1HNZE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnzE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzE02
5BR8I 4DR1I 4B3TE 2LUPB 4JI8I 2UUAE 1H74A 5IT9C 3C4TA 4LFBE 1X47A 1PIEA 4X64I 2HHHE 2VF3A 1ZM9A 4WUDA 4DUZI 2DIXA 2AJ4A 1T4NA 3J7Yp 2V2QA 1U2RA 3J80C 2RS7A 3JAMQ 4DPXA 4URLA 3H4LA 1O0WA 1XNQI 4DV4I 4LF9I 2UUCE 3F0NA 1X49A 4JI6E 4OX9I 4LF4I 2J7KA 1UHZA 4OOGC 5FLXQ 1FJGI 1KVKA 4X65I 5GMDA 5GMEA 1N36I 1IBKI 4DR2I 4JI2E 5LMUE 1ZM2A 4DPWA 3P1XA 3T1HI 2EFGA 4USMA 1ZXNA 4AQYI 4JI4E 1Z5AA 2RTXA 1IBMI 1UILA 4JI5I 2NUGA 1KTVA 1HNXE 4DV0I 4UTGA 1XNRI 4DUYE 1VISA 2UXCE 2CZ9A 1N33I 1Z0WA 4KQVA 4LF5I 4B3SI 3J81Q 4LFAE 1FWLA 3ZZTA 2VQFI 3LPSA 1XMOE 2GS8A 1XMQE 2HK3A 1EA6A 2A2DA 4R1FA 3ADJA 4M1KA 2NUFA 4JI1I 4DR7I 1RREA 1KKHA 2LTRA 1NZ0A 3QT6A 4GKKE 1Z5BA 4M2ZA 4JI7I 1Z0VA 5IT9Q 1YYKA 3WU4A 4DU7A 4DV2E 3QT5A 1HNZE 4I3HA 1NHIA 4JI3E 4DV1I 4WUBA 1N32E 1H73A 3OTOI 3WU5A 2RS6A 4JI0E 3QT7A 4LF6E 2IHR1 1WHQA 4JYAI 4X66E 2EZ6A 2V2ZA 1HR0E 4DR5I 1FNMA 2UU9I 4LF7E 2JY9A 3J7AG 1T4LB 5IWAE 4B3ME 2HFSA 2VQEI 1I94E 2L2MA 3ZZUA 2V2VA 2LUQA 3ADLA 4FWHA 4X8WA 3VYXA 4NXNE 2HK2A 4B3RI 4MYUA 3WU3A 1MU5A 1H72C 2DEJA 4NXME 5CFFE 4DR4E 2HFUA 1GQEA 4DV5E 4ZVIA 4HACA 2UUCI 4JI6I 1J5EE 4DU8A 3V5RA 2LTSA 2ZBKB 1DARA 4DR6E 5BR8E 2V34A 4JI2I 5LMUI 5LL6R 1MX0A 1PVGA 3ZKBA 2UXDI 2YT4A 1ZM4A 1ELOA 4X64E 4YY3E 4DPUA 4JI4I 2V8PA 1BKNA 1HNXI 2X7IA 3PYDA 3ZKDA 1FWKA 1WHNA 3ZZ0A 2A2CA 3PYEA 1IBLE 1XNQE 4DUYI 4DV4E 2UUBE 4X62E 4LF4E 1NHHA 1FJGE 2BM0A 4LFAI 4X65E 1H7UA 5A2QC 1N36E 1XMOI 1N34I 4WYQB 4UT4A 2L2NA 4GKJE 2N3GA 5L3JA 1Z59A 2LJPA 2DMYA 2NUEA 4DR3I 4LF8E 2NPFA 4EMDA 1K47A 3J7AM 3ADGA 2XEXA 4GKKI 3T1YI 2L33A 4RPFA 2L2KB 2X36A 2Q2EB 3C4BA 3D4JA 4DV2I 2UXBE 3LNUA 3ZM7A 1UEKA 4K0KI 4JI3I 4LF5E 1N32I 2E5LE 2VQFE 4DV7E 3HULA 4JI0I 4LF6I 1RR9A 4M30A 1Z0CA 4X66I 2B3TB 4HY1A 1FKAE 2LJHA 4JI7E 4FW9A 1EI1A 3Q1QA 5IWAI 4B3MI 4DKKA 4DXLA 4DV3E 1OJ4A 4DV6I 1RQ0A 4FWDA 1MG7A 4YHHE 2CPNA 5LMNE 1I94I 3LTOA 2DEIA 4B3TI 4JYAE 2UUAI 2RSMA 4LFBI 4FWGA 1KIJA 2LRSA 5A2QQ 2HHHI 4NXMI 4KHPE 4DPTA 3CWVA 4DR4I 2UU9E 4DV5I 4JV5E 2ZM6E 1XHKA 1HNWE 1J5EI 1Z0TA 3HTXA 2NA2A 2VQEE 2L3CA 1NHJA 4LFCE 2MDRA 4DR6I 1D6TA 2F4VE 4P52A 2OI2A 4DR1E 4ED4A 1A6FA 2JVAA 4B3RE 4JI8E 1T4OA 4YY3I 1QZRA 4HYMA 4DUZE 1X48A 1PKPA 3PYGA 2E1RA 1IBLI 2UUBI 4X62I 3B82A 1N0VC 4XTJA 4P7AA 2BV3A 3QT8A 4LF9E 3V2UC 2UXCI 3VYYA 4OX9E 1S16A 1ZM3A 2L3JA 4GKJI 1IBKE 1FI4A 2UXDE 4DR2E 2HKJA 1XMQI 1B63A 1YYWA 4LF8I 1Z0BA 4Z7CA 3K17A 1Z5CA 3T1HE 2R42A 4AQYE 1YZ9A 1IBME 4JI5E 2KHXA 1S4EA 1QU6A 2UXBI 2BM1A 4FN5A 1Z0EA 4DV0E 1N0UA 1XNRE 4PRVA 2N3HA 2E5LI 4HACB 1HNZI 1N33E 1WUUA 4DV7I 1N34E 1Z0GA 4B3SE 1H7SA 3B78A 4USKA 1B62A 1RC7A 2WW4A 2DB2A 4DR3E 4WFTA 3JAMC 3WU6A 3K1JA 4JI1E 3T1YE 2B7VA 4DR7E 4Z7YA 2R3VA 5FLXC 1HR0I 2ZITA 1EKZA 3PYFA 4LF7I 1ZBTA 4DV3I 2LBSB 4HXZA 4K0KE 2HKEA 4JG4A 4YHHI 5LMNI 4DV1E 1STUA 2B7TA 3J80Q 3OTOE 4WUCA 4PRXA 3LLHA 3M6AA 4NXNI 4KHPI 3J81C 4DR5E 1DI2A 4JV5I 2ZM6I 1HNWI 3GONA 4DV6E 3ADIA 3B8HA 4PU9A 4LFCI 1YYOA 1J26A 2F4VI 4DPYA 4MYTA 1ZXMA
chains in the Genus database with same CATH superfamily
1DGCA 4ZYGA 3KRNA 5BR8I 4DR1I 4B3TE 1X6HA 2LUPB 3HPSA 3QG5C 2EOZA 4JI8I 2ENCA 5IT9C 2UUAE 1H74A 4IFDB 3C4TA 4LFBE 1X47A 1TN9A 2O3ZA 1SFEA 2DSYA 2EWLA 1PIEA 2EL4A 4X64I 2HHHE 2VF3A 1ZM9A 1ZU1A 3KZZA 5A69A 5A6BD 1KYQA 2NN6D 1WXRA 2Z5EA 4DUZI 2DIXA 4FW7A 2V83A 2EMGA 2EMWA 2EOJA 2VF1A 1BBGA 2I13A 1T4NA 2AJ4A 3J7Yp 2M1SA 2PNLA 2V2QA 1U2RA 3J80C 2RS7A 2JOBA 4ZYHA 2PNZA 3JAMQ 2YU8A 2EM3A 2LT7A 1RMDA 2O1UA 4FW6A 4DPXA 4URLA 3H4LA 1O0WA 2FGGA 2MKDA 1XNQI 2EM0A 4DV4I 2UUCE 4LF9I 2J65A 3F0NA 1X49A 4JI6E 4OX9I 1L4SA 3EPJA 4LF4I 2C38B 2J7KA 1UHZA 4OOGC 4F2JC 5FLXQ 1FJGI 1KVKA 4X65I 4OO1C 2E1MA 5GMDA 5GMEA 1MEYC 1N36I 1IBKI 4DR2I 4JI2E 5LMUE 4O5GA 2I9IA 2LCEA 4M0VA 5AASA 1ZM2A 2YTPA 2WNRB 4DPWA 5JEAB 2KOUA 4IFDF 3M7NG 4R03A 2D9HA 1X6FA 3H1CA 2F8BA 3P1XA 4LCFA 1P42A 2EFGA 2JEBA 2Z5CA 3T1HI 2B9DA 4USMA 2C39A 4MDTA 4TUIA 1A1JA 1YUIA 1ZXNA 4JI4E 4ZYEA 1JK2A 1Z5AA 4AQYI 2RTXA 1IBMI 4R2CA 2CT1A 1UILA 2ODRC 4JI5I 4OKGA 2NUGA 1KTVA 1HNXE 1LLMC 4DV0I 4LOMA 4UTGA 1XNRI 1ZAAC 4DUYE 1VISA 2YTNA 2UXCE 2CZ9A 4F9AB 1N33I 1Z0WA 3P3GA 4KQVA 4LF5I 3DJWA 1UBDC 4B3SI 3J81Q 1A1IA 4LFAE 1FWLA 3ZZTA 2VQFI 2NABA 