4NXME

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4nxmE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxmE02
4URLA 2F4VI 4M30A 1N0VC 2HK3A 4DR5E 2UU9E 4LFBE 4JI8I 4GKKE 4OX9E 1UILA 1Z5BA 2AJ4A 4JI4E 2R42A 4DR3E 3PYFA 5IT9C 4P7AA 4DR4I 3VYXA 1BKNA 2LUQA 4X62I 4KHPI 4B3TI 5IWAI 2DEJA 4X66E 2L3JA 3LPSA 4WUBA 1Z0VA 2Q2EB 1EA6A 1HR0I 4DV7I 1RREA 4JI1I 3ZZ0A 2LBSB 4DPUA 4JI2E 1HNWI 4DPWA 1KIJA 2XEXA 2E5LE 4LF4I 1IBLE 1N33E 2LJHA 1MU5A 2B3TB 2HKJA 1D6TA 1QU6A 2BV3A 1IBMI 4DR2I 1PKPA 1IBKE 4JI0E 1N0UA 2X7IA 3PYGA 2UUAE 4K0KE 3J81C 2NPFA 2UXCI 4PRXA 2UXBE 4LF5I 4LF9E 4JI5I 3J7AG 2LJPA 3PYEA 4LFCE 4MYUA 4DV1I 3D4JA 1KVKA 2HHHI 2OI2A 1N34E 1FWLA 2B7TA 4DV6I 1EKZA 2V8PA 1HNXE 2BM0A 1S16A 4X65I 4DV4I 1H72C 1A6FA 2MDRA 2L33A 1WHNA 2LUPB 4HXZA 1N36E 2L2NA 4USKA 3HTXA 3B82A 3H4LA 4I3HA 3ZKDA 5BR8E 3LTOA 4Z7CA 3K1JA 1Z0CA 5LMUE 4JV5I 1YYOA 1U2RA 2V2QA 4LF6E 5FLXC 4LF7E 1K47A 4DXLA 1XMQI 2VF3A 4JYAE 2J7KA 2A2CA 3Q1QA 2RSMA 2L2MA 4X64I 2VQFE 2EFGA 4NXNE 1T4OA 4WUDA 3LLHA 4WYQB 5GMDA 5LMUI 2GS8A 4DUYE 4DR5I 2UU9I 4GKJI 3VYYA 4LFBI 4LFAI 4GKKI 4OX9I 1N32I 4DKKA 4DPTA 1RC7A 4DUZE 4JI4I 1X48A 3OTOE 3CWVA 1T4NA 2CPNA 1Z5AA 1GQEA 1OJ4A 3V2UC 5A2QC 4JI6E 3F0NA 3J80C 1UHZA 3JAMC 4B3RE 4X66I 2F4VE 4FWGA 1YYKA 3ADJA 3QT5A 4ED4A 4JI8E 2DEIA 4B3SE 1RQ0A 2UUCE 3GONA 4JI2I 3ADLA 4DR4E 2VQEE 2LRSA 4LF8E 4YHHI 2L3CA 4PU9A 1MG7A 1YZ9A 4DR1I 3T1HE 2E5LI 2UXDE 2N3HA 1IBLI 2NUEA 1Z0GA 2HFSA 4MYTA 4HY1A 3V5RA 4JI3E 5IT9Q 5L3JA 1J26A 1EI1A 1N33I 2ZM6I 5A2QQ 2HFUA 1HR0E 4DV5E 1NHHA 4FWDA 2UUAI 4K0KI 1H7UA 2LTSA 3J7Yp 1FWKA 1Z59A 2UXBI 2DIXA 4NXME 4LF4E 2HKEA 4LF9I 1ZM4A 1XNRI 4LFCI 4Z7YA 2X36A 2RS6A 4DU7A 1N34I 1IBME 2B7VA 1HNXI 2N3GA 1RR9A 4B3ME 2E1RA 1XNQE 4LF5E 3T1YE 1ZM2A 2HK2A 4JI5E 1N36I 5GMEA 1MX0A 2ZITA 1FJGE 2UUBI 4JI7E 4YY3I 1ZXNA 4DV3I 3J81Q 3WU6A 1QZRA 2L2KB 