4NXMI

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxmI00
2HK2A 1ZM4A 4LFCI 4DUYI 4DV0I 2HK3A 3ZZTA 4DV1I 1RR9A 1IBME 1HNXI 4HACA 4LF5I 1HR0E 3OTOE 3ZZUA 2VQEI 2A2CA 1I94I 4UT4A 3ZKBA 4DV6E 2J7KA 5FLXQ 4LFAE 1FI4A 4X66I 4DR2I 4FN5A 4WUDA 2E5LE 1D6TA 4B3SI 4JG4A 4JI6I 5IT9Q 2DEJA 1XMOE 1S16A 4EMDA 1Z0VA 4JI0E 4JI1I 3K17A 4DV6I 1KIJA 4YHHE 4LF7I 2HFUA 4DR7I 4JI7E 1Z5BA 2V2ZA 3H4LA 5A2QQ 1N34E 4FWGA 1XMQE 2BV3A 4DUYE 4LFCE 2V34A 4PU9A 3PYGA 3ZZ0A 3K1JA 1MG7A 4JI8I 1IBLE 3T1HI 3J7AM 2CZ9A 4HXZA 4LF8E 1KKHA 1FJGE 1H72C 5GMDA 3WU3A 1N34I 5LMUE 1XMQI 1H74A 4DR1E 4FW9A 1NHHA 1VISA 2BM0A 3F0NA 4DU8A 4DV5E 2R3VA 1B62A 4JI4I 4LF8I 4DPUA 4LFBI 4R1FA 1FWKA 4JI1E 3J80Q 4K0KI 1FNMA 1Z5AA 3HULA 5LMNI 4DV3E 4LF4E 4XTJA 2XEXA 1A6FA 4AQYI 1H7UA 3J81Q 4JI5I 4JI7I 3J80C 2AJ4A 3B8HA 3ZM7A 1HNZE 3T1YI 4MYTA 1K47A 4HACB 2F4VE 4DV0E 4HY1A 2NPFA 4LF6I 4X64I 1N0VC 1HNWE 3JAMC 2VQFI 4I3HA 4JYAE 5LMUI 1ZXMA 4X65E 2UXDE 1XNQI 1J5EI 3WU6A 4KHPI 4DV2I 2E5LI 4B3SE 2VF3A 3WU5A 3PYDA 3QT6A 4OX9E 1XMOI 4JV5I 2GS8A 1KVKA 4K0KE 4JI0I 4DXLA 2E1RA 1PIEA 4KHPE 3PYEA 4JI5E 4DR7E 4DV7I 1BKNA 4DUZE 2HKEA 4URLA 4JV5E 3D4JA 1N32I 4PRVA 1Z0WA 4DPYA 2V8PA 4LF6E 1ZXNA 4DU7A 2UUAE 1ZM9A 1IBLI 4NXNE 2UU9E 4DR6I 2ZM6E 1EI1A 3CWVA 2V2VA 4KQVA 4B3ME 1N32E 5IWAI 4JI3E 4DR5E 4PRXA 2BM1A 1ZM2A 4LFBE 3ZKDA 3V2UC 4B3RE 4GKKE 1QZRA 1Z5CA 4WUBA 5LMNE 4DV3I 1U2RA 1ELOA 4DR3I 4JI8E 4YY3E 4LF9I 5IWAE 4AQYE 1N36E 5BR8E 1FJGI 3M6AA 4HYMA 1HNZI 2WW4A 4P52A 2LJPA 4DR1I 4UTGA 2UUBI 1Z0CA 4YY3I 2X36A 1NZ0A 2V2QA 4LF9E 4LF5E 2A2DA 4DV5I 3J81C 3OTOI 4NXNI 1XHKA 2VQEE 2UU9I 4DR6E 2VQFE 1H73A 4DPTA 1N33I 4JI2I 4DV4E 2HHHI 4RPFA 4JYAI 4X65I 1DARA 2UXDI 2UXBE 1XNRE 1XNQE 1WUUA 4X62I 1KTVA 2Q2EB 4DV2E 4DR5I 1FKAE 2HFSA 1PVGA 4USKA 1B63A 4B3RI 1RREA 3T1YE 5IT9C 2X7IA 2HHHE 3QT8A 2F4VI 2UUCI 3JAMQ 4YHHI 1HNXE 1MX0A 5L3JA 1FWLA 1HNWI 2OI2A 1N36I 1PKPA 4DV7E 2EFGA 2DEIA 4DR2E 3V5RA 4USMA 2HKJA 2UUCE 2UUBE 4DR4I 3PYFA 2ZBKB 4JI6E 5A2QC 4ZVIA 2UXCE 1NHJA 4OX9I 2ZM6I 4DV4I 3QT7A 2UXBI 4B3TI 4Z7YA 1H7SA 5LL6R 4B3MI 4X62E 4WUCA 1NHIA 4DR4E 4DPXA 5GMEA 4JI3I 1IBKE 4DUZI 4FWHA 1Z0GA 5FLXC 1UEKA 4Z7CA 4B3TE 4DR3E 1IBMI 4LF4I 4MYUA 1Z0BA 1EA6A 2UUAI 3T1HE 3WU4A 4GKJI 5BR8I 1OJ4A 2R42A 1I94E 1Z59A 4NXMI 1ZM3A 4LFAI 4M1KA 1N0UA 2ZITA 4X66E 4P7AA 3Q1QA 3LTOA 4X64E 2UXCI 4DPWA 3QT5A 4JI4E 4GKJE 4ED4A 3LNUA 1N33E 4JI2E 4GKKI 4DV1E 4NXME 4FWDA 1J5EE 1S4EA 3B82A 1XNRI 4LF7E 1Z0EA 1HR0I 1IBKI 1Z0TA 3J7AG 1MU5A 3LPSA 3B78A 3GONA
chains in the Genus database with same CATH superfamily
