4LOMA

Crystal structure of mycobacterium tuberculosis hisb in complex with its substrate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
191
structure length
191
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Imidazoleglycerol-phosphate dehydratase
total genus 57
structure length 191
sequence length 191
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lomA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lomA02
2F1DA 4GQUA 4QNKA 4MU4A 5DNXA 5EL9A 4LOMA 4MU3A 5EKWA 2AE8A 5ELWA 1RHYA 4MU0A 4QNJA 4LPFA 4MU1A 5DNLA
chains in the Genus database with same CATH superfamily
4MDTA 1IBKE 4JI7I 4YY3E 4LF7E 1XNQI 4FW4A 5K36D 4RPFA 2BR2B 1UDOA 4IFDE 4JI0I 2BM0A 5LMNI 4DV4I 1KTVA 4B3RE 3CWVA 4DUZE 4GKKE 5BR8I 2Z5BA 1U2RA 1E3HA 3KRNA 2DEIA 4JYAI 4HXZA 1N33I 3K1JA 1DARA 4OO1E 3P76A 4DR1I 5IWAI 4FN5A 1ZM3A 2EFGA 1KVKA 4LF7I 5K36C 1XNQE 5JEAF 4JI8I 2Z5BB 4B3MI 4USMA 2BV3A 3M85D 2IESA 1XNRE 1R6MA 2Z5CA 4X64E 2UXDE 1HNXI 3U1YA 4X66I 1Z5AA 2VF3A 2VQEE 4UT4A 1OJ4A 4IFDA 5C0XA 4FW6A 1WUUA 4LF4E 2HK2A 4JI5I 2PNZB 3QT7A 4OO1A 1R6LA 4DPTA 3ZKBA 4YHHI 2ZM6E 1USVA 1Z5CA 4IFDF 2JEAA 2BA0G 3M85G 4JI0E 4U3DA 1I94I 1UDQA 1OYPA 1J5EI 4DR5E 3PYEA 2UUAI 5C0XB 2E5LE 5FWKA 2AE8A 4I3HA 2HHHE 2IOPA 4XTJA 3QT6A 4DU7A 2F4VI 1N33E 4BA1A 1HNZI 1XXEA 2V2QA 2VQFI 5K36B 1RR9A 1S4EA 4DR3I 3Q1QA 2CVEA 4JI5E 2GQ0A 1N0VC 1Z59A 2C37B 5K36E 1B62A 4GKJI 1VISA 4JG4A 4YHHE 1HR0E 3ZKDA 3OTOI 4LF6I 4DR6I 4DV0I 3PYFA 2IOQA 5IT9Q 3B8HA 5GMDA 1EA6A 2UUCE 4P7AA 5A2QC 1Y6ZA 5EL9A 3PS1A 4JV5I 2GO3A 4EMDA 3V5RA 4LOMA 3J81C 1Z0VA 2HFUA 1NHHA 4DR7E 1FI4A 1Z5BA 4DR5I 5IWAE 2E1RA 1UEKA 1IBLE 4KQVA 3H4LA 2UXBI 2Z5CB 4DV7E 2BA0D 5C0XD 2PO2A 1FWKA 4Z7CA 1MG7A 3PYDA 2LJPA 2F4VE 4X66E 2Z5EA 1ZM2A 5DRPA 2OI2A 3J7AM 2CZ9A 2BA1G 2PO1A 2O1TA 3M7ND 4R1FA 3CDJA 4QNJA 1HNWE 3J7AG 3ZZTA 2WP8B 4LCGA 5C0XE 1MU5A 4JI6I 1BKNA 5LL6R 1N32I 2C38B 2A2CA 3NZKA 3QT5A 2X36A 3B82A 1XMQI 3U1KA 3B78A 4QNKA 3PYGA 5DNXA 4LF4I 1VI7A 1PIEA 4DV3I 4HACA 4NXNI 1FJGE 4P52A 2JE6B 4IZJA 5GMEA 5DRQA 4NXME 5ELWA 5L3JA 1KIJA 1ZM9A 2R3VA 4LFAI 1XNRI 2HKJA 3K17A 1J5EE 