4NXMI

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxmI00
4FWHA 4DV7E 4LF5I 1H73A 5A2QC 4JI2E 4DPUA 1FJGE 4LF6I 5IT9Q 5FLXC 3LNUA 2F4VE 1Z5BA 4X62I 3K17A 1Z0CA 2UXBE 1XNQE 3M6AA 1MG7A 3LTOA 1KTVA 4JI4E 2UXDI 3T1YI 4JG4A 2V2QA 4DV5I 4B3MI 4EMDA 1DARA 4LFCI 3LPSA 4LF9I 4JI0I 1MU5A 4JV5I 5BR8E 4ED4A 1HR0I 2R3VA 4DR1E 4DV3I 3JAMC 4DR7E 4JI1I 4JI6I 1Z0WA 1N32E 4DV7I 1UEKA 1FWLA 2XEXA 4DR2I 2V8PA 1S16A 2VF3A 4X66E 4DR6E 1HNZE 2Q2EB 2F4VI 2V2VA 1ZM3A 3PYDA 2UUBE 1XNQI 4DUYE 4DR5E 4JI4I 4B3RE 1Z59A 4DV0E 3ZZUA 4FN5A 1N0VC 3T1HE 4MYTA 3J7AM 3K1JA 1N0UA 5BR8I 1H72C 4Z7YA 4PU9A 1S4EA 4DR1I 4DV5E 4KQVA 1D6TA 4DV4E 1Z0VA 1N32I 3H4LA 4LFBI 3V2UC 4X64E 2VQFI 2BM1A 1XNRE 4R1FA 4HACB 3PYEA 4LF4E 4DR6I 4UTGA 4DV3E 1H74A 4I3HA 4MYUA 2BM0A 4OX9E 2UUBI 2CZ9A 4DUYI 4DR2E 4DR5I 2V2ZA 1NZ0A 4B3RI 1IBME 2DEJA 4JI8I 4DV2I 4DV0I 4DV6E 2V34A 4DPXA 2HKJA 3T1HI 2GS8A 4DPWA 1FNMA 2A2DA 3J80C 4DU7A 3ZKDA 4NXME 5GMEA 2UUCE 4USKA 4DV4I 5IWAE 1ZM4A 4WUBA 2A2CA 4X64I 1XNRI 1NHHA 4DXLA 4DU8A 4LF4I 1RR9A 4X65E 4B3SI 4OX9I 1H7UA 5LMUE 5LL6R 4LFBE 2VQFE 3PYFA 1IBMI 2OI2A 4DV6I 2HFSA 5FLXQ 3J7AG 4LF8E 3J81C 1FKAE 1XMOI 4NXMI 5L3JA 3CWVA 4UT4A 1U2RA 2UUCI 4JI8E 4DV2E 3QT6A 1FI4A 5IWAI 2UUAE 3QT5A 4DPTA 3ZKBA 4AQYE 4NXNE 2R42A 2UU9E 1ZXNA 1ELOA 2J7KA 3JAMQ 4YY3I 4GKJE 2VQEI 3Q1QA 3QT8A 3B78A 2ZBKB 1EA6A 4X65I 1RREA 2E5LE 5LMUI 5IT9C 1Z5CA 1NHJA 4KHPI 2EFGA 1J5EI 1IBLE 4LFAE 4LF8I 4B3SE 4USMA 1PIEA 1H7SA 2HKEA 1Z0GA 3D4JA 1BKNA 1A6FA 4XTJA 1MX0A 4K0KE 4YHHE 1ZM2A 2ZITA 1IBKE 3HULA 3QT7A 4P52A 2UUAI 4B3TE 4AQYI 4NXNI 1XMOE 2UU9I 1WUUA 4GKKE 4GKJI 1N34E 1I94I 1ZM9A 1Z0EA 4URLA 4DV1E 2E5LI 1NHIA 4WUDA 4DR4E 1VISA 1Z5AA 4PRXA 1N36E 4YY3E 2VQEE 1FWKA 1IBLI 4JI5E 4FWGA 4LFAI 1N33E 4DR3I 3GONA 1XMQE 4HXZA 1HNWI 2HHHE 5A2QQ 3OTOE 3WU5A 2ZM6I 2UXCE 3WU6A 4K0KI 1HNXI 4YHHI 4HYMA 5LMNE 3F0NA 1IBKI 2E1RA 3ZM7A 4KHPE 1KVKA 1J5EE 4LF7E 2DEIA 3J80Q 2X7IA 2HFUA 4B3TI 4PRVA 4GKKI 1ZXMA 4Z7CA 4DUZE 1N34I 4WUCA 4HACA 4DPYA 3B8HA 4JI2I 4HY1A 4JI7E 1FJGI 4JYAE 4DV1I 4JI3E 2WW4A 1K47A 4FW9A 4M1KA 4DR4I 4LF5E 2LJPA 1N36I 2UXBI 4RPFA 5GMDA 1Z0TA 3WU3A 1XHKA 1QZRA 4JI5I 1I94E 3PYGA 2NPFA 1N33I 1XMQI 4LF6E 3V5RA 1B63A 1KIJA 2HHHI 4X62E 3OTOI 3ZZ0A 2UXCI 1Z0BA 4ZVIA 2HK3A 5LMNI 3J81Q 2UXDE 3T1YE 4LF7I 4P7AA 2BV3A 3ZZTA 4DR3E 4B3ME 4DR7I 4LFCE 1PKPA 4FWDA 1HNWE 3B82A 1EI1A 2AJ4A 4LF9E 4JI0E 2ZM6E 1PVGA 4JV5E 1B62A 1HNXE 4DUZI 1HR0E 3WU4A 2X36A 1KKHA 4X66I 4JI7I 4JYAI 1OJ4A 1HNZI 4JI3I 2HK2A 4JI1E 4JI6E
chains in the Genus database with same CATH superfamily
