4OX9E

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ox9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9E02
1MG7A 4RPFA 1IBMI 4HYMA 4MYTA 2VF3A 3PYGA 3ADIA 1FNMA 3QT8A 5CFFE 4PU9A 1DI2A 3QT7A 4DV7E 4JI3E 5IT9C 1K47A 5BR8I 3LTOA 1ELOA 4DR6I 2DMYA 1N34I 1N33E 2UUBE 1KTVA 2HKJA 3CWVA 2DEJA 4NXNI 1WUUA 1H7SA 3GONA 2L3JA 2AJ4A 1J26A 2LRSA 4LF8E 4LFCE 2MDRA 5LMNE 4LF7E 1X47A 3ADGA 4YY3E 1YYKA 1Z5AA 1ZM9A 2UUAI 1B63A 3OTOE 1MX0A 3T1YE 4HY1A 2LUQA 1XMOI 3D4JA 4OX9E 1XNRI 3PYFA 4B3SE 4XTJA 1I94I 2RSMA 3PYDA 3F0NA 1IBLE 4JI4I 1NZ0A 4B3TE 4URLA 1FJGI 3C4TA 4UTGA 4LF9I 4X62I 1HR0I 1N36E 1HNWE 3C4BA 1HNXI 5IT9Q 4DR3E 2UXDE 1ZXNA 4LF5I 1XMQI 2NUFA 4DV3E 3HTXA 2NA2A 1XHKA 4NXME 4DR7I 4X8WA 2IHR1 2HFUA 4AQYI 4P7AA 2NUGA 5GMEA 1IBKI 2R3VA 2J7KA 1ZM4A 4DR2I 4ED4A 1Z0EA 4GKJE 4DPUA 3JAMC 3HULA 1IBME 4JI8E 1RR9A 1Z0WA 4X65I 4MYUA 1KVKA 1HNZE 3ZKDA 2LJPA 2VQFI 4LFAE 4DPTA 4JYAI 3P1XA 4DUYI 1T4OA 1Z0GA 4B3RE 4DPXA 1H72C 3ZZ0A 4YHHI 4NXNE 2LBSB 1EKZA 2B7VA 2R42A 2B3TB 4FWHA 4PRVA 4R1FA 2L2NA 3B82A 3WU3A 4DV0I 3J7Yp 5L3JA 2RS7A 4JV5I 4DV5I 3T1HE 1Z5BA 2F4VI 4X66I 4DV6I 2L2MA 2GS8A 4DV2I 4GKKI 1QZRA 2E5LI 4X64I 4JI6I 3ZKBA 1Z0CA 1I94E 2V2VA 5LMUI 3JAMQ 4P52A 2UXCI 4USMA 4DR5E 4LFBE 4DU8A 1HR0E 3LPSA 3B78A 3B8HA 2CPNA 1N32I 1HNXE 2LTSA 1DARA 1OJ4A 5IWAI 4DKKA 2ZM6I 1FWKA 4K0KE 1Z59A 1XMQE 2UU9I 3QT6A 4DR7E 4FWDA 1RREA 4DR1E 2VQEI 4DV1I 1RQ0A 2DB2A 4AQYE 4JI5I 1KKHA 1IBKE 1XNQE 3V5RA 1WHQA 3M6AA 3LNUA 4OOGC 1N0UA 2NPFA 3ZZTA 4JI1I 4B3ME 3VYYA 3LLHA 5GMDA 3ADJA 2HHHI 1EI1A 4DV7I 4JI3I 1U2RA 2HK3A 4WUBA 4LF4E 4DUYE 2DEIA 4FN5A 1N33I 2UUBI 1FWLA 2V34A 4FWGA 4ZVIA 3ZZUA 4WUCA 2JVAA 1QU6A 1FKAE 1UHZA 1NHIA 4JI2I 4LF8I 1KIJA 4LFCI 4WYQB 1A6FA 3Q1QA 4YY3I 4UT4A 4DV5E 4DR4I 1WHNA 1ZXMA 2LUPB 3OTOI 4I3HA 3PYEA 3T1YI 1X48A 4OX9I 4GKKE 2E5LE 4B3SI 4X64E 4JI6E 5BR8E 4JI0I 1NHHA 4Z7YA 4DR6E 1N34E 4DXLA 2UXCE 2V2QA 2UUCI 2UXBI 1H7UA 4B3TI 2BM1A 2ZITA 1N36I 3K1JA 5IWAE 3QT5A 2UXDI 4NXMI 2UUAE 4KHPI 1Z0VA 2VQEE 1B62A 2KHXA 4DV1E 2BV3A 1XMOE 1STUA 1XNRE 2X36A 1Z0BA 2ZBKB 3J7AG 2JY9A 4JI7I 1T4NA 1MU5A 1H73A 4JI4E 2BM0A 4GKJI 1FJGE 2YT4A 4DUZI 2WW4A 4M30A 4JI1E 4LF9E 2NUEA 3H4LA 3ADLA 4USKA 4X62E 4JI8I 4FW9A 2HKEA 2B7TA 2HHHE 3WU5A 5FLXC 4DV4I 1HNZI 4PRXA 4DPWA 1ZBTA 1UILA 2V2ZA 4LF5E 4LFAI 1T4LB 4LF6I 1ZM2A 4B3RI 1VISA 1Z0TA 4WUDA 5A2QC 1J5EI 1D6TA 3J7AM 2EZ6A 3J80C 2CZ9A 2LTRA 2E1RA 4DR2E 4JI2E 4X65E 1ZM3A 2EFGA 4DR4E 1YYOA 3K17A 3J81C 3T1HI 4KQVA 1O0WA 2VQFE 4JYAE 2L33A 4JI0E 1YYWA 3WU6A 1H74A 5LL6R 2UUCE 2L2KB 2UXBE 4DR5I 4LFBI 4YHHE 5FLXQ 1X49A 1RC7A 3V2UC 1S16A 2OI2A 4K0KI 4DV0E 1Z5CA 3ZM7A 1NHJA 5LMNI 4LF7I 1PVGA 4JV5E 1S4EA 5A2QQ 1GQEA 4KHPE 2HK2A 4DR1I 2F4VE 4X66E 4DV6E 4HXZA 3J80Q 4DV2E 1PIEA 1XNQI 4JI7E 5LMUE 2A2CA 2DIXA 2V8PA 2N3GA 1UEKA 2LJHA 1IBLI 2XEXA 4DUZE 2RS6A 4WFTA 3J81Q 4DPYA 4B3MI 1PKPA 1HNWI 4DV4E 1N32E 3WU4A 1N0VC 4JG4A 1YZ9A 2ZM6E 2RTXA 3VYXA 4DR3I 2Q2EB 4LF4I 2UU9E 4DV3I 4LF6E 1EA6A 1J5EE 4Z7CA 2A2DA 2L3CA 2N3HA 2HFSA 4EMDA 4JI5E 4DU7A 4HACA 4M2ZA 2X7IA 4HACB 1BKNA 1FI4A 4M1KA
chains in the Genus database with same CATH superfamily
4P78A 2EOFA 3MSWA 1MG7A 4RPFA 1IBMI 2EMWA 4HYMA 4IFDA 1IMUA 1Y4SA 4MYTA 1IQOA 2VF3A 5ADZA 3ADIA 3PYGA 1FNMA 3QT8A 4F6NA 5CFFE 2MKDA 4PU9A 5DRRA 4FK5C 1DI2A 5TSEA 2YSOA 3QT7A 4DV7E 5DROA 4F9CB 4JI3E 5IT9C 2EN1A 1K47A 3HJCA 5JEAB 1YHCA 2EN6A 2J7JA 2IESA 5BR8I 3LTOA 1ELOA 4DR6I 2DMYA 4BC9A 1N34I 1N33E 2UUBE 1ZBQA 1KTVA 2HKJA 1JK1A 3CWVA 2EOMA 3HPSA 1OYSA 2LVHA 2DEJA 1TN9A 1UDNA 4DMIA 2EPPA 1KJKA 4NXNI 1USUA 4R2RA 1E3PA 3DF6A 1A1HA 1WUUA 1H7SA 3GONA 2EM6A 2L3JA 2EQ1A 3THNA 5KL4A 2EOYA 4R2EA 2CG9A 2YU8A 5C0XA 2PO0A 5K36A 4BA2A 1B69A 3OMLA 1TF3A 2EMZA 4MLVA 1J26A 2AJ4A 2CVEA 2LRSA 4LF8E 3HKMA 3M85D 4LFCE 2MDRA 2JE6B 5K36B 5LMNE 4LF7E 1X47A 3M7NG 3ADGA 4YY3E 1YYKA 1Z5AA 1ZM9A 1YUJA 2EMLA 2WZOA 1UN6B 2UUAI 1B63A 4IZKB 3OTOE 1MX0A 3T1YE 4HY1A 2EMFA 4OO1F 2WBTA 2YWQA 2LUQA 4BC7A 1XMOI 4L5NC 2Z5CB 3D4JA 4O5GA 4FW3A 1PJSA 2BA0G 2LCEA 2MC6A 4OX9E 1A1GA 3PYFA 1XNRI 4B3SE 2YSPA 1Y6ZA 1PJQA 4XTJA 2EM0A 1G2FC 1I94I 2RSMA 3PYDA 5DRPA 1AAYA 3F0NA 1IBLE 4JI4I 2PNLA 5KL7A 3P76A 1NZ0A 4B3TE 4URLA 2JYAA 1FJGI 3C4TA 3LMLA 4UTGA 4LF9I 2EORA 4X62I 1HR0I 3RMPA 1N36E 1HNWE 4MU3A 2JPAA 1NEIA 3C4BA 