2HK2A 1ZM4A 4LFCI 4DUYI 4DV0I 2CGEA 2J65A 2HK3A 3ZZTA 4DV1I 4IFDB 1RR9A 4IFDE 1IBME 1HNXI 2O3ZA 2AE8A 3PS3A 2NN6D 4HACA 4LF5I 1HR0E 3OTOE 4LPFA 3ZZUA 2VQEI 4OO1D 2A2CA 1I94I 1UDOA 4UT4A 3ZKBA 4DV6E 2J7KA 5FLXQ 4LFAE 1FI4A 3K85A 4X66I 4DR2I 4FN5A 4WUDA 2E5LE 1D6TA 4B3SI 3PS2A 4JG4A 3DD6A 3GCMA 5DNXA 2WNRA 4JI6I 4U3BA 5IT9Q 2DEJA 1XMOE 1S16A 2VESA 4EMDA 3Q6MA 2IOQA 2C37B 1Z0VA 4JI0E 4JI1I 3K17A 2Z5EA 4DV6I 1KIJA 1P42A 5DRQA 4YHHE 4LF7I 2HFUA 4DR7I 4MU0A 4JI7E 2NN6B 1Z5BA 2C37A 2V2ZA 1R6MA 3H4LA 5A2QQ 1N34E 4FWGA 1XMQE 2BV3A 4DUYE 4LFCE 2V34A 4PU9A 5C0XC 3PYGA 3ZZ0A 2CVEA 4NBQA 3K1JA 3CDIA 1OYPA 1MG7A 1Y4UA 4JI8I 1IBLE 3T1HI 3J7AM 2CZ9A 4HXZA 4LF8E 3GMEA 1KKHA 1FJGE 4OKGA 1H72C 1E3PA 5GMDA 3WU3A 1N34I 5LMUE 1USVA 1XMQI 4IZKB 1H74A 4IFDF 4DR1E 4ISAA 4FW9A 1NHHA 1VISA 2BM0A 3H1CA 5C0XE 3F0NA 4AM3A 2C38A 4DU8A 2JEBA 4DV5E 2R3VA 3KRNA 1B62A 3PS1A 3HKMA 4JI4I 4LF8I 4DPUA 4LFBI 1UDSA 4FW3A 4R1FA 4LCFA 1FWKA 4JI1E 5K36E 3J80Q 4K0KI 1FNMA 1Z5AA 3HULA 5LMNI 4DV3E 4BA1A 3M7ND 4LF4E 4XTJA 2XEXA 1A6FA 4AQYI 1H7UA 3J81Q 4JI5I 4JI7I 3J80C 2AJ4A 3Q6NA 2BR2A 3B8HA 1YH8A 4IFDA 3ZM7A 1HNZE 5C0XF 3T1YI 4MYTA 2BA0D 1K47A 4HACB 1E3HA 2F4VE 5K36C 4DV0E 5C0XB 4HY1A 2NPFA 4IZKA 3CDJA 4LF6I 4X64I 1N0VC 1Y4SA 1HNWE 2PNZA 2F1DA 4IZJB 3JAMC 2C39A 2VQFI 1UDNA 4I3HA 4JYAE 5LMUI 1ZXMA 4X65E 2UXDE 1XNQI 2PO0B 1J5EI 3WU6A 2Z5CA 4KHPI 5FWKA 4DV2I 2E5LI 1YHCA 4B3SE 2VF3A 3WU5A 3PYDA 2PO2B 5DRRA 2PNZB 4AIDA 3QT6A 3P06A 4OX9E 4MU4A 3NZKA 1XMOI 2BR2B 2O1WA 4JV5I 2NN6E 3PRYA 2GS8A 4OO1B 1KVKA 4K0KE 4JI0I 4DXLA 3P76A 2E1RA 1PIEA 4KHPE 3PYEA 2C38B 1Y5YA 4QNJA 4JI5E 4DR7E 2PO2A 4DV7I 1BKNA 2NN6C 4J3DA 4DUZE 2HKEA 5ELWA 4URLA 4OO1F 4JV5E 3D4JA 1N32I 4PRVA 1Z0WA 4MDTA 4DPYA 2V8PA 4MQYA 4LF6E 1ZXNA 4DU7A 2UUAE 1ZM9A 1IBLI 4LCGA 4OZEA 4NXNE 2UU9E 2WP8B 2ZM6E 4DR6I 5DNLA 4AIMA 1EI1A 5DRPA 3CWVA 2V2VA 4KQVA 4B3ME 1RHYA 1N32E 3B4TA 5JEAF 4FW4A 1OYSA 2BA1D 5IWAI 4JI3E 4DR5E 4PRXA 4MU1A 1Y60A 2C39B 2BM1A 5JEAD 4BA2A 4BA1B 1ZM2A 3U1YA 5K36B 4LFBE 3ZKDA 3L7ZA 3V2UC 4B3RE 4GKKE 1QZRA 1Z5CA 5K36F 4WUBA 4LOMA 5LMNE 4DV3I 1U2RA 1ELOA 4DR3I 4FW7A 4JI8E 4YY3E 5K36A 4LF9I 3UHMA 5IWAE 2NN6F 4AQYE 1N36E 5BR8E 1FJGI 4MU3A 3M6AA 2JE6A 4HYMA 1HNZI 2WW4A 4P52A 2LJPA 4DR1I 1USUA 4UTGA 2UUBI 1Z0CA 2IOPA 4OO1E 4YY3I 2X36A 4N3OA 1NZ0A 2V2QA 4LF9E 2Z5CB 2A2DA 4DV5I 4LF5E 3J81C 3OTOI 4NXNI 1XHKA 2VQEE 2UU9I 4DR6E 2VQFE 1H73A 1Y6ZA 4DPTA 1N33I 4JI2I 4DV4E 2HHHI 2JE6B 4RPFA 4JYAI 4LCHA 4X65I 1DARA 2UXDI 2UXBE 1XNRE 1XNQE 1WUUA 4X62I 1KTVA 2JEAA 3LPSA 2Q2EB 4DV2E 4DR5I 2O1UA 4OO1A 2IERA 3U1KA 1FKAE 5JEAA 2HFSA 1PVGA 4USKA 2GQ0A 2PO1B 1B63A 4B3RI 1RREA 3T1YE 2GO3A 5IT9C 2X7IA 2HHHE 3QT8A 2F4VI 4IFDC 3JAMQ 5JEAB 2PNMA 4YHHI 2UUCI 1HNXE 1MX0A 2BA0G 5L3JA 1FWLA 5K36D 1HNWI 2OI2A 1HK7A 4BA2B 2CG9A 4IS9A 1N36I 1PKPA 4DV7E 2EFGA 2DEIA 5C0XD 2WP8A 4DR2E 3V5RA 4USMA 2HKJA 2UUCE 2UUBE 4DR4I 3PYFA 2ZBKB 4JI6E 5A2QC 4QNKA 4ZVIA 2UXCE 1NHJA 4FW5A 3HJCA 4OX9I 2PO0A 2Z5BB 2ZM6I 4DV4I 3QT7A 4IFDD 2UXBI 4B3TI 4Z7YA 1H7SA 5LL6R 