1HNZE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnzE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzE02
4NXMI 1IBLE 4B3RI 2DB2A 3C4TA 4DKKA 1PIEA 4DUZE 4DR3I 1PKPA 4DV4I 1XMOE 2NUFA 3ZM7A 1N33I 1RQ0A 2B7VA 2VF3A 3B8HA 3V5RA 3J80C 4X66I 2Q2EB 3ZKDA 2AJ4A 3H4LA 4DR1E 1H74A 1KVKA 2RS6A 2HFSA 2UUBI 1OJ4A 1HNXE 4LF8E 4AQYE 2R3VA 1N36I 4JI6E 2J7KA 3JAMQ 4KHPE 4LF4E 1KTVA 2DMYA 3PYDA 4DPWA 2LRSA 4YHHI 2NUEA 1S4EA 2OI2A 4DV2E 2NPFA 4NXNE 2UU9E 4X64I 2KHXA 1Z0GA 2R42A 4B3ME 2UXDE 1PVGA 1ELOA 5FLXQ 2HFUA 3QT5A 1U2RA 3B82A 2RTXA 4GKJI 4LFAI 1ZM3A 2V2QA 1WHNA 4B3SI 4DV0I 1EKZA 3J81Q 4DUZI 1HNWI 4FWDA 2WW4A 4LFCI 1XMOI 4NXME 4B3RE 3B78A 3F0NA 4DR3E 2DEJA 4JI3I 1A6FA 4DV4E 4OOGC 2HKJA 1S16A 3VYXA 3JAMC 2LTSA 4DR1I 1EA6A 2N3HA 1H7UA 3ZZTA 2LUPB 2GS8A 3LLHA 1X47A 1HNXI 1O0WA 1IBMI 1XNQI 5LL6R 4AQYI 1H72C 1N0UA 2NUGA 2VQFI 4LF4I 3J80Q 5FLXC 1YYKA 4USKA 2V34A 4DV2I 3ADGA 5IT9Q 4DV3I 4YHHE 3J81C 4P7AA 1KKHA 4PU9A 4X64E 5GMEA 1N0VC 1XMQI 3D4JA 3T1YI 1QZRA 1HNZI 1DI2A 1UILA 4HY1A 2BM0A 4GKJE 4LFAE 4UTGA 3V2UC 1ZBTA 1UHZA 4B3SE 4DV0E 2A2CA 4PRVA 2LJHA 3LTOA 1HNWE 4DPUA 1T4NA 4FW9A 4LFCE 3ZZ0A 3QT6A 1Z0TA 4WYQB 5LMNI 1BKNA 1Z5CA 4JI3E 5IWAI 2VQEI 1YYOA 1FWKA 4USMA 2UUCE 4LF6I 4DR6I 1B63A 3ZKBA 1XNRI 4M30A 1STUA 5IT9C 2EFGA 2V8PA 2BV3A 1IBME 4JI5E 1XNQE 2L3CA 2VQFE 4JI4I 4DV7I 2E1RA 4LF9I 4OX9I 1IBKI 1FJGI 4DV3E 4WUDA 1X49A 1GQEA 3ZZUA 4DUYI 2LJPA 5BR8I 1WHQA 1XMQE 3T1YE 4X62E 3WU6A 4I3HA 1HNZE 3PYEA 3PYFA 1FWLA 4JI1I 2L2NA 4WUCA 4JI2I 2DIXA 2LBSB 4WUBA 4X65I 4Z7YA 5LMUI 1ZXNA 5L3JA 1NZ0A 1KIJA 2DEIA 2N3GA 4FN5A 4JI0E 5LMNE 4B3TE 2UUCI 4XTJA 3Q1QA 2EZ6A 4Z7CA 5IWAE 2VQEE 1ZM9A 4HXZA 2UXCI 1FI4A 1Z5AA 4DR4I 4LF6E 1NHHA 4DR6E 4JI5I 1XNRE 4FWGA 1YZ9A 1T4OA 1Z0CA 2ZBKB 3J7AG 4DXLA 3ADIA 4JI4E 1N32I 2JY9A 3HTXA 4DV7E 1MU5A 1ZXMA 4EMDA 4R1FA 4LF9E 4LF5I 4DV1I 4OX9E 4DV5I 1IBKE 3LPSA 2IHR1 3GONA 3HULA 1FJGE 2ZM6I 4X62I 2F4VI 1Z0EA 4FWHA 2L2KB 3P1XA 1EI1A 4DUYE 3WU5A 5BR8E 2B3TB 2UXBI 4HYMA 1X48A 3K17A 4JI1E 4JYAI 3QT8A 3T1HI 3OTOI 4DR2E 2X36A 4YY3E 4JI2E 4GKKI 4X65E 4DV6I 2V2ZA 4K0KI 5LMUE 4JI0I 4B3TI 3CWVA 4DR7I 2RS7A 3WU3A 1T4LB 5GMDA 4JI7E 3M6AA 4RPFA 1MG7A 4JV5I 2YT4A 4DPXA 1FNMA 2UXCE 4DR4E 3VYYA 4JI8I 1Z59A 1QU6A 1DARA 1ZM2A 1ZM4A 1N34E 2ZITA 1I94I 2BM1A 4LF7I 1XHKA 2V2VA 2E5LI 1N32E 2L3JA 2NA2A 1NHJA 1HR0I 4LF5E 4DV1E 3K1JA 4DV5E 1YYWA 2ZM6E 4DR5E 4MYTA 3J7Yp 1VISA 1Z5BA 2JVAA 2F4VE 4DPYA 3C4BA 2X7IA 3PYGA 4HACB 4UT4A 4DR2I 4YY3I 1B62A 2UUAI 2UXBE 2LUQA 1J5EI 4LFBI 4JYAE 2L33A 3T1HE 3OTOE 1Z0VA 1K47A 4P52A 4JG4A 4GKKE 4DV6E 4WFTA 4K0KE 2HHHI 4JI7I 1IBLI 4DR7E 4DPTA 2A2DA 1RR9A 2HKEA 3QT7A 1H7SA 1RC7A 1MX0A 4JV5E 4URLA 1N34I 5A2QQ 4HACA 1WUUA 1H73A 4JI8E 1N33E 3ADLA 4KQVA 4M2ZA 1I94E 2B7TA 4DU8A 2HK2A 4X66E 4MYUA 1NHIA 2XEXA 4LF7E 2CPNA 2MDRA 2E5LE 4LF8I 3ADJA 1Z0BA 2RSMA 4DR5I 4JI6I 2UUBE 4KHPI 4DU7A 1FKAE 1HR0E 1Z0WA 1N36E 4M1KA 4NXNI 2UU9I 1D6TA 4PRXA 4B3MI 4ZVIA 1UEKA 2UXDI 2HK3A 5CFFE 1J26A 2UUAE 2LTRA 1J5EE 4LFBE 2CZ9A 3LNUA 4X8WA 5A2QC 4ED4A 1RREA 3J7AM 3WU4A 2L2MA 2HHHE
chains in the Genus database with same CATH superfamily
1F2IG 4NXMI 1IBLE 4B3RI 2LJUA 4IFDD 2DB2A 3C4TA 2JT2A 4DKKA 1PIEA 4DUZE 2EMFA 2EOQA 2EM2A 2K4VA 2NABA 2BA0D 4DR3I 5K36E 1PKPA 4DV4I 1XMOE 3C6MA 2V88A 4F2JC 2NUFA 2EN1A 3ZM7A 4M9VC 2EM9A 2EP3A 1N33I 2EL4A 2YRKA 1RQ0A 2ENHA 2B7VA 1USVA 2VF3A 4OZEA 2EQ1A 2WP8A 2EOHA 4LCGA 3B8HA 1PJSA 3V5RA 2GO3A 2AE8A 3J80C 4LTYA 4X66I 2Q2EB 2YTEA 3ZKDA 3LMLA 2AJ4A 5A6BA 3H4LA 2JOBA 3M85G 1QNTA 1P42A 4DR1E 2C39B 2Z5BB 1H74A 2C37B 1KVKA 2RS6A 2VRDA 2HFSA 4F54A 1YUIA 3HKMA 3NZKA 4OKGA 1EH8A 1OJ4A 2UUBI 4QNKA 3AV0A 4ZYHA 5K36A 1HNXE 4LF8E 2EJ4A 4LCHA 4AQYE 1ZR9A 2YTGA 1KJKA 3EPLA 5AE3A 1SFEA 2R3VA 1N36I 4JI6E 2J7KA 3JAMQ 4KHPE 2EMXA 4LF4E 4M0VA 2DMYA 2L6MA 2EM5A 2EOXA 2WBSA 1KTVA 3PYDA 4DPWA 3GLLA 2LRSA 2RPCA 2EMHA 5EL9A 4YHHI 2EOJA 2NUEA 5DNLA 1WJPA 1YH8A 1GZ6A 2BBGA 1S4EA 2OI2A 3BF2A 4DMIA 4DV2E 2NPFA 4NXNE 1Y5YA 2O1TA 2UU9E 4X64I 1WRJA 2KHXA 3HPSA 1Z0GA 2R42A 3P3EA 4B3ME 2H36X 2UXDE 5A6AA 1ELOA 1PVGA 2D9HA 5FLXQ 2HFUA 2JEBB 1Y6ZA 3QT5A 1U2RA 2EPPA 4HTGA 4BCAA 1YFHA 3B82A 5C0XD 2C39A 2RTXA 4GKJI 2DLKA 2Z5BA 4LFAI 1ZM3A 3L7ZB 2C37A 1USUA 3Q6MA 1VI7A 1WHNA 2V2QA 4B3SI 3DD6A 4DV0I 4ZYGA 1EKZA 3J81Q 