3LPSA 1XMOE 2GS8A 1XMQE 2HK3A 5JEAF 2YZTA 1EA6A 2A2DA 2CVEA 2YRHA 4R2AA 4R1FA 3UHMA 2YSOA 3ADJA 4RHBB 2EORA 2NUFA 4M1KA 1Y4SA 2CGEA 2VESA 4JI1I 4BA2A 2H36X 2VRDA 4DR7I 1RREA 1KKHA 2E72A 2LTRA 1NZ0A 4IS1C 2EN8A 2EOQA 4GKKE 4R2EA 3QT6A 1Z5BA 4M2ZA 5K36B 4JI7I 4IZJA 2EOHA 2LO3A 1Z0VA 2PNZB 4NHRA 5IT9Q 4N3OA 1YYKA 4BC7A 3WU4A 4DU7A 1YSAC 4QNJA 4DV2E 2PO1B 1T38A 1UDSA 3QT5A 2YTDA 1HNZE 4I3HA 1NHIA 5DROA 4JI3E 1R6LA 4WUBA 4DV1I 1N32E 1H73A 2R1FA 4KWYA 2HGHA 3P06A 3OTOI 4IFDC 3WU5A 4BC9A 1UDOA 2RS6A 4JI0E 2V8QB 3QT7A 4LF6E 1RHYA 4F54A 3EPKA 2PNMA 2IHR1 4O24A 1WHQA 4BHCA 4JYAI 2GPIA 4R2DA 4X66E 2C37A 2JE6B 2EZ6A 4RH8A 2JEBB 1QNTA 2Z5CB 4IZJD 3VK6A 2V2ZA 2K7IA 3EQ1A 1JK1A 2EN6A 2LE2A 1HR0E 4DR5I 5K36F 3M85G 4WXDA 1FNMA 2UU9I 4LF7E 1YHCA 1ZR9A 2JY9A 2EL5A 2YRKA 3J7AG 1T4LB 5IWAE 1IQOA 2HHHI 4B3ME 4FW3A 1EH6A 3ZOQB 2WCC3 4QNKA 5DRPA 2HFSA 4O43A 4HEIA 2JT2A 5JEAC 2VQEI 2L92A 1YPNA 1I94E 4MQYA 2L2MA 3MHHC 3P76A 1MGTA 3ZZUA 2V2VA 1Y60A 2JXPA 2LUQA 3ADLA 1WJPA 4FWHA 1UDQA 4X8WA 3VYXA 4NXNE 2HK2A 5ELWA 4B3RI 1IQSA 2MKNA 4MYUA 5C0XB 3WU3A 1MU5A 1H72C 5DRQA 2DEJA 3DD6A 2EOIA 4BHBA 4NXME 2BA1G 5CFFE 4BMJA 4DR4E 2HFUA 1GQEA 4DV5E 2BR2B 1X5WA 3F6HA 2ADRA 3IWDA 4ZVIA 3AV0A 2EMCA 4HACA 2UUCI 2EMAA 2EJ4A 2V86A 4JI6I 2J7JA 1J5EE 4LCHA 1OYSA 4MU1A 4DU8A 3V5RA 2BA0D 2LTSA 4Q35B 2MDGA 3IWBA 2ZBKB 2ENHA 4DR6E 5BR8E 1DARA 2V34A 2EN3A 1YH8A 2GO4A 3PS3A 3H09A 3KWRA 2WP8A 5LMUI 4JI2I 5LL6R 1MX0A 2VE7C 1PVGA 1NEIA 1GZ6A 3ZKBA 2UXDI 1Y5YA 4OO1E 2YT4A 1EH8A 1ZM4A 5K36C 2EOOA 1Y6ZA 1ELOA 4X64E 5C0XF 1E3HA 2JP9A 1Y4UA 2CG9A 4LPFA 2IESA 3B4TA 4YY3E 2BB8A 2IOPA 2PO0A 4DPUA 2O1VA 4R2PA 1G2FC 2M4IA 4JI4I 2YTEA 4WSPA 4BCAA 2EE8A 1BBOA 3HKMA 1SR9A 2V8PA 1BKNA 1HNXI 4F9BB 1XXEA 2X7IA 3PYDA 3ZKDA 1FWKA 1WHNA 3ZZ0A 2A2CA 3PYEA 4IZKB 2ENAA 1IBLE 1XNQE 2NN6B 4DUYI 4DV4E 2UUBE 3CDIA 2EP3A 2G7HA 4X62E 2N8XA 3VHTB 2LVHA 4LF4E 1NHHA 5IXMB 1FJGE 2BM0A 2GLIA 3U1YA 5A6AA 4OO1D 4LFAI 4X65E 1H7UA 3FIGA 5KL6A 5A2QC 1N36E 1XMOI 1N34I 3OMLA 2YTFA 4WYQB 4UT4A 4BA1B 2L2NA 3ECRA 4P78A 2N3GA 3MSWA 2V87A 4GKJE 2YSPA 1Z59A 5L3JA 2LJPA 2DMYA 3P3CA 3BF2A 2NUEA 4DR3I 4LF8E 2NPFA 2EPPA 4EMDA 2RPCA 4ZYDA 1K47A 5KL4A 1X3CA 3J7AM 3ADGA 3L00A 2XEXA 4GKKI 3T1YI 2ODRD 2L33A 2RQLA 4RPFA 2L2KB 4GEQB 3THOB 2X36A 4L8NA 2ELZA 2EPLX 2Q2EB 2NN6F 3C4BA 3D4JA 4BBYA 4DV2I 2GO3A 3RMPA 4F6NA 2UXBE 3LNUA 3ZM7A 1UEKA 4K0KI 4JI3I 3M7ND 4LF5E 1N32I 4R2QA 2JR1A 2E5LE 2VQFE 2FTXB 2HC5A 4DV7E 2EPNA 2M7QA 3HULA 4LCGA 4JI0I 5C0XC 4FK5C 5AC4A 4LF6I 2EM2A 1RR9A 2EMBA 2PO2A 4IFDA 2EOXA 4M30A 4I8OA 4IFDE 1Z0CA 2O1WA 4X66I 3GLLA 1GTKA 1YFHA 3AUZA 1AAYA 4WXCA 2B3TB 1EH7A 4X9JA 4HY1A 1FKAE 3HPZA 3L7ZA 1ZBQA 2LJHA 4JI7E 2C39B 1BB8A 2EM6A 4FW9A 2LJUA 1EI1A 3K85A 2RSIA 3Q1QA 5IWAI 1OYRA 4B3MI 4DKKA 2JEAA 3THNA 4DXLA 1DQ3A 5FWKA 2YWQA 4DV3E 2YRMA 1OJ4A 2C38A 4KZSA 2F1DA 4DV6I 1RQ0A 4FWDA 1MG7A 2DMIA 2EN2A 2EQ3A 2EQ0A 2L6MA 5AE1A 2JPAA 2IERA 4IS9A 4IFDD 4YHHE 2CPNA 3GCMA 2JYAA 5LMNE 1I94I 3LTOA 5TSEA 2MC5A 2YU5A 2DEIA 2WNRA 5AC5A 5JEAA 3KZYA 5JEAE 3JTZA 4B3TI 4WX9A 3LMLA 4JYAE 4U3BA 2EQ1A 4L5NC 1TF3A 2UUAI 2EMLA 2RSMA 4AM3A 4LFBI 4FWGA 1KIJA 2LV2A 2DLKA 2GHFA 2LRSA 1UDNA 2EMYA 2ELYA 2V89A 4KHPE 4DPTA 5A2QQ 5A6KA 2NN6C 4NXMI 3CWVA 4DR4I 2UU9E 2EPCA 4DV5I 3U1KA 2HJJA 3K6QA 4J8ZA 4BA2B 5KL3A 4JV5E 2ZM6E 5KL2A 1A1KA 4NZVA 1XHKA 4IZJB 2EMKA 1HNWE 4R2RA 2EOMA 1USUA 1J5EI 4N4RB 2YPNA 1Z0TA 3HTXA 2NA2A 5JEAD 2VQEE 2L3CA 1P47A 4LFCE 1NHJA 2MDRA 4DR6I 1D6TA 5ADZA 2F4VE 2V85A 2WBTA 4P52A 4R8OA 2OI2A 4MU3A 4DR1E 1PDAA 4P7DA 4GZNC 2PO2B 4ED4A 3M85D 1N3GA 2A25A 3C6KA 2JVAA 3M99B 1A6FA 4B3RE 4JI8E 2KONA 1T4OA 4OO1A 2EMFA 3CDJA 4YY3I 3HQ1A 4R2SA 1QZRA 4HYMA 2C37B 4LU9A 5K36A 4DUZE 5K36E 2BBGA 3L7ZB 1X48A 4HTGA 2YTQA 5DNLA 5F3WA 2Q8UA 5A6JA 2YTOA 4MLQA 3JU0A 1PKPA 3PYGA 2E1RA 1TF6A 2PO1A 1IBLI 1A1GA 2UUBI 2EN7A 2JEAB 4X62I 1PJSA 3B82A 1N0VC 4XTJA 4P7AA 5LLQA 3PS2A 2JOXA 4MU0A 2BV3A 2GQ0A 4LF9E 3QT8A 3V2UC 2UXCI 4IJDA 3VYYA 4OX9E 1USVA 2O1TA 1S16A 1ZM3A 2YTGA 2L3JA 4GKJI 2EM7A 1F2IG 1IBKE 2BA1D 1FI4A 2EL6A 4DR2E 2UXDE 2HKJA 1XMQI 5K36D 2JE6A 1B63A 1YYWA 4GQUA 4LF8I 3MHSC 1Z0BA 2Z5BA 1WRJA 2EPAA 2AE8A 4Z7CA 1PJQA 3K17A 1G2DC 1NCSA 2M9AA 4WUDA 1Z5CA 2EMZA 3T1HE 4J3DA 2IOQA 2EPKX 4Q28A 2EM9A 1R6MA 2R42A 5KL7A 4AQYE 