1HNZE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnzE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnzE02
3D4JA 1ZXNA 1Z5CA 1N36E 2NUFA 4PU9A 3OTOE 2RSMA 1PKPA 1T4NA 1DARA 1RREA 2VQFE 1H74A 4DPXA 3ADJA 4DV6E 3B78A 1FI4A 4M1KA 1FJGI 2UU9E 1U2RA 2L2NA 2NA2A 2ZITA 4JI5I 2V2VA 4R1FA 1I94E 2BM1A 2UUAE 4B3RE 4LF4E 3QT8A 2V8PA 4Z7YA 4JV5I 5LMUI 3F0NA 2X7IA 2J7KA 4DPWA 4NXME 2DMYA 4GKKI 2HHHI 2LJPA 1X49A 1DI2A 1WUUA 2JY9A 4FWHA 3ADIA 4X66I 1XMQI 4M2ZA 1STUA 2KHXA 4HYMA 4X62I 1FJGE 3V2UC 2UXCI 5L3JA 2AJ4A 1Z59A 4JI5E 2DEIA 4RPFA 3VYYA 2LRSA 4YHHI 1RC7A 4LF7I 2B7VA 2LBSB 5FLXC 4DR1I 2GS8A 1XNQI 4JV5E 5LMUE 1Z0GA 1ZM9A 1Z0TA 1A6FA 1ELOA 4GKKE 1UILA 2HHHE 1OJ4A 4K0KI 3ZKBA 1KKHA 1ZM3A 3PYFA 1Z0WA 5GMDA 1KVKA 4JI8I 3ZZ0A 1ZXMA 3T1YI 1NHHA 4X66E 1XMQE 4DUYI 3J7AM 1N32I 4DPYA 4OOGC 3T1HI 3JAMC 4X62E 2CPNA 2UXCE 3ADLA 1S16A 3ZZTA 1RR9A 1J26A 4HXZA 1HNZI 4NXNI 4YHHE 2B7TA 4YY3I 4JI2I 4LF7E 4MYUA 2L3JA 2DEJA 4DR1E 4LF8I 1XNQE 3WU3A 1IBMI 1XNRI 3WU6A 3LLHA 1HR0I 5GMEA 3P1XA 4DR4I 4URLA 4DV7I 3ZZUA 4K0KE 2UXDI 2L3CA 4LFCI 4JI8E 4Z7CA 3T1YE 2EFGA 4DUYE 1N32E 1H7UA 3T1HE 1WHNA 4I3HA 3C4TA 3C4BA 3VYXA 1ZBTA 2A2CA 2CZ9A 2HKEA 2UUCI 1O0WA 2ZBKB 1HNZE 2N3HA 4NXNE 4YY3E 4JI2E 3M6AA 3J7Yp 4LF8E 2X36A 1IBME 4LF9I 1XNRE 1HR0E 4DR4E 4DXLA 4JI4I 4DV7E 2UXDE 1H72C 4DR6I 4MYTA 1EI1A 4LFCE 1FWLA 2L33A 3LPSA 1J5EI 2OI2A 4DR5I 2V34A 1YYOA 1EKZA 1KTVA 2HFUA 5BR8I 2A2DA 4FW9A 1D6TA 2UXBI 4X64I 4B3MI 2UUCE 4AQYI 2JVAA 2LTSA 1PIEA 2HK3A 4HY1A 2HFSA 2RTXA 1HNWI 4ED4A 1Z0EA 1VISA 4LF9E 4XTJA 2NUGA 3B8HA 4DR2I 1Z0VA 2UUBI 3H4LA 4LF6I 2NUEA 4JI4E 2E1RA 1ZM2A 1PVGA 4DR6E 1IBKI 2L2MA 1J5EE 5IWAI 3K17A 3QT5A 2B3TB 5CFFE 2VF3A 5A2QC 5FLXQ 4DR5E 4NXMI 1MX0A 1N34I 4LF5I 2R42A 5BR8E 1WHQA 1X47A 2RS6A 2UXBE 4JI7I 2YT4A 4JYAI 4FWDA 1NZ0A 4X65I 4X64E 4B3ME 3WU5A 5LL6R 2HK2A 4JG4A 1ZM4A 2VQEI 4AQYE 4DPUA 4FWGA 1QZRA 2LJHA 2V2QA 4USKA 3QT6A 3CWVA 1HNWE 1YYWA 1RQ0A 1N0VC 1N33I 4FN5A 3HULA 1MU5A 4B3TI 5A2QQ 4DR2E 2UUBE 3JAMQ 4X8WA 2ZM6I 2NPFA 4LF6E 1IBKE 4WUBA 5IWAE 4JI1E 1NHJA 4JI0I 1HNXI 2BM0A 4HACB 3ZKDA 1H7SA 1N34E 4B3SI 3PYDA 4LF5E 4WFTA 3J80C 2L2KB 4JI7E 4DKKA 4JYAE 3LTOA 4X65E 4DR3I 4DR7E 4GKJI 4UT4A 2VQEE 4USMA 5LMNE 1S4EA 4DPTA 3PYEA 2DB2A 2WW4A 4DV1I 4DV4I 2BV3A 1N33E 4B3TE 4ZVIA 1MG7A 4DV3I 2ZM6E 4WYQB 1B63A 1H73A 3J80Q 4WUCA 4P7AA 1YZ9A 1FKAE 4LFBI 1N0UA 3ZM7A 4DV5E 2EZ6A 2N3GA 4JI0E 1HNXE 4UTGA 1UEKA 3LNUA 4OX9I 1QU6A 4B3SE 4DV2I 4KHPI 2F4VI 5IT9C 2LUPB 1T4OA 3PYGA 4DV0I 1FWKA 4DR3E 4GKJE 4DUZI 4P52A 1IBLI 1XMOI 3GONA 2V2ZA 4LFAI 1YYKA 4DV1E 4DV4E 2DIXA 1Z5AA 3B82A 4JI3I 4HACA 3K1JA 1UHZA 4DV3E 2E5LI 4EMDA 3ADGA 1T4LB 2IHR1 4JI6I 5IT9Q 4LFBE 3J81C 4JI1I 1Z0CA 3J7AG 4PRXA 1EA6A 3V5RA 1GQEA 1N36I 4OX9E 3OTOI 1NHIA 3Q1QA 4DV2E 4KHPE 1FNMA 2LTRA 3QT7A 2F4VE 2Q2EB 2VQFI 4DR7I 4WUDA 4DV0E 5LMNI 4DV6I 3WU4A 4DUZE 2MDRA 2UU9I 1IBLE 1XMOE 1KIJA 1Z0BA 3J81Q 4LFAE 3HTXA 2R3VA 2XEXA 1I94I 2UUAI 4JI3E 4B3RI 2E5LE 4LF4I 4M30A 1K47A 4DV5I 4JI6E 1XHKA 1B62A 4PRVA 4KQVA 2HKJA 2LUQA 1Z5BA 4DU7A 1X48A 4DU8A 1BKNA 2RS7A
chains in the Genus database with same CATH superfamily
3D4JA 1ZXNA 4L8NA 2EOHA 1BBOA 1N36E 2NUFA 1E3PA 4WXCA 4R2DA 1Z5CA 2O1WA 4PU9A 3OTOE 5A6KA 1PKPA 2JR1A 2EP3A 5A6JA 2BR2B 4R2PA 1T4NA 1DARA 1RREA 4O5GA 2VQFE 1H74A 3HJCA 4MU1A 2EN7A 5K36C 4DPXA 2LCEA 2YTPA 2ODRD 1E3HA 2JE6A 3ADJA 5AASA 5FWKA 4DV6E 3B78A 4ZYHA 1GTKA 1IQSA 1FI4A 3KZYA 4IZJB 4M1KA 5KL6A 4DMIA 1FJGI 2UU9E 4BA1B 2M7QA 2VE7C 1U2RA 1VI7A 2BA1G 2DRPA 3P06A 2L2NA 3M99B 4FW6A 2NA2A 1YUIA 4OZEA 2ZITA 1PJQA 5C0XB 4JI5I 2V2VA 4R1FA 2ELZA 4U3DA 4WSGA 1I94E 2BM1A 4OO1A 2UUAE 2ENHA 2EPCA 4B3RE 2F1DA 4TUIA 5JEAA 2AE8A 4LF4E 3QT8A 2C38B 3AV0A 2EPNA 2V8PA 1P42A 2PNZA 2GO4A 2LMZA 4Z7YA 2EMKA 4JV5I 5LMUI 3F0NA 2YU5A 3GCMA 2X7IA 2HC5A 1R6MA 2VESA 4LCGA 2J7KA 1SFEA 4ISAA 4IFDA 4DPWA 5LLQA 4BBYA 4NXME 2DMYA 3H1CA 4GKKI 2HHHI 1N3GA 2EL6A 4WSPA 2LJPA 2JP9A 2WNRB 1X49A 1DI2A 2LJUA 1WUUA 2EN3A 3HQ1A 2EMIA 2JY9A 2YTGA 4FW3A 4FWHA 2ODRC 3ADIA 4RH8A 1UDSA 4X66I 1XMQI 4M2ZA 2GO3A 1STUA 4TUGA 4FW4A 2KHXA 4X9JA 4QNKA 1UN6B 2N8XA 4HYMA 2L8TA 2IERA 3MHSC 2E1MA 3DD6A 2EMYA 1FJGE 4X62I 3V2UC 1DGCA 4BMJA 2UXCI 5L3JA 2AJ4A 4J3DA 1Z59A 4JI5E 1Z5BA 2DEIA 2Z5EA 4RPFA 3VYYA 1AH5A 2LRSA 3P3CA 5DROA 3F6GA 