4NXMI

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxmI00
4EMDA 4JI4E 1H7SA 4JI2I 4NXNI 4GKKI 5GMDA 4LF8I 1BKNA 1KIJA 4YY3E 4HYMA 2BV3A 1MU5A 3GONA 3WU6A 5BR8I 4DUZI 1IBLE 4XTJA 5LL6R 5IWAI 4HACA 4JV5I 2EFGA 4HACB 3PYFA 2VQEE 4DR2I 5IT9C 1Z0TA 3PYEA 4DR6E 4AQYE 4DR7I 4DR1I 2CZ9A 1S16A 2UU9I 2HHHI 2HFUA 4DR5E 1PIEA 4DU7A 4USKA 4B3TI 1QZRA 1NHJA 5L3JA 1Z0BA 1XHKA 4JYAI 3QT5A 4ED4A 1FJGE 4DR4I 2HKJA 1K47A 3D4JA 3WU3A 5LMNE 2E1RA 1HNXE 1HNWI 3WU4A 4R1FA 1Z5AA 5LMUI 4Z7CA 2OI2A 4DV6I 4X62I 1XNRE 1H7UA 4KHPI 3ZM7A 4YHHE 3T1HE 2XEXA 4B3ME 2R42A 2WW4A 1HR0I 4USMA 1N32E 1Z5CA 4DPXA 4OX9E 4LF4I 4FN5A 2UUAE 4LF6E 4Z7YA 3LTOA 4UTGA 1IBKE 4LFBI 1N33I 3CWVA 2UUBI 4NXMI 4DV2I 4MYTA 2ZBKB 3QT8A 4JG4A 4DPUA 1KVKA 4X66E 1ZXMA 2UUCI 4JI1I 2DEJA 4DV3E 1KKHA 3B82A 4DV1I 4DV7I 5IT9Q 3QT6A 2X7IA 2ZITA 4X65I 4JI5I 2UXCE 4LFCI 4JI7E 1NZ0A 3LPSA 1Z0VA 1Z0EA 1D6TA 4FWHA 4JI3I 3H4LA 4JI4I 4DUYE 4LFAE 4HXZA 1FNMA 1NHHA 1KTVA 1FI4A 1Z5BA 4YY3I 4B3SE 4DV5E 1IBME 3F0NA 4HY1A 3PYGA 1XNQE 3J7AM 1H73A 4I3HA 1IBLI 4WUCA 3J81Q 4DPWA 2ZM6E 2VQFE 1Z0WA 2VQEI 1N34E 4K0KE 2UXBE 4DR6I 1HNZE 4AQYI 2HFSA 4LF5I 1U2RA 4PU9A 4FW9A 4DR5I 2UXDE 4P7AA 4DPYA 1N36E 4LF9E 2X36A 3V5RA 1Z59A 1FJGI 4FWGA 3K1JA 4DR3E 4ZVIA 2NPFA 1FKAE 5LMNI 4KQVA 1HNXI 3J81C 1WUUA 3QT7A 1XNRI 4PRXA 4YHHI 3T1HI 2Q2EB 1FWLA 2F4VE 1N32I 1I94E 4JI8E 1MX0A 3K17A 2HK2A 4OX9I 4GKJE 4DV4E 3ZZUA 3ZKDA 2UUAI 1ZM4A 4LF6I 1XMOE 4JI0E 1MG7A 2V34A 4FWDA 1IBKI 1A6FA 1EI1A 1H72C 3T1YE 1J5EE 3OTOE 4LF7E 3V2UC 2E5LE 4X64E 2V2ZA 4B3RE 2BM0A 3PYDA 1ZM3A 3HULA 4X66I 1ELOA 4DV3I 2V2VA 2VF3A 4DV0E 2A2DA 3LNUA 1XMQE 3J80Q 1PKPA 4JI6E 2AJ4A 4JI2E 3JAMQ 2UXCI 4JI7I 4NXNE 2V8PA 4GKKE 4LF8E 1S4EA 1N0UA 1EA6A 4DUYI 4LFAI 5BR8E 4DXLA 2LJPA 4DUZE 5IWAE 4JV5E 1PVGA 4B3SI 4DV5I 1IBMI 1NHIA 1B62A 5FLXQ 1OJ4A 4DR2E 3J80C 1XNQI 4DR7E 4DR1E 2UU9E 3ZZ0A 2HHHE 3JAMC 2ZM6I 2VQFI 2J7KA 4MYUA 1N34I 4B3TE 4K0KI 4LF5E 2UXBI 2BM1A 1H74A 4PRVA 1HNZI 4JYAE 1RREA 4DR4E 1ZM9A 1FWKA 5A2QQ 1HNWE 2UXDI 4M1KA 1N36I 1B63A 2HK3A 5LMUE 4DV6E 4X62E 4LF9I 3WU5A 5FLXC 4KHPE 1Z0CA 4DR3I 4P52A 2GS8A 4DU8A 2R3VA 1HR0E 2A2CA 1VISA 4B3MI 1N0VC 4LF4E 3ZZTA 1ZXNA 1ZM2A 3J7AG 1RR9A 1UEKA 4LFBE 2F4VI 1N33E 2UUBE 1I94I 4JI8I 5A2QC 4WUDA 4NXME 4DV2E 4GKJI 4DV4I 3B78A 4DPTA 4UT4A 2HKEA 1XMOI 4JI0I 2UUCE 4JI1E 3T1YI 4DV1E 1J5EI 3OTOI 2V2QA 4LF7I 2E5LI 2DEIA 4RPFA 4X64I 4URLA 4DV7E 4B3RI 3ZKBA 4X65E 4JI5E 4LFCE 3Q1QA 3M6AA 3B8HA 4DV0I 1Z0GA 4WUBA 1DARA 4JI3E 5GMEA 1XMQI 4JI6I
chains in the Genus database with same CATH superfamily