3IWCA 2NN6A 2EN3A 3ECRA 4O24A 5C0XD 1HNXI 5K36D 4U3BA 5IT9Q 4IZJB 4DR3E 2UXDE 1ZXNA 4LF5I 2LO3A 3HPZA 3PS1A 1XMQI 2NUFA 4DV3E 2EPKX 3HTXA 4HEIA 2NA2A 1X3CA 1XHKA 5JEAE 4NXME 2LV2A 4DR7I 4NZVA 3VK6A 3B4TA 2YTIA 1WRJA 4X8WA 2LT7A 4F6MA 1YH8A 2JEBB 2ENHA 5EKWA 2IHR1 5LLQA 3UK3C 2HFUA 4AQYI 4OO1B 4N4RB 4MU0A 2NUGA 4P7AA 2WCC3 5GMEA 3BIDA 1IBKI 1YUIA 2DSYA 4F2JC 2EOEA 2EM5A 4ZYDA 2R3VA 2IOPA 3C6KA 2J7KA 2EE8A 1ZM4A 4DR2I 4ED4A 1Z0EA 4GKJE 2YRKA 3JAMC 4FW4A 3HULA 4DPUA 1IBME 2EMAA 1JK2A 2Z5BB 2EMCA 4JI8E 1RR9A 2JR1A 2C37A 1Z0WA 2EPCA 1MGTA 3HQ1A 1DQ3A 4X65I 5C0XE 5K36E 2V8QB 4MYUA 2V85A 1HNZE 1KVKA 5F3WA 2I9IA 2EPUA 3ZKDA 5C0XC 2LJPA 1EH7A 4NHRA 3EPLA 2VQFI 4LFAE 5K36C 4DPTA 4JYAI 2EQ3A 3P1XA 4DUYI 2V86A 1T4OA 1Z0GA 2EPXA 4B3RE 3P3CA 1LLMC 2BA1G 4OO1D 1F2IG 1OYPA 1Y5YA 4DPXA 2EM4A 1H72C 3ZZ0A 2F8BA 1OYRA 4Q35B 3VHTB 4YHHI 4NXNE 2L8TA 3MHSC 2LBSB 1EKZA 2Z5EA 1SR9A 2B7VA 2R42A 1X6HA 2B3TB 4FWHA 4PRVA 4R1FA 2DLKA 2L2NA 2YRHA 2MKNA 3B82A 2IOQA 3KWRA 1BB8A 2C39B 2IERA 4U3DA 1UDOA 2CTDA 3WU3A 4DV0I 4WX9A 3EPKA 2KONA 3J7Yp 2LJUA 1BBOA 2WP8B 1PDAA 2RS7A 5L3JA 4JV5I 2R1FA 4R2SA 3UHMA 4BHBA 4DV5I 4IFDB 4MQYA 3T1HE 2HGHA 1Z5BA 2VE7C 2NABA 2F4VI 4X66I 3F6HA 4DV6I 2WBUA 2L2MA 5KL2A 4WXDA 2GS8A 4R2PA 2YU5A 4MU4A 4DV2I 4GKKI 1QZRA 2E5LI 4X64I 1QNTA 4JI6I 5A6BD 3ZKBA 4OO1E 1Z0CA 3GLLA 1I94E 1T38A 2V2VA 5LMUI 2JEAA 3JAMQ 4P52A 2UXCI 1X6EA 4FW6A 4USMA 2EM8A 2YTQA 4HTGA 4DR5E 4LFBE 4OO1C 4DU8A 2V88A 3IWDA 1HR0E 2L92A 2EMXA 1G2DC 4LPFA 2DRPA 3LPSA 3B78A 3B8HA 2CPNA 4FW5A 4IS1C 4AIDA 1T39A 1N32I 2BR2A 2NN6F 3L7ZA 1HNXE 2LTSA 1DARA 3BGHA 1OJ4A 5IWAI 4OZEA 4DKKA 2ZM6I 1FWKA 2YTFA 4GQUA 4K0KE 1Z59A 1MEYC 2EMIA 2C38A 4IFDD 1XMQE 4BA1A 2GO4A 4LCFA 2Q8UA 3AV0A 3QT6A 5IV8B 2PO0B 5C0XB 2UU9I 4BA2B 4DR7E 1UBDC 4FWDA 2GHFA 1RREA 3GCMA 4DR1E 2EPLX 2FTXB 3QG5C 2K7IA 3EPHA 4M0VA 2VQEI 1Z1BA 1RQ0A 2DB2A 4DV1I 5DNYA 1A1IA 4AQYE 4JI5I 1KKHA 4MU1A 2EOHA 1IBKE 1XNQE 2MDGA 2WNRA 3V5RA 2ENCA 1WHQA 4M9VC 5A6JA 2YTPA 2GLIA 3U1KA 3M6AA 3H09A 2ODRD 3LNUA 4OOGC 1N0UA 2I13A 2NPFA 3ZZTA 4JI1I 4B3ME 3VYYA 3LLHA 5GMDA 3ADJA 4LTYA 2HHHI 2GO3A 4R2CA 3BF2A 2EOOA 4IFDE 4I8OA 5AE2A 1EI1A 4DV7I 2NN6B 4JI3I 2EWLA 1U2RA 4O4KA 2HK3A 4WUBA 4LF4E 1ZU1A 2JT2A 4DUYE 2DEIA 1IQSA 4IFDC 4FN5A 2EPZA 2YTEA 1N33I 2UUBI 2LMZA 1FWLA 2EMBA 3AUZA 2EOSA 2WBSA 2V34A 2PO2A 3M7ND 3KZYA 4FWGA 3DJWA 1KYQA 4WSPA 4ZVIA 4R03A 1A1FA 3ZZUA 3CDJA 4WUCA 4TUIA 2JVAA 2GPIA 1QU6A 3K85A 1FKAE 1UHZA 1R6MA 3THOB 2BA0D 1NHIA 1ZAAC 2VESA 2EL6A 1HK7A 5A6AA 4JI2I 1GZ6A 4LF8I 2EOZA 2G7HA 2JOXA 4BMJA 1KIJA 4LFCI 1WJPA 1NCSA 4WYQB 2ODRC 1A6FA 3Q1QA 4YY3I 2YTGA 4UT4A 4DV5E 2NN6D 4DR4I 1WHNA 1ZXMA 2ADRA 4GZNC 2PNZA 2LUPB 2C37B 2KOUA 2FGGA 4I3HA 3PYEA 3OTOI 3T1YI 4LOMA 1ZR9A 1WXRA 1X48A 2JWOA 3EPJA 5AASA 4OX9I 4GKKE 2ENAA 2CSHA 4X9JA 3IWBA 2E5LE 4X64E 2O1WA 4JI6E 5BR8E 4B3SI 4JI0I 1NHHA 4Z7YA 4DR6E 1VI7A 1N34E 3CDIA 4FW7A 2YTOA 4DXLA 3DD6A 2V83A 2UXCE 2V2QA 2UUCI 2EN8A 2UXBI 1H7UA 1RMDA 4B3TI 2BM1A 4OKGA 1Y60A 2EPAA 3FIGA 3L00A 1XXEA 2ZITA 1N36I 3JTZA 3Q6NA 5JEAF 2O1TA 3K1JA 5IWAE 3QT5A 2BBGA 4LCHA 2UXDI 4R2QA 2K4VA 2HC5A 2NN6E 2CGEA 4WXCA 1P47A 4NXMI 2O3ZA 2EPRA 2UUAE 4KHPI 4BHCA 2VRDA 1Z0VA 2VQEE 1B62A 3PS2A 2NN6C 2KHXA 4DV1E 2BV3A 1XMOE 1UDQA 3HXLA 3P3EA 1YFHA 4DV4I 2PO1A 1STUA 2EOJA 1XNRE 2EM3A 1EH8A 2X36A 2D9HA 5DNXA 1Z0BA 2ZBKB 3J7AG 4JI8I 2EPMX 2JY9A 4JI7I 1T4NA 1MU5A 1H73A 3TQMA 4JI4E 2BM0A 4RHBB 2JEAB 2J65A 4GKJI 2JXPA 1FJGE 2YT4A 4DUZI 2BA1D 1AH5A 4M30A 4JI1E 4LF9E 2NUEA 3ADLA 2EMGA 4X62E 2WW4A 3H4LA 4FW9A 4USKA 5AE3A 1YSAC 2HKEA 2B7TA 4WSGA 5FLXC 2HHHE 4QNKA 3WU5A 4N3OA 2FV4B 4PRXA 1P42A 4DPWA 1ZBTA 4Q28A 1HNZI 1UILA 5JEAA 2V2ZA 2PRTA 2LE2A 5KL6A 2BR2B 3L7ZB 4LF5E 4LFAI 1T4LB 2CT1A 5DNLA 3KZZA 4LF6I 1USVA 2YTJA 1ZM2A 2C38B 4B3RI 4IJDA 1VISA 1Z0TA 4BA1B 4WUDA 2EM2A 4MLQA 3EQ1A 4J8ZA 5A2QC 2ELYA 2JP9A 1J5EI 3J7AM 2EN2A 1D6TA 4GEQB 2RQLA 2EZ6A 2M4IA 4BCAA 2R76A 3J80C 4L8NA 2CZ9A 2RPCA 5T6JA 2ELZA 2LTRA 2E1RA 4O43A 2JE6A 2PNMA 4DR2E 4JI2E 2WNRB 3KRNA 5FWKA 4KWYA 2EMHA 4F9BB 5EL9A 4IZKA 2EN7A 2E72A 1X6FA 5A69A 4X65E 2MC5A 1ZM3A 2E1MA 4DR4E 1YYOA 2EFGA 3K17A 3J81C 2Z5CA 5JEAD 3T1HI 2BB8A 2YPNA 4KQVA 4R2DA 1O0WA 3P06A 3PS3A 4NBQA 2VQFE 3F6GA 2JOBA 2YTNA 4WPYA 4JYAE 4AIMA 1EH6A 2L33A 4F9AB 4JI0E 