4FWHA 5C0XC 4DV7E 2CG9A 4LF5I 1H73A 5A2QC 1E3PA 4JI2E 4DPUA 1FJGE 2JEAB 4LF6I 2CVEA 5IT9Q 5FLXC 3LNUA 2F4VE 1Z5BA 4X62I 1Y4UA 2PO1B 3K17A 2C39A 1Z0CA 2UXBE 3HKMA 2IERA 1XNQE 2NN6C 3M6AA 1MG7A 3LTOA 1KTVA 4JI4E 4MU4A 5K36A 2JE6B 2UXDI 3T1YI 4JG4A 2AE8A 2V2QA 4DV5I 4B3MI 3P3EA 4EMDA 1DARA 1YH8A 4LFCI 4BA1A 3LPSA 4LF9I 4JI0I 1Y5YA 1MU5A 4JV5I 5BR8E 4ED4A 5JEAF 1HR0I 2R3VA 3L7ZB 4DR1E 3GLLA 4DV3I 3JAMC 4DR7E 3M7NG 4JI1I 1UDSA 4JI6I 1Z0WA 1N32E 4DV7I 1UEKA 1VI7A 3PS3A 2PO0B 1FWLA 5FWKA 2XEXA 4DR2I 2V8PA 5C0XD 2PNMA 1S16A 2BA1D 2VF3A 4X66E 4MU1A 4DR6E 1HNZE 1XXEA 2C38B 2Q2EB 2F4VI 5JEAA 2V2VA 1ZM3A 2O1WA 3PYDA 2UUBE 4U3DA 2C37B 1XNQI 4DUYE 4DR5E 4JI4I 4B3RE 1Z59A 5DNLA 4LCFA 2NN6D 4DV0E 3ZZUA 3H1CA 4FN5A 1N0VC 1Y60A 3T1HE 4MYTA 3J7AM 2JEBA 3K1JA 4OO1B 1N0UA 3U1YA 5BR8I 1H72C 4Z7YA 4PU9A 4MDTA 1S4EA 2IESA 2BA0D 4DR1I 3CDIA 4DV5E 4KQVA 1D6TA 4DV4E 4IFDF 1Z0VA 2JEAA 1N32I 2NN6E 3H4LA 4LFBI 2WP8B 3V2UC 1RHYA 4X64E 5DRRA 2BM1A 2VQFI 3HJCA 1XNRE 4R1FA 4OKGA 4HACB 3PYEA 5DRPA 1R6LA 4OZEA 4LF4E 4DR6I 2JE6A 1USUA 4UTGA 4OO1E 4DV3E 1H74A 4I3HA 5JEAD 4MYUA 2BM0A 3P76A 4OX9E 2UUBI 4IFDC 2CZ9A 4DUYI 4DR2E 4DR5I 2V2ZA 4IFDA 1NZ0A 4B3RI 1OYSA 2DEJA 1IBME 4JI8I 4DV2I 4DV0I 4DV6E 2V34A 3L7ZA 4DPXA 2HKJA 3T1HI 2GS8A 4DPWA 1FNMA 2A2DA 3J80C 4DU7A 1P42A 3ZKDA 5K36C 3GCMA 2PO0A 4NXME 5GMEA 1E3HA 2Z5BB 2UUCE 4USKA 3Q6NA 4OO1F 4DV4I 2C38A 5DNXA 1R6MA 5IWAE 1ZM4A 4WUBA 2A2CA 2PO2B 4MQYA 4NBQA 4X64I 1XNRI 4FW7A 2C37A 3GMEA 2O1TA 4BA2B 4QNKA 1NHHA 4DXLA 4DU8A 4LF4I 1RR9A 1OYPA 4X65E 4B3SI 4OX9I 1H7UA 5DROA 5LMUE 5LL6R 3CDJA 5C0XB 4LFBE 4OO1A 2Z5CB 2VQFE 3PYFA 2J65A 4AM3A 4IFDD 1IBMI 2OI2A 4IZKA 2F1DA 5JEAC 4DV6I 2HFSA 5FLXQ 4ISAA 2CGEA 3J7AG 4LF8E 3J81C 5DRQA 3P3CA 1FKAE 3M7ND 1XMOI 4NXMI 5L3JA 3CWVA 2WP8A 4UT4A 1U2RA 2UUCI 2NN6B 5K36D 3PS1A 4LCHA 4JI8E 2JT2A 4DV2E 3U1KA 4IZJA 3QT6A 5C0XE 1FI4A 4J3DA 5IWAI 2UUAE 3QT5A 2PNLA 4DPTA 3ZKBA 4AQYE 4NXNE 2R42A 2BA0G 2UU9E 2PNZB 5EKWA 1ZXNA 1ELOA 2J7KA 3JAMQ 4YY3I 4GKJE 2VQEI 3Q1QA 3QT8A 3B78A 2ZBKB 3NZKA 1EA6A 4X65I 1RREA 2O1UA 2E5LE 5K36E 5LMUI 2PO1A 5IT9C 4AIDA 1Z5CA 3K85A 1NHJA 1Y6ZA 4KHPI 2EFGA 1J5EI 2WNRB 1IBLE 4LFAE 5C0XF 4LF8I 5JEAB 4B3SE 2Z5EA 4USMA 1PIEA 1H7SA 2HKEA 1Z0GA 3D4JA 1BKNA 1A6FA 4XTJA 2PO2A 1MX0A 4K0KE 4YHHE 1ZM2A 2ZITA 1IBKE 3HULA 3QT7A 2GO3A 2JEBB 4P52A 2UUAI 2NN6F 2O1VA 4B3TE 2GO4A 4AQYI 4NXNI 4FW3A 3M85D 4U3BA 2IOPA 1XMOE 2UU9I 1WUUA 5C0XA 2Z5CA 5JEAE 4GKKE 4GKJI 1N34E 3KRNA 1I94I 5ELWA 1ZM9A 1Z0EA 4URLA 4DV1E 2E5LI 1NHIA 4WUDA 4DR4E 1VISA 1Z5AA 4PRXA 1N36E 4YY3E 2VQEE 2NN6A 1UDOA 1FWKA 2BR2B 1IBLI 4JI5E 4FWGA 4LFAI 3P3GA 1YHCA 1N33E 4DR3I 3GONA 3UHMA 1XMQE 4HXZA 1HNWI 4OO1C 2HHHE 5A2QQ 4IS9A 3WU5A 3OTOE 2ZM6I 2UXCE 2BA1G 1Y4SA 4IFDB 3WU6A 4K0KI 1HNXI 1UDNA 4YHHI 2PNZA 4HYMA 5LMNE 3F0NA 1IBKI 2E1RA 3ZM7A 4KHPE 1KVKA 1J5EE 1UDQA 4LF7E 2DEIA 3J80Q 2X7IA 2HFUA 2C39B 4B3TI 3B4TA 4PRVA 1HK7A 4GKKI 1ZXMA 5K36B 4Z7CA 4LOMA 4DUZE 1N34I 4WUCA 4HACA 4DPYA 3B8HA 4JI2I 4HY1A 4JI7E 1FJGI 4JYAE 4BA1B 4LCGA 2WNRA 