4OX9E

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ox9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9E02
2E1RA 4JI0I 1Z0TA 4B3SE 4DPUA 2DEIA 1XMQE 3LPSA 2B7VA 4RPFA 4Z7YA 4YY3E 4DU8A 2VQFE 1Z59A 4OX9I 5FLXQ 3ADJA 1EA6A 5FLXC 5CFFE 4B3SI 1N32E 1XMQI 1QU6A 4JYAE 1XHKA 1B62A 2GS8A 3ZZ0A 4USMA 5L3JA 3WU3A 4YY3I 4LF6E 3P1XA 3B8HA 4WUCA 2RTXA 1X49A 1ZXNA 3GONA 1N32I 2NUEA 4DR7E 3HULA 1A6FA 1HNWE 4DR2I 1MU5A 4JYAI 1Z5BA 4DPWA 4DU7A 1EKZA 4LF6I 5IT9Q 4YHHE 1WHNA 2LTSA 1ZBTA 3B78A 1U2RA 1XMOI 4DR7I 1HR0E 2UXDE 2V2QA 2N3GA 3T1YE 2LTRA 1H72C 1EI1A 5LMUE 1KTVA 1B63A 4YHHI 1Z5AA 3ZM7A 1ZM9A 2VF3A 3ADLA 3C4TA 5A2QQ 3ZZTA 1HR0I 2UXDI 5IWAE 3WU5A 4UTGA 3T1YI 4LF7E 1XNQE 3J81Q 1N0UA 1WUUA 4WUBA 4DV1E 5GMEA 1N34E 1UILA 4DV2I 1FWLA 1ZXMA 3VYXA 2HHHI 2WW4A 4LF9I 4LFAI 1HNZI 3H4LA 2N3HA 4JI6E 1FJGI 4LF7I 3D4JA 2L3CA 1RC7A 4DV1I 2UU9E 1N34I 3OTOE 1XNRE 2UUBE 4GKKI 3PYFA 2VQEE 1ELOA 1Z0BA 4B3ME 4LFCI 3JAMC 4FWGA 4X64I 2LJHA 3M6AA 1MX0A 1Z0WA 4DPYA 2UU9I 3OTOI 2BV3A 1T4OA 4JI1E 2BM1A 4M2ZA 1XNRI 2UUBI 1BKNA 2HFSA 1T4LB 2X7IA 2VQEI 4OX9E 4B3MI 2L33A 2NA2A 3CWVA 2CPNA 4OOGC 4KQVA 1Z0GA 4Z7CA 2CZ9A 2NUGA 4JI1I 1Z5CA 4FW9A 3Q1QA 2RS7A 3PYEA 2UXCE 2V8PA 2LBSB 3QT6A 1X48A 4DR2E 3PYGA 3J7AM 4LF8E 3WU4A 5BR8E 4JI4E 4LF4E 1YYWA 4DR1E 2UXCI 2DEJA 4X65E 2R3VA 1NHJA 1GQEA 1H74A 1XMOE 4JG4A 4WYQB 3K1JA 3QT8A 4LF8I 4FWDA 5BR8I 2ZM6I 4JI4I 4LF4I 1S16A 4DR1I 2L2MA 4X65I 3HTXA 4AQYE 1YYKA 3T1HI 1X47A 1N36I 2BM0A 4DV7E 2EFGA 2B7TA 2L2KB 4LF5I 2JY9A 1OJ4A 3QT5A 3K17A 4R1FA 1KVKA 3VYYA 1FKAE 1MG7A 4FN5A 3LLHA 4DV0E 4DPXA 1RREA 4DV2E 4AQYI 3J80Q 2HHHE 4I3HA 4DKKA 3J80C 1DARA 4DV7I 4LF9E 2LJPA 4LFAE 1HNZE 1FJGE 1UHZA 2A2CA 4DV0I 4DPTA 1I94I 2UUCE 4DV5E 4DR6I 4GKKE 1PIEA 5LMNE 4X66I 1STUA 4URLA 2ZBKB 2YT4A 2NUFA 2B3TB 1IBLE 4LFCE 4LFBE 4NXNE 1N0VC 4DR3E 4X64E 3ZKBA 2HK2A 4JV5E 4WUDA 2LRSA 4HACA 3J7AG 4KHPI 2UUCI 4DV5I 4P52A 1QZRA 5LMNI 1Z0EA 3JAMQ 1H7UA 2HFUA 1IBLI 4LFBI 2E5LI 4NXNI 4DR3I 1VISA 4JV5I 2DIXA 4GKJI 2JVAA 1KIJA 1Z0VA 4UT4A 2Q2EB 4X62I 4M30A 4DR5E 4FWHA 4B3RE 3F0NA 3J7Yp 4DUZE 4PRVA 1O0WA 2AJ4A 2X36A 2V34A 3QT7A 1NHHA 4USKA 4XTJA 4DR5I 4B3RI 4DUZI 2UUAI 2L3JA 2MDRA 3ZKDA 1NZ0A 4NXME 1IBMI 1YZ9A 2DMYA 4DXLA 1RQ0A 3V2UC 1J5EI 1T4NA 2XEXA 1H7SA 4PU9A 2ZM6E 1RR9A 1K47A 1ZM4A 4NXMI 4P7AA 3T1HE 4ED4A 1N36E 2V2ZA 4LF5E 3V5RA 2OI2A 2J7KA 2EZ6A 4JI5E 1S4EA 1N33E 2VQFI 1WHQA 2LUPB 2RSMA 3WU6A 4JI7E 1J26A 4JI5I 4B3TE 4HACB 4HY1A 2DB2A 1I94E 1N33I 1IBKE 2R42A 2L2NA 4JI8E 5GMDA 5IT9C 4ZVIA 4DR6E 4K0KE 5LL6R 4DR4E 1ZM3A 4X66E 4JI7I 4X8WA 1HNWI 3LNUA 2KHXA 2NPFA 2HKJA 4MYTA 4WFTA 4B3TI 4JI3E 1IBKI 4MYUA 4KHPE 1NHIA 4JI8I 4DUYE 4K0KI 4DR4I 1FI4A 2E5LE 4JI2E 4HYMA 5A2QC 4DV6E 1KKHA 4JI3I 2V2VA 2F4VE 5LMUI 4DV3E 1PVGA 4HXZA 3C4BA 1H73A 4PRXA 4GKJE 4DUYI 4X62E 3J81C 4DV4E 1D6TA 2LUQA 4JI2I 2HK3A 5IWAI 3ADIA 2IHR1 4DV6I 1DI2A 2A2DA 3ZZUA 3ADGA 2F4VI 1XNQI 1UEKA 4DV3I 3B82A 4EMDA 4DV4I 2HKEA 2UXBE 2UUAE 1YYOA 3PYDA 1HNXE 2ZITA 4JI6I 1IBME 1Z0CA 4JI0E 1FNMA 1J5EE 1ZM2A 1FWKA 1PKPA 4M1KA 2UXBI 3LTOA 2RS6A 1HNXI
chains in the Genus database with same CATH superfamily
2EPPA 4ZYHA 2EPKX 2E1RA 1WJPA 4JI0I 1Z0TA 1USUA 4B3SE 1YFHA 2O1TA 2FV4B 4AIMA 4DPUA 5AE3A 2DEIA 1XMQE 2PO1B 2EWLA 3LPSA 1WXRA 2E1MA 2B7VA 4RPFA 5F3WA 4Z7YA 4YY3E 1R6LA 4DU8A 1Y5YA 3GLLA 2VQFE 2O3ZA 1Z59A 4OX9I 5KL6A 5FLXQ 1T39A 3ADJA 1EA6A 5FLXC 5CFFE 4B3SI 3KRNA 1N32E 2C37A 2EM0A 5DRRA 2ODRD 1XMQI 1QU6A 5AC4A 2H36X 2YTGA 4JYAE 1XHKA 1B62A 2DSYA 2GS8A 2EJ4A 3ZZ0A 4USMA 5L3JA 5JEAD 3WU3A 4YY3I 1RMDA 2PO2A 2VF1A 4F2JC 4LF6E 3P1XA 3B8HA 5JEAB 1UN6B 4O4KA 2RTXA 2JE6B 4WUCA 1X49A 2IERA 1ZXNA 4F9BB 4MU3A 4BA2B 3GONA 2WCC3 1N32I 2NUEA 4LCFA 4DR7E 2L6MA 3HULA 1IQSA 1A6FA 2E72A 1HNWE 4DR2I 1MU5A 4OO1C 1YPNA 2EOYA 4JYAI 1Z5BA 2NN6F 1YUIA 4DPWA 4DU7A 2O1WA 2NABA 1EKZA 1KYQA 4OKGA 4LF6I 5IT9Q 3IWBA 2EPAA 4YHHE 4R2QA 4MU0A 3AV0A 2WBUA 4OO1D 1GZ6A 1N3GA 1WHNA 4WSPA 4J8ZA 1B69A 2LTSA 4OO1B 1ZBTA 1F2IG 5A6AA 1U2RA 3B78A 1L4SA 2V83A 1XMOI 4DR7I 4LPFA 2EMBA 1A1FA 1HK7A 1HR0E 2UXDE 2GLIA 2LE2A 2V2QA 2N3GA 5DROA 3T1YE 2LTRA 1H72C 2YRKA 3NZKA 4IZKB 1PDAA 2EM6A 1EI1A 5LMUE 2MC5A 4R2SA 1KTVA 1B63A 1P42A 4YHHI 3IWDA 5FWKA 1Z5AA 3MHHC 4MQYA 3ZM7A 1ZM9A 4BA1B 2CSHA 3BIDA 2D9HA 3P3CA 3PS3A 2VF3A 