4DUZI 1HNWI 1GTKA 4L8NA 4FWDA 5AC5A 2YTDA 2WW4A 4LFCI 1XMOI 2JPAA 4NXME 4B3RE 3B78A 3F0NA 4TUGA 2Q8UA 1BBGA 2EOOA 2HC5A 5F3WA 4DR3E 2DEJA 4JI3I 2YTFA 1A6FA 4DV4E 2DMIA 1UDSA 4OOGC 2EM8A 1A1KA 3U1YA 3EQ1A 2HKJA 2WBUA 1S16A 2BB8A 3VYXA 1UDNA 2F8BA 2PO0B 3JAMC 2LTSA 4DR1I 1EA6A 2N3HA 2I9IA 1H7UA 2EM7A 3ZZTA 2M7QA 2LUPB 3HXLA 2GS8A 2HJJA 2L8TA 4RH8A 2I13A 3LLHA 2JEBA 2EOEA 1X47A 1A1GA 3CDJA 1HNXI 1O0WA 1IBMI 1XNQI 1X5WA 2EPMX 4R2EA 2EORA 5LL6R 5A6BD 1X6FA 1H72C 4LPFA 3K6QA 3L7ZA 4AQYI 1N0UA 2EPOA 2NUGA 2VQFI 4LF4I 3J80Q 4RHBB 5FLXC 2CVEA 2EPXA 5K36F 1NEIA 1YYKA 3P76A 4USKA 1YSAC 4KZSA 2EMLA 2ENCA 2V34A 3Q6NA 5ELWA 4DV2I 3ADGA 2JWOA 3GMEA 5IT9Q 5JEAB 2GO4A 4DV3I 4YHHE 2EPLX 3EPJA 2O1UA 3J81C 2M9AA 3UK3C 4P7AA 4OO1C 3IWDA 1KKHA 2IOQA 1G2DC 3PS3A 4PU9A 5TSEA 2C38B 1N3GA 5JEAE 5DNYA 4X64E 1N0VC 2PO0A 4MQYA 3D4JA 2EPUA 5GMEA 3T1YI 1XMQI 2EMGA 1QZRA 4I8OA 1HNZI 2EE8A 1DI2A 1UILA 2EM4A 4HY1A 5C0XC 2BM0A 4BC9A 4GKJE 4LFAE 4UTGA 3V2UC 5DRRA 1ZBTA 2PNZB 1TF6A 1UHZA 4R2AA 4X9JA 4B3SE 2E72A 4DV0E 5KL7A 1ZAAC 2A2CA 4F6MA 2LJHA 4WX9A 1IQOA 3LTOA 1HNWE 4PRVA 1T4NA 2EQ0A 4DPUA 4FW9A 4LFCE 2MC5A 3ZZ0A 4IZJB 3QT6A 2EOZA 1Z0TA 1A1HA 2GLIA 4FW3A 4WYQB 5LMNI 3BBGA 4R2PA 2YSPA 2L92A 5AE1A 1G2FC 4JI3E 1BKNA 4GEQB 1Z5CA 2LVHA 2KONA 4MLQA 1E3PA 5JEAA 5EKWA 2JYAA 2EOIA 2YTIA 5IWAI 2VQEI 2EM0A 2V89A 1YYOA 1FWKA 2YTNA 4WSGA 1OYPA 4LCFA 4IJDA 2C38A 4USMA 2DRPA 2UUCE 1TN9A 1T39A 1WXRA 1B63A 4LF6I 4DR6I 2V8QB 3ZKBA 1XNRI 2YZTA 4M30A 1STUA 2ENAA 3DF6A 5IT9C 3ZOQB 2EFGA 3P3GA 2V8PA 2BV3A 1YPNA 3TQMA 1YHCA 1IBME 4JI5E 1XNQE 5DRPA 4R8OA 4MDTA 2EPZA 4L5NC 4F9BB 2PNZA 2L3CA 2VQFE 2HGHA 4JI4I 2M4IA 4OO1D 2YPNA 2JR1A 2EMAA 3M85D 2WBTA 3JU0A 4R2DA 2E1RA 3PS1A 4DV7I 2PO1B 4BC7A 4GQUA 4IZJA 4LF9I 2EPAA 4QNJA 2YTQA 3EPHA 3BGHA 4OX9I 4IFDB 1IBKI 1JK2A 2WNRB 1FJGI 4FW6A 3AUZA 4ZYEA 4DV3E 5K36C 3CDIA 4WUDA 3L00A 1X49A 3HPZA 4IS1C 4IFDE 1GQEA 3VHTB 3ZZUA 4TUIA 2ADRA 4DUYI 2LJPA 3H1CA 5BR8I 4FK5C 1WHQA 1XMQE 4FW4A 3T1YE 4X62E 4AIDA 2JEAB 2DLQA 4ZYDA 2JXPA 2CG9A 4Q28A 1SR9A 4R2QA 4HEIA 2EL6A 4MU1A 1UBDC 4I3HA 3WU6A 1HNZE 4BA2B 3PYEA 3PYFA 1FWLA 1UDQA 4JI1I 3M7ND 2BA1G 4O4KA 1Y4SA 2L2NA 4WUCA 4JI2I 2DIXA 2IOPA 1B69A 2LBSB 2M1SA 4WUBA 4Z7YA 4X65I 2J65A 4LOMA 5LMUI 1ZXNA 2PO1A 5KL6A 2MDGA 2B9DA 5L3JA 2CSHA 2YU8A 4MLVA 1NZ0A 2CTDA 5A6JA 5KL4A 1KIJA 2LO3A 4O43A 2DEIA 2FV4B 1AH5A 4IFDA 2N3GA 1DQ3A 4FN5A 2ELYA 5LMNE 4JI0E 2WNRA 4B3TE 1OYSA 3F6GA 5AASA 2UUCI 2EM6A 4BHBA 4XTJA 5JEAF 3Q1QA 2Z5EA 2JOXA 2EZ6A 4NHRA 3H09A 2F1DA 4Z7CA 2EMZA 3PRYA 2PNMA 5IWAE 2YRHA 2VQEE 1ZM9A 4MU3A 4HXZA 2O1VA 2UXCI 1FI4A 1L4SA 1Z5AA 2PO2B 4FW5A 4DR4I 2R1FA 4LF6E 4DR6E 1NHHA 2FGGA 4JI5I 1EH6A 1XNRE 2JEAA 1BB8A 1A1FA 1OYRA 4BA2A 2ELZA 3K85A 3ECRA 4FWGA 1IMUA 1YZ9A 2VE7C 1T4OA 3J7AG 1Z0CA 2LT7A 2VESA 4R2SA 2ZBKB 4U3BA 1PJQA 4DXLA 2V87A 2NN6F 1X6EA 3KZZA 4R03A 4WSPA 2DGCA 5K36D 3DJWA 4WXCA 3P3CA 4IZKB 3ADIA 5KL2A 4JI4E 1N32I 2JY9A 1IQSA 1Z1BA 3HTXA 4DV7E 1KYQA 2MKDA 1MU5A 1ZXMA 4EMDA 2V86A 4R1FA 4NBQA 4LF9E 2EMBA 1AAYA 4DV1I 4LF5I 2WCC3 5IV8B 4OX9E 4DV5I 1IBKE 3LPSA 2EOFA 2IHR1 3GONA 1FJGE 3HULA 5FWKA 2ZM6I 2YTOA 3MHSC 2EMIA 4X62I 2LV2A 5AC4A 2F4VI 1Z0EA 4FWHA 2L2KB 3P1XA 1EI1A 4DUYE 3WU5A 5BR8E 2PO2A 2B3TB 4IS9A 2NN6B 4MU0A 2UXBI 4HYMA 2V83A 1X48A 1R6MA 3K17A 3P06A 4JI1E 4ISAA 4F6NA 4JYAI 3FIGA 3QT8A 3T1HI 3OTOI 2A25A 4DR2E 2X36A 2NN6E 4YY3E 1NCSA 4JI2E 5A6KA 2O1WA 2GQ0A 2EPKX 4GKKI 4WXDA 2BA0G 3B4TA 4X65E 5ADZA 4FW7A 5AE2A 4IZKA 4DV6I 5T6JA 2V2ZA 4K0KI 5LMUE 1X6HA 3JTZA 4JI0I 4B3TI 3CWVA 3PS2A 4DR7I 2RS7A 2EN7A 4J8ZA 1PDAA 5DRQA 5A69A 3WU3A 4IFDF 1T4LB 5GMDA 1T38A 4JI7E 3M6AA 4RPFA 2JE6B 2K7IA 4J3DA 3KZYA 1MG7A 4JV5I 1ZU1A 2YT4A 4DPXA 1FNMA 2UXCE 1E3HA 1RMDA 2VF1A 4DR4E 3VYYA 4JI8I 1ZBQA 2NN6A 1Z59A 2LMZA 1QU6A 5JEAC 4NZVA 1DARA 1ZM2A 1ZM4A 4U3DA 1N34E 1XXEA 1BBOA 2ZITA 1I94I 2BM1A 1RHYA 5KL3A 2DSYA 4LF7I 1XHKA 2YRMA 2V2VA 2E5LI 3THOB 2Z5CB 3U1KA 1N32E 2L3JA 2NA2A 2GPIA 2ODRC 1NHJA 4GZNC 2EOMA 1Y60A 2NN6C 3BIDA 1HR0I 4LF5E 4BMJA 2EPRA 4DV1E 1A1IA 3K1JA 2EN3A 4DV5E 2BR2B 1YYWA 4OO1F 2ZM6E 4DR5E 4MYTA 3J7Yp 1VISA 2JE6A 2N8XA 1Z5BA 4P78A 2YSOA 2JVAA 2FTXB 2F4VE 4DPYA 3C4BA 2X7IA 2LE2A 3PYGA 1JK1A 4HACB 4AIMA 4UT4A 4DR2I 2RQLA 1DGCA 2EL5A 1B62A 4YY3I 2UUAI 2EQ3A 2UXBE 3MSWA 