4FW6A 3PRYA 2WW4A 4AIMA 4DV1I 4JI3E 4IFDE 1K47A 4FW9A 1USVA 4M1KA 3Q6MA 4DR4I 4LF5E 2LJPA 1N36I 2UXBI 4RPFA 5GMDA 1Z0TA 4LPFA 3WU3A 1XHKA 1QZRA 4JI5I 1I94E 3PYGA 2NPFA 1N33I 1XMQI 4LF6E 3V5RA 1B63A 1KIJA 2HHHI 4X62E 3OTOI 3ZZ0A 4MU3A 2UXCI 1Z0BA 4OO1D 2VESA 4ZVIA 2HK3A 4GQUA 4MU0A 5LMNI 2Z5BA 4IZKB 4FW5A 3J81Q 2UXDE 3T1YE 4LF7I 4P7AA 2BV3A 3ZZTA 1OYRA 3PS2A 4DR3E 4B3ME 4DR7I 4LFCE 1PKPA 4FWDA 1HNWE 2GQ0A 3B82A 4FW4A 1EI1A 2AJ4A 4LF9E 4JI0E 5EL9A 2ZM6E 1PVGA 3P06A 4JV5E 1B62A 1HNXE 4DUZI 4BA2A 1HR0E 3WU4A 2X36A 1KKHA 3DD6A 4IZJB 4QNJA 2O3ZA 4IZJD 4X66I 4JI7I 4JYAI 4N3OA 1OJ4A 2BR2A 1HNZI 4JI3I 2HK2A 3M85G 4JI1E 2IOQA 5K36F 4JI6E
chains in the Genus database with same CATH topology
4FWHA 4DV7E 2CG9A 4LF5I 1H73A 5A2QC 4JI2E 4DPUA 1FJGE 4LF6I 5IT9Q 5FLXC 3LNUA 2F4VE 1Z5BA 4X62I 1Y4UA 3K17A 1Z0CA 2UXBE 1XNQE 3M6AA 1MG7A 3LTOA 1KTVA 4JI4E 2UXDI 3T1YI 4JG4A 2V2QA 4DV5I 4B3MI 4EMDA 1DARA 4LFCI 3LPSA 4LF9I 4JI0I 1MU5A 4JV5I 5BR8E 4ED4A 1HR0I 2R3VA 4DR1E 4DV3I 3JAMC 4DR7E 4JI1I 4JI6I 1Z0WA 1N32E 4DV7I 1UEKA 1FWLA 5FWKA 2XEXA 4DR2I 2V8PA 2PNMA 1S16A 2VF3A 4X66E 4DR6E 1HNZE 2Q2EB 2F4VI 2V2VA 1ZM3A 2O1WA 3PYDA 2UUBE 1XNQI 4DUYE 4DR5E 4JI4I 4B3RE 1Z59A 4DV0E 3ZZUA 4FN5A 1N0VC 3T1HE 4MYTA 3J7AM 3K1JA 1N0UA 5BR8I 1H72C 4Z7YA 4PU9A 1S4EA 4DR1I 4DV5E 4KQVA 1D6TA 4DV4E 1Z0VA 1N32I 3H4LA 4LFBI 3V2UC 4X64E 2VQFI 2BM1A 1XNRE 3HJCA 4R1FA 4HACB 3PYEA 4LF4E 4DR6I 1USUA 4UTGA 4DV3E 1H74A 4I3HA 4MYUA 2BM0A 4OX9E 2UUBI 2CZ9A 4DUYI 4DR2E 4DR5I 2V2ZA 1NZ0A 4B3RI 1IBME 2DEJA 4JI8I 4DV2I 4DV0I 4DV6E 2V34A 4DPXA 2HKJA 3T1HI 2GS8A 4DPWA 1FNMA 2A2DA 3J80C 4DU7A 3ZKDA 4NXME 5GMEA 2Z5BB 2UUCE 4USKA 3Q6NA 4DV4I 5IWAE 1ZM4A 4WUBA 2A2CA 4X64I 1XNRI 2O1TA 1NHHA 4DXLA 4DU8A 4LF4I 1RR9A 4X65E 4B3SI 4OX9I 1H7UA 5LMUE 5LL6R 4LFBE 2Z5CB 2VQFE 3PYFA 1IBMI 2OI2A 4IZKA 4DV6I 2HFSA 5FLXQ 2CGEA 3J7AG 4LF8E 3J81C 1FKAE 1XMOI 4NXMI 5L3JA 3CWVA 4UT4A 1U2RA 2UUCI 4JI8E 4DV2E 4IZJA 3QT6A 1FI4A 5IWAI 2UUAE 3QT5A 2PNLA 4DPTA 3ZKBA 4AQYE 4NXNE 2R42A 2UU9E 1ZXNA 1ELOA 2J7KA 3JAMQ 4YY3I 4GKJE 2VQEI 3Q1QA 3QT8A 3B78A 2ZBKB 1EA6A 4X65I 1RREA 2O1UA 2E5LE 5LMUI 5IT9C 1Z5CA 3K85A 1NHJA 1Y6ZA 4KHPI 2EFGA 1J5EI 1IBLE 4LFAE 4LF8I 4B3SE 2Z5EA 4USMA 1PIEA 1H7SA 2HKEA 1Z0GA 3D4JA 1BKNA 1A6FA 4XTJA 1MX0A 4K0KE 4YHHE 1ZM2A 2ZITA 1IBKE 3HULA 3QT7A 4P52A 2UUAI 2O1VA 4B3TE 4AQYI 4NXNI 2IOPA 1XMOE 2UU9I 1WUUA 2Z5CA 4GKKE 4GKJI 1N34E 1I94I 1ZM9A 1Z0EA 4URLA 4DV1E 2E5LI 1NHIA 4WUDA 4DR4E 1VISA 1Z5AA 4PRXA 1N36E 4YY3E 2VQEE 1FWKA 1IBLI 4JI5E 4FWGA 4LFAI 1N33E 4DR3I 3GONA 1XMQE 4HXZA 1HNWI 2HHHE 5A2QQ 3OTOE 3WU5A 2ZM6I 2UXCE 1Y4SA 3WU6A 4K0KI 1HNXI 4YHHI 4HYMA 5LMNE 3F0NA 1IBKI 2E1RA 3ZM7A 4KHPE 1KVKA 1J5EE 4LF7E 2DEIA 3J80Q 2X7IA 2HFUA 4B3TI 4PRVA 1HK7A 4GKKI 1ZXMA 4Z7CA 4DUZE 1N34I 4WUCA 4HACA 