1YYWA 1YPNA 1RHYA 3JU0A 3WU6A 3NZKA 5LL6R 2M9AA 1H74A 2UUCE 2O1UA 2L2KB 2UXBE 4ZYGA 4J3DA 2EOQA 4DR5I 4LFBI 4YHHE 2PO2B 1BBGA 5FLXQ 1X49A 1RC7A 3BBGA 3V2UC 4IZJA 2M1SA 4KZSA 2H36X 1S16A 2EOIA 2EMKA 2V87A 2OI2A 1PJTA 2GQ0A 4K0KI 2O1VA 4DV0E 1Z5CA 5A6KA 1L4SA 3ZM7A 1NHJA 5LMNI 4LF7I 1PVGA 4JV5E 1S4EA 1A1JA 3U1YA 2JEBA 5A2QQ 1GQEA 4KHPE 2HK2A 4DR1I 4P7DA 2EQ0A 1Y4UA 4QNJA 2F4VE 2F1DA 4X66E 4DV6E 4OO1A 5ELWA 2YTDA 1N3GA 4R8OA 4HXZA 5DRQA 5JEAC 2PNZB 2EM9A 2EP3A 2HJJA 5IXMB 5KL3A 3J80Q 4DV2E 2B9DA 2EJ4A 4R2AA 4F54A 1PIEA 3P3GA 4TUGA 1XNQI 4JI7E 5LMUE 2M7QA 2A2CA 2DMIA 3M99B 3ZOQB 2DIXA 4LCGA 2V8PA 1DGCA 2Z5BA 2N3GA 1UEKA 2LJHA 5KL5A 4RH8A 5AC5A 1IBLI 5AE1A 4AM3A 2XEXA 4DUZE 4BS9A 2AE8A 4IFDF 2RS6A 2EPNA 1A1LA 1X5WA 2EL5A 2L6MA 4WFTA 4IZJD 4DPYA 3J81Q 4B3MI 1PKPA 2RSIA 1HNWI 4ISAA 4DV4E 1N32E 1SFEA 3WU4A 2VF1A 1N0VC 1GTKA 4JG4A 1A1KA 3GMEA 2V89A 1YZ9A 2ZM6E 2RTXA 3VYXA 4DR3I 2Q2EB 2A25A 4LF4I 4IS9A 2UU9E 2YZTA 4DV3I 3MHHC 2EPOA 4LF6E 1R6LA 5A6BA 3C6MA 1EA6A 4ZYEA 1J5EE 2DGCA 4Z7CA 2EN4A 2A2DA 2EMYA 2L3CA 3PRYA 4MDTA 2N3HA 2EOXA 1E3HA 2HFSA 2EL4A 1TF6A 1UDSA 4EMDA 4JI5E 4DU7A 4ZYHA 4HACA 2YRMA 3K6QA 4LU9A 4BBYA 4M2ZA 2PO1B 2EM7A 2C39A 3M85G 5C0XF 2DLQA 2X7IA 4HACB 5K36F 2N8XA 1BKNA 1FI4A 5AC4A 2WP8A 4M1KA 3Q6MA 3H1CA
chains in the Genus database with same CATH topology
4P78A 3MSWA 1MG7A 4RPFA 1IBMI 4HYMA 1Y4SA 4MYTA 2VF3A 5ADZA 3ADIA 3PYGA 1FNMA 3QT8A 5CFFE 4PU9A 1DI2A 3QT7A 4DV7E 4F9CB 4JI3E 5IT9C 1K47A 3HJCA 5BR8I 3LTOA 1ELOA 4DR6I 2DMYA 4BC9A 1N34I 1N33E 2UUBE 1ZBQA 1KTVA 2HKJA 3CWVA 3HPSA 2DEJA 4DMIA 4NXNI 1USUA 3DF6A 1WUUA 1H7SA 3GONA 2L3JA 2CG9A 3OMLA 2AJ4A 1J26A 2LRSA 4LF8E 4LFCE 2MDRA 5LMNE 4LF7E 1X47A 3ADGA 4YY3E 1YYKA 1Z5AA 1ZM9A 2WZOA 2UUAI 1B63A 4IZKB 3OTOE 1MX0A 3T1YE 4HY1A 2LUQA 4BC7A 1XMOI 4L5NC 2Z5CB 3D4JA 2MC6A 4OX9E 1XNRI 3PYFA 4B3SE 1Y6ZA 4XTJA 1I94I 2RSMA 3PYDA 3F0NA 1IBLE 4JI4I 2PNLA 1NZ0A 4B3TE 4URLA 1FJGI 3C4TA 3LMLA 4UTGA 4LF9I 4X62I 1HR0I 3RMPA 1N36E 1HNWE 3C4BA 3IWCA 1HNXI 5IT9Q 4IZJB 4DR3E 2UXDE 1ZXNA 4LF5I 3HPZA 1XMQI 2NUFA 4DV3E 3HTXA 2NA2A 1XHKA 4NXME 4DR7I 3VK6A 4X8WA 2IHR1 2HFUA 4AQYI 4P7AA 2NUGA 5GMEA 1IBKI 2DSYA 2R3VA 2IOPA 2J7KA 1ZM4A 4DR2I 4ED4A 1Z0EA 4GKJE 3JAMC 4DPUA 3HULA 1IBME 2Z5BB 4JI8E 1RR9A 2JR1A 1Z0WA 3HQ1A 1DQ3A 4X65I 2V8QB 4MYUA 2V85A 1HNZE 1KVKA 5F3WA 3ZKDA 2LJPA 2VQFI 4LFAE 4DPTA 4JYAI 3P1XA 4DUYI 2V86A 1T4OA 1Z0GA 4B3RE 4DPXA 1H72C 3ZZ0A 2F8BA 4YHHI 4NXNE 2L8TA 2LBSB 1EKZA 2Z5EA 1SR9A 2B7VA 2R42A 2B3TB 4FWHA 4PRVA 4R1FA 2L2NA 3B82A 2IOQA 3KWRA 3WU3A 4DV0I 2KONA 3J7Yp 5L3JA 2RS7A 4JV5I 4DV5I 3T1HE 1Z5BA 2VE7C 2F4VI 4X66I 3F6HA 4DV6I 2L2MA 2GS8A 4DV2I 4GKKI 1QZRA 2E5LI 4X64I 4JI6I 3ZKBA 1Z0CA 1I94E 2V2VA 5LMUI 3JAMQ 4P52A 2UXCI 4USMA 4DR5E 4LFBE 4DU8A 2V88A 3IWDA 1HR0E 2L92A 3LPSA 3B78A 3B8HA 2CPNA 1N32I 1HNXE 2LTSA 1DARA 1OJ4A 5IWAI 4DKKA 2ZM6I 1FWKA 4K0KE 1Z59A 1XMQE 3AV0A 3QT6A 2UU9I 4DR7E 4FWDA 1RREA 4DR1E 2FTXB 4M0VA 2VQEI 4DV1I 1RQ0A 2DB2A 5DNYA 4AQYE 4JI5I 1KKHA 1IBKE 1XNQE 3V5RA 1WHQA 3M6AA 3H09A 2ODRD 3LNUA 4OOGC 1N0UA 2NPFA 3ZZTA 4JI1I 4B3ME 3VYYA 3LLHA 5GMDA 3ADJA 4LTYA 2HHHI 4I8OA 5AE2A 1EI1A 4DV7I 4JI3I 2EWLA 1U2RA 2HK3A 4WUBA 4LF4E 4DUYE 2DEIA 4FN5A 1N33I 2UUBI 2LMZA 1FWLA 2V34A 3AUZA 4FWGA 3DJWA 4WSPA 4ZVIA 4R03A 3ZZUA 4WUCA 4TUIA 2JVAA 1QU6A 3K85A 1FKAE 1UHZA 1NHIA 1HK7A 4JI2I 1GZ6A 4LF8I 2G7HA 2JOXA 4BMJA 1KIJA 4LFCI 4WYQB 2ODRC 1A6FA 3Q1QA 4YY3I 4UT4A 4DV5E 4DR4I 1WHNA 1ZXMA 2LUPB 2KOUA 2FGGA 4I3HA 3PYEA 3OTOI 3T1YI 1WXRA 1X48A 2JWOA 5AASA 4OX9I 4GKKE 3IWBA 2E5LE 4X64E 2O1WA 4JI6E 5BR8E 4B3SI 4JI0I 1NHHA 4Z7YA 4DR6E 1N34E 4DXLA 2V83A 2UXCE 2V2QA 2UUCI 2UXBI 1H7UA 4B3TI 2BM1A 3FIGA 2ZITA 1N36I 3JTZA 3Q6NA 2O1TA 3K1JA 5IWAE 3QT5A 2UXDI 2K4VA 2CGEA 4NXMI 2UUAE 4KHPI 1Z0VA 2VQEE 1B62A 2KHXA 4DV1E 2BV3A 1XMOE 3HXLA 1STUA 1XNRE 2X36A 1Z0BA 2ZBKB 3J7AG 2JY9A 4JI7I 1T4NA 1MU5A 1H73A 4JI4E 2BM0A 4GKJI 1FJGE 2YT4A 4DUZI 2WW4A 4M30A 4JI1E 4LF9E 2NUEA 3H4LA 3ADLA 4USKA 4X62E 4JI8I 4FW9A 5AE3A 2HKEA 2B7TA 5FLXC 2HHHE 3WU5A 4DV4I 1HNZI 4N3OA 2FV4B 4PRXA 4DPWA 1ZBTA 4Q28A 1UILA 2V2ZA 2LE2A 4LF5E 4LFAI 1T4LB 4LF6I 1USVA 1ZM2A 4B3RI 1VISA 1Z0TA 4WUDA 4J8ZA 5A2QC 1J5EI 1D6TA 3J7AM 4GEQB 2EZ6A 2M4IA 4BCAA 3J80C 4L8NA 2CZ9A 5T6JA 2LTRA 2E1RA 2PNMA 4DR2E 