1USVA 4EMDA 5JEAF 4JI4E 1H7SA 4JI2I 3K85A 4NXNI 4GKKI 5GMDA 4LF8I 1BKNA 1KIJA 4YY3E 4HYMA 2BV3A 2Z5CA 1MU5A 3GONA 3WU6A 2C38A 5BR8I 1UDOA 3GCMA 3GMEA 3L7ZA 3U1YA 4DUZI 1IBLE 3P76A 3L7ZB 4XTJA 5LL6R 5IWAI 4HACA 4JV5I 2EFGA 4HACB 3PYFA 4OO1A 2VQEE 4DR2I 4OO1B 5IT9C 1Z0TA 2JT2A 3PYEA 4DR6E 4AQYE 4DR7I 4DR1I 5DNXA 2CZ9A 5JEAA 2O3ZA 4BA2B 1S16A 5JEAB 2UU9I 4BA1A 2HHHI 4OO1C 2HFUA 4DR5E 1PIEA 4BA1B 4DU7A 4J3DA 4IFDB 2WP8A 4USKA 4B3TI 2WP8B 1QZRA 1NHJA 5L3JA 1Z0BA 1XHKA 4JYAI 3QT5A 2F1DA 3HKMA 5DROA 4ED4A 4IFDC 1FJGE 4DR4I 2HKJA 1K47A 3D4JA 3WU3A 5LMNE 2E1RA 1HNXE 1HNWI 3WU4A 4R1FA 1Z5AA 4FW7A 5LMUI 4Z7CA 2OI2A 4DV6I 4X62I 2C39A 1XNRE 3HJCA 1RHYA 4IFDD 1H7UA 4KHPI 3ZM7A 4YHHE 3T1HE 2XEXA 4B3ME 3PS2A 2R42A 2WW4A 1HR0I 5K36C 4USMA 1N32E 1OYPA 1Z5CA 4DPXA 5K36E 4OX9E 4LF4I 4FN5A 4MDTA 2UUAE 4LF6E 1Y6ZA 2Z5EA 4Z7YA 3LTOA 4UTGA 2PO0A 1IBKE 4LFBI 5K36D 1N33I 3CWVA 2UUBI 1HK7A 2C37A 4NXMI 4DV2I 1UDSA 4MYTA 2ZBKB 3QT8A 4MU1A 4JG4A 4DPUA 1KVKA 3U1KA 4X66E 2NN6A 2J65A 1ZXMA 2UUCI 5DRPA 2DEJA 4JI1I 4DV3E 1KKHA 2JEBA 3B82A 1OYSA 4DV1I 5C0XC 4DV7I 5C0XE 5IT9Q 3QT6A 2AE8A 2X7IA 2ZITA 3NZKA 4U3DA 4FW4A 4X65I 4JI5I 2UXCE 4LFCI 4JI7E 1NZ0A 3LPSA 4OKGA 4IFDF 1Z0VA 5C0XD 4LOMA 1Z0EA 3Q6NA 4FWHA 4JI3I 1D6TA 3H4LA 1Y60A 4MU0A 4DUYE 4JI4I 4LFAE 4HXZA 2CGEA 4U3BA 3DD6A 1FNMA 1NHHA 3H1CA 1KTVA 1FI4A 1Z5BA 4YY3I 4B3SE 3P3EA 4DV5E 2BR2B 1IBME 3F0NA 4HY1A 5K36F 4JI6I 3PYGA 1XNQE 2IESA 3J7AM 1H73A 4IZKA 4FW3A 2JEAB 4I3HA 4IZKB 1IBLI 4BA2A 4WUCA 3J81Q 2WNRB 1Y4UA 4DPWA 2ZM6E 2VQFE 1R6LA 1Z0WA 2VQEI 1N34E 4K0KE 4IFDA 4LPFA 1P42A 2UXBE 4DR6I 1HNZE 4AQYI 3P3GA 3Q6MA 2HFSA 4LF5I 4IZJB 1U2RA 4PU9A 4FW9A 4DR5I 4AM3A 2UXDE 4P7AA 4DPYA 1N36E 4LF9E 2X36A 3V5RA 4GQUA 3PS1A 5C0XF 4ISAA 1Z59A 1FJGI 4FWGA 3K1JA 4DR3E 5K36A 5DRQA 4ZVIA 1R6MA 2NPFA 5K36B 5DRRA 1FKAE 5LMNI 4KQVA 1HNXI 2PNZA 2PNZB 4IZJD 3J81C 2PO1A 1WUUA 3QT7A 2PO1B 4MU4A 1XNRI 2BA1G 4QNKA 4QNJA 4PRXA 4LCFA 4YHHI 3T1HI 1XXEA 2GO3A 2Q2EB 1FWLA 2F4VE 1N32I 1I94E 4JI8E 1MX0A 3GLLA 2O1UA 2HK2A 3K17A 4OX9I 4AIDA 4GKJE 4NBQA 4DV4E 3ZZUA 3ZKDA 2UUAI 1ZM4A 4LF6I 2BA1D 1USUA 1XMOE 4JI0E 1MG7A 2V34A 4FWDA 1IBKI 1A6FA 1EI1A 5C0XA 1H72C 3P3CA 3T1YE 4MQYA 5C0XB 5EKWA 1J5EE 3OTOE 4LF7E 2PNLA 3V2UC 2E5LE 4X64E 2V2ZA 4B3RE 2O1TA 2BM0A 3PYDA 1ZM3A 3HULA 2Z5BB 5FWKA 4X66I 3CDIA 1ELOA 4DV3I 2V2VA 2PO2B 2VF3A 4FW6A 4DV0E 2A2DA 3LNUA 1XMQE 3J80Q 1PKPA 4JI6E 1Y4SA 2AJ4A 4JI2E 3JAMQ 2UXCI 4JI7I 4NXNE 2V8PA 4GKKE 2NN6E 1Y5YA 3B4TA 4LF8E 4FW5A 1S4EA 2IERA 2JE6A 1YHCA 1N0UA 2JE6B 2BR2A 1EA6A 4DUYI 4LFAI 5BR8E 5DNLA 2NN6D 4DXLA 2LJPA 4DUZE 2JEAA 5IWAE 4JV5E 2BA0G 1PVGA 2WNRA 4B3SI 2Z5CB 2IOPA 4DV5I 1IBMI 1E3HA 1NHIA 1B62A 5FLXQ 1OJ4A 2C38B 4DR2E 3J80C 1XNQI 4DR7E 4DR1E 4JI3E 2UU9E 3ZZ0A 2HHHE 4IZJA 3JAMC 2ZM6I 2VQFI 2J7KA 4MYUA 1OYRA 2BA0D 2GQ0A 1N34I 4B3TE 4K0KI 4LF5E 3M7NG 2UXBI 2BM1A 4MU3A 1H74A 4PRVA 1HNZI 4JYAE 2GO4A 1RREA 4DR4E 4OO1E 1ZM9A 1FWKA 5A2QQ 5JEAC 1HNWE 3M85G 2UXDI 1UDNA 3P06A 5ELWA 4M1KA 5JEAE 1N36I 1B63A 2HK3A 5LMUE 4DV6E 4X62E 