4B3MI 4X62E 4WUCA 5JEAE 1NHIA 2WNRB 4DPXA 4DR4E 4GQUA 5GMEA 4JI3I 1IBKE 1R6LA 2BA1G 4DUZI 4FWHA 1Z0GA 2JT2A 4U3DA 5FLXC 3M7NG 1UEKA 4Z7CA 3GLLA 4B3TE 4DR3E 1IBMI 4LF4I 3P3GA 4MYUA 1Z0BA 1EA6A 2UUAI 3T1HE 3WU4A 3M85D 4GKJI 3L7ZB 5BR8I 1OJ4A 2R42A 1I94E 5C0XA 1VI7A 2PNLA 1Z59A 5DROA 4NXMI 1ZM3A 2O1TA 4M1KA 4LFAI 1N0UA 2ZITA 4X66E 4IZJA 4P7AA 3Q1QA 3LTOA 4X64E 4IZJD 2UXCI 4DPWA 1UDQA 5EKWA 2NN6A 3QT5A 4JI4E 4GKJE 4ED4A 3LNUA 1XXEA 4OO1C 1N33E 5JEAC 2O1VA 2JEAB 2JEBB 4JI2E 2PO1A 4GKKI 1OYRA 4DV1E 4NXME 4FWDA 1J5EE 1S4EA 3B82A 1XNRI 2IESA 3M85G 4LF7E 1Z0EA 1HR0I 4FW6A 2Z5BA 1IBKI 2GO4A 1Z0TA 3P3CA 3J7AG 5EL9A 1MU5A 3P3EA 3B78A 3GONA
chains in the Genus database with same CATH topology
2HK2A 1ZM4A 4LFCI 4DUYI 4DV0I 2CGEA 2HK3A 3ZZTA 4DV1I 1RR9A 1IBME 1HNXI 4HACA 4LF5I 1HR0E 3OTOE 3ZZUA 2VQEI 2A2CA 1I94I 4UT4A 3ZKBA 4DV6E 2J7KA 5FLXQ 4LFAE 1FI4A 3K85A 4X66I 4DR2I 4FN5A 4WUDA 2E5LE 1D6TA 4B3SI 4JG4A 4JI6I 5IT9Q 2DEJA 1XMOE 1S16A 4EMDA 3Q6MA 2IOQA 1Z0VA 4JI0E 4JI1I 3K17A 2Z5EA 4DV6I 1KIJA 4YHHE 4LF7I 2HFUA 4DR7I 4JI7E 1Z5BA 2V2ZA 3H4LA 5A2QQ 1N34E 4FWGA 1XMQE 2BV3A 4DUYE 4LFCE 2V34A 4PU9A 3PYGA 3ZZ0A 3K1JA 1MG7A 1Y4UA 4JI8I 1IBLE 3T1HI 3J7AM 2CZ9A 4HXZA 4LF8E 1KKHA 1FJGE 1H72C 5GMDA 3WU3A 1N34I 5LMUE 1USVA 1XMQI 4IZKB 1H74A 4DR1E 4FW9A 1NHHA 1VISA 2BM0A 3F0NA 4DU8A 4DV5E 2R3VA 1B62A 4JI4I 4LF8I 4DPUA 4LFBI 4R1FA 1FWKA 4JI1E 3J80Q 4K0KI 1FNMA 1Z5AA 3HULA 5LMNI 4DV3E 4LF4E 4XTJA 2XEXA 1A6FA 4AQYI 1H7UA 3J81Q 4JI5I 4JI7I 3J80C 2AJ4A 3Q6NA 3B8HA 3ZM7A 1HNZE 3T1YI 4MYTA 1K47A 4HACB 2F4VE 4DV0E 4HY1A 2NPFA 4IZKA 4LF6I 4X64I 1N0VC 1Y4SA 1HNWE 4IZJB 3JAMC 2VQFI 4I3HA 4JYAE 5LMUI 1ZXMA 4X65E 2UXDE 1XNQI 1J5EI 3WU6A 2Z5CA 4KHPI 5FWKA 4DV2I 2E5LI 4B3SE 2VF3A 3WU5A 3PYDA 3QT6A 3P06A 4OX9E 1XMOI 2O1WA 4JV5I 3PRYA 2GS8A 1KVKA 4K0KE 4JI0I 4DXLA 2E1RA 1PIEA 4KHPE 3PYEA 4JI5E 4DR7E 4DV7I 1BKNA 4DUZE 2HKEA 4URLA 4JV5E 3D4JA 1N32I 4PRVA 1Z0WA 4DPYA 2V8PA 4LF6E 1ZXNA 4DU7A 2UUAE 1ZM9A 1IBLI 4NXNE 2UU9E 4DR6I 2ZM6E 1EI1A 3CWVA 2V2VA 4KQVA 4B3ME 1N32E 5IWAI 4JI3E 4DR5E 4PRXA 2BM1A 1ZM2A 4LFBE 3ZKDA 3V2UC 4B3RE 4GKKE 1QZRA 1Z5CA 4WUBA 5LMNE 4DV3I 1U2RA 1ELOA 4DR3I 4JI8E 4YY3E 4LF9I 5IWAE 4AQYE 1N36E 5BR8E 1FJGI 3M6AA 4HYMA 1HNZI 2WW4A 4P52A 2LJPA 4DR1I 1USUA 4UTGA 2UUBI 1Z0CA 2IOPA 4YY3I 2X36A 4N3OA 1NZ0A 2V2QA 4LF9E 2Z5CB 2A2DA 4DV5I 4LF5E 3J81C 3OTOI 4NXNI 1XHKA 2VQEE 2UU9I 4DR6E 2VQFE 1H73A 1Y6ZA 4DPTA 1N33I 4JI2I 4DV4E 2HHHI 4RPFA 4JYAI 4X65I 1DARA 2UXDI 2UXBE 1XNRE 1XNQE 1WUUA 4X62I 1KTVA 2Q2EB 4DV2E 4DR5I 2O1UA 1FKAE 2HFSA 1PVGA 4USKA 2GQ0A 1B63A 4B3RI 1RREA 3T1YE 5IT9C 2X7IA 2HHHE 3QT8A 2F4VI 2UUCI 3JAMQ 2PNMA 4YHHI 1HNXE 1MX0A 5L3JA 1FWLA 1HNWI 2OI2A 1HK7A 2CG9A 1N36I 1PKPA 4DV7E 2EFGA 2DEIA 4DR2E 3V5RA 4USMA 2HKJA 2UUCE 2UUBE 4DR4I 3PYFA 