4OX9E

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ox9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9E02
2LRSA 2A2DA 1X47A 4X62I 5L3JA 1RR9A 4DXLA 4OX9I 2V34A 3B78A 4B3RI 3V2UC 1XMQI 4JV5E 4JG4A 1IBKI 3ADJA 2UU9I 4JI5E 2DIXA 2ZM6E 1T4OA 2UXBE 2CPNA 3P1XA 4KQVA 4PRVA 4GKJI 1Z0EA 4YHHE 1H72C 3T1HE 2NUFA 4GKKI 2HHHI 1PKPA 4JI7E 2R42A 4DR3I 1IBME 1DI2A 1J5EI 4FWHA 2BM0A 1FKAE 4DR5E 4DPWA 4M2ZA 3OTOI 1ELOA 1N36E 4P52A 2EZ6A 3ZZUA 4NXME 4DV6E 1XNQI 4FN5A 4DUYE 3K17A 3ZZTA 5LL6R 3ADIA 1B62A 1K47A 1D6TA 5IT9Q 2WW4A 3JAMQ 2LJPA 4DV7I 2L2KB 5GMEA 2RTXA 5BR8E 4LFCI 3J7AM 4JI1E 4M1KA 2NPFA 1ZXMA 1N33I 1Z0TA 2R3VA 3QT5A 3QT6A 1MX0A 1YZ9A 3H4LA 1H7UA 1RQ0A 3HULA 4HY1A 4DPYA 2DEJA 1XMOE 1ZBTA 2F4VE 2V2QA 1HNXE 3M6AA 4JI0E 2ZM6I 2AJ4A 1KIJA 2UXBI 2L2MA 1Z5AA 1ZXNA 2VQFE 2LUPB 2DEIA 3K1JA 4YY3I 4YHHI 3ZKDA 2LBSB 4JI8E 4DV3E 3T1HI 2L3CA 5LMNE 1HNWE 4ZVIA 3Q1QA 4JI7I 1H7SA 2NUGA 1QU6A 1Z0VA 4LF4E 1NZ0A 5IT9C 1H73A 3JAMC 4DR5I 1NHJA 2N3GA 2B3TB 4FWGA 1YYWA 1ZM2A 1EI1A 2LTSA 4DR2E 2VQEI 4P7AA 4NXMI 5LMUI 4UTGA 4DV6I 4JI4I 2E5LE 1N34E 4DV5E 3ADGA 1IBLE 4LFAI 2V8PA 4DV2I 3ZKBA 1MG7A 3WU4A 3ADLA 2Q2EB 4WUCA 1FNMA 1RREA 1FWKA 1EKZA 3T1YE 4WUBA 2IHR1 4MYTA 4JI1I 4Z7CA 4HACA 3J80C 4OOGC 2UXDI 4AQYE 1YYKA 4LF8I 2LUQA 4B3SI 3PYEA 2RS7A 4WYQB 3QT7A 1XMOI 4PU9A 1HNXI 4DV1E 1ZM3A 4JI0I 1Z0GA 2L33A 2CZ9A 4DV0E 1ZM4A 4WFTA 4K0KE 4KHPE 2VQFI 3QT8A 1UEKA 1GQEA 4X64E 3V5RA 4JI8I 4DV3I 1UILA 3D4JA 5LMNI 1HR0E 2ZITA 2UUAE 2HFSA 1EA6A 4X8WA 1FWLA 4LF4I 4DR7E 4B3MI 4X65E 1FI4A 1I94E 4DR6E 4JYAI 3LLHA 4JI3E 4DR2I 1Z0BA 3C4TA 4DPTA 2UXCE 4X66E 4LFBE 4DV5I 1IBLI 1KVKA 2RSMA 3WU5A 1NHIA 1YYOA 4X62E 4MYUA 3B8HA 2LTRA 4JV5I 1N0UA 4B3RE 3T1YI 3GONA 4PRXA 1DARA 4JI5I 2LJHA 2E1RA 1IBKE 3F0NA 3J7AG 4WUDA 2N3HA 1B63A 4I3HA 4URLA 2ZBKB 3J80Q 3J81C 1XNRE 4GKJE 3PYDA 4DV1I 1T4NA 3ZM7A 4DV0I 1KKHA 4LF7E 4GKKE 1IBMI 2HHHE 1S16A 1WHNA 2L2NA 1PVGA 5A2QQ 4DR3E 4X64I 1U2RA 3WU3A 1J5EE 4DKKA 2HFUA 1T4LB 1N36I 3PYFA 2KHXA 1PIEA 4HYMA 4USMA 4DU7A 4DUYI 4LF9E 4DR7I 2DMYA 2B7TA 4DR4E 3LPSA 4UT4A 2V2VA 1HNZE 1Z5CA 4B3TE 4DPXA 4DV4E 4JI3I 1X48A 5BR8I 1FJGE 1BKNA 5FLXQ 4XTJA 4R1FA 2UXCI 1X49A 4RPFA 5IWAE 1N32E 3LTOA 1H74A 1N33E 1S4EA 2F4VI 1OJ4A 4DPUA 5CFFE 4FW9A 5A2QC 2HKJA 2NUEA 2UUBE 2NA2A 1ZM9A 2X36A 1RC7A 1Z0WA 1XNRI 1KTVA 4M30A 3LNUA 2HK2A 1HNWI 2JY9A 4YY3E 4DU8A 4DR1E 1O0WA 1NHHA 2VF3A 4NXNE 2UUCE 4EMDA 3J81Q 1N0VC 4LF7I 2J7KA 4LF6E 4DUZE 2L3JA 2BM1A 5FLXC 2HK3A 4LF5E 4ED4A 4JI6E 2YT4A 4USKA 2E5LI 4LF9I 2X7IA 1N34I 2VQEE 1STUA 4JI2E 4HACB 5LMUE 4JI4E 1Z5BA 4DR4I 1WHQA 1HNZI 4B3TI 4LFAE 4DV4I 4DV2E 1FJGI 4OX9E 2V2ZA 1XMQE 2XEXA 5IWAI 1N32I 4Z7YA 1UHZA 2HKEA 4AQYI 2UU9E 4FWDA 1A6FA 2RS6A 1VISA 3CWVA 2UXDE 2GS8A 4LF8E 4B3SE 1XHKA 2B7VA 3VYXA 2UUBI 2OI2A 4KHPI 4K0KI 1J26A 3J7Yp 2JVAA 3VYYA 1MU5A 4HXZA 1Z59A 1HR0I 2UUAI 4DR1I 1Z0CA 4NXNI 3OTOE 2UUCI 2A2CA 3B82A 1WUUA 2EFGA 3PYGA 3C4BA 4X65I 4LF6I 4DUZI 1XNQE 4B3ME 1I94I 2MDRA 4DR6I 4LF5I 1QZRA 2DB2A 3ZZ0A 2BV3A 4JI6I 4JYAE 4DV7E 3WU6A 5GMDA 4X66I 4LFBI 4LFCE 3HTXA 4JI2I
chains in the Genus database with same CATH superfamily
3C6KA 2LRSA 1X3CA 1A1KA 4BA1A 2A2DA 1X47A 4X62I 3M85D 5L3JA 1RR9A 4DXLA 2ENHA 5C0XB 2VF1A 2EOJA 4OX9I 2V34A 3B78A 4R8OA 4B3RI 1IMUA 3V2UC 3Q6NA 2RQLA 1XMQI 2EMHA 3CDJA 2YTFA 2EPMX 2Z5BB 4JV5E 4JG4A 1IBKI 3PS3A 3ADJA 2PO2A 2UU9I 2YTNA 4JI5E 2DIXA 2M9AA 1T4OA 2ZM6E 2JEBB 3B4TA 2WNRB 2UXBE 2CPNA 3P1XA 3L7ZB 4BS9A 2EOMA 4R2EA 4KQVA 4PRVA 4AIDA 4F2JC 3EQ1A 3VHTB 4GKJI 1Z0EA 2J65A 3DJWA 2AE8A 4MQYA 4YHHE 1H72C 1PJQA 3T1HE 2BA0D 2NUFA 3NZKA 4GKKI 2EMAA 4MU3A 1KYQA 1EH6A 2HHHI 1PKPA 4JI7E 1L4SA 2R42A 2EOIA 3UHMA 4IZJB 1A1GA 1A1LA 5ADZA 4M9VC 2C37B 4DR3I 4OO1B 1SFEA 2EM5A 1IBME 1DI2A 2JPAA 1J5EI 4LOMA 4FWHA 2BM0A 1FKAE 3MSWA 1T38A 4DR5E 1X5WA 1Y5YA 4DPWA 4M2ZA 3CDIA 2CTDA 3PS1A 2PNLA 3OTOI 2EPXA 2RPCA 1ELOA 2YTIA 1N36E 4BC9A 5A6BD 5JEAD 3K85A 2BR2B 2YTGA 1GTKA 2DMIA 3M7ND 2EPOA 4P52A 2EZ6A 3ZZUA 4WSPA 4NXME 2JEAA 4DV6E 1XNQI 2GQ0A 4FN5A 2LCEA 4DUYE 1TF6A 4IZKB 4KZSA 3THNA 3K17A 5C0XF 2WBTA 4R2AA 4L8NA 1UDNA 3ZZTA 2WBUA 1NCSA 5LL6R 4ISAA 3ADIA 4RH8A 1B62A 1GZ6A 1G2FC 1K47A 5IT9Q 1D6TA 2EM2A 2WW4A 2BA1G 2CGEA 2HJJA 3JAMQ 4FW6A 1T39A 2LJPA 2L2KB 2EPCA 5GMEA 4DV7I 2JOBA 2RTXA 5BR8E 