4YHHI 1RC7A 2EOSA 4LF7I 2D9HA 3K85A 2GHFA 2B7VA 2I13A 2LBSB 5FLXC 4O43A 1Y60A 2BR2A 4F9BB 4DR1I 2GS8A 3U1YA 3HPSA 1XNQI 3H09A 4JV5E 5LMUE 5AE2A 1Z0GA 3TQMA 1TF3A 5DNXA 4F9CB 2FTXB 1ZM9A 4IZJA 3L7ZB 2JYAA 4WX9A 2IOQA 1Y4UA 1Z0TA 1A6FA 1ELOA 4BA1A 1IMUA 2ENCA 1UILA 2HHHE 4GKKE 1OJ4A 4K0KI 5C0XA 4F54A 3ZKBA 2HGHA 1KKHA 2YSPA 1ZM3A 4BS9A 4AM3A 3PYFA 2WBTA 4R8OA 1Z0WA 4KZSA 5GMDA 3M85G 1KVKA 2DLKA 4JI8I 2EPLX 3ZZ0A 1WRJA 4HEIA 1ZXMA 2MC5A 1NHHA 3T1YI 4X66E 1XMQE 2C37A 2JWOA 2NN6A 4DUYI 3J7AM 2B9DA 5K36D 1N32I 3UHMA 2VRDA 4DPYA 4OOGC 3T1HI 2ELYA 3B4TA 3JAMC 4I8OA 2CPNA 3QG5C 4X62E 2GQ0A 4IS1C 2A25A 1BBGA 2UXCE 3EPHA 1X5WA 3ADLA 1S16A 1RR9A 2NN6E 3ZZTA 2JXPA 1J26A 4HXZA 1BB8A 1HNZI 4GQUA 3JU0A 1TF6A 4NXNI 4YHHE 2B7TA 4YY3I 4JI2I 1RMDA 4LF7E 2WNRA 4AIMA 4MYUA 2L3JA 2DEJA 2EM0A 2YTDA 4DR1E 2JEAA 2EM6A 1Y6ZA 4LF8I 4AIDA 1QNTA 2EMBA 1XNQE 3WU3A 1IBMI 2EMWA 1XNRI 3WU6A 3LLHA 2EN8A 2LV2A 4WPYA 5GMEA 1HR0I 1RHYA 3P1XA 1P47A 4DR4I 5K36B 2EM8A 4R2QA 4URLA 1A1HA 2NABA 1IQOA 4DV7I 2CGEA 4K0KE 3ZZUA 3M7ND 2UXDI 2L3CA 2VF1A 5K36F 1USVA 3GLLA 2V88A 4LFCI 4JI8E 2EN4A 4Z7CA 4M0VA 5F3WA 2DMIA 3T1YE 4LOMA 2EFGA 4DUYE 2BA1D 3HPZA 2O3ZA 2Q8UA 3THOB 1N32E 1H7UA 2EPZA 3T1HE 3PS3A 1WHNA 4I3HA 3C4TA 3C4BA 2NN6D 3VYXA 3PRYA 2EM5A 1ZBTA 1HK7A 2A2CA 2CZ9A 2MKDA 3KWRA 2WBUA 2K4VA 4BHBA 2HKEA 2UUCI 1O0WA 2V83A 2ZBKB 1HNZE 2PO2B 2RPCA 2EOIA 2N3HA 2EPOA 4NXNE 3JTZA 4ZYDA 2EJ4A 1YSAC 1ZU1A 4YY3E 4JI2E 1A1KA 3M6AA 3J7Yp 2DGCA 3AUZA 3VK6A 5DNYA 1YH8A 4MU0A 5KL3A 2YTQA 4OO1E 4LF8E 2X36A 1IBME 4NZVA 2F8BA 2CSHA 2LO3A 5JEAE 2Z5BB 4LF9I 2PNLA 4R2SA 1B69A 1HR0E 1XNRE 2O1TA 1ZAAC 2R1FA 3CDJA 5KL4A 3NZKA 4LU9A 1A1LA 4FK5C 4DR4E 4DXLA 2J7JA 2WP8B 4JI4I 4DV7E 2YTFA 4IFDE 2BA0D 2UXDE 2KONA 3RMPA 1H72C 3PS1A 4L5NC 4MYTA 4DR6I 1EI1A 1X3CA 3C6KA 4LFCE 1FWLA 2L33A 3LPSA 1J5EI 1UDQA 2PO1B 4LCFA 4KWYA 2Z5CB 3IWCA 5A6BD 2OI2A 2EMLA 2MKNA 1YFHA 4DR5I 2V34A 1YYOA 3Q6MA 1EKZA 1KTVA 3EPLA 2HFUA 1EH8A 2MC6A 2WCC3 2A2DA 5BR8I 3IWDA 4FW9A 1R6LA 2IOPA 1D6TA 2UXBI 2EOQA 2EPMX 2LT7A 3Q6NA 3U1KA 4BHCA 4X64I 1NCSA 5K36A 4B3MI 2UUCE 2M4IA 1JK2A 4AQYI 2JVAA 2LTSA 4Q35B 1PIEA 2HK3A 1ZR9A 2L6MA 4HY1A 5EKWA 4BC9A 2HFSA 1DQ3A 2YU8A 1XXEA 3KRNA 2RTXA 1HNWI 2EM3A 4ED4A 4F6NA 1A1FA 1Z0EA 1VISA 4LF9E 4XTJA 2NUGA 3B8HA 4DR2I 3LMLA 1Z0VA 3HKMA 2UUBI 3C6MA 2DSYA 3H4LA 4LF6I 5KL5A 2NUEA 4JI4E 2E1RA 1A1JA 2YTEA 4R2EA 1ZM2A 1PVGA 4DR6E 1EH7A 2PO0B 2YRMA 3MHHC 2MDGA 4U3BA 2EMAA 1USUA 2IESA 2EM2A 1Y4SA 1IBKI 4ZYEA 2L2MA 2YTNA 1J5EE 5IWAI 2EWLA 3K17A 5C0XE 2C38A 3QT5A 2B3TB 5CFFE 4R03A 2VF3A 5A2QC 4N3OA 5FLXQ 2EPRA 2EPXA 4DR5E 4NXMI 3FIGA 1MX0A 1N34I 2V8QB 2C39B 4LF5I 3HXLA 1LLMC 2R42A 5BR8E 1WHQA 1X47A 2RS6A 4N4RB 4IJDA 2UXBE 3GMEA 2YT4A 2O1VA 4NBQA 4JYAI 4FWDA 2EQ3A 1NZ0A 4X65I 4X64E 5ADZA 1WJPA 4B3ME 3WU5A 5LL6R 2HK2A 4JG4A 1ZM4A 1X6HA 2M1SA 4AQYE 1MGTA 1GZ6A 1UBDC 2VQEI 4GEQB 4DPUA 1SR9A 2EOZA 4FWGA 1QZRA 2LJHA 2V2QA 3L00A 3CDIA 4USKA 3QT6A 2LE2A 3CWVA 4MDTA 2M9AA 4P78A 1RQ0A 1YPNA 1YYWA 1HNWE 2K7IA 1N0VC 2PO1A 2L92A 1N33I 4FN5A 4MU4A 3HULA 5AC4A 1MU5A 4B3TI 5A2QQ 4DR2E 2UUBE 3JAMQ 4X8WA 2EE8A 2DLQA 2ZM6I 4R2AA 2NPFA 4LF6E 5DRPA 1Z1BA 3BF2A 4Q28A 2RQLA 1T38A 2E72A 2PNMA 3F6HA 1IBKE 4WUBA 2KOUA 5C0XC 5IWAE 4JI1E 1NHJA 2CT1A 4JI0I 2ADRA 2EPAA 2BM0A 2R76A 1HNXI 4HACB 3ZKDA 1H7SA 1N34E 2JEBB 4B3SI 3PYDA 4LF5E 4WFTA 3J80C 5TSEA 2L2KB 3L7ZA 3UK3C 4JI7E 2EN6A 2EOYA 4DKKA 2EL4A 4JYAE 1KJKA 3LTOA 4P7DA 4X65E 5IXMB 5A6BA 2EQ0A 4DR7E 4DR3I 3M7NG 2EOEA 4GKJI 5IV8B 2JOBA 2VQEE 4USMA 4UT4A 5LMNE 1S4EA 1G2FC 4DPTA 2EOFA 3PS2A 2PO0A 2EN1A 3PYEA 1PJTA 2DB2A 1AAYA 2WW4A 4DV1I 1KYQA 2EM7A 4DV4I 2BV3A 3VHTB 1N33E 2EPUA 4B3TE 2YWQA 2C39A 4ZVIA 1MG7A 5ELWA 4DV3I 2ZM6E 2V89A 2JOXA 2YRHA 4WYQB 1B63A 1H73A 4IZKB 5C0XF 3J80Q 4WUCA 1JK1A 2C37B 3DF6A 2NN6B 4P7AA 1YZ9A 4FW7A 2ENAA 4GZNC 1FKAE 3OMLA 1N0UA 1YUJA 2WBSA 3ZM7A 2EMXA 4LFBI 2YRKA 4DV5E 4LTYA 2EMCA 2EORA 2PRTA 2EZ6A 1UDOA 5EL9A 2NN6F 4OKGA 4F2JC 1OYRA 1OYSA 2EOJA 2N3GA 2NN6C 4J8ZA 2EM9A 4JI0E 1L4SA 1HNXE 4UTGA 1UEKA 3LNUA 4OX9I 1QU6A 2YTJA 4B3SE 1TN9A 5AE1A 4FW5A 4DV2I 4KHPI 4BA2B 2F4VI 1X6EA 5IT9C 1EH6A 4M9VC 2LUPB 1T4OA 3PYGA 2JEAB 4DV0I 2EMFA 1FWKA 4DR3E 4GKJE 3P76A 2BA0G 4DUZI 4OO1D 4QNJA 2V87A 2EL5A 3ZOQB 5K36E 4P52A 5JEAD 1IBLI 3EPJA 