4LF9I 3WU5A 4OO1D 5FLXC 4IFDE 3M7ND 4KHPE 1Z0CA 4DR3I 5JEAD 4P52A 2GS8A 4DU8A 2R3VA 1HR0E 2A2CA 1VISA 5EL9A 4B3MI 2NN6F 2C39B 3M85D 1N0VC 4LF4E 4OZEA 3ZZTA 1ZXNA 3UHMA 1ZM2A 3J7AG 1RR9A 2IOQA 1UEKA 2O1VA 4LFBE 2F4VI 3PS3A 1N33E 2CVEA 2UUBE 1I94I 4JI8I 5A2QC 3PRYA 4WUDA 4NXME 4DV2E 4GKJI 4LCGA 4DV4I 3B78A 4DPTA 2PO0B 4UT4A 2HKEA 1VI7A 1XMOI 4JI0I 4LCHA 2UUCE 2Z5BA 4JI1E 3T1YI 2PNMA 4DV1E 2C37B 1J5EI 3OTOI 2PO2A 2V2QA 3KRNA 4LF7I 4N3OA 2E5LI 1E3PA 2DEIA 4RPFA 4X64I 4URLA 4DV7E 4B3RI 2VESA 2NN6B 3ZKBA 1YH8A 4X65E 4JI5E 2JEBB 2O1WA 4LFCE 3Q1QA 3M6AA 3B8HA 4OO1F 4IS9A 2NN6C 4DV0I 1Z0GA 3CDJA 4WUBA 1DARA 4AIMA 5GMEA 1XMQI 2CG9A 1UDQA
chains in the Genus database with same CATH topology
1USVA 4EMDA 4JI4E 1H7SA 4JI2I 3K85A 4NXNI 4GKKI 5GMDA 4LF8I 1BKNA 1KIJA 4YY3E 4HYMA 2BV3A 2Z5CA 1MU5A 3GONA 3WU6A 5BR8I 4DUZI 1IBLE 4XTJA 5LL6R 5IWAI 4HACA 4JV5I 2EFGA 4HACB 3PYFA 2VQEE 4DR2I 5IT9C 1Z0TA 3PYEA 4DR6E 4AQYE 4DR7I 4DR1I 2CZ9A 1S16A 2UU9I 2HHHI 2HFUA 4DR5E 1PIEA 4DU7A 4USKA 4B3TI 1QZRA 1NHJA 5L3JA 1Z0BA 1XHKA 4JYAI 3QT5A 4ED4A 1FJGE 4DR4I 2HKJA 1K47A 3D4JA 3WU3A 5LMNE 2E1RA 1HNXE 1HNWI 3WU4A 4R1FA 1Z5AA 5LMUI 4Z7CA 2OI2A 4DV6I 4X62I 1XNRE 3HJCA 1H7UA 4KHPI 3ZM7A 4YHHE 3T1HE 2XEXA 4B3ME 2R42A 2WW4A 1HR0I 4USMA 1N32E 1Z5CA 4DPXA 4OX9E 4LF4I 4FN5A 2UUAE 4LF6E 1Y6ZA 2Z5EA 4Z7YA 3LTOA 4UTGA 1IBKE 4LFBI 1N33I 3CWVA 2UUBI 1HK7A 4NXMI 4DV2I 4MYTA 2ZBKB 3QT8A 4JG4A 4DPUA 1KVKA 4X66E 1ZXMA 2UUCI 4JI1I 2DEJA 4DV3E 1KKHA 3B82A 4DV1I 4DV7I 5IT9Q 3QT6A 2X7IA 2ZITA 4X65I 4JI5I 2UXCE 4LFCI 4JI7E 1NZ0A 3LPSA 1Z0VA 1Z0EA 3Q6NA 4FWHA 4JI3I 1D6TA 3H4LA 4JI4I 4DUYE 4LFAE 4HXZA 2CGEA 1FNMA 1NHHA 1KTVA 1FI4A 1Z5BA 4YY3I 4B3SE 4DV5E 1IBME 3F0NA 4HY1A 4JI6I 3PYGA 1XNQE 3J7AM 1H73A 4IZKA 4I3HA 4IZKB 1IBLI 4WUCA 3J81Q 1Y4UA 4DPWA 2ZM6E 2VQFE 1Z0WA 2VQEI 1N34E 4K0KE 2UXBE 4DR6I 1HNZE 4AQYI 2HFSA 3Q6MA 4LF5I 4IZJB 1U2RA 4PU9A 4FW9A 4DR5I 2UXDE 4P7AA 4DPYA 1N36E 4LF9E 2X36A 3V5RA 1Z59A 1FJGI 4FWGA 3K1JA 4DR3E 4ZVIA 2NPFA 1FKAE 5LMNI 4KQVA 1HNXI 4IZJD 3J81C 1WUUA 3QT7A 1XNRI 4PRXA 4YHHI 3T1HI 2Q2EB 1FWLA 2F4VE 1N32I 1I94E 4JI8E 1MX0A 2O1UA 2HK2A 3K17A 4OX9I 4GKJE 4DV4E 3ZZUA 3ZKDA 2UUAI 1ZM4A 4LF6I 1USUA 1XMOE 4JI0E 1MG7A 2V34A 4FWDA 1IBKI 1A6FA 1EI1A 1H72C 3T1YE 1J5EE 3OTOE 4LF7E 2PNLA 3V2UC 2E5LE 4X64E 2V2ZA 4B3RE 2O1TA 2BM0A 3PYDA 1ZM3A 3HULA 2Z5BB 5FWKA 4X66I 1ELOA 4DV3I 2V2VA 2VF3A 4DV0E 2A2DA 3LNUA 1XMQE 3J80Q 1PKPA 4JI6E 1Y4SA 2AJ4A 4JI2E 3JAMQ 2UXCI 4JI7I 4NXNE 2V8PA 4GKKE 4LF8E 1S4EA 1N0UA 1EA6A 4DUYI 4LFAI 5BR8E 4DXLA 2LJPA 4DUZE 5IWAE 4JV5E 1PVGA 4B3SI 2Z5CB 2IOPA 4DV5I 1IBMI 1NHIA 1B62A 5FLXQ 1OJ4A 4DR2E 3J80C 1XNQI 4DR7E 4DR1E 2UU9E 3ZZ0A 2HHHE 4IZJA 3JAMC 2ZM6I 2VQFI 2J7KA 4MYUA 2GQ0A 1N34I 4B3TE 4K0KI 4LF5E 2UXBI 2BM1A 1H74A 4PRVA 1HNZI 4JYAE 