1EH7A 1LLMC 2LUQA 2V85A 4MU4A 1J5EI 4LFBI 4JYAE 2L33A 2PRTA 3T1HE 3OTOE 4Q35B 1Z0VA 1K47A 1MEYC 4N4RB 4BHCA 4P52A 5C0XF 2CT1A 4JG4A 4GKKE 3KRNA 4KWYA 2G7HA 4DV6E 4WFTA 2Z5CA 4K0KE 1MGTA 2BA1D 2HHHI 4OO1B 2E1MA 3VK6A 1IBLI 4JI7I 2EMYA 5IXMB 4DR7E 2EOYA 2EPCA 4P7DA 4DPTA 2A2DA 5JEAD 2EPNA 2EN8A 2J7JA 2MC6A 1RR9A 2HKEA 2EOSA 2BR2A 1H7SA 3QT7A 3F6HA 1RC7A 4OO1E 1PJTA 2YTPA 2RSIA 2EMCA 3MHHC 1A1JA 4JV5E 1MX0A 1HK7A 4BA1B 2WZOA 4URLA 1N34I 5A2QQ 4HACA 1WUUA 3RMPA 1Y4UA 2KOUA 1H73A 4IFDC 4JI8E 4N3OA 2LCEA 2ODRD 1N33E 3OMLA 5C0XB 3HJCA 2O3ZA 3ADLA 2YWQA 3KWRA 4KQVA 2NN6D 2EWLA 5KL5A 4M2ZA 1I94E 2B7TA 2EN2A 2IESA 4DU8A 2HK2A 2JP9A 4X66E 4F9CB 4MYUA 2EMWA 5C0XE 2IERA 1NHIA 3IWBA 2EN4A 4R2RA 4LF7E 2XEXA 1X3CA 2CPNA 2MDRA 2E5LE 4LF8I 3ADJA 2CGEA 3QG5C 3C6KA 4IZJD 1Z0BA 4OO1A 2RSMA 1R6LA 4DR5I 4JI6I 2UUBE 4KHPI 4DU7A 1FKAE 2EN6A 5DROA 4BS9A 4BBYA 1HR0E 3M7NG 2R76A 1Z0WA 1TF3A 1UDOA 2EM3A 3GCMA 1N36E 2YTJA 4R2CA 3HQ1A 4M1KA 4NXNI 4BA1A 2WP8B 4WPYA 2UU9I 3UHMA 3M99B 4O24A 3THNA 3EPKA 4PRXA 1D6TA 1UN6B 4B3MI 2PNLA 1UEKA 4ZVIA 2HK3A 2UXDI 2MKNA 5CFFE 1YUJA 1J26A 2UUAE 5C0XA 2LTRA 5LLQA 2GHFA 1J5EE 1P47A 4LFBE 2CZ9A 3LNUA 1A1LA 4X8WA 5A2QC 4ED4A 5DNXA 2YU5A 4LU9A 4O5GA 4AM3A 1RREA 4F9AB 3J7AM 5K36B 3IWCA 3WU4A 2EMKA 2L2MA 2HHHE
chains in the Genus database with same CATH topology
4NXMI 1IBLE 4B3RI 2DB2A 3C4TA 4DKKA 1PIEA 4DUZE 2K4VA 4DR3I 1PKPA 4DV4I 1XMOE 2V88A 2NUFA 3ZM7A 1N33I 1RQ0A 2B7VA 1USVA 2VF3A 3B8HA 3V5RA 3J80C 4LTYA 4X66I 2Q2EB 3ZKDA 3LMLA 2AJ4A 3H4LA 2JOBA 4DR1E 2Z5BB 1H74A 1KVKA 2RS6A 2HFSA 4F54A 2UUBI 1OJ4A 3AV0A 1HNXE 4LF8E 4AQYE 5AE3A 2R3VA 1N36I 4JI6E 2J7KA 3JAMQ 4KHPE 4LF4E 4M0VA 2DMYA 2L6MA 1KTVA 3PYDA 4DPWA 2LRSA 4YHHI 2NUEA 1GZ6A 1S4EA 2OI2A 4DMIA 4DV2E 2NPFA 4NXNE 2O1TA 2UU9E 4X64I 2KHXA 3HPSA 1Z0GA 2R42A 4B3ME 2H36X 2UXDE 1PVGA 1ELOA 5FLXQ 2HFUA 1Y6ZA 3QT5A 1U2RA 4BCAA 3B82A 2RTXA 4GKJI 4LFAI 2Z5BA 1ZM3A 1USUA 3Q6MA 2V2QA 1WHNA 4B3SI 4DV0I 1EKZA 3J81Q 4DUZI 1HNWI 4L8NA 4FWDA 2WW4A 4LFCI 1XMOI 4NXME 4B3RE 3B78A 3F0NA 4TUGA 5F3WA 4DR3E 2DEJA 4JI3I 1A6FA 4DV4E 4OOGC 2HKJA 1S16A 3VYXA 2F8BA 3JAMC 2LTSA 4DR1I 1EA6A 2N3HA 1H7UA 3ZZTA 2M7QA 2LUPB 3HXLA 2GS8A 2L8TA 3LLHA 1X47A 1HNXI 1O0WA 1IBMI 1XNQI 5LL6R 4AQYI 1H72C 3K6QA 1N0UA 2NUGA 2VQFI 4LF4I 3J80Q 5FLXC 1YYKA 4USKA 3Q6NA 4KZSA 2V34A 4DV2I 3ADGA 2JWOA 5IT9Q 4DV3I 4YHHE 2O1UA 3J81C 4P7AA 3IWDA 1KKHA 2IOQA 4PU9A 5DNYA 4X64E 1N0VC 5GMEA 1XMQI 3D4JA 3T1YI 1QZRA 4I8OA 1HNZI 1DI2A 1UILA 4HY1A 2BM0A 4BC9A 4GKJE 4LFAE 4UTGA 3V2UC 1ZBTA 1UHZA 4B3SE 4DV0E 2A2CA 4PRVA 2LJHA 3LTOA 1HNWE 4DPUA 1T4NA 4FW9A 4LFCE 2MC5A 3ZZ0A 4IZJB 3QT6A 1Z0TA 4WYQB 5LMNI 1BKNA 2O1VA 2L92A 5AE1A 4JI3E 1Z5CA 4GEQB 2KONA 5IWAI 2VQEI 2V89A 1YYOA 1FWKA 4USMA 2UUCE 4LF6I 4DR6I 1WXRA 1B63A 2V8QB 3ZKBA 1XNRI 2YZTA 4M30A 1STUA 5IT9C 3DF6A 3ZOQB 2EFGA 2V8PA 2BV3A 1IBME 4JI5E 1XNQE 4R8OA 4L5NC 4F9BB 2L3CA 2VQFE 4JI4I 2M4IA 2JR1A 4DV7I 3JU0A 2E1RA 4BC7A 4IZJA 4LF9I 4OX9I 1IBKI 1FJGI 3AUZA 4DV3E 4WUDA 1X49A 3HPZA 1GQEA 3ZZUA 4TUIA 4DUYI 2LJPA 5BR8I 1WHQA 1XMQE 3T1YE 4X62E 2CG9A 4Q28A 1SR9A 3WU6A 4I3HA 1HNZE 3PYEA 3PYFA 1FWLA 4JI1I 1Y4SA 2L2NA 4WUCA 4JI2I 2DIXA 2IOPA 2LBSB 2M1SA 4WUBA 4Z7YA 4X65I 5LMUI 1ZXNA 2B9DA 5L3JA 1NZ0A 1KIJA 2DEIA 2FV4B 2N3GA 1DQ3A 4FN5A 4JI0E 5LMNE 4B3TE 3F6GA 5AASA 2UUCI 4XTJA 3Q1QA 2Z5EA 2JOXA 2EZ6A 4Z7CA 3H09A 3PRYA 2PNMA 5IWAE 2VQEE 1ZM9A 4HXZA 2UXCI 1FI4A 1Z5AA 4DR4I 4LF6E 1NHHA 4DR6E 2FGGA 4JI5I 1XNRE 3K85A 4FWGA 1YZ9A 2VE7C 1T4OA 3J7AG 1Z0CA 2ZBKB 4DXLA 2V87A 4R03A 4WSPA 3DJWA 4IZKB 3ADIA 4JI4E 1N32I 2JY9A 3HTXA 4DV7E 1MU5A 1ZXMA 4EMDA 2V86A 4R1FA 4LF9E 4LF5I 4DV1I 4OX9E 4DV5I 1IBKE 3LPSA 2IHR1 3GONA 3HULA 1FJGE 5FWKA 2ZM6I 4X62I 2F4VI 1Z0EA 4FWHA 2L2KB 3P1XA 1EI1A 4DUYE 3WU5A 5BR8E 2B3TB 2UXBI 4HYMA 2V83A 1X48A 3K17A 3P06A 4JI1E 4JYAI 3FIGA 3QT8A 3T1HI 3OTOI 4DR2E 2X36A 4YY3E 4JI2E 2O1WA 2GQ0A 4GKKI 4X65E 5ADZA 4IZKA 5AE2A 4DV6I 5T6JA 2V2ZA 4K0KI 5LMUE 4JI0I 3JTZA 4B3TI 3CWVA 4DR7I 2RS7A 4J8ZA 3WU3A 1T4LB 5GMDA 4JI7E 3M6AA 4RPFA 1MG7A 4JV5I 2YT4A 4DPXA 1FNMA 2UXCE 2VF1A 4DR4E 3VYYA 4JI8I 1ZBQA 1Z59A 2LMZA 1QU6A 1DARA 1ZM2A 1ZM4A 1N34E 2ZITA 1I94I 2BM1A 2DSYA 4LF7I 1XHKA 2V2VA 2E5LI 2Z5CB 1N32E 2L3JA 2NA2A 2ODRC 1NHJA 1HR0I 4LF5E 4BMJA 4DV1E 3K1JA 4DV5E 