2PO1B 3H09A 4LFCI 4WXCA 2E72A 2EM4A 2YTDA 3J7AM 2EMFA 4JI1E 3DF6A 3DD6A 1P47A 4M1KA 2EL6A 2O1TA 2NPFA 1ZXMA 1N33I 2V83A 4NHRA 1Z0TA 2CG9A 2R3VA 4BHBA 1PJSA 3QT5A 3KZZA 3QT6A 2EMYA 1MX0A 2YPNA 1YZ9A 3H4LA 5K36D 3F6HA 1RQ0A 1H7UA 3HULA 3MHHC 4HY1A 4DPYA 2DEJA 4ZYDA 3FIGA 4TUIA 1XMOE 1ZBTA 2F4VE 2V2QA 1HNXE 4O5GA 3M6AA 5KL3A 4JI0E 4WX9A 2ZM6I 4FK5C 2AJ4A 1KIJA 2EE8A 3HJCA 2UXBI 1X6FA 2L2MA 2YU8A 1Z5AA 4FW5A 4OO1E 1ZXNA 4GEQB 2VQFE 5A6AA 4AIMA 2LUPB 2DEIA 1UDQA 3K1JA 4YY3I 4YHHI 3ZKDA 2LBSB 4R2QA 2V89A 4JI8E 4DV3E 3T1HI 2L3CA 2E1MA 5LMNE 1HNWE 4BA2B 3AV0A 4ZVIA 2ADRA 3P3CA 2EPZA 4Q28A 4JI7I 1H7SA 4J3DA 3Q1QA 2Z5BA 1UN6B 3QG5C 2NUGA 1QU6A 2O1VA 1Z0VA 2G7HA 4LF4E 1NZ0A 3KRNA 5IT9C 1H73A 3P3EA 2C38A 4BBYA 3JAMC 2IOPA 2BA1D 4BHCA 2WNRA 2ELZA 2WP8B 3L7ZA 4DR5I 1NHJA 1YH8A 2ENAA 2YZTA 2N3GA 2B3TB 2EMBA 2EN6A 4FWGA 2EN8A 2D9HA 2EQ0A 5K36E 1YYWA 4DU8A 1ZM2A 4MU1A 4O43A 1EI1A 2J7JA 2LTSA 2Z5CB 4DR2E 2VQEI 2FGGA 1E3HA 4P7AA 4LTYA 5EKWA 4UTGA 5LMUI 4DV6I 4NXMI 4JI4I 2A25A 2E5LE 4F9CB 1N34E 4DV5E 4WXDA 4IZJA 3ADGA 1IBLE 4P7DA 5FWKA 4LFAI 2NN6D 2V8PA 1RMDA 4DV2I 3ZKBA 1MG7A 3WU4A 2YSPA 3ADLA 2M4IA 5ELWA 2Q2EB 1YSAC 4WUCA 5DNYA 5C0XC 4LCFA 1N3GA 5AASA 1FNMA 1RREA 1FWKA 3U1KA 2EPAA 1EKZA 2PRTA 3T1YE 4WUBA 3KWRA 2IHR1 4HEIA 2WBSA 1KJKA 4LCGA 3BGHA 4R2RA 4MYTA 4FW3A 2EJ4A 1Y60A 4M0VA 4HACA 4JI1I 4Z7CA 1BBGA 3J80C 4OOGC 2UXDI 1ZBQA 4AQYE 4FW4A 1YYKA 4LF8I 5DNLA 2LUQA 3EPLA 4B3SI 3PYEA 1ZU1A 2EPUA 4IFDE 2RS7A 5A6JA 1F2IG 4R2PA 1UBDC 4WYQB 1IQSA 2JYAA 2V86A 2VE7C 1R6LA 5JEAB 2Q8UA 2L92A 3GCMA 3QT7A 1XMOI 1OYPA 1DQ3A 5T6JA 4PU9A 1HNXI 1XXEA 2PO1A 4DV1E 1R6MA 1ZM3A 4JI0I 1Z0GA 2L33A 2CZ9A 2BB8A 2EN2A 2EM9A 2KOUA 4DV0E 1ZM4A 1YUIA 2NN6E 3HPZA 4WFTA 4K0KE 2M7QA 4KHPE 3RMPA 2VQFI 3QT8A 5C0XD 2LJUA 3IWDA 4BMJA 1UEKA 2O1UA 4OO1C 1GQEA 4X64E 1YPNA 3V5RA 2FTXB 4ZYGA 4GQUA 4JI8I 2FV4B 1Y4UA 4DV3I 1UILA 2F8BA 1IQOA 3D4JA 4R2CA 5LMNI 1HR0E 2EN4A 2UUAE 2ZITA 5DRRA 2EOXA 2HFSA 3PRYA 2CSHA 1EA6A 4X8WA 2L6MA 2LT7A 5KL4A 4IJDA 1DGCA 1FWLA 3M99B 2PNMA 4LF4I 2CT1A 2YTOA 1USVA 1TF3A 4DR7E 4B3MI 2BBGA 2CVEA 2EPLX 4X65E 5K36B 2EPPA 4F54A 2EM0A 2EOOA 4O4KA 1I94E 1FI4A 3IWCA 4DR6E 4JYAI 3C6MA 3LLHA 2YWQA 4JI3E 4DR2I 2PNZB 1Z0BA 1TN9A 1PDAA 3C4TA 4DPTA 3MHSC 2UXCE 4X66E 2LO3A 4LFBE 2PO2B 4DV5I 2R76A 1LLMC 1KVKA 2RSMA 1UDOA 1IBLI 3WU5A 2LVHA 1MGTA 1NHIA 2PO0A 1YYOA 1EH8A 4X62E 4IZJD 2EMLA 4ZYHA 2DGCA 4TUGA 5IXMB 4MYUA 4ZYEA 2LTRA 3B8HA 5JEAE 4BCAA 1A1HA 4NBQA 2WZOA 4JV5I 1N0UA 4MU0A 2R1FA 3ECRA 4B3RE 1YHCA 3GONA 3T1YI 4PRXA 2EPNA 2KONA 1DARA 4OO1F 2NABA 4JI5I 3P76A 2YTPA 5DRQA 2LJHA 2E1RA 1IBKE 1JK2A 3JTZA 3J7AG 3F0NA 2LV2A 4WUDA 1EH7A 1ZR9A 2N3HA 1B63A 4IFDB 4I3HA 4URLA 5C0XA 2ODRC 2ZBKB 3J81C 3J80Q 1XNRE 3M85G 4F6MA 1WJPA 5AE2A 2EPKX 4JI2I 4GKJE 2LMZA 1OYSA 3PYDA 1SR9A 4DV1I 4LPFA 1T4NA 3HXLA 3ZM7A 2EOZA 4LCHA 4DV0I 2YTQA 1KKHA 2JP9A 4LF7E 2NN6B 4GKKE 1IBMI 2JEAB 2GLIA 2HHHE 1S16A 1WHNA 2L2NA 1PVGA 1RHYA 2JEBA 5K36F 5A2QQ 4DR3E 4X64I 1U2RA 5AE3A 3WU3A 1J5EE 4DKKA 3THOB 2HFUA 1T4LB 2EOHA 5A6BA 1ZAAC 2M1SA 1N36I 3PYFA 3P3GA 5AC4A 1BBOA 2KHXA 2I9IA 2EP3A 1PIEA 1UDSA 4HYMA 4WPYA 4F9AB 4USMA 2MC5A 1HK7A 2JT2A 4DU7A 4LF9E 4DUYI 4IS9A 4DR7I 2DMYA 1A1FA 2C37A 2MDGA 4IS1C 4OO1A 3KZYA 2JOXA 4O24A 2B7TA 2EMXA 2V85A 4NZVA 2C39B 4DR4E 3LPSA 2VESA 2V2VA 2EOQA 1HNZE 4UT4A 1Z5CA 4OZEA 1YFHA 4B3TE 4I8OA 4R2DA 3ZOQB 4DPXA 4J8ZA 4DV4E 1X48A 4JI3I 5BR8I 1FJGE 2YTJA 5DROA 2GO4A 2YSOA 2VRDA 1BKNA 5FLXQ 4XTJA 5F3WA 4R1FA 2UXCI 5DRPA 2BR2A 1X49A 5IV8B 4RPFA 2JE6B 3HQ1A 2Z5EA 5IWAE 3L00A 1N32E 2RSIA 4IFDF 2F1DA 4IZKA 2EMIA 5AE1A 4GZNC 2DLKA 1Z1BA 2ELYA 2YRMA 1B69A 3M7NG 4WSGA 3GLLA 3LTOA 1H74A 5K36A 2EOEA 3H1CA 5KL2A 2MC6A 1N33E 3JU0A 2DSYA 2V88A 1S4EA 5TSEA 2YU5A 5JEAC 2F4VI 1NEIA 1MEYC 1OJ4A 2PNZA 5CFFE 2NN6F 4DPUA 5A2QC 2DRPA 4FW9A 2HKJA 2NUEA 3GMEA 2UUBE 2EN1A 2EWLA 2NA2A 5LLQA 2EL5A 2C38B 2JXPA 2GHFA 4KWYA 4QNJA 1VI7A 2EN3A 4Q35B 1ZM9A 2X36A 1RC7A 2LE2A 4U3DA 2EQ1A 1Z0WA 1XNRI 1AH5A 4M30A 1KTVA 3LNUA 2HK2A 1HNWI 2EM3A 3BF2A 2JY9A 2JR1A 2EMCA 4R03A 4DMIA 4YY3E 4DR1E 1O0WA 2EMGA 1NHHA 4NXNE 4HTGA 1P42A 2VF3A 5KL5A 2UUCE 4EMDA 3J81Q 2H36X 4OKGA 1N0VC 4LF7I 1PJTA 3BIDA 4QNKA 2J7KA 4BA1B 4LF6E 4DUZE 2EMWA 2L3JA 4IFDA 5FLXC 2N8XA 2BM1A 4MLQA 2HK3A 4LF5E 2YTEA 4N4RB 