4JI2E 5FWKA 4F9BB 4IZKA 4X65E 2MC5A 1ZM3A 2E1MA 4DR4E 1YYOA 2EFGA 3K17A 3J81C 2Z5CA 3T1HI 4KQVA 1O0WA 3P06A 2VQFE 3F6GA 2JOBA 4WPYA 4JYAE 2L33A 4F9AB 4JI0E 1YYWA 3JU0A 3WU6A 5LL6R 1H74A 2UUCE 2O1UA 2L2KB 2UXBE 4DR5I 4LFBI 4YHHE 5FLXQ 1X49A 1RC7A 3V2UC 4IZJA 2M1SA 4KZSA 2H36X 1S16A 2V87A 2OI2A 2GQ0A 4K0KI 2O1VA 4DV0E 1Z5CA 3ZM7A 1NHJA 5LMNI 4LF7I 1PVGA 4JV5E 1S4EA 5A2QQ 1GQEA 4KHPE 2HK2A 4DR1I 4P7DA 1Y4UA 2F4VE 4X66E 4DV6E 4R8OA 4HXZA 3J80Q 4DV2E 2B9DA 4F54A 1PIEA 4TUGA 1XNQI 4JI7E 5LMUE 2M7QA 2A2CA 3ZOQB 2DIXA 2V8PA 2Z5BA 2N3GA 1UEKA 2LJHA 1IBLI 5AE1A 2XEXA 4DUZE 4BS9A 2RS6A 2L6MA 4WFTA 4IZJD 3J81Q 4DPYA 4B3MI 1PKPA 1HNWI 4DV4E 1N32E 3WU4A 2VF1A 1N0VC 4JG4A 2V89A 1YZ9A 2ZM6E 2RTXA 3VYXA 4DR3I 2Q2EB 4LF4I 2UU9E 2YZTA 4DV3I 4LF6E 1EA6A 1J5EE 4Z7CA 2A2DA 3PRYA 2L3CA 2N3HA 2HFSA 4EMDA 4JI5E 4DU7A 4HACA 3K6QA 4LU9A 4BBYA 4M2ZA 2X7IA 4HACB 1BKNA 1FI4A 4M1KA 3Q6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG7 A;  4RPF A;  1IBM I;  4HYM A;  4MYT A;  2VF3 A;  3PYG A;  3ADI A;  1FNM A;  3QT8 A;  5CFF E;  4PU9 A;  1DI2 A;  3QT7 A;  4DV7 E;  4JI3 E;  5IT9 C;  1K47 A;  5BR8 I;  3LTO A;  1ELO A;  4DR6 I;  2DMY A;  1N34 I;  1N33 E;  2UUB E;  1KTV A;  2HKJ A;  3CWV A;  2DEJ A;  4NXN I;  1WUU A;  1H7S A;  3GON A;  2L3J A;  2AJ4 A;  1J26 A;  2LRS A;  4LF8 E;  4LFC E;  2MDR A;  5LMN E;  4LF7 E;  1X47 A;  3ADG A;  4YY3 E;  1YYK A;  1Z5A A;  1ZM9 A;  2UUA I;  1B63 A;  3OTO E;  1MX0 A;  3T1Y E;  4HY1 A;  2LUQ A;  1XMO I;  3D4J A;  4OX9 E;  1XNR I;  3PYF A;  4B3S E;  4XTJ A;  1I94 I;  2RSM A;  3PYD A;  3F0N A;  1IBL E;  4JI4 I;  1NZ0 A;  4B3T E;  4URL A;  1FJG I;  3C4T A;  4UTG A;  4LF9 I;  4X62 I;  1HR0 I;  1N36 E;  1HNW E;  3C4B A;  1HNX I;  5IT9 Q;  4DR3 E;  2UXD E;  1ZXN A;  4LF5 I;  1XMQ I;  2NUF A;  4DV3 E;  3HTX A;  2NA2 A;  1XHK A;  4NXM E;  4DR7 I;  4X8W A;  2IHR 1;  2HFU A;  4AQY I;  4P7A A;  2NUG A;  5GME A;  1IBK I;  2R3V A;  2J7K A;  1ZM4 A;  4DR2 I;  4ED4 A;  1Z0E A;  4GKJ E;  4DPU A;  3JAM C;  3HUL A;  1IBM E;  4JI8 E;  1RR9 A;  1Z0W A;  4X65 I;  4MYU A;  1KVK A;  1HNZ E;  3ZKD A;  2LJP A;  2VQF I;  4LFA E;  4DPT A;  4JYA I;  3P1X A;  4DUY I;  1T4O A;  1Z0G A;  4B3R E;  4DPX A;  1H72 C;  3ZZ0 A;  4YHH I;  4NXN E;  2LBS B;  1EKZ A;  2B7V A;  2R42 A;  2B3T B;  4FWH A;  4PRV A;  4R1F A;  2L2N A;  3B82 A;  3WU3 A;  4DV0 I;  3J7Y p;  5L3J A;  2RS7 A;  4JV5 I;  4DV5 I;  3T1H E;  1Z5B A;  2F4V I;  4X66 I;  4DV6 I;  2L2M A;  2GS8 A;  4DV2 I;  4GKK I;  1QZR A;  2E5L I;  4X64 I;  4JI6 I;  3ZKB A;  1Z0C A;  1I94 E;  2V2V A;  5LMU I;  3JAM Q;  4P52 A;  2UXC I;  4USM A;  4DR5 E;  4LFB E;  4DU8 A;  1HR0 E;  3LPS A;  3B78 A;  3B8H A;  2CPN A;  1N32 I;  1HNX E;  2LTS A;  1DAR A;  1OJ4 A;  5IWA I;  4DKK A;  2ZM6 I;  1FWK A;  4K0K E;  1Z59 A;  1XMQ E;  2UU9 I;  3QT6 A;  4DR7 E;  4FWD A;  1RRE A;  4DR1 E;  2VQE I;  4DV1 I;  1RQ0 A;  2DB2 A;  4AQY E;  4JI5 I;  1KKH A;  1IBK E;  1XNQ E;  3V5R A;  1WHQ A;  3M6A A;  3LNU A;  4OOG C;  1N0U A;  2NPF A;  3ZZT A;  4JI1 I;  4B3M E;  3VYY A;  3LLH A;  5GMD A;  3ADJ A;  2HHH I;  1EI1 A;  4DV7 I;  4JI3 I;  1U2R A;  2HK3 A;  4WUB A;  4LF4 E;  4DUY E;  2DEI A;  4FN5 A;  1N33 I;  2UUB I;  1FWL A;  2V34 A;  4FWG A;  4ZVI A;  3ZZU A;  4WUC A;  2JVA A;  1QU6 A;  1FKA E;  1UHZ A;  1NHI A;  4JI2 I;  4LF8 I;  1KIJ A;  4LFC I;  4WYQ B;  1A6F A;  3Q1Q A;  4YY3 I;  4UT4 A;  4DV5 E;  4DR4 I;  1WHN A;  1ZXM A;  2LUP B;  3OTO I;  4I3H A;  3PYE A;  3T1Y I;  1X48 A;  4OX9 I;  4GKK E;  2E5L E;  4B3S I;  4X64 E;  4JI6 E;  5BR8 E;  4JI0 I;  1NHH A;  4Z7Y A;  4DR6 E;  1N34 E;  4DXL A;  2UXC E;  2V2Q A;  2UUC I;  2UXB I;  1H7U A;  4B3T I;  2BM1 A;  2ZIT A;  1N36 I;  3K1J A;  5IWA E;  3QT5 A;  2UXD I;  4NXM I;  2UUA E;  4KHP I;  1Z0V A;  2VQE E;  1B62 A;  2KHX A;  4DV1 E;  2BV3 A;  1XMO E;  1STU A;  1XNR E;  2X36 A;  1Z0B A;  2ZBK B;  3J7A G;  2JY9 A;  4JI7 I;  1T4N A;  1MU5 A;  1H73 A;  4JI4 E;  2BM0 A;  4GKJ I;  1FJG E;  2YT4 A;  4DUZ I;  2WW4 A;  4M30 A;  4JI1 E;  4LF9 E;  2NUE A;  3H4L A;  3ADL A;  4USK A;  4X62 E;  4JI8 I;  4FW9 A;  2HKE A;  2B7T A;  2HHH E;  3WU5 A;  5FLX C;  4DV4 I;  1HNZ I;  4PRX A;  4DPW A;  1ZBT A;  1UIL A;  2V2Z A;  4LF5 E;  4LFA I;  1T4L B;  4LF6 I;  1ZM2 A;  4B3R I;  