4GQUA 4O5GA 3ADLA 3C4TA 5A2QQ 1P47A 3ZZTA 1HR0I 2UXDI 2Q8UA 2JPAA 5IWAE 3WU5A 4UTGA 3T1YI 4LF7E 1XNQE 1MGTA 3EPKA 4L5NC 2BBGA 1A1IA 3J81Q 4MLVA 1N0UA 2EQ3A 1WUUA 4DV1E 4WUBA 2EMFA 5GMEA 1N34E 2I9IA 4IS1C 1UILA 3JU0A 4DV2I 1FWLA 1ZXMA 3VYXA 2WP8A 2WW4A 2HHHI 3HPSA 2V85A 4QNJA 4R2AA 4LF9I 1KJKA 4LFAI 1HNZI 3H4LA 2N3HA 4JI6E 1FJGI 2NN6A 4LF7I 3D4JA 3THOB 4F54A 4IFDF 3M85D 2L3CA 1RC7A 4DV1I 4O43A 3CDJA 4BC9A 2UU9E 3OTOE 2YTFA 2VRDA 4MU4A 1N34I 4HTGA 3K6QA 1XNRE 2EPNA 2UUBE 4AM3A 4GKKI 3PYFA 2MKNA 2VQEE 1ELOA 1Z0BA 2M7QA 4B3ME 4WX9A 2C37B 4LFCI 3JAMC 3F6GA 1BBGA 2DLQA 2Z5BB 3P3EA 3F6HA 4FWGA 2EL5A 4X64I 2LJHA 4TUGA 3M6AA 2EPUA 1BB8A 1MX0A 1Z0WA 4DPYA 2UU9I 1SR9A 3OTOI 2NN6E 1UDNA 2PO2B 2BV3A 1T4OA 4WXCA 5AASA 2J65A 4JI1E 2BM1A 4M2ZA 2CGEA 4ISAA 2EOQA 4P78A 1X6HA 1BKNA 4IZJD 2HFSA 1T4LB 2UUBI 2ELYA 2PNZA 2X7IA 4IZJB 4BCAA 3M85G 2VQEI 4OX9E 4B3MI 1SFEA 5KL5A 2L33A 2NA2A 3DF6A 2EQ1A 2YTJA 1TF3A 3CWVA 2CPNA 2YWQA 4OOGC 5A6JA 1A1LA 2IOPA 4BHBA 3C6KA 4KQVA 1Z0GA 1WRJA 2EMZA 4N3OA 1AH5A 2V87A 4Z7CA 3OMLA 2CZ9A 2R76A 2V8QB 5IV8B 2NUGA 1UBDC 4JI1I 4DMIA 2LVHA 1Z5CA 2EM4A 1ZU1A 1G2DC 4IS9A 4FW9A 3Q1QA 2RS7A 5ELWA 3PYEA 2EMCA 1ZBQA 2EN6A 2YRHA 2UXCE 2C38A 1OYRA 5GMDA 2BA0G 2V8PA 2LBSB 4NZVA 3QT6A 2CVEA 5DNLA 4IFDA 1X48A 2C39A 4DR2E 1Y60A 2BA1G 1LLMC 2WNRA 2EMLA 3HJCA 3PYGA 2GPIA 3J7AM 3P3GA 2M9AA 4LF8E 2EPXA 3UHMA 3MHSC 5DNYA 2EM7A 3WU4A 5BR8E 4JI4E 4R2DA 4LF4E 2EMKA 1YYWA 5KL2A 4DR1E 2EMXA 3CDIA 2UXCI 2YTEA 2DEJA 2EM5A 2DGCA 4X65E 2EPOA 2R3VA 1NHJA 1GQEA 1H74A 2WBSA 4BHCA 1XMOE 3FIGA 4FW3A 3BBGA 2YPNA 4JG4A 4MDTA 4FW5A 2VE7C 4WYQB 2LJUA 3K1JA 3QT8A 2NN6C 1Z1BA 4FWDA 4LF8I 2V88A 4FW6A 4IFDE 2V86A 4LTYA 5BR8I 1RHYA 2ZM6I 4JI4I 4LF4I 1S16A 4DR1I 2MKDA 3LTOA 2EP3A 2L2MA 4O24A 4X65I 5C0XF 3HTXA 4Q28A 2K4VA 4AQYE 1YYKA 2NN6D 3U1KA 3T1HI 1X47A 1N36I 2BM0A 2EM3A 3JTZA 4FW4A 4DV7E 1TN9A 2EFGA 2JEBB 3DD6A 2B7TA 2L2KB 4LU9A 4QNKA 2JY9A 4LF5I 3C6MA 5A69A 1OJ4A 2YTPA 3K17A 3QT5A 2PO1A 4R1FA 4IJDA 2I13A 4ZYEA 1KVKA 4RHBB 3VYYA 1FKAE 1MG7A 2RSIA 4ZYGA 4FN5A 3LLHA 2FTXB 4DV0E 2LT7A 4DPXA 5K36F 1RREA 3PS1A 2EMWA 4DV2E 4AQYI 3J80Q 2HHHE 2JEAA 2YZTA 4HEIA 3L7ZA 1X6EA 4I3HA 4DKKA 3J80C 1DARA 1PJSA 2BB8A 2ELZA 2F8BA 1AAYA 4LF9E 2GO3A 4LFAE 2EPMX 4BMJA 1HNZE 1FJGE 2LJPA 4WSGA 4R2RA 4MU1A 1UHZA 2A2CA 1A1JA 2IESA 2EN8A 2GHFA 2BR2B 4DV7I 2FGGA 4LCHA 4DPTA 3EPLA 4DV0I 1I94I 2UUCE 2PNZB 1VI7A 2EN1A 4DV5E 5JEAA 3MSWA 4DR6I 4GKKE 3EPHA 1PIEA 5LMNE 4X66I 1STUA 2EOXA 2EMIA 1X3CA 2ZBKB 4URLA 2EN7A 2YTIA 2YT4A 2NUFA 2B3TB 1IBLE 4LFCE 4LFBE 2K7IA 4NXNE 1N0VC 4DR3E 4X64E 3ZKBA 4WPYA 1EH7A 2EL6A 3HXLA 1YHCA 2HK2A 3AUZA 3Q6NA 4JV5E 4IFDC 4WUDA 2LRSA 3PRYA 3J7AG 2CG9A 4HACA 4KHPI 1DGCA 5C0XA 4F6NA 2UUCI 4DV5I 4GEQB 4P52A 4J3DA 5DNXA 1QZRA 2C38B 5LMNI 1DQ3A 1Z0EA 5EKWA 1H7UA 3JAMQ 4IFDD 4N4RB 1ZR9A 2HFUA 2KONA 1IBLI 2EOEA 4OZEA 2E5LI 4NXNI 1Y6ZA 4IFDB 5T6JA 4LFBI 5JEAE 4DR3I 2LCEA 2LMZA 4UT4A 2EQ0A 1VISA 2WNRB 2EMYA 2BA0D 4JV5I 2DIXA 2L8TA 4IZKA 2RQLA 4NHRA 1X5WA 5K36A 4GKJI 2JVAA 1KIJA 2YRMA 3HQ1A 5LLQA 1Z0VA 1PJQA 2EOIA 2BA1D 2Q2EB 4X62I 5A6BA 1A1KA 4M30A 4DR5E 4FWHA 5EL9A 4AIDA 3M99B 3P06A 4B3RE 3F0NA 3Q6MA 3J7Yp 3EPJA 4DUZE 1IMUA 4PRVA 1NCSA 1O0WA 2Z5CA 4U3DA 2N8XA 5C0XE 4R2PA 2AJ4A 1USVA 2X36A 3L00A 3B4TA 1Y4UA 2A25A 1NEIA 2EM2A 1Y4SA 2V89A 2V34A 3QT7A 4OO1E 4NBQA 3PS2A 4X9JA 2GQ0A 1NHHA 1A1HA 1YUJA 4USKA 4XTJA 2ENHA 1E3HA 1EH8A 4DR5I 3HKMA 1XNRI 2ENAA 4R2CA 4B3RI 2J7JA 4DUZI 2AE8A 2UUAI 5AE2A 2L3JA 2EOMA 2JWOA 4R03A 5K36E 2MDRA 3ZKDA 1NZ0A 4NXME 3KWRA 3K85A 1IBMI 1YZ9A 2EOJA 2YTOA 2DMYA 2YSPA 4DXLA 1RQ0A 3V2UC 1UDQA 1J5EI 1T4NA 3RMPA 2EMGA 2XEXA 2WZOA 1H7SA 4PU9A 3ZOQB 1X6FA 1MEYC 4RH8A 2ZM6E 1RR9A 1YH8A 2EM9A 2ODRC 2JEAB 4BS9A 4R2EA 1GTKA 1K47A 1ZM4A 3L7ZB 4NXMI 5JEAF 4P7AA 3T1HE 4ED4A 5JEAC 1N36E 1EH6A 2RPCA 2V2ZA 2IOQA 2PO0A 2Z5BA 5AC5A 4LF5E 3V5RA 2OI2A 2J7KA 2JOXA 1IQOA 5KL4A 2EZ6A 2WBTA 5IXMB 4JI5E 2PRTA 4I8OA 1JK2A 4LCGA 2HC5A 2WP8B 1S4EA 1N33E 1OYSA 4BBYA 4F9AB 2O1VA 2MDGA 5KL7A 2HGHA 2Z5EA 2VQFI 1WHQA 2LUPB 5C0XC 4IZJA 3U1YA 2KOUA 2RSMA 2NN6B 3WU6A 4JI7E 4OO1F 5AE1A 2ADRA 4ZYDA 1J26A 1UDOA 5TSEA 5C0XD 4JI5I 2DRPA 4B3TE 3TQMA 4HACB 2M4IA 4HY1A 5C0XB 2DB2A 4MLQA 1I94E 1N33I 1TF6A 1IBKE 1UDSA 3GMEA 3KZYA 4LOMA 2R42A 5K36C 2L2NA 4F9CB 