4OX9E

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ox9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9E02
4X64I 4DR7I 4LFBI 3CWVA 1O0WA 1B62A 3QT8A 1WUUA 4JG4A 4MYUA 1IBKE 4WUBA 4DV6I 4KHPI 4GKJE 2DEJA 5IT9C 2B3TB 4DV1I 1H72C 4JI6E 2UXDE 1UILA 5LMNI 4DR7E 4LF6I 2KHXA 2LTSA 3JAMQ 1T4NA 4JI2I 4LF4I 4OX9I 2LTRA 4DR6I 5LMUE 1Z0CA 4NXME 1ELOA 4X62E 1MU5A 4GKKI 4OX9E 4PRVA 2DEIA 1J5EI 4DUZI 4KQVA 1Z5BA 2NUGA 4GKKE 1Z0BA 1PIEA 3PYGA 1FJGE 2HK2A 2UUCE 4DKKA 3ADLA 1Z0TA 2HFSA 4JI1E 1WHNA 2UXBI 3LPSA 4DU8A 1ZXMA 1NHIA 3VYYA 2NUFA 1H73A 4JYAE 4NXNI 2UXBE 1X47A 3HULA 4DV5I 3J7AM 1N32I 4DR1I 5FLXQ 3ADIA 4LF6E 3PYDA 1UHZA 1N33I 3B8HA 2L3CA 1IBMI 4JI4E 4DR5I 2UUCI 2V2QA 1EI1A 1A6FA 3V5RA 4B3RE 4LFCI 2F4VI 1FKAE 4AQYI 1HNWI 2AJ4A 1Z0EA 2RS6A 4LFCE 2VQEE 5BR8E 4LFAI 4B3SI 1N34E 4AQYE 4JI1I 2E5LE 3F0NA 2V2ZA 4YHHE 1U2RA 4MYTA 3B82A 3LTOA 2EFGA 1N32E 5IT9Q 1WHQA 3C4BA 3WU5A 1KVKA 1EA6A 1N0VC 2V8PA 4HY1A 1FWLA 3JAMC 4DPWA 4PU9A 2UU9I 4LF8E 3K17A 4UT4A 3QT6A 4B3TE 1XNQE 4LF7E 1MG7A 2L33A 1XMOE 1KIJA 5A2QC 1I94E 1ZM3A 5LL6R 1N33E 3D4JA 1KKHA 4JI5I 2VQFI 1IBME 1DI2A 1XNQI 4JI3I 4WYQB 1VISA 4FWGA 1J26A 2HFUA 1T4OA 3J80C 3WU3A 4FW9A 2HHHI 2UUAE 1Z0VA 4HACA 1HNZE 5LMNE 4DR4I 1N36E 1HR0I 2ZBKB 4P52A 2LJPA 2L2KB 4X64E 4URLA 2E5LI 2DIXA 4X66E 1IBKI 2NPFA 4X62I 4X65I 5GMDA 4I3HA 1J5EE 3H4LA 4DUZE 4DV2E 4DR3I 2UXCE 1EKZA 3J7AG 3WU4A 3ZZTA 1S4EA 2JY9A 2UUAI 4DR6E 1X48A 1HNZI 4R1FA 2RSMA 2GS8A 1RREA 1RC7A 4GKJI 2XEXA 4LF9I 4DV1E 2V2VA 2LRSA 1IBLI 2UXDI 1ZBTA 2X36A 1PVGA 2HKEA 4DV0I 2LBSB 1FNMA 4LFBE 4USMA 3PYEA 2RTXA 4DV0E 2HKJA 1N36I 4JI7E 3T1HE 1S16A 4B3ME 4JI8I 4LF5E 2CPNA 1XNRI 4DR2E 1NZ0A 2HHHE 4JI7I 2DMYA 2F4VE 4B3RI 4DU7A 4DPXA 1H7UA 2UXCI 2UUBI 3GONA 4JV5E 2R42A 2N3GA 4DPTA 4JI6I 4DR5E 4FN5A 5A2QQ 2CZ9A 4B3SE 2UUBE 4X66I 3WU6A 3LNUA 2BV3A 3OTOE 1GQEA 4LF9E 4DR1E 3ZM7A 4DPYA 4XTJA 4X8WA 1B63A 4FWHA 5GMEA 4DXLA 3J80Q 3QT5A 1NHHA 4HYMA 3B78A 3J81C 4B3TI 1QZRA 2VQEI 4LF7I 4ZVIA 3J81Q 1Z59A 5FLXC 1RQ0A 4RPFA 2V34A 4DV5E 4JI2E 4DUYE 1T4LB 1STUA 1D6TA 2B7VA 4DPUA 1XNRE 4EMDA 2BM0A 4DV7I 1HNXI 2A2CA 4M1KA 4DV4E 2RS7A 4K0KI 4JV5I 4OOGC 1HR0E 1YZ9A 4DV7E 5LMUI 3Q1QA 1N0UA 3M6AA 1HNWE 2UU9E 4DUYI 4LFAE 5BR8I 1BKNA 1Z5AA 1ZXNA 1N34I 2DB2A 2L2MA 4JI0I 3K1JA 4WFTA 2L3JA 2VQFE 4JI3E 1FJGI 3V2UC 2E1RA 3VYXA 4P7AA 4DV3I 1HNXE 4K0KE 1Z0GA 1YYOA 2LUQA 2MDRA 1Z0WA 4USKA 4YY3I 4Z7YA 4JI4I 3ZZUA 1RR9A 2WW4A 2R3VA 3HTXA 1FI4A 4YY3E 4DR4E 2ZITA 1H74A 3C4TA 4JI0E 1ZM2A 2HK3A 1DARA 1PKPA 2NUEA 3T1HI 4HACB 2L2NA 2B7TA 4M30A 4JI8E 4B3MI 1I94I 4DR3E 4DV2I 1X49A 1ZM4A 3ZKDA 4YHHI 3T1YI 2A2DA 4DV4I 1K47A 4UTGA 3LLHA 3T1YE 1NHJA 1XMOI 4LF4E 3ADGA 4DV3E 3QT7A 1IBLE 1KTVA 2NA2A 4LF5I 4PRXA 4Z7CA 2ZM6E 4NXMI 4DR2I 3P1XA 1H7SA 1OJ4A 3ZZ0A 3PYFA 2EZ6A 1Z5CA 1ZM9A 1YYKA 4X65E 2OI2A 1XMQI 1QU6A 2J7KA 2LJHA 2JVAA 1FWKA 4ED4A 5CFFE 1MX0A 5IWAE 4M2ZA 5L3JA 2IHR1 4WUCA 3ADJA 2YT4A 4JYAI 4LF8I 2ZM6I 3J7Yp 4WUDA 4NXNE 2X7IA 5IWAI 4HXZA 1UEKA 1YYWA 2BM1A 2LUPB 2Q2EB 4JI5E 4DV6E 1XHKA 4KHPE 4FWDA 3OTOI 2N3HA 2VF3A 1XMQE 3ZKBA
chains in the Genus database with same CATH superfamily
5AASA 4X64I 4DR7I 2EM5A 3CWVA 4LFBI 4F9AB 4ZYGA 1O0WA 1B62A 1A1GA 3QT8A 4MU0A 4HTGA 1WUUA 4JG4A 1IBKE 4MYUA 4WUBA 5JEAD 4DV6I 1X6HA 2JR1A 2YTGA 4GKJE 5IT9C 1E3PA 2YSOA 4M9VC 2ELYA 2EPUA 3RMPA 2DEJA 4GQUA 3KRNA 2B3TB 4DV1I 1H72C 2JXPA 2EQ0A 4JI6E 1UILA 2UXDE 5LMNI 4DR7E 4LF6I 2NN6E 4BHBA 4IFDD 2KHXA 4X9JA 5C0XD 2LTSA 2WP8B 2YTFA 4R2DA 1WRJA 3JAMQ 5K36A 2ENCA 1T4NA 3THNA 2L92A 4JI2I 2EOOA 1P42A 3PS3A 4LF4I 4OX9I 2LTRA 2JT2A 3Q6NA 4DR6I 3AV0A 3L7ZA 2GPIA 5LMUE 1Z0CA 2ADRA 4NXME 2V85A 1ELOA 2ENHA 2EMXA 4O43A 1RHYA 3Q6MA 4X62E 1MU5A 3K85A 3ZOQB 4GKKI 2EL5A 4OX9E 1IQOA 1L4SA 4PRVA 2DEIA 1J5EI 3IWCA 4DUZI 4OO1B 2EM4A 4KQVA 2MKDA 1ZU1A 5KL3A 2YRMA 1Z5BA 4IZKA 1T38A 5A6BD 1USVA 2NUGA 4GKKE 2KOUA 1Z0BA 1PIEA 3PYGA 1FJGE 1RMDA 2EPXA 2I9IA 1A1HA 2HK2A 3P76A 2ELZA 2V89A 2UUCE 2EOQA 3MSWA 4DKKA 2LJUA 3ADLA 1Z0TA 3EQ1A 1F2IG 2O1UA 2HFSA 4JI1E 1WHNA 2UXBI 1BB8A 3LPSA 4DU8A 1ZXMA 2YU5A 5C0XA 1NHIA 2IESA 4BC7A 3VYYA 2NUFA 5EKWA 1H73A 4TUGA 4JYAE 5C0XB 4IFDB 3ECRA 2EM2A 1JK2A 2C38A 2CTDA 4NXNI 2UXBE 4IFDC 1X47A 3HULA 4DV5I 1T39A 3J7AM 1N32I 4DR1I 5FLXQ 4R2AA 2EPMX 3ADIA 4LF6E 2JYAA 3PYDA 