1XMOI 4RHBB 5DRRA 3GONA 4MLQA 3K6QA 2V2ZA 4LFAI 2V85A 4DV1E 4DV4E 2YZTA 1YYKA 2DIXA 1Z5AA 4NHRA 2EOOA 1PDAA 2YTOA 3MSWA 4O4KA 3B82A 2EN2A 1Y5YA 4JI3I 1UDNA 4HACA 4IFDD 3M85D 2JEBA 3K1JA 2EMHA 1UHZA 5AE3A 2J65A 1A1IA 2EPKX 2YSOA 4DV3E 4EMDA 2E5LI 3ADGA 2LVHA 3EPKA 4F6MA 1T4LB 2JE6B 4LCHA 2YTIA 2IHR1 1ZBQA 4R2RA 2PO2A 4JI6I 5IT9Q 4LFBE 1NEIA 1F2IG 3J81C 4JI1I 2EPPA 2EOXA 2O1UA 2BBGA 2CTDA 4ZYGA 4WXDA 5KL7A 3J7AG 2WZOA 4MLVA 1Z0CA 2I9IA 4PRXA 1MEYC 1EA6A 3BGHA 4F9AB 3V5RA 1GQEA 5A69A 1N36I 5T6JA 5DRQA 4OO1B 4OX9E 5AC5A 1YHCA 2Z5BA 4IS9A 3OTOI 5KL2A 2H36X 3KZZA 1NHIA 3Q1QA 5JEAB 4DV2E 4KHPE 1FNMA 2LTRA 3QT7A 2F4VE 4OO1F 4JI7I 2Q2EB 2PNZB 2YPNA 2VQFI 3P3GA 2WP8A 2EQ1A 2EM4A 4DR7I 2RSIA 1A1GA 4OO1C 4WUDA 4DV0E 5JEAF 2EOMA 3ECRA 4IZKA 1G2DC 5LMNI 4DV6I 3WU4A 4DUZE 5JEAC 4IFDB 3THNA 2HJJA 2V86A 5A6AA 2MDRA 2UU9I 4HTGA 1IBLE 2FGGA 1XMOE 1KIJA 1Z0BA 2G7HA 2EMGA 4BCAA 3J81Q 4IFDF 2BB8A 4LFAE 2Z5CA 2FV4B 3HTXA 4LPFA 2R3VA 4IFDC 1PJSA 3P3EA 2XEXA 1I94I 3BBGA 2UUAI 4JI3E 4IZJD 2JT2A 5DNLA 4B3RI 2CG9A 1OYPA 2CVEA 2E5LE 4BA2A 4LF4I 4M30A 1K47A 1X6FA 2GLIA 4DV5I 2JPAA 4JI6E 5C0XD 1WXRA 1XHKA 1B62A 4MQYA 2GPIA 3EQ1A 4R2CA 4KQVA 4MU3A 3IWBA 2HKJA 4PRVA 1T39A 3DJWA 4O24A 2LUQA 3BIDA 2EMZA 2RSMA 4DU7A 1X48A 4DU8A 4BC7A 1BKNA 2RS7A
chains in the Genus database with same CATH topology
3D4JA 1ZXNA 4L8NA 1Z5CA 2O1WA 1N36E 2NUFA 4PU9A 3OTOE 1PKPA 2JR1A 1T4NA 1DARA 1RREA 2VQFE 1H74A 3HJCA 4DPXA 2ODRD 5FWKA 3ADJA 5AASA 4DV6E 3B78A 1FI4A 4IZJB 4M1KA 4DMIA 1FJGI 2UU9E 2M7QA 2VE7C 1U2RA 3P06A 2L2NA 2NA2A 2ZITA 4JI5I 2V2VA 4R1FA 1I94E 2BM1A 2UUAE 4B3RE 4TUIA 4LF4E 3QT8A 2V8PA 3AV0A 4Z7YA 2LMZA 4JV5I 5LMUI 3F0NA 2X7IA 2J7KA 4DPWA 4BBYA 4NXME 2DMYA 4GKKI 2HHHI 4WSPA 2LJPA 1X49A 1DI2A 1WUUA 3HQ1A 2JY9A 4FWHA 2ODRC 3ADIA 4X66I 1XMQI 4M2ZA 1STUA 4TUGA 2KHXA 4HYMA 2L8TA 2E1MA 4X62I 1FJGE 3V2UC 4BMJA 2UXCI 5L3JA 2AJ4A 1Z59A 4JI5E 1Z5BA 2DEIA 2Z5EA 4RPFA 3VYYA 2LRSA 3F6GA 4YHHI 1RC7A 4LF7I 3K85A 2B7VA 2LBSB 5FLXC 4F9BB 4DR1I 2GS8A 3HPSA 1XNQI 3H09A 4JV5E 5LMUE 5AE2A 1Z0GA 4F9CB 2FTXB 1ZM9A 4IZJA 2IOQA 1Y4UA 1Z0TA 1A6FA 1ELOA 4GKKE 1UILA 2HHHE 1OJ4A 4K0KI 4F54A 3ZKBA 1KKHA 1ZM3A 4BS9A 3PYFA 4R8OA 1Z0WA 4KZSA 5GMDA 1KVKA 4JI8I 3ZZ0A 1ZXMA 2MC5A 1NHHA 3T1YI 4X66E 1XMQE 4DUYI 2JWOA 3J7AM 2B9DA 1N32I 4DPYA 4OOGC 3T1HI 3JAMC 4I8OA 2CPNA 4X62E 2GQ0A 2UXCE 3ADLA 1S16A 3ZZTA 1RR9A 1J26A 4HXZA 1HNZI 3JU0A 4NXNI 4YHHE 2B7TA 4YY3I 4JI2I 4LF7E 4MYUA 2L3JA 2DEJA 4DR1E 1Y6ZA 4LF8I 1XNQE 3WU3A 1IBMI 1XNRI 3WU6A 3LLHA 1HR0I 4WPYA 5GMEA 3P1XA 4DR4I 4URLA 4DV7I 2CGEA 4K0KE 3ZZUA 2UXDI 2L3CA 2VF1A 1USVA 2V88A 4LFCI 4JI8E 4Z7CA 4M0VA 5F3WA 3T1YE 2EFGA 4DUYE 3HPZA 1N32E 1H7UA 3T1HE 1WHNA 4I3HA 3C4TA 3C4BA 3VYXA 3PRYA 1ZBTA 1HK7A 2A2CA 2CZ9A 3KWRA 2K4VA 2HKEA 2UUCI 1O0WA 2V83A 2ZBKB 1HNZE 2N3HA 4NXNE 3JTZA 4YY3E 4JI2E 3M6AA 3J7Yp 3AUZA 3VK6A 5DNYA 4LF8E 2X36A 1IBME 2F8BA 2Z5BB 4LF9I 2PNLA 1XNRE 1HR0E 2O1TA 4LU9A 4DR4E 4DXLA 4JI4I 4DV7E 2UXDE 2KONA 3RMPA 1H72C 4L5NC 4MYTA 4DR6I 1EI1A 4LFCE 1FWLA 2L33A 3LPSA 1J5EI 2Z5CB 3IWCA 2OI2A 4DR5I 2V34A 1YYOA 3Q6MA 1EKZA 1KTVA 2HFUA 5BR8I 2MC6A 2A2DA 3IWDA 4FW9A 2IOPA 1D6TA 2UXBI 3Q6NA 4X64I 4B3MI 2UUCE 2M4IA 4AQYI 2JVAA 2LTSA 1PIEA 2HK3A 2L6MA 4HY1A 4BC9A 2HFSA 1DQ3A 2RTXA 1HNWI 4ED4A 1Z0EA 1VISA 4LF9E 4XTJA 2NUGA 3B8HA 4DR2I 3LMLA 1Z0VA 2UUBI 2DSYA 3H4LA 4LF6I 2NUEA 4JI4E 2E1RA 1ZM2A 1PVGA 4DR6E 1USUA 1IBKI 1Y4SA 2L2MA 1J5EE 5IWAI 2EWLA 3K17A 3QT5A 2B3TB 5CFFE 4R03A 2VF3A 5A2QC 4N3OA 5FLXQ 4DR5E 4NXMI 3FIGA 1MX0A 1N34I 2V8QB 4LF5I 3HXLA 2R42A 5BR8E 1WHQA 1X47A 2RS6A 2UXBE 4JI7I 2YT4A 2O1VA 4JYAI 4FWDA 1NZ0A 4X65I 4X64E 5ADZA 4B3ME 3WU5A 5LL6R 2HK2A 4JG4A 1ZM4A 2VQEI 2M1SA 4AQYE 1GZ6A 4GEQB 4DPUA 1SR9A 4FWGA 1QZRA 2LJHA 2V2QA 4USKA 3QT6A 2LE2A 3CWVA 1HNWE 4P78A 1RQ0A 1YYWA 1N0VC 2L92A 1N33I 4FN5A 3HULA 1MU5A 4B3TI 5A2QQ 4DR2E 2UUBE 3JAMQ 4X8WA 2ZM6I 2NPFA 4LF6E 4Q28A 2PNMA 3F6HA 1IBKE 4WUBA 2KOUA 5IWAE 4JI1E 1NHJA 4JI0I 1HNXI 2BM0A 4HACB 3ZKDA 1H7SA 1N34E 4B3SI 3PYDA 4LF5E 4WFTA 3J80C 2L2KB 4JI7E 4DKKA 4JYAE 3LTOA 4P7DA 4X65E 4DR3I 4DR7E 4GKJI 2JOBA 2VQEE 4USMA 4UT4A 5LMNE 1S4EA 4DPTA 3PYEA 2DB2A 2WW4A 4DV1I 4DV4I 2BV3A 1N33E 4B3TE 4ZVIA 1MG7A 4DV3I 2ZM6E 2V89A 2JOXA 4WYQB 1B63A 1H73A 4IZKB 3J80Q 4WUCA 3DF6A 4P7AA 