4JI8E 1OYPA 5IT9C 4ZVIA 2EN3A 2EPCA 4BC7A 4DR6E 5LL6R 4DR4E 4K0KE 1ZM3A 4X66E 2JT2A 3DJWA 4TUIA 4JI7I 3M7ND 2B9DA 2JR1A 4X8WA 1HNWI 1ZAAC 2YTNA 3LNUA 2KHXA 2NPFA 2HKJA 2YTDA 4MYTA 4WFTA 5K36D 4B3TI 4JI3E 2YU5A 5K36B 3UK3C 1T38A 5A6BD 1QNTA 1IBKI 4MYUA 4Q35B 4KHPE 2JP9A 3ECRA 1NHIA 5DRPA 2EN2A 4FK5C 4DUYE 4JI8I 3P76A 1JK1A 2JE6A 4K0KI 4DR4I 1FI4A 3THNA 2ENCA 2Z5CB 4DV6I 2EMAA 2EOSA 3H09A 4BA2A 2EL4A 2E5LE 4JI2E 5A2QC 4HYMA 2HJJA 2EMHA 4DV6E 1R6MA 1KKHA 2F1DA 2V2VA 2F4VE 4JI3I 5LMUI 3BF2A 2EN4A 4DV3E 2EE8A 3VHTB 1PVGA 4HXZA 3C4BA 1H73A 4PRXA 4GKJE 2EOOA 3M7NG 2EORA 2LV2A 4KZSA 4DUYI 4X62E 2EOZA 3J81C 3IWCA 2DLKA 2JYAA 4DV4E 2EPLX 3BGHA 1D6TA 3VK6A 2YTQA 2VESA 4OO1A 3GCMA 2EPRA 2LUQA 4JI2I 2R1FA 1A1GA 2HK3A 5IWAI 3ADIA 2CT1A 1BBOA 2C39B 2IHR1 2G7HA 5A6KA 4F6MA 2DMIA 3HPZA 1DI2A 2A2DA 3ADGA 2JEBA 2JXPA 1G2FC 1UEKA 3ZZUA 2EOHA 1XNQI 2F4VI 3EQ1A 2EPZA 1YSAC 4DV3I 4M0VA 1E3PA 3B82A 4EMDA 4DV4I 4R8OA 2CTDA 4M9VC 2HKEA 2UXBE 4BA1A 2UUAE 3H1CA 4FW7A 1YYOA 3PYDA 1HNXE 1XXEA 5ADZA 4P7DA 2GO4A 2EOFA 3LMLA 3QG5C 2ZITA 4U3BA 1IBME 1Z0CA 4JI6I 5KL3A 4GZNC 1PJTA 4WXDA 2PO0B 4L8NA 4JI0E 2YSOA 1FNMA 1J5EE 1ZM2A 2JOBA 1FWKA 2PNLA 2M1SA 2O1UA 1PKPA 2L92A 2PNMA 4M1KA 2BR2A 2LO3A 4KWYA 3KZZA 2YU8A 5DRQA 2EM8A 2RS6A 2UXBI 2MC6A 1HNXI
chains in the Genus database with same CATH topology
2E1RA 4JI0I 1Z0TA 1USUA 4B3SE 2O1TA 2FV4B 4DPUA 5AE3A 2DEIA 1XMQE 2EWLA 3LPSA 1WXRA 2E1MA 2B7VA 4RPFA 5F3WA 4Z7YA 4YY3E 4DU8A 2VQFE 1Z59A 4OX9I 5FLXQ 3ADJA 1EA6A 5FLXC 5CFFE 4B3SI 1N32E 2ODRD 1XMQI 1QU6A 2H36X 4JYAE 1XHKA 1B62A 2DSYA 2GS8A 3ZZ0A 4USMA 5L3JA 3WU3A 4YY3I 2VF1A 4LF6E 3P1XA 3B8HA 4WUCA 2RTXA 1X49A 1ZXNA 4F9BB 3GONA 1N32I 2NUEA 4DR7E 2L6MA 3HULA 1A6FA 1HNWE 4DR2I 1MU5A 4JYAI 1Z5BA 4DPWA 4DU7A 2O1WA 1EKZA 4LF6I 5IT9Q 3IWBA 4YHHE 3AV0A 1GZ6A 1WHNA 4WSPA 4J8ZA 2LTSA 1ZBTA 3B78A 1U2RA 2V83A 1XMOI 4DR7I 1HK7A 1HR0E 2UXDE 2LE2A 2V2QA 2N3GA 3T1YE 2LTRA 1H72C 4IZKB 1EI1A 5LMUE 2MC5A 1KTVA 1B63A 4YHHI 3IWDA 5FWKA 1Z5AA 3ZM7A 1ZM9A 2VF3A 3ADLA 3C4TA 5A2QQ 3ZZTA 1HR0I 2UXDI 5IWAE 3WU5A 4UTGA 3T1YI 4LF7E 1XNQE 4L5NC 3J81Q 1N0UA 1WUUA 4WUBA 4DV1E 5GMEA 1N34E 1UILA 3JU0A 4DV2I 1FWLA 1ZXMA 3VYXA 2HHHI 2WW4A 3HPSA 2V85A 4LF9I 4LFAI 1HNZI 3H4LA 2N3HA 4JI6E 1FJGI 4LF7I 3D4JA 4F54A 2L3CA 1RC7A 4DV1I 4BC9A 2UU9E 3OTOE 1N34I 3K6QA 1XNRE 2UUBE 4GKKI 3PYFA 2VQEE 1ELOA 1Z0BA 2M7QA 4B3ME 4LFCI 3JAMC 3F6GA 2Z5BB 3F6HA 4FWGA 4X64I 2LJHA 4TUGA 3M6AA 1MX0A 1Z0WA 4DPYA 2UU9I 1SR9A 3OTOI 2BV3A 1T4OA 5AASA 4JI1E 2BM1A 4M2ZA 2CGEA 2UUBI 4IZJD 4P78A 1BKNA 1XNRI 2HFSA 1T4LB 2X7IA 4IZJB 4BCAA 2VQEI 4OX9E 4B3MI 2L33A 2NA2A 3DF6A 3CWVA 2CPNA 4OOGC 2IOPA 4KQVA 1Z0GA 4N3OA 2V87A 4Z7CA 3OMLA 2CZ9A 2V8QB 2NUGA 4JI1I 4DMIA 1Z5CA 4FW9A 3Q1QA 2RS7A 3PYEA 1ZBQA 2UXCE 2V8PA 2LBSB 3QT6A 1X48A 4DR2E 3HJCA 3PYGA 3J7AM 4LF8E 5DNYA 3WU4A 5BR8E 4JI4E 4LF4E 1YYWA 4DR1E 2UXCI 2DEJA 4X65E 2R3VA 1NHJA 1GQEA 1H74A 1XMOE 3FIGA 4JG4A 2VE7C 4WYQB 3K1JA 3QT8A 4LF8I 4FWDA 2V88A 2V86A 4LTYA 5BR8I 2ZM6I 4JI4I 4LF4I 1S16A 4DR1I 2L2MA 4X65I 3HTXA 4Q28A 2K4VA 4AQYE 1YYKA 3T1HI 1X47A 1N36I 2BM0A 3JTZA 4DV7E 2EFGA 2B7TA 2L2KB 4LU9A 4LF5I 2JY9A 1OJ4A 3QT5A 3K17A 4R1FA 1KVKA 3VYYA 1FKAE 1MG7A 4FN5A 3LLHA 2FTXB 4DV0E 4DPXA 1RREA 4DV2E 4AQYI 3J80Q 2HHHE 2YZTA 4I3HA 4DKKA 3J80C 1DARA 2F8BA 4DV7I 4LF9E 2LJPA 4LFAE 4BMJA 1HNZE 1FJGE 1UHZA 2A2CA 2FGGA 4DV0I 4DPTA 1I94I 2UUCE 4DV5E 3MSWA 4DR6I 4GKKE 1PIEA 5LMNE 4X66I 1STUA 4URLA 2ZBKB 2YT4A 2NUFA 2B3TB 1IBLE 4LFCE 4LFBE 4NXNE 1N0VC 4DR3E 4X64E 3ZKBA 4WPYA 3HXLA 3Q6NA 2HK2A 3AUZA 4JV5E 4WUDA 2LRSA 3PRYA 3J7AG 2CG9A 4HACA 4KHPI 2UUCI 4DV5I 4GEQB 4P52A 1QZRA 5LMNI 1DQ3A 1Z0EA 3JAMQ 1H7UA 2HFUA 2KONA 1IBLI 4LFBI 2E5LI 4NXNI 1Y6ZA 5T6JA 4DR3I 2LMZA 1VISA 4JV5I 2DIXA 2L8TA 4IZKA 4GKJI 2JVAA 1KIJA 3HQ1A 1Z0VA 4UT4A 2Q2EB 4X62I 4M30A 4DR5E 4FWHA 3P06A 4B3RE 3F0NA 3Q6MA 3J7Yp 4DUZE 4PRVA 1O0WA 2Z5CA 2AJ4A 1USVA 2X36A 1Y4UA 1Y4SA 2V89A 2V34A 3QT7A 2GQ0A 1NHHA 4USKA 4XTJA 4DR5I 4B3RI 4DUZI 2UUAI 5AE2A 2L3JA 2JWOA 4R03A 2MDRA 3ZKDA 1NZ0A 4NXME 3KWRA 3K85A 1IBMI 1YZ9A 2DMYA 4DXLA 1RQ0A 3V2UC 1J5EI 1T4NA 3RMPA 2XEXA 2WZOA 1H7SA 4PU9A 3ZOQB 2ZM6E 1RR9A 2ODRC 4BS9A 1K47A 1ZM4A 4NXMI 4P7AA 3T1HE 4ED4A 1N36E 2V2ZA 2IOQA 2Z5BA 4LF5E 3V5RA 2OI2A 2J7KA 2JOXA 2EZ6A 4JI5E 