1VIS A;  1Z0T A;  4WUD A;  5A2Q C;  1J5E I;  1D6T A;  3J7A M;  2EZ6 A;  3J80 C;  2CZ9 A;  2LTR A;  2E1R A;  4DR2 E;  4JI2 E;  4X65 E;  1ZM3 A;  2EFG A;  4DR4 E;  1YYO A;  3K17 A;  3J81 C;  3T1H I;  4KQV A;  1O0W A;  2VQF E;  4JYA E;  2L33 A;  4JI0 E;  1YYW A;  3WU6 A;  1H74 A;  5LL6 R;  2UUC E;  2L2K B;  2UXB E;  4DR5 I;  4LFB I;  4YHH E;  5FLX Q;  1X49 A;  1RC7 A;  3V2U C;  1S16 A;  2OI2 A;  4K0K I;  4DV0 E;  1Z5C A;  3ZM7 A;  1NHJ A;  5LMN I;  4LF7 I;  1PVG A;  4JV5 E;  1S4E A;  5A2Q Q;  1GQE A;  4KHP E;  2HK2 A;  4DR1 I;  2F4V E;  4X66 E;  4DV6 E;  4HXZ A;  3J80 Q;  4DV2 E;  1PIE A;  1XNQ I;  4JI7 E;  5LMU E;  2A2C A;  2DIX A;  2V8P A;  2N3G A;  1UEK A;  2LJH A;  1IBL I;  2XEX A;  4DUZ E;  2RS6 A;  4WFT A;  3J81 Q;  4DPY A;  4B3M I;  1PKP A;  1HNW I;  4DV4 E;  1N32 E;  3WU4 A;  1N0V C;  4JG4 A;  1YZ9 A;  2ZM6 E;  2RTX A;  3VYX A;  4DR3 I;  2Q2E B;  4LF4 I;  2UU9 E;  4DV3 I;  4LF6 E;  1EA6 A;  1J5E E;  4Z7C A;  2A2D A;  2L3C A;  2N3H A;  2HFS A;  4EMD A;  4JI5 E;  4DU7 A;  4HAC A;  4M2Z A;  2X7I A;  4HAC B;  1BKN A;  1FI4 A;  4M1K A; 
#chains in the Genus database with same CATH topology
 4P78 A;  2EOF A;  3MSW A;  1MG7 A;  4RPF A;  1IBM I;  2EMW A;  4HYM A;  4IFD A;  1IMU A;  1Y4S A;  4MYT A;  1IQO A;  2VF3 A;  5ADZ A;  3ADI A;  3PYG A;  1FNM A;  3QT8 A;  4F6N A;  5CFF E;  2MKD A;  4PU9 A;  5DRR A;  4FK5 C;  1DI2 A;  5TSE A;  2YSO A;  3QT7 A;  4DV7 E;  5DRO A;  4F9C B;  4JI3 E;  5IT9 C;  2EN1 A;  1K47 A;  3HJC A;  5JEA B;  1YHC A;  2EN6 A;  2J7J A;  2IES A;  5BR8 I;  3LTO A;  1ELO A;  4DR6 I;  2DMY A;  4BC9 A;  1N34 I;  1N33 E;  2UUB E;  1ZBQ A;  1KTV A;  2HKJ A;  1JK1 A;  3CWV A;  2EOM A;  3HPS A;  1OYS A;  2LVH A;  2DEJ A;  1TN9 A;  1UDN A;  4DMI A;  2EPP A;  1KJK A;  4NXN I;  1USU A;  4R2R A;  1E3P A;  3DF6 A;  1A1H A;  1WUU A;  1H7S A;  3GON A;  2EM6 A;  2L3J A;  2EQ1 A;  3THN A;  5KL4 A;  2EOY A;  4R2E A;  2CG9 A;  2YU8 A;  5C0X A;  2PO0 A;  5K36 A;  4BA2 A;  1B69 A;  3OML A;  1TF3 A;  2EMZ A;  4MLV A;  1J26 A;  2AJ4 A;  2CVE A;  2LRS A;  4LF8 E;  3HKM A;  3M85 D;  4LFC E;  2MDR A;  2JE6 B;  5K36 B;  5LMN E;  4LF7 E;  1X47 A;  3M7N G;  3ADG A;  4YY3 E;  1YYK A;  1Z5A A;  1ZM9 A;  1YUJ A;  2EML A;  2WZO A;  1UN6 B;  2UUA I;  1B63 A;  4IZK B;  3OTO E;  1MX0 A;  3T1Y E;  4HY1 A;  2EMF A;  4OO1 F;  2WBT A;  2YWQ A;  2LUQ A;  4BC7 A;  1XMO I;  4L5N C;  2Z5C B;  3D4J A;  4O5G A;  4FW3 A;  1PJS A;  2BA0 G;  2LCE A;  2MC6 A;  4OX9 E;  1A1G A;  3PYF A;  1XNR I;  4B3S E;  2YSP A;  1Y6Z A;  1PJQ A;  4XTJ A;  2EM0 A;  1G2F C;  1I94 I;  2RSM A;  3PYD A;  5DRP A;  1AAY A;  3F0N A;  1IBL E;  4JI4 I;  2PNL A;  5KL7 A;  3P76 A;  1NZ0 A;  4B3T E;  4URL A;  2JYA A;  1FJG I;  3C4T A;  3LML A;  4UTG A;  4LF9 I;  2EOR A;  4X62 I;  1HR0 I;  3RMP A;  1N36 E;  1HNW E;  4MU3 A;  2JPA A;  1NEI A;  3C4B A;  3IWC A;  2NN6 A;  2EN3 A;  3ECR A;  4O24 A;  5C0X D;  1HNX I;  5K36 D;  4U3B A;  5IT9 Q;  4IZJ B;  4DR3 E;  2UXD E;  1ZXN A;  4LF5 I;  2LO3 A;  3HPZ A;  3PS1 A;  1XMQ I;  2NUF A;  4DV3 E;  2EPK X;  3HTX A;  4HEI A;  2NA2 A;  1X3C A;  1XHK A;  5JEA E;  4NXM E;  2LV2 A;  4DR7 I;  4NZV A;  3VK6 A;  3B4T A;  2YTI A;  1WRJ A;  4X8W A;  2LT7 A;  4F6M A;  1YH8 A;  2JEB B;  2ENH A;  5EKW A;  2IHR 1;  5LLQ A;  3UK3 C;  2HFU A;  4AQY I;  4OO1 B;  4N4R B;  4MU0 A;  2NUG A;  4P7A A;  2WCC 3;  5GME A;  3BID A;  1IBK I;  1YUI A;  2DSY A;  4F2J C;  2EOE A;  2EM5 A;  4ZYD A;  2R3V A;  2IOP A;  3C6K A;  2J7K A;  2EE8 A;  1ZM4 A;  4DR2 I;  4ED4 A;  1Z0E A;  4GKJ E;  2YRK A;  3JAM C;  4FW4 A;  3HUL A;  4DPU A;  1IBM E;  2EMA A;  1JK2 A;  2Z5B B;  2EMC A;  4JI8 E;  1RR9 A;  2JR1 A;  2C37 A;  1Z0W A;  2EPC A;  1MGT A;  3HQ1 A;  1DQ3 A;  4X65 I;  5C0X E;  5K36 E;  2V8Q B;  4MYU A;  2V85 A;  1HNZ E;  1KVK A;  5F3W A;  2I9I A;  2EPU A;  3ZKD A;  5C0X C;  2LJP A;  1EH7 A;  4NHR A;  3EPL A;  2VQF I;  4LFA E;  5K36 C;  4DPT A;  4JYA I;  2EQ3 A;  3P1X A;  4DUY I;  2V86 A;  1T4O A;  1Z0G A;  2EPX A;  4B3R E;  3P3C A;  1LLM C;  2BA1 G;  4OO1 D;  1F2I G;  1OYP A;  1Y5Y A;  4DPX A;  2EM4 A;  1H72 C;  3ZZ0 A;  2F8B A;  1OYR A;  4Q35 B;  3VHT B;  4YHH I;  4NXN E;  2L8T A;  3MHS C;  2LBS B;  1EKZ A;  2Z5E A;  1SR9 A;  2B7V A;  2R42 A;  1X6H A;  