1YZ9A 1FKAE 3OMLA 1N0UA 4LFBI 3ZM7A 4DV5E 4LTYA 2EZ6A 2N3GA 4J8ZA 4JI0E 1HNXE 4UTGA 1UEKA 3LNUA 4OX9I 1QU6A 4B3SE 5AE1A 4DV2I 4KHPI 2F4VI 5IT9C 2LUPB 1T4OA 3PYGA 4DV0I 1FWKA 4DR3E 4GKJE 4DUZI 2V87A 3ZOQB 4P52A 1IBLI 1XMOI 3GONA 3K6QA 2V2ZA 4LFAI 2V85A 4DV1E 4DV4E 2YZTA 1YYKA 2DIXA 1Z5AA 3B82A 3MSWA 4JI3I 4HACA 3K1JA 1UHZA 5AE3A 4DV3E 2E5LI 4EMDA 3ADGA 1T4LB 2IHR1 1ZBQA 4JI6I 5IT9Q 4LFBE 3J81C 4JI1I 2O1UA 3J7AG 1Z0CA 2WZOA 4PRXA 1EA6A 4F9AB 3V5RA 1GQEA 1N36I 5T6JA 4OX9E 2Z5BA 3OTOI 2H36X 1NHIA 3Q1QA 4DV2E 4KHPE 1FNMA 2LTRA 3QT7A 2F4VE 2Q2EB 2VQFI 4DR7I 4WUDA 4DV0E 4IZKA 5LMNI 4DV6I 3WU4A 4DUZE 2V86A 2MDRA 2UU9I 1IBLE 2FGGA 1XMOE 1KIJA 1Z0BA 2G7HA 4BCAA 3J81Q 4LFAE 2Z5CA 2FV4B 3HTXA 2R3VA 2XEXA 1I94I 2UUAI 4JI3E 4IZJD 4B3RI 2CG9A 2E5LE 4LF4I 4M30A 1K47A 4DV5I 4JI6E 1WXRA 1XHKA 1B62A 4PRVA 4KQVA 3IWBA 2HKJA 3DJWA 2LUQA 2RSMA 4DU7A 1X48A 4DU8A 4BC7A 1BKNA 2RS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4J A;  1ZXN A;  1Z5C A;  1N36 E;  2NUF A;  4PU9 A;  3OTO E;  2RSM A;  1PKP A;  1T4N A;  1DAR A;  1RRE A;  2VQF E;  1H74 A;  4DPX A;  3ADJ A;  4DV6 E;  3B78 A;  1FI4 A;  4M1K A;  1FJG I;  2UU9 E;  1U2R A;  2L2N A;  2NA2 A;  2ZIT A;  4JI5 I;  2V2V A;  4R1F A;  1I94 E;  2BM1 A;  2UUA E;  4B3R E;  4LF4 E;  3QT8 A;  2V8P A;  4Z7Y A;  4JV5 I;  5LMU I;  3F0N A;  2X7I A;  2J7K A;  4DPW A;  4NXM E;  2DMY A;  4GKK I;  2HHH I;  2LJP A;  1X49 A;  1DI2 A;  1WUU A;  2JY9 A;  4FWH A;  3ADI A;  4X66 I;  1XMQ I;  4M2Z A;  1STU A;  2KHX A;  4HYM A;  4X62 I;  1FJG E;  3V2U C;  2UXC I;  5L3J A;  2AJ4 A;  1Z59 A;  4JI5 E;  2DEI A;  4RPF A;  3VYY A;  2LRS A;  4YHH I;  1RC7 A;  4LF7 I;  2B7V A;  2LBS B;  5FLX C;  4DR1 I;  2GS8 A;  1XNQ I;  4JV5 E;  5LMU E;  1Z0G A;  1ZM9 A;  1Z0T A;  1A6F A;  1ELO A;  4GKK E;  1UIL A;  2HHH E;  1OJ4 A;  4K0K I;  3ZKB A;  1KKH A;  1ZM3 A;  3PYF A;  1Z0W A;  5GMD A;  1KVK A;  4JI8 I;  3ZZ0 A;  1ZXM A;  3T1Y I;  1NHH A;  4X66 E;  1XMQ E;  4DUY I;  3J7A M;  1N32 I;  4DPY A;  4OOG C;  3T1H I;  3JAM C;  4X62 E;  2CPN A;  2UXC E;  3ADL A;  1S16 A;  3ZZT A;  1RR9 A;  1J26 A;  4HXZ A;  1HNZ I;  4NXN I;  4YHH E;  2B7T A;  4YY3 I;  4JI2 I;  4LF7 E;  4MYU A;  2L3J A;  2DEJ A;  4DR1 E;  4LF8 I;  1XNQ E;  3WU3 A;  1IBM I;  1XNR I;  3WU6 A;  3LLH A;  1HR0 I;  5GME A;  3P1X A;  4DR4 I;  4URL A;  4DV7 I;  3ZZU A;  4K0K E;  2UXD I;  2L3C A;  4LFC I;  4JI8 E;  4Z7C A;  3T1Y E;  2EFG A;  4DUY E;  1N32 E;  1H7U A;  3T1H E;  1WHN A;  4I3H A;  3C4T A;  3C4B A;  3VYX A;  1ZBT A;  2A2C A;  2CZ9 A;  2HKE A;  2UUC I;  1O0W A;  2ZBK B;  1HNZ E;  2N3H A;  4NXN E;  4YY3 E;  4JI2 E;  3M6A A;  3J7Y p;  4LF8 E;  2X36 A;  1IBM E;  4LF9 I;  1XNR E;  1HR0 E;  4DR4 E;  4DXL A;  4JI4 I;  4DV7 E;  2UXD E;  1H72 C;  4DR6 I;  4MYT A;  1EI1 A;  4LFC E;  1FWL A;  2L33 A;  3LPS A;  1J5E I;  2OI2 A;  4DR5 I;  2V34 A;  1YYO A;  1EKZ A;  1KTV A;  2HFU A;  5BR8 I;  2A2D A;  4FW9 A;  1D6T A;  2UXB I;  4X64 I;  4B3M I;  2UUC E;  4AQY I;  2JVA A;  2LTS A;  1PIE A;  2HK3 A;  4HY1 A;  2HFS A;  2RTX A;  1HNW I;  4ED4 A;  1Z0E A;  1VIS A;  4LF9 E;  4XTJ A;  2NUG A;  3B8H A;  4DR2 I;  1Z0V A;  2UUB I;  3H4L A;  4LF6 I;  2NUE A;  4JI4 E;  2E1R A;  1ZM2 A;  1PVG A;  4DR6 E;  1IBK I;  2L2M A;  1J5E E;  5IWA I;  3K17 A;  3QT5 A;  2B3T B;  5CFF E;  2VF3 A;  5A2Q C;  5FLX Q;  4DR5 E;  4NXM I;  1MX0 A;  1N34 I;  4LF5 I;  2R42 A;  5BR8 E;  1WHQ A;  1X47 A;  2RS6 A;  2UXB E;  4JI7 I;  2YT4 A;  4JYA I;  4FWD A;  1NZ0 A;  4X65 I;  4X64 E;  4B3M E;  3WU5 A;  5LL6 R;  2HK2 A;  4JG4 A;  1ZM4 A;  2VQE I;  4AQY E;  4DPU A;  4FWG A;  1QZR A;  2LJH A;  2V2Q A;  4USK A;  3QT6 A;  3CWV A;  1HNW E;  1YYW A;  1RQ0 A;  1N0V C;  1N33 I;  4FN5 A;  3HUL A;  1MU5 A;  4B3T I;  5A2Q Q;  4DR2 E;  2UUB E;  3JAM Q;  4X8W A;  2ZM6 I;  2NPF A;  4LF6 E;  1IBK E;  4WUB A;  5IWA E;  4JI1 E;  1NHJ A;  4JI0 I;  1HNX I;  2BM0 A;  4HAC B;  3ZKD A;  1H7S A;  1N34 E;  4B3S I;  3PYD A;  4LF5 E;  4WFT A;  3J80 C;  2L2K B;  4JI7 E;  4DKK A;  4JYA E;  3LTO A;  4X65 E;  4DR3 I;  4DR7 E;  4GKJ I;  4UT4 A;  2VQE E;  4USM A;  5LMN E;  1S4E A;  4DPT A;  3PYE A;  2DB2 A;  2WW4 A;  4DV1 I;  4DV4 I;  2BV3 A;  1N33 E;  4B3T E;  4ZVI A;  1MG7 A;  4DV3 I;  2ZM6 E;  4WYQ B;  1B63 A;  1H73 A;  