4LOMA

Crystal structure of mycobacterium tuberculosis hisb in complex with its substrate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
191
structure length
191
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis
total genus 57
structure length 191
sequence length 191
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lomA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lomA02
5ELWA 4MU3A 4MU0A 1RHYA 5DNLA 4MU4A 4QNJA 4LPFA 4MU1A 2AE8A 2F1DA 4QNKA 5DNXA 5EL9A 4LOMA 5EKWA 4GQUA
chains in the Genus database with same CATH superfamily
2HK2A 4USKA 4DPWA 4PU9A 2VQFI 4P52A 2GO4A 4FW3A 2C38A 2C37B 4KHPE 4JI6E 3P06A 4XTJA 3KRNA 2J7KA 4DR5E 2C38B 3B78A 3Q6MA 4DV7E 2V2ZA 2PO0A 5A2QQ 2PNLA 4OZEA 4Z7CA 1KIJA 3K1JA 5IWAE 1Z0CA 1RHYA 2R42A 1WUUA 1IBKI 1K47A 3OTOE 4URLA 4LFCE 4LCGA 4K0KI 4GKKE 4AQYE 2PO2A 2UUAI 2UXBE 4IFDA 2NN6C 1NHHA 4HACA 2J65A 2PO2B 3H4LA 2Z5BA 2X36A 2E1RA 2VF3A 2UXCI 4LF7I 4HACB 2UU9E 2Z5BB 2F4VI 4FW7A 1P42A 2R3VA 4LF6E 3ZKDA 2PO1A 4X62I 1OJ4A 4JI3E 1N34E 3U1YA 2BA0G 2V2VA 4NXMI 2PO1B 2EFGA 1ZM2A 1N36E 2AE8A 2GQ0A 1YH8A 3JAMQ 5K36D 2O1TA 4LCFA 5C0XA 4USMA 5FLXC 4OO1A 2C39A 5DNXA 1HNWI 3QT7A 4JG4A 1MU5A 2O3ZA 4HYMA 1HR0E 3J7AM 1IBLI 2JE6B 4DV1I 4IZKB 4IFDE 3UHMA 4DPXA 4DR2E 1USUA 1OYSA 1QZRA 1Z0VA 2O1WA 4LFBI 4JI7I 4GKJI 3NZKA 1KTVA 3HJCA 4DV4E 2ZM6I 4R1FA 2A2CA 1XMQI 2HK3A 1N0VC 4DUYI 4B3SE 2DEIA 1Y4UA 4FWGA 4DR7I 4X66E 2WP8B 1XNQI 1Z5CA 5LL6R 3ZM7A 5DRPA 3QT8A 4U3BA 1B62A 2BV3A 4QNJA 3ZZ0A 2V8PA 3PYDA 5DRRA 4DV5I 3M7ND 4DV3E 4FW4A 4BA1A 5C0XE 4JI5E 4IZJA 2A2DA 4OO1E 4BA2B 1UDSA 4UTGA 3PS1A 1ZM3A 5IT9Q 4I3HA 3U1KA 1XMOE 4OX9E 4HXZA 4DPYA 4B3MI 1HNZE 2CG9A 3Q6NA 4JI8E 2WNRA 4DUZE 1VISA 4NXNI 4UT4A 1H7UA 1IBME 1NHIA 1BKNA 1Z5AA 5BR8E 3J80C 2UXDE 4X65I 4YY3E 2PNZB 3F0NA 4DPTA 5JEAC 1XXEA 1FNMA 3T1YE 4AM3A 1I94E 4JV5E 3WU6A 5K36C 4JI6I 1FJGE 4DR4I 4MU4A 4JYAE 3V5RA 2O1UA 3PYEA 4LF4E 1XHKA 2BA1D 1NHJA 5LMUE 2BR2A 1EA6A 4IFDF 4DXLA 2OI2A 2BR2B 1H7SA 2DEJA 2IERA 1HNXE 2NN6E 3OTOI 4LFCI 5L3JA 4YHHE 2PO0B 2CZ9A 3P3EA 4QNKA 5GMDA 2VQEE 4AQYI 1HK7A 2UXBI 3WU4A 