2JWOA 2V87A 1UHZA 2YWQA 4IZKB 2DLKA 1N33I 3B8HA 2L3CA 2YU8A 3DJWA 2L8TA 1OYSA 2JEBB 2YPNA 1IBMI 4JI4E 4DR5I 2UUCI 2V8QB 2V2QA 2EOFA 1EI1A 5AC4A 3DD6A 2M7QA 1A6FA 2EN1A 2MKNA 3V5RA 4BA2A 2WBSA 2YTNA 2EOYA 4B3RE 4LFCI 2F4VI 1FKAE 1P47A 1OYRA 2CGEA 2EOXA 4F9BB 1GZ6A 3P3CA 2EPKX 4J8ZA 4MDTA 4AQYI 4BA1B 3M7ND 1HNWI 2EN6A 2PNLA 2AJ4A 4KWYA 3F6GA 1Z0EA 2RS6A 4LFCE 2EOZA 2G7HA 2EMLA 2VQEE 4FW6A 5T6JA 5BR8E 4LFAI 4LCGA 5A6AA 4OKGA 4B3SI 1N34E 2O3ZA 2EP3A 2EM7A 2FGGA 4AQYE 1E3HA 1UDSA 2EMIA 4JI1I 2E5LE 3F0NA 2V2ZA 2FTXB 4LU9A 5FWKA 4YHHE 2YTQA 2EMZA 1U2RA 2BR2A 1UDOA 4MYTA 3MHSC 4ZYEA 2EM8A 2VE7C 5DNYA 2HJJA 2EJ4A 2GHFA 2PNZA 1EH8A 2BR2B 3B82A 2H36X 3LTOA 2EFGA 1N32E 5IT9Q 1X6FA 2BA1D 5DRPA 4P7DA 4IS1C 1WHQA 3C4BA 1OYPA 3WU5A 2R76A 2D9HA 1KVKA 1EA6A 1N0VC 2J7JA 4WPYA 2V8PA 4HY1A 2EM0A 3JAMC 1FWLA 1YHCA 4DPWA 2MC6A 4PU9A 2RSIA 5A6JA 2JP9A 1TN9A 4IFDA 2DRPA 2LCEA 1YH8A 4KHPI 2UU9I 2BB8A 3AUZA 4OO1F 4LF8E 3K17A 4UT4A 2B9DA 3QT6A 4B3TE 2EL6A 5K36F 1XNQE 1PDAA 2EMAA 4I8OA 1A1FA 5IXMB 4LF7E 2L33A 1XMOE 4BMJA 1MG7A 3CDIA 1KIJA 5A2QC 4P78A 4BS9A 2EPAA 2EN3A 1I94E 1ZM3A 5LL6R 2BA0G 1N33E 3D4JA 1KKHA 4JI5I 2VQFI 1IBME 1DI2A 1XNQI 4JI3I 2RPCA 4BC9A 4MLVA 2C39A 2CT1A 2VRDA 4WYQB 3H09A 1X6EA 4R2SA 1VISA 4FWGA 2EM9A 4R2EA 1J26A 2HFUA 2IERA 1T4OA 3J80C 2N8XA 2I13A 5DRQA 2CVEA 4FW9A 3WU3A 4AM3A 2HHHI 2EM6A 2UUAE 3M85D 2EPLX 1Z0VA 2GLIA 4HACA 1HNZE 5LMNE 2E72A 5AE2A 3L7ZB 4AIMA 4F54A 3BGHA 4NZVA 4N3OA 4DR4I 1N36E 2EPRA 1N3GA 3NZKA 1HR0I 1KJKA 5DNLA 2AE8A 2ZBKB 4P52A 2LJPA 2L2KB 4X64E 4URLA 3P3EA 1Z1BA 3OMLA 2E5LI 2DIXA 4X66E 2WNRB 1IBKI 2NPFA 4J3DA 4X62I 4LCFA 4MLQA 4X65I 4Q28A 5GMDA 2EN8A 3KZYA 4TUIA 5KL7A 4I3HA 4GEQB 2EM3A 1J5EE 3H4LA 2JOXA 2PNZB 2YTPA 4DUZE 4DV2E 4DR3I 4R2PA 1A1KA 2UXCE 1EKZA 3J7AG 2PO1B 3WU4A 2EMKA 3ZZTA 3BIDA 1S4EA 2JY9A 3VHTB 2YTEA 2UUAI 2EN7A 5KL4A 1G2DC 4DR6E 1UDQA 1X48A 1HNZI 2WBUA 4R1FA 1X5WA 2BBGA 2EPCA 2RSMA 2JEAA 3HKMA 5K36E 2GS8A 2LE2A 1RREA 1RC7A 1UDNA 2NN6D 1BBGA 2XEXA 4LF9I 3BBGA 2F8BA 3HXLA 3C6MA 4R2RA 4DV1E 2LO3A 2YRKA 2LRSA 2CG9A 2V2VA 1IBLI 1ZBTA 1PJTA 5DROA 1NEIA 2UXDI 1GTKA 2X36A 3EPLA 3KWRA 1PVGA 2YRHA 2HKEA 5A6KA 4DV0I 1Y60A 2EMHA 2LBSB 4IS9A 3EPHA 4F6NA 4R2CA 1FNMA 3FIGA 2EOHA 2WCC3 4LFBE 4USMA 4R2QA 5K36D 1DQ3A 4OO1D 2RTXA 3LMLA 4N4RB 4DV0E 4GZNC 3PYEA 2HKJA 1R6MA 5EL9A 2JPAA 1N36I 4JI7E 3T1HE 2YSPA 1S16A 4WSPA 4B3ME 4JI8I 1MEYC 2EOJA 2PO2B 1Y4UA 5AE3A 3JTZA 4RHBB 2PO0B 3TQMA 4LF5E 1PJQA 2CPNA 1XNRI 5DNXA 4DR2E 1NZ0A 2HHHE 4BA1A 4JI7I 5ELWA 2DMYA 2F4VE 4B3RI 2HGHA 5C0XC 4DU7A 1VI7A 1YSAC 5LLQA 2EPOA 4DPXA 1AH5A 1H7UA 2O1VA 2Z5BA 4IFDF 4FW3A 2MDGA 2UUBI 2UXCI 4KZSA 4LPFA 3GONA 4JV5E 2M4IA 4O24A 2R42A 4WX9A 1B69A 3EPKA 3U1KA 2N3GA 4DPTA 4R03A 1Y6ZA 4JI6I 1WJPA 4DR5E 4FN5A 5A2QQ 2CZ9A 2GO4A 4B3SE 4BA2B 2EPPA 4MU3A 2UUBE 4X66I 2MC5A 3LNUA 3WU6A 2GQ0A 2BV3A 4IZJB 1EH7A 3OTOE 1GQEA 4LF9E 4DR1E 4OO1C 2K7IA 1A1IA 4ZYHA 4DMIA 1XXEA 2YZTA 3ZM7A 4DPYA 4XTJA 2GO3A 4X8WA 1LLMC 1B63A 2Z5EA 3KZZA 4LOMA 5JEAE 2FV4B 4F9CB 2EMWA 3HPZA 4FWHA 4FK5C 2HC5A 2YTDA 4IZJD 5C0XF 3U1YA 1ZR9A 4NHRA 1TF3A 2Z5BB 3GMEA 2C38B 3P3GA 5GMEA 3P06A 1XMQE 3L00A 4O4KA 1YUIA 4DXLA 2JEAB 3J80Q 4ISAA 2J65A 2DMIA 1ZAAC 3QT5A 2KONA 1NHHA 3GLLA 4AIDA 2EMGA 4GKJI 5KL6A 5TSEA 3EPJA 2EN2A 3M99B 4HYMA 1Y5YA 3B78A 5K36C 1SR9A 3J81C 4B3TI 2IOPA 1QZRA 4IJDA 2ENAA 2VQEI 4LF7I 4ZVIA 3J81Q 2PRTA 1NCSA 2O1TA 2DGCA 1Z59A 5FLXC 1RQ0A 4RPFA 2V34A 4FW4A 4DV5E 4JI2E 4DUYE 1T4LB 1STUA 1D6TA 3MHHC 2A25A 5F3WA 2Z5CB 2B7VA 2V83A 4DPUA 1XNRE 2EPNA 3HPSA 2JE6B 4M0VA 3DF6A 2M1SA 4ZYDA 3B4TA 4EMDA 2BA0D 5AE1A 2BM0A 4DV7I 2JEBA 1ZBQA 2LV2A 1R6LA 1HNXI 2A2CA 4M1KA 4DV4E 2RS7A 4K0KI 3ZKBA 1SFEA 5JEAF 4JV5I 2M9AA 4OOGC 5C0XE 2NN6B 4U3BA 2WNRA 1HR0E 1YZ9A 4DV7E 5LMUI 2WP8A 2E1MA 4FW7A 3Q1QA 1N0UA 3M6AA 1HNWE 1PJSA 2UU9E 2PNMA 1IMUA 2PO0A 2NN6F 4DUYI 4OZEA 4LFAE 5BR8I 1DGCA 2K4VA 1BKNA 1Z5AA 1ZXNA 1N34I 2DB2A 2L2MA 2EQ3A 3JU0A 2LMZA 4JI0I 3K1JA 2EMFA 1UBDC 2BA1G 1YUJA 2NN6C 1X3CA 4WFTA 5IV8B 2L3JA 4BCAA 2VQFE 2YTIA 4MU4A 3F6HA 4JI3E 3K6QA 3UK3C 2E1RA 4MU1A 3V2UC 3VYXA 4P7AA 2EOMA 3C6KA 4IFDE 4DV3I 4WXCA 3VK6A 1HNXE 4K0KE 2JOBA 1Z0GA 2EMYA 1EH6A 2LUQA 1YYOA 2ODRD 2WZOA 2MDRA 1Z0WA 4USKA 3IWBA 4Z7YA 5JEAC 4YY3I 3HQ1A 4R8OA 4JI4I 3ZZUA 1RR9A 2WW4A 2LVHA 