4DPYA 3B8HA 4JI2I 4HY1A 4JI7E 1FJGI 4JYAE 4DV1I 4JI3E 3PRYA 2WW4A 1K47A 4FW9A 1USVA 4M1KA 3Q6MA 4DR4I 4LF5E 2LJPA 1N36I 2UXBI 4RPFA 5GMDA 1Z0TA 3WU3A 1XHKA 1QZRA 4JI5I 1I94E 3PYGA 2NPFA 1N33I 1XMQI 4LF6E 3V5RA 1B63A 1KIJA 2HHHI 4X62E 3OTOI 3ZZ0A 2UXCI 1Z0BA 4ZVIA 2HK3A 5LMNI 2Z5BA 4IZKB 3J81Q 2UXDE 3T1YE 4LF7I 4P7AA 2BV3A 3ZZTA 4DR3E 4B3ME 4DR7I 4LFCE 1PKPA 4FWDA 1HNWE 2GQ0A 3B82A 1EI1A 2AJ4A 4LF9E 4JI0E 2ZM6E 1PVGA 3P06A 4JV5E 1B62A 1HNXE 4DUZI 1HR0E 3WU4A 2X36A 1KKHA 4IZJB 4IZJD 4X66I 4JI7I 4JYAI 4N3OA 1OJ4A 1HNZI 4JI3I 2HK2A 4JI1E 2IOQA 4JI6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWH A;  4DV7 E;  4LF5 I;  1H73 A;  5A2Q C;  4JI2 E;  4DPU A;  1FJG E;  4LF6 I;  5IT9 Q;  5FLX C;  3LNU A;  2F4V E;  1Z5B A;  4X62 I;  3K17 A;  1Z0C A;  2UXB E;  1XNQ E;  3M6A A;  1MG7 A;  3LTO A;  1KTV A;  4JI4 E;  2UXD I;  3T1Y I;  4JG4 A;  2V2Q A;  4DV5 I;  4B3M I;  4EMD A;  1DAR A;  4LFC I;  3LPS A;  4LF9 I;  4JI0 I;  1MU5 A;  4JV5 I;  5BR8 E;  4ED4 A;  1HR0 I;  2R3V A;  4DR1 E;  4DV3 I;  3JAM C;  4DR7 E;  4JI1 I;  4JI6 I;  1Z0W A;  1N32 E;  4DV7 I;  1UEK A;  1FWL A;  2XEX A;  4DR2 I;  2V8P A;  1S16 A;  2VF3 A;  4X66 E;  4DR6 E;  1HNZ E;  2Q2E B;  2F4V I;  2V2V A;  1ZM3 A;  3PYD A;  2UUB E;  1XNQ I;  4DUY E;  4DR5 E;  4JI4 I;  4B3R E;  1Z59 A;  4DV0 E;  3ZZU A;  4FN5 A;  1N0V C;  3T1H E;  4MYT A;  3J7A M;  3K1J A;  1N0U A;  5BR8 I;  1H72 C;  4Z7Y A;  4PU9 A;  1S4E A;  4DR1 I;  4DV5 E;  4KQV A;  1D6T A;  4DV4 E;  1Z0V A;  1N32 I;  3H4L A;  4LFB I;  3V2U C;  4X64 E;  2VQF I;  2BM1 A;  1XNR E;  4R1F A;  4HAC B;  3PYE A;  4LF4 E;  4DR6 I;  4UTG A;  4DV3 E;  1H74 A;  4I3H A;  4MYU A;  2BM0 A;  4OX9 E;  2UUB I;  2CZ9 A;  4DUY I;  4DR2 E;  4DR5 I;  2V2Z A;  1NZ0 A;  4B3R I;  1IBM E;  2DEJ A;  4JI8 I;  4DV2 I;  4DV0 I;  4DV6 E;  2V34 A;  4DPX A;  2HKJ A;  3T1H I;  2GS8 A;  4DPW A;  1FNM A;  2A2D A;  3J80 C;  4DU7 A;  3ZKD A;  4NXM E;  5GME A;  2UUC E;  4USK A;  4DV4 I;  5IWA E;  1ZM4 A;  4WUB A;  2A2C A;  4X64 I;  1XNR I;  1NHH A;  4DXL A;  4DU8 A;  4LF4 I;  1RR9 A;  4X65 E;  4B3S I;  4OX9 I;  1H7U A;  5LMU E;  5LL6 R;  4LFB E;  2VQF E;  3PYF A;  1IBM I;  2OI2 A;  4DV6 I;  2HFS A;  5FLX Q;  3J7A G;  4LF8 E;  3J81 C;  1FKA E;  1XMO I;  4NXM I;  5L3J A;  3CWV A;  4UT4 A;  1U2R A;  2UUC I;  4JI8 E;  4DV2 E;  3QT6 A;  1FI4 A;  5IWA I;  2UUA E;  3QT5 A;  4DPT A;  3ZKB A;  4AQY E;  4NXN E;  2R42 A;  2UU9 E;  1ZXN A;  1ELO A;  2J7K A;  3JAM Q;  4YY3 I;  4GKJ E;  2VQE I;  3Q1Q A;  3QT8 A;  3B78 A;  2ZBK B;  1EA6 A;  4X65 I;  1RRE A;  2E5L E;  5LMU I;  5IT9 C;  1Z5C A;  1NHJ A;  4KHP I;  2EFG A;  1J5E I;  1IBL E;  4LFA E;  4LF8 I;  4B3S E;  4USM A;  1PIE A;  1H7S A;  2HKE A;  1Z0G A;  3D4J A;  1BKN A;  1A6F A;  4XTJ A;  1MX0 A;  4K0K E;  