1YYWA 2ZM6E 4DR5E 4MYTA 3J7Yp 1VISA 1Z5BA 4P78A 2JVAA 2FTXB 2F4VE 4DPYA 3C4BA 2X7IA 2LE2A 3PYGA 4HACB 4UT4A 4DR2I 4YY3I 1B62A 2UUAI 2UXBE 3MSWA 2LUQA 2V85A 1J5EI 4LFBI 4JYAE 2L33A 3T1HE 3OTOE 1Z0VA 1K47A 4P52A 4JG4A 4GKKE 2G7HA 4DV6E 4WFTA 2Z5CA 4K0KE 2HHHI 2E1MA 3VK6A 1IBLI 4JI7I 4DR7E 4P7DA 4DPTA 2A2DA 2MC6A 1RR9A 2HKEA 3QT7A 1H7SA 3F6HA 1RC7A 1MX0A 4JV5E 4URLA 1HK7A 2WZOA 1N34I 5A2QQ 4HACA 1WUUA 3RMPA 1Y4UA 2KOUA 1H73A 4JI8E 4N3OA 2ODRD 1N33E 3OMLA 3HJCA 3ADLA 3KWRA 4KQVA 2EWLA 4M2ZA 1I94E 2B7TA 4DU8A 2HK2A 4X66E 4F9CB 4MYUA 1NHIA 3IWBA 2XEXA 4LF7E 2CPNA 2MDRA 2E5LE 4LF8I 3ADJA 2CGEA 4IZJD 1Z0BA 2RSMA 4DR5I 4JI6I 2UUBE 4KHPI 4DU7A 1FKAE 4BS9A 4BBYA 1HR0E 1Z0WA 1N36E 4M1KA 3HQ1A 4NXNI 2UU9I 4WPYA 1D6TA 4PRXA 4B3MI 2PNLA 1UEKA 4ZVIA 2HK3A 2UXDI 5CFFE 1J26A 2UUAE 2LTRA 1J5EE 4LFBE 2CZ9A 3LNUA 4X8WA 5A2QC 4ED4A 4LU9A 1RREA 4F9AB 3J7AM 3IWCA 3WU4A 2L2MA 2HHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM I;  1IBL E;  4B3R I;  2DB2 A;  3C4T A;  4DKK A;  1PIE A;  4DUZ E;  4DR3 I;  1PKP A;  4DV4 I;  1XMO E;  2NUF A;  3ZM7 A;  1N33 I;  1RQ0 A;  2B7V A;  2VF3 A;  3B8H A;  3V5R A;  3J80 C;  4X66 I;  2Q2E B;  3ZKD A;  2AJ4 A;  3H4L A;  4DR1 E;  1H74 A;  1KVK A;  2RS6 A;  2HFS A;  2UUB I;  1OJ4 A;  1HNX E;  4LF8 E;  4AQY E;  2R3V A;  1N36 I;  4JI6 E;  2J7K A;  3JAM Q;  4KHP E;  4LF4 E;  1KTV A;  2DMY A;  3PYD A;  4DPW A;  2LRS A;  4YHH I;  2NUE A;  1S4E A;  2OI2 A;  4DV2 E;  2NPF A;  4NXN E;  2UU9 E;  4X64 I;  2KHX A;  1Z0G A;  2R42 A;  4B3M E;  2UXD E;  1PVG A;  1ELO A;  5FLX Q;  2HFU A;  3QT5 A;  1U2R A;  3B82 A;  2RTX A;  4GKJ I;  4LFA I;  1ZM3 A;  2V2Q A;  1WHN A;  4B3S I;  4DV0 I;  1EKZ A;  3J81 Q;  4DUZ I;  1HNW I;  4FWD A;  2WW4 A;  4LFC I;  1XMO I;  4NXM E;  4B3R E;  3B78 A;  3F0N A;  4DR3 E;  2DEJ A;  4JI3 I;  1A6F A;  4DV4 E;  4OOG C;  2HKJ A;  1S16 A;  3VYX A;  3JAM C;  2LTS A;  4DR1 I;  1EA6 A;  2N3H A;  1H7U A;  3ZZT A;  2LUP B;  2GS8 A;  3LLH A;  1X47 A;  1HNX I;  1O0W A;  1IBM I;  1XNQ I;  5LL6 R;  4AQY I;  1H72 C;  1N0U A;  2NUG A;  2VQF I;  4LF4 I;  3J80 Q;  5FLX C;  1YYK A;  4USK A;  2V34 A;  4DV2 I;  3ADG A;  5IT9 Q;  4DV3 I;  4YHH E;  3J81 C;  4P7A A;  1KKH A;  4PU9 A;  4X64 E;  5GME A;  1N0V C;  1XMQ I;  3D4J A;  3T1Y I;  1QZR A;  1HNZ I;  1DI2 A;  1UIL A;  4HY1 A;  2BM0 A;  4GKJ E;  4LFA E;  4UTG A;  3V2U C;  1ZBT A;  1UHZ A;  4B3S E;  4DV0 E;  2A2C A;  4PRV A;  2LJH A;  3LTO A;  1HNW E;  4DPU A;  1T4N A;  4FW9 A;  4LFC E;  3ZZ0 A;  3QT6 A;  1Z0T A;  4WYQ B;  5LMN I;  1BKN A;  1Z5C A;  4JI3 E;  5IWA I;  2VQE I;  1YYO A;  1FWK A;  4USM A;  2UUC E;  4LF6 I;  4DR6 I;  1B63 A;  3ZKB A;  1XNR I;  4M30 A;  1STU A;  5IT9 C;  2EFG A;  2V8P A;  2BV3 A;  1IBM E;  4JI5 E;  1XNQ E;  2L3C A;  2VQF E;  4JI4 I;  4DV7 I;  2E1R A;  4LF9 I;  4OX9 I;  1IBK I;  1FJG I;  4DV3 E;  4WUD A;  1X49 A;  1GQE A;  3ZZU A;  4DUY I;  2LJP A;  5BR8 I;  1WHQ A;  1XMQ E;  3T1Y E;  4X62 E;  3WU6 A;  4I3H A;  1HNZ E;  3PYE A;  3PYF A;  1FWL A;  4JI1 I;  2L2N A;  4WUC A;  4JI2 I;  2DIX A;  2LBS B;  4WUB A;  4X65 I;  4Z7Y A;  5LMU I;  1ZXN A;  5L3J A;  1NZ0 A;  1KIJ A;  2DEI A;  2N3G A;  4FN5 A;  4JI0 E;  5LMN E;  4B3T E;  2UUC I;  4XTJ A;  3Q1Q A;  2EZ6 A;  4Z7C A;  5IWA E;  2VQE E;  1ZM9 A;  4HXZ A;  2UXC I;  1FI4 A;  1Z5A A;  4DR4 I;  4LF6 E;  1NHH A;  4DR6 E;  4JI5 I;  1XNR E;  4FWG A;  1YZ9 A;  1T4O A;  1Z0C A;  2ZBK B;  3J7A G;  4DXL A;  3ADI A;  4JI4 E;  1N32 I;  2JY9 A;  3HTX A;  4DV7 E;  1MU5 A;  1ZXM A;  4EMD A;  4R1F A;  4LF9 E;  4LF5 I;  4DV1 I;  4OX9 E;  4DV5 I;  1IBK E;  3LPS A;  2IHR 1;  3GON A;  3HUL A;  1FJG E;  2ZM6 I;  4X62 I;  2F4V I;  1Z0E A;  4FWH A;  2L2K B;  3P1X A;  1EI1 A;  4DUY E;  3WU5 A;  5BR8 E;  2B3T B;  2UXB I;  4HYM A;  1X48 A;  3K17 A;  4JI1 E;  4JYA I;  3QT8 A;  3T1H I;  3OTO I;  4DR2 E;  2X36 A;  4YY3 E;  4JI2 E;  4GKK I;  4X65 E;  4DV6 I;  2V2Z A;  4K0K I;  5LMU E;  4JI0 I;  4B3T I;  3CWV A;  4DR7 I;  2RS7 A;  3WU3 A;  1T4L B;  5GMD A;  4JI7 E;  3M6A A;  4RPF A;  1MG7 A;  4JV5 I;  2YT4 A;  4DPX A;  1FNM A;  2UXC E;  4DR4 E;  3VYY A;  4JI8 I;  1Z59 A;  1QU6 A;  1DAR A;  1ZM2 A;  1ZM4 A;  1N34 E;  2ZIT A;  1I94 I;  2BM1 A;  4LF7 I;  1XHK A;  2V2V A;  2E5L I;  1N32 E;  2L3J A;  