3J80 Q;  4WUC A;  4P7A A;  1YZ9 A;  1FKA E;  4LFB I;  1N0U A;  3ZM7 A;  4DV5 E;  2EZ6 A;  2N3G A;  4JI0 E;  1HNX E;  4UTG A;  1UEK A;  3LNU A;  4OX9 I;  1QU6 A;  4B3S E;  4DV2 I;  4KHP I;  2F4V I;  5IT9 C;  2LUP B;  1T4O A;  3PYG A;  4DV0 I;  1FWK A;  4DR3 E;  4GKJ E;  4DUZ I;  4P52 A;  1IBL I;  1XMO I;  3GON A;  2V2Z A;  4LFA I;  1YYK A;  4DV1 E;  4DV4 E;  2DIX A;  1Z5A A;  3B82 A;  4JI3 I;  4HAC A;  3K1J A;  1UHZ A;  4DV3 E;  2E5L I;  4EMD A;  3ADG A;  1T4L B;  2IHR 1;  4JI6 I;  5IT9 Q;  4LFB E;  3J81 C;  4JI1 I;  1Z0C A;  3J7A G;  4PRX A;  1EA6 A;  3V5R A;  1GQE A;  1N36 I;  4OX9 E;  3OTO I;  1NHI A;  3Q1Q A;  4DV2 E;  4KHP E;  1FNM A;  2LTR A;  3QT7 A;  2F4V E;  2Q2E B;  2VQF I;  4DR7 I;  4WUD A;  4DV0 E;  5LMN I;  4DV6 I;  3WU4 A;  4DUZ E;  2MDR A;  2UU9 I;  1IBL E;  1XMO E;  1KIJ A;  1Z0B A;  3J81 Q;  4LFA E;  3HTX A;  2R3V A;  2XEX A;  1I94 I;  2UUA I;  4JI3 E;  4B3R I;  2E5L E;  4LF4 I;  4M30 A;  1K47 A;  4DV5 I;  4JI6 E;  1XHK A;  1B62 A;  4PRV A;  4KQV A;  2HKJ A;  2LUQ A;  1Z5B A;  4DU7 A;  1X48 A;  4DU8 A;  1BKN A;  2RS7 A; 
#chains in the Genus database with same CATH topology
 3D4J A;  1ZXN A;  4L8N A;  2EOH A;  1BBO A;  1N36 E;  2NUF A;  1E3P A;  4WXC A;  4R2D A;  1Z5C A;  2O1W A;  4PU9 A;  3OTO E;  5A6K A;  1PKP A;  2JR1 A;  2EP3 A;  5A6J A;  2BR2 B;  4R2P A;  1T4N A;  1DAR A;  1RRE A;  4O5G A;  2VQF E;  1H74 A;  3HJC A;  4MU1 A;  2EN7 A;  5K36 C;  4DPX A;  2LCE A;  2YTP A;  2ODR D;  1E3H A;  2JE6 A;  3ADJ A;  5AAS A;  5FWK A;  4DV6 E;  3B78 A;  4ZYH A;  1GTK A;  1IQS A;  1FI4 A;  3KZY A;  4IZJ B;  4M1K A;  5KL6 A;  4DMI A;  1FJG I;  2UU9 E;  4BA1 B;  2M7Q A;  2VE7 C;  1U2R A;  1VI7 A;  2BA1 G;  2DRP A;  3P06 A;  2L2N A;  3M99 B;  4FW6 A;  2NA2 A;  1YUI A;  4OZE A;  2ZIT A;  1PJQ A;  5C0X B;  4JI5 I;  2V2V A;  4R1F A;  2ELZ A;  4U3D A;  4WSG A;  1I94 E;  2BM1 A;  4OO1 A;  2UUA E;  2ENH A;  2EPC A;  4B3R E;  2F1D A;  4TUI A;  5JEA A;  2AE8 A;  4LF4 E;  3QT8 A;  2C38 B;  3AV0 A;  2EPN A;  2V8P A;  1P42 A;  2PNZ A;  2GO4 A;  2LMZ A;  4Z7Y A;  2EMK A;  4JV5 I;  5LMU I;  3F0N A;  2YU5 A;  3GCM A;  2X7I A;  2HC5 A;  1R6M A;  2VES A;  4LCG A;  2J7K A;  1SFE A;  4ISA A;  4IFD A;  4DPW A;  5LLQ A;  4BBY A;  4NXM E;  2DMY A;  3H1C A;  4GKK I;  2HHH I;  1N3G A;  2EL6 A;  4WSP A;  2LJP A;  2JP9 A;  2WNR B;  1X49 A;  1DI2 A;  2LJU A;  1WUU A;  2EN3 A;  3HQ1 A;  2EMI A;  2JY9 A;  2YTG A;  4FW3 A;  4FWH A;  2ODR C;  3ADI A;  4RH8 A;  1UDS A;  4X66 I;  1XMQ I;  4M2Z A;  2GO3 A;  1STU A;  4TUG A;  4FW4 A;  2KHX A;  4X9J A;  4QNK A;  1UN6 B;  2N8X A;  4HYM A;  2L8T A;  2IER A;  3MHS C;  2E1M A;  3DD6 A;  2EMY A;  1FJG E;  4X62 I;  3V2U C;  1DGC A;  4BMJ A;  2UXC I;  5L3J A;  2AJ4 A;  4J3D A;  1Z59 A;  4JI5 E;  1Z5B A;  2DEI A;  2Z5E A;  4RPF A;  3VYY A;  1AH5 A;  2LRS A;  3P3C A;  5DRO A;  3F6G A;  4YHH I;  1RC7 A;  2EOS A;  4LF7 I;  2D9H A;  3K85 A;  2GHF A;  2B7V A;  2I13 A;  2LBS B;  5FLX C;  4O43 A;  1Y60 A;  2BR2 A;  4F9B B;  4DR1 I;  2GS8 A;  3U1Y A;  3HPS A;  1XNQ I;  3H09 A;  4JV5 E;  5LMU E;  5AE2 A;  1Z0G A;  3TQM A;  1TF3 A;  5DNX A;  4F9C B;  2FTX B;  1ZM9 A;  4IZJ A;  3L7Z B;  2JYA A;  4WX9 A;  2IOQ A;  1Y4U A;  1Z0T A;  1A6F A;  1ELO A;  4BA1 A;  1IMU A;  2ENC A;  1UIL A;  2HHH E;  4GKK E;  1OJ4 A;  4K0K I;  5C0X A;  4F54 A;  3ZKB A;  2HGH A;  1KKH A;  2YSP A;  1ZM3 A;  4BS9 A;  4AM3 A;  3PYF A;  2WBT A;  4R8O A;  1Z0W A;  4KZS A;  5GMD A;  3M85 G;  1KVK A;  2DLK A;  4JI8 I;  2EPL X;  3ZZ0 A;  1WRJ A;  4HEI A;  1ZXM A;  2MC5 A;  1NHH A;  3T1Y I;  4X66 E;  1XMQ E;  2C37 A;  2JWO A;  2NN6 A;  4DUY I;  3J7A M;  2B9D A;  5K36 D;  1N32 I;  3UHM A;  2VRD A;  4DPY A;  4OOG C;  3T1H I;  2ELY A;  3B4T A;  3JAM C;  4I8O A;  2CPN A;  3QG5 C;  4X62 E;  2GQ0 A;  4IS1 C;  2A25 A;  1BBG A;  2UXC E;  3EPH A;  1X5W A;  3ADL A;  1S16 A;  1RR9 A;  2NN6 E;  3ZZT A;  2JXP A;  1J26 A;  4HXZ A;  1BB8 A;  1HNZ I;  4GQU A;  3JU0 A;  1TF6 A;  4NXN I;  4YHH E;  2B7T A;  4YY3 I;  4JI2 I;  1RMD A;  4LF7 E;  2WNR A;  4AIM A;  4MYU A;  2L3J A;  2DEJ A;  2EM0 A;  2YTD A;  4DR1 E;  2JEA A;  2EM6 A;  1Y6Z A;  4LF8 I;  4AID A;  1QNT A;  2EMB A;  1XNQ E;  3WU3 A;  1IBM I;  2EMW A;  1XNR I;  3WU6 A;  3LLH A;  2EN8 A;  