PVG A;  4MU0 A;  3D4J A;  3CWV A;  4QNJ A;  4DUY I;  1FJG E;  4GKJ E;  2PO2 B;  3PYG A;  3Q6M A;  4B3R E;  1Y6Z A;  2WNR B;  1H72 C;  4JI0 E;  1H74 A;  2BA0 G;  5JEA D;  4JI2 I;  2HKJ A;  2V34 A;  4LF4 E;  4R1F A;  4HYM A;  1HNX E;  3LPS A;  2XEX A;  4YY3 E;  1HR0 I;  4GKJ I;  4DUZ E;  2PO2 A;  3QT5 A;  4B3R I;  4IFD C;  5IWA E;  4JI3 E;  4LPF A;  4BA2 A;  2C38 A;  3KRN A;  4DPY A;  3M85 G;  1D6T A;  1HNZ I;  4JI4 I;  4DV3 I;  1ZXN A;  4JI6 I;  2UXD E;  1QZR A;  4YHH E;  4UT4 A;  4X62 E;  1PKP A;  1E3P A;  3ZKB A;  4KHP E;  2O1U A;  5JEA A;  4DV4 E;  3WU5 A;  2BA1 G;  4J3D A;  3J7A G;  2JEB B;  3HJC A;  3PRY A;  5ELW A;  5LMN E;  4U3D A;  1XNR E;  5K36 E;  1OYS A;  4FW7 A;  4DR3 E;  4IFD A;  5EL9 A;  4DR7 I;  1J5E I;  3Q1Q A;  2JEA B;  4HXZ A;  3T1Y E;  4JI1 E;  1Y60 A;  3WU6 A;  1OYP A;  2UXC E;  4JV5 E;  1NZ0 A;  1Z0T A;  4AQY I;  4URL A;  3K17 A;  4GQU A;  1UDS A;  4MYT A;  1N36 I;  4IFD D;  1U2R A;  1XMO I;  3P3C A;  1R6L A;  4AQY E;  1ZM3 A;  4DV7 E;  3DD6 A;  4IZJ B;  3P3E A;  2WNR A;  4IZJ D;  4OO1 B;  2NN6 D;  2GQ0 A;  4WUB A;  2UU9 I;  4ISA A;  2GO3 A;  1KVK A;  1EA6 A;  4JI8 I;  4B3M I;  4USM A;  3HUL A;  4JI5 E;  3OTO E;  4B3T E;  4IS9 A;  4NBQ A;  2PNZ B;  1IBL E;  4FWH A;  4BA2 B;  1FJG I;  1Z59 A;  4X65 I;  4RPF A;  4M1K A;  2UUA I;  2O1W A;  4Z7C A;  2CGE A;  4Z7Y A;  3ZZT A;  1UDQ A;  4LOM A;  4LCH A;  4ED4 A;  5C0X F;  2UXD I;  2O1T A;  4DR6 I;  2IOP A;  2PO1 A;  4JG4 A;  4LCG A;  4LF6 E;  5LMU I;  3U1K A;  2VQF I;  2AJ4 A;  2A2D A;  5IWA I;  4JI3 I;  2CVE A;  2UXB E;  4DPU A;  1BKN A;  4B3S I;  3JAM Q;  3L7Z B;  2Z5B B;  4X66 E;  2IES A;  2BR2 A;  4NXN E;  1FWL A;  4DV7 I;  3HKM A;  3M7N D;  1Y4U A;  1OYR A;  5DRQ A;  3PYF A;  2C39 A;  2HHH E;  2J7K A;  2PNL A;  4DPW A;  1N36 E;  4DV5 E;  4I3H A;  2CZ9 A;  4JI7 I;  1H73 A;  4DV1 E;  3ZZ0 A;  4FW9 A;  2NN6 E;  4DR3 I;  3QT8 A;  3UHM A;  4MU3 A;  1FI4 A;  2IER A;  3U1Y A;  2UUC E;  4BA1 A;  1USV A;  5LMU E;  3M85 D;  1N32 E;  2HK3 A;  4WUD A;  3J80 C;  3V5R A;  2O3Z A;  1S4E A;  4IZK B;  2VQE E;  4QNK A;  4OKG A;  4X64 I;  2NN6 A;  4DPT A;  4DV5 