3OTOI

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
total genus 18
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3otoI00
2HHHE 4DV3I 4B3RE 2VQFI 1PVGA 5LMNE 4NXNI 1ELOA 5IT9C 1RR9A 2UUCE 1ZM4A 3B8HA 4B3MI 1BKNA 4LFAE 4X66E 1NHIA 1S16A 1VISA 4JI4E 3HULA 3WU5A 2HFUA 4LF9E 4X62E 4DR4E 1I94I 4JI8I 1XHKA 1Z0BA 1FI4A 1EI1A 3K1JA 5A2QC 2AJ4A 1FNMA 4EMDA 3ZZTA 4K0KE 4JI2I 2GS8A 2E5LI 4B3SE 4DV4I 3T1YI 4DPXA 4Z7CA 2UUBI 2HK2A 1Z0VA 4GKJI 1XMQI 4AQYE 1D6TA 4DU7A 4DR6E 2WW4A 2XEXA 1Z0GA 1WUUA 4HACA 4P7AA 3J81C 4JYAE 4FWDA 1KTVA 4DV6I 3LPSA 4KQVA 1IBKI 4DR5E 2HK3A 1XMOE 4M1KA 4LF6E 2F4VE 1HNZE 1B63A 2ZITA 1FKAE 4DU8A 4LF8I 4DPWA 4LFCI 3V2UC 1HNWE 4HY1A 5IT9Q 1XNRE 4DV2E 4DR3I 4DR7E 2V2QA 4X65E 1IBLI 1H73A 5BR8E 4JV5I 5A2QQ 3J80C 2ZM6E 1K47A 4DPYA 2R42A 2BV3A 4OX9I 2UXDI 1FWLA 1ZM2A 2OI2A 5IWAE 2HKEA 4DV1E 4DUYE 4JI3I 3JAMC 4FN5A 2UUAE 1ZXMA 3QT8A 4X64E 2VQEE 4DPUA 1IBME 4LF7E 5LMUI 2E1RA 4DV5E 1H7UA 2HHHI 1H74A 4DR2E 4GKKE 3K17A 5LMNI 1N32E 2Q2EB 3D4JA 4JI1E 3J81Q 2UUCI 4LFAI 4YHHI 4X66I 4PRXA 4JI4I 3LTOA 4LF9I 4DV7E 1Z5CA 1H7SA 4LF5E 4WUCA 4X62I 4B3ME 3ZKBA 4DR4I 4DR1E 1FJGE 4USKA 4FWHA 1N33I 4K0KI 1HNXI 4ZVIA 4B3SI 4JI8E 2X7IA 3QT5A 1HR0E 2UXBE 4LF4E 1U2RA 4KHPE 3WU6A 3PYFA 4FW9A 3PYGA 4WUDA 4JI0E 4AQYI 4DR6I 2UUBE 1ZM3A 3J80Q 2UU9E 4URLA 4ED4A 2A2DA 5FLXC 1Z5AA 1DARA 1XNQE 4JI5E 4LF6I 2F4VI 3JAMQ 1N0VC 3WU4A 1HNZI 1ZM9A 4USMA 4DV0E 2UXCE 4R1FA 4DUZE 4I3HA 1HNWI 4HACB 4DXLA 2V8PA 4DV2I 2BM0A 1N36E 2V2VA 1B62A 4DR7I 4UT4A 4YY3E 4X65I 1PIEA 4RPFA 3PYDA 1J5EE 5BR8I 4P52A 3OTOE 2DEIA 3J7AG 4HYMA 3GONA 3ZZ0A 2NPFA 3QT7A 4HXZA 4NXME 1KKHA 3T1HE 4JI7I 5IWAI 2HFSA 4JI6E 4DV1I 4DUYI 1MX0A 2VQEI 2UUAI 1IBMI 4LF7I 1Z0WA 4B3TI 2UXDE 1S4EA 4DV5I 1N34E 4B3RI 4LFBE 5L3JA 4DR2I 4GKKI 5LL6R 4JI3E 1N32I 4MYUA 4JI1I 4DV3E 5FLXQ 2VQFE 4NXNE 3CWVA 1Z0TA 1OJ4A 4Z7YA 1H72C 4DV7I 4LF5I 2BM1A 4YHHE 2V34A 4DR1I 1FJGI 3B82A 3PYEA 3V5RA 1I94E 1EA6A 1MU5A 3QT6A 1RREA 1QZRA 1HR0I 2UXBI 2EFGA 3ZKDA 4LF4I 4KHPI 4JI2E 4FWGA 1N33E 2E5LE 4DV4E 1MG7A 1HNXE 2HKJA 2J7KA 3T1YE 3M6AA 4JI0I 3Q1QA 4JYAI 1Z0EA 2UU9I 4GKJE 3B78A 1XMQE 1N0UA 5GMDA 4DR5I 2R3VA 1XMOI 1XNQI 2V2ZA 4JI5I 2LJPA 2X36A 4JG4A 1A6FA 4PRVA 3F0NA 4MYTA 4DV6E 2VF3A 1NZ0A 4PU9A 3ZZUA 1IBKE 4DV0I 1PKPA 2UXCI 1UEKA 4DUZI 1NHJA 1XNRI 2ZBKB 1N36I 4LF8E 3J7AM 4LFCE 4YY3I 3LNUA 4UTGA 3WU3A 4DR3E 4DPTA 1J5EI 1NHHA 2CZ9A 1KVKA 2ZM6I 3OTOI 2DEJA 1IBLE 1Z59A 4WUBA 4NXMI 3T1HI 4JV5E 4X64I 4JI6I 5GMEA 3ZM7A 4OX9E 2A2CA 1FWKA 1ZXNA 1KIJA 1N34I 4JI7E 4LFBI 1Z0CA 3H4LA 5LMUE 1Z5BA 4B3TE 4XTJA
chains in the Genus database with same CATH superfamily