1A1JA 3PS2A 1QNTA 2DSYA 2R3VA 2NN6A 1UN6B 3HTXA 1FI4A 4LCHA 4YY3E 2WBTA 3BF2A 4DR4E 2RQLA 5ADZA 2ZITA 2EL4A 1H74A 2EQ1A 3C4TA 4JI0E 1ZM2A 2PO2A 4U3DA 2EORA 2HK3A 2ODRC 2YTJA 1DARA 5KL5A 2VF1A 1PKPA 1AAYA 2NUEA 5K36B 5AC5A 3T1HI 4HACB 2L2NA 2B7TA 4M30A 2CSHA 4JI8E 4B3MI 2C37B 2DLQA 4HEIA 4NBQA 1YPNA 1I94I 2L6MA 4DR3E 4DV2I 2EOEA 5A6BA 1X49A 4L5NC 2EN4A 4F6MA 1ZM4A 3ZKDA 1A1LA 1Y4SA 4YHHI 3T1YI 2A2DA 2EWLA 3UHMA 2C39B 4DV4I 1K47A 1MGTA 4UTGA 3LLHA 2VESA 2R1FA 3T1YE 1NHJA 3PRYA 1XMOI 4L8NA 4LF4E 3ADGA 4DV3E 3QT7A 1IBLE 1KTVA 2NA2A 2EMBA 3GCMA 4LF5I 4PRXA 4Z7CA 2ZM6E 2V86A 4NXMI 2Z5CA 2O1WA 3P1XA 1H7SA 1OJ4A 4QNJA 4DR2I 3ZZ0A 1G2FC 3PYFA 2LT7A 2NABA 2EZ6A 5A69A 4OO1A 2EMCA 1Z5CA 3H1CA 1ZM9A 4RH8A 2C37A 2EPZA 5JEAB 1YYKA 3PS1A 4X65E 2OI2A 1XMQI 1QU6A 5JEAA 1USUA 2J7KA 4Q35B 3THOB 2LJHA 2JVAA 1FWKA 4IZJA 4ED4A 5CFFE 1YFHA 2Q8UA 1HK7A 2PO1A 4LTYA 4FW5A 1JK1A 1MX0A 5IWAE 4M2ZA 5L3JA 2IHR1 2F1DA 4MQYA 2EOIA 4WUCA 3ADJA 5DRRA 4OO1E 2YT4A 2IOQA 4JYAI 4LF8I 1FJGI 3M7NG 2ZM6I 3J7Yp 1BBOA 4O5GA 4WUDA 4NXNE 2X7IA 4BHCA 2V88A 4F2JC 5KL2A 5IWAI 1KYQA 4WXDA 4BBYA 2YTOA 1TF6A 1UEKA 1YYWA 4HXZA 4QNKA 3M85G 2EE8A 2BM1A 2EOSA 3IWDA 1WXRA 2LUPB 2Q2EB 4JI5E 4DV6E 1XHKA 2JE6A 4KHPE 4FWDA 3QG5C 3OTOI 2N3HA 2VF3A 4WSGA 3HJCA 3CDJA 1IQSA
chains in the Genus database with same CATH topology
5AASA 4X64I 4DR7I 4LFBI 3CWVA 4F9AB 1O0WA 1B62A 3QT8A 1WUUA 4JG4A 4MYUA 1IBKE 4WUBA 4DV6I 4KHPI 2JR1A 4GKJE 2DEJA 5IT9C 3RMPA 2B3TB 4DV1I 1H72C 4JI6E 2UXDE 1UILA 5LMNI 4DR7E 4LF6I 2KHXA 2LTSA 3JAMQ 1T4NA 2L92A 4JI2I 4LF4I 4OX9I 2LTRA 4DR6I 3Q6NA 3AV0A 5LMUE 1Z0CA 4NXME 2V85A 1ELOA 3Q6MA 4X62E 1MU5A 3K85A 3ZOQB 4GKKI 4OX9E 4PRVA 2DEIA 1J5EI 3IWCA 4DUZI 4KQVA 1Z5BA 4IZKA 1USVA 2NUGA 4GKKE 2KOUA 1Z0BA 1PIEA 3PYGA 1FJGE 2HK2A 2V89A 2UUCE 3MSWA 4DKKA 3ADLA 1Z0TA 2O1UA 2HFSA 4JI1E 1WHNA 2UXBI 3LPSA 4DU8A 1ZXMA 1NHIA 4BC7A 3VYYA 2NUFA 1H73A 4TUGA 4JYAE 4NXNI 2UXBE 1X47A 3HULA 4DV5I 3J7AM 1N32I 4DR1I 5FLXQ 3ADIA 4LF6E 3PYDA 2JWOA 2V87A 1UHZA 4IZKB 1N33I 3B8HA 2L3CA 3DJWA 2L8TA 1IBMI 4JI4E 4DR5I 2UUCI 2V8QB 2V2QA 1EI1A 2M7QA 1A6FA 3V5RA 4B3RE 4LFCI 2F4VI 1FKAE 2CGEA 4F9BB 1GZ6A 4J8ZA 4AQYI 1HNWI 2PNLA 2AJ4A 3F6GA 1Z0EA 2RS6A 4LFCE 2G7HA 2VQEE 5T6JA 5BR8E 4LFAI 4B3SI 1N34E 2FGGA 4AQYE 4JI1I 2E5LE 3F0NA 2V2ZA 2FTXB 4LU9A 5FWKA 4YHHE 1U2RA 4MYTA 5DNYA 2VE7C 3B82A 2H36X 3LTOA 2EFGA 1N32E 5IT9Q 4P7DA 1WHQA 3C4BA 3WU5A 1KVKA 1EA6A 1N0VC 4WPYA 2V8PA 4HY1A 3JAMC 1FWLA 4DPWA 2MC6A 4PU9A 2UU9I 3AUZA 4LF8E 3K17A 4UT4A 2B9DA 3QT6A 4B3TE 1XNQE 4I8OA 4LF7E 1MG7A 2L33A 1XMOE 4BMJA 1KIJA 5A2QC 4P78A 4BS9A 1I94E 1ZM3A 5LL6R 1N33E 3D4JA 1KKHA 4JI5I 2VQFI 1IBME 1DI2A 1XNQI 4JI3I 4BC9A 4WYQB 3H09A 1VISA 4FWGA 1J26A 2HFUA 1T4OA 3J80C 3WU3A 4FW9A 2HHHI 2UUAE 1Z0VA 4HACA 1HNZE 5LMNE 5AE2A 4F54A 4N3OA 4DR4I 1N36E 1HR0I 2ZBKB 4P52A 2LJPA 2L2KB 4X64E 4URLA 3OMLA 2E5LI 2DIXA 4X66E 1IBKI 2NPFA 4X62I 4X65I 4Q28A 5GMDA 4TUIA 4I3HA 4GEQB 1J5EE 3H4LA 2JOXA 4DUZE 4DV2E 4DR3I 2UXCE 1EKZA 3J7AG 3WU4A 3ZZTA 1S4EA 2JY9A 2UUAI 4DR6E 1X48A 1HNZI 4R1FA 2RSMA 2GS8A 2LE2A 1RREA 1RC7A 4GKJI 2XEXA 4LF9I 2F8BA 3HXLA 2CG9A 4DV1E 2V2VA 2LRSA 1IBLI 2UXDI 1ZBTA 2X36A 3KWRA 1PVGA 2HKEA 4DV0I 2LBSB 1FNMA 3FIGA 4LFBE 4USMA 1DQ3A 2RTXA 3LMLA 4DV0E 3PYEA 2HKJA 1N36I 1S16A 4JI7E 3T1HE 4WSPA 4B3ME 4JI8I 1Y4UA 5AE3A 3JTZA 4LF5E 2CPNA 1XNRI 4DR2E 1NZ0A 2HHHE 4JI7I 2DMYA 2F4VE 4B3RI 4DU7A 4DPXA 2O1VA 1H7UA 2Z5BA 2UXCI 2UUBI 4KZSA 3GONA 4JV5E 2M4IA 2R42A 2N3GA 4DPTA 4R03A 1Y6ZA 4JI6I 4DR5E 4FN5A 5A2QQ 2CZ9A 4B3SE 2UUBE 4X66I 2MC5A 3LNUA 3WU6A 2GQ0A 2BV3A 4IZJB 3OTOE 1GQEA 4LF9E 4DR1E 4DMIA 3ZM7A 2YZTA 4DPYA 4XTJA 4X8WA 1B63A 2Z5EA 2FV4B 4F9CB 4FWHA 3HPZA 4IZJD 2Z5BB 5GMEA 3P06A 4DXLA 3J80Q 3QT5A 2KONA 1NHHA 4HYMA 3B78A 1SR9A 3J81C 4B3TI 2IOPA 1QZRA 2VQEI 4LF7I 4ZVIA 3J81Q 2O1TA 1Z59A 5FLXC 1RQ0A 4RPFA 2V34A 4DV5E 4JI2E 4DUYE 1T4LB 1STUA 1D6TA 5F3WA 2Z5CB 2B7VA 2V83A 4DPUA 1XNRE 3HPSA 4M0VA 3DF6A 2M1SA 4EMDA 5AE1A 2BM0A 4DV7I 1ZBQA 1HNXI 2A2CA 4M1KA 4DV4E 2RS7A 4K0KI 3ZKBA 4JV5I 4OOGC 1HR0E 1YZ9A 4DV7E 5LMUI 2E1MA 3Q1QA 1N0UA 3M6AA 1HNWE 2UU9E 2PNMA 4DUYI 4LFAE 5BR8I 1BKNA 2K4VA 1Z5AA 1ZXNA 1N34I 2DB2A 2L2MA 2LMZA 3JU0A 4JI0I 3K1JA 4WFTA 2L3JA 2VQFE 4BCAA 3F6HA 4JI3E 3K6QA 2E1RA 3V2UC 1FJGI 3VYXA 4P7AA 