2CTDA 1YZ9A 1IBME 2EPZA 1IMUA 4JI5E 2KHXA 1S4EA 2YTIA 1VI7A 1A1LA 1QU6A 3NZKA 2BM1A 2WBUA 4FN5A 1Z0EA 1A1HA 2UXBI 4DV0E 1N0UA 2DRPA 1XNRE 3HJCA 2L8TA 4PRVA 2DLQA 2N3HA 2EMIA 2DGCA 4HACB 2E5LI 1HNZI 1N33E 1WUUA 4DV7I 4TUGA 1N34E 1OYPA 2EM4A 1Z0GA 4U3DA 4B3SE 1H7SA 5KL5A 3EPLA 3P3EA 2EPXA 2EOSA 4O4KA 3B78A 4USKA 1A1FA 3EPHA 1KJKA 1RC7A 3BIDA 1B62A 2WW4A 2WP8B 2DB2A 4DR3E 4WFTA 5C0XA 4DMIA 3JAMC 3WU6A 4WSGA 5C0XE 2EPMX 4OO1B 2WZOA 3PS1A 2R76A 2YTJA 4MLVA 3K1JA 5DNYA 1HK7A 4JI1E 3T1YE 2EOEA 2B7VA 4DR7E 3PRYA 2R3VA 4Z7YA 5FLXC 1YUJA 2BR2A 1HR0I 2EPRA 2ZITA 3Q6NA 2PO0B 4F6MA 3BBGA 1EKZA 3PYFA 3DF6A 4LF7I 4OZEA 1ZBTA 2EPOA 2EMHA 2LBSB 4HXZA 4K0KE 4AIMA 2MC6A 4DV3I 2EM8A 5EL9A 4AIDA 2HKEA 5AE3A 4JG4A 4YHHI 5LMNI 4WPYA 4DV1E 1STUA 1AH5A 2B7TA 1X6EA 5C0XD 3J80Q 2V88A 2WBSA 3OTOE 2PRTA 4MU4A 3IWCA 2EM5A 5DRRA 5T6JA 4WUCA 3Q6MA 4PRXA 1T39A 3BGHA 3LLHA 3F6GA 4OO1F 5IV8B 2K4VA 2Z5BB 2JWOA 2BA0G 5AE2A 3M6AA 3C6MA 1B69A 4NXNI 2CSHA 2LMZA 4F9CB 4KHPI 3HXLA 2EOFA 1PJTA 1UN6B 3J81C 4NBQA 3GMEA 4DR5E 1DI2A 4JV5I 2ZM6I 4IZKA 5A6BA 2NN6A 1Z1BA 2EN1A 2NN6E 2FV4B 3GONA 1HNWI 4BS9A 4FW4A 4M9VC 1E3PA 3UK3C 5EKWA 4DV6E 2EMXA 2EPUA 3ADIA 4ISAA 3B8HA 2EN4A 2EOYA 4PU9A 4LFCI 4FW5A 1YYOA 4LTYA 1J26A 2F4VI 4DPYA 3TQMA 4MYTA 4BA1A 5DNXA 1ZXMA
chains in the Genus database with same CATH topology
5BR8I 4DR1I 4B3TE 2LUPB 3HPSA 4JI8I 5IT9C 2UUAE 1H74A 3C4TA 4LFBE 1X47A 2DSYA 2EWLA 1PIEA 4X64I 2HHHE 2VF3A 1ZM9A 4WUDA 4DUZI 2Z5EA 1WXRA 2DIXA 2V83A 2VF1A 2AJ4A 1T4NA 3J7Yp 2M1SA 2PNLA 2V2QA 1U2RA 3J80C 2RS7A 2JOBA 3JAMQ 4DPXA 2O1UA 4URLA 3H4LA 2FGGA 1O0WA 1XNQI 4DV4I 4LF9I 2UUCE 3F0NA 1X49A 4JI6E 4OX9I 4LF4I 2J7KA 1UHZA 4OOGC 5FLXQ 1FJGI 1KVKA 4X65I 2E1MA 5GMDA 5GMEA 1N36I 1IBKI 4DR2I 4JI2E 5LMUE 4M0VA 5AASA 1ZM2A 4DPWA 2KOUA 4R03A 2F8BA 3P1XA 3T1HI 2EFGA 2Z5CA 2B9DA 4USMA 4TUIA 1ZXNA 4AQYI 4JI4E 1Z5AA 2RTXA 1IBMI 2ODRC 1UILA 4JI5I 2NUGA 1KTVA 1HNXE 4DV0I 4UTGA 1XNRI 4DUYE 1VISA 2UXCE 2CZ9A 4F9AB 1N33I 1Z0WA 4KQVA 4LF5I 3DJWA 4B3SI 3J81Q 4LFAE 1FWLA 3ZZTA 2VQFI 3LPSA 1XMOE 2GS8A 1XMQE 2HK3A 2YZTA 1EA6A 2A2DA 4R1FA 3ADJA 4M1KA 2NUFA 1Y4SA 2CGEA 4JI1I 2H36X 4DR7I 1RREA 1KKHA 2LTRA 1NZ0A 3QT6A 4GKKE 1Z5BA 4M2ZA 4JI7I 4IZJA 1Z0VA 5IT9Q 4N3OA 1YYKA 4BC7A 3WU4A 4DU7A 4DV2E 3QT5A 1HNZE 4I3HA 1NHIA 4JI3E 4DV1I 4WUBA 1N32E 1H73A 3P06A 3OTOI 3WU5A 4BC9A 2RS6A 4JI0E 2V8QB 3QT7A 4LF6E 4F54A 2PNMA 2IHR1 1WHQA 4JYAI 4X66E 2EZ6A 2Z5CB 4IZJD 3VK6A 2V2ZA 2LE2A 1HR0E 4DR5I 1FNMA 2UU9I 4LF7E 2JY9A 3J7AG 1T4LB 5IWAE 4B3ME 3ZOQB 2HFSA 2VQEI 2L92A 1I94E 2L2MA 3ZZUA 2V2VA 2LUQA 3ADLA 4FWHA 4X8WA 3VYXA 4NXNE 2HK2A 4B3RI 4MYUA 3WU3A 1MU5A 1H72C 2DEJA 4NXME 5CFFE 4BMJA 4DR4E 2HFUA 1GQEA 4DV5E 3F6HA 3IWDA 4ZVIA 3AV0A 4HACA 2UUCI 2V86A 4JI6I 1J5EE 4DU8A 3V5RA 2LTSA 3IWBA 2ZBKB 1DARA 4DR6E 5BR8E 2V34A 3H09A 3KWRA 5LMUI 4JI2I 5LL6R 1MX0A 2VE7C 1PVGA 1GZ6A 3ZKBA 2UXDI 2YT4A 1ZM4A 1Y6ZA 1ELOA 4X64E 1Y4UA 2CG9A 4YY3E 2IOPA 4DPUA 4JI4I 2O1VA 2M4IA 4WSPA 4BCAA 1SR9A 2V8PA 1BKNA 1HNXI 4F9BB 2X7IA 3PYDA 3ZKDA 1FWKA 1WHNA 3ZZ0A 2A2CA 3PYEA 4IZKB 1IBLE 1XNQE 4DUYI 4DV4E 2UUBE 2G7HA 4X62E 4LF4E 1NHHA 1FJGE 2BM0A 4LFAI 4X65E 1H7UA 3FIGA 5A2QC 1N36E 1XMOI 1N34I 3OMLA 4WYQB 4UT4A 2L2NA 4GKJE 4P78A 2N3GA 3MSWA 2V87A 5L3JA 1Z59A 2LJPA 2DMYA 2NUEA 4DR3I 4LF8E 2NPFA 4EMDA 1K47A 3J7AM 3ADGA 2XEXA 4GKKI 3T1YI 2ODRD 2L33A 4RPFA 2L2KB 4GEQB 2X36A 4L8NA 2Q2EB 3C4BA 3D4JA 4BBYA 4DV2I 3RMPA 2UXBE 3LNUA 3ZM7A 1UEKA 4K0KI 4JI3I 4LF5E 1N32I 2JR1A 2E5LE 2VQFE 2FTXB 4DV7E 2M7QA 3HULA 4JI0I 4LF6I 1RR9A 4M30A 4I8OA 1Z0CA 2O1WA 4X66I 3AUZA 2B3TB 4HY1A 1FKAE 3HPZA 1ZBQA 2LJHA 4JI7E 4FW9A 1EI1A 3K85A 3Q1QA 5IWAI 4B3MI 4DKKA 4DXLA 1DQ3A 5FWKA 4DV3E 1OJ4A 4DV6I 4KZSA 1RQ0A 4FWDA 1MG7A 2L6MA 5AE1A 4YHHE 2CPNA 5LMNE 1I94I 3LTOA 2MC5A 2DEIA 3JTZA 4B3TI 3LMLA 4JYAE 4L5NC 2UUAI 2RSMA 4LFBI 4FWGA 1KIJA 2LRSA 5A2QQ 2HHHI 4NXMI 2V89A 4KHPE 4DPTA 3CWVA 4DR4I 2UU9E 4DV5I 3K6QA 4J8ZA 4JV5E 2ZM6E 1XHKA 4IZJB 1HNWE 1USUA 1J5EI 1Z0TA 3HTXA 2NA2A 2VQEE 2L3CA 1NHJA 4LFCE 2MDRA 4DR6I 1D6TA 5ADZA 2F4VE 2V85A 4P52A 4R8OA 2OI2A 4DR1E 4P7DA 4ED4A 1A6FA 2JVAA 4B3RE 4JI8E 2KONA 1T4OA 4YY3I 3HQ1A 1QZRA 4HYMA 4LU9A 4DUZE 1X48A 5F3WA 3JU0A 1PKPA 3PYGA 2E1RA 1IBLI 2UUBI 4X62I 3B82A 1N0VC 4XTJA 4P7AA 2JOXA 2BV3A 2GQ0A 4LF9E 