2B3T B;  4FWH A;  4PRV A;  4R1F A;  2DLK A;  2L2N A;  2YRH A;  2MKN A;  3B82 A;  2IOQ A;  3KWR A;  1BB8 A;  2C39 B;  2IER A;  4U3D A;  1UDO A;  2CTD A;  3WU3 A;  4DV0 I;  4WX9 A;  3EPK A;  2KON A;  3J7Y p;  2LJU A;  1BBO A;  2WP8 B;  1PDA A;  2RS7 A;  5L3J A;  4JV5 I;  2R1F A;  4R2S A;  3UHM A;  4BHB A;  4DV5 I;  4IFD B;  4MQY A;  3T1H E;  2HGH A;  1Z5B A;  2VE7 C;  2NAB A;  2F4V I;  4X66 I;  3F6H A;  4DV6 I;  2WBU A;  2L2M A;  5KL2 A;  4WXD A;  2GS8 A;  4R2P A;  2YU5 A;  4MU4 A;  4DV2 I;  4GKK I;  1QZR A;  2E5L I;  4X64 I;  1QNT A;  4JI6 I;  5A6B D;  3ZKB A;  4OO1 E;  1Z0C A;  3GLL A;  1I94 E;  1T38 A;  2V2V A;  5LMU I;  2JEA A;  3JAM Q;  4P52 A;  2UXC I;  1X6E A;  4FW6 A;  4USM A;  2EM8 A;  2YTQ A;  4HTG A;  4DR5 E;  4LFB E;  4OO1 C;  4DU8 A;  2V88 A;  3IWD A;  1HR0 E;  2L92 A;  2EMX A;  1G2D C;  4LPF A;  2DRP A;  3LPS A;  3B78 A;  3B8H A;  2CPN A;  4FW5 A;  4IS1 C;  4AID A;  1T39 A;  1N32 I;  2BR2 A;  2NN6 F;  3L7Z A;  1HNX E;  2LTS A;  1DAR A;  3BGH A;  1OJ4 A;  5IWA I;  4OZE A;  4DKK A;  2ZM6 I;  1FWK A;  2YTF A;  4GQU A;  4K0K E;  1Z59 A;  1MEY C;  2EMI A;  2C38 A;  4IFD D;  1XMQ E;  4BA1 A;  2GO4 A;  4LCF A;  2Q8U A;  3AV0 A;  3QT6 A;  5IV8 B;  2PO0 B;  5C0X B;  2UU9 I;  4BA2 B;  4DR7 E;  1UBD C;  4FWD A;  2GHF A;  1RRE A;  3GCM A;  4DR1 E;  2EPL X;  2FTX B;  3QG5 C;  2K7I A;  3EPH A;  4M0V A;  2VQE I;  1Z1B A;  1RQ0 A;  2DB2 A;  4DV1 I;  5DNY A;  1A1I A;  4AQY E;  4JI5 I;  1KKH A;  4MU1 A;  2EOH A;  1IBK E;  1XNQ E;  2MDG A;  2WNR A;  3V5R A;  2ENC A;  1WHQ A;  4M9V C;  5A6J A;  2YTP A;  2GLI A;  3U1K A;  3M6A A;  3H09 A;  2ODR D;  3LNU A;  4OOG C;  1N0U A;  2I13 A;  2NPF A;  3ZZT A;  4JI1 I;  4B3M E;  3VYY A;  3LLH A;  5GMD A;  3ADJ A;  4LTY A;  2HHH I;  2GO3 A;  4R2C A;  3BF2 A;  2EOO A;  4IFD E;  4I8O A;  5AE2 A;  1EI1 A;  4DV7 I;  2NN6 B;  4JI3 I;  2EWL A;  1U2R A;  4O4K A;  2HK3 A;  4WUB A;  4LF4 E;  1ZU1 A;  2JT2 A;  4DUY E;  2DEI A;  1IQS A;  4IFD C;  4FN5 A;  2EPZ A;  2YTE A;  1N33 I;  2UUB I;  2LMZ A;  1FWL A;  2EMB A;  3AUZ A;  2EOS A;  2WBS A;  2V34 A;  2PO2 A;  3M7N D;  3KZY A;  4FWG A;  3DJW A;  1KYQ A;  4WSP A;  4ZVI A;  4R03 A;  1A1F A;  3ZZU A;  3CDJ A;  4WUC A;  4TUI A;  2JVA A;  2GPI A;  1QU6 A;  3K85 A;  1FKA E;  1UHZ A;  1R6M A;  3THO B;  2BA0 D;  1NHI A;  1ZAA C;  2VES A;  2EL6 A;  1HK7 A;  5A6A A;  4JI2 I;  1GZ6 A;  4LF8 I;  2EOZ A;  2G7H A;  2JOX A;  4BMJ A;  1KIJ A;  4LFC I;  1WJP A;  1NCS A;  4WYQ B;  2ODR C;  1A6F A;  3Q1Q A;  4YY3 I;  2YTG A;  4UT4 A;  4DV5 E;  2NN6 D;  4DR4 I;  1WHN A;  1ZXM A;  2ADR A;  4GZN C;  2PNZ A;  2LUP B;  2C37 B;  2KOU A;  2FGG A;  4I3H A;  3PYE A;  3OTO I;  3T1Y I;  4LOM A;  1ZR9 A;  1WXR A;  1X48 A;  2JWO A;  3EPJ A;  5AAS A;  4OX9 I;  4GKK E;  2ENA A;  2CSH A;  4X9J A;  3IWB A;  2E5L E;  4X64 E;  2O1W A;  4JI6 E;  5BR8 E;  4B3S I;  4JI0 I;  1NHH A;  4Z7Y A;  4DR6 E;  1VI7 A;  1N34 E;  3CDI A;  4FW7 A;  2YTO A;  4DXL A;  3DD6 A;  2V83 A;  2UXC E;  2V2Q A;  2UUC I;  2EN8 A;  2UXB I;  1H7U A;  1RMD A;  4B3T I;  2BM1 A;  4OKG A;  1Y60 A;  2EPA A;  3FIG A;  3L00 A;  1XXE A;  2ZIT A;  1N36 I;  3JTZ A;  3Q6N A;  5JEA F;  2O1T A;  3K1J A;  5IWA E;  3QT5 A;  2BBG A;  4LCH A;  2UXD I;  4R2Q A;  2K4V A;  2HC5 A;  2NN6 E;  2CGE A;  4WXC A;  1P47 A;  4NXM I;  2O3Z A;  2EPR A;  2UUA E;  4KHP I;  4BHC A;  2VRD A;  1Z0V A;  2VQE E;  1B62 A;  3PS2 A;  2NN6 C;  2KHX A;  4DV1 E;  2BV3 A;  1XMO E;  1UDQ A;  3HXL A;  3P3E A;  1YFH A;  4DV4 I;  2PO1 A;  1STU A;  2EOJ A;  1XNR E;  2EM3 A;  1EH8 A;  2X36 A;  2D9H A;  5DNX A;  1Z0B A;  2ZBK B;  3J7A G;  4JI8 I;  2EPM X;  2JY9 A;  4JI7 I;  1T4N A;  1MU5 A;  1H73 A;  3TQM A;  4JI4 E;  2BM0 A;  4RHB B;  2JEA B;  2J65 A;  4GKJ I;  2JXP A;  1FJG E;  2YT4 A;  4DUZ I;  2BA1 D;  1AH5 A;  4M30 A;  4JI1 E;  4LF9 E;  2NUE A;  3ADL A;  2EMG A;  4X62 E;  2WW4 A;  3H4L A;  4FW9 A;  4USK A;  5AE3 A;  1YSA C;  2HKE A;  2B7T A;  4WSG A;  5FLX C;  2HHH E;  4QNK A;  3WU5 A;  4N3O A;  2FV4 B;  4PRX A;  1P42 A;  4DPW A;  1ZBT A;  4Q28 A;  1HNZ I;  1UIL A;  5JEA A;  2V2Z A;  2PRT A;  2LE2 A;  5KL6 A;  2BR2 B;  3L7Z B;  4LF5 E;  4LFA I;  1T4L B;  2CT1 A;  5DNL A;  3KZZ A;  4LF6 I;  1USV A;  2YTJ A;  1ZM2 A;  2C38 B;  4B3R I;  