4DV3I 3VK6A 1HNXE 4K0KE 2JOBA 1Z0GA 1YYOA 2LUQA 2ODRD 2WZOA 2MDRA 1Z0WA 4USKA 3IWBA 4Z7YA 4YY3I 3HQ1A 4R8OA 4JI4I 3ZZUA 1RR9A 2WW4A 2DSYA 2R3VA 3HTXA 1FI4A 4YY3E 4DR4E 5ADZA 2ZITA 1H74A 3C4TA 4JI0E 1ZM2A 2HK3A 2ODRC 1DARA 2VF1A 1PKPA 2NUEA 3T1HI 4HACB 2L2NA 2B7TA 4M30A 4JI8E 4B3MI 1I94I 2L6MA 4DR3E 4DV2I 1X49A 4L5NC 1ZM4A 3ZKDA 1Y4SA 4YHHI 3T1YI 2A2DA 2EWLA 4DV4I 1K47A 4UTGA 3LLHA 3T1YE 1NHJA 3PRYA 1XMOI 4L8NA 4LF4E 3ADGA 4DV3E 3QT7A 1IBLE 1KTVA 2NA2A 4LF5I 4PRXA 4Z7CA 2ZM6E 2V86A 4NXMI 2Z5CA 2O1WA 3P1XA 1H7SA 1OJ4A 4DR2I 3ZZ0A 3PYFA 2EZ6A 1Z5CA 1ZM9A 1YYKA 4X65E 2OI2A 1XMQI 1QU6A 1USUA 2J7KA 4IZJA 2LJHA 2JVAA 1FWKA 4ED4A 5CFFE 1HK7A 4LTYA 1MX0A 5IWAE 4M2ZA 5L3JA 2IHR1 4WUCA 3ADJA 2YT4A 2IOQA 4JYAI 4LF8I 2ZM6I 3J7Yp 4WUDA 4NXNE 2X7IA 2V88A 5IWAI 4BBYA 4HXZA 1UEKA 1YYWA 2BM1A 1WXRA 3IWDA 2LUPB 2Q2EB 4JI5E 4DV6E 1XHKA 4KHPE 4FWDA 3OTOI 2N3HA 2VF3A 1XMQE 3HJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 I;  4DR7 I;  4LFB I;  3CWV A;  1O0W A;  1B62 A;  3QT8 A;  1WUU A;  4JG4 A;  4MYU A;  1IBK E;  4WUB A;  4DV6 I;  4KHP I;  4GKJ E;  2DEJ A;  5IT9 C;  2B3T B;  4DV1 I;  1H72 C;  4JI6 E;  2UXD E;  1UIL A;  5LMN I;  4DR7 E;  4LF6 I;  2KHX A;  2LTS A;  3JAM Q;  1T4N A;  4JI2 I;  4LF4 I;  4OX9 I;  2LTR A;  4DR6 I;  5LMU E;  1Z0C A;  4NXM E;  1ELO A;  4X62 E;  1MU5 A;  4GKK I;  4OX9 E;  4PRV A;  2DEI A;  1J5E I;  4DUZ I;  4KQV A;  1Z5B A;  2NUG A;  4GKK E;  1Z0B A;  1PIE A;  3PYG A;  1FJG E;  2HK2 A;  2UUC E;  4DKK A;  3ADL A;  1Z0T A;  2HFS A;  4JI1 E;  1WHN A;  2UXB I;  3LPS A;  4DU8 A;  1ZXM A;  1NHI A;  3VYY A;  2NUF A;  1H73 A;  4JYA E;  4NXN I;  2UXB E;  1X47 A;  3HUL A;  4DV5 I;  3J7A M;  1N32 I;  4DR1 I;  5FLX Q;  3ADI A;  4LF6 E;  3PYD A;  1UHZ A;  1N33 I;  3B8H A;  2L3C A;  1IBM I;  4JI4 E;  4DR5 I;  2UUC I;  2V2Q A;  1EI1 A;  1A6F A;  3V5R A;  4B3R E;  4LFC I;  2F4V I;  1FKA E;  4AQY I;  1HNW I;  2AJ4 A;  1Z0E A;  2RS6 A;  4LFC E;  2VQE E;  5BR8 E;  4LFA I;  4B3S I;  1N34 E;  4AQY E;  4JI1 I;  2E5L E;  3F0N A;  2V2Z A;  4YHH E;  1U2R A;  4MYT A;  3B82 A;  3LTO A;  2EFG A;  1N32 E;  5IT9 Q;  1WHQ A;  3C4B A;  3WU5 A;  1KVK A;  1EA6 A;  1N0V C;  2V8P A;  4HY1 A;  1FWL A;  3JAM C;  4DPW A;  4PU9 A;  2UU9 I;  4LF8 E;  3K17 A;  4UT4 A;  3QT6 A;  4B3T E;  1XNQ E;  4LF7 E;  1MG7 A;  2L33 A;  1XMO E;  1KIJ A;  5A2Q C;  1I94 E;  1ZM3 A;  5LL6 R;  1N33 E;  3D4J A;  1KKH A;  4JI5 I;  2VQF I;  1IBM E;  1DI2 A;  1XNQ I;  4JI3 I;  4WYQ B;  1VIS A;  4FWG A;  1J26 A;  2HFU A;  1T4O A;  3J80 C;  3WU3 A;  4FW9 A;  2HHH I;  2UUA E;  1Z0V A;  4HAC A;  1HNZ E;  5LMN E;  4DR4 I;  1N36 E;  1HR0 I;  2ZBK B;  4P52 A;  2LJP A;  2L2K B;  4X64 E;  4URL A;  2E5L I;  2DIX A;  4X66 E;  1IBK I;  2NPF A;  4X62 I;  4X65 I;  5GMD A;  4I3H A;  1J5E E;  3H4L A;  4DUZ E;  4DV2 E;  4DR3 I;  2UXC E;  1EKZ A;  3J7A G;  3WU4 A;  3ZZT A;  1S4E A;  2JY9 A;  2UUA I;  4DR6 E;  1X48 A;  1HNZ I;  4R1F A;  2RSM A;  2GS8 A;  1RRE A;  1RC7 A;  4GKJ I;  2XEX A;  4LF9 I;  4DV1 E;  2V2V A;  2LRS A;  1IBL I;  2UXD I;  1ZBT A;  2X36 A;  1PVG A;  2HKE A;  4DV0 I;  2LBS B;  1FNM A;  4LFB E;  4USM A;  3PYE A;  2RTX A;  4DV0 E;  2HKJ A;  1N36 I;  4JI7 E;  3T1H E;  1S16 A;  4B3M E;  4JI8 I;  4LF5 E;  2CPN A;  1XNR I;  4DR2 E;  1NZ0 A;  2HHH E;  4JI7 I;  2DMY A;  2F4V E;  4B3R I;  4DU7 A;  4DPX A;  1H7U A;  2UXC I;  2UUB I;  3GON A;  4JV5 E;  2R42 A;  2N3G A;  4DPT A;  4JI6 I;  4DR5 E;  4FN5 A;  5A2Q Q;  2CZ9 A;  4B3S E;  2UUB E;  4X66 I;  3WU6 A;  3LNU A;  2BV3 A;  3OTO E;  1GQE A;  4LF9 E;  4DR1 E;  3ZM7 A;  4DPY A;  4XTJ A;  4X8W A;  1B63 A;  4FWH A;  5GME A;  4DXL A;  3J80 Q;  3QT5 A;  1NHH A;  4HYM A;  3B78 A;  3J81 C;  4B3T I;  1QZR A;  2VQE I;  4LF7 I;  4ZVI A;  3J81 Q;  1Z59 A;  5FLX C;  1RQ0 A;  4RPF A;  2V34 A;  4DV5 E;  4JI2 E;  4DUY E;  1T4L B;  1STU A;  1D6T A;  2B7V A;  4DPU A;  1XNR E;  4EMD A;  2BM0 A;  4DV7 I;  1HNX I;  2A2C A;  4M1K A;  4DV4 E;  2RS7 A;  4K0K I;  4JV5 I;  4OOG C;  1HR0 E;  1YZ9 A;  4DV7 E;  5LMU I;  3Q1Q A;  1N0U A;  3M6A A;  1HNW E;  2UU9 E;  4DUY I;  4LFA E;  5BR8 I;  1BKN A;  1Z5A A;  1ZXN A;  1N34 I;  2DB2 A;  2L2M A;  4JI0 I;  3K1J A;  4WFT A;  2L3J A;  2VQF E;  4JI3 E;  1FJG I;  3V2U C;  2E1R A;  3VYX A;  