3QT8A 3V2UC 2UXCI 3VYYA 4OX9E 1USVA 2O1TA 1S16A 1ZM3A 2L3JA 4GKJI 1IBKE 1FI4A 2UXDE 4DR2E 2HKJA 1XMQI 1B63A 1YYWA 4LF8I 1Z0BA 2Z5BA 4Z7CA 3K17A 1Z5CA 3T1HE 2IOQA 4Q28A 2R42A 4AQYE 1YZ9A 1IBME 4JI5E 2KHXA 1S4EA 1QU6A 2UXBI 2BM1A 4FN5A 1Z0EA 4DV0E 1N0UA 1XNRE 3HJCA 4PRVA 2L8TA 2N3HA 2E5LI 4HACB 1HNZI 1N33E 1WUUA 4DV7I 4TUGA 1N34E 1Z0GA 4B3SE 1H7SA 3B78A 4USKA 1B62A 1RC7A 2WW4A 2DB2A 4DR3E 4WFTA 4DMIA 3JAMC 3WU6A 2WZOA 3K1JA 5DNYA 1HK7A 4JI1E 3T1YE 2B7VA 4DR7E 3PRYA 2R3VA 4Z7YA 5FLXC 1HR0I 2ZITA 3Q6NA 1EKZA 3PYFA 3DF6A 4LF7I 1ZBTA 4DV3I 2LBSB 4HXZA 4K0KE 2MC6A 2HKEA 5AE3A 4JG4A 4YHHI 5LMNI 4WPYA 4DV1E 1STUA 2B7TA 3J80Q 2V88A 3OTOE 3IWCA 5T6JA 4WUCA 3Q6MA 4PRXA 3LLHA 3F6GA 2K4VA 2Z5BB 2JWOA 3M6AA 5AE2A 4NXNI 2LMZA 4F9CB 4KHPI 3HXLA 3J81C 4DR5E 1DI2A 4JV5I 2ZM6I 4IZKA 2FV4B 3GONA 1HNWI 4BS9A 4DV6E 3ADIA 3B8HA 4PU9A 4LFCI 1YYOA 4LTYA 1J26A 2F4VI 4DPYA 4MYTA 1ZXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 I;  4DR1 I;  4B3T E;  2LUP B;  4JI8 I;  2UUA E;  1H74 A;  5IT9 C;  3C4T A;  4LFB E;  1X47 A;  1PIE A;  4X64 I;  2HHH E;  2VF3 A;  1ZM9 A;  4WUD A;  4DUZ I;  2DIX A;  2AJ4 A;  1T4N A;  3J7Y p;  2V2Q A;  1U2R A;  3J80 C;  2RS7 A;  3JAM Q;  4DPX A;  4URL A;  3H4L A;  1O0W A;  1XNQ I;  4DV4 I;  4LF9 I;  2UUC E;  3F0N A;  1X49 A;  4JI6 E;  4OX9 I;  4LF4 I;  2J7K A;  1UHZ A;  4OOG C;  5FLX Q;  1FJG I;  1KVK A;  4X65 I;  5GMD A;  5GME A;  1N36 I;  1IBK I;  4DR2 I;  4JI2 E;  5LMU E;  1ZM2 A;  4DPW A;  3P1X A;  3T1H I;  2EFG A;  4USM A;  1ZXN A;  4AQY I;  4JI4 E;  1Z5A A;  2RTX A;  1IBM I;  1UIL A;  4JI5 I;  2NUG A;  1KTV A;  1HNX E;  4DV0 I;  4UTG A;  1XNR I;  4DUY E;  1VIS A;  2UXC E;  2CZ9 A;  1N33 I;  1Z0W A;  4KQV A;  4LF5 I;  4B3S I;  3J81 Q;  4LFA E;  1FWL A;  3ZZT A;  2VQF I;  3LPS A;  1XMO E;  2GS8 A;  1XMQ E;  2HK3 A;  1EA6 A;  2A2D A;  4R1F A;  3ADJ A;  4M1K A;  2NUF A;  4JI1 I;  4DR7 I;  1RRE A;  1KKH A;  2LTR A;  1NZ0 A;  3QT6 A;  4GKK E;  1Z5B A;  4M2Z A;  4JI7 I;  1Z0V A;  5IT9 Q;  1YYK A;  3WU4 A;  4DU7 A;  4DV2 E;  3QT5 A;  1HNZ E;  4I3H A;  1NHI A;  4JI3 E;  4DV1 I;  4WUB A;  1N32 E;  1H73 A;  3OTO I;  3WU5 A;  2RS6 A;  4JI0 E;  3QT7 A;  4LF6 E;  2IHR 1;  1WHQ A;  4JYA I;  4X66 E;  2EZ6 A;  2V2Z A;  1HR0 E;  4DR5 I;  1FNM A;  2UU9 I;  4LF7 E;  2JY9 A;  3J7A G;  1T4L B;  5IWA E;  4B3M E;  2HFS A;  2VQE I;  1I94 E;  2L2M A;  3ZZU A;  2V2V A;  2LUQ A;  3ADL A;  4FWH A;  4X8W A;  3VYX A;  4NXN E;  2HK2 A;  4B3R I;  4MYU A;  3WU3 A;  1MU5 A;  1H72 C;  2DEJ A;  4NXM E;  5CFF E;  4DR4 E;  2HFU A;  1GQE A;  4DV5 E;  4ZVI A;  4HAC A;  2UUC I;  4JI6 I;  1J5E E;  4DU8 A;  3V5R A;  2LTS A;  2ZBK B;  1DAR A;  4DR6 E;  5BR8 E;  2V34 A;  4JI2 I;  5LMU I;  5LL6 R;  1MX0 A;  1PVG A;  3ZKB A;  2UXD I;  2YT4 A;  1ZM4 A;  1ELO A;  4X64 E;  4YY3 E;  4DPU A;  4JI4 I;  2V8P A;  1BKN A;  1HNX I;  2X7I A;  3PYD A;  3ZKD A;  1FWK A;  1WHN A;  3ZZ0 A;  2A2C A;  3PYE A;  1IBL E;  1XNQ E;  4DUY I;  4DV4 E;  2UUB E;  4X62 E;  4LF4 E;  1NHH A;  1FJG E;  2BM0 A;  4LFA I;  4X65 E;  1H7U A;  5A2Q C;  1N36 E;  1XMO I;  1N34 I;  4WYQ B;  4UT4 A;  2L2N A;  4GKJ E;  2N3G A;  5L3J A;  1Z59 A;  2LJP A;  2DMY A;  2NUE A;  4DR3 I;  4LF8 E;  2NPF A;  4EMD A;  1K47 A;  3J7A M;  3ADG A;  2XEX A;  4GKK I;  3T1Y I;  2L33 A;  4RPF A;  2L2K B;  2X36 A;  2Q2E B;  3C4B A;  3D4J A;  4DV2 I;  2UXB E;  3LNU A;  3ZM7 A;  1UEK A;  4K0K I;  4JI3 I;  4LF5 E;  1N32 I;  2E5L E;  2VQF E;  4DV7 E;  3HUL A;  4JI0 I;  4LF6 I;  1RR9 A;  4M30 A;  1Z0C A;  4X66 I;  2B3T B;  4HY1 A;  1FKA E;  2LJH A;  4JI7 E;  4FW9 A;  1EI1 A;  3Q1Q A;  5IWA I;  4B3M I;  4DKK A;  4DXL A;  4DV3 E;  1OJ4 A;  4DV6 I;  1RQ0 A;  4FWD A;  1MG7 A;  4YHH E;  2CPN A;  5LMN E;  1I94 I;  3LTO A;  2DEI A;  4B3T I;  4JYA E;  2UUA I;  2RSM A;  4LFB I;  4FWG A;  1KIJ A;  2LRS A;  5A2Q Q;  2HHH I;  4NXM I;  4KHP E;  4DPT A;  3CWV A;  4DR4 I;  2UU9 E;  4DV5 I;  4JV5 E;  2ZM6 E;  1XHK A;  1HNW E;  1J5E I;  1Z0T A;  3HTX A;  2NA2 A;  2VQE E;  2L3C A;  1NHJ A;  4LFC E;  2MDR A;  4DR6 I;  1D6T A;  2F4V E;  4P52 A;  2OI2 A;  4DR1 E;  4ED4 A;  1A6F A;  2JVA A;  4B3R E;  4JI8 E;  1T4O A;  4YY3 I;  1QZR A;  4HYM A;  4DUZ E;  1X48 A;  1PKP A;  3PYG A;  2E1R A;  1IBL I;  2UUB I;  4X62 I;  3B82 