2HHHE 2PNZA 4DV3I 4MU0A 3M85D 4B3RE 2VQFI 1PVGA 5LMNE 1Y60A 4NXNI 4BA1A 1ELOA 3U1KA 5IT9C 1RR9A 2UUCE 1ZM4A 3B8HA 4B3MI 1BKNA 4LFAE 2BA0G 4X66E 4IFDB 1NHIA 1S16A 1VISA 4JI4E 3HULA 3WU5A 2HFUA 4LF9E 5DROA 4X62E 4DR4E 1I94I 4JI8I 1XHKA 1Z0BA 3GLLA 4LCGA 1FI4A 1EI1A 5K36B 3K1JA 5A2QC 2AJ4A 1FNMA 4EMDA 3PRYA 3ZZTA 4QNJA 3P3EA 4K0KE 4JI2I 2GS8A 2E5LI 4B3SE 4DV4I 3T1YI 2O1TA 5DNXA 2WNRB 3PS3A 4DPXA 4Z7CA 3HKMA 4U3BA 2UUBI 2Z5CA 2HK2A 1Z0VA 4MU4A 4GKJI 2C37A 4OO1D 1XMQI 4AQYE 1D6TA 4DU7A 4DR6E 2WW4A 2XEXA 1Z0GA 2CVEA 1WUUA 4HACA 4P7AA 4MU1A 3J81C 4JYAE 1Y5YA 5DRPA 4FWDA 1KTVA 4DV6I 3LPSA 2C38A 4KQVA 1IBKI 1RHYA 4DR5E 1OYSA 2HK3A 1XMOE 4M1KA 5JEAC 4LF6E 2F4VE 4FW6A 2JT2A 1HNZE 5DNLA 1B63A 2ZITA 1FKAE 2PO2B 4DU8A 4LF8I 4DPWA 4LFCI 3V2UC 1HNWE 4HY1A 2JEAB 5IT9Q 1XNRE 4DV2E 4DR3I 4DR7E 2V2QA 4X65E 1IBLI 4OO1B 1H73A 5BR8E 4JV5I 5A2QQ 3J80C 2ZM6E 1K47A 4DPYA 2R42A 2BV3A 4OX9I 2UXDI 1FWLA 1ZM2A 2WP8A 2OI2A 5IWAE 2HKEA 4DV1E 4FW4A 4DUYE 2PO1A 4JI3I 3JAMC 4FN5A 3QT8A 1ZXMA 4X64E 2VQEE 1IBME 4DPUA 2UUAE 4LF7E 5LMUI 2E1RA 4DV5E 5EKWA 1H7UA 2NN6C 2HHHI 1H74A 3CDIA 2Z5EA 4DR2E 4GKKE 3K17A 5C0XC 2O1UA 5LMNI 1N32E 2Q2EB 3D4JA 3HJCA 5EL9A 4JI1E 3J81Q 2UUCI 4LFAI 2GO3A 4YHHI 4X66I 4ISAA 3L7ZA 4BA2A 4PRXA 4JI4I 3LTOA 4MU3A 3Q6NA 5JEAE 4LF9I 2IOPA 4FW3A 4DV7E 1Z5CA 4IFDC 1H7SA 4LF5E 4WUCA 4X62I 4B3ME 3ZKBA 4DR4I 4DR1E 2PO1B 3PS1A 5FWKA 1FJGE 1XXEA 4USKA 4FWHA 2PNZB 1N33I 4K0KI 1HNXI 4ZVIA 4GQUA 5K36C 4B3SI 4JI8E 4BA1B 4MQYA 2X7IA 3NZKA 3QT5A 1HR0E 2UXBE 2O3ZA 1U2RA 4LF4E 4KHPE 3UHMA 3WU6A 3PYFA 4U3DA 5JEAA 3P76A 4FW9A 2AE8A 1OYPA 3PYGA 4WUDA 4JI0E 1R6MA 4AQYI 4DR6I 2BR2A 2UUBE 1ZM3A 2IOQA 3J80Q 2UU9E 4URLA 3PS2A 4ED4A 2A2DA 1R6LA 5FLXC 4FW7A 1Z5AA 3U1YA 1DARA 1XNQE 2IERA 4JI5E 4LF6I 2F4VI 5ELWA 3JAMQ 5JEAF 1N0VC 3WU4A 1HNZI 1ZM9A 2NN6E 2Z5CB 4IS9A 4USMA 2VESA 2JE6A 2O1WA 2C37B 5C0XE 4DV0E 4LCFA 2UXCE 4R1FA 4DUZE 4I3HA 1E3HA 1YHCA 1HNWI 3P3CA 4HACB 4DXLA 2V8PA 4DV2I 2BM0A 3DD6A 1N36E 1USUA 2BA1D 1B62A 2V2VA 4DR7I 4UT4A 4YY3E 4X65I 4IFDE 1Y4SA 2C38B 1PIEA 4RPFA 4IZKA 3PYDA 1J5EE 2NN6A 4AM3A 2JEBA 4LCHA 4AIDA 5BR8I 2C39A 4P52A 3OTOE 2DEIA 3J7AG 5C0XA 4HYMA 3GONA 4OO1C 4IZJA 3ZZ0A 2NPFA 5K36E 3QT7A 4HXZA 4LPFA 3P06A 1VI7A 1KKHA 3Q6MA 4NXME 3T1HE 2PO0A 2Z5BA 4JI7I 5IWAI 2HFSA 4JI6E 4DV1I 4DUYI 3M85G 4IFDA 1HK7A 1MX0A 2VQEI 2UUAI 1IBMI 4LF7I 1Z0WA 4B3TI 2UXDE 5DRQA 1S4EA 2CGEA 4DV5I 1N34E 3M7ND 4B3RI 4IZKB 2NN6F 4MDTA 4LFBE 5L3JA 4DR2I 4GKKI 1E3PA 5LL6R 4JI3E 1N32I 4MYUA 5K36A 5C0XF 4JI1I 1P42A 1UDOA 4DV3E 5FLXQ 2VQFE 1UDNA 4NXNE 2WP8B 2PNMA 3CWVA 1Z0TA 2PO0B 1UDSA 1OJ4A 4Z7YA 1H72C 4DV7I 2Z5BB 4LF5I 2WNRA 4IFDF 2O1VA 2BM1A 3K85A 4N3OA 4YHHE 2V34A 5JEAD 4DR1I 1FJGI 2BA0D 3B82A 3PYEA 3H1CA 3V5RA 2PNLA 1I94E 1EA6A 1MU5A 3QT6A 1RREA 1QZRA 5K36F 1UDQA 2J65A 1HR0I 2UXBI 2EFGA 3ZKDA 4LF4I 4KHPI 4JI2E 3L7ZB 2F1DA 4FWGA 4BA2B 2E5LE 1N33E 4DV4E 1MG7A 1HNXE 2HKJA 2J7KA 3T1YE 3M6AA 4JI0I 5DRRA 3GMEA 3Q1QA 4OO1E 4JYAI 1Z0EA 