4LOMA

Crystal structure of mycobacterium tuberculosis hisb in complex with its substrate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
191
structure length
191
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 57
structure length 191
sequence length 191
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lomA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lomA02
4MU0A 5EKWA 1RHYA 2F1DA 4GQUA 4MU3A 4MU1A 4QNJA 5DNLA 4LOMA 4MU4A 2AE8A 4QNKA 5DNXA 5ELWA 4LPFA 5EL9A
chains in the Genus database with same CATH superfamily
1ZM3A 3PS2A 4JI0E 4JI5I 2UXDI 1HNWE 4B3SI 5BR8E 3OTOI 2UXCI 4OO1F 4JYAI 4OZEA 4LFBI 2X36A 5K36F 3UHMA 4DPWA 2JE6A 1ZM2A 4PU9A 1B62A 3ZM7A 4IFDF 4LCGA 5DROA 4K0KE 2VQFI 3PYFA 3L7ZA 1ZXMA 1XMQE 1NHHA 1Z0CA 3V5RA 1N0VC 2IERA 2NN6F 2HHHE 4LOMA 4DR1E 1ELOA 5GMEA 1HNZE 1MX0A 3QT7A 4YY3I 4DV2I 3U1YA 2WNRA 1UEKA 4LF8E 3DD6A 3M7ND 2C37A 2IOQA 4UT4A 1N36E 2VESA 3K17A 4B3TE 4OO1E 4QNKA 5A2QQ 1FNMA 3P3GA 4DPUA 3ZKDA 3T1YE 5K36E 1VI7A 4J3DA 5FLXQ 4JG4A 4JI5E 4BA1B 5L3JA 3H1CA 2UXCE 4DR7I 1BKNA 2AE8A 4LFBE 2ZITA 3J80C 1Z0GA 2NN6E 2BM0A 4FW6A 2V8PA 4N3OA 4FWHA 5LMUI 3GCMA 1K47A 1HNXI 4HACA 4PRVA 4FW4A 4BA2B 3PYGA 4DPYA 2HK2A 1EA6A 4JI2I 4OKGA 1XNQI 4YY3E 4DV2E 1H7UA 4DUZE 2WP8B 2PO1A 4LF9E 4OO1C 2HKJA 1Z59A 4DPTA 2BM1A 5K36C 4OO1D 3B78A 2BR2B 1NHIA 4DU8A 1XNRI 2O1VA 1HNWI 5K36D 3B4TA 5BR8I 4DV4I 1KIJA 2O3ZA 1KTVA 3CDJA 4OX9I 4QNJA 1U2RA 2E5LI 3J81C 2HFUA 2Z5BB 1OYSA 1UDQA 3LNUA 3M85G 2NN6C 2J65A 5JEAA 2UUAI 4FWGA 1OJ4A 4JI3E 2NN6D 4LF4I 4HXZA 3PRYA 2UU9I 5LL6R 5LMUE 4URLA 2JT2A 1OYPA 3K85A 1Z0EA 1HNXE 4DR1I 4ISAA 4DUYI 4DV5I 1MG7A 1HNZI 3P3CA 2UUBI 4LCHA 1FI4A 4KQVA 4DR4I 2PNZA 4JI2E 4MYTA 5IT9Q 1N0UA 5C0XA 1Y6ZA 4Z7YA 2Z5CB 4U3DA 5ELWA 4KHPI 1S16A 1XNRE 1J5EE 1H73A 3HJCA 4IZKA 4DV4E 4MU1A 4LFAI 1Y4SA 2A2DA 2O1UA 3Q6NA 5DNXA 1Z5AA 4OX9E 3P3EA 2E5LE 3KRNA 3HKMA 2AJ4A 1Z0VA 2UUAE 1QZRA 3F0NA 3WU5A 2F4VI 4AM3A 5EKWA 4X65I 3WU6A 4LF4E 2LJPA 4IS9A 2X7IA 1USUA 2IOPA 2UU9E 4DR6I 1E3HA 4LFCI 5DNLA 2R3VA 1EI1A 1N33E 4WUDA 4DUYE 4DV5E 4HY1A 2UUBE 2DEIA 4DUZI 1ZM9A 