4DR3E 1Z0WA 4JI1E 4LFAE 1Y5YA 2IOQA 2E5LE 2UUBE 2ZBKB 2F1DA 1Z0TA 2UU9I 4HY1A 5C0XF 4LF6I 4IFDB 4OO1F 1PVGA 4IFDD 2LJPA 4J3DA 4DV2E 1N34I 4B3RE 2Q2EB 4DV6E 3PYGA 1N36I 4DV0E 3ZKBA 2X7IA 2IOPA 4ISAA 1UEKA 4EMDA 1ZM4A 1OYRA 3T1HE 4K0KE 1J5EI 1HR0I 2JEBA 4B3TE 2ZITA 3M85G 5DNLA 5C0XB 2HHHE 4OO1B 2O1VA 2C39B 5JEAA 5C0XD 4OO1D 4LF7E 2Z5CA 1FWLA 1Y4SA 4RPFA 4FWHA 5LMNE 4WUDA 1Z0GA 4FWDA 4LF5E 4U3DA 4B3SI 5A2QC 4LF9I 1N33E 4JI0I 4X66I 1N32E 2NN6F 4M1KA 4WUBA 4DR1I 4PRVA 1XNRE 5EKWA 3PRYA 1DARA 1HNWE 3H1CA 1R6MA 4X64I 1S16A 3GCMA 1XMOI 1PIEA 1H73A 1HNZI 3P76A 4DR6I 4JI8I 4LFBE 4BA1B 1YHCA 2NN6A 3V2UC 3WU3A 1ELOA 4IZJB 2JT2A 5JEAE 4IZJD 4DPUA 1IBMI 2ZM6E 2NN6B 3D4JA 5K36E 2PNMA 5BR8I 2UXDI 4DUYE 2NN6D 3L7ZA 3B8HA 2NPFA 4YY3I 4JI4E 3J7AG 1ZXNA 2VESA 4DR7E 3T1YI 4JI2I 2WNRB 4JV5I 1N0UA 3L7ZB 3M6AA 3JAMC 1FJGI 1RR9A 3J81Q 2AJ4A 5EL9A 3B4TA 4LF4I 1ZXMA 4KHPI 1UDOA 4FW9A 5LMUI 2CGEA 1KVKA 3K85A 4DR5I 2BA0D 4DV7I 4IS9A 1NZ0A 1HNXI 5ELWA 5IWAI 4DU8A 4YHHI 3GMEA 2VQEI 4LOMA 2UUCE 1Y60A 5FLXQ 1KKHA 1E3PA 1B63A 4DR3I 4JI1I 1U2RA 4LFAI 4GKKI 1OYPA 2E5LI 2UUBI 4LF8E 1FI4A 1Z59A 3CWVA 2HKEA 3LTOA 4DR4E 1D6TA 4MU3A 4N3OA 3Q1QA 2VQFE 1PKPA 4MDTA 4LPFA 4MU1A 4ZVIA 2V34A 3DD6A 1USVA 4DV2I 4B3RI 4AIDA 3QT6A 4DV6I 3WU5A 1ZM9A 4DV0I 3M7NG 4JI3I 5GMEA 5IT9C 4GQUA 4LCHA 5JEAF 5K36F 3T1HI 1Z0EA 4MU0A 1IBKE 1FKAE 4B3TI 1EI1A 3J81C 2HHHI 1R6LA 2UUAE 3CDJA 4MYTA 5LMNI 3CDIA 2JEBB 1Z0BA 3QT5A 4DR2I 4LF5I 2GS8A 2UXCE 2IESA 2JEAA 5K36A 1H74A 1N33I 3ZZUA 2HKJA 4FN5A 2F4VE 5JEAB 4DV4I 1MX0A 1N32I 5JEAD 1Y6ZA 4X62E 2Z5CB 2BA1G 2JEAB 5K36B 3J80Q 1XNRI 3GLLA 4NXME 3GONA 3P3CA 3B82A 5DROA 2JE6A 5FWKA 1J5EE 4IZKA 1RREA 4AIMA 4DV3I 4JI5I 2HFSA 4P7AA 1IBLE 3PYFA 1UDQA 3ZZTA 4DV1E 4OX9I 1S4EA 2WP8A 4JI7E 4DUZI 4JI4I 4LF9E 4GKJE 3P3GA 1VI7A 2BM1A 4JI0E 4IFDC 1XMQE 2WW4A 4DU7A 4DR1E 1H72C 4MYUA 1FWKA 4BA2A 3K17A 4ED4A 1XNQE 1I94I 4PRXA 4Z7YA 4MQYA 1MG7A 4FW5A 4JYAI 2XEXA 4WUCA 4OKGA 4X64E 3LNUA 4DV5E 2HFUA 4FW6A 4DR6E 2Z5EA 3LPSA 2UUCI 2BM0A 3HKMA 2PNZA 2GO3A 3HULA 5C0XC 3PS3A 4B3ME 2CVEA 4OO1C 1Z5BA 3M85D 4NXNE 2V2QA 3PS2A 1A6FA 4JI2E 4LF8I 1E3HA 4KQVA 1UDNA 5DRQA 2C37A 4NBQA 4X65E