4I8OA 1S4EA 1N33E 2Z5EA 4BBYA 4F9AB 2O1VA 2VQFI 1WHQA 2LUPB 4IZJA 2KOUA 2RSMA 3WU6A 4JI7E 5AE1A 1J26A 4JI5I 4B3TE 4HACB 2M4IA 4HY1A 2DB2A 1I94E 1N33I 1IBKE 2R42A 2L2NA 4F9CB 4JI8E 5GMDA 5IT9C 4ZVIA 4BC7A 4DR6E 4K0KE 5LL6R 4DR4E 1ZM3A 4X66E 3DJWA 4TUIA 4JI7I 2B9DA 2JR1A 4X8WA 1HNWI 3LNUA 2KHXA 2NPFA 2HKJA 4MYTA 4WFTA 4B3TI 4JI3E 1IBKI 4MYUA 4KHPE 1NHIA 4JI8I 4DUYE 4K0KI 4DR4I 1FI4A 2Z5CB 3H09A 2E5LE 4JI2E 5A2QC 4HYMA 4DV6E 1KKHA 4JI3I 2V2VA 2F4VE 5LMUI 4DV3E 1PVGA 4HXZA 3C4BA 1H73A 4PRXA 4GKJE 4KZSA 4DUYI 4X62E 3J81C 3IWCA 4DV4E 1D6TA 3VK6A 2LUQA 4JI2I 2HK3A 5IWAI 3ADIA 2IHR1 2G7HA 4DV6I 1DI2A 2A2DA 3HPZA 3ZZUA 3ADGA 2F4VI 1XNQI 1UEKA 4DV3I 4M0VA 3B82A 4EMDA 4DV4I 4R8OA 2HKEA 2UXBE 2UUAE 1YYOA 3PYDA 1HNXE 5ADZA 4P7DA 3LMLA 2ZITA 4JI6I 1IBME 1Z0CA 4L8NA 4JI0E 1FNMA 1J5EE 1ZM2A 2JOBA 1FWKA 2PNLA 2M1SA 2O1UA 1PKPA 2L92A 2PNMA 4M1KA 2UXBI 3LTOA 2RS6A 2MC6A 1HNXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1R A;  4JI0 I;  1Z0T A;  4B3S E;  4DPU A;  2DEI A;  1XMQ E;  3LPS A;  2B7V A;  4RPF A;  4Z7Y A;  4YY3 E;  4DU8 A;  2VQF E;  1Z59 A;  4OX9 I;  5FLX Q;  3ADJ A;  1EA6 A;  5FLX C;  5CFF E;  4B3S I;  1N32 E;  1XMQ I;  1QU6 A;  4JYA E;  1XHK A;  1B62 A;  2GS8 A;  3ZZ0 A;  4USM A;  5L3J A;  3WU3 A;  4YY3 I;  4LF6 E;  3P1X A;  3B8H A;  4WUC A;  2RTX A;  1X49 A;  1ZXN A;  3GON A;  1N32 I;  2NUE A;  4DR7 E;  3HUL A;  1A6F A;  1HNW E;  4DR2 I;  1MU5 A;  4JYA I;  1Z5B A;  4DPW A;  4DU7 A;  1EKZ A;  4LF6 I;  5IT9 Q;  4YHH E;  1WHN A;  2LTS A;  1ZBT A;  3B78 A;  1U2R A;  1XMO I;  4DR7 I;  1HR0 E;  2UXD E;  2V2Q A;  2N3G A;  3T1Y E;  2LTR A;  1H72 C;  1EI1 A;  5LMU E;  1KTV A;  1B63 A;  4YHH I;  1Z5A A;  3ZM7 A;  1ZM9 A;  2VF3 A;  3ADL A;  3C4T A;  5A2Q Q;  3ZZT A;  1HR0 I;  2UXD I;  5IWA E;  3WU5 A;  4UTG A;  3T1Y I;  4LF7 E;  1XNQ E;  3J81 Q;  1N0U A;  1WUU A;  4WUB A;  4DV1 E;  5GME A;  1N34 E;  1UIL A;  4DV2 I;  1FWL A;  1ZXM A;  3VYX A;  2HHH I;  2WW4 A;  4LF9 I;  4LFA I;  1HNZ I;  3H4L A;  2N3H A;  4JI6 E;  1FJG I;  4LF7 I;  3D4J A;  2L3C A;  1RC7 A;  4DV1 I;  2UU9 E;  1N34 I;  3OTO E;  1XNR E;  2UUB E;  4GKK I;  3PYF A;  2VQE E;  1ELO A;  1Z0B A;  4B3M E;  4LFC I;  3JAM C;  4FWG A;  4X64 I;  2LJH A;  3M6A A;  1MX0 A;  1Z0W A;  4DPY A;  2UU9 I;  3OTO I;  2BV3 A;  1T4O A;  4JI1 E;  2BM1 A;  4M2Z A;  1XNR I;  2UUB I;  1BKN A;  2HFS A;  1T4L B;  2X7I A;  2VQE I;  4OX9 E;  4B3M I;  2L33 A;  2NA2 A;  3CWV A;  2CPN A;  4OOG C;  4KQV A;  1Z0G A;  4Z7C A;  2CZ9 A;  2NUG A;  4JI1 I;  1Z5C A;  4FW9 A;  3Q1Q A;  2RS7 A;  3PYE A;  2UXC E;  2V8P A;  2LBS B;  3QT6 A;  1X48 A;  4DR2 E;  3PYG A;  3J7A M;  4LF8 E;  3WU4 A;  5BR8 E;  4JI4 E;  4LF4 E;  1YYW A;  4DR1 E;  2UXC I;  2DEJ A;  4X65 E;  2R3V A;  1NHJ A;  1GQE A;  1H74 A;  1XMO E;  4JG4 A;  4WYQ B;  3K1J A;  3QT8 A;  4LF8 I;  4FWD A;  5BR8 I;  2ZM6 I;  4JI4 I;  4LF4 I;  1S16 A;  4DR1 I;  2L2M A;  4X65 I;  3HTX A;  4AQY E;  1YYK A;  3T1H I;  1X47 A;  1N36 I;  2BM0 A;  4DV7 E;  2EFG A;  2B7T A;  2L2K B;  4LF5 I;  2JY9 A;  1OJ4 A;  3QT5 A;  3K17 A;  4R1F A;  1KVK A;  3VYY A;  1FKA E;  1MG7 A;  4FN5 A;  3LLH A;  4DV0 E;  4DPX A;  1RRE A;  4DV2 E;  4AQY I;  3J80 Q;  2HHH E;  4I3H A;  4DKK A;  3J80 C;  1DAR A;  4DV7 I;  4LF9 E;  2LJP A;  4LFA E;  1HNZ E;  1FJG E;  1UHZ A;  2A2C A;  4DV0 I;  4DPT A;  1I94 I;  2UUC E;  4DV5 E;  4DR6 I;  4GKK E;  1PIE A;  5LMN E;  4X66 I;  1STU A;  4URL A;  2ZBK B;  2YT4 A;  2NUF A;  2B3T B;  1IBL E;  4LFC E;  4LFB E;  4NXN E;  1N0V C;  4DR3 E;  4X64 E;  3ZKB A;  2HK2 A;  4JV5 E;  4WUD A;  2LRS A;  4HAC A;  3J7A G;  4KHP I;  2UUC I;  4DV5 I;  4P52 A;  1QZR A;  5LMN I;  1Z0E A;  3JAM Q;  1H7U A;  2HFU A;  1IBL I;  4LFB I;  2E5L I;  4NXN I;  4DR3 I;  1VIS A;  4JV5 I;  2DIX A;  4GKJ I;  2JVA A;  1KIJ A;  1Z0V A;  4UT4 A;  2Q2E B;  4X62 I;  4M30 A;  4DR5 E;  4FWH A;  4B3R E;  3F0N A;  3J7Y p;  4DUZ E;  4PRV A;  1O0W A;  2AJ4 A;  2X36 A;  2V34 A;  3QT7 A;  1NHH A;  4USK A;  4XTJ A;  4DR5 I;  4B3R I;  4DUZ I;  2UUA I;  2L3J A;  2MDR A;  3ZKD A;  1NZ0 A;  4NXM E;  1IBM I;  1YZ9 A;  2DMY A;  4DXL A;  1RQ0 A;  3V2U C;  1J5E I;  1T4N A;  2XEX A;  1H7S A;  4PU9 A;  2ZM6 E;  1RR9 A;  1K47 A;  1ZM4 A;  4NXM I;  4P7A A;  3T1H E;  4ED4 A;  1N36 E;  