I;  1USU A;  5A2Q C;  5GME A;  1ZM9 A;  4KHP I;  4P7A A;  4DR4 E;  1Z5A A;  4FWG A;  5IT9 C;  2PO1 B;  4IFD E;  5JEA B;  1E3H A;  4B3M E;  2PNM A;  5K36 A;  2BV3 A;  1HNX I;  5C0X A;  2JEB A;  4LFB E;  5C0X E;  4JI2 E;  1KIJ A;  3GLL A;  1FKA E;  5BR8 E;  1PIE A;  2E5L E;  5JEA E;  4OX9 E;  1NHI A;  4B3S E;  1Z0V A;  1HR0 E;  4JYA E;  2R42 A;  3B8H A;  4HAC B;  1Y4S A;  2F4V I;  3P3G A;  1NHJ A;  1ZM2 A;  1IBM I;  4DR6 E;  2GS8 A;  2C37 A;  2WP8 B;  5L3J A;  1MX0 A;  2UUB E;  1XMQ E;  1K47 A;  4FW4 A;  4DR7 E;  2Z5B A;  2VES A;  4PRX A;  4MYU A;  5K36 F;  1N0U A;  5FLX Q;  4AIM A;  2V2Q A;  4IZK A;  4FN5 A;  5EKW A;  4JI5 I;  4DXL A;  2C39 B;  1ELO A;  2X7I A;  4LF5 E;  2HKE A;  4EMD A;  1FNM A;  4FW3 A;  5DRP A;  4LFC E;  4YHH I;  4LCF A;  2Z5C A;  4ZVI A;  1I94 I;  4LF7 I;  2JT2 A;  3PS3 A;  2BA1 D;  4WUC A;  2VF3 A;  4U3B A;  3J81 Q;  4LF8 I;  4P52 A;  4DV6 E;  4DR2 I;  2BA0 D;  4MQY A;  4MU1 A;  1H7U A;  1J5E E;  4LF4 I;  3J7A M;  1WUU A;  4LFA I;  2CG9 A;  4X66 I;  4LF5 I;  5IT9 Q;  1UDO A;  2BM0 A;  1XHK A;  1KKH A;  4NXM I;  1XNR I;  1H7S A;  3CDI A;  4LF6 I;  2WW4 A;  2Q2E B;  1ZXM A;  1Z0E A;  3J80 Q;  4DU7 A;  4DV2 I;  1IBK I;  5K36 C;  4XTJ A;  1RHY A;  3LNU A;  1HK7 A;  1YHC A;  3L7Z A;  4OO1 C;  2ZM6 E;  4DR1 E;  4GKK I;  5DNX A;  1IBL I;  1KTV A;  4LF9 I;  4OX9 I;  1N33 E;  1Z0C A;  4IZJ A;  2EFG A;  3M6A A;  2WP8 A;  3J81 C;  1FWK A;  2DEJ A;  4OO1 A;  4LFA E;  4PU9 A;  4K0K E;  4AID A;  1N33 I;  4DUZ I;  1YH8 A;  1RR9 A;  5C0X D;  1N34 E;  1VIS A;  4K0K I;  2F1D A;  1B63 A;  5BR8 I;  2UU9 E;  1XXE A;  2JEA A;  3M7N G;  1Z5C A;  4DUY E;  3K85 A;  3B82 A;  3PYE A;  3B78 A;  3QT6 A;  4X64 E;  4DR4 I;  2VQF E;  1XNQ I;  4USK A;  4PRV A;  4DV0 E;  3H1C A;  4OO1 F;  2ZM6 I;  3JAM C;  3K1J A;  4DR1 I;  4KQV A;  5DRR A;  1HNW E;  3T1H E;  4OZE A;  4JV5 I;  4JI1 I;  2V2Z A;  3GON A;  4LFC I;  5FLX C;  4DV2 E;  1IBK E;  5GMD A;  5K36 B;  1UEK A;  2PO0 A;  5K36 D;  5C0X B;  2NN6 B;  1N0V C;  4FW5 A;  4NXM E;  4OO1 D;  2V8P A;  2V2V A;  1N32 I;  2HFS A;  1NHH A;  2PNZ A;  4DU8 A;  3B4T A;  5DRO A;  1OJ4 A;  1UDN A;  3P76 A;  4IFD F;  4DV0 I;  4NXN I;  1HNW I;  3Q6N A;  4LF7 E;  4JYA I;  3P06 A;  5DNL A;  2F4V E;  1N34 I;  2ZBK B;  1XNQ E;  2J65 A;  2UXC I;  5JEA F;  3T1Y I;  4YY3 I;  3ZZU A;  5FWK A; 