2LV2 A;  4WPY A;  5GME A;  1HR0 I;  1RHY A;  3P1X A;  1P47 A;  4DR4 I;  5K36 B;  2EM8 A;  4R2Q A;  4URL A;  1A1H A;  2NAB A;  1IQO A;  4DV7 I;  2CGE A;  4K0K E;  3ZZU A;  3M7N D;  2UXD I;  2L3C A;  2VF1 A;  5K36 F;  1USV A;  3GLL A;  2V88 A;  4LFC I;  4JI8 E;  2EN4 A;  4Z7C A;  4M0V A;  5F3W A;  2DMI A;  3T1Y E;  4LOM A;  2EFG A;  4DUY E;  2BA1 D;  3HPZ A;  2O3Z A;  2Q8U A;  3THO B;  1N32 E;  1H7U A;  2EPZ A;  3T1H E;  3PS3 A;  1WHN A;  4I3H A;  3C4T A;  3C4B A;  2NN6 D;  3VYX A;  3PRY A;  2EM5 A;  1ZBT A;  1HK7 A;  2A2C A;  2CZ9 A;  2MKD A;  3KWR A;  2WBU A;  2K4V A;  4BHB A;  2HKE A;  2UUC I;  1O0W A;  2V83 A;  2ZBK B;  1HNZ E;  2PO2 B;  2RPC A;  2EOI A;  2N3H A;  2EPO A;  4NXN E;  3JTZ A;  4ZYD A;  2EJ4 A;  1YSA C;  1ZU1 A;  4YY3 E;  4JI2 E;  1A1K A;  3M6A A;  3J7Y p;  2DGC A;  3AUZ A;  3VK6 A;  5DNY A;  1YH8 A;  4MU0 A;  5KL3 A;  2YTQ A;  4OO1 E;  4LF8 E;  2X36 A;  1IBM E;  4NZV A;  2F8B A;  2CSH A;  2LO3 A;  5JEA E;  2Z5B B;  4LF9 I;  2PNL A;  4R2S A;  1B69 A;  1HR0 E;  1XNR E;  2O1T A;  1ZAA C;  2R1F A;  3CDJ A;  5KL4 A;  3NZK A;  4LU9 A;  1A1L A;  4FK5 C;  4DR4 E;  4DXL A;  2J7J A;  2WP8 B;  4JI4 I;  4DV7 E;  2YTF A;  4IFD E;  2BA0 D;  2UXD E;  2KON A;  3RMP A;  1H72 C;  3PS1 A;  4L5N C;  4MYT A;  4DR6 I;  1EI1 A;  1X3C A;  3C6K A;  4LFC E;  1FWL A;  2L33 A;  3LPS A;  1J5E I;  1UDQ A;  2PO1 B;  4LCF A;  4KWY A;  2Z5C B;  3IWC A;  5A6B D;  2OI2 A;  2EML A;  2MKN A;  1YFH A;  4DR5 I;  2V34 A;  1YYO A;  3Q6M A;  1EKZ A;  1KTV A;  3EPL A;  2HFU A;  1EH8 A;  2MC6 A;  2WCC 3;  2A2D A;  5BR8 I;  3IWD A;  4FW9 A;  1R6L A;  2IOP A;  1D6T A;  2UXB I;  2EOQ A;  2EPM X;  2LT7 A;  3Q6N A;  3U1K A;  4BHC A;  4X64 I;  1NCS A;  5K36 A;  4B3M I;  2UUC E;  2M4I A;  1JK2 A;  4AQY I;  2JVA A;  2LTS A;  4Q35 B;  1PIE A;  2HK3 A;  1ZR9 A;  2L6M A;  4HY1 A;  5EKW A;  4BC9 A;  2HFS A;  1DQ3 A;  2YU8 A;  1XXE A;  3KRN A;  2RTX A;  1HNW I;  2EM3 A;  4ED4 A;  4F6N A;  1A1F A;  1Z0E A;  1VIS A;  4LF9 E;  4XTJ A;  2NUG A;  3B8H A;  4DR2 I;  3LML A;  1Z0V A;  3HKM A;  2UUB I;  3C6M A;  2DSY A;  3H4L A;  4LF6 I;  5KL5 A;  2NUE A;  4JI4 E;  2E1R A;  1A1J A;  2YTE A;  4R2E A;  1ZM2 A;  1PVG A;  4DR6 E;  1EH7 A;  2PO0 B;  2YRM A;  3MHH C;  2MDG A;  4U3B A;  2EMA A;  1USU A;  2IES A;  2EM2 A;  1Y4S A;  1IBK I;  4ZYE A;  2L2M A;  2YTN A;  1J5E E;  5IWA I;  2EWL A;  3K17 A;  5C0X E;  2C38 A;  3QT5 A;  2B3T B;  5CFF E;  4R03 A;  2VF3 A;  5A2Q C;  4N3O A;  5FLX Q;  2EPR A;  2EPX A;  4DR5 E;  4NXM I;  3FIG A;  1MX0 A;  1N34 I;  2V8Q B;  2C39 B;  4LF5 I;  3HXL A;  1LLM C;  2R42 A;  5BR8 E;  1WHQ A;  1X47 A;  2RS6 A;  4N4R B;  4IJD A;  2UXB E;  3GME A;  2YT4 A;  2O1V A;  4NBQ A;  4JYA I;  4FWD A;  2EQ3 A;  1NZ0 A;  4X65 I;  4X64 E;  5ADZ A;  1WJP A;  4B3M E;  3WU5 A;  5LL6 R;  2HK2 A;  4JG4 A;  1ZM4 A;  1X6H A;  2M1S A;  4AQY E;  1MGT A;  1GZ6 A;  1UBD C;  2VQE I;  4GEQ B;  4DPU A;  1SR9 A;  2EOZ A;  4FWG A;  1QZR A;  2LJH A;  2V2Q A;  3L00 A;  3CDI A;  4USK A;  3QT6 A;  2LE2 A;  3CWV A;  4MDT A;  2M9A A;  4P78 A;  1RQ0 A;  1YPN A;  1YYW A;  1HNW E;  2K7I A;  1N0V C;  2PO1 A;  2L92 A;  1N33 I;  4FN5 A;  4MU4 A;  3HUL A;  5AC4 A;  1MU5 A;  4B3T I;  5A2Q Q;  4DR2 E;  2UUB E;  3JAM Q;  4X8W A;  2EE8 A;  2DLQ A;  2ZM6 I;  4R2A A;  2NPF A;  4LF6 E;  5DRP A;  1Z1B A;  3BF2 A;  4Q28 A;  2RQL A;  1T38 A;  2E72 A;  2PNM A;  3F6H A;  1IBK E;  4WUB A;  2KOU A;  5C0X C;  5IWA E;  4JI1 E;  1NHJ A;  2CT1 A;  4JI0 I;  2ADR A;  2EPA A;  2BM0 A;  2R76 A;  1HNX I;  4HAC B;  3ZKD A;  1H7S A;  1N34 E;  2JEB B;  4B3S I;  3PYD A;  4LF5 E;  4WFT A;  3J80 C;  5TSE A;  2L2K B;  3L7Z A;  3UK3 C;  4JI7 E;  2EN6 A;  2EOY A;  4DKK A;  2EL4 A;  4JYA E;  1KJK A;  3LTO A;  4P7D A;  4X65 E;  5IXM B;  5A6B A;  2EQ0 A;  4DR7 E;  4DR3 I;  3M7N G;  2EOE A;  4GKJ I;  5IV8 B;  2JOB A;  2VQE E;  4USM A;  4UT4 A;  5LMN E;  1S4E A;  1G2F C;  4DPT A;  2EOF A;  3PS2 A;  2PO0 A;  2EN1 A;  3PYE A;  1PJT A;  2DB2 A;  1AAY A;  2WW4 A;  4DV1 I;  1KYQ A;  2EM7 A;  4DV4 I;  2BV3 A;  3VHT B;  1N33 E;  2EPU A;  4B3T E;  2YWQ A;  2C39 A;  4ZVI A;  1MG7 A;  5ELW A;  4DV3 I;  2ZM6 E;  2V89 A;  2JOX A;  2YRH A;  4WYQ B;  1B63 A;  1H73 A;  4IZK B;  5C0X F;  3J80 Q;  4WUC A;  1JK1 A;  