2V2Z A;  4LF5 E;  3V5R A;  2OI2 A;  2J7K A;  2EZ6 A;  4JI5 E;  1S4E A;  1N33 E;  2VQF I;  1WHQ A;  2LUP B;  2RSM A;  3WU6 A;  4JI7 E;  1J26 A;  4JI5 I;  4B3T E;  4HAC B;  4HY1 A;  2DB2 A;  1I94 E;  1N33 I;  1IBK E;  2R42 A;  2L2N A;  4JI8 E;  5GMD A;  5IT9 C;  4ZVI A;  4DR6 E;  4K0K E;  5LL6 R;  4DR4 E;  1ZM3 A;  4X66 E;  4JI7 I;  4X8W A;  1HNW I;  3LNU A;  2KHX A;  2NPF A;  2HKJ A;  4MYT A;  4WFT A;  4B3T I;  4JI3 E;  1IBK I;  4MYU A;  4KHP E;  1NHI A;  4JI8 I;  4DUY E;  4K0K I;  4DR4 I;  1FI4 A;  2E5L E;  4JI2 E;  4HYM A;  5A2Q C;  4DV6 E;  1KKH A;  4JI3 I;  2V2V A;  2F4V E;  5LMU I;  4DV3 E;  1PVG A;  4HXZ A;  3C4B A;  1H73 A;  4PRX A;  4GKJ E;  4DUY I;  4X62 E;  3J81 C;  4DV4 E;  1D6T A;  2LUQ A;  4JI2 I;  2HK3 A;  5IWA I;  3ADI A;  2IHR 1;  4DV6 I;  1DI2 A;  2A2D A;  3ZZU A;  3ADG A;  2F4V I;  1XNQ I;  1UEK A;  4DV3 I;  3B82 A;  4EMD A;  4DV4 I;  2HKE A;  2UXB E;  2UUA E;  1YYO A;  3PYD A;  1HNX E;  2ZIT A;  4JI6 I;  1IBM E;  1Z0C A;  4JI0 E;  1FNM A;  1J5E E;  1ZM2 A;  1FWK A;  1PKP A;  4M1K A;  2UXB I;  3LTO A;  2RS6 A;  1HNX I; 
#chains in the Genus database with same CATH topology
 2EPP A;  4ZYH A;  2EPK X;  2E1R A;  1WJP A;  4JI0 I;  1Z0T A;  1USU A;  4B3S E;  1YFH A;  2O1T A;  2FV4 B;  4AIM A;  4DPU A;  5AE3 A;  2DEI A;  1XMQ E;  2PO1 B;  2EWL A;  3LPS A;  1WXR A;  2E1M A;  2B7V A;  4RPF A;  5F3W A;  4Z7Y A;  4YY3 E;  1R6L A;  4DU8 A;  1Y5Y A;  3GLL A;  2VQF E;  2O3Z A;  1Z59 A;  4OX9 I;  5KL6 A;  5FLX Q;  1T39 A;  3ADJ A;  1EA6 A;  5FLX C;  5CFF E;  4B3S I;  3KRN A;  1N32 E;  2C37 A;  2EM0 A;  5DRR A;  2ODR D;  1XMQ I;  1QU6 A;  5AC4 A;  2H36 X;  2YTG A;  4JYA E;  1XHK A;  1B62 A;  2DSY A;  2GS8 A;  2EJ4 A;  3ZZ0 A;  4USM A;  5L3J A;  5JEA D;  3WU3 A;  4YY3 I;  1RMD A;  2PO2 A;  2VF1 A;  4F2J C;  4LF6 E;  3P1X A;  3B8H A;  5JEA B;  1UN6 B;  4O4K A;  2RTX A;  2JE6 B;  4WUC A;  1X49 A;  2IER A;  1ZXN A;  4F9B B;  4MU3 A;  4BA2 B;  3GON A;  2WCC 3;  1N32 I;  2NUE A;  4LCF A;  4DR7 E;  2L6M A;  3HUL A;  1IQS A;  1A6F A;  2E72 A;  1HNW E;  4DR2 I;  1MU5 A;  4OO1 C;  1YPN A;  2EOY A;  4JYA I;  1Z5B A;  2NN6 F;  1YUI A;  4DPW A;  4DU7 A;  2O1W A;  2NAB A;  1EKZ A;  1KYQ A;  4OKG A;  4LF6 I;  5IT9 Q;  3IWB A;  2EPA A;  4YHH E;  4R2Q A;  4MU0 A;  3AV0 A;  2WBU A;  4OO1 D;  1GZ6 A;  1N3G A;  1WHN A;  4WSP A;  4J8Z A;  1B69 A;  2LTS A;  4OO1 B;  1ZBT A;  1F2I G;  5A6A A;  1U2R A;  3B78 A;  1L4S A;  2V83 A;  1XMO I;  4DR7 I;  4LPF A;  2EMB A;  1A1F A;  1HK7 A;  1HR0 E;  2UXD E;  2GLI A;  2LE2 A;  2V2Q A;  2N3G A;  5DRO A;  3T1Y E;  2LTR A;  1H72 C;  2YRK A;  3NZK A;  4IZK B;  1PDA A;  2EM6 A;  1EI1 A;  5LMU E;  2MC5 A;  4R2S A;  1KTV A;  1B63 A;  1P42 A;  4YHH I;  3IWD A;  5FWK A;  1Z5A A;  3MHH C;  4MQY A;  3ZM7 A;  1ZM9 A;  4BA1 B;  2CSH A;  3BID A;  2D9H A;  3P3C A;  3PS3 A;  2VF3 A;  4GQU A;  4O5G A;  3ADL A;  3C4T A;  5A2Q Q;  1P47 A;  3ZZT A;  1HR0 I;  2UXD I;  2Q8U A;  2JPA A;  5IWA E;  3WU5 A;  4UTG A;  3T1Y I;  4LF7 E;  1XNQ E;  1MGT A;  3EPK A;  4L5N C;  2BBG A;  1A1I A;  3J81 Q;  4MLV A;  1N0U A;  2EQ3 A;  1WUU A;  4DV1 E;  4WUB A;  2EMF A;  5GME A;  1N34 E;  2I9I A;  4IS1 C;  1UIL A;  3JU0 A;  4DV2 I;  1FWL A;  1ZXM A;  3VYX A;  2WP8 A;  2WW4 A;  2HHH I;  3HPS A;  2V85 A;  4QNJ A;  4R2A A;  4LF9 I;  1KJK A;  4LFA I;  1HNZ I;  3H4L A;  2N3H A;  4JI6 E;  1FJG I;  2NN6 A;  4LF7 I;  3D4J A;  3THO B;  4F54 A;  4IFD F;  3M85 D;  2L3C A;  1RC7 A;  4DV1 I;  4O43 A;  3CDJ A;  4BC9 A;  2UU9 E;  3OTO E;  2YTF A;  2VRD A;  4MU4 A;  1N34 I;  4HTG A;  3K6Q A;  1XNR E;  2EPN A;  2UUB E;  4AM3 A;  4GKK I;  3PYF A;  2MKN A;  2VQE E;  1ELO A;  1Z0B A;  2M7Q A;  4B3M E;  4WX9 A;  2C37 B;  4LFC I;  3JAM C;  3F6G A;  1BBG A;  2DLQ A;  2Z5B B;  3P3E A;  3F6H A;  4FWG A;  2EL5 A;  4X64 I;  2LJH A;  4TUG A;  3M6A A;  2EPU A;  1BB8 A;  1MX0 A;  1Z0W A;  4DPY A;  2UU9 I;  1SR9 A;  3OTO I;  2NN6 E;  1UDN A;  2PO2 B;  2BV3 A;  1T4O A;  4WXC A;  5AAS A;  2J65 A;  4JI1 E;  2BM1 A;  4M2Z A;  2CGE A;  4ISA A;  2EOQ A;  4P78 A;  1X6H A;  1BKN A;  4IZJ D;  2HFS A;  1T4L B;  2UUB I;  2ELY A;  2PNZ A;  2X7I A;  4IZJ B;  4BCA A;  3M85 G;  2VQE I;  4OX9 E;  4B3M I;  1SFE A;  5KL5 A;  2L33 A;  2NA2 A;  3DF6 A;  2EQ1 A;  