3UK3C 5K36C 5EL9A 2I13A 5DNXA 4BA2A 2EM8A 1BB8A 4ED4A 4JI6E 2YT4A 3VK6A 3Q6MA 4USKA 2E5LI 4LF9I 2X7IA 1N34I 2VQEE 1STUA 2NN6A 5AC5A 4JI2E 4HACB 5LMUE 4JI4E 1Z5BA 2O3ZA 4DR4I 1WHQA 2YRHA 5KL6A 2WP8A 5JEAF 1HNZI 3LMLA 4B3TI 4LFAE 4OO1D 1USUA 4DV4I 2HGHA 3U1YA 5C0XE 4DV2E 1FJGI 4OX9E 2V2ZA 2ENCA 3EPJA 2IOQA 1QNTA 4FW7A 4LU9A 1X6HA 2Z5CA 1XMQE 2MKNA 2YRKA 1OYRA 3HKMA 4L5NC 1JK1A 1AAYA 2XEXA 5IWAI 1N32I 4Z7YA 1UHZA 4R2SA 2HKEA 2O1WA 4AQYI 3HPSA 4F9BB 2UU9E 4FWDA 3BBGA 2GO3A 1A6FA 2RS6A 2EOFA 2C39A 1VISA 3CWVA 3IWBA 4RHBB 2UXDE 2GS8A 4LF8E 4IFDC 4B3SE 2EQ3A 2DLQA 1XHKA 2B7VA 2EM7A 2WCC3 2V87A 5KL7A 2GPIA 2EORA 2HC5A 3VYXA 2UUBI 1WRJA 2EM6A 2IESA 2JE6A 2OI2A 1WXRA 3K6QA 4KHPI 4K0KI 3OMLA 4U3BA 2NN6C 1J26A 2L8TA 2EOSA 3J7Yp 2EOYA 2JVAA 3F6GA 3VYYA 1MU5A 1Y4SA 4MU4A 4HXZA 3TQMA 1Z59A 2MKDA 1Y6ZA 1HR0I 2UUAI 5JEAA 4DR1I 1Z0CA 4F6NA 2IERA 4NXNI 1E3PA 2EL4A 3OTOE 2UUCI 2A2CA 5A6KA 3B82A 1WUUA 1A1IA 4P78A 2V8QB 2K4VA 2EFGA 3PYGA 2BA0G 3C4BA 4X65I 2B9DA 4LF6I 4DUZI 4BC7A 2JWOA 1XNQE 2EMZA 2PO0B 4MDTA 4B3ME 1I94I 2MDRA 4N3OA 4DR6I 4LF5I 2EN7A 3PS2A 1QZRA 2DB2A 4X9JA 5A69A 3ZZ0A 2K7IA 2ODRD 4MLVA 1A1JA 3P06A 2EMKA 4IFDD 1X6EA 3EPHA 2BV3A 4JI6I 4JYAE 4DV7E 3WU6A 4AM3A 5GMDA 4X66I 3AUZA 3EPKA 4LFBI 1G2DC 2EPRA 4LFCE 3HTXA 1YUJA
chains in the Genus database with same CATH topology
2LRSA 2A2DA 1X47A 4X62I 5L3JA 1RR9A 4DXLA 2VF1A 4OX9I 2V34A 3B78A 4R8OA 4B3RI 3V2UC 3Q6NA 1XMQI 2Z5BB 4JV5E 4JG4A 1IBKI 3ADJA 2UU9I 4JI5E 2DIXA 2ZM6E 1T4OA 2UXBE 2CPNA 3P1XA 4BS9A 4KQVA 4PRVA 4GKJI 1Z0EA 3DJWA 4YHHE 1H72C 3T1HE 2NUFA 4GKKI 2HHHI 1PKPA 4JI7E 2R42A 4IZJB 4DR3I 5ADZA 1IBME 1DI2A 1J5EI 4FWHA 2BM0A 1FKAE 3MSWA 4DR5E 4DPWA 4M2ZA 2PNLA 3OTOI 1ELOA 1N36E 4BC9A 3K85A 4P52A 2EZ6A 3ZZUA 4WSPA 4NXME 4DV6E 1XNQI 2GQ0A 4FN5A 4IZKB 4DUYE 4KZSA 3K17A 3ZZTA 4L8NA 5LL6R 3ADIA 1B62A 1GZ6A 1K47A 1D6TA 5IT9Q 2WW4A 2CGEA 3JAMQ 2LJPA 4DV7I 2L2KB 5GMEA 2JOBA 2RTXA 5BR8E 3H09A 4LFCI 3J7AM 4JI1E 3DF6A 4M1KA 2O1TA 2NPFA 1ZXMA 1N33I 2V83A 1Z0TA 2CG9A 2R3VA 3QT5A 3QT6A 1MX0A 1YZ9A 3H4LA 3F6HA 1RQ0A 1H7UA 3HULA 4HY1A 4DPYA 2DEJA 1XMOE 3FIGA 4TUIA 1ZBTA 2F4VE 2V2QA 1HNXE 3M6AA 4JI0E 2ZM6I 2AJ4A 1KIJA 3HJCA 2UXBI 2L2MA 1Z5AA 1ZXNA 4GEQB 2VQFE 2LUPB 2DEIA 3K1JA 4YY3I 4YHHI 3ZKDA 2LBSB 2V89A 4JI8E 4DV3E 3T1HI 2L3CA 2E1MA 5LMNE 1HNWE 3AV0A 4ZVIA 3Q1QA 4Q28A 4JI7I 1H7SA 2Z5BA 2NUGA 1QU6A 2O1VA 1Z0VA 2G7HA 4LF4E 1NZ0A 5IT9C 1H73A 4BBYA 3JAMC 2IOPA 4DR5I 1NHJA 2YZTA 2N3GA 2B3TB 4FWGA 1YYWA 1ZM2A 1EI1A 2LTSA 2Z5CB 4DR2E 2VQEI 2FGGA 4P7AA 4NXMI 4LTYA 5LMUI 4UTGA 4DV6I 4JI4I 2E5LE 4F9CB 1N34E 4DV5E 4IZJA 3ADGA 1IBLE 4P7DA 5FWKA 4LFAI 2V8PA 4DV2I 3ZKBA 1MG7A 3WU4A 3ADLA 2M4IA 2Q2EB 4WUCA 5DNYA 5AASA 1FNMA 1RREA 1FWKA 1EKZA 3T1YE 4WUBA 3KWRA 2IHR1 4MYTA 4JI1I 4Z7CA 4M0VA 4HACA 3J80C 4OOGC 2UXDI 1ZBQA 4AQYE 1YYKA 4LF8I 2LUQA 4B3SI 3PYEA 2RS7A 4WYQB 2V86A 2VE7C 2L92A 3QT7A 1XMOI 1DQ3A 5T6JA 4PU9A 1HNXI 4DV1E 1ZM3A 4JI0I 1Z0GA 2L33A 2CZ9A 2KOUA 4DV0E 1ZM4A 3HPZA 4WFTA 4KHPE 4K0KE 2M7QA 3RMPA 2VQFI 3QT8A 3IWDA 4BMJA 1UEKA 2O1UA 1GQEA 4X64E 3V5RA 2FTXB 4JI8I 4DV3I 2FV4B 1Y4UA 1UILA 2F8BA 3D4JA 5LMNI 1HR0E 2ZITA 2UUAE 2HFSA 3PRYA 1EA6A 4X8WA 2L6MA 1FWLA 2PNMA 4LF4I 1USVA 4DR7E 4B3MI 4X65E 4F54A 1FI4A 1I94E 3IWCA 4DR6E 4JYAI 3LLHA 4JI3E 4DR2I 1Z0BA 3C4TA 4DPTA 2UXCE 4X66E 4LFBE 4DV5I 1IBLI 1KVKA 2RSMA 3WU5A 1NHIA 1YYOA 4X62E 4IZJD 4TUGA 4MYUA 3B8HA 2LTRA 4BCAA 2WZOA 4JV5I 1N0UA 4B3RE 3T1YI 3GONA 4PRXA 2KONA 1DARA 4JI5I 2LJHA 2E1RA 1IBKE 3JTZA 3J7AG 3F0NA 4WUDA 2N3HA 1B63A 4I3HA 4URLA 2ODRC 2ZBKB 3J81C 3J80Q 1XNRE 5AE2A 4GKJE 2LMZA 3PYDA 1SR9A 4DV1I 1T4NA 3HXLA 3ZM7A 4DV0I 1KKHA 4LF7E 4GKKE 1IBMI 2HHHE 1S16A 1WHNA 2L2NA 1PVGA 5A2QQ 4DR3E 4X64I 1U2RA 5AE3A 3WU3A 1J5EE 4DKKA 2HFUA 1T4LB 1N36I 2M1SA 3PYFA 2KHXA 1PIEA 4HYMA 4WPYA 4F9AB 4USMA 2MC5A 1HK7A 4DU7A 4DUYI 4LF9E 4DR7I 2DMYA 2JOXA 2B7TA 2V85A 4DR4E 3LPSA 4UT4A 2V2VA 1HNZE 1Z5CA 4B3TE 4I8OA 3ZOQB 4DPXA 4J8ZA 4DV4E 1X48A 4JI3I 5BR8I 1FJGE 1BKNA 5FLXQ 4XTJA 5F3WA 4R1FA 2UXCI 1X49A 4RPFA 3HQ1A 2Z5EA 5IWAE 1N32E 4IZKA 5AE1A 3LTOA 1H74A 2MC6A 1N33E 3JU0A 2DSYA 2V88A 1S4EA 2F4VI 1OJ4A 4DPUA 5CFFE 5A2QC 4FW9A 2HKJA 2NUEA 2UUBE 2NA2A 2EWLA 1ZM9A 2X36A 1RC7A 2LE2A 1Z0WA 1XNRI 4M30A 1KTVA 3LNUA 2HK2A 1HNWI 2JY9A 2JR1A 4R03A 