2ZBKB 4JI6E 5A2QC 4ZVIA 2UXCE 1NHJA 3HJCA 4OX9I 2Z5BB 2ZM6I 4DV4I 3QT7A 2UXBI 4B3TI 4Z7YA 1H7SA 5LL6R 4B3MI 4X62E 4WUCA 1NHIA 4DR4E 4DPXA 5GMEA 4JI3I 1IBKE 4DUZI 4FWHA 1Z0GA 5FLXC 1UEKA 4Z7CA 4B3TE 4DR3E 1IBMI 4LF4I 4MYUA 1Z0BA 1EA6A 2UUAI 3T1HE 3WU4A 4GKJI 5BR8I 1OJ4A 2R42A 1I94E 2PNLA 1Z59A 4NXMI 1ZM3A 2O1TA 4M1KA 4LFAI 1N0UA 2ZITA 4X66E 4IZJA 4P7AA 3Q1QA 3LTOA 4X64E 4IZJD 2UXCI 4DPWA 3QT5A 4JI4E 4GKJE 4ED4A 3LNUA 1N33E 2O1VA 4JI2E 4GKKI 4DV1E 4NXME 4FWDA 1J5EE 1S4EA 3B82A 1XNRI 4LF7E 1Z0EA 1HR0I 2Z5BA 1IBKI 1Z0TA 3J7AG 1MU5A 3LPSA 3B78A 3GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK2 A;  1ZM4 A;  4LFC I;  4DUY I;  4DV0 I;  2HK3 A;  3ZZT A;  4DV1 I;  1RR9 A;  1IBM E;  1HNX I;  4HAC A;  4LF5 I;  1HR0 E;  3OTO E;  3ZZU A;  2VQE I;  2A2C A;  1I94 I;  4UT4 A;  3ZKB A;  4DV6 E;  2J7K A;  5FLX Q;  4LFA E;  1FI4 A;  4X66 I;  4DR2 I;  4FN5 A;  4WUD A;  2E5L E;  1D6T A;  4B3S I;  4JG4 A;  4JI6 I;  5IT9 Q;  2DEJ A;  1XMO E;  1S16 A;  4EMD A;  1Z0V A;  4JI0 E;  4JI1 I;  3K17 A;  4DV6 I;  1KIJ A;  4YHH E;  4LF7 I;  2HFU A;  4DR7 I;  4JI7 E;  1Z5B A;  2V2Z A;  3H4L A;  5A2Q Q;  1N34 E;  4FWG A;  1XMQ E;  2BV3 A;  4DUY E;  4LFC E;  2V34 A;  4PU9 A;  3PYG A;  3ZZ0 A;  3K1J A;  1MG7 A;  4JI8 I;  1IBL E;  3T1H I;  3J7A M;  2CZ9 A;  4HXZ A;  4LF8 E;  1KKH A;  1FJG E;  1H72 C;  5GMD A;  3WU3 A;  1N34 I;  5LMU E;  1XMQ I;  1H74 A;  4DR1 E;  4FW9 A;  1NHH A;  1VIS A;  2BM0 A;  3F0N A;  4DU8 A;  4DV5 E;  2R3V A;  1B62 A;  4JI4 I;  4LF8 I;  4DPU A;  4LFB I;  4R1F A;  1FWK A;  4JI1 E;  3J80 Q;  4K0K I;  1FNM A;  1Z5A A;  3HUL A;  5LMN I;  4DV3 E;  4LF4 E;  4XTJ A;  2XEX A;  1A6F A;  4AQY I;  1H7U A;  3J81 Q;  4JI5 I;  4JI7 I;  3J80 C;  2AJ4 A;  3B8H A;  3ZM7 A;  1HNZ E;  3T1Y I;  4MYT A;  1K47 A;  4HAC B;  2F4V E;  4DV0 E;  4HY1 A;  2NPF A;  4LF6 I;  4X64 I;  1N0V C;  1HNW E;  3JAM C;  2VQF I;  4I3H A;  4JYA E;  5LMU I;  1ZXM A;  4X65 E;  2UXD E;  1XNQ I;  1J5E I;  3WU6 A;  4KHP I;  4DV2 I;  2E5L I;  4B3S E;  2VF3 A;  3WU5 A;  3PYD A;  3QT6 A;  4OX9 E;  1XMO I;  4JV5 I;  2GS8 A;  1KVK A;  4K0K E;  4JI0 I;  4DXL A;  2E1R A;  1PIE A;  4KHP E;  3PYE A;  4JI5 E;  4DR7 E;  4DV7 I;  1BKN A;  4DUZ E;  2HKE A;  4URL A;  4JV5 E;  3D4J A;  1N32 I;  4PRV A;  1Z0W A;  4DPY A;  2V8P A;  4LF6 E;  1ZXN A;  4DU7 A;  2UUA E;  1ZM9 A;  1IBL I;  4NXN E;  2UU9 E;  4DR6 I;  2ZM6 E;  1EI1 A;  3CWV A;  2V2V A;  4KQV A;  4B3M E;  1N32 E;  5IWA I;  4JI3 E;  4DR5 E;  4PRX A;  2BM1 A;  1ZM2 A;  4LFB E;  3ZKD A;  3V2U C;  4B3R E;  4GKK E;  1QZR A;  1Z5C A;  4WUB A;  5LMN E;  4DV3 I;  1U2R A;  1ELO A;  4DR3 I;  4JI8 E;  4YY3 E;  4LF9 I;  5IWA E;  4AQY E;  1N36 E;  5BR8 E;  1FJG I;  3M6A A;  4HYM A;  1HNZ I;  2WW4 A;  4P52 A;  2LJP A;  4DR1 I;  4UTG A;  