A;  1N0V C;  4XTJ A;  4P7A A;  2BV3 A;  3QT8 A;  4LF9 E;  3V2U C;  2UXC I;  3VYY A;  4OX9 E;  1S16 A;  1ZM3 A;  2L3J A;  4GKJ I;  1IBK E;  1FI4 A;  2UXD E;  4DR2 E;  2HKJ A;  1XMQ I;  1B63 A;  1YYW A;  4LF8 I;  1Z0B A;  4Z7C A;  3K17 A;  1Z5C A;  3T1H E;  2R42 A;  4AQY E;  1YZ9 A;  1IBM E;  4JI5 E;  2KHX A;  1S4E A;  1QU6 A;  2UXB I;  2BM1 A;  4FN5 A;  1Z0E A;  4DV0 E;  1N0U A;  1XNR E;  4PRV A;  2N3H A;  2E5L I;  4HAC B;  1HNZ I;  1N33 E;  1WUU A;  4DV7 I;  1N34 E;  1Z0G A;  4B3S E;  1H7S A;  3B78 A;  4USK A;  1B62 A;  1RC7 A;  2WW4 A;  2DB2 A;  4DR3 E;  4WFT A;  3JAM C;  3WU6 A;  3K1J A;  4JI1 E;  3T1Y E;  2B7V A;  4DR7 E;  4Z7Y A;  2R3V A;  5FLX C;  1HR0 I;  2ZIT A;  1EKZ A;  3PYF A;  4LF7 I;  1ZBT A;  4DV3 I;  2LBS B;  4HXZ A;  4K0K E;  2HKE A;  4JG4 A;  4YHH I;  5LMN I;  4DV1 E;  1STU A;  2B7T A;  3J80 Q;  3OTO E;  4WUC A;  4PRX A;  3LLH A;  3M6A A;  4NXN I;  4KHP I;  3J81 C;  4DR5 E;  1DI2 A;  4JV5 I;  2ZM6 I;  1HNW I;  3GON A;  4DV6 E;  3ADI A;  3B8H A;  4PU9 A;  4LFC I;  1YYO A;  1J26 A;  2F4V I;  4DPY A;  4MYT A;  1ZXM A; 
#chains in the Genus database with same CATH topology
 1DGC A;  4ZYG A;  3KRN A;  5BR8 I;  4DR1 I;  4B3T E;  1X6H A;  2LUP B;  3HPS A;  3QG5 C;  2EOZ A;  4JI8 I;  2ENC A;  5IT9 C;  2UUA E;  1H74 A;  4IFD B;  3C4T A;  4LFB E;  1X47 A;  1TN9 A;  2O3Z A;  1SFE A;  2DSY A;  2EWL A;  1PIE A;  2EL4 A;  4X64 I;  2HHH E;  2VF3 A;  1ZM9 A;  1ZU1 A;  3KZZ A;  5A69 A;  5A6B D;  1KYQ A;  2NN6 D;  1WXR A;  2Z5E A;  4DUZ I;  2DIX A;  4FW7 A;  2V83 A;  2EMG A;  2EMW A;  2EOJ A;  2VF1 A;  1BBG A;  2I13 A;  1T4N A;  2AJ4 A;  3J7Y p;  2M1S A;  2PNL A;  2V2Q A;  1U2R A;  3J80 C;  2RS7 A;  2JOB A;  4ZYH A;  2PNZ A;  3JAM Q;  2YU8 A;  2EM3 A;  2LT7 A;  1RMD A;  2O1U A;  4FW6 A;  4DPX A;  4URL A;  3H4L A;  1O0W A;  2FGG A;  2MKD A;  1XNQ I;  2EM0 A;  4DV4 I;  2UUC E;  4LF9 I;  2J65 A;  3F0N A;  1X49 A;  4JI6 E;  4OX9 I;  1L4S A;  3EPJ A;  4LF4 I;  2C38 B;  2J7K A;  1UHZ A;  4OOG C;  4F2J C;  5FLX Q;  1FJG I;  1KVK A;  4X65 I;  4OO1 C;  2E1M A;  5GMD A;  5GME A;  1MEY C;  1N36 I;  1IBK I;  4DR2 I;  4JI2 E;  5LMU E;  4O5G A;  2I9I A;  2LCE A;  4M0V A;  5AAS A;  1ZM2 A;  2YTP A;  2WNR B;  4DPW A;  5JEA B;  2KOU A;  4IFD F;  3M7N G;  4R03 A;  2D9H A;  1X6F A;  3H1C A;  2F8B A;  3P1X A;  4LCF A;  1P42 A;  2EFG A;  2JEB A;  2Z5C A;  3T1H I;  2B9D A;  4USM A;  2C39 A;  4MDT A;  4TUI A;  1A1J A;  1YUI A;  1ZXN A;  4JI4 E;  4ZYE A;  1JK2 A;  1Z5A A;  4AQY I;  2RTX A;  1IBM I;  4R2C A;  2CT1 A;  1UIL A;  2ODR C;  4JI5 I;  4OKG A;  2NUG A;  1KTV A;  1HNX E;  1LLM C;  4DV0 I;  4LOM A;  4UTG A;  1XNR I;  1ZAA C;  4DUY E;  1VIS A;  2YTN A;  2UXC E;  2CZ9 A;  4F9A B;  1N33 I;  1Z0W A;  3P3G A;  4KQV A;  4LF5 I;  3DJW A;  1UBD C;  4B3S I;  3J81 Q;  1A1I A;  4LFA E;  1FWL A;  3ZZT A;  2VQF I;  2NAB A;  3LPS A;  1XMO E;  2GS8 A;  1XMQ E;  2HK3 A;  5JEA F;  2YZT A;  1EA6 A;  2A2D A;  2CVE A;  2YRH A;  4R2A A;  4R1F A;  3UHM A;  2YSO A;  3ADJ A;  4RHB B;  2EOR A;  2NUF A;  4M1K A;  1Y4S A;  2CGE A;  2VES A;  4JI1 I;  4BA2 A;  2H36 X;  2VRD A;  4DR7 I;  1RRE A;  1KKH A;  2E72 A;  2LTR A;  1NZ0 A;  4IS1 C;  2EN8 A;  2EOQ A;  4GKK E;  4R2E A;  3QT6 A;  1Z5B A;  4M2Z A;  5K36 B;  4JI7 I;  4IZJ A;  2EOH A;  2LO3 A;  1Z0V A;  2PNZ B;  4NHR A;  5IT9 Q;  4N3O A;  1YYK A;  4BC7 A;  3WU4 A;  4DU7 A;  1YSA C;  4QNJ A;  4DV2 E;  2PO1 B;  1T38 A;  1UDS A;  3QT5 A;  2YTD A;  1HNZ E;  4I3H A;  1NHI A;  5DRO A;  4JI3 E;  1R6L A;  4WUB A;  4DV1 I;  1N32 E;  1H73 A;  2R1F A;  4KWY A;  2HGH A;  3P06 A;  3OTO I;  4IFD C;  3WU5 A;  4BC9 A;  1UDO A;  2RS6 A;  4JI0 E;  2V8Q B;  3QT7 A;  4LF6 E;  1RHY A;  4F54 A;  3EPK A;  2PNM A;  2IHR 1;  4O24 A;  1WHQ A;  4BHC A;  4JYA I;  2GPI A;  4R2D A;  4X66 E;  2C37 A;  2JE6 B;  2EZ6 A;  4RH8 A;  2JEB B;  1QNT A;  2Z5C B;  4IZJ D;  3VK6 A;  2V2Z A;  2K7I A;  3EQ1 A;  1JK1 A;  2EN6 A;  2LE2 A;  1HR0 E;  4DR5 I;  5K36 F;  3M85 G;  4WXD A;  1FNM A;  2UU9 I;  4LF7 E;  1YHC A;  1ZR9 A;  2JY9 A;  2EL5 A;  2YRK A;  3J7A G;  1T4L B;  5IWA E;  1IQO A;  2HHH I;  4B3M E;  4FW3 A;  1EH6 A;  3ZOQ B;  2WCC 3;  4QNK A;  5DRP A;  2HFS A;  4O43 A;  4HEI A;  2JT2 A;  5JEA C;  2VQE I;  2L92 A;  1YPN A;  