1RREA 4DR4E 1ZM9A 1FWKA 5A2QQ 1HNWE 2UXDI 3P06A 4M1KA 1N36I 1B63A 2HK3A 5LMUE 4DV6E 4X62E 4LF9I 3WU5A 5FLXC 4KHPE 1Z0CA 4DR3I 4P52A 2GS8A 4DU8A 2R3VA 1HR0E 2A2CA 1VISA 4B3MI 1N0VC 4LF4E 3ZZTA 1ZXNA 1ZM2A 3J7AG 1RR9A 2IOQA 1UEKA 2O1VA 4LFBE 2F4VI 1N33E 2UUBE 1I94I 4JI8I 5A2QC 3PRYA 4WUDA 4NXME 4DV2E 4GKJI 4DV4I 3B78A 4DPTA 4UT4A 2HKEA 1XMOI 4JI0I 2UUCE 2Z5BA 4JI1E 3T1YI 2PNMA 4DV1E 1J5EI 3OTOI 2V2QA 4LF7I 4N3OA 2E5LI 2DEIA 4RPFA 4X64I 4URLA 4DV7E 4B3RI 3ZKBA 4X65E 4JI5E 2O1WA 4LFCE 3Q1QA 3M6AA 3B8HA 4DV0I 1Z0GA 4WUBA 1DARA 4JI3E 5GMEA 1XMQI 2CG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMD A;  4JI4 E;  1H7S A;  4JI2 I;  4NXN I;  4GKK I;  5GMD A;  4LF8 I;  1BKN A;  1KIJ A;  4YY3 E;  4HYM A;  2BV3 A;  1MU5 A;  3GON A;  3WU6 A;  5BR8 I;  4DUZ I;  1IBL E;  4XTJ A;  5LL6 R;  5IWA I;  4HAC A;  4JV5 I;  2EFG A;  4HAC B;  3PYF A;  2VQE E;  4DR2 I;  5IT9 C;  1Z0T A;  3PYE A;  4DR6 E;  4AQY E;  4DR7 I;  4DR1 I;  2CZ9 A;  1S16 A;  2UU9 I;  2HHH I;  2HFU A;  4DR5 E;  1PIE A;  4DU7 A;  4USK A;  4B3T I;  1QZR A;  1NHJ A;  5L3J A;  1Z0B A;  1XHK A;  4JYA I;  3QT5 A;  4ED4 A;  1FJG E;  4DR4 I;  2HKJ A;  1K47 A;  3D4J A;  3WU3 A;  5LMN E;  2E1R A;  1HNX E;  1HNW I;  3WU4 A;  4R1F A;  1Z5A A;  5LMU I;  4Z7C A;  2OI2 A;  4DV6 I;  4X62 I;  1XNR E;  1H7U A;  4KHP I;  3ZM7 A;  4YHH E;  3T1H E;  2XEX A;  4B3M E;  2R42 A;  2WW4 A;  1HR0 I;  4USM A;  1N32 E;  1Z5C A;  4DPX A;  4OX9 E;  4LF4 I;  4FN5 A;  2UUA E;  4LF6 E;  4Z7Y A;  3LTO A;  4UTG A;  1IBK E;  4LFB I;  1N33 I;  3CWV A;  2UUB I;  4NXM I;  4DV2 I;  4MYT A;  2ZBK B;  3QT8 A;  4JG4 A;  4DPU A;  1KVK A;  4X66 E;  1ZXM A;  2UUC I;  4JI1 I;  2DEJ A;  4DV3 E;  1KKH A;  3B82 A;  4DV1 I;  4DV7 I;  5IT9 Q;  3QT6 A;  2X7I A;  2ZIT A;  4X65 I;  4JI5 I;  2UXC E;  4LFC I;  4JI7 E;  1NZ0 A;  3LPS A;  1Z0V A;  1Z0E A;  1D6T A;  4FWH A;  4JI3 I;  3H4L A;  4JI4 I;  4DUY E;  4LFA E;  4HXZ A;  1FNM A;  1NHH A;  1KTV A;  1FI4 A;  1Z5B A;  4YY3 I;  4B3S E;  4DV5 E;  1IBM E;  3F0N A;  4HY1 A;  3PYG A;  1XNQ E;  3J7A M;  1H73 A;  4I3H A;  1IBL I;  4WUC A;  3J81 Q;  4DPW A;  2ZM6 E;  2VQF E;  1Z0W A;  2VQE I;  1N34 E;  4K0K E;  2UXB E;  4DR6 I;  1HNZ E;  4AQY I;  2HFS A;  4LF5 I;  1U2R A;  4PU9 A;  4FW9 A;  4DR5 I;  2UXD E;  4P7A A;  4DPY A;  1N36 E;  4LF9 E;  2X36 A;  3V5R A;  1Z59 A;  1FJG I;  4FWG A;  3K1J A;  4DR3 E;  4ZVI A;  2NPF A;  1FKA E;  5LMN I;  4KQV A;  1HNX I;  3J81 C;  1WUU A;  3QT7 A;  1XNR I;  4PRX A;  4YHH I;  3T1H I;  2Q2E B;  1FWL A;  2F4V E;  1N32 I;  1I94 E;  4JI8 E;  1MX0 A;  3K17 A;  2HK2 A;  4OX9 I;  4GKJ E;  4DV4 E;  3ZZU A;  3ZKD A;  2UUA I;  1ZM4 A;  4LF6 I;  1XMO E;  4JI0 E;  1MG7 A;  2V34 A;  4FWD A;  1IBK I;  1A6F A;  1EI1 A;  1H72 C;  3T1Y E;  1J5E E;  3OTO E;  