2PO2A 4NBQA 2UU9I 4GKJE 3B78A 1XMQE 4FW5A 1N0UA 3GCMA 5GMDA 4DR5I 2R3VA 2JEAA 1XMOI 4J3DA 1XNQI 2V2ZA 3CDJA 4AIMA 4JI5I 1USVA 2LJPA 2X36A 4JG4A 1A6FA 4PRVA 5JEAB 3KRNA 3F0NA 4MYTA 4DV6E 2VF3A 1NZ0A 4PU9A 1Y6ZA 3ZZUA 1IBKE 4OO1A 4DV0I 2NN6D 1PKPA 2UXCI 2BA1G 1UEKA 4OKGA 1NHJA 4DUZI 1XNRI 2BR2B 5C0XD 2IESA 2GO4A 4IZJD 2ZBKB 1N36I 4LF8E 3J7AM 4LFCE 4YY3I 3LNUA 4UTGA 3WU3A 2GQ0A 1OYRA 4DR3E 1YH8A 4QNKA 4DPTA 1J5EI 4IFDD 1NHHA 1Y4UA 2CZ9A 1KVKA 2CG9A 4LOMA 2ZM6I 3OTOI 2JE6B 2DEJA 1IBLE 1Z59A 4WUBA 4OO1F 4NXMI 3T1HI 4JV5E 5K36D 4OZEA 3P3GA 4X64I 4JI6I 3M7NG 5GMEA 3ZM7A 4OX9E 3B4TA 2A2CA 1FWKA 1ZXNA 1KIJA 1N34I 2NN6B 4JI7E 4LFBI 2JEBB 2C39B 1Z0CA 3H4LA 5C0XB 5LMUE 1Z5BA 4B3TE 4IZJB 4XTJA
chains in the Genus database with same CATH topology
2HHHE 4DV3I 4B3RE 2VQFI 1PVGA 5LMNE 4NXNI 1ELOA 5IT9C 1RR9A 2UUCE 1ZM4A 3B8HA 4B3MI 1BKNA 4LFAE 4X66E 1NHIA 1S16A 1VISA 4JI4E 3HULA 3WU5A 2HFUA 4LF9E 4X62E 4DR4E 1I94I 4JI8I 1XHKA 1Z0BA 1FI4A 1EI1A 3K1JA 5A2QC 2AJ4A 1FNMA 4EMDA 3PRYA 3ZZTA 4K0KE 4JI2I 2GS8A 2E5LI 4B3SE 4DV4I 3T1YI 2O1TA 4DPXA 4Z7CA 2UUBI 2Z5CA 2HK2A 1Z0VA 4GKJI 1XMQI 4AQYE 1D6TA 4DU7A 4DR6E 2WW4A 2XEXA 1Z0GA 1WUUA 4HACA 4P7AA 3J81C 4JYAE 4FWDA 1KTVA 4DV6I 3LPSA 4KQVA 1IBKI 4DR5E 2HK3A 1XMOE 4M1KA 4LF6E 2F4VE 1HNZE 1B63A 2ZITA 1FKAE 4DU8A 4LF8I 4DPWA 4LFCI 3V2UC 1HNWE 4HY1A 5IT9Q 1XNRE 4DV2E 4DR3I 4DR7E 2V2QA 4X65E 1IBLI 1H73A 5BR8E 4JV5I 5A2QQ 3J80C 2ZM6E 1K47A 4DPYA 2R42A 2BV3A 4OX9I 2UXDI 1FWLA 1ZM2A 2OI2A 5IWAE 2HKEA 4DV1E 4DUYE 4JI3I 3JAMC 4FN5A 3QT8A 1ZXMA 4X64E 2VQEE 1IBME 4DPUA 2UUAE 4LF7E 5LMUI 2E1RA 4DV5E 1H7UA 2HHHI 1H74A 4DR2E 2Z5EA 4GKKE 3K17A 2O1UA 5LMNI 1N32E 2Q2EB 3D4JA 3HJCA 4JI1E 3J81Q 2UUCI 4LFAI 4YHHI 4X66I 4PRXA 4JI4I 3LTOA 3Q6NA 4LF9I 2IOPA 4DV7E 1Z5CA 1H7SA 4LF5E 4WUCA 4X62I 4B3ME 3ZKBA 4DR4I 4DR1E 5FWKA 1FJGE 4USKA 4FWHA 1N33I 4K0KI 1HNXI 4ZVIA 4B3SI 4JI8E 2X7IA 3QT5A 1HR0E 2UXBE 4LF4E 1U2RA 4KHPE 3WU6A 3PYFA 4FW9A 3PYGA 4WUDA 4JI0E 4AQYI 4DR6I 2UUBE 1ZM3A 2IOQA 3J80Q 2UU9E 4URLA 4ED4A 2A2DA 5FLXC 1Z5AA 1DARA 1XNQE 4JI5E 4LF6I 2F4VI 3JAMQ 1N0VC 3WU4A 1HNZI 1ZM9A 2Z5CB 4USMA 2O1WA 4DV0E 2UXCE 4R1FA 4DUZE 4I3HA 1HNWI 4HACB 4DXLA 2V8PA 4DV2I 2BM0A 1N36E 1USUA 2V2VA 1B62A 4DR7I 4UT4A 4YY3E 4X65I 1Y4SA 1PIEA 4RPFA 4IZKA 3PYDA 1J5EE 5BR8I 4P52A 3OTOE 2DEIA 3J7AG 4HYMA 3GONA 4IZJA 3ZZ0A 2NPFA 3QT7A 4HXZA 3P06A 3Q6MA 1KKHA 4NXME 3T1HE 2Z5BA 4JI7I 5IWAI 2HFSA 4JI6E 4DV1I 4DUYI 1HK7A 1MX0A 2VQEI 2UUAI 1IBMI 4LF7I 1Z0WA 4B3TI 2UXDE 1S4EA 2CGEA 4DV5I 1N34E 4B3RI 4IZKB 4LFBE 5L3JA 4DR2I 4GKKI 5LL6R 4JI3E 1N32I 4MYUA 4JI1I 4DV3E 5FLXQ 2VQFE 4NXNE 2PNMA 3CWVA 1Z0TA 1OJ4A 4Z7YA 1H72C 4DV7I 2Z5BB 4LF5I 2O1VA 2BM1A 3K85A 4N3OA 4YHHE 2V34A 4DR1I 1FJGI 3B82A 3PYEA 3V5RA 2PNLA 1I94E 1EA6A 1MU5A 3QT6A 1RREA 1QZRA 1HR0I 2UXBI 