4DMIA 4YY3E 4DU8A 4DR1E 1O0WA 1NHHA 2VF3A 4NXNE 2UUCE 4EMDA 3J81Q 2H36X 1N0VC 4LF7I 2J7KA 4LF6E 4DUZE 2L3JA 5FLXC 2BM1A 2HK3A 4LF5E 4ED4A 4JI6E 2YT4A 3VK6A 3Q6MA 4USKA 2E5LI 4LF9I 2X7IA 1N34I 2VQEE 1STUA 4JI2E 4HACB 5LMUE 4JI4E 1Z5BA 4DR4I 1WHQA 1HNZI 3LMLA 4B3TI 4LFAE 1USUA 4DV4I 4DV2E 1FJGI 4OX9E 2V2ZA 2IOQA 4LU9A 2Z5CA 1XMQE 4L5NC 2XEXA 5IWAI 1N32I 4Z7YA 1UHZA 2HKEA 2O1WA 4AQYI 3HPSA 4F9BB 2UU9E 4FWDA 1A6FA 2RS6A 1VISA 3CWVA 3IWBA 2UXDE 2GS8A 4LF8E 4B3SE 1XHKA 2B7VA 2V87A 3VYXA 2UUBI 2OI2A 1WXRA 3K6QA 4KHPI 4K0KI 3OMLA 1J26A 2L8TA 3J7Yp 2JVAA 3VYYA 3F6GA 1MU5A 1Y4SA 4HXZA 1Z59A 1Y6ZA 1HR0I 2UUAI 4DR1I 1Z0CA 4NXNI 3OTOE 2UUCI 2A2CA 3B82A 1WUUA 4P78A 2V8QB 2K4VA 2EFGA 3PYGA 3C4BA 4X65I 2B9DA 4LF6I 4DUZI 4BC7A 2JWOA 1XNQE 4B3ME 1I94I 2MDRA 4N3OA 4DR6I 4LF5I 1QZRA 2DB2A 3ZZ0A 2ODRD 3P06A 2BV3A 4JI6I 4JYAE 4DV7E 3WU6A 5GMDA 4X66I 3AUZA 4LFBI 4LFCE 3HTXA 4JI2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRS A;  2A2D A;  1X47 A;  4X62 I;  5L3J A;  1RR9 A;  4DXL A;  4OX9 I;  2V34 A;  3B78 A;  4B3R I;  3V2U C;  1XMQ I;  4JV5 E;  4JG4 A;  1IBK I;  3ADJ A;  2UU9 I;  4JI5 E;  2DIX A;  2ZM6 E;  1T4O A;  2UXB E;  2CPN A;  3P1X A;  4KQV A;  4PRV A;  4GKJ I;  1Z0E A;  4YHH E;  1H72 C;  3T1H E;  2NUF A;  4GKK I;  2HHH I;  1PKP A;  4JI7 E;  2R42 A;  4DR3 I;  1IBM E;  1DI2 A;  1J5E I;  4FWH A;  2BM0 A;  1FKA E;  4DR5 E;  4DPW A;  4M2Z A;  3OTO I;  1ELO A;  1N36 E;  4P52 A;  2EZ6 A;  3ZZU A;  4NXM E;  4DV6 E;  1XNQ I;  4FN5 A;  4DUY E;  3K17 A;  3ZZT A;  5LL6 R;  3ADI A;  1B62 A;  1K47 A;  1D6T A;  5IT9 Q;  2WW4 A;  3JAM Q;  2LJP A;  4DV7 I;  2L2K B;  5GME A;  2RTX A;  5BR8 E;  4LFC I;  3J7A M;  4JI1 E;  4M1K A;  2NPF A;  1ZXM A;  1N33 I;  1Z0T A;  2R3V A;  3QT5 A;  3QT6 A;  1MX0 A;  1YZ9 A;  3H4L A;  1H7U A;  1RQ0 A;  3HUL A;  4HY1 A;  4DPY A;  2DEJ A;  1XMO E;  1ZBT A;  2F4V E;  2V2Q A;  1HNX E;  3M6A A;  4JI0 E;  2ZM6 I;  2AJ4 A;  1KIJ A;  2UXB I;  2L2M A;  1Z5A A;  1ZXN A;  2VQF E;  2LUP B;  2DEI A;  3K1J A;  4YY3 I;  4YHH I;  3ZKD A;  2LBS B;  4JI8 E;  4DV3 E;  3T1H I;  2L3C A;  5LMN E;  1HNW E;  4ZVI A;  3Q1Q A;  4JI7 I;  1H7S A;  2NUG A;  1QU6 A;  1Z0V A;  4LF4 E;  1NZ0 A;  5IT9 C;  1H73 A;  3JAM C;  4DR5 I;  1NHJ A;  2N3G A;  2B3T B;  4FWG A;  1YYW A;  1ZM2 A;  1EI1 A;  2LTS A;  4DR2 E;  2VQE I;  4P7A A;  4NXM I;  5LMU I;  4UTG A;  4DV6 I;  4JI4 I;  2E5L E;  1N34 E;  4DV5 E;  3ADG A;  1IBL E;  4LFA I;  2V8P A;  4DV2 I;  3ZKB A;  1MG7 A;  3WU4 A;  3ADL A;  2Q2E B;  4WUC A;  1FNM A;  1RRE A;  1FWK A;  1EKZ A;  3T1Y E;  4WUB A;  2IHR 1;  4MYT A;  4JI1 I;  4Z7C A;  4HAC A;  3J80 C;  4OOG C;  2UXD I;  4AQY E;  1YYK A;  4LF8 I;  2LUQ A;  4B3S I;  3PYE A;  2RS7 A;  4WYQ B;  3QT7 A;  1XMO I;  4PU9 A;  1HNX I;  4DV1 E;  1ZM3 A;  4JI0 I;  1Z0G A;  2L33 A;  2CZ9 A;  4DV0 E;  1ZM4 A;  4WFT A;  4K0K E;  4KHP E;  2VQF I;  3QT8 A;  1UEK A;  1GQE A;  4X64 E;  3V5R A;  4JI8 I;  4DV3 I;  1UIL A;  3D4J A;  5LMN I;  1HR0 E;  2ZIT A;  2UUA E;  2HFS A;  1EA6 A;  4X8W A;  1FWL A;  4LF4 I;  4DR7 E;  4B3M I;  4X65 E;  1FI4 A;  1I94 E;  4DR6 E;  4JYA I;  3LLH A;  4JI3 E;  4DR2 I;  1Z0B A;  3C4T A;  4DPT A;  2UXC E;  4X66 E;  4LFB E;  4DV5 I;  1IBL I;  1KVK A;  2RSM A;  3WU5 A;  1NHI A;  1YYO A;  4X62 E;  4MYU A;  3B8H A;  2LTR A;  4JV5 I;  1N0U A;  4B3R E;  3T1Y I;  3GON A;  4PRX A;  1DAR A;  4JI5 I;  2LJH A;  2E1R A;  1IBK E;  3F0N A;  3J7A G;  4WUD A;  2N3H A;  1B63 A;  4I3H A;  4URL A;  2ZBK B;  3J80 Q;  3J81 C;  1XNR E;  4GKJ E;  3PYD A;  4DV1 I;  1T4N A;  3ZM7 A;  4DV0 I;  1KKH A;  4LF7 E;  4GKK E;  1IBM I;  2HHH E;  1S16 A;  1WHN A;  2L2N A;  1PVG A;  5A2Q Q;  4DR3 E;  4X64 I;  1U2R A;  3WU3 A;  1J5E E;  4DKK A;  2HFU A;  1T4L B;  1N36 I;  3PYF A;  2KHX A;  1PIE A;  4HYM A;  4USM A;  4DU7 A;  4DUY I;  4LF9 E;  4DR7 I;  2DMY A;  2B7T A;  4DR4 E;  3LPS A;  4UT4 A;  2V2V A;  1HNZ E;  1Z5C A;  4B3T E;  4DPX A;  4DV4 E;  4JI3 I;  1X48 A;  5BR8 I;  1FJG E;  1BKN A;  5FLX Q;  4XTJ A;  4R1F A;  2UXC I;  1X49 A;  4RPF A;  5IWA E;  1N32 E;  3LTO A;  1H74 A;  1N33 E;  1S4E A;  2F4V I;  1OJ4 A;  4DPU A;  5CFF E;  4FW9 A;  5A2Q C;  2HKJ A;  2NUE A;  2UUB E;  2NA2 A;  1ZM9 A;  2X36 A;  1RC7 A;  1Z0W A;  1XNR I;  1KTV A;  4M30 A;  