chains in the Genus database with same CATH topology
5ELWA 4MU3A 4MU0A 1RHYA 5DNLA 4MU4A 4QNJA 4LPFA 4MU1A 2AE8A 2F1DA 4QNKA 5DNXA 5EL9A 4LOMA 5EKWA 4GQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELW A;  4MU3 A;  4MU0 A;  1RHY A;  5DNL A;  4MU4 A;  4QNJ A;  4LPF A;  4MU1 A;  2AE8 A;  2F1D A;  4QNK A;  5DNX A;  5EL9 A;  4LOM A;  5EKW A;  4GQU A; 
#chains in the Genus database with same CATH topology
 2HK2 A;  4USK A;  4DPW A;  4PU9 A;  2VQF I;  4P52 A;  2GO4 A;  4FW3 A;  2C38 A;  2C37 B;  4KHP E;  4JI6 E;  3P06 A;  4XTJ A;  3KRN A;  2J7K A;  4DR5 E;  2C38 B;  3B78 A;  3Q6M A;  4DV7 E;  2V2Z A;  2PO0 A;  5A2Q Q;  2PNL A;  4OZE A;  4Z7C A;  1KIJ A;  3K1J A;  5IWA E;  1Z0C A;  1RHY A;  2R42 A;  1WUU A;  1IBK I;  1K47 A;  3OTO E;  4URL A;  4LFC E;  4LCG A;  4K0K I;  4GKK E;  4AQY E;  2PO2 A;  2UUA I;  2UXB E;  4IFD A;  2NN6 C;  1NHH A;  4HAC A;  2J65 A;  2PO2 B;  3H4L A;  2Z5B A;  2X36 A;  2E1R A;  2VF3 A;  2UXC I;  4LF7 I;  4HAC B;  2UU9 E;  2Z5B B;  2F4V I;  4FW7 A;  1P42 A;  2R3V A;  4LF6 E;  3ZKD A;  2PO1 A;  4X62 I;  1OJ4 A;  4JI3 E;  1N34 E;  3U1Y A;  2BA0 G;  2V2V A;  4NXM I;  2PO1 B;  2EFG A;  1ZM2 A;  1N36 E;  2AE8 A;  2GQ0 A;  1YH8 A;  3JAM Q;  5K36 D;  2O1T A;  4LCF A;  5C0X A;  4USM A;  5FLX C;  4OO1 A;  2C39 A;  5DNX A;  1HNW I;  3QT7 A;  4JG4 A;  1MU5 A;  2O3Z A;  4HYM A;  1HR0 E;  3J7A M;  1IBL I;  2JE6 B;  4DV1 I;  4IZK B;  4IFD E;  3UHM A;  4DPX A;  4DR2 E;  1USU A;  1OYS A;  1QZR A;  1Z0V A;  2O1W A;  4LFB I;  4JI7 I;  4GKJ I;  3NZK A;  1KTV A;  3HJC A;  4DV4 E;  2ZM6 I;  4R1F A;  2A2C A;  1XMQ I;  2HK3 A;  1N0V C;  4DUY I;  4B3S E;  2DEI A;  1Y4U A;  4FWG A;  4DR7 I;  4X66 E;  2WP8 B;  1XNQ I;  1Z5C A;  5LL6 R;  3ZM7 A;  5DRP A;  3QT8 A;  4U3B A;  1B62 A;  2BV3 A;  4QNJ A;  3ZZ0 A;  2V8P A;  3PYD A;  5DRR A;  4DV5 I;  3M7N D;  4DV3 E;  4FW4 A;  4BA1 A;  5C0X E;  4JI5 E;  4IZJ A;  2A2D A;  4OO1 E;  4BA2 B;  1UDS A;  4UTG A;  3PS1 A;  1ZM3 A;  5IT9 Q;  4I3H A;  3U1K A;  1XMO E;  4OX9 E;  