2C37 B;  3DF6 A;  2NN6 B;  4P7A A;  1YZ9 A;  4FW7 A;  2ENA A;  4GZN C;  1FKA E;  3OML A;  1N0U A;  1YUJ A;  2WBS A;  3ZM7 A;  2EMX A;  4LFB I;  2YRK A;  4DV5 E;  4LTY A;  2EMC A;  2EOR A;  2PRT A;  2EZ6 A;  1UDO A;  5EL9 A;  2NN6 F;  4OKG A;  4F2J C;  1OYR A;  1OYS A;  2EOJ A;  2N3G A;  2NN6 C;  4J8Z A;  2EM9 A;  4JI0 E;  1L4S A;  1HNX E;  4UTG A;  1UEK A;  3LNU A;  4OX9 I;  1QU6 A;  2YTJ A;  4B3S E;  1TN9 A;  5AE1 A;  4FW5 A;  4DV2 I;  4KHP I;  4BA2 B;  2F4V I;  1X6E A;  5IT9 C;  1EH6 A;  4M9V C;  2LUP B;  1T4O A;  3PYG A;  2JEA B;  4DV0 I;  2EMF A;  1FWK A;  4DR3 E;  4GKJ E;  3P76 A;  2BA0 G;  4DUZ I;  4OO1 D;  4QNJ A;  2V87 A;  2EL5 A;  3ZOQ B;  5K36 E;  4P52 A;  5JEA D;  1IBL I;  3EPJ A;  1XMO I;  4RHB B;  5DRR A;  3GON A;  4MLQ A;  3K6Q A;  2V2Z A;  4LFA I;  2V85 A;  4DV1 E;  4DV4 E;  2YZT A;  1YYK A;  2DIX A;  1Z5A A;  4NHR A;  2EOO A;  1PDA A;  2YTO A;  3MSW A;  4O4K A;  3B82 A;  2EN2 A;  1Y5Y A;  4JI3 I;  1UDN A;  4HAC A;  4IFD D;  3M85 D;  2JEB A;  3K1J A;  2EMH A;  1UHZ A;  5AE3 A;  2J65 A;  1A1I A;  2EPK X;  2YSO A;  4DV3 E;  4EMD A;  2E5L I;  3ADG A;  2LVH A;  3EPK A;  4F6M A;  1T4L B;  2JE6 B;  4LCH A;  2YTI A;  2IHR 1;  1ZBQ A;  4R2R A;  2PO2 A;  4JI6 I;  5IT9 Q;  4LFB E;  1NEI A;  1F2I G;  3J81 C;  4JI1 I;  2EPP A;  2EOX A;  2O1U A;  2BBG A;  2CTD A;  4ZYG A;  4WXD A;  5KL7 A;  3J7A G;  2WZO A;  4MLV A;  1Z0C A;  2I9I A;  4PRX A;  1MEY C;  1EA6 A;  3BGH A;  4F9A B;  3V5R A;  1GQE A;  5A69 A;  1N36 I;  5T6J A;  5DRQ A;  4OO1 B;  4OX9 E;  5AC5 A;  1YHC A;  2Z5B A;  4IS9 A;  3OTO I;  5KL2 A;  2H36 X;  3KZZ A;  1NHI A;  3Q1Q A;  5JEA B;  4DV2 E;  4KHP E;  1FNM A;  2LTR A;  3QT7 A;  2F4V E;  4OO1 F;  4JI7 I;  2Q2E B;  2PNZ B;  2YPN A;  2VQF I;  3P3G A;  2WP8 A;  2EQ1 A;  2EM4 A;  4DR7 I;  2RSI A;  1A1G A;  4OO1 C;  4WUD A;  4DV0 E;  5JEA F;  2EOM A;  3ECR A;  4IZK A;  1G2D C;  5LMN I;  4DV6 I;  3WU4 A;  4DUZ E;  5JEA C;  4IFD B;  3THN A;  2HJJ A;  2V86 A;  5A6A A;  2MDR A;  2UU9 I;  4HTG A;  1IBL E;  2FGG A;  1XMO E;  1KIJ A;  1Z0B A;  2G7H A;  2EMG A;  4BCA A;  3J81 Q;  4IFD F;  2BB8 A;  4LFA E;  2Z5C A;  2FV4 B;  3HTX A;  4LPF A;  2R3V A;  4IFD C;  1PJS A;  3P3E A;  2XEX A;  1I94 I;  3BBG A;  2UUA I;  4JI3 E;  4IZJ D;  2JT2 A;  5DNL A;  4B3R I;  2CG9 A;  1OYP A;  2CVE A;  2E5L E;  4BA2 A;  4LF4 I;  4M30 A;  1K47 A;  1X6F A;  2GLI A;  4DV5 I;  2JPA A;  4JI6 E;  5C0X D;  1WXR A;  1XHK A;  1B62 A;  4MQY A;  2GPI A;  3EQ1 A;  4R2C A;  4KQV A;  4MU3 A;  3IWB A;  2HKJ A;  4PRV A;  1T39 A;  3DJW A;  4O24 A;  2LUQ A;  3BID A;  2EMZ A;  2RSM A;  4DU7 A;  1X48 A;  4DU8 A;  4BC7 A;  1BKN A;  2RS7 A; 
#chains in the Genus database with same CATH homology
 3D4J A;  1ZXN A;  4L8N A;  1Z5C A;  2O1W A;  1N36 E;  2NUF A;  4PU9 A;  3OTO E;  1PKP A;  2JR1 A;  1T4N A;  1DAR A;  1RRE A;  2VQF E;  1H74 A;  3HJC A;  4DPX A;  2ODR D;  5FWK A;  3ADJ A;  5AAS A;  4DV6 E;  3B78 A;  1FI4 A;  4IZJ B;  4M1K A;  4DMI A;  1FJG I;  2UU9 E;  2M7Q A;  2VE7 C;  1U2R A;  3P06 A;  2L2N A;  2NA2 A;  2ZIT A;  4JI5 I;  2V2V A;  4R1F A;  1I94 E;  2BM1 A;  2UUA E;  4B3R E;  4TUI A;  4LF4 E;  3QT8 A;  2V8P A;  3AV0 A;  4Z7Y A;  2LMZ A;  4JV5 I;  5LMU I;  3F0N A;  2X7I A;  2J7K A;  4DPW A;  4BBY A;  4NXM E;  2DMY A;  4GKK I;  2HHH I;  4WSP A;  2LJP A;  1X49 A;  1DI2 A;  1WUU A;  3HQ1 A;  2JY9 A;  4FWH A;  2ODR C;  3ADI A;  4X66 I;  1XMQ I;  4M2Z A;  1STU A;  4TUG A;  2KHX A;  4HYM A;  2L8T A;  2E1M A;  4X62 I;  1FJG E;  3V2U C;  4BMJ A;  2UXC I;  5L3J A;  2AJ4 A;  1Z59 A;  4JI5 E;  1Z5B A;  2DEI A;  2Z5E A;  4RPF A;  3VYY A;  2LRS A;  3F6G A;  4YHH I;  1RC7 A;  4LF7 I;  3K85 A;  2B7V A;  2LBS B;  5FLX C;  4F9B B;  4DR1 I;  2GS8 A;  3HPS A;  1XNQ I;  3H09 A;  4JV5 E;  5LMU E;  5AE2 A;  1Z0G A;  4F9C B;  2FTX B;  1ZM9 A;  4IZJ A;  2IOQ A;  1Y4U A;  1Z0T A;  1A6F A;  1ELO A;  4GKK E;  1UIL A;  2HHH E;  1OJ4 A;  4K0K I;  4F54 A;  3ZKB A;  1KKH A;  1ZM3 A;  4BS9 A;  3PYF A;  4R8O A;  1Z0W A;  4KZS A;  5GMD A;  1KVK A;  4JI8 I;  3ZZ0 A;  1ZXM A;  2MC5 A;  1NHH A;  3T1Y I;  4X66 E;  1XMQ E;  4DUY I;  2JWO A;  3J7A M;  2B9D A;  1N32 I;  4DPY A;  4OOG C;  3T1H I;  3JAM C;  4I8O A;  2CPN A;  4X62 E;  2GQ0 A;  2UXC E;  3ADL A;  1S16 