2NA2 A;  1NHJ A;  1HR0 I;  4LF5 E;  4DV1 E;  3K1J A;  4DV5 E;  1YYW A;  2ZM6 E;  4DR5 E;  4MYT A;  3J7Y p;  1VIS A;  1Z5B A;  2JVA A;  2F4V E;  4DPY A;  3C4B A;  2X7I A;  3PYG A;  4HAC B;  4UT4 A;  4DR2 I;  4YY3 I;  1B62 A;  2UUA I;  2UXB E;  2LUQ A;  1J5E I;  4LFB I;  4JYA E;  2L33 A;  3T1H E;  3OTO E;  1Z0V A;  1K47 A;  4P52 A;  4JG4 A;  4GKK E;  4DV6 E;  4WFT A;  4K0K E;  2HHH I;  4JI7 I;  1IBL I;  4DR7 E;  4DPT A;  2A2D A;  1RR9 A;  2HKE A;  3QT7 A;  1H7S A;  1RC7 A;  1MX0 A;  4JV5 E;  4URL A;  1N34 I;  5A2Q Q;  4HAC A;  1WUU A;  1H73 A;  4JI8 E;  1N33 E;  3ADL A;  4KQV A;  4M2Z A;  1I94 E;  2B7T A;  4DU8 A;  2HK2 A;  4X66 E;  4MYU A;  1NHI A;  2XEX A;  4LF7 E;  2CPN A;  2MDR A;  2E5L E;  4LF8 I;  3ADJ A;  1Z0B A;  2RSM A;  4DR5 I;  4JI6 I;  2UUB E;  4KHP I;  4DU7 A;  1FKA E;  1HR0 E;  1Z0W A;  1N36 E;  4M1K A;  4NXN I;  2UU9 I;  1D6T A;  4PRX A;  4B3M I;  4ZVI A;  1UEK A;  2UXD I;  2HK3 A;  5CFF E;  1J26 A;  2UUA E;  2LTR A;  1J5E E;  4LFB E;  2CZ9 A;  3LNU A;  4X8W A;  5A2Q C;  4ED4 A;  1RRE A;  3J7A M;  3WU4 A;  2L2M A;  2HHH E; 
#chains in the Genus database with same CATH topology
 1F2I G;  4NXM I;  1IBL E;  4B3R I;  2LJU A;  4IFD D;  2DB2 A;  3C4T A;  2JT2 A;  4DKK A;  1PIE A;  4DUZ E;  2EMF A;  2EOQ A;  2EM2 A;  2K4V A;  2NAB A;  2BA0 D;  4DR3 I;  5K36 E;  1PKP A;  4DV4 I;  1XMO E;  3C6M A;  2V88 A;  4F2J C;  2NUF A;  2EN1 A;  3ZM7 A;  4M9V C;  2EM9 A;  2EP3 A;  1N33 I;  2EL4 A;  2YRK A;  1RQ0 A;  2ENH A;  2B7V A;  1USV A;  2VF3 A;  4OZE A;  2EQ1 A;  2WP8 A;  2EOH A;  4LCG A;  3B8H A;  1PJS A;  3V5R A;  2GO3 A;  2AE8 A;  3J80 C;  4LTY A;  4X66 I;  2Q2E B;  2YTE A;  3ZKD A;  3LML A;  2AJ4 A;  5A6B A;  3H4L A;  2JOB A;  3M85 G;  1QNT A;  1P42 A;  4DR1 E;  2C39 B;  2Z5B B;  1H74 A;  2C37 B;  1KVK A;  2RS6 A;  2VRD A;  2HFS A;  4F54 A;  1YUI A;  3HKM A;  3NZK A;  4OKG A;  1EH8 A;  1OJ4 A;  2UUB I;  4QNK A;  3AV0 A;  4ZYH A;  5K36 A;  1HNX E;  4LF8 E;  2EJ4 A;  4LCH A;  4AQY E;  1ZR9 A;  2YTG A;  1KJK A;  3EPL A;  5AE3 A;  1SFE A;  2R3V A;  1N36 I;  4JI6 E;  2J7K A;  3JAM Q;  4KHP E;  2EMX A;  4LF4 E;  4M0V A;  2DMY A;  2L6M A;  2EM5 A;  2EOX A;  2WBS A;  1KTV A;  3PYD A;  4DPW A;  3GLL A;  2LRS A;  2RPC A;  2EMH A;  5EL9 A;  4YHH I;  2EOJ A;  2NUE A;  5DNL A;  1WJP A;  1YH8 A;  1GZ6 A;  2BBG A;  1S4E A;  2OI2 A;  3BF2 A;  4DMI A;  4DV2 E;  2NPF A;  4NXN E;  1Y5Y A;  2O1T A;  2UU9 E;  4X64 I;  1WRJ A;  2KHX A;  3HPS A;  1Z0G A;  2R42 A;  3P3E A;  4B3M E;  2H36 X;  2UXD E;  5A6A A;  1ELO A;  1PVG A;  2D9H A;  5FLX Q;  2HFU A;  2JEB B;  1Y6Z A;  3QT5 A;  1U2R A;  2EPP A;  4HTG A;  4BCA A;  1YFH A;  3B82 A;  5C0X D;  2C39 A;  2RTX A;  4GKJ I;  2DLK A;  2Z5B A;  4LFA I;  1ZM3 A;  3L7Z B;  2C37 A;  1USU A;  3Q6M A;  1VI7 A;  1WHN A;  2V2Q A;  4B3S I;  3DD6 A;  4DV0 I;  4ZYG A;  1EKZ A;  3J81 Q;  4DUZ I;  1HNW I;  1GTK A;  4L8N A;  4FWD A;  5AC5 A;  2YTD A;  2WW4 A;  4LFC I;  1XMO I;  2JPA A;  4NXM E;  4B3R E;  3B78 A;  3F0N A;  4TUG A;  2Q8U A;  1BBG A;  2EOO A;  2HC5 A;  5F3W A;  4DR3 E;  2DEJ A;  4JI3 I;  2YTF A;  1A6F A;  4DV4 E;  2DMI A;  1UDS A;  4OOG C;  2EM8 A;  1A1K A;  3U1Y A;  3EQ1 A;  2HKJ A;  2WBU A;  1S16 A;  2BB8 A;  3VYX A;  1UDN A;  2F8B A;  2PO0 B;  3JAM C;  2LTS A;  4DR1 I;  1EA6 A;  2N3H A;  2I9I A;  1H7U A;  2EM7 A;  3ZZT A;  2M7Q A;  2LUP B;  3HXL A;  2GS8 A;  2HJJ A;  2L8T A;  4RH8 A;  2I13 A;  3LLH A;  2JEB A;  2EOE A;  1X47 A;  1A1G A;  3CDJ A;  1HNX I;  1O0W A;  1IBM I;  1XNQ I;  1X5W A;  2EPM X;  4R2E A;  2EOR A;  5LL6 R;  5A6B D;  1X6F A;  1H72 C;  4LPF A;  3K6Q A;  3L7Z A;  4AQY I;  1N0U A;  2EPO A;  2NUG A;  2VQF I;  4LF4 I;  3J80 Q;  4RHB B;  5FLX C;  2CVE A;  2EPX A;  5K36 F;  1NEI A;  1YYK A;  3P76 A;  4USK A;  1YSA C;  4KZS A;  2EML A;  2ENC A;  2V34 A;  3Q6N A;  5ELW A;  4DV2 I;  3ADG A;  2JWO A;  3GME A;  5IT9 Q;  5JEA B;  2GO4 A;  4DV3 I;  4YHH E;  2EPL X;  3EPJ A;  2O1U A;  3J81 C;  2M9A A;  3UK3 C;  4P7A A;  4OO1 C;  3IWD A;  1KKH A;  2IOQ A;  1G2D C;  3PS3 A;  4PU9 A;  5TSE A;  2C38 B;  1N3G A;  5JEA E;  5DNY A;  4X64 E;  1N0V C;  2PO0 A;  4MQY A;  3D4J A;  2EPU A;  5GME A;  3T1Y I;  1XMQ I;  2EMG A;  1QZR A;  4I8O A;  1HNZ I;  2EE8 A;  1DI2 A;  1UIL A;  