2EFGA 3ZKDA 4LF4I 4KHPI 4JI2E 4FWGA 1N33E 2E5LE 4DV4E 1MG7A 1HNXE 2HKJA 2J7KA 3T1YE 3M6AA 4JI0I 3Q1QA 4JYAI 1Z0EA 2UU9I 4GKJE 3B78A 1XMQE 1N0UA 5GMDA 4DR5I 2R3VA 1XMOI 1XNQI 2V2ZA 4JI5I 1USVA 2LJPA 2X36A 4JG4A 1A6FA 4PRVA 3F0NA 4MYTA 4DV6E 2VF3A 1NZ0A 4PU9A 1Y6ZA 3ZZUA 1IBKE 4DV0I 1PKPA 2UXCI 1UEKA 4DUZI 1NHJA 1XNRI 4IZJD 2ZBKB 1N36I 4LF8E 3J7AM 4LFCE 4YY3I 3LNUA 4UTGA 3WU3A 2GQ0A 4DR3E 4DPTA 1J5EI 1NHHA 1Y4UA 2CZ9A 1KVKA 2CG9A 2ZM6I 3OTOI 2DEJA 1IBLE 1Z59A 4WUBA 4NXMI 3T1HI 4JV5E 4X64I 4JI6I 5GMEA 3ZM7A 4OX9E 2A2CA 1FWKA 1ZXNA 1KIJA 1N34I 4JI7E 4LFBI 1Z0CA 3H4LA 5LMUE 1Z5BA 4B3TE 4IZJB 4XTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH E;  4DV3 I;  4B3R E;  2VQF I;  1PVG A;  5LMN E;  4NXN I;  1ELO A;  5IT9 C;  1RR9 A;  2UUC E;  1ZM4 A;  3B8H A;  4B3M I;  1BKN A;  4LFA E;  4X66 E;  1NHI A;  1S16 A;  1VIS A;  4JI4 E;  3HUL A;  3WU5 A;  2HFU A;  4LF9 E;  4X62 E;  4DR4 E;  1I94 I;  4JI8 I;  1XHK A;  1Z0B A;  1FI4 A;  1EI1 A;  3K1J A;  5A2Q C;  2AJ4 A;  1FNM A;  4EMD A;  3ZZT A;  4K0K E;  4JI2 I;  2GS8 A;  2E5L I;  4B3S E;  4DV4 I;  3T1Y I;  4DPX A;  4Z7C A;  2UUB I;  2HK2 A;  1Z0V A;  4GKJ I;  1XMQ I;  4AQY E;  1D6T A;  4DU7 A;  4DR6 E;  2WW4 A;  2XEX A;  1Z0G A;  1WUU A;  4HAC A;  4P7A A;  3J81 C;  4JYA E;  4FWD A;  1KTV A;  4DV6 I;  3LPS A;  4KQV A;  1IBK I;  4DR5 E;  2HK3 A;  1XMO E;  4M1K A;  4LF6 E;  2F4V E;  1HNZ E;  1B63 A;  2ZIT A;  1FKA E;  4DU8 A;  4LF8 I;  4DPW A;  4LFC I;  3V2U C;  1HNW E;  4HY1 A;  5IT9 Q;  1XNR E;  4DV2 E;  4DR3 I;  4DR7 E;  2V2Q A;  4X65 E;  1IBL I;  1H73 A;  5BR8 E;  4JV5 I;  5A2Q Q;  3J80 C;  2ZM6 E;  1K47 A;  4DPY A;  2R42 A;  2BV3 A;  4OX9 I;  2UXD I;  1FWL A;  1ZM2 A;  2OI2 A;  5IWA E;  2HKE A;  4DV1 E;  4DUY E;  4JI3 I;  3JAM C;  4FN5 A;  2UUA E;  1ZXM A;  3QT8 A;  4X64 E;  2VQE E;  4DPU A;  1IBM E;  4LF7 E;  5LMU I;  2E1R A;  4DV5 E;  1H7U A;  2HHH I;  1H74 A;  4DR2 E;  4GKK E;  3K17 A;  5LMN I;  1N32 E;  2Q2E B;  3D4J A;  4JI1 E;  3J81 Q;  2UUC I;  4LFA I;  4YHH I;  4X66 I;  4PRX A;  4JI4 I;  3LTO A;  4LF9 I;  4DV7 E;  1Z5C A;  1H7S A;  4LF5 E;  4WUC A;  4X62 I;  4B3M E;  3ZKB A;  4DR4 I;  4DR1 E;  1FJG E;  4USK A;  4FWH A;  1N33 I;  4K0K I;  1HNX I;  4ZVI A;  4B3S I;  4JI8 E;  2X7I A;  3QT5 A;  1HR0 E;  2UXB E;  4LF4 E;  1U2R A;  4KHP E;  3WU6 A;  3PYF A;  4FW9 A;  3PYG A;  4WUD A;  4JI0 E;  4AQY I;  4DR6 I;  2UUB E;  1ZM3 A;  3J80 Q;  2UU9 E;  4URL A;  4ED4 A;  2A2D A;  5FLX C;  1Z5A A;  1DAR A;  1XNQ E;  4JI5 E;  4LF6 I;  2F4V I;  3JAM Q;  1N0V C;  3WU4 A;  1HNZ I;  1ZM9 A;  4USM A;  4DV0 E;  2UXC E;  4R1F A;  4DUZ E;  4I3H A;  1HNW I;  4HAC B;  4DXL A;  2V8P A;  4DV2 I;  2BM0 A;  1N36 E;  2V2V A;  1B62 A;  4DR7 I;  4UT4 A;  4YY3 E;  4X65 I;  1PIE A;  4RPF A;  3PYD A;  1J5E E;  