2UUB I;  1Z0C A;  4YY3 I;  2X36 A;  1NZ0 A;  2V2Q A;  4LF9 E;  4LF5 E;  2A2D A;  4DV5 I;  3J81 C;  3OTO I;  4NXN I;  1XHK A;  2VQE E;  2UU9 I;  4DR6 E;  2VQF E;  1H73 A;  4DPT A;  1N33 I;  4JI2 I;  4DV4 E;  2HHH I;  4RPF A;  4JYA I;  4X65 I;  1DAR A;  2UXD I;  2UXB E;  1XNR E;  1XNQ E;  1WUU A;  4X62 I;  1KTV A;  2Q2E B;  4DV2 E;  4DR5 I;  1FKA E;  2HFS A;  1PVG A;  4USK A;  1B63 A;  4B3R I;  1RRE A;  3T1Y E;  5IT9 C;  2X7I A;  2HHH E;  3QT8 A;  2F4V I;  2UUC I;  3JAM Q;  4YHH I;  1HNX E;  1MX0 A;  5L3J A;  1FWL A;  1HNW I;  2OI2 A;  1N36 I;  1PKP A;  4DV7 E;  2EFG A;  2DEI A;  4DR2 E;  3V5R A;  4USM A;  2HKJ A;  2UUC E;  2UUB E;  4DR4 I;  3PYF A;  2ZBK B;  4JI6 E;  5A2Q C;  4ZVI A;  2UXC E;  1NHJ A;  4OX9 I;  2ZM6 I;  4DV4 I;  3QT7 A;  2UXB I;  4B3T I;  4Z7Y A;  1H7S A;  5LL6 R;  4B3M I;  4X62 E;  4WUC A;  1NHI A;  4DR4 E;  4DPX A;  5GME A;  4JI3 I;  1IBK E;  4DUZ I;  4FWH A;  1Z0G A;  5FLX C;  1UEK A;  4Z7C A;  4B3T E;  4DR3 E;  1IBM I;  4LF4 I;  4MYU A;  1Z0B A;  1EA6 A;  2UUA I;  3T1H E;  3WU4 A;  4GKJ I;  5BR8 I;  1OJ4 A;  2R42 A;  1I94 E;  1Z59 A;  4NXM I;  1ZM3 A;  4LFA I;  4M1K A;  1N0U A;  2ZIT A;  4X66 E;  4P7A A;  3Q1Q A;  3LTO A;  4X64 E;  2UXC I;  4DPW A;  3QT5 A;  4JI4 E;  4GKJ E;  4ED4 A;  3LNU A;  1N33 E;  4JI2 E;  4GKK I;  4DV1 E;  4NXM E;  4FWD A;  1J5E E;  1S4E A;  3B82 A;  1XNR I;  4LF7 E;  1Z0E A;  1HR0 I;  1IBK I;  1Z0T A;  3J7A G;  1MU5 A;  3LPS A;  3B78 A;  3GON A; 
#chains in the Genus database with same CATH topology
 2HK2 A;  1ZM4 A;  4LFC I;  4DUY I;  4DV0 I;  2CGE A;  2J65 A;  2HK3 A;  3ZZT A;  4DV1 I;  4IFD B;  1RR9 A;  4IFD E;  1IBM E;  1HNX I;  2O3Z A;  2AE8 A;  3PS3 A;  2NN6 D;  4HAC A;  4LF5 I;  1HR0 E;  3OTO E;  4LPF A;  3ZZU A;  2VQE I;  4OO1 D;  2A2C A;  1I94 I;  1UDO A;  4UT4 A;  3ZKB A;  4DV6 E;  2J7K A;  5FLX Q;  4LFA E;  1FI4 A;  3K85 A;  4X66 I;  4DR2 I;  4FN5 A;  4WUD A;  2E5L E;  1D6T A;  4B3S I;  3PS2 A;  4JG4 A;  3DD6 A;  3GCM A;  5DNX A;  2WNR A;  4JI6 I;  4U3B A;  5IT9 Q;  2DEJ A;  1XMO E;  1S16 A;  2VES A;  4EMD A;  3Q6M A;  2IOQ A;  2C37 B;  1Z0V A;  4JI0 E;  4JI1 I;  3K17 A;  2Z5E A;  4DV6 I;  1KIJ A;  1P42 A;  5DRQ A;  4YHH E;  4LF7 I;  2HFU A;  4DR7 I;  4MU0 A;  4JI7 E;  2NN6 B;  1Z5B A;  2C37 A;  2V2Z A;  1R6M A;  3H4L A;  5A2Q Q;  1N34 E;  4FWG A;  1XMQ E;  2BV3 A;  4DUY E;  4LFC E;  2V34 A;  4PU9 A;  5C0X C;  3PYG A;  3ZZ0 A;  2CVE A;  4NBQ A;  3K1J A;  3CDI A;  1OYP A;  1MG7 A;  1Y4U A;  4JI8 I;  1IBL E;  3T1H I;  3J7A M;  2CZ9 A;  4HXZ A;  4LF8 E;  3GME A;  1KKH A;  1FJG E;  4OKG A;  1H72 C;  1E3P A;  5GMD A;  3WU3 A;  1N34 I;  5LMU E;  1USV A;  1XMQ I;  4IZK B;  1H74 A;  4IFD F;  4DR1 E;  4ISA A;  4FW9 A;  1NHH A;  1VIS A;  2BM0 A;  3H1C A;  5C0X E;  3F0N