#chains in the Genus database with same CATH homology
 2E5L I;  5A2Q Q;  4LFB I;  1RRE A;  3ZKD A;  5LMN I;  4JI0 I;  5LL6 R;  1A6F A;  4GKK E;  3QT7 A;  2NPF A;  2VQE I;  4LF9 E;  1S16 A;  2ZIT A;  2IOQ A;  2OI2 A;  1XMQ I;  2DEI A;  4DPX A;  4X65 E;  4JI6 E;  1MG7 A;  2A2C A;  3OTO I;  4DR5 E;  4B3T I;  4JI4 E;  2X36 A;  1IBM E;  1EI1 A;  3H4L A;  3LTO A;  4JI8 E;  1Z0B A;  2O1V A;  4UTG A;  3WU3 A;  4JI7 E;  1DAR A;  2HFU A;  2Z5C B;  2BM1 A;  4DV6 I;  4DR2 E;  1MU5 A;  4HAC A;  1Z0W A;  4N3O A;  2R3V A;  2HHH I;  3F0N A;  1XMO E;  4LF8 E;  2Z5E A;  1I94 E;  1B62 A;  1ZM4 A;  3WU4 A;  4HY1 A;  2UXB I;  2UUC I;  2E1R A;  4DR5 I;  3ZM7 A;  1Z5B A;  2UUB I;  4DV1 I;  4X62 I;  3V2U C;  3PYD A;  4DV4 I;  3T1H I;  1HNZ E;  2LJP A;  4DV3 E;  1Z0G A;  4FWD A;  2UUA E;  2HK2 A;  1PVG A;  4DUY I;  3D4J A;  3CWV A;  1FJG E;  4GKJ E;  3PYG A;  3Q6M A;  4B3R E;  1Y6Z A;  4JI0 E;  1H72 C;  1H74 A;  4JI2 I;  2HKJ A;  2V34 A;  4LF4 E;  4R1F A;  4HYM A;  1HNX E;  3LPS A;  2XEX A;  4YY3 E;  1HR0 I;  4GKJ I;  4DUZ E;  3QT5 A;  4B3R I;  5IWA E;  4JI3 E;  4DPY A;  1D6T A;  1HNZ I;  4JI4 I;  4DV3 I;  1ZXN A;  4JI6 I;  2UXD E;  1QZR A;  4YHH E;  4UT4 A;  4X62 E;  1PKP A;  3ZKB A;  4KHP E;  2O1U A;  4DV4 E;  3WU5 A;  3J7A G;  3HJC A;  3PRY A;  5LMN E;  1XNR E;  4DR3 E;  4DR7 I;  1J5E I;  3Q1Q A;  4HXZ A;  3T1Y E;  4JI1 E;  3WU6 A;  2UXC E;  4JV5 E;  1NZ0 A;  1Z0T A;  4AQY I;  4URL A;  3K17 A;  4MYT A;  1N36 I;  1U2R A;  1XMO I;  4AQY E;  1ZM3 A;  4DV7 E;  4IZJ B;  4IZJ D;  2GQ0 A;  4WUB A;  2UU9 I;  1KVK A;  1EA6 A;  4JI8 I;  4B3M I;  4USM A;  3HUL A;  4JI5 E;  3OTO E;  4B3T E;  1IBL E;  4FWH A;  1FJG I;  1Z59 A;  4X65 I;  4RPF A;  4M1K A;  2UUA I;  2O1W A;  4Z7C A;  2CGE A;  4Z7Y A;  3ZZT A;  4ED4 A;  2UXD I;  2O1T A;  4DR6 I;  2IOP A;  4JG4 A;  4LF6 E;  5LMU I;  2VQF I;  2AJ4 A;  2A2D A;  5IWA I;  4JI3 I;  2UXB E;  4DPU A;  1BKN A;  