4YHH E;  1ZM2 A;  2ZIT A;  1IBK E;  3HUL A;  3QT7 A;  4P52 A;  2UUA I;  4B3T E;  4AQY I;  4NXN I;  1XMO E;  2UU9 I;  1WUU A;  4GKK E;  4GKJ I;  1N34 E;  1I94 I;  1ZM9 A;  1Z0E A;  4URL A;  4DV1 E;  2E5L I;  1NHI A;  4WUD A;  4DR4 E;  1VIS A;  1Z5A A;  4PRX A;  1N36 E;  4YY3 E;  2VQE E;  1FWK A;  1IBL I;  4JI5 E;  4FWG A;  4LFA I;  1N33 E;  4DR3 I;  3GON A;  1XMQ E;  4HXZ A;  1HNW I;  2HHH E;  5A2Q Q;  3OTO E;  3WU5 A;  2ZM6 I;  2UXC E;  3WU6 A;  4K0K I;  1HNX I;  4YHH I;  4HYM A;  5LMN E;  3F0N A;  1IBK I;  2E1R A;  3ZM7 A;  4KHP E;  1KVK A;  1J5E E;  4LF7 E;  2DEI A;  3J80 Q;  2X7I A;  2HFU A;  4B3T I;  4PRV A;  4GKK I;  1ZXM A;  4Z7C A;  4DUZ E;  1N34 I;  4WUC A;  4HAC A;  4DPY A;  3B8H A;  4JI2 I;  4HY1 A;  4JI7 E;  1FJG I;  4JYA E;  4DV1 I;  4JI3 E;  2WW4 A;  1K47 A;  4FW9 A;  4M1K A;  4DR4 I;  4LF5 E;  2LJP A;  1N36 I;  2UXB I;  4RPF A;  5GMD A;  1Z0T A;  3WU3 A;  1XHK A;  1QZR A;  4JI5 I;  1I94 E;  3PYG A;  2NPF A;  1N33 I;  1XMQ I;  4LF6 E;  3V5R A;  1B63 A;  1KIJ A;  2HHH I;  4X62 E;  3OTO I;  3ZZ0 A;  2UXC I;  1Z0B A;  4ZVI A;  2HK3 A;  5LMN I;  3J81 Q;  2UXD E;  3T1Y E;  4LF7 I;  4P7A A;  2BV3 A;  3ZZT A;  4DR3 E;  4B3M E;  4DR7 I;  4LFC E;  1PKP A;  4FWD A;  1HNW E;  3B82 A;  1EI1 A;  2AJ4 A;  4LF9 E;  4JI0 E;  2ZM6 E;  1PVG A;  4JV5 E;  1B62 A;  1HNX E;  4DUZ I;  1HR0 E;  3WU4 A;  2X36 A;  1KKH A;  4X66 I;  4JI7 I;  4JYA I;  1OJ4 A;  1HNZ I;  4JI3 I;  2HK2 A;  4JI1 E;  4JI6 E; 
#chains in the Genus database with same CATH topology
 4FWH A;  5C0X C;  4DV7 E;  2CG9 A;  4LF5 I;  1H73 A;  5A2Q C;  1E3P A;  4JI2 E;  4DPU A;  1FJG E;  2JEA B;  4LF6 I;  2CVE A;  5IT9 Q;  5FLX C;  3LNU A;  2F4V E;  1Z5B A;  4X62 I;  1Y4U A;  2PO1 B;  3K17 A;  2C39 A;  1Z0C A;  2UXB E;  3HKM A;  2IER A;  1XNQ E;  2NN6 C;  3M6A A;  1MG7 A;  3LTO A;  1KTV A;  4JI4 E;  4MU4 A;  5K36 A;  2JE6 B;  2UXD I;  3T1Y I;  4JG4 A;  2AE8 A;  2V2Q A;  4DV5 I;  4B3M I;  3P3E A;  4EMD A;  1DAR A;  1YH8 A;  4LFC I;  4BA1 A;  3LPS A;  4LF9 I;  4JI0 I;  1Y5Y A;  1MU5 A;  4JV5 I;  5BR8 E;  4ED4 A;  5JEA F;  1HR0 I;  2R3V A;  3L7Z B;  4DR1 E;  3GLL A;  4DV3 I;  3JAM C;  4DR7 E;  3M7N G;  4JI1 I;  1UDS A;  4JI6 I;  1Z0W A;  1N32 E;  4DV7 I;  1UEK A;  1VI7 A;  3PS3 A;  2PO0 B;  1FWL A;  5FWK A;  2XEX A;  4DR2 I;  2V8P A;  5C0X D;  2PNM A;  1S16 A;  2BA1 D;  2VF3 A;  4X66 E;  4MU1 A;  4DR6 E;  1HNZ E;  1XXE A;  2C38 B;  2Q2E B;  2F4V I;  5JEA A;  2V2V A;  1ZM3 A;  2O1W A;  3PYD A;  2UUB E;  4U3D A;  2C37 B;  1XNQ I;  4DUY E;  4DR5 E;  4JI4 I;  4B3R E;  1Z59 A;  5DNL A;  4LCF A;  2NN6 D;  4DV0 E;  3ZZU A;  3H1C A;  4FN5 A;  1N0V C;  1Y60 A;  3T1H E;  4MYT A;  3J7A M;  2JEB A;  3K1J A;  4OO1 B;  1N0U A;  3U1Y A;  5BR8 I;  1H72 C;  4Z7Y A;  4PU9 A;  4MDT