2EM4 A;  4HY1 A;  5C0X C;  2BM0 A;  4BC9 A;  4GKJ E;  4LFA E;  4UTG A;  3V2U C;  5DRR A;  1ZBT A;  2PNZ B;  1TF6 A;  1UHZ A;  4R2A A;  4X9J A;  4B3S E;  2E72 A;  4DV0 E;  5KL7 A;  1ZAA C;  2A2C A;  4F6M A;  2LJH A;  4WX9 A;  1IQO A;  3LTO A;  1HNW E;  4PRV A;  1T4N A;  2EQ0 A;  4DPU A;  4FW9 A;  4LFC E;  2MC5 A;  3ZZ0 A;  4IZJ B;  3QT6 A;  2EOZ A;  1Z0T A;  1A1H A;  2GLI A;  4FW3 A;  4WYQ B;  5LMN I;  3BBG A;  4R2P A;  2YSP A;  2L92 A;  5AE1 A;  1G2F C;  4JI3 E;  1BKN A;  4GEQ B;  1Z5C A;  2LVH A;  2KON A;  4MLQ A;  1E3P A;  5JEA A;  5EKW A;  2JYA A;  2EOI A;  2YTI A;  5IWA I;  2VQE I;  2EM0 A;  2V89 A;  1YYO A;  1FWK A;  2YTN A;  4WSG A;  1OYP A;  4LCF A;  4IJD A;  2C38 A;  4USM A;  2DRP A;  2UUC E;  1TN9 A;  1T39 A;  1WXR A;  1B63 A;  4LF6 I;  4DR6 I;  2V8Q B;  3ZKB A;  1XNR I;  2YZT A;  4M30 A;  1STU A;  2ENA A;  3DF6 A;  5IT9 C;  3ZOQ B;  2EFG A;  3P3G A;  2V8P A;  2BV3 A;  1YPN A;  3TQM A;  1YHC A;  1IBM E;  4JI5 E;  1XNQ E;  5DRP A;  4R8O A;  4MDT A;  2EPZ A;  4L5N C;  4F9B B;  2PNZ A;  2L3C A;  2VQF E;  2HGH A;  4JI4 I;  2M4I A;  4OO1 D;  2YPN A;  2JR1 A;  2EMA A;  3M85 D;  2WBT A;  3JU0 A;  4R2D A;  2E1R A;  3PS1 A;  4DV7 I;  2PO1 B;  4BC7 A;  4GQU A;  4IZJ A;  4LF9 I;  2EPA A;  4QNJ A;  2YTQ A;  3EPH A;  3BGH A;  4OX9 I;  4IFD B;  1IBK I;  1JK2 A;  2WNR B;  1FJG I;  4FW6 A;  3AUZ A;  4ZYE A;  4DV3 E;  5K36 C;  3CDI A;  4WUD A;  3L00 A;  1X49 A;  3HPZ A;  4IS1 C;  4IFD E;  1GQE A;  3VHT B;  3ZZU A;  4TUI A;  2ADR A;  4DUY I;  2LJP A;  3H1C A;  5BR8 I;  4FK5 C;  1WHQ A;  1XMQ E;  4FW4 A;  3T1Y E;  4X62 E;  4AID A;  2JEA B;  2DLQ A;  4ZYD A;  2JXP A;  2CG9 A;  4Q28 A;  1SR9 A;  4R2Q A;  4HEI A;  2EL6 A;  4MU1 A;  1UBD C;  4I3H A;  3WU6 A;  1HNZ E;  4BA2 B;  3PYE A;  3PYF A;  1FWL A;  1UDQ A;  4JI1 I;  3M7N D;  2BA1 G;  4O4K A;  1Y4S A;  2L2N A;  4WUC A;  4JI2 I;  2DIX A;  2IOP A;  1B69 A;  2LBS B;  2M1S A;  4WUB A;  4Z7Y A;  4X65 I;  2J65 A;  4LOM A;  5LMU I;  1ZXN A;  2PO1 A;  5KL6 A;  2MDG A;  2B9D A;  5L3J A;  2CSH A;  2YU8 A;  4MLV A;  1NZ0 A;  2CTD A;  5A6J A;  5KL4 A;  1KIJ A;  2LO3 A;  4O43 A;  2DEI A;  2FV4 B;  1AH5 A;  4IFD A;  2N3G A;  1DQ3 A;  4FN5 A;  2ELY A;  5LMN E;  4JI0 E;  2WNR A;  4B3T E;  1OYS A;  3F6G A;  5AAS A;  2UUC I;  2EM6 A;  4BHB A;  4XTJ A;  5JEA F;  3Q1Q A;  2Z5E A;  2JOX A;  2EZ6 A;  4NHR A;  3H09 A;  2F1D A;  4Z7C A;  2EMZ A;  3PRY A;  2PNM A;  5IWA E;  2YRH A;  2VQE E;  1ZM9 A;  4MU3 A;  4HXZ A;  2O1V A;  2UXC I;  1FI4 A;  1L4S A;  1Z5A A;  2PO2 B;  4FW5 A;  4DR4 I;  2R1F A;  4LF6 E;  4DR6 E;  1NHH A;  2FGG A;  4JI5 I;  1EH6 A;  1XNR E;  2JEA A;  1BB8 A;  1A1F A;  1OYR A;  4BA2 A;  2ELZ A;  3K85 A;  3ECR A;  4FWG A;  1IMU A;  1YZ9 A;  2VE7 C;  1T4O A;  3J7A G;  1Z0C A;  2LT7 A;  2VES A;  4R2S A;  2ZBK B;  4U3B A;  1PJQ A;  4DXL A;  2V87 A;  2NN6 F;  1X6E A;  3KZZ A;  4R03 A;  4WSP A;  2DGC A;  5K36 D;  3DJW A;  4WXC A;  3P3C A;  4IZK B;  3ADI A;  5KL2 A;  4JI4 E;  1N32 I;  2JY9 A;  1IQS A;  1Z1B A;  3HTX A;  4DV7 E;  1KYQ A;  2MKD A;  1MU5 A;  1ZXM A;  4EMD A;  2V86 A;  4R1F A;  4NBQ A;  4LF9 E;  2EMB A;  1AAY A;  4DV1 I;  4LF5 I;  2WCC 3;  5IV8 B;  4OX9 E;  4DV5 I;  1IBK E;  3LPS A;  2EOF A;  2IHR 1;  3GON A;  1FJG E;  3HUL A;  5FWK A;  2ZM6 I;  2YTO A;  3MHS C;  2EMI A;  4X62 I;  2LV2 A;  5AC4 A;  2F4V I;  1Z0E A;  4FWH A;  2L2K B;  3P1X A;  1EI1 A;  4DUY E;  3WU5 A;  5BR8 E;  2PO2 A;  2B3T B;  4IS9 A;  2NN6 B;  4MU0 A;  2UXB I;  4HYM A;  2V83 A;  1X48 A;  1R6M A;  3K17 A;  3P06 A;  4JI1 E;  4ISA A;  4F6N A;  4JYA I;  3FIG A;  3QT8 A;  3T1H I;  3OTO I;  2A25 A;  4DR2 E;  2X36 A;  2NN6 E;  4YY3 E;  1NCS A;  4JI2 E;  5A6K A;  2O1W A;  2GQ0 A;  2EPK X;  4GKK I;  4WXD A;  2BA0 G;  3B4T A;  4X65 E;  5ADZ A;  4FW7 A;  5AE2 A;  4IZK A;  4DV6 I;  5T6J A;  2V2Z A;  4K0K I;  5LMU E;  1X6H A;  3JTZ A;  4JI0 I;  4B3T I;  3CWV A;  3PS2 A;  4DR7 I;  2RS7 A;  2EN7 A;  4J8Z A;  1PDA A;  5DRQ A;  5A69 A;  3WU3 A;  4IFD F;  1T4L B;  5GMD A;  1T38 A;  4JI7 E;  3M6A A;  4RPF A;  2JE6 B;  2K7I A;  4J3D A;  3KZY A;  1MG7 A;  4JV5 I;  1ZU1 A;  2YT4 A;  4DPX A;  1FNM A;  2UXC E;  1E3H A;  1RMD A;  2VF1 A;  4DR4 E;  3VYY A;  4JI8 I;  1ZBQ A;  2NN6 A;  1Z59 A;  2LMZ A;  1QU6 A;  