A;  4AM3 A;  2C38 A;  4DU8 A;  2JEB A;  4DV5 E;  2R3V A;  3KRN A;  1B62 A;  3PS1 A;  3HKM A;  4JI4 I;  4LF8 I;  4DPU A;  4LFB I;  1UDS A;  4FW3 A;  4R1F A;  4LCF A;  1FWK A;  4JI1 E;  5K36 E;  3J80 Q;  4K0K I;  1FNM A;  1Z5A A;  3HUL A;  5LMN I;  4DV3 E;  4BA1 A;  3M7N D;  4LF4 E;  4XTJ A;  2XEX A;  1A6F A;  4AQY I;  1H7U A;  3J81 Q;  4JI5 I;  4JI7 I;  3J80 C;  2AJ4 A;  3Q6N A;  2BR2 A;  3B8H A;  1YH8 A;  4IFD A;  3ZM7 A;  1HNZ E;  5C0X F;  3T1Y I;  4MYT A;  2BA0 D;  1K47 A;  4HAC B;  1E3H A;  2F4V E;  5K36 C;  4DV0 E;  5C0X B;  4HY1 A;  2NPF A;  4IZK A;  3CDJ A;  4LF6 I;  4X64 I;  1N0V C;  1Y4S A;  1HNW E;  2PNZ A;  2F1D A;  4IZJ B;  3JAM C;  2C39 A;  2VQF I;  1UDN A;  4I3H A;  4JYA E;  5LMU I;  1ZXM A;  4X65 E;  2UXD E;  1XNQ I;  2PO0 B;  1J5E I;  3WU6 A;  2Z5C A;  4KHP I;  5FWK A;  4DV2 I;  2E5L I;  1YHC A;  4B3S E;  2VF3 A;  3WU5 A;  3PYD A;  2PO2 B;  5DRR A;  2PNZ B;  4AID A;  3QT6 A;  3P06 A;  4OX9 E;  4MU4 A;  3NZK A;  1XMO I;  2BR2 B;  2O1W A;  4JV5 I;  2NN6 E;  3PRY A;  2GS8 A;  4OO1 B;  1KVK A;  4K0K E;  4JI0 I;  4DXL A;  3P76 A;  2E1R A;  1PIE A;  4KHP E;  3PYE A;  2C38 B;  1Y5Y A;  4QNJ A;  4JI5 E;  4DR7 E;  2PO2 A;  4DV7 I;  1BKN A;  2NN6 C;  4J3D A;  4DUZ E;  2HKE A;  5ELW A;  4URL A;  4OO1 F;  4JV5 E;  3D4J A;  1N32 I;  4PRV A;  1Z0W A;  4MDT A;  4DPY A;  2V8P A;  4MQY A;  4LF6 E;  1ZXN A;  4DU7 A;  2UUA E;  1ZM9 A;  1IBL I;  4LCG A;  4OZE A;  4NXN E;  2UU9 E;  2WP8 B;  2ZM6 E;  4DR6 I;  5DNL A;  4AIM A;  1EI1 A;  5DRP A;  3CWV A;  2V2V A;  4KQV A;  4B3M E;  1RHY A;  1N32 E;  3B4T A;  5JEA F;  4FW4 A;  1OYS A;  2BA1 D;  5IWA I;  4JI3 E;  4DR5 E;  4PRX A;  4MU1 A;  1Y60 A;  2C39 B;  2BM1 A;  5JEA D;  4BA2 A;  4BA1 B;  1ZM2 A;  3U1Y A;  5K36 B;  4LFB E;  3ZKD A;  3L7Z A;  3V2U C;  4B3R E;  4GKK E;  1QZR A;  1Z5C A;  5K36 F;  4WUB A;  4LOM A;  5LMN E;  4DV3 I;  1U2R A;  1ELO A;  4DR3 I;  4FW7 A;  4JI8 E;  4YY3 E;  5K36 A;  4LF9 I;  3UHM A;  5IWA E;  2NN6 F;  4AQY E;  1N36 E;  5BR8 E;  1FJG I;  4MU3 A;  3M6A A;  2JE6 A;  4HYM A;  1HNZ I;  2WW4 A;  4P52 A;  2LJP A;  4DR1 I;  1USU A;  4UTG A;  2UUB I;  1Z0C A;  2IOP A;  4OO1 E;  4YY3 I;  2X36 A;  4N3O A;  1NZ0 A;  2V2Q A;  4LF9 E;  2Z5C B;  2A2D A;  4DV5 I;  4LF5 E;  3J81 C;  3OTO I;  4NXN I;  1XHK A;  2VQE E;  2UU9 I;  4DR6 E;  2VQF E;  1H73 A;  1Y6Z A;  4DPT A;  1N33 I;  4JI2 I;  4DV4 E;  2HHH I;  2JE6 B;  4RPF A;  4JYA I;  4LCH A;  4X65 I;  1DAR A;  2UXD I;  2UXB E;  1XNR E;  1XNQ E;  1WUU A;  4X62 I;  1KTV A;  2JEA A;  3LPS A;  2Q2E B;  4DV2 E;  4DR5 I;  2O1U A;  4OO1 A;  2IER A;  3U1K A;  1FKA E;  5JEA A;  2HFS A;  1PVG A;  4USK A;  2GQ0 A;  2PO1 B;  1B63 A;  4B3R I;  1RRE A;  3T1Y E;  2GO3 A;  5IT9 C;  2X7I A;  2HHH E;  3QT8 A;  2F4V I;  4IFD C;  