3LNU A;  2HK2 A;  1HNW I;  2JY9 A;  4YY3 E;  4DU8 A;  4DR1 E;  1O0W A;  1NHH A;  2VF3 A;  4NXN E;  2UUC E;  4EMD A;  3J81 Q;  1N0V C;  4LF7 I;  2J7K A;  4LF6 E;  4DUZ E;  2L3J A;  2BM1 A;  5FLX C;  2HK3 A;  4LF5 E;  4ED4 A;  4JI6 E;  2YT4 A;  4USK A;  2E5L I;  4LF9 I;  2X7I A;  1N34 I;  2VQE E;  1STU A;  4JI2 E;  4HAC B;  5LMU E;  4JI4 E;  1Z5B A;  4DR4 I;  1WHQ A;  1HNZ I;  4B3T I;  4LFA E;  4DV4 I;  4DV2 E;  1FJG I;  4OX9 E;  2V2Z A;  1XMQ E;  2XEX A;  5IWA I;  1N32 I;  4Z7Y A;  1UHZ A;  2HKE A;  4AQY I;  2UU9 E;  4FWD A;  1A6F A;  2RS6 A;  1VIS A;  3CWV A;  2UXD E;  2GS8 A;  4LF8 E;  4B3S E;  1XHK A;  2B7V A;  3VYX A;  2UUB I;  2OI2 A;  4KHP I;  4K0K I;  1J26 A;  3J7Y p;  2JVA A;  3VYY A;  1MU5 A;  4HXZ A;  1Z59 A;  1HR0 I;  2UUA I;  4DR1 I;  1Z0C A;  4NXN I;  3OTO E;  2UUC I;  2A2C A;  3B82 A;  1WUU A;  2EFG A;  3PYG A;  3C4B A;  4X65 I;  4LF6 I;  4DUZ I;  1XNQ E;  4B3M E;  1I94 I;  2MDR A;  4DR6 I;  4LF5 I;  1QZR A;  2DB2 A;  3ZZ0 A;  2BV3 A;  4JI6 I;  4JYA E;  4DV7 E;  3WU6 A;  5GMD A;  4X66 I;  4LFB I;  4LFC E;  3HTX A;  4JI2 I; 
#chains in the Genus database with same CATH topology
 3C6K A;  2LRS A;  1X3C A;  1A1K A;  4BA1 A;  2A2D A;  1X47 A;  4X62 I;  3M85 D;  5L3J A;  1RR9 A;  4DXL A;  2ENH A;  5C0X B;  2VF1 A;  2EOJ A;  4OX9 I;  2V34 A;  3B78 A;  4R8O A;  4B3R I;  1IMU A;  3V2U C;  3Q6N A;  2RQL A;  1XMQ I;  2EMH A;  3CDJ A;  2YTF A;  2EPM X;  2Z5B B;  4JV5 E;  4JG4 A;  1IBK I;  3PS3 A;  3ADJ A;  2PO2 A;  2UU9 I;  2YTN A;  4JI5 E;  2DIX A;  2M9A A;  1T4O A;  2ZM6 E;  2JEB B;  3B4T A;  2WNR B;  2UXB E;  2CPN A;  3P1X A;  3L7Z B;  4BS9 A;  2EOM A;  4R2E A;  4KQV A;  4PRV A;  4AID A;  4F2J C;  3EQ1 A;  3VHT B;  4GKJ I;  1Z0E A;  2J65 A;  3DJW A;  2AE8 A;  4MQY A;  4YHH E;  1H72 C;  1PJQ A;  3T1H E;  2BA0 D;  2NUF A;  3NZK A;  4GKK I;  2EMA A;  4MU3 A;  1KYQ A;  1EH6 A;  2HHH I;  1PKP A;  4JI7 E;  1L4S A;  2R42 A;  2EOI A;  3UHM A;  4IZJ B;  1A1G A;  1A1L A;  5ADZ A;  4M9V C;  2C37 B;  4DR3 I;  4OO1 B;  1SFE A;  2EM5 A;  1IBM E;  1DI2 A;  2JPA A;  1J5E I;  4LOM A;  4FWH A;  2BM0 A;  1FKA E;  3MSW A;  1T38 A;  4DR5 E;  1X5W A;  1Y5Y A;  4DPW A;  4M2Z A;  3CDI A;  2CTD A;  3PS1 A;  2PNL A;  3OTO I;  2EPX A;  2RPC A;  1ELO A;  2YTI A;  1N36 E;  4BC9 A;  5A6B D;  5JEA D;  3K85 A;  2BR2 B;  2YTG A;  1GTK A;  2DMI A;  3M7N D;  2EPO A;  4P52 A;  2EZ6 A;  3ZZU A;  4WSP A;  4NXM E;  2JEA A;  4DV6 E;  1XNQ I;  2GQ0 A;  4FN5 A;  2LCE A;  4DUY E;  1TF6 A;  4IZK B;  4KZS A;  3THN A;  3K17 A;  5C0X F;  2WBT A;  4R2A A;  4L8N A;  1UDN A;  3ZZT A;  2WBU A;  1NCS A;  5LL6 R;  4ISA A;  3ADI A;  4RH8 A;  1B62 A;  1GZ6 A;  1G2F C;  1K47 A;  5IT9 Q;  1D6T A;  2EM2 A;  2WW4 A;  2BA1 G;  2CGE A;  2HJJ A;  3JAM Q;  4FW6 A;  1T39 A;  2LJP A;  2L2K B;  2EPC A;  5GME A;  4DV7 I;  2JOB A;  2RTX A;  5BR8 E;  2PO1 B;  3H09 A;  4LFC I;  4WXC A;  2E72 A;  2EM4 A;  2YTD A;  3J7A M;  2EMF A;  4JI1 E;  3DF6 A;  3DD6 A;  1P47 A;  4M1K A;  2EL6 A;  2O1T A;  2NPF A;  1ZXM A;  1N33 I;  2V83 A;  4NHR A;  1Z0T A;  2CG9 A;  2R3V A;  4BHB A;  1PJS A;  3QT5 A;  3KZZ A;  3QT6 A;  2EMY A;  1MX0 A;  2YPN A;  1YZ9 A;  3H4L A;  5K36 D;  3F6H A;  1RQ0 A;  1H7U A;  3HUL A;  3MHH C;  4HY1 A;  4DPY A;  2DEJ A;  4ZYD A;  3FIG A;  4TUI A;  1XMO E;  1ZBT A;  2F4V E;  2V2Q A;  1HNX E;  4O5G A;  3M6A A;  5KL3 A;  4JI0 E;  4WX9 A;  2ZM6 I;  4FK5 C;  2AJ4 A;  1KIJ A;  2EE8 A;  3HJC A;  2UXB I;  1X6F A;  2L2M A;  2YU8 A;  1Z5A A;  4FW5 A;  4OO1 E;  1ZXN A;  4GEQ B;  2VQF E;  5A6A A;  4AIM A;  2LUP B;  2DEI A;  1UDQ A;  3K1J A;  4YY3 I;  4YHH I;  3ZKD A;  2LBS B;  4R2Q A;  2V89 A;  4JI8 E;  4DV3 E;  3T1H I;  2L3C A;  2E1M A;  5LMN E;  1HNW E;  4BA2 B;  3AV0 A;  4ZVI A;  2ADR A;  3P3C A;  2EPZ A;  4Q28 A;  4JI7 I;  1H7S A;  4J3D A;  3Q1Q A;  2Z5B A;  1UN6 B;  3QG5 C;  2NUG A;  1QU6 A;  2O1V A;  1Z0V A;  2G7H A;  4LF4 E;  1NZ0 A;  3KRN A;  5IT9 C;  1H73 A;  3P3E A;  2C38 A;  4BBY A;  3JAM C;  2IOP A;  2BA1 D;  4BHC A;  2WNR A;  2ELZ A;  2WP8 B;  3L7Z A;  4DR5 I;  1NHJ A;  1YH8 A;  2ENA A;  2YZT A;  2N3G A;  2B3T B;  2EMB A;  2EN6 A;  4FWG A;  2EN8 A;  2D9H A;  2EQ0 A;  5K36 E;  1YYW A;  4DU8 A;  1ZM2 A;  4MU1 A;  4O43 A;  1EI1 A;  2J7J A;  2LTS A;  