5BR8 I;  4P52 A;  3OTO E;  2DEI A;  3J7A G;  4HYM A;  3GON A;  3ZZ0 A;  2NPF A;  3QT7 A;  4HXZ A;  4NXM E;  1KKH A;  3T1H E;  4JI7 I;  5IWA I;  2HFS A;  4JI6 E;  4DV1 I;  4DUY I;  1MX0 A;  2VQE I;  2UUA I;  1IBM I;  4LF7 I;  1Z0W A;  4B3T I;  2UXD E;  1S4E A;  4DV5 I;  1N34 E;  4B3R I;  4LFB E;  5L3J A;  4DR2 I;  4GKK I;  5LL6 R;  4JI3 E;  1N32 I;  4MYU A;  4JI1 I;  4DV3 E;  5FLX Q;  2VQF E;  4NXN E;  3CWV A;  1Z0T A;  1OJ4 A;  4Z7Y A;  1H72 C;  4DV7 I;  4LF5 I;  2BM1 A;  4YHH E;  2V34 A;  4DR1 I;  1FJG I;  3B82 A;  3PYE A;  3V5R A;  1I94 E;  1EA6 A;  1MU5 A;  3QT6 A;  1RRE A;  1QZR A;  1HR0 I;  2UXB I;  2EFG A;  3ZKD A;  4LF4 I;  4KHP I;  4JI2 E;  4FWG A;  1N33 E;  2E5L E;  4DV4 E;  1MG7 A;  1HNX E;  2HKJ A;  2J7K A;  3T1Y E;  3M6A A;  4JI0 I;  3Q1Q A;  4JYA I;  1Z0E A;  2UU9 I;  4GKJ E;  3B78 A;  1XMQ E;  1N0U A;  5GMD A;  4DR5 I;  2R3V A;  1XMO I;  1XNQ I;  2V2Z A;  4JI5 I;  2LJP A;  2X36 A;  4JG4 A;  1A6F A;  4PRV A;  3F0N A;  4MYT A;  4DV6 E;  2VF3 A;  1NZ0 A;  4PU9 A;  3ZZU A;  1IBK E;  4DV0 I;  1PKP A;  2UXC I;  1UEK A;  4DUZ I;  1NHJ A;  1XNR I;  2ZBK B;  1N36 I;  4LF8 E;  3J7A M;  4LFC E;  4YY3 I;  3LNU A;  4UTG A;  3WU3 A;  4DR3 E;  4DPT A;  1J5E I;  1NHH A;  2CZ9 A;  1KVK A;  2ZM6 I;  3OTO I;  2DEJ A;  1IBL E;  1Z59 A;  4WUB A;  4NXM I;  3T1H I;  4JV5 E;  4X64 I;  4JI6 I;  5GME A;  3ZM7 A;  4OX9 E;  2A2C A;  1FWK A;  1ZXN A;  1KIJ A;  1N34 I;  4JI7 E;  4LFB I;  1Z0C A;  3H4L A;  5LMU E;  1Z5B A;  4B3T E;  4XTJ A; 
#chains in the Genus database with same CATH topology
 2HHH E;  2PNZ A;  4DV3 I;  4MU0 A;  3M85 D;  4B3R E;  2VQF I;  1PVG A;  5LMN E;  1Y60 A;  4NXN I;  4BA1 A;  1ELO A;  3U1K A;  5IT9 C;  1RR9 A;  2UUC E;  1ZM4 A;  3B8H A;  4B3M I;  1BKN A;  4LFA E;  2BA0 G;  4X66 E;  4IFD B;  1NHI A;  1S16 A;  1VIS A;  4JI4 E;  3HUL A;  3WU5 A;  2HFU A;  4LF9 E;  5DRO A;  4X62 E;  4DR4 E;  1I94 I;  4JI8 I;  1XHK A;  1Z0B A;  3GLL A;  4LCG A;  1FI4 A;  1EI1 A;  5K36 B;  3K1J A;  5A2Q C;  2AJ4 A;  1FNM A;  4EMD A;  3PRY A;  3ZZT A;  4QNJ A;  3P3E A;  4K0K E;  4JI2 I;  2GS8 A;  2E5L I;  4B3S E;  4DV4 I;  3T1Y I;  2O1T A;  5DNX A;  2WNR B;  3PS3 A;  4DPX A;  4Z7C A;  3HKM A;  4U3B A;  2UUB I;  2Z5C A;  2HK2 A;  1Z0V A;  4MU4 A;  4GKJ I;  2C37 A;  4OO1 D;  1XMQ I;  4AQY E;  1D6T A;  4DU7 A;  4DR6 E;  2WW4 A;  2XEX A;  1Z0G A;  2CVE A;  1WUU A;  4HAC A;  4P7A A;  4MU1 A;  3J81 C;  4JYA E;  1Y5Y A;  5DRP A;  4FWD A;  1KTV A;  4DV6 I;  3LPS A;  2C38 A;  4KQV A;  1IBK I;  1RHY A;  4DR5 E;  1OYS A;  2HK3 A;  1XMO E;  4M1K A;  5JEA C;  4LF6 E;  2F4V E;  4FW6 A;  2JT2 A;  1HNZ E;  5DNL A;  1B63 A;  2ZIT A;  1FKA E;  2PO2 B;  4DU8 A;  4LF8 I;  4DPW A;  4LFC I;  3V2U C;  1HNW E;  4HY1 A;  2JEA B;  5IT9 Q;  1XNR E;  4DV2 E;  4DR3 