4LF7 E;  3V2U C;  2E5L E;  4X64 E;  2V2Z A;  4B3R E;  2BM0 A;  3PYD A;  1ZM3 A;  3HUL A;  4X66 I;  1ELO A;  4DV3 I;  2V2V A;  2VF3 A;  4DV0 E;  2A2D A;  3LNU A;  1XMQ E;  3J80 Q;  1PKP A;  4JI6 E;  2AJ4 A;  4JI2 E;  3JAM Q;  2UXC I;  4JI7 I;  4NXN E;  2V8P A;  4GKK E;  4LF8 E;  1S4E A;  1N0U A;  1EA6 A;  4DUY I;  4LFA I;  5BR8 E;  4DXL A;  2LJP A;  4DUZ E;  5IWA E;  4JV5 E;  1PVG A;  4B3S I;  4DV5 I;  1IBM I;  1NHI A;  1B62 A;  5FLX Q;  1OJ4 A;  4DR2 E;  3J80 C;  1XNQ I;  4DR7 E;  4DR1 E;  2UU9 E;  3ZZ0 A;  2HHH E;  3JAM C;  2ZM6 I;  2VQF I;  2J7K A;  4MYU A;  1N34 I;  4B3T E;  4K0K I;  4LF5 E;  2UXB I;  2BM1 A;  1H74 A;  4PRV A;  1HNZ I;  4JYA E;  1RRE A;  4DR4 E;  1ZM9 A;  1FWK A;  5A2Q Q;  1HNW E;  2UXD I;  4M1K A;  1N36 I;  1B63 A;  2HK3 A;  5LMU E;  4DV6 E;  4X62 E;  4LF9 I;  3WU5 A;  5FLX C;  4KHP E;  1Z0C A;  4DR3 I;  4P52 A;  2GS8 A;  4DU8 A;  2R3V A;  1HR0 E;  2A2C A;  1VIS A;  4B3M I;  1N0V C;  4LF4 E;  3ZZT A;  1ZXN A;  1ZM2 A;  3J7A G;  1RR9 A;  1UEK A;  4LFB E;  2F4V I;  1N33 E;  2UUB E;  1I94 I;  4JI8 I;  5A2Q C;  4WUD A;  4NXM E;  4DV2 E;  4GKJ I;  4DV4 I;  3B78 A;  4DPT A;  4UT4 A;  2HKE A;  1XMO I;  4JI0 I;  2UUC E;  4JI1 E;  3T1Y I;  4DV1 E;  1J5E I;  3OTO I;  2V2Q A;  4LF7 I;  2E5L I;  2DEI A;  4RPF A;  4X64 I;  4URL A;  4DV7 E;  4B3R I;  3ZKB A;  4X65 E;  4JI5 E;  4LFC E;  3Q1Q A;  3M6A A;  3B8H A;  4DV0 I;  1Z0G A;  4WUB A;  1DAR A;  4JI3 E;  5GME A;  1XMQ I;  4JI6 I; 
#chains in the Genus database with same CATH topology
 1USV A;  4EMD A;  5JEA F;  4JI4 E;  1H7S A;  4JI2 I;  3K85 A;  4NXN I;  4GKK I;  5GMD A;  4LF8 I;  1BKN A;  1KIJ A;  4YY3 E;  4HYM A;  2BV3 A;  2Z5C A;  1MU5 A;  3GON A;  3WU6 A;  2C38 A;  5BR8 I;  1UDO A;  3GCM A;  3GME A;  3L7Z A;  3U1Y A;  4DUZ I;  1IBL E;  3P76 A;  3L7Z B;  4XTJ A;  5LL6 R;  5IWA I;  4HAC A;  4JV5 I;  2EFG A;  4HAC B;  3PYF A;  4OO1 A;  2VQE E;  4DR2 I;  4OO1 B;  5IT9 C;  1Z0T A;  2JT2 A;  3PYE A;  4DR6 E;  4AQY E;  4DR7 I;  4DR1 I;  5DNX A;  2CZ9 A;  5JEA A;  2O3Z A;  4BA2 B;  1S16 A;  5JEA B;  2UU9 I;  4BA1 A;  2HHH I;  4OO1 C;  2HFU A;  4DR5 E;  1PIE A;  4BA1 B;  4DU7 A;  4J3D A;  4IFD B;  2WP8 A;  4USK A;  4B3T I;  2WP8 B;  1QZR A;  1NHJ A;  5L3J A;  1Z0B A;  1XHK A;  4JYA I;  3QT5 A;  2F1D A;  3HKM A;  5DRO A;  4ED4 A;  4IFD C;  1FJG E;  4DR4 I;  2HKJ A;  1K47 A;  3D4J A;  3WU3 A;  5LMN E;  2E1R A;  1HNX E;  1HNW I;  3WU4 A;  4R1F A;  1Z5A A;  4FW7 A;  5LMU I;  4Z7C A;  2OI2 A;  4DV6 I;  4X62 I;  2C39 A;  1XNR E;  3HJC A;  1RHY A;  4IFD D;  1H7U A;  4KHP I;  3ZM7 A;  4YHH E;  3T1H E;  2XEX A;  4B3M E;  3PS2 A;  2R42 A;  2WW4 A;  1HR0 I;  5K36 C;  4USM A;  1N32 E;  1OYP A;  1Z5C A;  4DPX A;  5K36 E;  4OX9 E;  4LF4 I;  4FN5 A;  4MDT A;  2UUA E;  4LF6 