2UUBE 4DR6E 4FWGA 2O3ZA 1Z0EA 2VQFE 3PS3A 3HJCA 1ELOA 5DRRA 1EI1A 2IERA 2A2DA 4K0KI 4ED4A 1A6FA 4DPUA 4DV2I 4DR4I 2HFSA 4JI4E 4U3BA 2WNRB 1H72C 4GKJE 5IT9C 4JI6E 4UTGA 1S16A 3LTOA 4LCFA 3J80C 4IZKA 4DV4E 2C37A 4PU9A 4JI1E 4JI2I 4LFAE 4DV5E 5K36F 4FWHA 2PO2B 3M6AA 1YH8A 4X62I 4JV5E 2DEJA 4NXNE 5C0XC 1FJGI 4IZKB 2NN6A 1QZRA 2GS8A 3P3EA 3Q6MA 1N34E 3P06A 4LFBI 1IBMI 4KHPI 4DR4E 2NN6D 2WP8A 4USKA 1NHJA 3PRYA 2UXCE 4MQYA 4LCHA 2C38A 1KKHA 1N32E 1E3PA 4PRVA 5JEAA 4OO1B 2JT2A 3P3CA 4OKGA 4X62E 4AIMA 4DV1I 4JI3I 4K0KE 1HK7A 4J3DA 4AQYI 4B3TE 4DV3E 4DPYA 4DV6I 3V2UC 4MU0A 1Y4SA 1N34I 1I94E 2NN6C 3JAMC 5JEAB 4OO1F 3T1HE 4BA2A 4DV7I 2UU9I 4OO1C 4IFDD 2XEXA 3ZM7A 3J80Q 4ISAA 4IS9A 3GONA 1FNMA 2R42A 4DPXA 5FLXC 2HK3A 1K47A 3GMEA 1FKAE 5JEAD 1IBKI 5JEAC 3CDIA 4MU4A 4NXMI 1MX0A 4HACB 1HR0I 2PNLA 2C39B 3P3GA 2NPFA 2UXCI 4FW9A 2JE6A 4LF6E 4IFDC 4FW3A 3D4JA 2Q2EB 5BR8E 2UUBI 4DV1E 4JI3E 4GQUA 1NZ0A 1ZM4A 2C39A 2PNMA 4LF9E 1RREA 2O1UA 4X65I 5A2QQ 4M1KA 4DUYE 2NN6B 4HYMA 3WU5A 3PS2A 3H1CA 1PVGA 2V8PA 2NN6E 4JI7E 3T1YE 4JI4I 4YY3I 1N0UA 1N36E 4JI2E 2WNRA 3F0NA 4IZJD 2J65A 5LMUI 4JI1I 1Z0WA 2BM1A 3WU3A 4Z7YA 2JEAB 4LF5I 4LFCI 4B3SI 1XMOE 4AM3A 4WUBA 2HKEA 4OZEA 2PO1B 4NBQA 2V2ZA 1ZXMA 2PO0B 1UDSA 3DD6A 4DV2E 5C0XF 5FLXQ 1P42A 4KHPE 3LPSA 3JAMQ 2O1VA 4MYUA 4AQYE 1Y5YA 2JEBA 2ZBKB 4DR1E 4DXLA 2UUAE 3T1YI 1N36I 1D6TA 1XHKA 3GLLA 4DV5I 2PO0A 4JI8E 4B3ME 4BA2B 5DNLA 1H7SA 1H7UA 1OYRA 5LMUE 4DR2I 4OX9I 2UU9E 2V34A 4PRXA 4DV0E 4LF9I 4IZJB 4JYAE 1YHCA 5DROA 3J81Q 2BA1D 5JEAE 4LPFA 4MYTA 1Y4UA 5EKWA 4N3OA 1Z0GA 4LF8E 2J7KA 2AJ4A 4DV6E 3M7NG 3UHMA 4DR7I 1USUA 1RHYA 1PKPA 2O1WA 4B3RI 3GCMA 2VQEI 4WUDA 4HY1A 4FW7A 4FWDA 4MU1A 3LNUA 3B4TA 4FW5A 4DUYI 4DR3E 4LF8I 4LFBE 3T1HI 1IBME 4URLA 1H73A 2ZM6I 1IBLI 4OO1D 4MU3A 3QT8A 2VESA 1HNXE 2GO4A 1H74A 2F1DA 1Z0CA 5LMNE 3L7ZA 2E5LI 3K85A 2X7IA 2HHHI 1XMOI 4IFDB 1B63A 4ZVIA 3ZZ0A 2CG9A 1FWLA 1UDNA 2PNZA 3WU6A 1HNWI 4X65E 2CGEA 4DU8A 3L7ZB 2JEBB 3HULA 2WW4A 3HKMA 3Q6NA 2ZITA 2V2VA 1XMQE 3OTOE 1OYSA 4DUZI 1Z0BA 4GKKI 2NN6F 4X64I 2UXDI 1NHIA 2UXBE 4DR2E 2BR2A 4OX9E 4LF5E 4WUCA 4B3SE 4LFCE 1Z0TA 4AIDA 1HNZE 1ZXNA 4DPWA 2UUCI 4BA1B 4B3TI 1Y60A 3ZZUA 5K36A 3WU4A