5JEA C;  4NZV A;  1DAR A;  1ZM2 A;  1ZM4 A;  4U3D A;  1N34 E;  1XXE A;  1BBO A;  2ZIT A;  1I94 I;  2BM1 A;  1RHY A;  5KL3 A;  2DSY A;  4LF7 I;  1XHK A;  2YRM A;  2V2V A;  2E5L I;  3THO B;  2Z5C B;  3U1K A;  1N32 E;  2L3J A;  2NA2 A;  2GPI A;  2ODR C;  1NHJ A;  4GZN C;  2EOM A;  1Y60 A;  2NN6 C;  3BID A;  1HR0 I;  4LF5 E;  4BMJ A;  2EPR A;  4DV1 E;  1A1I A;  3K1J A;  2EN3 A;  4DV5 E;  2BR2 B;  1YYW A;  4OO1 F;  2ZM6 E;  4DR5 E;  4MYT A;  3J7Y p;  1VIS A;  2JE6 A;  2N8X A;  1Z5B A;  4P78 A;  2YSO A;  2JVA A;  2FTX B;  2F4V E;  4DPY A;  3C4B A;  2X7I A;  2LE2 A;  3PYG A;  1JK1 A;  4HAC B;  4AIM A;  4UT4 A;  4DR2 I;  2RQL A;  1DGC A;  2EL5 A;  1B62 A;  4YY3 I;  2UUA I;  2EQ3 A;  2UXB E;  3MSW A;  1EH7 A;  1LLM C;  2LUQ A;  2V85 A;  4MU4 A;  1J5E I;  4LFB I;  4JYA E;  2L33 A;  2PRT A;  3T1H E;  3OTO E;  4Q35 B;  1Z0V A;  1K47 A;  1MEY C;  4N4R B;  4BHC A;  4P52 A;  5C0X F;  2CT1 A;  4JG4 A;  4GKK E;  3KRN A;  4KWY A;  2G7H A;  4DV6 E;  4WFT A;  2Z5C A;  4K0K E;  1MGT A;  2BA1 D;  2HHH I;  4OO1 B;  2E1M A;  3VK6 A;  1IBL I;  4JI7 I;  2EMY A;  5IXM B;  4DR7 E;  2EOY A;  2EPC A;  4P7D A;  4DPT A;  2A2D A;  5JEA D;  2EPN A;  2EN8 A;  2J7J A;  2MC6 A;  1RR9 A;  2HKE A;  2EOS A;  2BR2 A;  1H7S A;  3QT7 A;  3F6H A;  1RC7 A;  4OO1 E;  1PJT A;  2YTP A;  2RSI A;  2EMC A;  3MHH C;  1A1J A;  4JV5 E;  1MX0 A;  1HK7 A;  4BA1 B;  2WZO A;  4URL A;  1N34 I;  5A2Q Q;  4HAC A;  1WUU A;  3RMP A;  1Y4U A;  2KOU A;  1H73 A;  4IFD C;  4JI8 E;  4N3O A;  2LCE A;  2ODR D;  1N33 E;  3OML A;  5C0X B;  3HJC A;  2O3Z A;  3ADL A;  2YWQ A;  3KWR A;  4KQV A;  2NN6 D;  2EWL A;  5KL5 A;  4M2Z A;  1I94 E;  2B7T A;  2EN2 A;  2IES A;  4DU8 A;  2HK2 A;  2JP9 A;  4X66 E;  4F9C B;  4MYU A;  2EMW A;  5C0X E;  2IER A;  1NHI A;  3IWB A;  2EN4 A;  4R2R A;  4LF7 E;  2XEX A;  1X3C A;  2CPN A;  2MDR A;  2E5L E;  4LF8 I;  3ADJ A;  2CGE A;  3QG5 C;  3C6K A;  4IZJ D;  1Z0B A;  4OO1 A;  2RSM A;  1R6L A;  4DR5 I;  4JI6 I;  2UUB E;  4KHP I;  4DU7 A;  1FKA E;  2EN6 A;  5DRO A;  4BS9 A;  4BBY A;  1HR0 E;  3M7N G;  2R76 A;  1Z0W A;  1TF3 A;  1UDO A;  2EM3 A;  3GCM A;  1N36 E;  2YTJ A;  4R2C A;  3HQ1 A;  4M1K A;  4NXN I;  4BA1 A;  2WP8 B;  4WPY A;  2UU9 I;  3UHM A;  3M99 B;  4O24 A;  3THN A;  3EPK A;  4PRX A;  1D6T A;  1UN6 B;  4B3M I;  2PNL A;  1UEK A;  4ZVI A;  2HK3 A;  2UXD I;  2MKN A;  5CFF E;  1YUJ A;  1J26 A;  2UUA E;  5C0X A;  2LTR A;  5LLQ A;  2GHF A;  1J5E E;  1P47 A;  4LFB E;  2CZ9 A;  3LNU A;  1A1L A;  4X8W A;  5A2Q C;  4ED4 A;  5DNX A;  2YU5 A;  4LU9 A;  4O5G A;  4AM3 A;  1RRE A;  4F9A B;  3J7A M;  5K36 B;  3IWC A;  3WU4 A;  2EMK A;  2L2M A;  2HHH E; 
#chains in the Genus database with same CATH homology
 4NXM I;  1IBL E;  4B3R I;  2DB2 A;  3C4T A;  4DKK A;  1PIE A;  4DUZ E;  2K4V A;  4DR3 I;  1PKP A;  4DV4 I;  1XMO E;  2V88 A;  2NUF A;  3ZM7 A;  1N33 I;  1RQ0 A;  2B7V A;  1USV A;  2VF3 A;  3B8H A;  3V5R A;  3J80 C;  4LTY A;  4X66 I;  2Q2E B;  3ZKD A;  3LML A;  2AJ4 A;  3H4L A;  2JOB A;  4DR1 E;  2Z5B B;  1H74 A;  1KVK A;  2RS6 A;  2HFS A;  4F54 A;  2UUB I;  1OJ4 A;  3AV0 A;  1HNX E;  4LF8 E;  4AQY E;  5AE3 A;  2R3V A;  1N36 I;  4JI6 E;  2J7K A;  3JAM Q;  4KHP E;  4LF4 E;  4M0V A;  2DMY A;  2L6M A;  1KTV A;  3PYD A;  4DPW A;  2LRS A;  4YHH I;  2NUE A;  1GZ6 A;  1S4E A;  2OI2 A;  4DMI A;  4DV2 E;  2NPF A;  4NXN E;  2O1T A;  2UU9 E;  4X64 I;  2KHX A;  3HPS A;  1Z0G A;  2R42 A;  4B3M E;  2H36 X;  2UXD E;  1PVG A;  1ELO A;  5FLX Q;  2HFU A;  1Y6Z A;  3QT5 A;  1U2R A;  4BCA A;  3B82 A;  2RTX A;  4GKJ I;  4LFA I;  2Z5B A;  1ZM3 A;  1USU A;  3Q6M A;  2V2Q A;  1WHN A;  4B3S I;  4DV0 I;  1EKZ A;  3J81 Q;  4DUZ I;  1HNW I;  4L8N A;  4FWD A;  2WW4 A;  4LFC I;  1XMO I;  4NXM E;  4B3R E;  3B78 A;  3F0N A;  4TUG A;  5F3W A;  4DR3 E;  2DEJ A;  4JI3 I;  1A6F A;  4DV4 E;  4OOG C;  2HKJ A;  1S16 A;  3VYX A;  2F8B A;  3JAM C;  2LTS A;  4DR1 I;  1EA6 A;  2N3H A;  1H7U A;  3ZZT A;  2M7Q A;  2LUP B;  3HXL A;  2GS8 A;  2L8T A;  3LLH A;  1X47 A;  1HNX I;  1O0W A;  1IBM I;  1XNQ I;  5LL6 R;  4AQY I;  1H72 C;  3K6Q A;  1N0U A;  2NUG A;  2VQF I;  4LF4 I;  3J80 Q;  5FLX C;  1YYK A;  4USK A;  3Q6N A;  4KZS A;  2V34 A;  4DV2 I;  3ADG A;  2JWO A;  5IT9 Q;  4DV3 I;  4YHH