4DR4E 1PKPA 4LF9I 1YHCA 1Z0WA 1S4EA 4IZJB 1D6TA 5LMNI 2DEJA 5JEAF 3GMEA 2XEXA 4MU4A 3ZKBA 4KHPE 2GO3A 5EL9A 4IFDE 3B82A 4DPXA 4WUBA 1YH8A 4LFAE 4B3MI 1N34I 4WUCA 4JI3I 3QT8A 1ZXNA 1HK7A 4HYMA 4IZJD 1IBKI 4DV1I 2F4VE 4OO1B 4X65E 2BV3A 4FW3A 4U3BA 2VF3A 1XMOI 5K36B 3LPSA 4M1KA 4DR6E 1Y4UA 3GLLA 5C0XF 2F1DA 4LFCE 4IFDB 2WW4A 4BA1A 4ED4A 2BA1D 3M6AA 1E3PA 5IWAI 2ZM6I 4USKA 5JEAE 4MU3A 2JEAB 2NN6B 2PO2B 1ZM4A 1RHYA 3PS1A 1XHKA 2PO0B 1FWKA 1OYRA 5LMNE 1J5EI 4IFDC 2PNMA 1IBLE 2BA0D 2UUCE 2GO4A 1IBMI 4IFDD 3P76A 1R6LA 3M7NG 1R6MA 4BA2A 1FJGI 3JAMC 1RR9A 4FN5A 2CGEA 2VQEI 1N34E 1Y60A 3Q6MA 2WP8A 2CG9A 5C0XE 2V2QA 2JEBB 2Q2EB 4DR2E 4XTJA 3ZZUA 1IBKE 1NHJA 4DV1E 2BR2A 1WUUA 4GKJE 3J80Q 1XMOE 3LTOA 4FW9A 2C39B 1N33I 4X64E 5DRQA 2V2ZA 5JEAC 4MQYA 4DV6I 4LF6I 2C38B 5IWAE 2ZM6E 5JEAD 2Z5BA 4I3HA 2UXBI 4JI1I 4LF5E 4GQUA 2BA1G 2EFGA 5GMDA 4DV7I 4X62I 1Z5BA 1XXEA 1IBME 4LCFA 3D4JA 3PYEA 1PIEA 2JE6B 1FJGE 5A2QC 3V2UC 2VQEE 5C0XC 1HR0I 5FLXC 3NZKA 5DRRA 4LF7E 4X66E 5C0XD 3L7ZB 2V34A 3J81Q 2HK3A 4LPFA 1A6FA 2Z5CA 1I94I 1DARA 1MU5A 4MU0A 4DR3E 4JI7I 3K1JA 4DV6E 2WNRB 4YHHI 4LF6E 4MDTA 2C37B 3PS3A 2HFSA 4P7AA 2UXBE 4JI1E 4JI8E 3WU4A 2E1RA 4USMA 1IBLI 2UUCI 4GKKI 1H74A 3QT5A 4DV0E 4DR5I 4NXNE 4DV7E 1RREA 2IESA 4FW7A 4X62E 4NXMI 4B3RI 1HR0E 1B63A 3T1HI 4DR2I 1N32I 2O1TA 4DV3I 4JI4E 4FWDA 2V2VA 3B8HA 4IZJA 4DXLA 4B3ME 3M85D 4GKJI 4HACB 3HULA 2UXDE 4X64I 1I94E 4B3SE 4Z7CA 3OTOE 3J7AG 2A2CA 3WU3A 4JYAE 4JI7E 4RPFA 2PO1B 4YHHE 2O1WA 2PNLA 4AIDA 2Z5EA 3U1KA 4LF5I 2CZ9A 4AQYI 4DU7A 3CWVA 4JI6I 1FWLA 4OO1A 1KKHA 2VQFE 1NZ0A 1H72C 5K36A 3ZZTA 4GKKE 5IT9C 3ZZ0A 4DR5E 4IFDA 3GONA 1USVA 1PVGA 4NXME 4B3RE 3P06A 5JEAB 1Z5CA 3PYDA 4JV5I 1KVKA 4FW5A 1Y5YA 4LF7I 4X66I 5DRPA 1VISA 3T1HE 2JEAA 4R1FA 1N32E 2NN6A 2PO2A 4DV3E 4JI0I 4MYUA 4EMDA 4PRXA 2PO0A 3Q1QA 4AIMA 1H7SA 4DR3I 1Z0BA 2PNZB 2CVEA 3H4LA 4P52A 4DR7E 2NPFA 4K0KI 2OI2A 5C0XB 4JI8I 4NBQA 1UDSA 1Z0TA 2J7KA 2GQ0A 4AQYE 2JEBA 1XMQI 4JI6E 4DV0I 3CDIA 4IZKB 1UDOA 2HHHI 4UTGA 4NXNI 3J7AM 2C39A 1FKAE 4ZVIA 2R42A 1P42A 5FWKA 4LF8I 1XNQE 2C38A 4JV5E 2BA0G 2GS8A 1UDNA 1N36I 4JI4I 4B3TI 2HKEA 3JAMQ 3QT6A 2ZBKB 3T1YI