2Z5C B;  4DR2 E;  2VQE I;  2FGG A;  1E3H A;  4P7A A;  4LTY A;  5EKW A;  4UTG A;  5LMU I;  4DV6 I;  4NXM I;  4JI4 I;  2A25 A;  2E5L E;  4F9C B;  1N34 E;  4DV5 E;  4WXD A;  4IZJ A;  3ADG A;  1IBL E;  4P7D A;  5FWK A;  4LFA I;  2NN6 D;  2V8P A;  1RMD A;  4DV2 I;  3ZKB A;  1MG7 A;  3WU4 A;  2YSP A;  3ADL A;  2M4I A;  5ELW A;  2Q2E B;  1YSA C;  4WUC A;  5DNY A;  5C0X C;  4LCF A;  1N3G A;  5AAS A;  1FNM A;  1RRE A;  1FWK A;  3U1K A;  2EPA A;  1EKZ A;  2PRT A;  3T1Y E;  4WUB A;  3KWR A;  2IHR 1;  4HEI A;  2WBS A;  1KJK A;  4LCG A;  3BGH A;  4R2R A;  4MYT A;  4FW3 A;  2EJ4 A;  1Y60 A;  4M0V A;  4HAC A;  4JI1 I;  4Z7C A;  1BBG A;  3J80 C;  4OOG C;  2UXD I;  1ZBQ A;  4AQY E;  4FW4 A;  1YYK A;  4LF8 I;  5DNL A;  2LUQ A;  3EPL A;  4B3S I;  3PYE A;  1ZU1 A;  2EPU A;  4IFD E;  2RS7 A;  5A6J A;  1F2I G;  4R2P A;  1UBD C;  4WYQ B;  1IQS A;  2JYA A;  2V86 A;  2VE7 C;  1R6L A;  5JEA B;  2Q8U A;  2L92 A;  3GCM A;  3QT7 A;  1XMO I;  1OYP A;  1DQ3 A;  5T6J A;  4PU9 A;  1HNX I;  1XXE A;  2PO1 A;  4DV1 E;  1R6M A;  1ZM3 A;  4JI0 I;  1Z0G A;  2L33 A;  2CZ9 A;  2BB8 A;  2EN2 A;  2EM9 A;  2KOU A;  4DV0 E;  1ZM4 A;  1YUI A;  2NN6 E;  3HPZ A;  4WFT A;  4K0K E;  2M7Q A;  4KHP E;  3RMP A;  2VQF I;  3QT8 A;  5C0X D;  2LJU A;  3IWD A;  4BMJ A;  1UEK A;  2O1U A;  4OO1 C;  1GQE A;  4X64 E;  1YPN A;  3V5R A;  2FTX B;  4ZYG A;  4GQU A;  4JI8 I;  2FV4 B;  1Y4U A;  4DV3 I;  1UIL A;  2F8B A;  1IQO A;  3D4J A;  4R2C A;  5LMN I;  1HR0 E;  2EN4 A;  2UUA E;  2ZIT A;  5DRR A;  2EOX A;  2HFS A;  3PRY A;  2CSH A;  1EA6 A;  4X8W A;  2L6M A;  2LT7 A;  5KL4 A;  4IJD A;  1DGC A;  1FWL A;  3M99 B;  2PNM A;  4LF4 I;  2CT1 A;  2YTO A;  1USV A;  1TF3 A;  4DR7 E;  4B3M I;  2BBG A;  2CVE A;  2EPL X;  4X65 E;  5K36 B;  2EPP A;  4F54 A;  2EM0 A;  2EOO A;  4O4K A;  1I94 E;  1FI4 A;  3IWC A;  4DR6 E;  4JYA I;  3C6M A;  3LLH A;  2YWQ A;  4JI3 E;  4DR2 I;  2PNZ B;  1Z0B A;  1TN9 A;  1PDA A;  3C4T A;  4DPT A;  3MHS C;  2UXC E;  4X66 E;  2LO3 A;  4LFB E;  2PO2 B;  4DV5 I;  2R76 A;  1LLM C;  1KVK A;  2RSM A;  1UDO A;  1IBL I;  3WU5 A;  2LVH A;  1MGT A;  1NHI A;  2PO0 A;  1YYO A;  1EH8 A;  4X62 E;  4IZJ D;  2EML A;  4ZYH A;  2DGC A;  4TUG A;  5IXM B;  4MYU A;  4ZYE A;  2LTR A;  3B8H A;  5JEA E;  4BCA A;  1A1H A;  4NBQ A;  2WZO A;  4JV5 I;  1N0U A;  4MU0 A;  2R1F A;  3ECR A;  4B3R E;  1YHC A;  3GON A;  3T1Y I;  4PRX A;  2EPN A;  2KON A;  1DAR A;  4OO1 F;  2NAB A;  4JI5 I;  3P76 A;  2YTP A;  5DRQ A;  2LJH A;  2E1R A;  1IBK E;  1JK2 A;  3JTZ A;  3J7A G;  3F0N A;  2LV2 A;  4WUD A;  1EH7 A;  1ZR9 A;  2N3H A;  1B63 A;  4IFD B;  4I3H A;  4URL A;  5C0X A;  2ODR C;  2ZBK B;  3J81 C;  3J80 Q;  1XNR E;  3M85 G;  4F6M A;  1WJP A;  5AE2 A;  2EPK X;  4JI2 I;  4GKJ E;  2LMZ A;  1OYS A;  3PYD A;  1SR9 A;  4DV1 I;  4LPF A;  1T4N A;  3HXL A;  3ZM7 A;  2EOZ A;  4LCH A;  4DV0 I;  2YTQ A;  1KKH A;  2JP9 A;  4LF7 E;  2NN6 B;  4GKK E;  1IBM I;  2JEA B;  2GLI A;  2HHH E;  1S16 A;  1WHN A;  2L2N A;  1PVG A;  1RHY A;  2JEB A;  5K36 F;  5A2Q Q;  4DR3 E;  4X64 I;  1U2R A;  5AE3 A;  3WU3 A;  1J5E E;  4DKK A;  3THO B;  2HFU A;  1T4L B;  2EOH A;  5A6B A;  1ZAA C;  2M1S A;  1N36 I;  3PYF A;  3P3G A;  5AC4 A;  1BBO A;  2KHX A;  2I9I A;  2EP3 A;  1PIE A;  1UDS A;  4HYM A;  4WPY A;  4F9A B;  4USM A;  2MC5 A;  1HK7 A;  2JT2 A;  4DU7 A;  4LF9 E;  4DUY I;  4IS9 A;  4DR7 I;  2DMY A;  1A1F A;  2C37 A;  2MDG A;  4IS1 C;  4OO1 A;  3KZY A;  2JOX A;  4O24 A;  2B7T A;  2EMX A;  2V85 A;  4NZV A;  2C39 B;  4DR4 E;  3LPS A;  2VES A;  2V2V A;  2EOQ A;  1HNZ E;  4UT4 A;  1Z5C A;  4OZE A;  1YFH A;  4B3T E;  4I8O A;  4R2D A;  3ZOQ B;  4DPX A;  4J8Z A;  4DV4 E;  1X48 A;  4JI3 I;  5BR8 I;  1FJG E;  2YTJ A;  5DRO A;  2GO4 A;  2YSO A;  2VRD A;  1BKN A;  5FLX Q;  4XTJ A;  5F3W A;  4R1F A;  2UXC I;  5DRP A;  2BR2 A;  1X49 A;  5IV8 B;  4RPF A;  2JE6 B;  3HQ1 A;  2Z5E A;  5IWA E;  3L00 A;  1N32 E;  2RSI A;  4IFD F;  2F1D A;  4IZK A;  2EMI A;  5AE1 A;  4GZN C;  2DLK A;  1Z1B A;  2ELY A;  2YRM A;  1B69 A;  3M7N G;  4WSG A;  3GLL A;  3LTO A;  1H74 A;  5K36 A;  2EOE A;  3H1C A;  5KL2 A;  2MC6 A;  1N33 E;  3JU0 A;  2DSY A;  2V88 A;  1S4E A;  5TSE A;  2YU5 A;  5JEA C;  2F4V I;  1NEI A;  1MEY C;  1OJ4 A;  2PNZ A;  5CFF E;  