1I94 E;  4MQY A;  2L2M A;  3MHH C;  3P76 A;  1MGT A;  3ZZU A;  2V2V A;  1Y60 A;  2JXP A;  2LUQ A;  3ADL A;  1WJP A;  4FWH A;  1UDQ A;  4X8W A;  3VYX A;  4NXN E;  2HK2 A;  5ELW A;  4B3R I;  1IQS A;  2MKN A;  4MYU A;  5C0X B;  3WU3 A;  1MU5 A;  1H72 C;  5DRQ A;  2DEJ A;  3DD6 A;  2EOI A;  4BHB A;  4NXM E;  2BA1 G;  5CFF E;  4BMJ A;  4DR4 E;  2HFU A;  1GQE A;  4DV5 E;  2BR2 B;  1X5W A;  3F6H A;  2ADR A;  3IWD A;  4ZVI A;  3AV0 A;  2EMC A;  4HAC A;  2UUC I;  2EMA A;  2EJ4 A;  2V86 A;  4JI6 I;  2J7J A;  1J5E E;  4LCH A;  1OYS A;  4MU1 A;  4DU8 A;  3V5R A;  2BA0 D;  2LTS A;  4Q35 B;  2MDG A;  3IWB A;  2ZBK B;  2ENH A;  4DR6 E;  5BR8 E;  1DAR A;  2V34 A;  2EN3 A;  1YH8 A;  2GO4 A;  3PS3 A;  3H09 A;  3KWR A;  2WP8 A;  5LMU I;  4JI2 I;  5LL6 R;  1MX0 A;  2VE7 C;  1PVG A;  1NEI A;  1GZ6 A;  3ZKB A;  2UXD I;  1Y5Y A;  4OO1 E;  2YT4 A;  1EH8 A;  1ZM4 A;  5K36 C;  2EOO A;  1Y6Z A;  1ELO A;  4X64 E;  5C0X F;  1E3H A;  2JP9 A;  1Y4U A;  2CG9 A;  4LPF A;  2IES A;  3B4T A;  4YY3 E;  2BB8 A;  2IOP A;  2PO0 A;  4DPU A;  2O1V A;  4R2P A;  1G2F C;  2M4I A;  4JI4 I;  2YTE A;  4WSP A;  4BCA A;  2EE8 A;  1BBO A;  3HKM A;  1SR9 A;  2V8P A;  1BKN A;  1HNX I;  4F9B B;  1XXE A;  2X7I A;  3PYD A;  3ZKD A;  1FWK A;  1WHN A;  3ZZ0 A;  2A2C A;  3PYE A;  4IZK B;  2ENA A;  1IBL E;  1XNQ E;  2NN6 B;  4DUY I;  4DV4 E;  2UUB E;  3CDI A;  2EP3 A;  2G7H A;  4X62 E;  2N8X A;  3VHT B;  2LVH A;  4LF4 E;  1NHH A;  5IXM B;  1FJG E;  2BM0 A;  2GLI A;  3U1Y A;  5A6A A;  4OO1 D;  4LFA I;  4X65 E;  1H7U A;  3FIG A;  5KL6 A;  5A2Q C;  1N36 E;  1XMO I;  1N34 I;  3OML A;  2YTF A;  4WYQ B;  4UT4 A;  4BA1 B;  2L2N A;  3ECR A;  4P78 A;  2N3G A;  3MSW A;  2V87 A;  4GKJ E;  2YSP A;  1Z59 A;  5L3J A;  2LJP A;  2DMY A;  3P3C A;  3BF2 A;  2NUE A;  4DR3 I;  4LF8 E;  2NPF A;  2EPP A;  4EMD A;  2RPC A;  4ZYD A;  1K47 A;  5KL4 A;  1X3C A;  3J7A M;  3ADG A;  3L00 A;  2XEX A;  4GKK I;  3T1Y I;  2ODR D;  2L33 A;  2RQL A;  4RPF A;  2L2K B;  4GEQ B;  3THO B;  2X36 A;  4L8N A;  2ELZ A;  2EPL X;  2Q2E B;  2NN6 F;  3C4B A;  3D4J A;  4BBY A;  4DV2 I;  2GO3 A;  3RMP A;  4F6N A;  2UXB E;  3LNU A;  3ZM7 A;  1UEK A;  4K0K I;  4JI3 I;  3M7N D;  4LF5 E;  1N32 I;  4R2Q A;  2JR1 A;  2E5L E;  2VQF E;  2FTX B;  2HC5 A;  4DV7 E;  2EPN A;  2M7Q A;  3HUL A;  4LCG A;  4JI0 I;  5C0X C;  4FK5 C;  5AC4 A;  4LF6 I;  2EM2 A;  1RR9 A;  2EMB A;  2PO2 A;  4IFD A;  2EOX A;  4M30 A;  4I8O A;  4IFD E;  1Z0C A;  2O1W A;  4X66 I;  3GLL A;  1GTK A;  1YFH A;  3AUZ A;  1AAY A;  4WXC A;  2B3T B;  1EH7 A;  4X9J A;  4HY1 A;  1FKA E;  3HPZ A;  3L7Z A;  1ZBQ A;  2LJH A;  4JI7 E;  2C39 B;  1BB8 A;  2EM6 A;  4FW9 A;  2LJU A;  1EI1 A;  3K85 A;  2RSI A;  3Q1Q A;  5IWA I;  1OYR A;  4B3M I;  4DKK A;  2JEA A;  3THN A;  4DXL A;  1DQ3 A;  5FWK A;  2YWQ A;  4DV3 E;  2YRM A;  1OJ4 A;  2C38 A;  4KZS A;  2F1D A;  4DV6 I;  1RQ0 A;  4FWD A;  1MG7 A;  2DMI A;  2EN2 A;  2EQ3 A;  2EQ0 A;  2L6M A;  5AE1 A;  2JPA A;  2IER A;  4IS9 A;  4IFD D;  4YHH E;  2CPN A;  3GCM A;  2JYA A;  5LMN E;  1I94 I;  3LTO A;  5TSE A;  2MC5 A;  2YU5 A;  2DEI A;  2WNR A;  5AC5 A;  5JEA A;  3KZY A;  5JEA E;  3JTZ A;  4B3T I;  4WX9 A;  3LML A;  4JYA E;  4U3B A;  2EQ1 A;  4L5N C;  1TF3 A;  2UUA I;  2EML A;  2RSM A;  4AM3 A;  4LFB I;  4FWG A;  1KIJ A;  2LV2 A;  2DLK A;  2GHF A;  2LRS A;  1UDN A;  2EMY A;  2ELY A;  2V89 A;  4KHP E;  4DPT A;  5A2Q Q;  5A6K A;  2NN6 C;  4NXM I;  3CWV A;  4DR4 I;  2UU9 E;  2EPC A;  4DV5 I;  3U1K A;  2HJJ A;  3K6Q A;  4J8Z A;  4BA2 B;  5KL3 A;  4JV5 E;  2ZM6 E;  5KL2 A;  1A1K A;  4NZV A;  1XHK A;  4IZJ B;  2EMK A;  1HNW E;  4R2R A;  2EOM A;  1USU A;  1J5E I;  4N4R B;  2YPN A;  1Z0T A;  3HTX A;  2NA2 A;  5JEA D;  2VQE E;  2L3C A;  1P47 A;  4LFC E;  1NHJ A;  2MDR A;  4DR6 I;  1D6T A;  5ADZ A;  2F4V E;  2V85 A;  2WBT A;  4P52 A;  4R8O A;  2OI2 A;  4MU3 A;  4DR1 E;  1PDA A;  4P7D A;  4GZN C;  2PO2 B;  4ED4 A;  3M85 D;  1N3G A;  2A25 A;  3C6K A;  2JVA A;  3M99 B;  1A6F A;  4B3R E;  4JI8 E;  2KON A;  1T4O A;  4OO1 A;  2EMF A;  3CDJ A;  4YY3 I;  3HQ1 A;  4R2S A;  1QZR A;  4HYM A;  2C37 B;  4LU9 A;  5K36 A;  4DUZ E;  5K36 E;  2BBG A;  3L7Z B;  1X48 A;  4HTG A;  2YTQ A;  5DNL A;  5F3W A;  2Q8U A;  5A6J A;  2YTO A;  4MLQ A;  