2YTJ A;  1TF3 A;  3CWV A;  2CPN A;  2YWQ A;  4OOG C;  5A6J A;  1A1L A;  2IOP A;  4BHB A;  3C6K A;  4KQV A;  1Z0G A;  1WRJ A;  2EMZ A;  4N3O A;  1AH5 A;  2V87 A;  4Z7C A;  3OML A;  2CZ9 A;  2R76 A;  2V8Q B;  5IV8 B;  2NUG A;  1UBD C;  4JI1 I;  4DMI A;  2LVH A;  1Z5C A;  2EM4 A;  1ZU1 A;  1G2D C;  4IS9 A;  4FW9 A;  3Q1Q A;  2RS7 A;  5ELW A;  3PYE A;  2EMC A;  1ZBQ A;  2EN6 A;  2YRH A;  2UXC E;  2C38 A;  1OYR A;  5GMD A;  2BA0 G;  2V8P A;  2LBS B;  4NZV A;  3QT6 A;  2CVE A;  5DNL A;  4IFD A;  1X48 A;  2C39 A;  4DR2 E;  1Y60 A;  2BA1 G;  1LLM C;  2WNR A;  2EML A;  3HJC A;  3PYG A;  2GPI A;  3J7A M;  3P3G A;  2M9A A;  4LF8 E;  2EPX A;  3UHM A;  3MHS C;  5DNY A;  2EM7 A;  3WU4 A;  5BR8 E;  4JI4 E;  4R2D A;  4LF4 E;  2EMK A;  1YYW A;  5KL2 A;  4DR1 E;  2EMX A;  3CDI A;  2UXC I;  2YTE A;  2DEJ A;  2EM5 A;  2DGC A;  4X65 E;  2EPO A;  2R3V A;  1NHJ A;  1GQE A;  1H74 A;  2WBS A;  4BHC A;  1XMO E;  3FIG A;  4FW3 A;  3BBG A;  2YPN A;  4JG4 A;  4MDT A;  4FW5 A;  2VE7 C;  4WYQ B;  2LJU A;  3K1J A;  3QT8 A;  2NN6 C;  1Z1B A;  4FWD A;  4LF8 I;  2V88 A;  4FW6 A;  4IFD E;  2V86 A;  4LTY A;  5BR8 I;  1RHY A;  2ZM6 I;  4JI4 I;  4LF4 I;  1S16 A;  4DR1 I;  2MKD A;  3LTO A;  2EP3 A;  2L2M A;  4O24 A;  4X65 I;  5C0X F;  3HTX A;  4Q28 A;  2K4V A;  4AQY E;  1YYK A;  2NN6 D;  3U1K A;  3T1H I;  1X47 A;  1N36 I;  2BM0 A;  2EM3 A;  3JTZ A;  4FW4 A;  4DV7 E;  1TN9 A;  2EFG A;  2JEB B;  3DD6 A;  2B7T A;  2L2K B;  4LU9 A;  4QNK A;  2JY9 A;  4LF5 I;  3C6M A;  5A69 A;  1OJ4 A;  2YTP A;  3K17 A;  3QT5 A;  2PO1 A;  4R1F A;  4IJD A;  2I13 A;  4ZYE A;  1KVK A;  4RHB B;  3VYY A;  1FKA E;  1MG7 A;  2RSI A;  4ZYG A;  4FN5 A;  3LLH A;  2FTX B;  4DV0 E;  2LT7 A;  4DPX A;  5K36 F;  1RRE A;  3PS1 A;  2EMW A;  4DV2 E;  4AQY I;  3J80 Q;  2HHH E;  2JEA A;  2YZT A;  4HEI A;  3L7Z A;  1X6E A;  4I3H A;  4DKK A;  3J80 C;  1DAR A;  1PJS A;  2BB8 A;  2ELZ A;  2F8B A;  1AAY A;  4LF9 E;  2GO3 A;  4LFA E;  2EPM X;  4BMJ A;  1HNZ E;  1FJG E;  2LJP A;  4WSG A;  4R2R A;  4MU1 A;  1UHZ A;  2A2C A;  1A1J A;  2IES A;  2EN8 A;  2GHF A;  2BR2 B;  4DV7 I;  2FGG A;  4LCH A;  4DPT A;  3EPL A;  4DV0 I;  1I94 I;  2UUC E;  2PNZ B;  1VI7 A;  2EN1 A;  4DV5 E;  5JEA A;  3MSW A;  4DR6 I;  4GKK E;  3EPH A;  1PIE A;  5LMN E;  4X66 I;  1STU A;  2EOX A;  2EMI A;  1X3C A;  2ZBK B;  4URL A;  2EN7 A;  2YTI A;  2YT4 A;  2NUF A;  2B3T B;  1IBL E;  4LFC E;  4LFB E;  2K7I A;  4NXN E;  1N0V C;  4DR3 E;  4X64 E;  3ZKB A;  4WPY A;  1EH7 A;  2EL6 A;  3HXL A;  1YHC A;  2HK2 A;  3AUZ A;  3Q6N A;  4JV5 E;  4IFD C;  4WUD A;  2LRS A;  3PRY A;  3J7A G;  2CG9 A;  4HAC A;  4KHP I;  1DGC A;  5C0X A;  4F6N A;  2UUC I;  4DV5 I;  4GEQ B;  4P52 A;  4J3D A;  5DNX A;  1QZR A;  2C38 B;  5LMN I;  1DQ3 A;  1Z0E A;  5EKW A;  1H7U A;  3JAM Q;  4IFD D;  4N4R B;  1ZR9 A;  2HFU A;  2KON A;  1IBL I;  2EOE A;  4OZE A;  2E5L I;  4NXN I;  1Y6Z A;  4IFD B;  5T6J A;  4LFB I;  5JEA E;  4DR3 I;  2LCE A;  2LMZ A;  4UT4 A;  2EQ0 A;  1VIS A;  2WNR B;  2EMY A;  2BA0 D;  4JV5 I;  2DIX A;  2L8T A;  4IZK A;  2RQL A;  4NHR A;  1X5W A;  5K36 A;  4GKJ I;  2JVA A;  1KIJ A;  2YRM A;  3HQ1 A;  5LLQ A;  1Z0V A;  1PJQ A;  2EOI A;  2BA1 D;  2Q2E B;  4X62 I;  5A6B A;  1A1K A;  4M30 A;  4DR5 E;  4FWH A;  5EL9 A;  4AID A;  3M99 B;  3P06 A;  4B3R E;  3F0N A;  3Q6M A;  3J7Y p;  3EPJ A;  4DUZ E;  1IMU A;  4PRV A;  1NCS A;  1O0W A;  2Z5C A;  4U3D A;  2N8X A;  5C0X E;  4R2P A;  2AJ4 A;  1USV A;  2X36 A;  3L00 A;  3B4T A;  1Y4U A;  2A25 A;  1NEI A;  2EM2 A;  1Y4S A;  2V89 A;  2V34 A;  3QT7 A;  4OO1 E;  4NBQ A;  3PS2 A;  4X9J A;  2GQ0 A;  1NHH A;  1A1H A;  1YUJ A;  4USK A;  4XTJ A;  2ENH A;  1E3H A;  1EH8 A;  4DR5 I;  3HKM A;  1XNR I;  2ENA A;  4R2C A;  4B3R I;  2J7J A;  4DUZ I;  2AE8 A;  2UUA I;  5AE2 A;  2L3J A;  2EOM A;  2JWO A;  4R03 A;  5K36 E;  2MDR A;  3ZKD A;  1NZ0 A;  4NXM E;  3KWR A;  3K85 A;  1IBM I;  1YZ9 A;  2EOJ A;  2YTO A;  2DMY A;  2YSP A;  4DXL A;  1RQ0 A;  3V2U C;  1UDQ A;  1J5E I;  1T4N A;  3RMP A;  2EMG A;  2XEX A;  2WZO A;  1H7S A;  4PU9 A;  3ZOQ B;  1X6F A;  1MEY C;  4RH8 A;  2ZM6 E;  1RR9 A;  1YH8 A;  2EM9 A;  2ODR C;  2JEA B;  4BS9 A;  4R2E A;  1GTK A;  1K47 A;  1ZM4 A;  3L7Z B;  4NXM I;  5JEA F;  4P7A A;  3T1H E;  