1HNZE 4DV0E 2NA2A 4UT4A 4X65E 4LF6I 1VISA 2V2ZA 1J5EE 3WU4A 1FKAE 4JYAI 2V2VA 2CZ9A 4DV2E 1XMOE 1YYWA 4NXNI 3K17A 4JG4A 2NUFA 3WU5A 4DR6E 2NUGA 4DR7E 4DUYI 3M6AA 1O0WA 1ELOA 4ZVIA 4AQYE 3PYDA 1FI4A 3B78A 4DR3I 1T4LB 1S4EA 4RPFA 4HACB 4OOGC 5LMNE 1I94E 3P1XA 4B3RI 2JY9A 5LL6R 1B63A 4DU8A 5FLXQ 2IHR1 1XHKA 2JVAA 4GKJE 1NHJA 5CFFE 4LFAE 1N32E 2R3VA 4B3SI 1STUA 2UUCI 1ZBTA 2VQEI 3WU3A 1WUUA 4LF8I 4R1FA 4X62E 3T1HI 2KHXA 2UXDI 4HACA 4KHPE 2BM1A 4B3TE 2DMYA 5IWAE 1UEKA 4JI3I 4FN5A 3QT7A 1KKHA 3QT8A 3J80Q 3JAMQ 4DPXA 4DV7E 4DPYA 4DV5I 2EZ6A 1ZM3A 4JI1E 2WW4A 1DI2A 3ZM7A 1IBKI 1KTVA 4JI0I 1NZ0A 1HNWE 4YHHE 4HYMA 4DR1E 1DARA 4NXMI 1ZM9A 4X8WA 4WFTA 3J7AM 1B62A 4FW9A 3C4BA 2ZM6E 2RTXA 2V34A 1NHIA 2DB2A 2LTRA 1Z0EA 1PIEA 4M1KA 4DR2E 4B3MI 3B8HA 1H74A 1ZXMA 1XNQI 2UXCE 3T1YI 1FNMA 3QT6A 1Z5CA 1XNRE 1FJGI 1X47A 2ZBKB 4JI7I 4DV1E 3C4TA 4KQVA 5BR8I 2HHHE 1H73A 4EMDA 4DV6E 3ZZUA 1HNZI 4DV0I 4USMA 4M2ZA 4DV4E 1Z0WA 3HULA 3ZZTA 1J5EI 4LF7I 1WHQA 4FWHA 2RS7A 4WUCA 2UUBE 4YY3E 4DV2I 1X49A 1XMOI 2VQFI 3ADGA 4DV3E 4DR6I 2YT4A 3ZKBA 4XTJA 4DR7I 1PVGA 4JV5E 4AQYI 4DUZI 3OTOI 1XMQE 5LMNI 4P52A 1H7SA 4JI6I 4X64E 4PRVA 1I94I 1Z0BA 2A2DA 4UTGA 3ADIA 3LNUA 1Z0TA
chains in the Genus database with same CATH superfamily
1UN6B 4URLA 2EMKA 4M30A 2F4VI 1N0VC 2HK3A 4DR5E 2EN7A 2UU9E 4LFBE 2EM9A 4JI8I 2JEAB 4GKKE 2JE6A 4OX9E 1UILA 1Z5BA 1Y4SA 2AJ4A 4OO1E 2NN6A 2EN2A 4JI4E 2R42A 4DR3E 4X9JA 4BMJA 5IT9C 4O5GA 1UDSA 3PYFA 4P7AA 1BBGA 1WJPA 3VYXA 4DR4I 2K4VA 2CG9A 3KWRA 2LO3A 4IZKA 3AV0A 1BKNA 3TQMA 2LUQA 5A6JA 1OYRA 4X62I 3L00A 2YTQA 3OMLA 5AE2A 2ELZA 4MLQA 3Q6MA 4KHPI 2M1SA 4B3TI 5IWAI 2DEJA 4MU1A 3EPHA 4X66E 1ZAAC 4IS1C 4WXDA 5IV8B 2L3JA 3LPSA 5C0XD 1LLMC 1YHCA 5DROA 2BA1G 3UK3C 4WUBA 2EOIA 4FW4A 2YSOA 2EMCA 1RMDA 1Z0VA 2Q2EB 2EMLA 1EA6A 4BA1B 4R2CA 4BHCA 4MQYA 2PNZB 1RREA 4DV7I 