I;  4DR7 E;  2V2Q A;  4X65 E;  1IBL I;  4OO1 B;  1H73 A;  5BR8 E;  4JV5 I;  5A2Q Q;  3J80 C;  2ZM6 E;  1K47 A;  4DPY A;  2R42 A;  2BV3 A;  4OX9 I;  2UXD I;  1FWL A;  1ZM2 A;  2WP8 A;  2OI2 A;  5IWA E;  2HKE A;  4DV1 E;  4FW4 A;  4DUY E;  2PO1 A;  4JI3 I;  3JAM C;  4FN5 A;  3QT8 A;  1ZXM A;  4X64 E;  2VQE E;  1IBM E;  4DPU A;  2UUA E;  4LF7 E;  5LMU I;  2E1R A;  4DV5 E;  5EKW A;  1H7U A;  2NN6 C;  2HHH I;  1H74 A;  3CDI A;  2Z5E A;  4DR2 E;  4GKK E;  3K17 A;  5C0X C;  2O1U A;  5LMN I;  1N32 E;  2Q2E B;  3D4J A;  3HJC A;  5EL9 A;  4JI1 E;  3J81 Q;  2UUC I;  4LFA I;  2GO3 A;  4YHH I;  4X66 I;  4ISA A;  3L7Z A;  4BA2 A;  4PRX A;  4JI4 I;  3LTO A;  4MU3 A;  3Q6N A;  5JEA E;  4LF9 I;  2IOP A;  4FW3 A;  4DV7 E;  1Z5C A;  4IFD C;  1H7S A;  4LF5 E;  4WUC A;  4X62 I;  4B3M E;  3ZKB A;  4DR4 I;  4DR1 E;  2PO1 B;  3PS1 A;  5FWK A;  1FJG E;  1XXE A;  4USK A;  4FWH A;  2PNZ B;  1N33 I;  4K0K I;  1HNX I;  4ZVI A;  4GQU A;  5K36 C;  4B3S I;  4JI8 E;  4BA1 B;  4MQY A;  2X7I A;  3NZK A;  3QT5 A;  1HR0 E;  2UXB E;  2O3Z A;  1U2R A;  4LF4 E;  4KHP E;  3UHM A;  3WU6 A;  3PYF A;  4U3D A;  5JEA A;  3P76 A;  4FW9 A;  2AE8 A;  1OYP A;  3PYG A;  4WUD A;  4JI0 E;  1R6M A;  4AQY I;  4DR6 I;  2BR2 A;  2UUB E;  1ZM3 A;  2IOQ A;  3J80 Q;  2UU9 E;  4URL A;  3PS2 A;  4ED4 A;  2A2D A;  1R6L A;  5FLX C;  4FW7 A;  1Z5A A;  3U1Y A;  1DAR A;  1XNQ E;  2IER A;  4JI5 E;  4LF6 I;  2F4V I;  5ELW A;  3JAM Q;  5JEA F;  1N0V C;  3WU4 A;  1HNZ I;  1ZM9 A;  2NN6 E;  2Z5C B;  4IS9 A;  4USM A;  2VES A;  2JE6 A;  2O1W A;  2C37 B;  5C0X E;  4DV0 E;  4LCF A;  2UXC E;  4R1F A;  4DUZ E;  4I3H A;  1E3H A;  1YHC A;  1HNW I;  3P3C A;  4HAC B;  4DXL A;  2V8P A;  4DV2 I;  2BM0 A;  3DD6 A;  1N36 E;  1USU A;  2BA1 D;  1B62 A;  2V2V A;  4DR7 I;  4UT4 A;  4YY3 E;  4X65 I;  4IFD E;  1Y4S A;  2C38 B;  1PIE A;  4RPF A;  4IZK A;  3PYD A;  1J5E E;  2NN6 A;  4AM3 A;  2JEB A;  4LCH A;  4AID A;  5BR8 I;  2C39 A;  4P52 A;  3OTO E;  2DEI A;  3J7A G;  5C0X A;  4HYM A;  3GON A;  4OO1 C;  4IZJ A;  3ZZ0 A;  2NPF A;  5K36 E;  3QT7 A;  4HXZ A;  4LPF A;  3P06 A;  1VI7 A;  1KKH A;  3Q6M A;  4NXM E;  3T1H E;  2PO0 A;  2Z5B A;  4JI7 I;  5IWA I;  2HFS A;  4JI6 E;  4DV1 I;  4DUY I;  3M85 G;  4IFD A;  1HK7 A;  1MX0 A;  2VQE I;  2UUA I;  1IBM I;  4LF7 I;  1Z0W A;  4B3T I;  2UXD E;  5DRQ A;  1S4E A;  2CGE A;  4DV5 I;  1N34 E;  3M7N D;  4B3R I;  4IZK B;  2NN6 F;  4MDT A;  4LFB E;  5L3J A;  4DR2 I;  4GKK I;  1E3P A;  5LL6 R;  4JI3 E;  1N32 I;  4MYU A;  5K36 A;  5C0X F;  4JI1 I;  1P42 A;  1UDO A;  4DV3 E;  5FLX Q;  2VQF E;  1UDN A;  4NXN E;  2WP8 B;  2PNM A;  3CWV A;  1Z0T A;  2PO0 B;  1UDS A;  1OJ4 A;  4Z7Y A;  1H72 C;  4DV7 I;  2Z5B B;  4LF5 I;  2WNR A;  4IFD F;  2O1V A;  2BM1 A;  3K85 A;  4N3O A;  4YHH E;  