3JU0 A;  1PKP A;  3PYG A;  2E1R A;  1TF6 A;  2PO1 A;  1IBL I;  1A1G A;  2UUB I;  2EN7 A;  2JEA B;  4X62 I;  1PJS A;  3B82 A;  1N0V C;  4XTJ A;  4P7A A;  5LLQ A;  3PS2 A;  2JOX A;  4MU0 A;  2BV3 A;  2GQ0 A;  4LF9 E;  3QT8 A;  3V2U C;  2UXC I;  4IJD A;  3VYY A;  4OX9 E;  1USV A;  2O1T A;  1S16 A;  1ZM3 A;  2YTG A;  2L3J A;  4GKJ I;  2EM7 A;  1F2I G;  1IBK E;  2BA1 D;  1FI4 A;  2EL6 A;  4DR2 E;  2UXD E;  2HKJ A;  1XMQ I;  5K36 D;  2JE6 A;  1B63 A;  1YYW A;  4GQU A;  4LF8 I;  3MHS C;  1Z0B A;  2Z5B A;  1WRJ A;  2EPA A;  2AE8 A;  4Z7C A;  1PJQ A;  3K17 A;  1G2D C;  1NCS A;  2M9A A;  4WUD A;  1Z5C A;  2EMZ A;  3T1H E;  4J3D A;  2IOQ A;  2EPK X;  4Q28 A;  2EM9 A;  1R6M A;  2R42 A;  5KL7 A;  4AQY E;  2CTD A;  1YZ9 A;  1IBM E;  2EPZ A;  1IMU A;  4JI5 E;  2KHX A;  1S4E A;  2YTI A;  1VI7 A;  1A1L A;  1QU6 A;  3NZK A;  2BM1 A;  2WBU A;  4FN5 A;  1Z0E A;  1A1H A;  2UXB I;  4DV0 E;  1N0U A;  2DRP A;  1XNR E;  3HJC A;  2L8T A;  4PRV A;  2DLQ A;  2N3H A;  2EMI A;  2DGC A;  4HAC B;  2E5L I;  1HNZ I;  1N33 E;  1WUU A;  4DV7 I;  4TUG A;  1N34 E;  1OYP A;  2EM4 A;  1Z0G A;  4U3D A;  4B3S E;  1H7S A;  5KL5 A;  3EPL A;  3P3E A;  2EPX A;  2EOS A;  4O4K A;  3B78 A;  4USK A;  1A1F A;  3EPH A;  1KJK A;  1RC7 A;  3BID A;  1B62 A;  2WW4 A;  2WP8 B;  2DB2 A;  4DR3 E;  4WFT A;  5C0X A;  4DMI A;  3JAM C;  3WU6 A;  4WSG A;  5C0X E;  2EPM X;  4OO1 B;  2WZO A;  3PS1 A;  2R76 A;  2YTJ A;  4MLV A;  3K1J A;  5DNY A;  1HK7 A;  4JI1 E;  3T1Y E;  2EOE A;  2B7V A;  4DR7 E;  3PRY A;  2R3V A;  4Z7Y A;  5FLX C;  1YUJ A;  2BR2 A;  1HR0 I;  2EPR A;  2ZIT A;  3Q6N A;  2PO0 B;  4F6M A;  3BBG A;  1EKZ A;  3PYF A;  3DF6 A;  4LF7 I;  4OZE A;  1ZBT A;  2EPO A;  2EMH A;  2LBS B;  4HXZ A;  4K0K E;  4AIM A;  2MC6 A;  4DV3 I;  2EM8 A;  5EL9 A;  4AID A;  2HKE A;  5AE3 A;  4JG4 A;  4YHH I;  5LMN I;  4WPY A;  4DV1 E;  1STU A;  1AH5 A;  2B7T A;  1X6E A;  5C0X D;  3J80 Q;  2V88 A;  2WBS A;  3OTO E;  2PRT A;  4MU4 A;  3IWC A;  2EM5 A;  5DRR A;  5T6J A;  4WUC A;  3Q6M A;  4PRX A;  1T39 A;  3BGH A;  3LLH A;  3F6G A;  4OO1 F;  5IV8 B;  2K4V A;  2Z5B B;  2JWO A;  2BA0 G;  5AE2 A;  3M6A A;  3C6M A;  1B69 A;  4NXN I;  2CSH A;  2LMZ A;  4F9C B;  4KHP I;  3HXL A;  2EOF A;  1PJT A;  1UN6 B;  3J81 C;  4NBQ A;  3GME A;  4DR5 E;  1DI2 A;  4JV5 I;  2ZM6 I;  4IZK A;  5A6B A;  2NN6 A;  1Z1B A;  2EN1 A;  2NN6 E;  2FV4 B;  3GON A;  1HNW I;  4BS9 A;  4FW4 A;  4M9V C;  1E3P A;  3UK3 C;  5EKW A;  4DV6 E;  2EMX A;  2EPU A;  3ADI A;  4ISA A;  3B8H A;  2EN4 A;  2EOY A;  4PU9 A;  4LFC I;  4FW5 A;  1YYO A;  4LTY A;  1J26 A;  2F4V I;  4DPY A;  3TQM A;  4MYT A;  4BA1 A;  5DNX A;  1ZXM A; 
#chains in the Genus database with same CATH homology
 5BR8 I;  4DR1 I;  4B3T E;  2LUP B;  3HPS A;  4JI8 I;  5IT9 C;  2UUA E;  1H74 A;  3C4T A;  4LFB E;  1X47 A;  2DSY A;  2EWL A;  1PIE A;  4X64 I;  2HHH E;  2VF3 A;  1ZM9 A;  4WUD A;  4DUZ I;  2Z5E A;  1WXR A;  2DIX A;  2V83 A;  2VF1 A;  2AJ4 A;  1T4N A;  3J7Y p;  2M1S A;  2PNL A;  2V2Q A;  1U2R A;  3J80 C;  2RS7 A;  2JOB A;  3JAM Q;  4DPX A;  2O1U A;  4URL A;  3H4L A;  2FGG A;  1O0W A;  1XNQ I;  4DV4 I;  4LF9 I;  2UUC E;  3F0N A;  1X49 A;  4JI6 E;  4OX9 I;  4LF4 I;  2J7K A;  1UHZ A;  4OOG C;  5FLX Q;  1FJG I;  1KVK A;  4X65 I;  2E1M A;  5GMD A;  5GME A;  1N36 I;  1IBK I;  4DR2 I;  4JI2 E;  5LMU E;  4M0V A;  5AAS A;  1ZM2 A;  4DPW A;  2KOU A;  4R03 A;  2F8B A;  3P1X A;  3T1H I;  2EFG A;  2Z5C A;  2B9D A;  4USM A;  4TUI A;  1ZXN A;  4AQY I;  4JI4 E;  1Z5A A;  2RTX A;  1IBM I;  2ODR C;  1UIL A;  4JI5 I;  2NUG A;  1KTV A;  1HNX E;  4DV0 I;  4UTG A;  1XNR I;  4DUY E;  1VIS A;  2UXC E;  2CZ9 A;  4F9A B;  1N33 I;  1Z0W A;  4KQV A;  4LF5 I;  3DJW A;  4B3S I;  3J81 Q;  4LFA E;  1FWL A;  3ZZT A;  2VQF I;  3LPS A;  1XMO E;  2GS8 A;  1XMQ E;  2HK3 A;  2YZT A;  1EA6 A;  2A2D A;  4R1F A;  3ADJ A;  4M1K A;  2NUF A;  1Y4S A;  2CGE A;  4JI1 I;  2H36 X;  4DR7 I;  1RRE A;  1KKH A;  2LTR A;  1NZ0 A;  3QT6 A;  4GKK E;  1Z5B A;  4M2Z A;  4JI7 I;  4IZJ A;  1Z0V A;  5IT9 Q;  4N3O A;  1YYK A;  4BC7 A;  3WU4 A;  4DU7 A;  4DV2 E;  3QT5 A;  1HNZ E;  4I3H A;  1NHI A;  4JI3 E;  4DV1 I;  4WUB A;  1N32 E;  1H73 A;  3P06 A;  3OTO I;  3WU5 A;  4BC9 A;  2RS6 A;  4JI0 E;  2V8Q