3JAM Q;  5JEA B;  2PNM A;  4YHH I;  2UUC I;  1HNX E;  1MX0 A;  2BA0 G;  5L3J A;  1FWL A;  5K36 D;  1HNW I;  2OI2 A;  1HK7 A;  4BA2 B;  2CG9 A;  4IS9 A;  1N36 I;  1PKP A;  4DV7 E;  2EFG A;  2DEI A;  5C0X D;  2WP8 A;  4DR2 E;  3V5R A;  4USM A;  2HKJ A;  2UUC E;  2UUB E;  4DR4 I;  3PYF A;  2ZBK B;  4JI6 E;  5A2Q C;  4QNK A;  4ZVI A;  2UXC E;  1NHJ A;  4FW5 A;  3HJC A;  4OX9 I;  2PO0 A;  2Z5B B;  2ZM6 I;  4DV4 I;  3QT7 A;  4IFD D;  2UXB I;  4B3T I;  4Z7Y A;  1H7S A;  5LL6 R;  4B3M I;  4X62 E;  4WUC A;  5JEA E;  1NHI A;  2WNR B;  4DPX A;  4DR4 E;  4GQU A;  5GME A;  4JI3 I;  1IBK E;  1R6L A;  2BA1 G;  4DUZ I;  4FWH A;  1Z0G A;  2JT2 A;  4U3D A;  5FLX C;  3M7N G;  1UEK A;  4Z7C A;  3GLL A;  4B3T E;  4DR3 E;  1IBM I;  4LF4 I;  3P3G A;  4MYU A;  1Z0B A;  1EA6 A;  2UUA I;  3T1H E;  3WU4 A;  3M85 D;  4GKJ I;  3L7Z B;  5BR8 I;  1OJ4 A;  2R42 A;  1I94 E;  5C0X A;  1VI7 A;  2PNL A;  1Z59 A;  5DRO A;  4NXM I;  1ZM3 A;  2O1T A;  4M1K A;  4LFA I;  1N0U A;  2ZIT A;  4X66 E;  4IZJ A;  4P7A A;  3Q1Q A;  3LTO A;  4X64 E;  4IZJ D;  2UXC I;  4DPW A;  1UDQ A;  5EKW A;  2NN6 A;  3QT5 A;  4JI4 E;  4GKJ E;  4ED4 A;  3LNU A;  1XXE A;  4OO1 C;  1N33 E;  5JEA C;  2O1V A;  2JEA B;  2JEB B;  4JI2 E;  2PO1 A;  4GKK I;  1OYR A;  4DV1 E;  4NXM E;  4FWD A;  1J5E E;  1S4E A;  3B82 A;  1XNR I;  2IES A;  3M85 G;  4LF7 E;  1Z0E A;  1HR0 I;  4FW6 A;  2Z5B A;  1IBK I;  2GO4 A;  1Z0T A;  3P3C A;  3J7A G;  5EL9 A;  1MU5 A;  3P3E A;  3B78 A;  3GON A; 
#chains in the Genus database with same CATH homology
 2HK2 A;  1ZM4 A;  4LFC I;  4DUY I;  4DV0 I;  2CGE A;  2HK3 A;  3ZZT A;  4DV1 I;  1RR9 A;  1IBM E;  1HNX I;  4HAC A;  4LF5 I;  1HR0 E;  3OTO E;  3ZZU A;  2VQE I;  2A2C A;  1I94 I;  4UT4 A;  3ZKB A;  4DV6 E;  2J7K A;  5FLX Q;  4LFA E;  1FI4 A;  3K85 A;  4X66 I;  4DR2 I;  4FN5 A;  4WUD A;  2E5L E;  1D6T A;  4B3S I;  4JG4 A;  4JI6 I;  5IT9 Q;  2DEJ A;  1XMO E;  1S16 A;  4EMD A;  3Q6M A;  2IOQ A;  1Z0V A;  4JI0 E;  4JI1 I;  3K17 A;  2Z5E A;  4DV6 I;  1KIJ A;  4YHH E;  4LF7 I;  2HFU A;  4DR7 I;  4JI7 E;  1Z5B A;  2V2Z A;  3H4L A;  5A2Q Q;  1N34 E;  4FWG A;  1XMQ E;  2BV3 A;  4DUY E;  4LFC E;  2V34 A;  4PU9 A;  3PYG A;  3ZZ0 A;  3K1J A;  1MG7 A;  1Y4U A;  4JI8 I;  1IBL E;  3T1H I;  3J7A M;  2CZ9 A;  4HXZ A;  4LF8 E;  1KKH A;  1FJG E;  1H72 C;  5GMD A;  3WU3 A;  1N34 I;  5LMU E;  1USV A;  1XMQ I;  4IZK B;  1H74 A;  4DR1 E;  4FW9 A;  1NHH A;  1VIS A;  2BM0 A;  3F0N A;  4DU8 A;  4DV5 E;  2R3V A;  1B62 A;  4JI4 I;  4LF8 I;  4DPU A;  4LFB I;  4R1F A;  1FWK A;  4JI1 E;  3J80 Q;  4K0K I;  1FNM A;  1Z5A A;  3HUL A;  5LMN I;  4DV3 E;  4LF4 E;  4XTJ A;  2XEX A;  1A6F A;  4AQY I;  1H7U A;  3J81 Q;  4JI5 I;  4JI7 I;  3J80 C;  2AJ4 A;  3Q6N A;  3B8H A;  3ZM7 A;  1HNZ E;  3T1Y