4B3S I;  3JAM Q;  2Z5B B;  4X66 E;  4NXN E;  1FWL A;  4DV7 I;  1Y4U A;  3PYF A;  2HHH E;  2J7K A;  2PNL A;  4DPW A;  1N36 E;  4DV5 E;  4I3H A;  2CZ9 A;  4JI7 I;  1H73 A;  4DV1 E;  3ZZ0 A;  4FW9 A;  4DR3 I;  3QT8 A;  1FI4 A;  2UUC E;  1USV A;  5LMU E;  1N32 E;  2HK3 A;  4WUD A;  3J80 C;  3V5R A;  1S4E A;  4IZK B;  2VQE E;  4X64 I;  4DPT A;  4DV5 I;  1USU A;  5A2Q C;  5GME A;  1ZM9 A;  4KHP I;  4P7A A;  4DR4 E;  1Z5A A;  4FWG A;  5IT9 C;  4B3M E;  2PNM A;  2BV3 A;  1HNX I;  4LFB E;  4JI2 E;  1KIJ A;  1FKA E;  5BR8 E;  1PIE A;  2E5L E;  4OX9 E;  1NHI A;  4B3S E;  1Z0V A;  1HR0 E;  4JYA E;  2R42 A;  3B8H A;  4HAC B;  1Y4S A;  2F4V I;  1NHJ A;  1ZM2 A;  1IBM I;  4DR6 E;  2GS8 A;  5L3J A;  1MX0 A;  2UUB E;  1XMQ E;  1K47 A;  4DR7 E;  2Z5B A;  4MYU A;  4PRX A;  1N0U A;  5FLX Q;  2V2Q A;  4IZK A;  4FN5 A;  4JI5 I;  4DXL A;  1ELO A;  2X7I A;  4LF5 E;  2HKE A;  4EMD A;  1FNM A;  4LFC E;  4YHH I;  2Z5C A;  4ZVI A;  1I94 I;  4LF7 I;  4WUC A;  2VF3 A;  3J81 Q;  4LF8 I;  4P52 A;  4DV6 E;  4DR2 I;  1H7U A;  1J5E E;  4LF4 I;  3J7A M;  1WUU A;  4LFA I;  2CG9 A;  4X66 I;  4LF5 I;  5IT9 Q;  2BM0 A;  1XHK A;  1KKH A;  4NXM I;  1XNR I;  1H7S A;  4LF6 I;  2WW4 A;  2Q2E B;  1ZXM A;  1Z0E A;  3J80 Q;  4DU7 A;  4DV2 I;  1IBK I;  4XTJ A;  3LNU A;  1HK7 A;  2ZM6 E;  4DR1 E;  4GKK I;  1IBL I;  1KTV A;  4LF9 I;  4OX9 I;  1N33 E;  1Z0C A;  4IZJ A;  2EFG A;  3M6A A;  3J81 C;  1FWK A;  2DEJ A;  4LFA E;  4PU9 A;  4K0K E;  1N33 I;  4DUZ I;  1RR9 A;  1N34 E;  1VIS A;  4K0K I;  1B63 A;  5BR8 I;  2UU9 E;  1Z5C A;  4DUY E;  3K85 A;  3B82 A;  3PYE A;  3B78 A;  3QT6 A;  4X64 E;  4DR4 I;  2VQF E;  1XNQ I;  4USK A;  4PRV A;  4DV0 E;  2ZM6 I;  3JAM C;  3K1J A;  4DR1 I;  4KQV A;  1HNW E;  3T1H E;  4JV5 I;  4JI1 I;  2V2Z A;  3GON A;  4LFC I;  5FLX C;  4DV2 E;  1IBK E;  5GMD A;  1UEK A;  1N0V C;  4NXM E;  2V8P A;  2V2V A;  1N32 I;  2HFS A;  1NHH A;  4DU8 A;  1OJ4 A;  4DV0 I;  4NXN I;  1HNW I;  3Q6N A;  4LF7 E;  4JYA I;  3P06 A;  2F4V E;  1N34 I;  2ZBK B;  1XNQ E;  2UXC I;  3T1Y I;  4YY3 I;  3ZZU A;  5FWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...