2NN6 F;  4DPU A;  5A2Q C;  2DRP A;  4FW9 A;  2HKJ A;  2NUE A;  3GME A;  2UUB E;  2EN1 A;  2EWL A;  2NA2 A;  5LLQ A;  2EL5 A;  2C38 B;  2JXP A;  2GHF A;  4KWY A;  4QNJ A;  1VI7 A;  2EN3 A;  4Q35 B;  1ZM9 A;  2X36 A;  1RC7 A;  2LE2 A;  4U3D A;  2EQ1 A;  1Z0W A;  1XNR I;  1AH5 A;  4M30 A;  1KTV A;  3LNU A;  2HK2 A;  1HNW I;  2EM3 A;  3BF2 A;  2JY9 A;  2JR1 A;  2EMC A;  4R03 A;  4DMI A;  4YY3 E;  4DR1 E;  1O0W A;  2EMG A;  1NHH A;  4NXN E;  4HTG A;  1P42 A;  2VF3 A;  5KL5 A;  2UUC E;  4EMD A;  3J81 Q;  2H36 X;  4OKG A;  1N0V C;  4LF7 I;  1PJT A;  3BID A;  4QNK A;  2J7K A;  4BA1 B;  4LF6 E;  4DUZ E;  2EMW A;  2L3J A;  4IFD A;  5FLX C;  2N8X A;  2BM1 A;  4MLQ A;  2HK3 A;  4LF5 E;  2YTE A;  4N4R B;  3UK3 C;  5K36 C;  5EL9 A;  2I13 A;  5DNX A;  4BA2 A;  2EM8 A;  1BB8 A;  4ED4 A;  4JI6 E;  2YT4 A;  3VK6 A;  3Q6M A;  4USK A;  2E5L I;  4LF9 I;  2X7I A;  1N34 I;  2VQE E;  1STU A;  2NN6 A;  5AC5 A;  4JI2 E;  4HAC B;  5LMU E;  4JI4 E;  1Z5B A;  2O3Z A;  4DR4 I;  1WHQ A;  2YRH A;  5KL6 A;  2WP8 A;  5JEA F;  1HNZ I;  3LML A;  4B3T I;  4LFA E;  4OO1 D;  1USU A;  4DV4 I;  2HGH A;  3U1Y A;  5C0X E;  4DV2 E;  1FJG I;  4OX9 E;  2V2Z A;  2ENC A;  3EPJ A;  2IOQ A;  1QNT A;  4FW7 A;  4LU9 A;  1X6H A;  2Z5C A;  1XMQ E;  2MKN A;  2YRK A;  1OYR A;  3HKM A;  4L5N C;  1JK1 A;  1AAY A;  2XEX A;  5IWA I;  1N32 I;  4Z7Y A;  1UHZ A;  4R2S A;  2HKE A;  2O1W A;  4AQY I;  3HPS A;  4F9B B;  2UU9 E;  4FWD A;  3BBG A;  2GO3 A;  1A6F A;  2RS6 A;  2EOF A;  2C39 A;  1VIS A;  3CWV A;  3IWB A;  4RHB B;  2UXD E;  2GS8 A;  4LF8 E;  4IFD C;  4B3S E;  2EQ3 A;  2DLQ A;  1XHK A;  2B7V A;  2EM7 A;  2WCC 3;  2V87 A;  5KL7 A;  2GPI A;  2EOR A;  2HC5 A;  3VYX A;  2UUB I;  1WRJ A;  2EM6 A;  2IES A;  2JE6 A;  2OI2 A;  1WXR A;  3K6Q A;  4KHP I;  4K0K I;  3OML A;  4U3B A;  2NN6 C;  1J26 A;  2L8T A;  2EOS A;  3J7Y p;  2EOY A;  2JVA A;  3F6G A;  3VYY A;  1MU5 A;  1Y4S A;  4MU4 A;  4HXZ A;  3TQM A;  1Z59 A;  2MKD A;  1Y6Z A;  1HR0 I;  2UUA I;  5JEA A;  4DR1 I;  1Z0C A;  4F6N A;  2IER A;  4NXN I;  1E3P A;  2EL4 A;  3OTO E;  2UUC I;  2A2C A;  5A6K A;  3B82 A;  1WUU A;  1A1I A;  4P78 A;  2V8Q B;  2K4V A;  2EFG A;  3PYG A;  2BA0 G;  3C4B A;  4X65 I;  2B9D A;  4LF6 I;  4DUZ I;  4BC7 A;  2JWO A;  1XNQ E;  2EMZ A;  2PO0 B;  4MDT A;  4B3M E;  1I94 I;  2MDR A;  4N3O A;  4DR6 I;  4LF5 I;  2EN7 A;  3PS2 A;  1QZR A;  2DB2 A;  4X9J A;  5A69 A;  3ZZ0 A;  2K7I A;  2ODR D;  4MLV A;  1A1J A;  3P06 A;  2EMK A;  4IFD D;  1X6E A;  3EPH A;  2BV3 A;  4JI6 I;  4JYA E;  4DV7 E;  3WU6 A;  4AM3 A;  5GMD A;  4X66 I;  3AUZ A;  3EPK A;  4LFB I;  1G2D C;  2EPR A;  4LFC E;  3HTX A;  1YUJ A; 
#chains in the Genus database with same CATH homology
 2LRS A;  2A2D A;  1X47 A;  4X62 I;  5L3J A;  1RR9 A;  4DXL A;  2VF1 A;  4OX9 I;  2V34 A;  3B78 A;  4R8O A;  4B3R I;  3V2U C;  3Q6N A;  1XMQ I;  2Z5B B;  4JV5 E;  4JG4 A;  1IBK I;  3ADJ A;  2UU9 I;  4JI5 E;  2DIX A;  2ZM6 E;  1T4O A;  2UXB E;  2CPN A;  3P1X A;  4BS9 A;  4KQV A;  4PRV A;  4GKJ I;  1Z0E A;  3DJW A;  4YHH E;  1H72 C;  3T1H E;  2NUF A;  4GKK I;  2HHH I;  1PKP A;  4JI7 E;  2R42 A;  4IZJ B;  4DR3 I;  5ADZ A;  1IBM E;  1DI2 A;  1J5E I;  4FWH A;  2BM0 A;  1FKA E;  3MSW A;  4DR5 E;  4DPW A;  4M2Z A;  2PNL A;  3OTO I;  1ELO A;  1N36 E;  4BC9 A;  3K85 A;  4P52 A;  2EZ6 A;  3ZZU A;  4WSP A;  4NXM E;  4DV6 E;  1XNQ I;  2GQ0 A;  4FN5 A;  4IZK B;  4DUY E;  4KZS A;  3K17 A;  3ZZT A;  4L8N A;  5LL6 R;  3ADI A;  1B62 A;  1GZ6 A;  1K47 A;  1D6T A;  5IT9 Q;  2WW4 A;  2CGE A;  3JAM Q;  2LJP A;  4DV7 I;  2L2K B;  5GME A;  2JOB A;  2RTX A;  5BR8 E;  3H09 A;  4LFC I;  3J7A M;  4JI1 E;  3DF6 A;  4M1K A;  2O1T A;  2NPF A;  1ZXM A;  1N33 I;  2V83 A;  1Z0T A;  2CG9 A;  2R3V A;  3QT5 A;  3QT6 A;  1MX0 A;  1YZ9 A;  3H4L A;  3F6H A;  1RQ0 A;  1H7U A;  3HUL A;  4HY1 A;  4DPY A;  2DEJ A;  1XMO E;  3FIG A;  4TUI A;  1ZBT A;  2F4V E;  2V2Q A;  1HNX E;  3M6A A;  4JI0 E;  2ZM6 I;  2AJ4 A;  1KIJ A;  3HJC A;  2UXB I;  2L2M A;  1Z5A A;  1ZXN A;  4GEQ B;  2VQF E;  2LUP B;  2DEI A;  3K1J A;  4YY3 I;  4YHH I;  3ZKD A;  2LBS B;  2V89 A;  4JI8 E;  4DV3 E;  3T1H I;  2L3C A;  2E1M A;  5LMN E;  1HNW E;  3AV0 A;  4ZVI A;  3Q1Q A;  4Q28 A;  4JI7 I;  1H7S A;  2Z5B A;  2NUG