I;  4MYT A;  1K47 A;  4HAC B;  2F4V E;  4DV0 E;  4HY1 A;  2NPF A;  4IZK A;  4LF6 I;  4X64 I;  1N0V C;  1Y4S A;  1HNW E;  4IZJ B;  3JAM C;  2VQF I;  4I3H A;  4JYA E;  5LMU I;  1ZXM A;  4X65 E;  2UXD E;  1XNQ I;  1J5E I;  3WU6 A;  2Z5C A;  4KHP I;  5FWK A;  4DV2 I;  2E5L I;  4B3S E;  2VF3 A;  3WU5 A;  3PYD A;  3QT6 A;  3P06 A;  4OX9 E;  1XMO I;  2O1W A;  4JV5 I;  3PRY A;  2GS8 A;  1KVK A;  4K0K E;  4JI0 I;  4DXL A;  2E1R A;  1PIE A;  4KHP E;  3PYE A;  4JI5 E;  4DR7 E;  4DV7 I;  1BKN A;  4DUZ E;  2HKE A;  4URL A;  4JV5 E;  3D4J A;  1N32 I;  4PRV A;  1Z0W A;  4DPY A;  2V8P A;  4LF6 E;  1ZXN A;  4DU7 A;  2UUA E;  1ZM9 A;  1IBL I;  4NXN E;  2UU9 E;  4DR6 I;  2ZM6 E;  1EI1 A;  3CWV A;  2V2V A;  4KQV A;  4B3M E;  1N32 E;  5IWA I;  4JI3 E;  4DR5 E;  4PRX A;  2BM1 A;  1ZM2 A;  4LFB E;  3ZKD A;  3V2U C;  4B3R E;  4GKK E;  1QZR A;  1Z5C A;  4WUB A;  5LMN E;  4DV3 I;  1U2R A;  1ELO A;  4DR3 I;  4JI8 E;  4YY3 E;  4LF9 I;  5IWA E;  4AQY E;  1N36 E;  5BR8 E;  1FJG I;  3M6A A;  4HYM A;  1HNZ I;  2WW4 A;  4P52 A;  2LJP A;  4DR1 I;  1USU A;  4UTG A;  2UUB I;  1Z0C A;  2IOP A;  4YY3 I;  2X36 A;  4N3O A;  1NZ0 A;  2V2Q A;  4LF9 E;  2Z5C B;  2A2D A;  4DV5 I;  4LF5 E;  3J81 C;  3OTO I;  4NXN I;  1XHK A;  2VQE E;  2UU9 I;  4DR6 E;  2VQF E;  1H73 A;  1Y6Z A;  4DPT A;  1N33 I;  4JI2 I;  4DV4 E;  2HHH I;  4RPF A;  4JYA I;  4X65 I;  1DAR A;  2UXD I;  2UXB E;  1XNR E;  1XNQ E;  1WUU A;  4X62 I;  1KTV A;  2Q2E B;  4DV2 E;  4DR5 I;  2O1U A;  1FKA E;  2HFS A;  1PVG A;  4USK A;  2GQ0 A;  1B63 A;  4B3R I;  1RRE A;  3T1Y E;  5IT9 C;  2X7I A;  2HHH E;  3QT8 A;  2F4V I;  2UUC I;  3JAM Q;  2PNM A;  4YHH I;  1HNX E;  1MX0 A;  5L3J A;  1FWL A;  1HNW I;  2OI2 A;  1HK7 A;  2CG9 A;  1N36 I;  1PKP A;  4DV7 E;  2EFG A;  2DEI A;  4DR2 E;  3V5R A;  4USM A;  2HKJ A;  2UUC E;  2UUB E;  4DR4 I;  3PYF A;  2ZBK B;  4JI6 E;  5A2Q C;  4ZVI A;  2UXC E;  1NHJ A;  3HJC A;  4OX9 I;  2Z5B B;  2ZM6 I;  4DV4 I;  3QT7 A;  2UXB I;  4B3T I;  4Z7Y A;  1H7S A;  5LL6 R;  4B3M I;  4X62 E;  4WUC A;  1NHI A;  4DR4 E;  4DPX A;  5GME A;  4JI3 I;  1IBK E;  4DUZ I;  4FWH A;  1Z0G A;  5FLX C;  1UEK A;  4Z7C A;  4B3T E;  4DR3 E;  1IBM I;  4LF4 I;  4MYU A;  1Z0B A;  1EA6 A;  2UUA I;  3T1H E;  3WU4 A;  4GKJ I;  5BR8 I;  1OJ4 A;  2R42 A;  1I94 E;  2PNL A;  1Z59 A;  4NXM I;  1ZM3 A;  2O1T A;  4M1K A;  4LFA I;  1N0U A;  2ZIT A;  4X66 E;  4IZJ A;  4P7A A;  3Q1Q A;  3LTO A;  4X64 E;  4IZJ D;  2UXC I;  4DPW A;  3QT5 A;  4JI4 E;  4GKJ E;  4ED4 A;  3LNU A;  1N33 E;  2O1V A;  4JI2 E;  4GKK I;  4DV1 E;  4NXM E;  4FWD A;  1J5E E;  1S4E A;  3B82 A;  1XNR I;  4LF7 E;  1Z0E A;  1HR0 I;  2Z5B A;  1IBK I;  1Z0T A;  3J7A G;  1MU5 A;  3LPS A;  3B78 A;  3GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...