A;  1S4E A;  2IES A;  2BA0 D;  4DR1 I;  3CDI A;  4DV5 E;  4KQV A;  1D6T A;  4DV4 E;  4IFD F;  1Z0V A;  2JEA A;  1N32 I;  2NN6 E;  3H4L A;  4LFB I;  2WP8 B;  3V2U C;  1RHY A;  4X64 E;  5DRR A;  2BM1 A;  2VQF I;  3HJC A;  1XNR E;  4R1F A;  4OKG A;  4HAC B;  3PYE A;  5DRP A;  1R6L A;  4OZE A;  4LF4 E;  4DR6 I;  2JE6 A;  1USU A;  4UTG A;  4OO1 E;  4DV3 E;  1H74 A;  4I3H A;  5JEA D;  4MYU A;  2BM0 A;  3P76 A;  4OX9 E;  2UUB I;  4IFD C;  2CZ9 A;  4DUY I;  4DR2 E;  4DR5 I;  2V2Z A;  4IFD A;  1NZ0 A;  4B3R I;  1OYS A;  2DEJ A;  1IBM E;  4JI8 I;  4DV2 I;  4DV0 I;  4DV6 E;  2V34 A;  3L7Z A;  4DPX A;  2HKJ A;  3T1H I;  2GS8 A;  4DPW A;  1FNM A;  2A2D A;  3J80 C;  4DU7 A;  1P42 A;  3ZKD A;  5K36 C;  3GCM A;  2PO0 A;  4NXM E;  5GME A;  1E3H A;  2Z5B B;  2UUC E;  4USK A;  3Q6N A;  4OO1 F;  4DV4 I;  2C38 A;  5DNX A;  1R6M A;  5IWA E;  1ZM4 A;  4WUB A;  2A2C A;  2PO2 B;  4MQY A;  4NBQ A;  4X64 I;  1XNR I;  4FW7 A;  2C37 A;  3GME A;  2O1T A;  4BA2 B;  4QNK A;  1NHH A;  4DXL A;  4DU8 A;  4LF4 I;  1RR9 A;  1OYP A;  4X65 E;  4B3S I;  4OX9 I;  1H7U A;  5DRO A;  5LMU E;  5LL6 R;  3CDJ A;  5C0X B;  4LFB E;  4OO1 A;  2Z5C B;  2VQF E;  3PYF A;  2J65 A;  4AM3 A;  4IFD D;  1IBM I;  2OI2 A;  4IZK A;  2F1D A;  5JEA C;  4DV6 I;  2HFS A;  5FLX Q;  4ISA A;  2CGE A;  3J7A G;  4LF8 E;  3J81 C;  5DRQ A;  3P3C A;  1FKA E;  3M7N D;  1XMO I;  4NXM I;  5L3J A;  3CWV A;  2WP8 A;  4UT4 A;  1U2R A;  2UUC I;  2NN6 B;  5K36 D;  3PS1 A;  4LCH A;  4JI8 E;  2JT2 A;  4DV2 E;  3U1K A;  4IZJ A;  3QT6 A;  5C0X E;  1FI4 A;  4J3D A;  5IWA I;  2UUA E;  3QT5 A;  2PNL A;  4DPT A;  3ZKB A;  4AQY E;  4NXN E;  2R42 A;  2BA0 G;  2UU9 E;  2PNZ B;  5EKW A;  1ZXN A;  1ELO A;  2J7K A;  3JAM Q;  4YY3 I;  4GKJ E;  2VQE I;  3Q1Q A;  3QT8 A;  3B78 A;  2ZBK B;  3NZK A;  1EA6 A;  4X65 I;  1RRE A;  2O1U A;  2E5L E;  5K36 E;  5LMU I;  2PO1 A;  5IT9 C;  4AID A;  1Z5C A;  3K85 A;  1NHJ A;  1Y6Z A;  4KHP I;  2EFG A;  1J5E I;  2WNR B;  1IBL E;  4LFA E;  5C0X F;  4LF8 I;  5JEA B;  4B3S E;  2Z5E A;  4USM A;  1PIE A;  1H7S A;  2HKE A;  1Z0G A;  3D4J A;  1BKN A;  1A6F A;  4XTJ A;  2PO2 A;  1MX0 A;  4K0K E;  4YHH E;  1ZM2 A;  2ZIT A;  1IBK E;  3HUL A;  3QT7 A;  2GO3 A;  2JEB B;  4P52 A;  2UUA I;  2NN6 F;  2O1V A;  4B3T E;  2GO4 A;  4AQY I;  4NXN I;  4FW3 A;  3M85 D;  4U3B A;  2IOP A;  1XMO E;  2UU9 I;  1WUU A;  5C0X A;  2Z5C A;  5JEA E;  4GKK E;  4GKJ I;  1N34 E;  3KRN A;  1I94 I;  5ELW A;  1ZM9 A;  1Z0E A;  4URL A;  4DV1 E;  2E5L I;  1NHI A;  4WUD A;  4DR4 E;  1VIS A;  1Z5A A;  4PRX A;  1N36 E;  4YY3 E;  2VQE E;  2NN6 A;  1UDO A;  1FWK A;  2BR2 B;  1IBL I;  4JI5 E;  4FWG A;  4LFA I;  3P3G A;  1YHC A;  1N33 E;  4DR3 I;  3GON A;  3UHM A;  1XMQ E;  4HXZ A;  1HNW I;  4OO1 C;  2HHH E;  5A2Q Q;  