chains in the Genus database with same CATH topology
4MU0A 5EKWA 1RHYA 2F1DA 4GQUA 4MU3A 4MU1A 4QNJA 5DNLA 4LOMA 4MU4A 2AE8A 4QNKA 5DNXA 5ELWA 4LPFA 5EL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MU0 A;  5EKW A;  1RHY A;  2F1D A;  4GQU A;  4MU3 A;  4MU1 A;  4QNJ A;  5DNL A;  4LOM A;  4MU4 A;  2AE8 A;  4QNK A;  5DNX A;  5ELW A;  4LPF A;  5EL9 A; 
#chains in the Genus database with same CATH topology
 1ZM3 A;  3PS2 A;  4JI0 E;  4JI5 I;  2UXD I;  1HNW E;  4B3S I;  5BR8 E;  3OTO I;  2UXC I;  4OO1 F;  4JYA I;  4OZE A;  4LFB I;  2X36 A;  5K36 F;  3UHM A;  4DPW A;  2JE6 A;  1ZM2 A;  4PU9 A;  1B62 A;  3ZM7 A;  4IFD F;  4LCG A;  5DRO A;  4K0K E;  2VQF I;  3PYF A;  3L7Z A;  1ZXM A;  1XMQ E;  1NHH A;  1Z0C A;  3V5R A;  1N0V C;  2IER A;  2NN6 F;  2HHH E;  4LOM A;  4DR1 E;  1ELO A;  5GME A;  1HNZ E;  1MX0 A;  3QT7 A;  4YY3 I;  4DV2 I;  3U1Y A;  2WNR A;  1UEK A;  4LF8 E;  3DD6 A;  3M7N D;  2C37 A;  2IOQ A;  4UT4 A;  1N36 E;  2VES A;  3K17 A;  4B3T E;  4OO1 E;  4QNK A;  5A2Q Q;  1FNM A;  3P3G A;  4DPU A;  3ZKD A;  3T1Y E;  5K36 E;  1VI7 A;  4J3D A;  5FLX Q;  4JG4 A;  4JI5 E;  4BA1 B;  5L3J A;  3H1C A;  2UXC E;  4DR7 I;  1BKN A;  2AE8 A;  4LFB E;  2ZIT A;  3J80 C;  1Z0G A;  2NN6 E;  2BM0 A;  4FW6 A;  2V8P A;  4N3O A;  4FWH A;  5LMU I;  3GCM A;  1K47 A;  1HNX I;  4HAC A;  4PRV A;  4FW4 A;  4BA2 B;  3PYG A;  4DPY A;  2HK2 A;  1EA6 A;  4JI2 I;  4OKG A;  1XNQ I;  4YY3 E;  4DV2 E;  1H7U A;  4DUZ E;  2WP8 B;  2PO1 A;  4LF9 E;  4OO1 C;  2HKJ A;  1Z59 A;  4DPT A;  2BM1 A;  5K36 C;  4OO1 D;  3B78 A;  2BR2 B;  1NHI A;  4DU8 A;  1XNR I;  2O1V A;  1HNW I;  5K36 D;  3B4T A;  5BR8 I;  4DV4 I;  1KIJ A;  2O3Z A;  1KTV A;  3CDJ A;  4OX9 I;  4QNJ A;  1U2R A;  2E5L I;  3J81 C;  2HFU A;  2Z5B B;  1OYS A;  1UDQ A;  3LNU A;  3M85 G;  2NN6 C;  2J65 A;  5JEA A;  2UUA I;  4FWG A;  1OJ4 A;  4JI3 E;  2NN6 D;  4LF4 I;  4HXZ A;  3PRY A;  2UU9 I;  5LL6 R;  5LMU E;  4URL A;  2JT2 A;  1OYP A;  3K85 A;  1Z0E A;  1HNX E;  4DR1 I;  4ISA A;  4DUY I;  4DV5 