4P7A A;  4DV3 I;  1HNX E;  4K0K E;  1Z0G A;  1YYO A;  2LUQ A;  2MDR A;  1Z0W A;  4USK A;  4YY3 I;  4Z7Y A;  4JI4 I;  3ZZU A;  1RR9 A;  2WW4 A;  2R3V A;  3HTX A;  1FI4 A;  4YY3 E;  4DR4 E;  2ZIT A;  1H74 A;  3C4T A;  4JI0 E;  1ZM2 A;  2HK3 A;  1DAR A;  1PKP A;  2NUE A;  3T1H I;  4HAC B;  2L2N A;  2B7T A;  4M30 A;  4JI8 E;  4B3M I;  1I94 I;  4DR3 E;  4DV2 I;  1X49 A;  1ZM4 A;  3ZKD A;  4YHH I;  3T1Y I;  2A2D A;  4DV4 I;  1K47 A;  4UTG A;  3LLH A;  3T1Y E;  1NHJ A;  1XMO I;  4LF4 E;  3ADG A;  4DV3 E;  3QT7 A;  1IBL E;  1KTV A;  2NA2 A;  4LF5 I;  4PRX A;  4Z7C A;  2ZM6 E;  4NXM I;  4DR2 I;  3P1X A;  1H7S A;  1OJ4 A;  3ZZ0 A;  3PYF A;  2EZ6 A;  1Z5C A;  1ZM9 A;  1YYK A;  4X65 E;  2OI2 A;  1XMQ I;  1QU6 A;  2J7K A;  2LJH A;  2JVA A;  1FWK A;  4ED4 A;  5CFF E;  1MX0 A;  5IWA E;  4M2Z A;  5L3J A;  2IHR 1;  4WUC A;  3ADJ A;  2YT4 A;  4JYA I;  4LF8 I;  2ZM6 I;  3J7Y p;  4WUD A;  4NXN E;  2X7I A;  5IWA I;  4HXZ A;  1UEK A;  1YYW A;  2BM1 A;  2LUP B;  2Q2E B;  4JI5 E;  4DV6 E;  1XHK A;  4KHP E;  4FWD A;  3OTO I;  2N3H A;  2VF3 A;  1XMQ E;  3ZKB A; 
#chains in the Genus database with same CATH topology
 5AAS A;  4X64 I;  4DR7 I;  2EM5 A;  3CWV A;  4LFB I;  4F9A B;  4ZYG A;  1O0W A;  1B62 A;  1A1G A;  3QT8 A;  4MU0 A;  4HTG A;  1WUU A;  4JG4 A;  1IBK E;  4MYU A;  4WUB A;  5JEA D;  4DV6 I;  1X6H A;  2JR1 A;  2YTG A;  4GKJ E;  5IT9 C;  1E3P A;  2YSO A;  4M9V C;  2ELY A;  2EPU A;  3RMP A;  2DEJ A;  4GQU A;  3KRN A;  2B3T B;  4DV1 I;  1H72 C;  2JXP A;  2EQ0 A;  4JI6 E;  1UIL A;  2UXD E;  5LMN I;  4DR7 E;  4LF6 I;  2NN6 E;  4BHB A;  4IFD D;  2KHX A;  4X9J A;  5C0X D;  2LTS A;  2WP8 B;  2YTF A;  4R2D A;  1WRJ A;  3JAM Q;  5K36 A;  2ENC A;  1T4N A;  3THN A;  2L92 A;  4JI2 I;  2EOO A;  1P42 A;  3PS3 A;  4LF4 I;  4OX9 I;  2LTR A;  2JT2 A;  3Q6N A;  4DR6 I;  3AV0 A;  3L7Z A;  2GPI A;  5LMU E;  1Z0C A;  2ADR A;  4NXM E;  2V85 A;  1ELO A;  2ENH A;  2EMX A;  4O43 A;  1RHY A;  3Q6M A;  4X62 E;  1MU5 A;  3K85 A;  3ZOQ B;  4GKK I;  2EL5 A;  4OX9 E;  1IQO A;  1L4S A;  4PRV A;  2DEI A;  1J5E I;  3IWC A;  4DUZ I;  4OO1 B;  2EM4 A;  4KQV A;  2MKD A;  1ZU1 A;  5KL3 A;  2YRM A;  1Z5B A;  4IZK A;  1T38 A;  5A6B D;  1USV A;  2NUG A;  4GKK E;  2KOU A;  1Z0B A;  1PIE A;  3PYG A;  1FJG E;  1RMD A;  2EPX A;  2I9I A;  1A1H A;  2HK2 A;  3P76 A;  2ELZ A;  2V89 A;  2UUC E;  2EOQ A;  3MSW A;  4DKK A;  2LJU A;  3ADL A;  1Z0T A;  3EQ1 A;  1F2I G;  2O1U A;  2HFS A;  4JI1 E;  1WHN A;  2UXB I;  1BB8 A;  3LPS A;  4DU8 A;  1ZXM A;  2YU5 A;  5C0X A;  1NHI A;  2IES A;  4BC7 A;  3VYY A;  2NUF A;  5EKW A;  1H73 A;  4TUG A;  4JYA E;  5C0X B;  4IFD B;  3ECR A;  2EM2 A;  1JK2 A;  2C38 A;  2CTD A;  4NXN I;  2UXB E;  4IFD C;  1X47 A;  3HUL A;  4DV5 I;  1T39 A;  3J7A M;  1N32 I;  4DR1 I;  5FLX Q;  4R2A A;  2EPM X;  3ADI A;  4LF6 E;  2JYA A;  3PYD A;  2JWO A;  2V87 A;  1UHZ A;  2YWQ A;  4IZK B;  2DLK A;  1N33 I;  3B8H A;  2L3C A;  2YU8 A;  3DJW A;  2L8T A;  1OYS A;  2JEB B;  2YPN A;  1IBM I;  4JI4 E;  4DR5 I;  2UUC I;  2V8Q B;  2V2Q A;  2EOF A;  1EI1 A;  5AC4 A;  3DD6 A;  2M7Q A;  1A6F A;  2EN1 A;  2MKN A;  3V5R A;  4BA2 A;  2WBS A;  2YTN A;  2EOY A;  4B3R E;  4LFC I;  2F4V I;  1FKA E;  1P47 A;  1OYR A;  2CGE A;  2EOX A;  4F9B B;  1GZ6 A;  3P3C A;  2EPK X;  4J8Z A;  4MDT A;  4AQY I;  4BA1 B;  3M7N D;  1HNW I;  2EN6 A;  2PNL A;  2AJ4 A;  4KWY A;  3F6G A;  1Z0E A;  2RS6 A;  4LFC E;  2EOZ A;  2G7H A;  2EML A;  2VQE E;  4FW6 A;  5T6J A;  5BR8 E;  4LFA I;  4LCG A;  5A6A A;  4OKG A;  4B3S I;  1N34 E;  2O3Z A;  2EP3 A;  2EM7 A;  2FGG A;  4AQY E;  1E3H A;  1UDS A;  2EMI A;  4JI1 I;  2E5L E;  3F0N A;  2V2Z A;  2FTX B;  4LU9 A;  5FWK A;  4YHH E;  2YTQ A;  2EMZ A;  1U2R A;  2BR2 A;  1UDO A;  4MYT A;  3MHS C;  4ZYE A;  2EM8 A;  2VE7 C;  5DNY A;  2HJJ A;  2EJ4 A;  2GHF A;  2PNZ A;  1EH8 A;  2BR2 B;  3B82 A;  2H36 X;  3LTO A;  2EFG A;  1N32 E;  5IT9 Q;  1X6F A;  2BA1 D;  5DRP A;  4P7D A;  4IS1 C;  1WHQ A;  3C4B A;  1OYP A;  3WU5 A;  2R76 A;  2D9H A;  1KVK A;  1EA6 A;  1N0V C;  2J7J A;  4WPY A;  2V8P A;  4HY1 A;  2EM0 A;  3JAM C;  1FWL A;  1YHC A;  4DPW A;  2MC6 A;  4PU9 A;  2RSI A;  5A6J A;  2JP9 A;  1TN9 A;  4IFD A;  2DRP A;  2LCE A;  1YH8 A;  4KHP I;  2UU9 I;  2BB8 A;  