chains in the Genus database with same CATH topology
2F1DA 4GQUA 4QNKA 4MU4A 5DNXA 5EL9A 4LOMA 4MU3A 5EKWA 2AE8A 5ELWA 1RHYA 4MU0A 4QNJA 4LPFA 4MU1A 5DNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1D A;  4GQU A;  4QNK A;  4MU4 A;  5DNX A;  5EL9 A;  4LOM A;  4MU3 A;  5EKW A;  2AE8 A;  5ELW A;  1RHY A;  4MU0 A;  4QNJ A;  4LPF A;  4MU1 A;  5DNL A; 
#chains in the Genus database with same CATH topology
 4MDT A;  1IBK E;  4JI7 I;  4YY3 E;  4LF7 E;  1XNQ I;  4FW4 A;  5K36 D;  4RPF A;  2BR2 B;  1UDO A;  4IFD E;  4JI0 I;  2BM0 A;  5LMN I;  4DV4 I;  1KTV A;  4B3R E;  3CWV A;  4DUZ E;  4GKK E;  5BR8 I;  2Z5B A;  1U2R A;  1E3H A;  3KRN A;  2DEI A;  4JYA I;  4HXZ A;  1N33 I;  3K1J A;  1DAR A;  4OO1 E;  3P76 A;  4DR1 I;  5IWA I;  4FN5 A;  1ZM3 A;  2EFG A;  1KVK A;  4LF7 I;  5K36 C;  1XNQ E;  5JEA F;  4JI8 I;  2Z5B B;  4B3M I;  4USM A;  2BV3 A;  3M85 D;  2IES A;  1XNR E;  1R6M A;  2Z5C A;  4X64 E;  2UXD E;  1HNX I;  3U1Y A;  4X66 I;  1Z5A A;  2VF3 A;  2VQE E;  4UT4 A;  1OJ4 A;  4IFD A;  5C0X A;  4FW6 A;  1WUU A;  4LF4 E;  2HK2 A;  4JI5 I;  2PNZ B;  3QT7 A;  4OO1 A;  1R6L A;  4DPT A;  3ZKB A;  4YHH I;  2ZM6 E;  1USV A;  1Z5C A;  4IFD F;  2JEA A;  2BA0 G;  3M85 G;  4JI0 E;  4U3D A;  1I94 I;  1UDQ A;  1OYP A;  1J5E I;  4DR5 E;  3PYE A;  2UUA I;  5C0X B;  2E5L E;  5FWK A;  2AE8 A;  4I3H A;  2HHH E;  2IOP A;  4XTJ A;  3QT6 A;  4DU7 A;  2F4V I;  1N33 E;  4BA1 A;  1HNZ I;  1XXE A;  2V2Q A;  2VQF I;  5K36 B;  1RR9 A;  1S4E A;  4DR3 I;  3Q1Q A;  2CVE A;  4JI5 E;  2GQ0 A;  1N0V C;  1Z59 A;  2C37 B;  5K36 E;  1B62 A;  4GKJ I;  1VIS A;  4JG4 A;  4YHH E;  1HR0 E;  3ZKD A;  3OTO I;  4LF6 I;  4DR6 I;  4DV0 I;  3PYF A;  2IOQ A;  5IT9 Q;  3B8H A;  5GMD A;  1EA6 A;  2UUC E;  4P7A A;  5A2Q C;  1Y6Z A;  5EL9 A;  3PS1 A;  4JV5 I;  2GO3 A;  4EMD A;  3V5R A;  4LOM A;  3J81 C;  1Z0V A;  2HFU A;  1NHH A;  4DR7 E;  1FI4 A;  1Z5B A;  4DR5 I;  5IWA E;  2E1R A;  1UEK A;  1IBL E;  4KQV A;  3H4L A;  2UXB I;  2Z5C B;  4DV7 E;  2BA0 