4IJD A;  1VIS A;  1Z0T A;  4BA1 B;  4WUD A;  2EM2 A;  4MLQ A;  3EQ1 A;  4J8Z A;  5A2Q C;  2ELY A;  2JP9 A;  1J5E I;  3J7A M;  2EN2 A;  1D6T A;  4GEQ B;  2RQL A;  2EZ6 A;  2M4I A;  4BCA A;  2R76 A;  3J80 C;  4L8N A;  2CZ9 A;  2RPC A;  5T6J A;  2ELZ A;  2LTR A;  2E1R A;  4O43 A;  2JE6 A;  2PNM A;  4DR2 E;  4JI2 E;  2WNR B;  3KRN A;  5FWK A;  4KWY A;  2EMH A;  4F9B B;  5EL9 A;  4IZK A;  2EN7 A;  2E72 A;  1X6F A;  5A69 A;  4X65 E;  2MC5 A;  1ZM3 A;  2E1M A;  4DR4 E;  1YYO A;  2EFG A;  3K17 A;  3J81 C;  2Z5C A;  5JEA D;  3T1H I;  2BB8 A;  2YPN A;  4KQV A;  4R2D A;  1O0W A;  3P06 A;  3PS3 A;  4NBQ A;  2VQF E;  3F6G A;  2JOB A;  2YTN A;  4WPY A;  4JYA E;  4AIM A;  1EH6 A;  2L33 A;  4F9A B;  4JI0 E;  1YYW A;  1YPN A;  1RHY A;  3JU0 A;  3WU6 A;  3NZK A;  5LL6 R;  2M9A A;  1H74 A;  2UUC E;  2O1U A;  2L2K B;  2UXB E;  4ZYG A;  4J3D A;  2EOQ A;  4DR5 I;  4LFB I;  4YHH E;  2PO2 B;  1BBG A;  5FLX Q;  1X49 A;  1RC7 A;  3BBG A;  3V2U C;  4IZJ A;  2M1S A;  4KZS A;  2H36 X;  1S16 A;  2EOI A;  2EMK A;  2V87 A;  2OI2 A;  1PJT A;  2GQ0 A;  4K0K I;  2O1V A;  4DV0 E;  1Z5C A;  5A6K A;  1L4S A;  3ZM7 A;  1NHJ A;  5LMN I;  4LF7 I;  1PVG A;  4JV5 E;  1S4E A;  1A1J A;  3U1Y A;  2JEB A;  5A2Q Q;  1GQE A;  4KHP E;  2HK2 A;  4DR1 I;  4P7D A;  2EQ0 A;  1Y4U A;  4QNJ A;  2F4V E;  2F1D A;  4X66 E;  4DV6 E;  4OO1 A;  5ELW A;  2YTD A;  1N3G A;  4R8O A;  4HXZ A;  5DRQ A;  5JEA C;  2PNZ B;  2EM9 A;  2EP3 A;  2HJJ A;  5IXM B;  5KL3 A;  3J80 Q;  4DV2 E;  2B9D A;  2EJ4 A;  4R2A A;  4F54 A;  1PIE A;  3P3G A;  4TUG A;  1XNQ I;  4JI7 E;  5LMU E;  2M7Q A;  2A2C A;  2DMI A;  3M99 B;  3ZOQ B;  2DIX A;  4LCG A;  2V8P A;  1DGC A;  2Z5B A;  2N3G A;  1UEK A;  2LJH A;  5KL5 A;  4RH8 A;  5AC5 A;  1IBL I;  5AE1 A;  4AM3 A;  2XEX A;  4DUZ E;  4BS9 A;  2AE8 A;  4IFD F;  2RS6 A;  2EPN A;  1A1L A;  1X5W A;  2EL5 A;  2L6M A;  4WFT A;  4IZJ D;  4DPY A;  3J81 Q;  4B3M I;  1PKP A;  2RSI A;  1HNW I;  4ISA A;  4DV4 E;  1N32 E;  1SFE A;  3WU4 A;  2VF1 A;  1N0V C;  1GTK A;  4JG4 A;  1A1K A;  3GME A;  2V89 A;  1YZ9 A;  2ZM6 E;  2RTX A;  3VYX A;  4DR3 I;  2Q2E B;  2A25 A;  4LF4 I;  4IS9 A;  2UU9 E;  2YZT A;  4DV3 I;  3MHH C;  2EPO A;  4LF6 E;  1R6L A;  5A6B A;  3C6M A;  1EA6 A;  4ZYE A;  1J5E E;  2DGC A;  4Z7C A;  2EN4 A;  2A2D A;  2EMY A;  2L3C A;  3PRY A;  4MDT A;  2N3H A;  2EOX A;  1E3H A;  2HFS A;  2EL4 A;  1TF6 A;  1UDS A;  4EMD A;  4JI5 E;  4DU7 A;  4ZYH A;  4HAC A;  2YRM A;  3K6Q A;  4LU9 A;  4BBY A;  4M2Z A;  2PO1 B;  2EM7 A;  2C39 A;  3M85 G;  5C0X F;  2DLQ A;  2X7I A;  4HAC B;  5K36 F;  2N8X A;  1BKN A;  1FI4 A;  5AC4 A;  2WP8 A;  4M1K A;  3Q6M A;  3H1C A; 
#chains in the Genus database with same CATH homology
 4P78 A;  3MSW A;  1MG7 A;  4RPF A;  1IBM I;  4HYM A;  1Y4S A;  4MYT A;  2VF3 A;  5ADZ A;  3ADI A;  3PYG A;  1FNM A;  3QT8 A;  5CFF E;  4PU9 A;  1DI2 A;  3QT7 A;  4DV7 E;  4F9C B;  4JI3 E;  5IT9 C;  1K47 A;  3HJC A;  5BR8 I;  3LTO A;  1ELO A;  4DR6 I;  2DMY A;  4BC9 A;  1N34 I;  1N33 E;  2UUB E;  1ZBQ A;  1KTV A;  2HKJ A;  3CWV A;  3HPS A;  2DEJ A;  4DMI A;  4NXN I;  1USU A;  3DF6 A;  1WUU A;  1H7S A;  3GON A;  2L3J A;  2CG9 A;  3OML A;  2AJ4 A;  1J26 A;  2LRS A;  4LF8 E;  4LFC E;  2MDR A;  5LMN E;  4LF7 E;  1X47 A;  3ADG A;  4YY3 E;  1YYK A;  1Z5A A;  1ZM9 A;  2WZO A;  2UUA I;  1B63 A;  4IZK B;  3OTO E;  1MX0 A;  3T1Y E;  4HY1 A;  2LUQ A;  4BC7 A;  1XMO I;  4L5N C;  2Z5C B;  3D4J A;  2MC6 A;  4OX9 E;  1XNR I;  3PYF A;  4B3S E;  1Y6Z A;  4XTJ A;  1I94 I;  2RSM A;  3PYD A;  3F0N A;  1IBL E;  4JI4 I;  2PNL A;  1NZ0 A;  4B3T E;  4URL A;  1FJG I;  3C4T A;  3LML A;  4UTG A;  4LF9 I;  4X62 I;  1HR0 I;  3RMP A;  1N36 E;  1HNW E;  3C4B A;  3IWC A;  1HNX I;  5IT9 Q;  4IZJ B;  4DR3 E;  2UXD E;  1ZXN A;  4LF5 I;  3HPZ A;  1XMQ I;  2NUF A;  4DV3 E;  3HTX A;  2NA2 A;  1XHK A;  4NXM E;  4DR7 I;  3VK6 A;  4X8W A;  2IHR 1;  2HFU A;  4AQY I;  4P7A A;  2NUG A;  5GME A;  1IBK I;  2DSY A;  2R3V A;  2IOP A;  2J7K A;  1ZM4 A;  4DR2 I;  4ED4 A;  1Z0E A;  4GKJ E;  3JAM C;  4DPU A;  3HUL A;  1IBM E;  2Z5B B;  4JI8 E;  1RR9 A;  2JR1 A;  1Z0W A;  3HQ1 A;  1DQ3 A;  4X65 I;  2V8Q B;  4MYU A;  2V85 A;  1HNZ E;  1KVK A;  5F3W A;  3ZKD A;  2LJP A;  2VQF I;  4LFA E;  4DPT