I;  1MG7 A;  1HNZ I;  3P3C A;  2UUB I;  4LCH A;  1FI4 A;  4KQV A;  4DR4 I;  2PNZ A;  4JI2 E;  4MYT A;  5IT9 Q;  1N0U A;  5C0X A;  1Y6Z A;  4Z7Y A;  2Z5C B;  4U3D A;  5ELW A;  4KHP I;  1S16 A;  1XNR E;  1J5E E;  1H73 A;  3HJC A;  4IZK A;  4DV4 E;  4MU1 A;  4LFA I;  1Y4S A;  2A2D A;  2O1U A;  3Q6N A;  5DNX A;  1Z5A A;  4OX9 E;  3P3E A;  2E5L E;  3KRN A;  3HKM A;  2AJ4 A;  1Z0V A;  2UUA E;  1QZR A;  3F0N A;  3WU5 A;  2F4V I;  4AM3 A;  5EKW A;  4X65 I;  3WU6 A;  4LF4 E;  2LJP A;  4IS9 A;  2X7I A;  1USU A;  2IOP A;  2UU9 E;  4DR6 I;  1E3H A;  4LFC I;  5DNL A;  2R3V A;  1EI1 A;  1N33 E;  4WUD A;  4DUY E;  4DV5 E;  4HY1 A;  2UUB E;  2DEI A;  4DUZ I;  1ZM9 A;  4DR4 E;  1PKP A;  4LF9 I;  1YHC A;  1Z0W A;  1S4E A;  4IZJ B;  1D6T A;  5LMN I;  2DEJ A;  5JEA F;  3GME A;  2XEX A;  4MU4 A;  3ZKB A;  4KHP E;  2GO3 A;  5EL9 A;  4IFD E;  3B82 A;  4DPX A;  4WUB A;  1YH8 A;  4LFA E;  4B3M I;  1N34 I;  4WUC A;  4JI3 I;  3QT8 A;  1ZXN A;  1HK7 A;  4HYM A;  4IZJ D;  1IBK I;  4DV1 I;  2F4V E;  4OO1 B;  4X65 E;  2BV3 A;  4FW3 A;  4U3B A;  2VF3 A;  1XMO I;  5K36 B;  3LPS A;  4M1K A;  4DR6 E;  1Y4U A;  3GLL A;  5C0X F;  2F1D A;  4LFC E;  4IFD B;  2WW4 A;  4BA1 A;  4ED4 A;  2BA1 D;  3M6A A;  1E3P A;  5IWA I;  2ZM6 I;  4USK A;  5JEA E;  4MU3 A;  2JEA B;  2NN6 B;  2PO2 B;  1ZM4 A;  1RHY A;  3PS1 A;  1XHK A;  2PO0 B;  1FWK A;  1OYR A;  5LMN E;  1J5E I;  4IFD C;  2PNM A;  1IBL E;  2BA0 D;  2UUC E;  2GO4 A;  1IBM I;  4IFD D;  3P76 A;  1R6L A;  3M7N G;  1R6M A;  4BA2 A;  1FJG I;  3JAM C;  1RR9 A;  4FN5 A;  2CGE A;  2VQE I;  1N34 E;  1Y60 A;  3Q6M A;  2WP8 A;  2CG9 A;  5C0X E;  2V2Q A;  2JEB B;  2Q2E B;  4DR2 E;  4XTJ A;  3ZZU A;  1IBK E;  1NHJ A;  4DV1 E;  2BR2 A;  1WUU A;  4GKJ E;  3J80 Q;  1XMO E;  3LTO A;  4FW9 A;  2C39 B;  1N33 I;  4X64 E;  5DRQ A;  2V2Z A;  5JEA C;  4MQY A;  4DV6 I;  4LF6 I;  2C38 B;  5IWA E;  2ZM6 E;  5JEA D;  2Z5B A;  4I3H A;  2UXB I;  4JI1 I;  4LF5 E;  4GQU A;  2BA1 G;  2EFG A;  5GMD A;  4DV7 I;  4X62 I;  1Z5B A;  1XXE A;  1IBM E;  4LCF A;  3D4J A;  3PYE A;  1PIE A;  2JE6 B;  