4ED4 A;  5JEA C;  1N36 E;  1EH6 A;  2RPC A;  2V2Z A;  2IOQ A;  2PO0 A;  2Z5B A;  5AC5 A;  4LF5 E;  3V5R A;  2OI2 A;  2J7K A;  2JOX A;  1IQO A;  5KL4 A;  2EZ6 A;  2WBT A;  5IXM B;  4JI5 E;  2PRT A;  4I8O A;  1JK2 A;  4LCG A;  2HC5 A;  2WP8 B;  1S4E A;  1N33 E;  1OYS A;  4BBY A;  4F9A B;  2O1V A;  2MDG A;  5KL7 A;  2HGH A;  2Z5E A;  2VQF I;  1WHQ A;  2LUP B;  5C0X C;  4IZJ A;  3U1Y A;  2KOU A;  2RSM A;  2NN6 B;  3WU6 A;  4JI7 E;  4OO1 F;  5AE1 A;  2ADR A;  4ZYD A;  1J26 A;  1UDO A;  5TSE A;  5C0X D;  4JI5 I;  2DRP A;  4B3T E;  3TQM A;  4HAC B;  2M4I A;  4HY1 A;  5C0X B;  2DB2 A;  4MLQ A;  1I94 E;  1N33 I;  1TF6 A;  1IBK E;  1UDS A;  3GME A;  3KZY A;  4LOM A;  2R42 A;  5K36 C;  2L2N A;  4F9C B;  4JI8 E;  1OYP A;  5IT9 C;  4ZVI A;  2EN3 A;  2EPC A;  4BC7 A;  4DR6 E;  5LL6 R;  4DR4 E;  4K0K E;  1ZM3 A;  4X66 E;  2JT2 A;  3DJW A;  4TUI A;  4JI7 I;  3M7N D;  2B9D A;  2JR1 A;  4X8W A;  1HNW I;  1ZAA C;  2YTN A;  3LNU A;  2KHX A;  2NPF A;  2HKJ A;  2YTD A;  4MYT A;  4WFT A;  5K36 D;  4B3T I;  4JI3 E;  2YU5 A;  5K36 B;  3UK3 C;  1T38 A;  5A6B D;  1QNT A;  1IBK I;  4MYU A;  4Q35 B;  4KHP E;  2JP9 A;  3ECR A;  1NHI A;  5DRP A;  2EN2 A;  4FK5 C;  4DUY E;  4JI8 I;  3P76 A;  1JK1 A;  2JE6 A;  4K0K I;  4DR4 I;  1FI4 A;  3THN A;  2ENC A;  2Z5C B;  4DV6 I;  2EMA A;  2EOS A;  3H09 A;  4BA2 A;  2EL4 A;  2E5L E;  4JI2 E;  5A2Q C;  4HYM A;  2HJJ A;  2EMH A;  4DV6 E;  1R6M A;  1KKH A;  2F1D A;  2V2V A;  2F4V E;  4JI3 I;  5LMU I;  3BF2 A;  2EN4 A;  4DV3 E;  2EE8 A;  3VHT B;  1PVG A;  4HXZ A;  3C4B A;  1H73 A;  4PRX A;  4GKJ E;  2EOO A;  3M7N G;  2EOR A;  2LV2 A;  4KZS A;  4DUY I;  4X62 E;  2EOZ A;  3J81 C;  3IWC A;  2DLK A;  2JYA A;  4DV4 E;  2EPL X;  3BGH A;  1D6T A;  3VK6 A;  2YTQ A;  2VES A;  4OO1 A;  3GCM A;  2EPR A;  2LUQ A;  4JI2 I;  2R1F A;  1A1G A;  2HK3 A;  5IWA I;  3ADI A;  2CT1 A;  1BBO A;  2C39 B;  2IHR 1;  2G7H A;  5A6K A;  4F6M A;  2DMI A;  3HPZ A;  1DI2 A;  2A2D A;  3ADG A;  2JEB A;  2JXP A;  1G2F C;  1UEK A;  3ZZU A;  2EOH A;  1XNQ I;  2F4V I;  3EQ1 A;  2EPZ A;  1YSA C;  4DV3 I;  4M0V A;  1E3P A;  3B82 A;  4EMD A;  4DV4 I;  4R8O A;  2CTD A;  4M9V C;  2HKE A;  2UXB E;  4BA1 A;  2UUA E;  3H1C A;  4FW7 A;  1YYO A;  3PYD A;  1HNX E;  1XXE A;  5ADZ A;  4P7D A;  2GO4 A;  2EOF A;  3LML A;  3QG5 C;  2ZIT A;  4U3B A;  1IBM E;  1Z0C A;  4JI6 I;  5KL3 A;  4GZN C;  1PJT A;  4WXD A;  2PO0 B;  4L8N A;  4JI0 E;  2YSO A;  1FNM A;  1J5E E;  1ZM2 A;  2JOB A;  1FWK A;  2PNL A;  2M1S A;  2O1U A;  1PKP A;  2L92 A;  2PNM A;  4M1K A;  2BR2 A;  2LO3 A;  4KWY A;  3KZZ A;  2YU8 A;  5DRQ A;  2EM8 A;  2RS6 A;  2UXB I;  2MC6 A;  1HNX I; 
#chains in the Genus database with same CATH homology
 2E1R A;  4JI0 I;  1Z0T A;  1USU A;  4B3S E;  2O1T A;  2FV4 B;  4DPU A;  5AE3 A;  2DEI A;  1XMQ E;  2EWL A;  3LPS A;  1WXR A;  2E1M A;  2B7V A;  4RPF A;  5F3W A;  4Z7Y A;  4YY3 E;  4DU8 A;  2VQF E;  1Z59 A;  4OX9 I;  5FLX Q;  3ADJ A;  1EA6 A;  5FLX C;  5CFF E;  4B3S I;  1N32 E;  2ODR D;  1XMQ I;  1QU6 A;  2H36 X;  4JYA E;  1XHK A;  1B62 A;  2DSY A;  2GS8 A;  3ZZ0 A;  4USM A;  5L3J A;  3WU3 A;  4YY3 I;  2VF1 A;  4LF6 E;  3P1X A;  3B8H A;  4WUC A;  2RTX A;  1X49 A;  1ZXN A;  4F9B B;  3GON A;  1N32 I;  2NUE A;  4DR7 E;  2L6M A;  3HUL A;  1A6F A;  1HNW E;  4DR2 I;  1MU5 A;  4JYA I;  1Z5B A;  4DPW A;  4DU7 A;  2O1W A;  1EKZ A;  4LF6 I;  5IT9 Q;  3IWB A;  4YHH E;  3AV0 A;  1GZ6 A;  1WHN A;  4WSP A;  4J8Z A;  2LTS A;  1ZBT A;  3B78 A;  1U2R A;  2V83 A;  1XMO I;  4DR7 I;  1HK7 A;  1HR0 E;  2UXD E;  2LE2 A;  2V2Q A;  2N3G A;  3T1Y E;  2LTR A;  1H72 C;  4IZK B;  1EI1 A;  5LMU E;  2MC5 A;  1KTV A;  1B63 A;  4YHH I;  3IWD A;  5FWK A;  1Z5A A;  3ZM7 A;  1ZM9 A;  2VF3 A;  3ADL A;  3C4T A;  5A2Q Q;  3ZZT A;  1HR0 I;  2UXD I;  5IWA E;  3WU5 A;  4UTG A;  3T1Y I;  4LF7 E;  1XNQ E;  4L5N C;  3J81 Q;  1N0U A;  1WUU A;  4WUB A;  4DV1 E;  5GME A;  1N34 E;  1UIL A;  3JU0 A;  4DV2 I;  1FWL A;  1ZXM A;  3VYX A;  2HHH I;  2WW4 A;  3HPS A;  2V85 A;  4LF9 I;  4LFA I;  1HNZ I;  3H4L A;  2N3H A;  4JI6 E;  1FJG I;  4LF7 I;  3D4J A;  4F54 A;  2L3C A;  1RC7 A;  4DV1 I;  4BC9 A;  2UU9 E;  3OTO E;  1N34 I;  3K6Q A;  1XNR E;  2UUB E;  4GKK I;  3PYF A;  2VQE E;  1ELO A;  1Z0B