E;  1Y6Z A;  2Z5E A;  4Z7Y A;  3LTO A;  4UTG A;  2PO0 A;  1IBK E;  4LFB I;  5K36 D;  1N33 I;  3CWV A;  2UUB I;  1HK7 A;  2C37 A;  4NXM I;  4DV2 I;  1UDS A;  4MYT A;  2ZBK B;  3QT8 A;  4MU1 A;  4JG4 A;  4DPU A;  1KVK A;  3U1K A;  4X66 E;  2NN6 A;  2J65 A;  1ZXM A;  2UUC I;  5DRP A;  2DEJ A;  4JI1 I;  4DV3 E;  1KKH A;  2JEB A;  3B82 A;  1OYS A;  4DV1 I;  5C0X C;  4DV7 I;  5C0X E;  5IT9 Q;  3QT6 A;  2AE8 A;  2X7I A;  2ZIT A;  3NZK A;  4U3D A;  4FW4 A;  4X65 I;  4JI5 I;  2UXC E;  4LFC I;  4JI7 E;  1NZ0 A;  3LPS A;  4OKG A;  4IFD F;  1Z0V A;  5C0X D;  4LOM A;  1Z0E A;  3Q6N A;  4FWH A;  4JI3 I;  1D6T A;  3H4L A;  1Y60 A;  4MU0 A;  4DUY E;  4JI4 I;  4LFA E;  4HXZ A;  2CGE A;  4U3B A;  3DD6 A;  1FNM A;  1NHH A;  3H1C A;  1KTV A;  1FI4 A;  1Z5B A;  4YY3 I;  4B3S E;  3P3E A;  4DV5 E;  2BR2 B;  1IBM E;  3F0N A;  4HY1 A;  5K36 F;  4JI6 I;  3PYG A;  1XNQ E;  2IES A;  3J7A M;  1H73 A;  4IZK A;  4FW3 A;  2JEA B;  4I3H A;  4IZK B;  1IBL I;  4BA2 A;  4WUC A;  3J81 Q;  2WNR B;  1Y4U A;  4DPW A;  2ZM6 E;  2VQF E;  1R6L A;  1Z0W A;  2VQE I;  1N34 E;  4K0K E;  4IFD A;  4LPF A;  1P42 A;  2UXB E;  4DR6 I;  1HNZ E;  4AQY I;  3P3G A;  3Q6M A;  2HFS A;  4LF5 I;  4IZJ B;  1U2R A;  4PU9 A;  4FW9 A;  4DR5 I;  4AM3 A;  2UXD E;  4P7A A;  4DPY A;  1N36 E;  4LF9 E;  2X36 A;  3V5R A;  4GQU A;  3PS1 A;  5C0X F;  4ISA A;  1Z59 A;  1FJG I;  4FWG A;  3K1J A;  4DR3 E;  5K36 A;  5DRQ A;  4ZVI A;  1R6M A;  2NPF A;  5K36 B;  5DRR A;  1FKA E;  5LMN I;  4KQV A;  1HNX I;  2PNZ A;  2PNZ B;  4IZJ D;  3J81 C;  2PO1 A;  1WUU A;  3QT7 A;  2PO1 B;  4MU4 A;  1XNR I;  2BA1 G;  4QNK A;  4QNJ A;  4PRX A;  4LCF A;  4YHH I;  3T1H I;  1XXE A;  2GO3 A;  2Q2E B;  1FWL A;  2F4V E;  1N32 I;  1I94 E;  4JI8 E;  1MX0 A;  3GLL A;  2O1U A;  2HK2 A;  3K17 A;  4OX9 I;  4AID A;  4GKJ E;  4NBQ A;  4DV4 E;  3ZZU A;  3ZKD A;  2UUA I;  1ZM4 A;  4LF6 I;  2BA1 D;  1USU A;  1XMO E;  4JI0 E;  1MG7 A;  2V34 A;  4FWD A;  1IBK I;  1A6F A;  1EI1 A;  5C0X A;  1H72 C;  3P3C A;  3T1Y E;  4MQY A;  5C0X B;  5EKW A;  1J5E E;  3OTO E;  4LF7 E;  2PNL A;  3V2U C;  2E5L E;  4X64 E;  2V2Z A;  4B3R E;  2O1T A;  2BM0 A;  3PYD A;  1ZM3 A;  3HUL A;  2Z5B B;  5FWK A;  4X66 I;  3CDI A;  1ELO A;  4DV3 I;  2V2V A;  2PO2 B;  2VF3 A;  4FW6 A;  4DV0 E;  2A2D A;  3LNU A;  1XMQ E;  3J80 Q;  1PKP A;  4JI6 E;  1Y4S A;  2AJ4 A;  4JI2 E;  3JAM Q;  2UXC I;  4JI7 I;  4NXN E;  2V8P A;  4GKK E;  2NN6 E;  1Y5Y A;  3B4T A;  4LF8 E;  4FW5 A;  1S4E A;  2IER A;  2JE6 A;  1YHC A;  1N0U A;  2JE6 B;  2BR2 A;  1EA6 A;  4DUY I;  4LFA I;  5BR8 E;  5DNL A;  2NN6 D;  4DXL A;  2LJP A;  4DUZ E;  2JEA A;  5IWA E;  4JV5 E;  2BA0 G;  1PVG A;  2WNR A;  4B3S I;  2Z5C B;  2IOP A;  4DV5 I;  1IBM I;  1E3H A;  1NHI A;  1B62 A;  5FLX Q;  1OJ4 A;  