1FJG E;  5A2Q C;  3V2U C;  2VQE E;  5C0X C;  1HR0 I;  5FLX C;  3NZK A;  5DRR A;  4LF7 E;  4X66 E;  5C0X D;  3L7Z B;  2V34 A;  3J81 Q;  2HK3 A;  4LPF A;  1A6F A;  2Z5C A;  1I94 I;  1DAR A;  1MU5 A;  4MU0 A;  4DR3 E;  4JI7 I;  3K1J A;  4DV6 E;  2WNR B;  4YHH I;  4LF6 E;  4MDT A;  2C37 B;  3PS3 A;  2HFS A;  4P7A A;  2UXB E;  4JI1 E;  4JI8 E;  3WU4 A;  2E1R A;  4USM A;  1IBL I;  2UUC I;  4GKK I;  1H74 A;  3QT5 A;  4DV0 E;  4DR5 I;  4NXN E;  4DV7 E;  1RRE A;  2IES A;  4FW7 A;  4X62 E;  4NXM I;  4B3R I;  1HR0 E;  1B63 A;  3T1H I;  4DR2 I;  1N32 I;  2O1T A;  4DV3 I;  4JI4 E;  4FWD A;  2V2V A;  3B8H A;  4IZJ A;  4DXL A;  4B3M E;  3M85 D;  4GKJ I;  4HAC B;  3HUL A;  2UXD E;  4X64 I;  1I94 E;  4B3S E;  4Z7C A;  3OTO E;  3J7A G;  2A2C A;  3WU3 A;  4JYA E;  4JI7 E;  4RPF A;  2PO1 B;  4YHH E;  2O1W A;  2PNL A;  4AID A;  2Z5E A;  3U1K A;  4LF5 I;  2CZ9 A;  4AQY I;  4DU7 A;  3CWV A;  4JI6 I;  1FWL A;  4OO1 A;  1KKH A;  2VQF E;  1NZ0 A;  1H72 C;  5K36 A;  3ZZT A;  4GKK E;  5IT9 C;  3ZZ0 A;  4DR5 E;  4IFD A;  3GON A;  1USV A;  1PVG A;  4NXM E;  4B3R E;  3P06 A;  5JEA B;  1Z5C A;  3PYD A;  4JV5 I;  1KVK A;  4FW5 A;  1Y5Y A;  4LF7 I;  4X66 I;  5DRP A;  1VIS A;  3T1H E;  2JEA A;  4R1F A;  1N32 E;  2NN6 A;  2PO2 A;  4DV3 E;  4JI0 I;  4MYU A;  4EMD A;  4PRX A;  2PO0 A;  3Q1Q A;  4AIM A;  1H7S A;  4DR3 I;  1Z0B A;  2PNZ B;  2CVE A;  3H4L A;  4P52 A;  4DR7 E;  2NPF A;  4K0K I;  2OI2 A;  5C0X B;  4JI8 I;  4NBQ A;  1UDS A;  1Z0T A;  2J7K A;  2GQ0 A;  4AQY E;  2JEB A;  1XMQ I;  4JI6 E;  4DV0 I;  3CDI A;  4IZK B;  1UDO A;  2HHH I;  4UTG A;  4NXN I;  3J7A M;  2C39 A;  1FKA E;  4ZVI A;  2R42 A;  1P42 A;  5FWK A;  4LF8 I;  1XNQ E;  2C38 A;  4JV5 E;  2BA0 G;  2GS8 A;  1UDN A;  1N36 I;  4JI4 I;  4B3T I;  2HKE A;  3JAM Q;  3QT6 A;  2ZBK B;  3T1Y I; 
#chains in the Genus database with same CATH homology
 4MU0 A;  5EKW A;  1RHY A;  2F1D A;  4GQU A;  4MU3 A;  4MU1 A;  4QNJ A;  5DNL A;  4LOM A;  4MU4 A;  2AE8 A;  4QNK A;  5DNX A;  5ELW A;  4LPF A;  5EL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...