2V34 A;  5JEA D;  4DR1 I;  1FJG I;  2BA0 D;  3B82 A;  3PYE A;  3H1C A;  3V5R A;  2PNL A;  1I94 E;  1EA6 A;  1MU5 A;  3QT6 A;  1RRE A;  1QZR A;  5K36 F;  1UDQ A;  2J65 A;  1HR0 I;  2UXB I;  2EFG A;  3ZKD A;  4LF4 I;  4KHP I;  4JI2 E;  3L7Z B;  2F1D A;  4FWG A;  4BA2 B;  2E5L E;  1N33 E;  4DV4 E;  1MG7 A;  1HNX E;  2HKJ A;  2J7K A;  3T1Y E;  3M6A A;  4JI0 I;  5DRR A;  3GME A;  3Q1Q A;  4OO1 E;  4JYA I;  1Z0E A;  2PO2 A;  4NBQ A;  2UU9 I;  4GKJ E;  3B78 A;  1XMQ E;  4FW5 A;  1N0U A;  3GCM A;  5GMD A;  4DR5 I;  2R3V A;  2JEA A;  1XMO I;  4J3D A;  1XNQ I;  2V2Z A;  3CDJ A;  4AIM A;  4JI5 I;  1USV A;  2LJP A;  2X36 A;  4JG4 A;  1A6F A;  4PRV A;  5JEA B;  3KRN A;  3F0N A;  4MYT A;  4DV6 E;  2VF3 A;  1NZ0 A;  4PU9 A;  1Y6Z A;  3ZZU A;  1IBK E;  4OO1 A;  4DV0 I;  2NN6 D;  1PKP A;  2UXC I;  2BA1 G;  1UEK A;  4OKG A;  1NHJ A;  4DUZ I;  1XNR I;  2BR2 B;  5C0X D;  2IES A;  2GO4 A;  4IZJ D;  2ZBK B;  1N36 I;  4LF8 E;  3J7A M;  4LFC E;  4YY3 I;  3LNU A;  4UTG A;  3WU3 A;  2GQ0 A;  1OYR A;  4DR3 E;  1YH8 A;  4QNK A;  4DPT A;  1J5E I;  4IFD D;  1NHH A;  1Y4U A;  2CZ9 A;  1KVK A;  2CG9 A;  4LOM A;  2ZM6 I;  3OTO I;  2JE6 B;  2DEJ A;  1IBL E;  1Z59 A;  4WUB A;  4OO1 F;  4NXM I;  3T1H I;  4JV5 E;  5K36 D;  4OZE A;  3P3G A;  4X64 I;  4JI6 I;  3M7N G;  5GME A;  3ZM7 A;  4OX9 E;  3B4T A;  2A2C A;  1FWK A;  1ZXN A;  1KIJ A;  1N34 I;  2NN6 B;  4JI7 E;  4LFB I;  2JEB B;  2C39 B;  1Z0C A;  3H4L A;  5C0X B;  5LMU E;  1Z5B A;  4B3T E;  4IZJ B;  4XTJ A; 
#chains in the Genus database with same CATH homology
 2HHH E;  4DV3 I;  4B3R E;  2VQF I;  1PVG A;  5LMN E;  4NXN I;  1ELO A;  5IT9 C;  1RR9 A;  2UUC E;  1ZM4 A;  3B8H A;  4B3M I;  1BKN A;  4LFA E;  4X66 E;  1NHI A;  1S16 A;  1VIS A;  4JI4 E;  3HUL A;  3WU5 A;  2HFU A;  4LF9 E;  4X62 E;  4DR4 E;  1I94 I;  4JI8 I;  1XHK A;  1Z0B A;  1FI4 A;  1EI1 A;  3K1J A;  5A2Q C;  2AJ4 A;  1FNM A;  4EMD A;  3PRY A;  3ZZT A;  4K0K E;  4JI2 I;  2GS8 A;  2E5L I;  4B3S E;  4DV4 I;  3T1Y I;  2O1T A;  4DPX A;  4Z7C A;  2UUB I;  2Z5C A;  2HK2 A;  1Z0V A;  4GKJ I;  1XMQ I;  4AQY E;  1D6T A;  4DU7 A;  4DR6 E;  2WW4 A;  2XEX A;  1Z0G A;  1WUU A;  4HAC A;  4P7A A;  3J81 C;  4JYA E;  4FWD A;  1KTV A;  4DV6 I;  3LPS A;  4KQV A;  1IBK I;  4DR5 E;  2HK3 A;  1XMO E;  4M1K A;  4LF6 E;  2F4V E;  1HNZ E;  1B63 A;  2ZIT A;  1FKA E;  4DU8 A;  4LF8 I;  4DPW A;  4LFC I;  3V2U C;  1HNW E;  4HY1 A;  5IT9 Q;  1XNR E;  4DV2 E;  4DR3 I;  4DR7 E;  2V2Q A;  4X65 E;  1IBL I;  1H73 A;  5BR8 E;  4JV5 I;  5A2Q Q;  3J80 C;  2ZM6 E;  1K47 A;  4DPY A;  2R42 A;  2BV3 A;  4OX9 I;  2UXD I;  1FWL A;  1ZM2 A;  2OI2 A;  5IWA E;  2HKE A;  4DV1 E;  4DUY E;  4JI3 I;  3JAM C;  4FN5 A;  3QT8 A;  1ZXM A;  4X64 E;  2VQE E;  1IBM E;  4DPU A;  2UUA E;  4LF7 E;  5LMU I;  