A;  1QU6 A;  2O1V A;  1Z0V A;  2G7H A;  4LF4 E;  1NZ0 A;  5IT9 C;  1H73 A;  4BBY A;  3JAM C;  2IOP A;  4DR5 I;  1NHJ A;  2YZT A;  2N3G A;  2B3T B;  4FWG A;  1YYW A;  1ZM2 A;  1EI1 A;  2LTS A;  2Z5C B;  4DR2 E;  2VQE I;  2FGG A;  4P7A A;  4NXM I;  4LTY A;  5LMU I;  4UTG A;  4DV6 I;  4JI4 I;  2E5L E;  4F9C B;  1N34 E;  4DV5 E;  4IZJ A;  3ADG A;  1IBL E;  4P7D A;  5FWK A;  4LFA I;  2V8P A;  4DV2 I;  3ZKB A;  1MG7 A;  3WU4 A;  3ADL A;  2M4I A;  2Q2E B;  4WUC A;  5DNY A;  5AAS A;  1FNM A;  1RRE A;  1FWK A;  1EKZ A;  3T1Y E;  4WUB A;  3KWR A;  2IHR 1;  4MYT A;  4JI1 I;  4Z7C A;  4M0V A;  4HAC A;  3J80 C;  4OOG C;  2UXD I;  1ZBQ A;  4AQY E;  1YYK A;  4LF8 I;  2LUQ A;  4B3S I;  3PYE A;  2RS7 A;  4WYQ B;  2V86 A;  2VE7 C;  2L92 A;  3QT7 A;  1XMO I;  1DQ3 A;  5T6J A;  4PU9 A;  1HNX I;  4DV1 E;  1ZM3 A;  4JI0 I;  1Z0G A;  2L33 A;  2CZ9 A;  2KOU A;  4DV0 E;  1ZM4 A;  3HPZ A;  4WFT A;  4KHP E;  4K0K E;  2M7Q A;  3RMP A;  2VQF I;  3QT8 A;  3IWD A;  4BMJ A;  1UEK A;  2O1U A;  1GQE A;  4X64 E;  3V5R A;  2FTX B;  4JI8 I;  4DV3 I;  2FV4 B;  1Y4U A;  1UIL A;  2F8B A;  3D4J A;  5LMN I;  1HR0 E;  2ZIT A;  2UUA E;  2HFS A;  3PRY A;  1EA6 A;  4X8W A;  2L6M A;  1FWL A;  2PNM A;  4LF4 I;  1USV A;  4DR7 E;  4B3M I;  4X65 E;  4F54 A;  1FI4 A;  1I94 E;  3IWC A;  4DR6 E;  4JYA I;  3LLH A;  4JI3 E;  4DR2 I;  1Z0B A;  3C4T A;  4DPT A;  2UXC E;  4X66 E;  4LFB E;  4DV5 I;  1IBL I;  1KVK A;  2RSM A;  3WU5 A;  1NHI A;  1YYO A;  4X62 E;  4IZJ D;  4TUG A;  4MYU A;  3B8H A;  2LTR A;  4BCA A;  2WZO A;  4JV5 I;  1N0U A;  4B3R E;  3T1Y I;  3GON A;  4PRX A;  2KON A;  1DAR A;  4JI5 I;  2LJH A;  2E1R A;  1IBK E;  3JTZ A;  3J7A G;  3F0N A;  4WUD A;  2N3H A;  1B63 A;  4I3H A;  4URL A;  2ODR C;  2ZBK B;  3J81 C;  3J80 Q;  1XNR E;  5AE2 A;  4GKJ E;  2LMZ A;  3PYD A;  1SR9 A;  4DV1 I;  1T4N A;  3HXL A;  3ZM7 A;  4DV0 I;  1KKH A;  4LF7 E;  4GKK E;  1IBM I;  2HHH E;  1S16 A;  1WHN A;  2L2N A;  1PVG A;  5A2Q Q;  4DR3 E;  4X64 I;  1U2R A;  5AE3 A;  3WU3 A;  1J5E E;  4DKK A;  2HFU A;  1T4L B;  1N36 I;  2M1S A;  3PYF A;  2KHX A;  1PIE A;  4HYM A;  4WPY A;  4F9A B;  4USM A;  2MC5 A;  1HK7 A;  4DU7 A;  4DUY I;  4LF9 E;  4DR7 I;  2DMY A;  2JOX A;  2B7T A;  2V85 A;  4DR4 E;  3LPS A;  4UT4 A;  2V2V A;  1HNZ E;  1Z5C A;  4B3T E;  4I8O A;  3ZOQ B;  4DPX A;  4J8Z A;  4DV4 E;  1X48 A;  4JI3 I;  5BR8 I;  1FJG E;  1BKN A;  5FLX Q;  4XTJ A;  5F3W A;  4R1F A;  2UXC I;  1X49 A;  4RPF A;  3HQ1 A;  2Z5E A;  5IWA E;  1N32 E;  4IZK A;  5AE1 A;  3LTO A;  1H74 A;  2MC6 A;  1N33 E;  3JU0 A;  2DSY A;  2V88 A;  1S4E A;  2F4V I;  1OJ4 A;  4DPU A;  5CFF E;  5A2Q C;  4FW9 A;  2HKJ A;  2NUE A;  2UUB E;  2NA2 A;  2EWL A;  1ZM9 A;  2X36 A;  1RC7 A;  2LE2 A;  1Z0W A;  1XNR I;  4M30 A;  1KTV A;  3LNU A;  2HK2 A;  1HNW I;  2JY9 A;  2JR1 A;  4R03 A;  4DMI A;  4YY3 E;  4DU8 A;  4DR1 E;  1O0W A;  1NHH A;  2VF3 A;  4NXN E;  2UUC E;  4EMD A;  3J81 Q;  2H36 X;  1N0V C;  4LF7 I;  2J7K A;  4LF6 E;  4DUZ E;  2L3J A;  5FLX C;  2BM1 A;  2HK3 A;  4LF5 E;  4ED4 A;  4JI6 E;  2YT4 A;  3VK6 A;  3Q6M A;  4USK A;  2E5L I;  4LF9 I;  2X7I A;  1N34 I;  2VQE E;  1STU A;  4JI2 E;  4HAC B;  5LMU E;  4JI4 E;  1Z5B A;  4DR4 I;  1WHQ A;  1HNZ I;  3LML A;  4B3T I;  4LFA E;  1USU A;  4DV4 I;  4DV2 E;  1FJG I;  4OX9 E;  2V2Z A;  2IOQ A;  4LU9 A;  2Z5C A;  1XMQ E;  4L5N C;  2XEX A;  5IWA I;  1N32 I;  4Z7Y A;  1UHZ A;  2HKE A;  2O1W A;  4AQY I;  3HPS A;  4F9B B;  2UU9 E;  4FWD A;  1A6F A;  2RS6 A;  1VIS A;  3CWV A;  3IWB A;  2UXD E;  2GS8 A;  4LF8 E;  4B3S E;  1XHK A;  2B7V A;  2V87 A;  3VYX A;  2UUB I;  2OI2 A;  1WXR A;  3K6Q A;  4KHP I;  4K0K I;  3OML A;  1J26 A;  2L8T A;  3J7Y p;  2JVA A;  3VYY A;  3F6G A;  1MU5 A;  1Y4S A;  4HXZ A;  1Z59 A;  1Y6Z A;  1HR0 I;  2UUA I;  4DR1 I;  1Z0C A;  4NXN I;  3OTO E;  2UUC I;  2A2C A;  3B82 A;  1WUU A;  4P78 A;  2V8Q B;  2K4V A;  2EFG A;  3PYG A;  3C4B A;  4X65 I;  2B9D A;  4LF6 I;  4DUZ I;  4BC7 A;  2JWO A;  1XNQ E;  4B3M E;  1I94 I;  2MDR A;  4N3O A;  4DR6 I;  4LF5 I;  1QZR A;  2DB2 A;  3ZZ0 A;  2ODR D;  3P06 A;  2BV3 A;  4JI6 I;  4JYA E;  4DV7 E;  3WU6 A;  5GMD A;  4X66 I;  3AUZ A;  4LFB I;  4LFC E;  3HTX A;  4JI2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...