3AUZ A;  4OO1 F;  4LF8 E;  3K17 A;  4UT4 A;  2B9D A;  3QT6 A;  4B3T E;  2EL6 A;  5K36 F;  1XNQ E;  1PDA A;  2EMA A;  4I8O A;  1A1F A;  5IXM B;  4LF7 E;  2L33 A;  1XMO E;  4BMJ A;  1MG7 A;  3CDI A;  1KIJ A;  5A2Q C;  4P78 A;  4BS9 A;  2EPA A;  2EN3 A;  1I94 E;  1ZM3 A;  5LL6 R;  2BA0 G;  1N33 E;  3D4J A;  1KKH A;  4JI5 I;  2VQF I;  1IBM E;  1DI2 A;  1XNQ I;  4JI3 I;  2RPC A;  4BC9 A;  4MLV A;  2C39 A;  2CT1 A;  2VRD A;  4WYQ B;  3H09 A;  1X6E A;  4R2S A;  1VIS A;  4FWG A;  2EM9 A;  4R2E A;  1J26 A;  2HFU A;  2IER A;  1T4O A;  3J80 C;  2N8X A;  2I13 A;  5DRQ A;  2CVE A;  4FW9 A;  3WU3 A;  4AM3 A;  2HHH I;  2EM6 A;  2UUA E;  3M85 D;  2EPL X;  1Z0V A;  2GLI A;  4HAC A;  1HNZ E;  5LMN E;  2E72 A;  5AE2 A;  3L7Z B;  4AIM A;  4F54 A;  3BGH A;  4NZV A;  4N3O A;  4DR4 I;  1N36 E;  2EPR A;  1N3G A;  3NZK A;  1HR0 I;  1KJK A;  5DNL A;  2AE8 A;  2ZBK B;  4P52 A;  2LJP A;  2L2K B;  4X64 E;  4URL A;  3P3E A;  1Z1B A;  3OML A;  2E5L I;  2DIX A;  4X66 E;  2WNR B;  1IBK I;  2NPF A;  4J3D A;  4X62 I;  4LCF A;  4MLQ A;  4X65 I;  4Q28 A;  5GMD A;  2EN8 A;  3KZY A;  4TUI A;  5KL7 A;  4I3H A;  4GEQ B;  2EM3 A;  1J5E E;  3H4L A;  2JOX A;  2PNZ B;  2YTP A;  4DUZ E;  4DV2 E;  4DR3 I;  4R2P A;  1A1K A;  2UXC E;  1EKZ A;  3J7A G;  2PO1 B;  3WU4 A;  2EMK A;  3ZZT A;  3BID A;  1S4E A;  2JY9 A;  3VHT B;  2YTE A;  2UUA I;  2EN7 A;  5KL4 A;  1G2D C;  4DR6 E;  1UDQ A;  1X48 A;  1HNZ I;  2WBU A;  4R1F A;  1X5W A;  2BBG A;  2EPC A;  2RSM A;  2JEA A;  3HKM A;  5K36 E;  2GS8 A;  2LE2 A;  1RRE A;  1RC7 A;  1UDN A;  2NN6 D;  1BBG A;  2XEX A;  4LF9 I;  3BBG A;  2F8B A;  3HXL A;  3C6M A;  4R2R A;  4DV1 E;  2LO3 A;  2YRK A;  2LRS A;  2CG9 A;  2V2V A;  1IBL I;  1ZBT A;  1PJT A;  5DRO A;  1NEI A;  2UXD I;  1GTK A;  2X36 A;  3EPL A;  3KWR A;  1PVG A;  2YRH A;  2HKE A;  5A6K A;  4DV0 I;  1Y60 A;  2EMH A;  2LBS B;  4IS9 A;  3EPH A;  4F6N A;  4R2C A;  1FNM A;  3FIG A;  2EOH A;  2WCC 3;  4LFB E;  4USM A;  4R2Q A;  5K36 D;  1DQ3 A;  4OO1 D;  2RTX A;  3LML A;  4N4R B;  4DV0 E;  4GZN C;  3PYE A;  2HKJ A;  1R6M A;  5EL9 A;  2JPA A;  1N36 I;  4JI7 E;  3T1H E;  2YSP A;  1S16 A;  4WSP A;  4B3M E;  4JI8 I;  1MEY C;  2EOJ A;  2PO2 B;  1Y4U A;  5AE3 A;  3JTZ A;  4RHB B;  2PO0 B;  3TQM A;  4LF5 E;  1PJQ A;  2CPN A;  1XNR I;  5DNX A;  4DR2 E;  1NZ0 A;  2HHH E;  4BA1 A;  4JI7 I;  5ELW A;  2DMY A;  2F4V E;  4B3R I;  2HGH A;  5C0X C;  4DU7 A;  1VI7 A;  1YSA C;  5LLQ A;  2EPO A;  4DPX A;  1AH5 A;  1H7U A;  2O1V A;  2Z5B A;  4IFD F;  4FW3 A;  2MDG A;  2UUB I;  2UXC I;  4KZS A;  4LPF A;  3GON A;  4JV5 E;  2M4I A;  4O24 A;  2R42 A;  4WX9 A;  1B69 A;  3EPK A;  3U1K A;  2N3G A;  4DPT A;  4R03 A;  1Y6Z A;  4JI6 I;  1WJP A;  4DR5 E;  4FN5 A;  5A2Q Q;  2CZ9 A;  2GO4 A;  4B3S E;  4BA2 B;  2EPP A;  4MU3 A;  2UUB E;  4X66 I;  2MC5 A;  3LNU A;  3WU6 A;  2GQ0 A;  2BV3 A;  4IZJ B;  1EH7 A;  3OTO E;  1GQE A;  4LF9 E;  4DR1 E;  4OO1 C;  2K7I A;  1A1I A;  4ZYH A;  4DMI A;  1XXE A;  2YZT A;  3ZM7 A;  4DPY A;  4XTJ A;  2GO3 A;  4X8W A;  1LLM C;  1B63 A;  2Z5E A;  3KZZ A;  4LOM A;  5JEA E;  2FV4 B;  4F9C B;  2EMW A;  3HPZ A;  4FWH A;  4FK5 C;  2HC5 A;  2YTD A;  4IZJ D;  5C0X F;  3U1Y A;  1ZR9 A;  4NHR A;  1TF3 A;  2Z5B B;  3GME A;  2C38 B;  3P3G A;  5GME A;  3P06 A;  1XMQ E;  3L00 A;  4O4K A;  1YUI A;  4DXL A;  2JEA B;  3J80 Q;  4ISA A;  2J65 A;  2DMI A;  1ZAA C;  3QT5 A;  2KON A;  1NHH A;  3GLL A;  4AID A;  2EMG A;  4GKJ I;  5KL6 A;  5TSE A;  3EPJ A;  2EN2 A;  3M99 B;  4HYM A;  1Y5Y A;  3B78 A;  5K36 C;  1SR9 A;  3J81 C;  4B3T I;  2IOP A;  1QZR A;  4IJD A;  2ENA A;  2VQE I;  4LF7 I;  4ZVI A;  3J81 Q;  2PRT A;  1NCS A;  2O1T A;  2DGC A;  1Z59 A;  5FLX C;  1RQ0 A;  4RPF A;  2V34 A;  4FW4 A;  4DV5 E;  4JI2 E;  4DUY E;  1T4L B;  1STU A;  1D6T A;  3MHH C;  2A25 A;  5F3W A;  2Z5C B;  2B7V A;  2V83 A;  4DPU A;  1XNR E;  2EPN A;  3HPS A;  2JE6 B;  4M0V A;  3DF6 A;  2M1S A;  4ZYD A;  3B4T A;  4EMD A;  2BA0 D;  5AE1 A;  2BM0 A;  4DV7 I;  2JEB A;  1ZBQ A;  2LV2 A;  1R6L A;  1HNX I;  2A2C A;  4M1K A;  4DV4 E;  2RS7 A;  4K0K I;  3ZKB A;  1SFE A;  5JEA F;  4JV5 I;  2M9A A;  4OOG C;  5C0X E;  2NN6 B;  4U3B A;  2WNR A;  1HR0 E;  1YZ9 A;  4DV7 E;  5LMU I;  2WP8 A;  2E1M A;  4FW7 A;  3Q1Q A;  