B;  3QT7 A;  4LF6 E;  4F54 A;  2PNM A;  2IHR 1;  1WHQ A;  4JYA I;  4X66 E;  2EZ6 A;  2Z5C B;  4IZJ D;  3VK6 A;  2V2Z A;  2LE2 A;  1HR0 E;  4DR5 I;  1FNM A;  2UU9 I;  4LF7 E;  2JY9 A;  3J7A G;  1T4L B;  5IWA E;  4B3M E;  3ZOQ B;  2HFS A;  2VQE I;  2L92 A;  1I94 E;  2L2M A;  3ZZU A;  2V2V A;  2LUQ A;  3ADL A;  4FWH A;  4X8W A;  3VYX A;  4NXN E;  2HK2 A;  4B3R I;  4MYU A;  3WU3 A;  1MU5 A;  1H72 C;  2DEJ A;  4NXM E;  5CFF E;  4BMJ A;  4DR4 E;  2HFU A;  1GQE A;  4DV5 E;  3F6H A;  3IWD A;  4ZVI A;  3AV0 A;  4HAC A;  2UUC I;  2V86 A;  4JI6 I;  1J5E E;  4DU8 A;  3V5R A;  2LTS A;  3IWB A;  2ZBK B;  1DAR A;  4DR6 E;  5BR8 E;  2V34 A;  3H09 A;  3KWR A;  5LMU I;  4JI2 I;  5LL6 R;  1MX0 A;  2VE7 C;  1PVG A;  1GZ6 A;  3ZKB A;  2UXD I;  2YT4 A;  1ZM4 A;  1Y6Z A;  1ELO A;  4X64 E;  1Y4U A;  2CG9 A;  4YY3 E;  2IOP A;  4DPU A;  4JI4 I;  2O1V A;  2M4I A;  4WSP A;  4BCA A;  1SR9 A;  2V8P A;  1BKN A;  1HNX I;  4F9B B;  2X7I A;  3PYD A;  3ZKD A;  1FWK A;  1WHN A;  3ZZ0 A;  2A2C A;  3PYE A;  4IZK B;  1IBL E;  1XNQ E;  4DUY I;  4DV4 E;  2UUB E;  2G7H A;  4X62 E;  4LF4 E;  1NHH A;  1FJG E;  2BM0 A;  4LFA I;  4X65 E;  1H7U A;  3FIG A;  5A2Q C;  1N36 E;  1XMO I;  1N34 I;  3OML A;  4WYQ B;  4UT4 A;  2L2N A;  4GKJ E;  4P78 A;  2N3G A;  3MSW A;  2V87 A;  5L3J A;  1Z59 A;  2LJP A;  2DMY A;  2NUE A;  4DR3 I;  4LF8 E;  2NPF A;  4EMD A;  1K47 A;  3J7A M;  3ADG A;  2XEX A;  4GKK I;  3T1Y I;  2ODR D;  2L33 A;  4RPF A;  2L2K B;  4GEQ B;  2X36 A;  4L8N A;  2Q2E B;  3C4B A;  3D4J A;  4BBY A;  4DV2 I;  3RMP A;  2UXB E;  3LNU A;  3ZM7 A;  1UEK A;  4K0K I;  4JI3 I;  4LF5 E;  1N32 I;  2JR1 A;  2E5L E;  2VQF E;  2FTX B;  4DV7 E;  2M7Q A;  3HUL A;  4JI0 I;  4LF6 I;  1RR9 A;  4M30 A;  4I8O A;  1Z0C A;  2O1W A;  4X66 I;  3AUZ A;  2B3T B;  4HY1 A;  1FKA E;  3HPZ A;  1ZBQ A;  2LJH A;  4JI7 E;  4FW9 A;  1EI1 A;  3K85 A;  3Q1Q A;  5IWA I;  4B3M I;  4DKK A;  4DXL A;  1DQ3 A;  5FWK A;  4DV3 E;  1OJ4 A;  4DV6 I;  4KZS A;  1RQ0 A;  4FWD A;  1MG7 A;  2L6M A;  5AE1 A;  4YHH E;  2CPN A;  5LMN E;  1I94 I;  3LTO A;  2MC5 A;  2DEI A;  3JTZ A;  4B3T I;  3LML A;  4JYA E;  4L5N C;  2UUA I;  2RSM A;  4LFB I;  4FWG A;  1KIJ A;  2LRS A;  5A2Q Q;  2HHH I;  4NXM I;  2V89 A;  4KHP E;  4DPT A;  3CWV A;  4DR4 I;  2UU9 E;  4DV5 I;  3K6Q A;  4J8Z A;  4JV5 E;  2ZM6 E;  1XHK A;  4IZJ B;  1HNW E;  1USU A;  1J5E I;  1Z0T A;  3HTX A;  2NA2 A;  2VQE E;  2L3C A;  1NHJ A;  4LFC E;  2MDR A;  4DR6 I;  1D6T A;  5ADZ A;  2F4V E;  2V85 A;  4P52 A;  4R8O A;  2OI2 A;  4DR1 E;  4P7D A;  4ED4 A;  1A6F A;  2JVA A;  4B3R E;  4JI8 E;  2KON A;  1T4O A;  4YY3 I;  3HQ1 A;  1QZR A;  4HYM A;  4LU9 A;  4DUZ E;  1X48 A;  5F3W A;  3JU0 A;  1PKP A;  3PYG A;  2E1R A;  1IBL I;  2UUB I;  4X62 I;  3B82 A;  1N0V C;  4XTJ A;  4P7A A;  2JOX A;  2BV3 A;  2GQ0 A;  4LF9 E;  3QT8 A;  3V2U C;  2UXC I;  3VYY A;  4OX9 E;  1USV A;  2O1T A;  1S16 A;  1ZM3 A;  2L3J A;  4GKJ I;  1IBK E;  1FI4 A;  2UXD E;  4DR2 E;  2HKJ A;  1XMQ I;  1B63 A;  1YYW A;  4LF8 I;  1Z0B A;  2Z5B A;  4Z7C A;  3K17 A;  1Z5C A;  3T1H E;  2IOQ A;  4Q28 A;  2R42 A;  4AQY E;  1YZ9 A;  1IBM E;  4JI5 E;  2KHX A;  1S4E A;  1QU6 A;  2UXB I;  2BM1 A;  4FN5 A;  1Z0E A;  4DV0 E;  1N0U A;  1XNR E;  3HJC A;  4PRV A;  2L8T A;  2N3H A;  2E5L I;  4HAC B;  1HNZ I;  1N33 E;  1WUU A;  4DV7 I;  4TUG A;  1N34 E;  1Z0G A;  4B3S E;  1H7S A;  3B78 A;  4USK A;  1B62 A;  1RC7 A;  2WW4 A;  2DB2 A;  4DR3 E;  4WFT A;  4DMI A;  3JAM C;  3WU6 A;  2WZO A;  3K1J A;  5DNY A;  1HK7 A;  4JI1 E;  3T1Y E;  2B7V A;  4DR7 E;  3PRY A;  2R3V A;  4Z7Y A;  5FLX C;  1HR0 I;  2ZIT A;  3Q6N A;  1EKZ A;  3PYF A;  3DF6 A;  4LF7 I;  1ZBT A;  4DV3 I;  2LBS B;  4HXZ A;  4K0K E;  2MC6 A;  2HKE A;  5AE3 A;  4JG4 A;  4YHH I;  5LMN I;  4WPY A;  4DV1 E;  1STU A;  2B7T A;  3J80 Q;  2V88 A;  3OTO E;  3IWC A;  5T6J A;  4WUC A;  3Q6M A;  4PRX A;  3LLH A;  3F6G A;  2K4V A;  2Z5B B;  2JWO A;  3M6A A;  5AE2 A;  4NXN I;  2LMZ A;  4F9C B;  4KHP I;  3HXL A;  3J81 C;  4DR5 E;  1DI2 A;  4JV5 I;  2ZM6 I;  4IZK A;  2FV4 B;  3GON A;  1HNW I;  4BS9 A;  4DV6 E;  3ADI A;  3B8H A;  4PU9 A;  4LFC I;  1YYO A;  4LTY A;  1J26 A;  2F4V I;  4DPY A;  4MYT A;  1ZXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...