1HR0I 4JI1I 2EOQA 3ZZ0A 2LBSB 4DPUA 4JI2E 5K36C 3F6HA 5A6KA 2JEAA 1VI7A 5DNYA 4DPWA 1HNWI 2DLKA 4ZYDA 1KIJA 2MKDA 4BC9A 4TUGA 5AC4A 3AUZA 2XEXA 2E5LE 2FGGA 4LF4I 1IBLE 1X6FA 2LJUA 4L8NA 2EMGA 5KL2A 4L5NC 1N33E 2LJHA 2LMZA 4FK5C 1MU5A 2B3TB 1N3GA 3HQ1A 2EL6A 4KWYA 2O1VA 4GQUA 4MU0A 2HKJA 1D6TA 1QU6A 2BV3A 3GCMA 2L6MA 3LNUA 1IBMI 1TF6A 2EPPA 4DR2I 1PKPA 2GHFA 1IBKE 2WP8A 4JI0E 3P76A 1PDAA 1N0UA 2X7IA 3PYGA 4BA1A 2UUAE 4K0KE 2PNZA 1G2DC 3J81C 1SFEA 5AE3A 1YUJA 2I13A 2YTEA 4PRXA 2YSPA 2NPFA 2UXBE 4N4RB 2UXCI 4MDTA 3MHSC 4LF5I 1P42A 4FW7A 2O1WA 4LF9E 3J7AG 4JI5I 3H09A 4KZSA 2LJPA 1B69A 1A1JA 3PYEA 1MGTA 2H36X 4HEIA 4LFCE 5ADZA 1HK7A 4MYUA 4QNKA 4BCAA 4DV1I 3D4JA 1WRJA 1KVKA 5JEAC 3C6KA 1WXRA 2HHHI 1X6HA 2OI2A 1N34E 4R2QA 1FWLA 2B7TA 2Z5CB 1EKZA 4DV6I 3M7NG 3KZZA 4J8ZA 2V8PA 3FIGA 1Y60A 2JWOA 4O43A 2ENHA 1A1LA 2EQ1A 1HNXE 2CVEA 4R03A 2JP9A 2FV4B 2BM0A 1S16A 4X65I 4DV4I 4HTGA 2EE8A 1H72C 1A6FA 2MDRA 2L33A 1WHNA 4ZYEA 2EM3A 2LUPB 4HXZA 1N36E 2L2NA 1DGCA 2YTPA 2C38B 4USKA 3HTXA 2Q8UA 3B82A 1NEIA 4LFBI 2EP3A 4LTYA 1UDNA 2WNRB 3H4LA 4I8OA 3H1CA 3PS3A 4I3HA 2YTNA 2ENCA 2RQLA 5BR8E 3ZKDA 4OO1C 2JPAA 3LTOA 5EL9A 4F54A 4Z7CA 5JEAA 3K1JA 2D9HA 1Z0CA 2EPMX 2EM5A 3U1YA 2VESA 2E72A 3CDJA 2IOQA 4JV5I 3EPLA 2EMFA 1YYOA 2NN6D 4F9CB 1U2RA 2V2QA 3HXLA 2EPLX 5FLXC 4LF6E 4LF7E 1K47A 4P7DA 1X3CA 1X6EA 1YUIA 4DXLA 1XMQI 2VF3A 3GLLA 4JYAE 2J7KA 2EMWA 3MHHC 1GTKA 2A2CA 4IFDF 3Q1QA 2RSMA 4IZJD 2L2MA 4X64I 3IWBA 2VQFE 5A6AA 2JR1A 1Z1BA 2EFGA 3PS2A 2EMYA 4GZNC 4NXNE 4BBYA 1R6MA 1T4OA 2C38A 4WUDA 3U1KA 3LLHA 4WYQB 5GMDA 2YTDA 5LMUI 1A1KA 2GS8A 2EOOA 3HKMA 4LU9A 4WXCA 2WNRA 3P3CA 3UHMA 2YRMA 3BGHA 4DUYE 4DR5I 2VE7C 3VYYA 2VF1A 2VRDA 1E3HA 2UU9I 4LFAI 4OX9I 4GKKI 1N32I 5DNLA 4DKKA 4DPTA 1RC7A 4DUZE 4JI4I 1X48A 3OTOE 3CWVA 2EN8A 3VK6A 2F8BA 1T4NA 4F6NA 2CPNA 1Z5AA 4O4KA 1GQEA 