4IS9 A;  3WU5 A;  3OTO E;  2ZM6 I;  2UXC E;  2BA1 G;  1Y4S A;  4IFD B;  3WU6 A;  4K0K I;  1HNX I;  1UDN A;  4YHH I;  2PNZ A;  4HYM A;  5LMN E;  3F0N A;  1IBK I;  2E1R A;  3ZM7 A;  4KHP E;  1KVK A;  1J5E E;  1UDQ A;  4LF7 E;  2DEI A;  3J80 Q;  2X7I A;  2HFU A;  2C39 B;  4B3T I;  3B4T A;  4PRV A;  1HK7 A;  4GKK I;  1ZXM A;  5K36 B;  4Z7C A;  4LOM A;  4DUZ E;  1N34 I;  4WUC A;  4HAC A;  4DPY A;  3B8H A;  4JI2 I;  4HY1 A;  4JI7 E;  1FJG I;  4JYA E;  4BA1 B;  4LCG A;  2WNR A;  4FW6 A;  3PRY A;  2WW4 A;  4AIM A;  4DV1 I;  4JI3 E;  4IFD E;  1K47 A;  4FW9 A;  1USV A;  4M1K A;  3Q6M A;  4DR4 I;  4LF5 E;  2LJP A;  1N36 I;  2UXB I;  4RPF A;  5GMD A;  1Z0T A;  4LPF A;  3WU3 A;  1XHK A;  1QZR A;  4JI5 I;  1I94 E;  3PYG A;  2NPF A;  1N33 I;  1XMQ I;  4LF6 E;  3V5R A;  1B63 A;  1KIJ A;  2HHH I;  4X62 E;  3OTO I;  3ZZ0 A;  4MU3 A;  2UXC I;  1Z0B A;  4OO1 D;  2VES A;  4ZVI A;  2HK3 A;  4GQU A;  4MU0 A;  5LMN I;  2Z5B A;  4IZK B;  4FW5 A;  3J81 Q;  2UXD E;  3T1Y E;  4LF7 I;  4P7A A;  2BV3 A;  3ZZT A;  1OYR A;  3PS2 A;  4DR3 E;  4B3M E;  4DR7 I;  4LFC E;  1PKP A;  4FWD A;  1HNW E;  2GQ0 A;  3B82 A;  4FW4 A;  1EI1 A;  2AJ4 A;  4LF9 E;  4JI0 E;  5EL9 A;  2ZM6 E;  1PVG A;  3P06 A;  4JV5 E;  1B62 A;  1HNX E;  4DUZ I;  4BA2 A;  1HR0 E;  3WU4 A;  2X36 A;  1KKH A;  3DD6 A;  4IZJ B;  4QNJ A;  2O3Z A;  4IZJ D;  4X66 I;  4JI7 I;  4JYA I;  4N3O A;  1OJ4 A;  2BR2 A;  1HNZ I;  4JI3 I;  2HK2 A;  3M85 G;  4JI1 E;  2IOQ A;  5K36 F;  4JI6 E; 
#chains in the Genus database with same CATH homology
 4FWH A;  4DV7 E;  2CG9 A;  4LF5 I;  1H73 A;  5A2Q C;  4JI2 E;  4DPU A;  1FJG E;  4LF6 I;  5IT9 Q;  5FLX C;  3LNU A;  2F4V E;  1Z5B A;  4X62 I;  1Y4U A;  3K17 A;  1Z0C A;  2UXB E;  1XNQ E;  3M6A A;  1MG7 A;  3LTO A;  1KTV A;  4JI4 E;  2UXD I;  3T1Y I;  4JG4 A;  2V2Q A;  4DV5 I;  4B3M I;  4EMD A;  1DAR A;  4LFC I;  3LPS A;  4LF9 I;  4JI0 I;  1MU5 A;  4JV5 I;  5BR8 E;  4ED4 A;  1HR0 I;  2R3V A;  4DR1 E;  4DV3 I;  3JAM C;  4DR7 E;  4JI1 I;  4JI6 I;  1Z0W A;  1N32 E;  4DV7 I;  1UEK A;  1FWL A;  5FWK A;  2XEX A;  4DR2 I;  2V8P A;  2PNM A;  1S16 A;  2VF3 A;  4X66 E;  4DR6 E;  1HNZ E;  2Q2E B;  2F4V I;  2V2V A;  1ZM3 A;  2O1W A;  3PYD A;  2UUB E;  1XNQ I;  4DUY E;  4DR5 E;  4JI4 I;  4B3R E;  1Z59 A;  4DV0 E;  3ZZU A;  4FN5 A;  1N0V C;  3T1H E;  4MYT A;  3J7A M;  3K1J A;  1N0U A;  5BR8 I;  1H72 C;  4Z7Y A;  4PU9 A;  1S4E A;  4DR1 I;  4DV5 E;  4KQV A;  1D6T A;  4DV4 E;  1Z0V A;  1N32 I;  3H4L A;  4LFB I;  3V2U C;  4X64 E;  2VQF I;  2BM1 A;  1XNR E;  3HJC A;  4R1F A;  4HAC B;  3PYE A;  4LF4 E;  4DR6 I;  1USU A;  4UTG A;  4DV3 E;  1H74 A;  4I3H A;  4MYU A;  2BM0 A;  4OX9 E;  2UUB I;  2CZ9 A;  4DUY I;  4DR2 E;  4DR5 I;  2V2Z A;  1NZ0 A;  4B3R I;  1IBM E;  2DEJ A;  4JI8 I;  