4HXZ A;  4DPY A;  4B3M I;  1HNZ E;  2CG9 A;  3Q6N A;  4JI8 E;  2WNR A;  4DUZ E;  1VIS A;  4NXN I;  4UT4 A;  1H7U A;  1IBM E;  1NHI A;  1BKN A;  1Z5A A;  5BR8 E;  3J80 C;  2UXD E;  4X65 I;  4YY3 E;  2PNZ B;  3F0N A;  4DPT A;  5JEA C;  1XXE A;  1FNM A;  3T1Y E;  4AM3 A;  1I94 E;  4JV5 E;  3WU6 A;  5K36 C;  4JI6 I;  1FJG E;  4DR4 I;  4MU4 A;  4JYA E;  3V5R A;  2O1U A;  3PYE A;  4LF4 E;  1XHK A;  2BA1 D;  1NHJ A;  5LMU E;  2BR2 A;  1EA6 A;  4IFD F;  4DXL A;  2OI2 A;  2BR2 B;  1H7S A;  2DEJ A;  2IER A;  1HNX E;  2NN6 E;  3OTO I;  4LFC I;  5L3J A;  4YHH E;  2PO0 B;  2CZ9 A;  3P3E A;  4QNK A;  5GMD A;  2VQE E;  4AQY I;  1HK7 A;  2UXB I;  3WU4 A;  4DR3 E;  1Z0W A;  4JI1 E;  4LFA E;  1Y5Y A;  2IOQ A;  2E5L E;  2UUB E;  2ZBK B;  2F1D A;  1Z0T A;  2UU9 I;  4HY1 A;  5C0X F;  4LF6 I;  4IFD B;  4OO1 F;  1PVG A;  4IFD D;  2LJP A;  4J3D A;  4DV2 E;  1N34 I;  4B3R E;  2Q2E B;  4DV6 E;  3PYG A;  1N36 I;  4DV0 E;  3ZKB A;  2X7I A;  2IOP A;  4ISA A;  1UEK A;  4EMD A;  1ZM4 A;  1OYR A;  3T1H E;  4K0K E;  1J5E I;  1HR0 I;  2JEB A;  4B3T E;  2ZIT A;  3M85 G;  5DNL A;  5C0X B;  2HHH E;  4OO1 B;  2O1V A;  2C39 B;  5JEA A;  5C0X D;  4OO1 D;  4LF7 E;  2Z5C A;  1FWL A;  1Y4S A;  4RPF A;  4FWH A;  5LMN E;  4WUD A;  1Z0G A;  4FWD A;  4LF5 E;  4U3D A;  4B3S I;  5A2Q C;  4LF9 I;  1N33 E;  4JI0 I;  4X66 I;  1N32 E;  2NN6 F;  4M1K A;  4WUB A;  4DR1 I;  4PRV A;  1XNR E;  5EKW A;  3PRY A;  1DAR A;  1HNW E;  3H1C A;  1R6M A;  4X64 I;  1S16 A;  3GCM A;  1XMO I;  1PIE A;  1H73 A;  1HNZ I;  3P76 A;  4DR6 I;  4JI8 I;  4LFB E;  4BA1 B;  1YHC A;  2NN6 A;  3V2U C;  3WU3 A;  1ELO A;  4IZJ B;  2JT2 A;  5JEA E;  4IZJ D;  4DPU A;  1IBM I;  2ZM6 E;  2NN6 B;  3D4J A;  5K36 E;  2PNM A;  5BR8 I;  2UXD I;  4DUY E;  2NN6 D;  3L7Z A;  3B8H A;  2NPF A;  4YY3 I;  4JI4 E;  3J7A G;  1ZXN A;  2VES A;  4DR7 E;  3T1Y I;  4JI2 I;  2WNR B;  4JV5 I;  1N0U A;  3L7Z B;  3M6A A;  3JAM C;  1FJG I;  1RR9 A;  3J81 Q;  2AJ4 A;  5EL9 A;  3B4T A;  4LF4 I;  1ZXM A;  4KHP I;  1UDO A;  4FW9 A;  5LMU I;  2CGE A;  1KVK A;  3K85 A;  4DR5 I;  2BA0 