2C38 B;  4DR2 E;  3J80 C;  1XNQ I;  4DR7 E;  4DR1 E;  4JI3 E;  2UU9 E;  3ZZ0 A;  2HHH E;  4IZJ A;  3JAM C;  2ZM6 I;  2VQF I;  2J7K A;  4MYU A;  1OYR A;  2BA0 D;  2GQ0 A;  1N34 I;  4B3T E;  4K0K I;  4LF5 E;  3M7N G;  2UXB I;  2BM1 A;  4MU3 A;  1H74 A;  4PRV A;  1HNZ I;  4JYA E;  2GO4 A;  1RRE A;  4DR4 E;  4OO1 E;  1ZM9 A;  1FWK A;  5A2Q Q;  5JEA C;  1HNW E;  3M85 G;  2UXD I;  1UDN A;  3P06 A;  5ELW A;  4M1K A;  5JEA E;  1N36 I;  1B63 A;  2HK3 A;  5LMU E;  4DV6 E;  4X62 E;  4LF9 I;  3WU5 A;  4OO1 D;  5FLX C;  4IFD E;  3M7N D;  4KHP E;  1Z0C A;  4DR3 I;  5JEA D;  4P52 A;  2GS8 A;  4DU8 A;  2R3V A;  1HR0 E;  2A2C A;  1VIS A;  5EL9 A;  4B3M I;  2NN6 F;  2C39 B;  3M85 D;  1N0V C;  4LF4 E;  4OZE A;  3ZZT A;  1ZXN A;  3UHM A;  1ZM2 A;  3J7A G;  1RR9 A;  2IOQ A;  1UEK A;  2O1V A;  4LFB E;  2F4V I;  3PS3 A;  1N33 E;  2CVE A;  2UUB E;  1I94 I;  4JI8 I;  5A2Q C;  3PRY A;  4WUD A;  4NXM E;  4DV2 E;  4GKJ I;  4LCG A;  4DV4 I;  3B78 A;  4DPT A;  2PO0 B;  4UT4 A;  2HKE A;  1VI7 A;  1XMO I;  4JI0 I;  4LCH A;  2UUC E;  2Z5B A;  4JI1 E;  3T1Y I;  2PNM A;  4DV1 E;  2C37 B;  1J5E I;  3OTO I;  2PO2 A;  2V2Q A;  3KRN A;  4LF7 I;  4N3O A;  2E5L I;  1E3P A;  2DEI A;  4RPF A;  4X64 I;  4URL A;  4DV7 E;  4B3R I;  2VES A;  2NN6 B;  3ZKB A;  1YH8 A;  4X65 E;  4JI5 E;  2JEB B;  2O1W A;  4LFC E;  3Q1Q A;  3M6A A;  3B8H A;  4OO1 F;  4IS9 A;  2NN6 C;  4DV0 I;  1Z0G A;  3CDJ A;  4WUB A;  1DAR A;  4AIM A;  5GME A;  1XMQ I;  2CG9 A;  1UDQ A; 
#chains in the Genus database with same CATH homology
 1USV A;  4EMD A;  4JI4 E;  1H7S A;  4JI2 I;  3K85 A;  4NXN I;  4GKK I;  5GMD A;  4LF8 I;  1BKN A;  1KIJ A;  4YY3 E;  4HYM A;  2BV3 A;  2Z5C A;  1MU5 A;  3GON A;  3WU6 A;  5BR8 I;  4DUZ I;  1IBL E;  4XTJ A;  5LL6 R;  5IWA I;  4HAC A;  4JV5 I;  2EFG A;  4HAC B;  3PYF A;  2VQE E;  4DR2 I;  5IT9 C;  1Z0T A;  3PYE A;  4DR6 E;  4AQY E;  4DR7 I;  4DR1 I;  2CZ9 A;  1S16 A;  2UU9 I;  2HHH I;  2HFU A;  4DR5 E;  1PIE A;  4DU7 A;  4USK A;  4B3T I;  1QZR A;  1NHJ A;  5L3J A;  1Z0B A;  1XHK A;  4JYA I;  3QT5 A;  4ED4 A;  1FJG E;  4DR4 I;  2HKJ A;  1K47 A;  3D4J A;  3WU3 A;  5LMN E;  2E1R A;  1HNX E;  1HNW I;  3WU4 A;  4R1F A;  1Z5A A;  5LMU I;  4Z7C A;  2OI2 A;  4DV6 I;  4X62 I;  1XNR E;  3HJC A;  1H7U A;  4KHP I;  3ZM7 A;  4YHH E;  3T1H E;  2XEX A;  4B3M E;  2R42 A;  2WW4 A;  1HR0 I;  4USM A;  1N32 E;  1Z5C A;  4DPX A;  4OX9 E;  4LF4 I;  4FN5 A;  2UUA E;  4LF6 E;  1Y6Z A;  2Z5E A;  4Z7Y A;  3LTO A;  4UTG A;  1IBK E;  4LFB I;  1N33 I;  3CWV A;  2UUB I;  1HK7 A;  4NXM I;  4DV2 I;  4MYT A;  2ZBK B;  3QT8 A;  4JG4 A;  4DPU A;  1KVK A;  4X66 E;  1ZXM A;  2UUC I;  4JI1 I;  2DEJ A;  4DV3 E;  1KKH A;  3B82 A;  4DV1 I;  4DV7 I;  5IT9 Q;  3QT6 A;  2X7I A;  2ZIT A;  4X65 I;  4JI5 I;  