D;  5C0X D;  2PO2 A;  1FWK A;  4Z7C A;  1MG7 A;  3PYD A;  2LJP A;  2F4V E;  4X66 E;  2Z5E A;  1ZM2 A;  5DRP A;  2OI2 A;  3J7A M;  2CZ9 A;  2BA1 G;  2PO1 A;  2O1T A;  3M7N D;  4R1F A;  3CDJ A;  4QNJ A;  1HNW E;  3J7A G;  3ZZT A;  2WP8 B;  4LCG A;  5C0X E;  1MU5 A;  4JI6 I;  1BKN A;  5LL6 R;  1N32 I;  2C38 B;  2A2C A;  3NZK A;  3QT5 A;  2X36 A;  3B82 A;  1XMQ I;  3U1K A;  3B78 A;  4QNK A;  3PYG A;  5DNX A;  4LF4 I;  1VI7 A;  1PIE A;  4DV3 I;  4HAC A;  4NXN I;  1FJG E;  4P52 A;  2JE6 B;  4IZJ A;  5GME A;  5DRQ A;  4NXM E;  5ELW A;  5L3J A;  1KIJ A;  1ZM9 A;  2R3V A;  4LFA I;  1XNR I;  2HKJ A;  3K17 A;  1J5E E;  2UUB E;  4DR6 E;  4FWG A;  2O3Z A;  1Z0E A;  2VQF E;  3PS3 A;  3HJC A;  1ELO A;  5DRR A;  1EI1 A;  2IER A;  2A2D A;  4K0K I;  4ED4 A;  1A6F A;  4DPU A;  4DV2 I;  4DR4 I;  2HFS A;  4JI4 E;  4U3B A;  2WNR B;  1H72 C;  4GKJ E;  5IT9 C;  4JI6 E;  4UTG A;  1S16 A;  3LTO A;  4LCF A;  3J80 C;  4IZK A;  4DV4 E;  2C37 A;  4PU9 A;  4JI1 E;  4JI2 I;  4LFA E;  4DV5 E;  5K36 F;  4FWH A;  2PO2 B;  3M6A A;  1YH8 A;  4X62 I;  4JV5 E;  2DEJ A;  4NXN E;  5C0X C;  1FJG I;  4IZK B;  2NN6 A;  1QZR A;  2GS8 A;  3P3E A;  3Q6M A;  1N34 E;  3P06 A;  4LFB I;  1IBM I;  4KHP I;  4DR4 E;  2NN6 D;  2WP8 A;  4USK A;  1NHJ A;  3PRY A;  2UXC E;  4MQY A;  4LCH A;  2C38 A;  1KKH A;  1N32 E;  1E3P A;  4PRV A;  5JEA A;  4OO1 B;  2JT2 A;  3P3C A;  4OKG A;  4X62 E;  4AIM A;  4DV1 I;  4JI3 I;  4K0K E;  1HK7 A;  4J3D A;  4AQY I;  4B3T E;  4DV3 E;  4DPY A;  4DV6 I;  3V2U C;  4MU0 A;  1Y4S A;  1N34 I;  1I94 E;  2NN6 C;  3JAM C;  5JEA B;  4OO1 F;  3T1H E;  4BA2 A;  4DV7 I;  2UU9 I;  4OO1 C;  4IFD D;  2XEX A;  3ZM7 A;  3J80 Q;  4ISA A;  4IS9 A;  3GON A;  1FNM A;  2R42 A;  4DPX A;  5FLX C;  2HK3 A;  1K47 A;  3GME A;  1FKA E;  5JEA D;  1IBK I;  5JEA C;  3CDI A;  4MU4 A;  4NXM I;  1MX0 A;  4HAC B;  1HR0 I;  2PNL A;  2C39 B;  3P3G A;  2NPF A;  2UXC I;  4FW9 A;  2JE6 A;  4LF6 E;  4IFD C;  4FW3 A;  3D4J A;  2Q2E B;  5BR8 E;  2UUB I;  4DV1 E;  4JI3 E;  4GQU A;  1NZ0 A;  1ZM4 A;  2C39 A;  2PNM A;  4LF9 E;  1RRE A;  2O1U A;  