D;  4DV7 I;  4IS9 A;  1NZ0 A;  1HNX I;  5ELW A;  5IWA I;  4DU8 A;  4YHH I;  3GME A;  2VQE I;  4LOM A;  2UUC E;  1Y60 A;  5FLX Q;  1KKH A;  1E3P A;  1B63 A;  4DR3 I;  4JI1 I;  1U2R A;  4LFA I;  4GKK I;  1OYP A;  2E5L I;  2UUB I;  4LF8 E;  1FI4 A;  1Z59 A;  3CWV A;  2HKE A;  3LTO A;  4DR4 E;  1D6T A;  4MU3 A;  4N3O A;  3Q1Q A;  2VQF E;  1PKP A;  4MDT A;  4LPF A;  4MU1 A;  4ZVI A;  2V34 A;  3DD6 A;  1USV A;  4DV2 I;  4B3R I;  4AID A;  3QT6 A;  4DV6 I;  3WU5 A;  1ZM9 A;  4DV0 I;  3M7N G;  4JI3 I;  5GME A;  5IT9 C;  4GQU A;  4LCH A;  5JEA F;  5K36 F;  3T1H I;  1Z0E A;  4MU0 A;  1IBK E;  1FKA E;  4B3T I;  1EI1 A;  3J81 C;  2HHH I;  1R6L A;  2UUA E;  3CDJ A;  4MYT A;  5LMN I;  3CDI A;  2JEB B;  1Z0B A;  3QT5 A;  4DR2 I;  4LF5 I;  2GS8 A;  2UXC E;  2IES A;  2JEA A;  5K36 A;  1H74 A;  1N33 I;  3ZZU A;  2HKJ A;  4FN5 A;  2F4V E;  5JEA B;  4DV4 I;  1MX0 A;  1N32 I;  5JEA D;  1Y6Z A;  4X62 E;  2Z5C B;  2BA1 G;  2JEA B;  5K36 B;  3J80 Q;  1XNR I;  3GLL A;  4NXM E;  3GON A;  3P3C A;  3B82 A;  5DRO A;  2JE6 A;  5FWK A;  1J5E E;  4IZK A;  1RRE A;  4AIM A;  4DV3 I;  4JI5 I;  2HFS A;  4P7A A;  1IBL E;  3PYF A;  1UDQ A;  3ZZT A;  4DV1 E;  4OX9 I;  1S4E A;  2WP8 A;  4JI7 E;  4DUZ I;  4JI4 I;  4LF9 E;  4GKJ E;  3P3G A;  1VI7 A;  2BM1 A;  4JI0 E;  4IFD C;  1XMQ E;  2WW4 A;  4DU7 A;  4DR1 E;  1H72 C;  4MYU A;  1FWK A;  4BA2 A;  3K17 A;  4ED4 A;  1XNQ E;  1I94 I;  4PRX A;  4Z7Y A;  4MQY A;  1MG7 A;  4FW5 A;  4JYA I;  2XEX A;  4WUC A;  4OKG A;  4X64 E;  3LNU A;  4DV5 E;  2HFU A;  4FW6 A;  4DR6 E;  2Z5E A;  3LPS A;  2UUC I;  2BM0 A;  3HKM A;  2PNZ A;  2GO3 A;  3HUL A;  5C0X C;  3PS3 A;  4B3M E;  2CVE A;  4OO1 C;  1Z5B A;  3M85 D;  4NXN E;  2V2Q A;  3PS2 A;  1A6F A;  4JI2 E;  4LF8 I;  1E3H A;  4KQV A;  1UDN A;  5DRQ A;  2C37 A;  4NBQ A;  4X65 E; 
#chains in the Genus database with same CATH homology
 5ELW A;  4MU3 A;  4MU0 A;  1RHY A;  5DNL A;  4MU4 A;  4QNJ A;  4LPF A;  4MU1 A;  2AE8 A;  2F1D A;  4QNK A;  5DNX A;  5EL9 A;  4LOM A;  5EKW A;  4GQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...