A;  3ZZT A;  1RR9 A;  1J26 A;  4HXZ A;  1HNZ I;  3JU0 A;  4NXN I;  4YHH E;  2B7T A;  4YY3 I;  4JI2 I;  4LF7 E;  4MYU A;  2L3J A;  2DEJ A;  4DR1 E;  1Y6Z A;  4LF8 I;  1XNQ E;  3WU3 A;  1IBM I;  1XNR I;  3WU6 A;  3LLH A;  1HR0 I;  4WPY A;  5GME A;  3P1X A;  4DR4 I;  4URL A;  4DV7 I;  2CGE A;  4K0K E;  3ZZU A;  2UXD I;  2L3C A;  2VF1 A;  1USV A;  2V88 A;  4LFC I;  4JI8 E;  4Z7C A;  4M0V A;  5F3W A;  3T1Y E;  2EFG A;  4DUY E;  3HPZ A;  1N32 E;  1H7U A;  3T1H E;  1WHN A;  4I3H A;  3C4T A;  3C4B A;  3VYX A;  3PRY A;  1ZBT A;  1HK7 A;  2A2C A;  2CZ9 A;  3KWR A;  2K4V A;  2HKE A;  2UUC I;  1O0W A;  2V83 A;  2ZBK B;  1HNZ E;  2N3H A;  4NXN E;  3JTZ A;  4YY3 E;  4JI2 E;  3M6A A;  3J7Y p;  3AUZ A;  3VK6 A;  5DNY A;  4LF8 E;  2X36 A;  1IBM E;  2F8B A;  2Z5B B;  4LF9 I;  2PNL A;  1XNR E;  1HR0 E;  2O1T A;  4LU9 A;  4DR4 E;  4DXL A;  4JI4 I;  4DV7 E;  2UXD E;  2KON A;  3RMP A;  1H72 C;  4L5N C;  4MYT A;  4DR6 I;  1EI1 A;  4LFC E;  1FWL A;  2L33 A;  3LPS A;  1J5E I;  2Z5C B;  3IWC A;  2OI2 A;  4DR5 I;  2V34 A;  1YYO A;  3Q6M A;  1EKZ A;  1KTV A;  2HFU A;  5BR8 I;  2MC6 A;  2A2D A;  3IWD A;  4FW9 A;  2IOP A;  1D6T A;  2UXB I;  3Q6N A;  4X64 I;  4B3M I;  2UUC E;  2M4I A;  4AQY I;  2JVA A;  2LTS A;  1PIE A;  2HK3 A;  2L6M A;  4HY1 A;  4BC9 A;  2HFS A;  1DQ3 A;  2RTX A;  1HNW I;  4ED4 A;  1Z0E A;  1VIS A;  4LF9 E;  4XTJ A;  2NUG A;  3B8H A;  4DR2 I;  3LML A;  1Z0V A;  2UUB I;  2DSY A;  3H4L A;  4LF6 I;  2NUE A;  4JI4 E;  2E1R A;  1ZM2 A;  1PVG A;  4DR6 E;  1USU A;  1IBK I;  1Y4S A;  2L2M A;  1J5E E;  5IWA I;  2EWL A;  3K17 A;  3QT5 A;  2B3T B;  5CFF E;  4R03 A;  2VF3 A;  5A2Q C;  4N3O A;  5FLX Q;  4DR5 E;  4NXM I;  3FIG A;  1MX0 A;  1N34 I;  2V8Q B;  4LF5 I;  3HXL A;  2R42 A;  5BR8 E;  1WHQ A;  1X47 A;  2RS6 A;  2UXB E;  4JI7 I;  2YT4 A;  2O1V A;  4JYA I;  4FWD A;  1NZ0 A;  4X65 I;  4X64 E;  5ADZ A;  4B3M E;  3WU5 A;  5LL6 R;  2HK2 A;  4JG4 A;  1ZM4 A;  2VQE I;  2M1S A;  4AQY E;  1GZ6 A;  4GEQ B;  4DPU A;  1SR9 A;  4FWG A;  1QZR A;  2LJH A;  2V2Q A;  4USK A;  3QT6 A;  2LE2 A;  3CWV A;  1HNW E;  4P78 A;  1RQ0 A;  1YYW A;  1N0V C;  2L92 A;  1N33 I;  4FN5 A;  3HUL A;  1MU5 A;  4B3T I;  5A2Q Q;  4DR2 E;  2UUB E;  3JAM Q;  4X8W A;  2ZM6 I;  2NPF A;  4LF6 E;  4Q28 A;  2PNM A;  3F6H A;  1IBK E;  4WUB A;  2KOU A;  5IWA E;  4JI1 E;  1NHJ A;  4JI0 I;  1HNX I;  2BM0 A;  4HAC B;  3ZKD A;  1H7S A;  1N34 E;  4B3S I;  3PYD A;  4LF5 E;  4WFT A;  3J80 C;  2L2K B;  4JI7 E;  4DKK A;  4JYA E;  3LTO A;  4P7D A;  4X65 E;  4DR3 I;  4DR7 E;  4GKJ I;  2JOB A;  2VQE E;  4USM A;  4UT4 A;  5LMN E;  1S4E A;  4DPT A;  3PYE A;  2DB2 A;  2WW4 A;  4DV1 I;  4DV4 I;  2BV3 A;  1N33 E;  4B3T E;  4ZVI A;  1MG7 A;  4DV3 I;  2ZM6 E;  2V89 A;  2JOX A;  4WYQ B;  1B63 A;  1H73 A;  4IZK B;  3J80 Q;  4WUC A;  3DF6 A;  4P7A A;  1YZ9 A;  1FKA E;  3OML A;  1N0U A;  4LFB I;  3ZM7 A;  4DV5 E;  4LTY A;  2EZ6 A;  2N3G A;  4J8Z A;  4JI0 E;  1HNX E;  4UTG A;  1UEK A;  3LNU A;  4OX9 I;  1QU6 A;  4B3S E;  5AE1 A;  4DV2 I;  4KHP I;  2F4V I;  5IT9 C;  2LUP B;  1T4O A;  3PYG A;  4DV0 I;  1FWK A;  4DR3 E;  4GKJ E;  4DUZ I;  2V87 A;  3ZOQ B;  4P52 A;  1IBL I;  1XMO I;  3GON A;  3K6Q A;  2V2Z A;  4LFA I;  2V85 A;  4DV1 E;  4DV4 E;  2YZT A;  1YYK A;  2DIX A;  1Z5A A;  3B82 A;  3MSW A;  4JI3 I;  4HAC A;  3K1J A;  1UHZ A;  5AE3 A;  4DV3 E;  2E5L I;  4EMD A;  3ADG A;  1T4L B;  2IHR 1;  1ZBQ A;  4JI6 I;  5IT9 Q;  4LFB E;  3J81 C;  4JI1 I;  2O1U A;  3J7A G;  1Z0C A;  2WZO A;  4PRX A;  1EA6 A;  4F9A B;  3V5R A;  1GQE A;  1N36 I;  5T6J A;  4OX9 E;  2Z5B A;  3OTO I;  2H36 X;  1NHI A;  3Q1Q A;  4DV2 E;  4KHP E;  1FNM A;  2LTR A;  3QT7 A;  2F4V E;  2Q2E B;  2VQF I;  4DR7 I;  4WUD A;  4DV0 E;  4IZK A;  5LMN I;  4DV6 I;  3WU4 A;  4DUZ E;  2V86 A;  2MDR A;  2UU9 I;  1IBL E;  2FGG A;  1XMO E;  1KIJ A;  1Z0B A;  2G7H A;  4BCA A;  3J81 Q;  4LFA E;  2Z5C A;  2FV4 B;  3HTX A;  2R3V A;  2XEX A;  1I94 I;  2UUA I;  4JI3 E;  4IZJ D;  4B3R I;  2CG9 A;  2E5L E;  4LF4 I;  4M30 A;  1K47 A;  4DV5 I;  4JI6 E;  1WXR A;  1XHK A;  1B62 A;  4PRV A;  4KQV A;  3IWB A;  2HKJ A;  3DJW A;  2LUQ A;  2RSM A;  4DU7 A;  1X48 A;  4DU8 A;  4BC7 A;  1BKN A;  2RS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...