4DV2 I;  4DV0 I;  4DV6 E;  2V34 A;  4DPX A;  2HKJ A;  3T1H I;  2GS8 A;  4DPW A;  1FNM A;  2A2D A;  3J80 C;  4DU7 A;  3ZKD A;  4NXM E;  5GME A;  2Z5B B;  2UUC E;  4USK A;  3Q6N A;  4DV4 I;  5IWA E;  1ZM4 A;  4WUB A;  2A2C A;  4X64 I;  1XNR I;  2O1T A;  1NHH A;  4DXL A;  4DU8 A;  4LF4 I;  1RR9 A;  4X65 E;  4B3S I;  4OX9 I;  1H7U A;  5LMU E;  5LL6 R;  4LFB E;  2Z5C B;  2VQF E;  3PYF A;  1IBM I;  2OI2 A;  4IZK A;  4DV6 I;  2HFS A;  5FLX Q;  2CGE A;  3J7A G;  4LF8 E;  3J81 C;  1FKA E;  1XMO I;  4NXM I;  5L3J A;  3CWV A;  4UT4 A;  1U2R A;  2UUC I;  4JI8 E;  4DV2 E;  4IZJ A;  3QT6 A;  1FI4 A;  5IWA I;  2UUA E;  3QT5 A;  2PNL A;  4DPT A;  3ZKB A;  4AQY E;  4NXN E;  2R42 A;  2UU9 E;  1ZXN A;  1ELO A;  2J7K A;  3JAM Q;  4YY3 I;  4GKJ E;  2VQE I;  3Q1Q A;  3QT8 A;  3B78 A;  2ZBK B;  1EA6 A;  4X65 I;  1RRE A;  2O1U A;  2E5L E;  5LMU I;  5IT9 C;  1Z5C A;  3K85 A;  1NHJ A;  1Y6Z A;  4KHP I;  2EFG A;  1J5E I;  1IBL E;  4LFA E;  4LF8 I;  4B3S E;  2Z5E A;  4USM A;  1PIE A;  1H7S A;  2HKE A;  1Z0G A;  3D4J A;  1BKN A;  1A6F A;  4XTJ A;  1MX0 A;  4K0K E;  4YHH E;  1ZM2 A;  2ZIT A;  1IBK E;  3HUL A;  3QT7 A;  4P52 A;  2UUA I;  2O1V A;  4B3T E;  4AQY I;  4NXN I;  2IOP A;  1XMO E;  2UU9 I;  1WUU A;  2Z5C A;  4GKK E;  4GKJ I;  1N34 E;  1I94 I;  1ZM9 A;  1Z0E A;  4URL A;  4DV1 E;  2E5L I;  1NHI A;  4WUD A;  4DR4 E;  1VIS A;  1Z5A A;  4PRX A;  1N36 E;  4YY3 E;  2VQE E;  1FWK A;  1IBL I;  4JI5 E;  4FWG A;  4LFA I;  1N33 E;  4DR3 I;  3GON A;  1XMQ E;  4HXZ A;  1HNW I;  2HHH E;  5A2Q Q;  3OTO E;  3WU5 A;  2ZM6 I;  2UXC E;  1Y4S A;  3WU6 A;  4K0K I;  1HNX I;  4YHH I;  4HYM A;  5LMN E;  3F0N A;  1IBK I;  2E1R A;  3ZM7 A;  4KHP E;  1KVK A;  1J5E E;  4LF7 E;  2DEI A;  3J80 Q;  2X7I A;  2HFU A;  4B3T I;  4PRV A;  1HK7 A;  4GKK I;  1ZXM A;  4Z7C A;  4DUZ E;  1N34 I;  4WUC A;  4HAC A;  4DPY A;  3B8H A;  4JI2 I;  4HY1 A;  4JI7 E;  1FJG I;  4JYA E;  4DV1 I;  4JI3 E;  3PRY A;  2WW4 A;  1K47 A;  4FW9 A;  1USV A;  4M1K A;  3Q6M A;  4DR4 I;  4LF5 E;  2LJP A;  1N36 I;  2UXB I;  4RPF A;  5GMD A;  1Z0T A;  3WU3 A;  1XHK A;  1QZR A;  4JI5 I;  1I94 E;  3PYG A;  2NPF A;  1N33 I;  1XMQ I;  4LF6 E;  3V5R A;  1B63 A;  1KIJ A;  2HHH I;  4X62 E;  3OTO I;  3ZZ0 A;  2UXC I;  1Z0B A;  4ZVI A;  2HK3 A;  5LMN I;  2Z5B A;  4IZK B;  3J81 Q;  2UXD E;  3T1Y E;  4LF7 I;  4P7A A;  2BV3 A;  3ZZT A;  4DR3 E;  4B3M E;  4DR7 I;  4LFC E;  1PKP A;  4FWD A;  1HNW E;  2GQ0 A;  3B82 A;  1EI1 A;  2AJ4 A;  4LF9 E;  4JI0 E;  2ZM6 E;  1PVG A;  3P06 A;  4JV5 E;  1B62 A;  1HNX E;  4DUZ I;  1HR0 E;  3WU4 A;  2X36 A;  1KKH A;  4IZJ B;  4IZJ D;  4X66 I;  4JI7 I;  4JYA I;  4N3O A;  1OJ4 A;  1HNZ I;  4JI3 I;  2HK2 A;  4JI1 E;  2IOQ A;  4JI6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...