1N0U A;  3M6A A;  1HNW E;  1PJS A;  2UU9 E;  2PNM A;  1IMU A;  2PO0 A;  2NN6 F;  4DUY I;  4OZE A;  4LFA E;  5BR8 I;  1DGC A;  2K4V A;  1BKN A;  1Z5A A;  1ZXN A;  1N34 I;  2DB2 A;  2L2M A;  2EQ3 A;  3JU0 A;  2LMZ A;  4JI0 I;  3K1J A;  2EMF A;  1UBD C;  2BA1 G;  1YUJ A;  2NN6 C;  1X3C A;  4WFT A;  5IV8 B;  2L3J A;  4BCA A;  2VQF E;  2YTI A;  4MU4 A;  3F6H A;  4JI3 E;  3K6Q A;  3UK3 C;  2E1R A;  4MU1 A;  3V2U C;  3VYX A;  4P7A A;  2EOM A;  3C6K A;  4IFD E;  4DV3 I;  4WXC A;  3VK6 A;  1HNX E;  4K0K E;  2JOB A;  1Z0G A;  2EMY A;  1EH6 A;  2LUQ A;  1YYO A;  2ODR D;  2WZO A;  2MDR A;  1Z0W A;  4USK A;  3IWB A;  4Z7Y A;  5JEA C;  4YY3 I;  3HQ1 A;  4R8O A;  4JI4 I;  3ZZU A;  1RR9 A;  2WW4 A;  2LVH A;  1A1J A;  3PS2 A;  1QNT A;  2DSY A;  2R3V A;  2NN6 A;  1UN6 B;  3HTX A;  1FI4 A;  4LCH A;  4YY3 E;  2WBT A;  3BF2 A;  4DR4 E;  2RQL A;  5ADZ A;  2ZIT A;  2EL4 A;  1H74 A;  2EQ1 A;  3C4T A;  4JI0 E;  1ZM2 A;  2PO2 A;  4U3D A;  2EOR A;  2HK3 A;  2ODR C;  2YTJ A;  1DAR A;  5KL5 A;  2VF1 A;  1PKP A;  1AAY A;  2NUE A;  5K36 B;  5AC5 A;  3T1H I;  4HAC B;  2L2N A;  2B7T A;  4M30 A;  2CSH A;  4JI8 E;  4B3M I;  2C37 B;  2DLQ A;  4HEI A;  4NBQ A;  1YPN A;  1I94 I;  2L6M A;  4DR3 E;  4DV2 I;  2EOE A;  5A6B A;  1X49 A;  4L5N C;  2EN4 A;  4F6M A;  1ZM4 A;  3ZKD A;  1A1L A;  1Y4S A;  4YHH I;  3T1Y I;  2A2D A;  2EWL A;  3UHM A;  2C39 B;  4DV4 I;  1K47 A;  1MGT A;  4UTG A;  3LLH A;  2VES A;  2R1F A;  3T1Y E;  1NHJ A;  3PRY A;  1XMO I;  4L8N A;  4LF4 E;  3ADG A;  4DV3 E;  3QT7 A;  1IBL E;  1KTV A;  2NA2 A;  2EMB A;  3GCM A;  4LF5 I;  4PRX A;  4Z7C A;  2ZM6 E;  2V86 A;  4NXM I;  2Z5C A;  2O1W A;  3P1X A;  1H7S A;  1OJ4 A;  4QNJ A;  4DR2 I;  3ZZ0 A;  1G2F C;  3PYF A;  2LT7 A;  2NAB A;  2EZ6 A;  5A69 A;  4OO1 A;  2EMC A;  1Z5C A;  3H1C A;  1ZM9 A;  4RH8 A;  2C37 A;  2EPZ A;  5JEA B;  1YYK A;  3PS1 A;  4X65 E;  2OI2 A;  1XMQ I;  1QU6 A;  5JEA A;  1USU A;  2J7K A;  4Q35 B;  3THO B;  2LJH A;  2JVA A;  1FWK A;  4IZJ A;  4ED4 A;  5CFF E;  1YFH A;  2Q8U A;  1HK7 A;  2PO1 A;  4LTY A;  4FW5 A;  1JK1 A;  1MX0 A;  5IWA E;  4M2Z A;  5L3J A;  2IHR 1;  2F1D A;  4MQY A;  2EOI A;  4WUC A;  3ADJ A;  5DRR A;  4OO1 E;  2YT4 A;  2IOQ A;  4JYA I;  4LF8 I;  1FJG I;  3M7N G;  2ZM6 I;  3J7Y p;  1BBO A;  4O5G A;  4WUD A;  4NXN E;  2X7I A;  4BHC A;  2V88 A;  4F2J C;  5KL2 A;  5IWA I;  1KYQ A;  4WXD A;  4BBY A;  2YTO A;  1TF6 A;  1UEK A;  1YYW A;  4HXZ A;  4QNK A;  3M85 G;  2EE8 A;  2BM1 A;  2EOS A;  3IWD A;  1WXR A;  2LUP B;  2Q2E B;  4JI5 E;  4DV6 E;  1XHK A;  2JE6 A;  4KHP E;  4FWD A;  3QG5 C;  3OTO I;  2N3H A;  2VF3 A;  4WSG A;  3HJC A;  3CDJ A;  1IQS A; 
#chains in the Genus database with same CATH homology
 5AAS A;  4X64 I;  4DR7 I;  4LFB I;  3CWV A;  4F9A B;  1O0W A;  1B62 A;  3QT8 A;  1WUU A;  4JG4 A;  4MYU A;  1IBK E;  4WUB A;  4DV6 I;  4KHP I;  2JR1 A;  4GKJ E;  2DEJ A;  5IT9 C;  3RMP A;  2B3T B;  4DV1 I;  1H72 C;  4JI6 E;  2UXD E;  1UIL A;  5LMN I;  4DR7 E;  4LF6 I;  2KHX A;  2LTS A;  3JAM Q;  1T4N A;  2L92 A;  4JI2 I;  4LF4 I;  4OX9 I;  2LTR A;  4DR6 I;  3Q6N A;  3AV0 A;  5LMU E;  1Z0C A;  4NXM E;  2V85 A;  1ELO A;  3Q6M A;  4X62 E;  1MU5 A;  3K85 A;  3ZOQ B;  4GKK I;  4OX9 E;  4PRV A;  2DEI A;  1J5E I;  3IWC A;  4DUZ I;  4KQV A;  1Z5B A;  4IZK A;  1USV A;  2NUG A;  4GKK E;  2KOU A;  1Z0B A;  1PIE A;  3PYG A;  1FJG E;  2HK2 A;  2V89 A;  2UUC E;  3MSW A;  4DKK A;  3ADL A;  1Z0T A;  2O1U A;  2HFS A;  4JI1 E;  1WHN A;  2UXB I;  3LPS A;  4DU8 A;  1ZXM A;  1NHI A;  4BC7 A;  3VYY A;  2NUF A;  1H73 A;  4TUG A;  4JYA E;  4NXN I;  2UXB E;  1X47 A;  3HUL A;  4DV5 I;  3J7A M;  1N32 I;  4DR1 I;  5FLX Q;  3ADI A;  4LF6 E;  3PYD A;  2JWO A;  2V87 A;  1UHZ A;  4IZK B;  1N33 I;  3B8H A;  2L3C A;  3DJW A;  2L8T A;  1IBM I;  4JI4 E;  4DR5 I;  2UUC I;  2V8Q B;  2V2Q A;  1EI1 A;  2M7Q A;  1A6F A;  3V5R A;  4B3R E;  4LFC I;  2F4V I;  1FKA E;  2CGE A;  4F9B B;  1GZ6 A;  4J8Z A;  4AQY I;  1HNW I;  2PNL A;  2AJ4 A;  3F6G A;  1Z0E A;  2RS6 A;  4LFC E;  2G7H A;  2VQE E;  5T6J A;  5BR8 E;  4LFA I;  4B3S I;  1N34 E;  2FGG A;  4AQY E;  4JI1 I;  2E5L E;  3F0N A;  2V2Z A;  2FTX B;  4LU9 A;  5FWK A;  4YHH E;  1U2R A;  4MYT A;  5DNY A;  2VE7 C;  3B82 A;  2H36 X;  3LTO