E;  2O1U A;  3J81 C;  4P7A A;  3IWD A;  1KKH A;  2IOQ A;  4PU9 A;  5DNY A;  4X64 E;  1N0V C;  5GME A;  1XMQ I;  3D4J A;  3T1Y I;  1QZR A;  4I8O A;  1HNZ I;  1DI2 A;  1UIL A;  4HY1 A;  2BM0 A;  4BC9 A;  4GKJ E;  4LFA E;  4UTG A;  3V2U C;  1ZBT A;  1UHZ A;  4B3S E;  4DV0 E;  2A2C A;  4PRV A;  2LJH A;  3LTO A;  1HNW E;  4DPU A;  1T4N A;  4FW9 A;  4LFC E;  2MC5 A;  3ZZ0 A;  4IZJ B;  3QT6 A;  1Z0T A;  4WYQ B;  5LMN I;  1BKN A;  2O1V A;  2L92 A;  5AE1 A;  4JI3 E;  1Z5C A;  4GEQ B;  2KON A;  5IWA I;  2VQE I;  2V89 A;  1YYO A;  1FWK A;  4USM A;  2UUC E;  4LF6 I;  4DR6 I;  1WXR A;  1B63 A;  2V8Q B;  3ZKB A;  1XNR I;  2YZT A;  4M30 A;  1STU A;  5IT9 C;  3DF6 A;  3ZOQ B;  2EFG A;  2V8P A;  2BV3 A;  1IBM E;  4JI5 E;  1XNQ E;  4R8O A;  4L5N C;  4F9B B;  2L3C A;  2VQF E;  4JI4 I;  2M4I A;  2JR1 A;  4DV7 I;  3JU0 A;  2E1R A;  4BC7 A;  4IZJ A;  4LF9 I;  4OX9 I;  1IBK I;  1FJG I;  3AUZ A;  4DV3 E;  4WUD A;  1X49 A;  3HPZ A;  1GQE A;  3ZZU A;  4TUI A;  4DUY I;  2LJP A;  5BR8 I;  1WHQ A;  1XMQ E;  3T1Y E;  4X62 E;  2CG9 A;  4Q28 A;  1SR9 A;  3WU6 A;  4I3H A;  1HNZ E;  3PYE A;  3PYF A;  1FWL A;  4JI1 I;  1Y4S A;  2L2N A;  4WUC A;  4JI2 I;  2DIX A;  2IOP A;  2LBS B;  2M1S A;  4WUB A;  4Z7Y A;  4X65 I;  5LMU I;  1ZXN A;  2B9D A;  5L3J A;  1NZ0 A;  1KIJ A;  2DEI A;  2FV4 B;  2N3G A;  1DQ3 A;  4FN5 A;  4JI0 E;  5LMN E;  4B3T E;  3F6G A;  5AAS A;  2UUC I;  4XTJ A;  3Q1Q A;  2Z5E A;  2JOX A;  2EZ6 A;  4Z7C A;  3H09 A;  3PRY A;  2PNM A;  5IWA E;  2VQE E;  1ZM9 A;  4HXZ A;  2UXC I;  1FI4 A;  1Z5A A;  4DR4 I;  4LF6 E;  1NHH A;  4DR6 E;  2FGG A;  4JI5 I;  1XNR E;  3K85 A;  4FWG A;  1YZ9 A;  2VE7 C;  1T4O A;  3J7A G;  1Z0C A;  2ZBK B;  4DXL A;  2V87 A;  4R03 A;  4WSP A;  3DJW A;  4IZK B;  3ADI A;  4JI4 E;  1N32 I;  2JY9 A;  3HTX A;  4DV7 E;  1MU5 A;  1ZXM A;  4EMD A;  2V86 A;  4R1F A;  4LF9 E;  4LF5 I;  4DV1 I;  4OX9 E;  4DV5 I;  1IBK E;  3LPS A;  2IHR 1;  3GON A;  3HUL A;  1FJG E;  5FWK A;  2ZM6 I;  4X62 I;  2F4V I;  1Z0E A;  4FWH A;  2L2K B;  3P1X A;  1EI1 A;  4DUY E;  3WU5 A;  5BR8 E;  2B3T B;  2UXB I;  4HYM A;  2V83 A;  1X48 A;  3K17 A;  3P06 A;  4JI1 E;  4JYA I;  3FIG A;  3QT8 A;  3T1H I;  3OTO I;  4DR2 E;  2X36 A;  4YY3 E;  4JI2 E;  2O1W A;  2GQ0 A;  4GKK I;  4X65 E;  5ADZ A;  4IZK A;  5AE2 A;  4DV6 I;  5T6J A;  2V2Z A;  4K0K I;  5LMU E;  4JI0 I;  3JTZ A;  4B3T I;  3CWV A;  4DR7 I;  2RS7 A;  4J8Z A;  3WU3 A;  1T4L B;  5GMD A;  4JI7 E;  3M6A A;  4RPF A;  1MG7 A;  4JV5 I;  2YT4 A;  4DPX A;  1FNM A;  2UXC E;  2VF1 A;  4DR4 E;  3VYY A;  4JI8 I;  1ZBQ A;  1Z59 A;  2LMZ A;  1QU6 A;  1DAR A;  1ZM2 A;  1ZM4 A;  1N34 E;  2ZIT A;  1I94 I;  2BM1 A;  2DSY A;  4LF7 I;  1XHK A;  2V2V A;  2E5L I;  2Z5C B;  1N32 E;  2L3J A;  2NA2 A;  2ODR C;  1NHJ A;  1HR0 I;  4LF5 E;  4BMJ A;  4DV1 E;  3K1J A;  4DV5 E;  1YYW A;  2ZM6 E;  4DR5 E;  4MYT A;  3J7Y p;  1VIS A;  1Z5B A;  4P78 A;  2JVA A;  2FTX B;  2F4V E;  4DPY A;  3C4B A;  2X7I A;  2LE2 A;  3PYG A;  4HAC B;  4UT4 A;  4DR2 I;  4YY3 I;  1B62 A;  2UUA I;  2UXB E;  3MSW A;  2LUQ A;  2V85 A;  1J5E I;  4LFB I;  4JYA E;  2L33 A;  3T1H E;  3OTO E;  1Z0V A;  1K47 A;  4P52 A;  4JG4 A;  4GKK E;  2G7H A;  4DV6 E;  4WFT A;  2Z5C A;  4K0K E;  2HHH I;  2E1M A;  3VK6 A;  1IBL I;  4JI7 I;  4DR7 E;  4P7D A;  4DPT A;  2A2D A;  2MC6 A;  1RR9 A;  2HKE A;  3QT7 A;  1H7S A;  3F6H A;  1RC7 A;  1MX0 A;  4JV5 E;  4URL A;  1HK7 A;  2WZO A;  1N34 I;  5A2Q Q;  4HAC A;  1WUU A;  3RMP A;  1Y4U A;  2KOU A;  1H73 A;  4JI8 E;  4N3O A;  2ODR D;  1N33 E;  3OML A;  3HJC A;  3ADL A;  3KWR A;  4KQV A;  2EWL A;  4M2Z A;  1I94 E;  2B7T A;  4DU8 A;  2HK2 A;  4X66 E;  4F9C B;  4MYU A;  1NHI A;  3IWB A;  2XEX A;  4LF7 E;  2CPN A;  2MDR A;  2E5L E;  4LF8 I;  3ADJ A;  2CGE A;  4IZJ D;  1Z0B A;  2RSM A;  4DR5 I;  4JI6 I;  2UUB E;  4KHP I;  4DU7 A;  1FKA E;  4BS9 A;  4BBY A;  1HR0 E;  1Z0W A;  1N36 E;  4M1K A;  3HQ1 A;  4NXN I;  2UU9 I;  4WPY A;  1D6T A;  4PRX A;  4B3M I;  2PNL A;  1UEK A;  4ZVI A;  2HK3 A;  2UXD I;  5CFF E;  1J26 A;  2UUA E;  2LTR A;  1J5E E;  4LFB E;  2CZ9 A;  3LNU A;  4X8W A;  5A2Q C;  4ED4 A;  4LU9 A;  1RRE A;  4F9A B;  3J7A M;  3IWC A;  3WU4 A;  2L2M A;  2HHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...