A;  2M7Q A;  4B3M E;  4LFC I;  3JAM C;  3F6G A;  2Z5B B;  3F6H A;  4FWG A;  4X64 I;  2LJH A;  4TUG A;  3M6A A;  1MX0 A;  1Z0W A;  4DPY A;  2UU9 I;  1SR9 A;  3OTO I;  2BV3 A;  1T4O A;  5AAS A;  4JI1 E;  2BM1 A;  4M2Z A;  2CGE A;  2UUB I;  4IZJ D;  4P78 A;  1BKN A;  1XNR I;  2HFS A;  1T4L B;  2X7I A;  4IZJ B;  4BCA A;  2VQE I;  4OX9 E;  4B3M I;  2L33 A;  2NA2 A;  3DF6 A;  3CWV A;  2CPN A;  4OOG C;  2IOP A;  4KQV A;  1Z0G A;  4N3O A;  2V87 A;  4Z7C A;  3OML A;  2CZ9 A;  2V8Q B;  2NUG A;  4JI1 I;  4DMI A;  1Z5C A;  4FW9 A;  3Q1Q A;  2RS7 A;  3PYE A;  1ZBQ A;  2UXC E;  2V8P A;  2LBS B;  3QT6 A;  1X48 A;  4DR2 E;  3HJC A;  3PYG A;  3J7A M;  4LF8 E;  5DNY A;  3WU4 A;  5BR8 E;  4JI4 E;  4LF4 E;  1YYW A;  4DR1 E;  2UXC I;  2DEJ A;  4X65 E;  2R3V A;  1NHJ A;  1GQE A;  1H74 A;  1XMO E;  3FIG A;  4JG4 A;  2VE7 C;  4WYQ B;  3K1J A;  3QT8 A;  4LF8 I;  4FWD A;  2V88 A;  2V86 A;  4LTY A;  5BR8 I;  2ZM6 I;  4JI4 I;  4LF4 I;  1S16 A;  4DR1 I;  2L2M A;  4X65 I;  3HTX A;  4Q28 A;  2K4V A;  4AQY E;  1YYK A;  3T1H I;  1X47 A;  1N36 I;  2BM0 A;  3JTZ A;  4DV7 E;  2EFG A;  2B7T A;  2L2K B;  4LU9 A;  4LF5 I;  2JY9 A;  1OJ4 A;  3QT5 A;  3K17 A;  4R1F A;  1KVK A;  3VYY A;  1FKA E;  1MG7 A;  4FN5 A;  3LLH A;  2FTX B;  4DV0 E;  4DPX A;  1RRE A;  4DV2 E;  4AQY I;  3J80 Q;  2HHH E;  2YZT A;  4I3H A;  4DKK A;  3J80 C;  1DAR A;  2F8B A;  4DV7 I;  4LF9 E;  2LJP A;  4LFA E;  4BMJ A;  1HNZ E;  1FJG E;  1UHZ A;  2A2C A;  2FGG A;  4DV0 I;  4DPT A;  1I94 I;  2UUC E;  4DV5 E;  3MSW A;  4DR6 I;  4GKK E;  1PIE A;  5LMN E;  4X66 I;  1STU A;  4URL A;  2ZBK B;  2YT4 A;  2NUF A;  2B3T B;  1IBL E;  4LFC E;  4LFB E;  4NXN E;  1N0V C;  4DR3 E;  4X64 E;  3ZKB A;  4WPY A;  3HXL A;  3Q6N A;  2HK2 A;  3AUZ A;  4JV5 E;  4WUD A;  2LRS A;  3PRY A;  3J7A G;  2CG9 A;  4HAC A;  4KHP I;  2UUC I;  4DV5 I;  4GEQ B;  4P52 A;  1QZR A;  5LMN I;  1DQ3 A;  1Z0E A;  3JAM Q;  1H7U A;  2HFU A;  2KON A;  1IBL I;  4LFB I;  2E5L I;  4NXN I;  1Y6Z A;  5T6J A;  4DR3 I;  2LMZ A;  1VIS A;  4JV5 I;  2DIX A;  2L8T A;  4IZK A;  4GKJ I;  2JVA A;  1KIJ A;  3HQ1 A;  1Z0V A;  4UT4 A;  2Q2E B;  4X62 I;  4M30 A;  4DR5 E;  4FWH A;  3P06 A;  4B3R E;  3F0N A;  3Q6M A;  3J7Y p;  4DUZ E;  4PRV A;  1O0W A;  2Z5C A;  2AJ4 A;  1USV A;  2X36 A;  1Y4U A;  1Y4S A;  2V89 A;  2V34 A;  3QT7 A;  2GQ0 A;  1NHH A;  4USK A;  4XTJ A;  4DR5 I;  4B3R I;  4DUZ I;  2UUA I;  5AE2 A;  2L3J A;  2JWO A;  4R03 A;  2MDR A;  3ZKD A;  1NZ0 A;  4NXM E;  3KWR A;  3K85 A;  1IBM I;  1YZ9 A;  2DMY A;  4DXL A;  1RQ0 A;  3V2U C;  1J5E I;  1T4N A;  3RMP A;  2XEX A;  2WZO A;  1H7S A;  4PU9 A;  3ZOQ B;  2ZM6 E;  1RR9 A;  2ODR C;  4BS9 A;  1K47 A;  1ZM4 A;  4NXM I;  4P7A A;  3T1H E;  4ED4 A;  1N36 E;  2V2Z A;  2IOQ A;  2Z5B A;  4LF5 E;  3V5R A;  2OI2 A;  2J7K A;  2JOX A;  2EZ6 A;  4JI5 E;  4I8O A;  1S4E A;  1N33 E;  2Z5E A;  4BBY A;  4F9A B;  2O1V A;  2VQF I;  1WHQ A;  2LUP B;  4IZJ A;  2KOU A;  2RSM A;  3WU6 A;  4JI7 E;  5AE1 A;  1J26 A;  4JI5 I;  4B3T E;  4HAC B;  2M4I A;  4HY1 A;  2DB2 A;  1I94 E;  1N33 I;  1IBK E;  2R42 A;  2L2N A;  4F9C B;  4JI8 E;  5GMD A;  5IT9 C;  4ZVI A;  4BC7 A;  4DR6 E;  4K0K E;  5LL6 R;  4DR4 E;  1ZM3 A;  4X66 E;  3DJW A;  4TUI A;  4JI7 I;  2B9D A;  2JR1 A;  4X8W A;  1HNW I;  3LNU A;  2KHX A;  2NPF A;  2HKJ A;  4MYT A;  4WFT A;  4B3T I;  4JI3 E;  1IBK I;  4MYU A;  4KHP E;  1NHI A;  4JI8 I;  4DUY E;  4K0K I;  4DR4 I;  1FI4 A;  2Z5C B;  3H09 A;  2E5L E;  4JI2 E;  5A2Q C;  4HYM A;  4DV6 E;  1KKH A;  4JI3 I;  2V2V A;  2F4V E;  5LMU I;  4DV3 E;  1PVG A;  4HXZ A;  3C4B A;  1H73 A;  4PRX A;  4GKJ E;  4KZS A;  4DUY I;  4X62 E;  3J81 C;  3IWC A;  4DV4 E;  1D6T A;  3VK6 A;  2LUQ A;  4JI2 I;  2HK3 A;  5IWA I;  3ADI A;  2IHR 1;  2G7H A;  4DV6 I;  1DI2 A;  2A2D A;  3HPZ A;  3ZZU A;  3ADG A;  2F4V I;  1XNQ I;  1UEK A;  4DV3 I;  4M0V A;  3B82 A;  4EMD A;  4DV4 I;  4R8O A;  2HKE A;  2UXB E;  2UUA E;  1YYO A;  3PYD A;  1HNX E;  5ADZ A;  4P7D A;  3LML A;  2ZIT A;  4JI6 I;  1IBM E;  1Z0C A;  4L8N A;  4JI0 E;  1FNM A;  1J5E E;  1ZM2 A;  2JOB A;  1FWK A;  2PNL A;  2M1S A;  2O1U A;  1PKP A;  2L92 A;  2PNM A;  4M1K A;  2UXB I;  3LTO A;  2RS6 A;  2MC6 A;  1HNX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...