A;  2EFG A;  1N32 E;  5IT9 Q;  4P7D A;  1WHQ A;  3C4B A;  3WU5 A;  1KVK A;  1EA6 A;  1N0V C;  4WPY A;  2V8P A;  4HY1 A;  3JAM C;  1FWL A;  4DPW A;  2MC6 A;  4PU9 A;  2UU9 I;  3AUZ A;  4LF8 E;  3K17 A;  4UT4 A;  2B9D A;  3QT6 A;  4B3T E;  1XNQ E;  4I8O A;  4LF7 E;  1MG7 A;  2L33 A;  1XMO E;  4BMJ A;  1KIJ A;  5A2Q C;  4P78 A;  4BS9 A;  1I94 E;  1ZM3 A;  5LL6 R;  1N33 E;  3D4J A;  1KKH A;  4JI5 I;  2VQF I;  1IBM E;  1DI2 A;  1XNQ I;  4JI3 I;  4BC9 A;  4WYQ B;  3H09 A;  1VIS A;  4FWG A;  1J26 A;  2HFU A;  1T4O A;  3J80 C;  3WU3 A;  4FW9 A;  2HHH I;  2UUA E;  1Z0V A;  4HAC A;  1HNZ E;  5LMN E;  5AE2 A;  4F54 A;  4N3O A;  4DR4 I;  1N36 E;  1HR0 I;  2ZBK B;  4P52 A;  2LJP A;  2L2K B;  4X64 E;  4URL A;  3OML A;  2E5L I;  2DIX A;  4X66 E;  1IBK I;  2NPF A;  4X62 I;  4X65 I;  4Q28 A;  5GMD A;  4TUI A;  4I3H A;  4GEQ B;  1J5E E;  3H4L A;  2JOX A;  4DUZ E;  4DV2 E;  4DR3 I;  2UXC E;  1EKZ A;  3J7A G;  3WU4 A;  3ZZT A;  1S4E A;  2JY9 A;  2UUA I;  4DR6 E;  1X48 A;  1HNZ I;  4R1F A;  2RSM A;  2GS8 A;  2LE2 A;  1RRE A;  1RC7 A;  4GKJ I;  2XEX A;  4LF9 I;  2F8B A;  3HXL A;  2CG9 A;  4DV1 E;  2V2V A;  2LRS A;  1IBL I;  2UXD I;  1ZBT A;  2X36 A;  3KWR A;  1PVG A;  2HKE A;  4DV0 I;  2LBS B;  1FNM A;  3FIG A;  4LFB E;  4USM A;  1DQ3 A;  2RTX A;  3LML A;  4DV0 E;  3PYE A;  2HKJ A;  1N36 I;  1S16 A;  4JI7 E;  3T1H E;  4WSP A;  4B3M E;  4JI8 I;  1Y4U A;  5AE3 A;  3JTZ A;  4LF5 E;  2CPN A;  1XNR I;  4DR2 E;  1NZ0 A;  2HHH E;  4JI7 I;  2DMY A;  2F4V E;  4B3R I;  4DU7 A;  4DPX A;  2O1V A;  1H7U A;  2Z5B A;  2UXC I;  2UUB I;  4KZS A;  3GON A;  4JV5 E;  2M4I A;  2R42 A;  2N3G A;  4DPT A;  4R03 A;  1Y6Z A;  4JI6 I;  4DR5 E;  4FN5 A;  5A2Q Q;  2CZ9 A;  4B3S E;  2UUB E;  4X66 I;  2MC5 A;  3LNU A;  3WU6 A;  2GQ0 A;  2BV3 A;  4IZJ B;  3OTO E;  1GQE A;  4LF9 E;  4DR1 E;  4DMI A;  3ZM7 A;  2YZT A;  4DPY A;  4XTJ A;  4X8W A;  1B63 A;  2Z5E A;  2FV4 B;  4F9C B;  4FWH A;  3HPZ A;  4IZJ D;  2Z5B B;  5GME A;  3P06 A;  4DXL A;  3J80 Q;  3QT5 A;  2KON A;  1NHH A;  4HYM A;  3B78 A;  1SR9 A;  3J81 C;  4B3T I;  2IOP A;  1QZR A;  2VQE I;  4LF7 I;  4ZVI A;  3J81 Q;  2O1T A;  1Z59 A;  5FLX C;  1RQ0 A;  4RPF A;  2V34 A;  4DV5 E;  4JI2 E;  4DUY E;  1T4L B;  1STU A;  1D6T A;  5F3W A;  2Z5C B;  2B7V A;  2V83 A;  4DPU A;  1XNR E;  3HPS A;  4M0V A;  3DF6 A;  2M1S A;  4EMD A;  5AE1 A;  2BM0 A;  4DV7 I;  1ZBQ A;  1HNX I;  2A2C A;  4M1K A;  4DV4 E;  2RS7 A;  4K0K I;  3ZKB A;  4JV5 I;  4OOG C;  1HR0 E;  1YZ9 A;  4DV7 E;  5LMU I;  2E1M A;  3Q1Q A;  1N0U A;  3M6A A;  1HNW E;  2UU9 E;  2PNM A;  4DUY I;  4LFA E;  5BR8 I;  1BKN A;  2K4V A;  1Z5A A;  1ZXN A;  1N34 I;  2DB2 A;  2L2M A;  2LMZ A;  3JU0 A;  4JI0 I;  3K1J A;  4WFT A;  2L3J A;  2VQF E;  4BCA A;  3F6H A;  4JI3 E;  3K6Q A;  2E1R A;  3V2U C;  1FJG I;  3VYX A;  4P7A A;  4DV3 I;  3VK6 A;  1HNX E;  4K0K E;  2JOB A;  1Z0G A;  1YYO A;  2LUQ A;  2ODR D;  2WZO A;  2MDR A;  1Z0W A;  4USK A;  3IWB A;  4Z7Y A;  4YY3 I;  3HQ1 A;  4R8O A;  4JI4 I;  3ZZU A;  1RR9 A;  2WW4 A;  2DSY A;  2R3V A;  3HTX A;  1FI4 A;  4YY3 E;  4DR4 E;  5ADZ A;  2ZIT A;  1H74 A;  3C4T A;  4JI0 E;  1ZM2 A;  2HK3 A;  2ODR C;  1DAR A;  2VF1 A;  1PKP A;  2NUE A;  3T1H I;  4HAC B;  2L2N A;  2B7T A;  4M30 A;  4JI8 E;  4B3M I;  1I94 I;  2L6M A;  4DR3 E;  4DV2 I;  1X49 A;  4L5N C;  1ZM4 A;  3ZKD A;  1Y4S A;  4YHH I;  3T1Y I;  2A2D A;  2EWL A;  4DV4 I;  1K47 A;  4UTG A;  3LLH A;  3T1Y E;  1NHJ A;  3PRY A;  1XMO I;  4L8N A;  4LF4 E;  3ADG A;  4DV3 E;  3QT7 A;  1IBL E;  1KTV A;  2NA2 A;  4LF5 I;  4PRX A;  4Z7C A;  2ZM6 E;  2V86 A;  4NXM I;  2Z5C A;  2O1W A;  3P1X A;  1H7S A;  1OJ4 A;  4DR2 I;  3ZZ0 A;  3PYF A;  2EZ6 A;  1Z5C A;  1ZM9 A;  1YYK A;  4X65 E;  2OI2 A;  1XMQ I;  1QU6 A;  1USU A;  2J7K A;  4IZJ A;  2LJH A;  2JVA A;  1FWK A;  4ED4 A;  5CFF E;  1HK7 A;  4LTY A;  1MX0 A;  5IWA E;  4M2Z A;  5L3J A;  2IHR 1;  4WUC A;  3ADJ A;  2YT4 A;  2IOQ A;  4JYA I;  4LF8 I;  2ZM6 I;  3J7Y p;  4WUD A;  4NXN E;  2X7I A;  2V88 A;  5IWA I;  4BBY A;  4HXZ A;  1UEK A;  1YYW A;  2BM1 A;  1WXR A;  3IWD A;  2LUP B;  2Q2E B;  4JI5 E;  4DV6 E;  1XHK A;  4KHP E;  4FWD A;  3OTO I;  2N3H A;  2VF3 A;  1XMQ E;  3HJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...