2E1R A;  4DV5 E;  1H7U A;  2HHH I;  1H74 A;  4DR2 E;  2Z5E A;  4GKK E;  3K17 A;  2O1U A;  5LMN I;  1N32 E;  2Q2E B;  3D4J A;  3HJC A;  4JI1 E;  3J81 Q;  2UUC I;  4LFA I;  4YHH I;  4X66 I;  4PRX A;  4JI4 I;  3LTO A;  3Q6N A;  4LF9 I;  2IOP A;  4DV7 E;  1Z5C A;  1H7S A;  4LF5 E;  4WUC A;  4X62 I;  4B3M E;  3ZKB A;  4DR4 I;  4DR1 E;  5FWK A;  1FJG E;  4USK A;  4FWH A;  1N33 I;  4K0K I;  1HNX I;  4ZVI A;  4B3S I;  4JI8 E;  2X7I A;  3QT5 A;  1HR0 E;  2UXB E;  4LF4 E;  1U2R A;  4KHP E;  3WU6 A;  3PYF A;  4FW9 A;  3PYG A;  4WUD A;  4JI0 E;  4AQY I;  4DR6 I;  2UUB E;  1ZM3 A;  2IOQ A;  3J80 Q;  2UU9 E;  4URL A;  4ED4 A;  2A2D A;  5FLX C;  1Z5A A;  1DAR A;  1XNQ E;  4JI5 E;  4LF6 I;  2F4V I;  3JAM Q;  1N0V C;  3WU4 A;  1HNZ I;  1ZM9 A;  2Z5C B;  4USM A;  2O1W A;  4DV0 E;  2UXC E;  4R1F A;  4DUZ E;  4I3H A;  1HNW I;  4HAC B;  4DXL A;  2V8P A;  4DV2 I;  2BM0 A;  1N36 E;  1USU A;  2V2V A;  1B62 A;  4DR7 I;  4UT4 A;  4YY3 E;  4X65 I;  1Y4S A;  1PIE A;  4RPF A;  4IZK A;  3PYD A;  1J5E E;  5BR8 I;  4P52 A;  3OTO E;  2DEI A;  3J7A G;  4HYM A;  3GON A;  4IZJ A;  3ZZ0 A;  2NPF A;  3QT7 A;  4HXZ A;  3P06 A;  3Q6M A;  1KKH A;  4NXM E;  3T1H E;  2Z5B A;  4JI7 I;  5IWA I;  2HFS A;  4JI6 E;  4DV1 I;  4DUY I;  1HK7 A;  1MX0 A;  2VQE I;  2UUA I;  1IBM I;  4LF7 I;  1Z0W A;  4B3T I;  2UXD E;  1S4E A;  2CGE A;  4DV5 I;  1N34 E;  4B3R I;  4IZK B;  4LFB E;  5L3J A;  4DR2 I;  4GKK I;  5LL6 R;  4JI3 E;  1N32 I;  4MYU A;  4JI1 I;  4DV3 E;  5FLX Q;  2VQF E;  4NXN E;  2PNM A;  3CWV A;  1Z0T A;  1OJ4 A;  4Z7Y A;  1H72 C;  4DV7 I;  2Z5B B;  4LF5 I;  2O1V A;  2BM1 A;  3K85 A;  4N3O A;  4YHH E;  2V34 A;  4DR1 I;  1FJG I;  3B82 A;  3PYE A;  3V5R A;  2PNL A;  1I94 E;  1EA6 A;  1MU5 A;  3QT6 A;  1RRE A;  1QZR A;  1HR0 I;  2UXB I;  2EFG A;  3ZKD A;  4LF4 I;  4KHP I;  4JI2 E;  4FWG A;  1N33 E;  2E5L E;  4DV4 E;  1MG7 A;  1HNX E;  2HKJ A;  2J7K A;  3T1Y E;  3M6A A;  4JI0 I;  3Q1Q A;  4JYA I;  1Z0E A;  2UU9 I;  4GKJ E;  3B78 A;  1XMQ E;  1N0U A;  5GMD A;  4DR5 I;  2R3V A;  1XMO I;  1XNQ I;  2V2Z A;  4JI5 I;  1USV A;  2LJP A;  2X36 A;  4JG4 A;  1A6F A;  4PRV A;  3F0N A;  4MYT A;  4DV6 E;  2VF3 A;  1NZ0 A;  4PU9 A;  1Y6Z A;  3ZZU A;  1IBK E;  4DV0 I;  1PKP A;  2UXC I;  1UEK A;  4DUZ I;  1NHJ A;  1XNR I;  4IZJ D;  2ZBK B;  1N36 I;  4LF8 E;  3J7A M;  4LFC E;  4YY3 I;  3LNU A;  4UTG A;  3WU3 A;  2GQ0 A;  4DR3 E;  4DPT A;  1J5E I;  1NHH A;  1Y4U A;  2CZ9 A;  1KVK A;  2CG9 A;  2ZM6 I;  3OTO I;  2DEJ A;  1IBL E;  1Z59 A;  4WUB A;  4NXM I;  3T1H I;  4JV5 E;  4X64 I;  4JI6 I;  5GME A;  3ZM7 A;  4OX9 E;  2A2C A;  1FWK A;  1ZXN A;  1KIJ A;  1N34 I;  4JI7 E;  4LFB I;  1Z0C A;  3H4L A;  5LMU E;  1Z5B A;  4B3T E;  4IZJ B;  4XTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...