A;  4JYA I;  3P1X A;  4DUY I;  2V86 A;  1T4O A;  1Z0G A;  4B3R E;  4DPX A;  1H72 C;  3ZZ0 A;  2F8B A;  4YHH I;  4NXN E;  2L8T A;  2LBS B;  1EKZ A;  2Z5E A;  1SR9 A;  2B7V A;  2R42 A;  2B3T B;  4FWH A;  4PRV A;  4R1F A;  2L2N A;  3B82 A;  2IOQ A;  3KWR A;  3WU3 A;  4DV0 I;  2KON A;  3J7Y p;  5L3J A;  2RS7 A;  4JV5 I;  4DV5 I;  3T1H E;  1Z5B A;  2VE7 C;  2F4V I;  4X66 I;  3F6H A;  4DV6 I;  2L2M A;  2GS8 A;  4DV2 I;  4GKK I;  1QZR A;  2E5L I;  4X64 I;  4JI6 I;  3ZKB A;  1Z0C A;  1I94 E;  2V2V A;  5LMU I;  3JAM Q;  4P52 A;  2UXC I;  4USM A;  4DR5 E;  4LFB E;  4DU8 A;  2V88 A;  3IWD A;  1HR0 E;  2L92 A;  3LPS A;  3B78 A;  3B8H A;  2CPN A;  1N32 I;  1HNX E;  2LTS A;  1DAR A;  1OJ4 A;  5IWA I;  4DKK A;  2ZM6 I;  1FWK A;  4K0K E;  1Z59 A;  1XMQ E;  3AV0 A;  3QT6 A;  2UU9 I;  4DR7 E;  4FWD A;  1RRE A;  4DR1 E;  2FTX B;  4M0V A;  2VQE I;  4DV1 I;  1RQ0 A;  2DB2 A;  5DNY A;  4AQY E;  4JI5 I;  1KKH A;  1IBK E;  1XNQ E;  3V5R A;  1WHQ A;  3M6A A;  3H09 A;  2ODR D;  3LNU A;  4OOG C;  1N0U A;  2NPF A;  3ZZT A;  4JI1 I;  4B3M E;  3VYY A;  3LLH A;  5GMD A;  3ADJ A;  4LTY A;  2HHH I;  4I8O A;  5AE2 A;  1EI1 A;  4DV7 I;  4JI3 I;  2EWL A;  1U2R A;  2HK3 A;  4WUB A;  4LF4 E;  4DUY E;  2DEI A;  4FN5 A;  1N33 I;  2UUB I;  2LMZ A;  1FWL A;  2V34 A;  3AUZ A;  4FWG A;  3DJW A;  4WSP A;  4ZVI A;  4R03 A;  3ZZU A;  4WUC A;  4TUI A;  2JVA A;  1QU6 A;  3K85 A;  1FKA E;  1UHZ A;  1NHI A;  1HK7 A;  4JI2 I;  1GZ6 A;  4LF8 I;  2G7H A;  2JOX A;  4BMJ A;  1KIJ A;  4LFC I;  4WYQ B;  2ODR C;  1A6F A;  3Q1Q A;  4YY3 I;  4UT4 A;  4DV5 E;  4DR4 I;  1WHN A;  1ZXM A;  2LUP B;  2KOU A;  2FGG A;  4I3H A;  3PYE A;  3OTO I;  3T1Y I;  1WXR A;  1X48 A;  2JWO A;  5AAS A;  4OX9 I;  4GKK E;  3IWB A;  2E5L E;  4X64 E;  2O1W A;  4JI6 E;  5BR8 E;  4B3S I;  4JI0 I;  1NHH A;  4Z7Y A;  4DR6 E;  1N34 E;  4DXL A;  2V83 A;  2UXC E;  2V2Q A;  2UUC I;  2UXB I;  1H7U A;  4B3T I;  2BM1 A;  3FIG A;  2ZIT A;  1N36 I;  3JTZ A;  3Q6N A;  2O1T A;  3K1J A;  5IWA E;  3QT5 A;  2UXD I;  2K4V A;  2CGE A;  4NXM I;  2UUA E;  4KHP I;  1Z0V A;  2VQE E;  1B62 A;  2KHX A;  4DV1 E;  2BV3 A;  1XMO E;  3HXL A;  1STU A;  1XNR E;  2X36 A;  1Z0B A;  2ZBK B;  3J7A G;  2JY9 A;  4JI7 I;  1T4N A;  1MU5 A;  1H73 A;  4JI4 E;  2BM0 A;  4GKJ I;  1FJG E;  2YT4 A;  4DUZ I;  2WW4 A;  4M30 A;  4JI1 E;  4LF9 E;  2NUE A;  3H4L A;  3ADL A;  4USK A;  4X62 E;  4JI8 I;  4FW9 A;  5AE3 A;  2HKE A;  2B7T A;  5FLX C;  2HHH E;  3WU5 A;  4DV4 I;  1HNZ I;  4N3O A;  2FV4 B;  4PRX A;  4DPW A;  1ZBT A;  4Q28 A;  1UIL A;  2V2Z A;  2LE2 A;  4LF5 E;  4LFA I;  1T4L B;  4LF6 I;  1USV A;  1ZM2 A;  4B3R I;  1VIS A;  1Z0T A;  4WUD A;  4J8Z A;  5A2Q C;  1J5E I;  1D6T A;  3J7A M;  4GEQ B;  2EZ6 A;  2M4I A;  4BCA A;  3J80 C;  4L8N A;  2CZ9 A;  5T6J A;  2LTR A;  2E1R A;  2PNM A;  4DR2 E;  4JI2 E;  5FWK A;  4F9B B;  4IZK A;  4X65 E;  2MC5 A;  1ZM3 A;  2E1M A;  4DR4 E;  1YYO A;  2EFG A;  3K17 A;  3J81 C;  2Z5C A;  3T1H I;  4KQV A;  1O0W A;  3P06 A;  2VQF E;  3F6G A;  2JOB A;  4WPY A;  4JYA E;  2L33 A;  4F9A B;  4JI0 E;  1YYW A;  3JU0 A;  3WU6 A;  5LL6 R;  1H74 A;  2UUC E;  2O1U A;  2L2K B;  2UXB E;  4DR5 I;  4LFB I;  4YHH E;  5FLX Q;  1X49 A;  1RC7 A;  3V2U C;  4IZJ A;  2M1S A;  4KZS A;  2H36 X;  1S16 A;  2V87 A;  2OI2 A;  2GQ0 A;  4K0K I;  2O1V A;  4DV0 E;  1Z5C A;  3ZM7 A;  1NHJ A;  5LMN I;  4LF7 I;  1PVG A;  4JV5 E;  1S4E A;  5A2Q Q;  1GQE A;  4KHP E;  2HK2 A;  4DR1 I;  4P7D A;  1Y4U A;  2F4V E;  4X66 E;  4DV6 E;  4R8O A;  4HXZ A;  3J80 Q;  4DV2 E;  2B9D A;  4F54 A;  1PIE A;  4TUG A;  1XNQ I;  4JI7 E;  5LMU E;  2M7Q A;  2A2C A;  3ZOQ B;  2DIX A;  2V8P A;  2Z5B A;  2N3G A;  1UEK A;  2LJH A;  1IBL I;  5AE1 A;  2XEX A;  4DUZ E;  4BS9 A;  2RS6 A;  2L6M A;  4WFT A;  4IZJ D;  3J81 Q;  4DPY A;  4B3M I;  1PKP A;  1HNW I;  4DV4 E;  1N32 E;  3WU4 A;  2VF1 A;  1N0V C;  4JG4 A;  2V89 A;  1YZ9 A;  2ZM6 E;  2RTX A;  3VYX A;  4DR3 I;  2Q2E B;  4LF4 I;  2UU9 E;  2YZT A;  4DV3 I;  4LF6 E;  1EA6 A;  1J5E E;  4Z7C A;  2A2D A;  3PRY A;  2L3C A;  2N3H A;  2HFS A;  4EMD A;  4JI5 E;  4DU7 A;  4HAC A;  3K6Q A;  4LU9 A;  4BBY A;  4M2Z A;  2X7I A;  4HAC B;  1BKN A;  1FI4 A;  4M1K A;  3Q6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...