4X65 I;  5A2Q Q;  4M1K A;  4DUY E;  2NN6 B;  4HYM A;  3WU5 A;  3PS2 A;  3H1C A;  1PVG A;  2V8P A;  2NN6 E;  4JI7 E;  3T1Y E;  4JI4 I;  4YY3 I;  1N0U A;  1N36 E;  4JI2 E;  2WNR A;  3F0N A;  4IZJ D;  2J65 A;  5LMU I;  4JI1 I;  1Z0W A;  2BM1 A;  3WU3 A;  4Z7Y A;  2JEA B;  4LF5 I;  4LFC I;  4B3S I;  1XMO E;  4AM3 A;  4WUB A;  2HKE A;  4OZE A;  2PO1 B;  4NBQ A;  2V2Z A;  1ZXM A;  2PO0 B;  1UDS A;  3DD6 A;  4DV2 E;  5C0X F;  5FLX Q;  1P42 A;  4KHP E;  3LPS A;  3JAM Q;  2O1V A;  4MYU A;  4AQY E;  1Y5Y A;  2JEB A;  2ZBK B;  4DR1 E;  4DXL A;  2UUA E;  3T1Y I;  1N36 I;  1D6T A;  1XHK A;  3GLL A;  4DV5 I;  2PO0 A;  4JI8 E;  4B3M E;  4BA2 B;  5DNL A;  1H7S A;  1H7U A;  1OYR A;  5LMU E;  4DR2 I;  4OX9 I;  2UU9 E;  2V34 A;  4PRX A;  4DV0 E;  4LF9 I;  4IZJ B;  4JYA E;  1YHC A;  5DRO A;  3J81 Q;  2BA1 D;  5JEA E;  4LPF A;  4MYT A;  1Y4U A;  5EKW A;  4N3O A;  1Z0G A;  4LF8 E;  2J7K A;  2AJ4 A;  4DV6 E;  3M7N G;  3UHM A;  4DR7 I;  1USU A;  1RHY A;  1PKP A;  2O1W A;  4B3R I;  3GCM A;  2VQE I;  4WUD A;  4HY1 A;  4FW7 A;  4FWD A;  4MU1 A;  3LNU A;  3B4T A;  4FW5 A;  4DUY I;  4DR3 E;  4LF8 I;  4LFB E;  3T1H I;  1IBM E;  4URL A;  1H73 A;  2ZM6 I;  1IBL I;  4OO1 D;  4MU3 A;  3QT8 A;  2VES A;  1HNX E;  2GO4 A;  1H74 A;  2F1D A;  1Z0C A;  5LMN E;  3L7Z A;  2E5L I;  3K85 A;  2X7I A;  2HHH I;  1XMO I;  4IFD B;  1B63 A;  4ZVI A;  3ZZ0 A;  2CG9 A;  1FWL A;  1UDN A;  2PNZ A;  3WU6 A;  1HNW I;  4X65 E;  2CGE A;  4DU8 A;  3L7Z B;  2JEB B;  3HUL A;  2WW4 A;  3HKM A;  3Q6N A;  2ZIT A;  2V2V A;  1XMQ E;  3OTO E;  1OYS A;  4DUZ I;  1Z0B A;  4GKK I;  2NN6 F;  4X64 I;  2UXD I;  1NHI A;  2UXB E;  4DR2 E;  2BR2 A;  4OX9 E;  4LF5 E;  4WUC A;  4B3S E;  4LFC E;  1Z0T A;  4AID A;  1HNZ E;  1ZXN A;  4DPW A;  2UUC I;  4BA1 B;  4B3T I;  1Y60 A;  3ZZU A;  5K36 A;  3WU4 A; 
#chains in the Genus database with same CATH homology
 2F1D A;  4GQU A;  4QNK A;  4MU4 A;  5DNX A;  5EL9 A;  4LOM A;  4MU3 A;  5EKW A;  2AE8 A;  5ELW A;  1RHY A;  4MU0 A;  4QNJ A;  4LPF A;  4MU1 A;  5DNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...