2UXC E;  4LFC I;  4JI7 E;  1NZ0 A;  3LPS A;  1Z0V A;  1Z0E A;  3Q6N A;  4FWH A;  4JI3 I;  1D6T A;  3H4L A;  4JI4 I;  4DUY E;  4LFA E;  4HXZ A;  2CGE A;  1FNM A;  1NHH A;  1KTV A;  1FI4 A;  1Z5B A;  4YY3 I;  4B3S E;  4DV5 E;  1IBM E;  3F0N A;  4HY1 A;  4JI6 I;  3PYG A;  1XNQ E;  3J7A M;  1H73 A;  4IZK A;  4I3H A;  4IZK B;  1IBL I;  4WUC A;  3J81 Q;  1Y4U A;  4DPW A;  2ZM6 E;  2VQF E;  1Z0W A;  2VQE I;  1N34 E;  4K0K E;  2UXB E;  4DR6 I;  1HNZ E;  4AQY I;  2HFS A;  3Q6M A;  4LF5 I;  4IZJ B;  1U2R A;  4PU9 A;  4FW9 A;  4DR5 I;  2UXD E;  4P7A A;  4DPY A;  1N36 E;  4LF9 E;  2X36 A;  3V5R A;  1Z59 A;  1FJG I;  4FWG A;  3K1J A;  4DR3 E;  4ZVI A;  2NPF A;  1FKA E;  5LMN I;  4KQV A;  1HNX I;  4IZJ D;  3J81 C;  1WUU A;  3QT7 A;  1XNR I;  4PRX A;  4YHH I;  3T1H I;  2Q2E B;  1FWL A;  2F4V E;  1N32 I;  1I94 E;  4JI8 E;  1MX0 A;  2O1U A;  2HK2 A;  3K17 A;  4OX9 I;  4GKJ E;  4DV4 E;  3ZZU A;  3ZKD A;  2UUA I;  1ZM4 A;  4LF6 I;  1USU A;  1XMO E;  4JI0 E;  1MG7 A;  2V34 A;  4FWD A;  1IBK I;  1A6F A;  1EI1 A;  1H72 C;  3T1Y E;  1J5E E;  3OTO E;  4LF7 E;  2PNL A;  3V2U C;  2E5L E;  4X64 E;  2V2Z A;  4B3R E;  2O1T A;  2BM0 A;  3PYD A;  1ZM3 A;  3HUL A;  2Z5B B;  5FWK A;  4X66 I;  1ELO A;  4DV3 I;  2V2V A;  2VF3 A;  4DV0 E;  2A2D A;  3LNU A;  1XMQ E;  3J80 Q;  1PKP A;  4JI6 E;  1Y4S A;  2AJ4 A;  4JI2 E;  3JAM Q;  2UXC I;  4JI7 I;  4NXN E;  2V8P A;  4GKK E;  4LF8 E;  1S4E A;  1N0U A;  1EA6 A;  4DUY I;  4LFA I;  5BR8 E;  4DXL A;  2LJP A;  4DUZ E;  5IWA E;  4JV5 E;  1PVG A;  4B3S I;  2Z5C B;  2IOP A;  4DV5 I;  1IBM I;  1NHI A;  1B62 A;  5FLX Q;  1OJ4 A;  4DR2 E;  3J80 C;  1XNQ I;  4DR7 E;  4DR1 E;  2UU9 E;  3ZZ0 A;  2HHH E;  4IZJ A;  3JAM C;  2ZM6 I;  2VQF I;  2J7K A;  4MYU A;  2GQ0 A;  1N34 I;  4B3T E;  4K0K I;  4LF5 E;  2UXB I;  2BM1 A;  1H74 A;  4PRV A;  1HNZ I;  4JYA E;  1RRE A;  4DR4 E;  1ZM9 A;  1FWK A;  5A2Q Q;  1HNW E;  2UXD I;  3P06 A;  4M1K A;  1N36 I;  1B63 A;  2HK3 A;  5LMU E;  4DV6 E;  4X62 E;  4LF9 I;  3WU5 A;  5FLX C;  4KHP E;  1Z0C A;  4DR3 I;  4P52 A;  2GS8 A;  4DU8 A;  2R3V A;  1HR0 E;  2A2C A;  1VIS A;  4B3M I;  1N0V C;  4LF4 E;  3ZZT A;  1ZXN A;  1ZM2 A;  3J7A G;  1RR9 A;  2IOQ A;  1UEK A;  2O1V A;  4LFB E;  2F4V I;  1N33 E;  2UUB E;  1I94 I;  4JI8 I;  5A2Q C;  3PRY A;  4WUD A;  4NXM E;  4DV2 E;  4GKJ I;  4DV4 I;  3B78 A;  4DPT A;  4UT4 A;  2HKE A;  1XMO I;  4JI0 I;  2UUC E;  2Z5B A;  4JI1 E;  3T1Y I;  2PNM A;  4DV1 E;  1J5E I;  3OTO I;  2V2Q A;  4LF7 I;  4N3O A;  2E5L I;  2DEI A;  4RPF A;  4X64 I;  4URL A;  4DV7 E;  4B3R I;  3ZKB A;  4X65 E;  4JI5 E;  2O1W A;  4LFC E;  3Q1Q A;  3M6A A;  3B8H A;  4DV0 I;  1Z0G A;  4WUB A;  1DAR A;  4JI3 E;  5GME A;  1XMQ I;  2CG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...