5A2QC 1OJ4A 3V2UC 4IFDE 2R1FA 4JI6E 3ZOQB 3F0NA 3J80C 2EPRA 1UHZA 2LE2A 3JAMC 5A69A 1A1GA 2JEBB 5EKWA 4B3RE 2MC5A 2O1UA 2YRHA 4X66I 2EJ4A 2C39A 5A6BA 2EN3A 2WBSA 5DNXA 4LCFA 2F4VE 2F1DA 4BA2B 4FWGA 1YYKA 3ADJA 3QT5A 2EPCA 4ED4A 4JI8E 2DEIA 4AIDA 2ADRA 4B3SE 1RQ0A 2UUCE 3GONA 4JI2I 3ADLA 2M4IA 2EOEA 4DR4E 2EPUA 3HJCA 2VQEE 2WBUA 5K36D 2LRSA 1PJSA 4LF8E 4YHHI 2ELYA 3THNA 2L3CA 1MG7A 4PU9A 2EM0A 3THOB 1YZ9A 4DR1I 1AH5A 3T1HE 3DJWA 2E5LI 2UXDE 2N3HA 1IBLI 4P78A 4TUIA 2NUEA 1Z0GA 3ECRA 2HFSA 4MYTA 4HY1A 3V5RA 4JI3E 3LMLA 4F9AB 1J26A 1EI1A 2JEBA 5L3JA 5IT9Q 2YTJA 1N33I 1R6LA 2ZM6I 5A2QQ 1QNTA 2DRPA 1YPNA 2HFUA 3L7ZB 1HR0E 1P47A 2BA1D 5C0XF 5DRPA 4DV5E 1NHHA 4BA2A 1YFHA 2K7IA 1BB8A 4FWDA 2UUAI 4K0KI 1H7UA 2LTSA 2V86A 3JU0A 4R2AA 2EN1A 3J7Yp 1FWKA 4ISAA 1Z59A 2YWQA 2DIXA 2UXBI 1ZU1A 4NXME 3KZYA 4LF4E 2HKEA 2RPCA 2IESA 1ZM4A 4LF9I 1A1FA 2JOXA 4DV5I 2EPNA 1XNRI 1OYPA 4LFCI 4Z7YA 2YU5A 2X36A 4U3DA 4AIMA 3IWCA 2KONA 2RS6A 4DU7A 2EMHA 1N34I 2EOYA 5JEAD 2YPNA 5C0XE 1IBME 4IS9A 3GMEA 2B7VA 2MC6A 1HNXI 3L7ZA 2N3GA 2GO3A 2YRKA 1RR9A 3QG5C 2I9IA 3C6MA 1X5WA 2V85A 2YTIA 4B3ME 5IXMB 1IMUA 2E1RA 1XNQE 2E1MA 1XXEA 1EH6A 1IQSA 3T1YE 2DLQA 4LF5E 4QNJA 2EMAA 1ZM2A 5K36E 2HK2A 2CSHA 4JI5E 2GO4A 2V89A 4LCHA 5GMEA 1A1HA 1N36I 1BBOA 1MX0A 2ZITA 1AAYA 1E3PA 3K85A 3JTZA 1FJGE 2UUBI 2PO1B 2EWLA 2N8XA 4JI7E 1KJKA 3F6GA 4YY3I 2EM2A 1ZXNA 5ELWA 3J81Q 4DV3I 2GPIA 1Y5YA 4FW6A 2JYAA 4OO1D 3P3GA 3WU6A 2EQ3A 4GEQB 1QZRA 2L2KB 1HNZE 4Q28A 2IERA 4IFDB 4DV0E 2NA2A 2Z5BB 1F2IG 4BS9A 3M7ND 4ZYGA 4UT4A 4X65E 2Z5CA 1PJTA 4LF6I 1VISA 2LT7A 1J5EE 1JK2A 2V2ZA 1FKAE 2EOFA 5KL3A 3WU4A 4JYAI 2V2VA 1UDOA 2CZ9A 4F9BB 4OZEA 4J3DA 4Q35B 2EOHA 2NABA 4R2SA 4DV2E 1XMOE 4LOMA 2EOZA 1YYWA 4NXNI 3K17A 2EL4A 4WSPA 4JG4A 4MLVA 5T6JA 5A6BD 2LVHA 2NUFA 3WU5A 2PO1A 4DR6E 2L8TA 2EORA 2CTDA 4NBQA 2HC5A 2NUGA 4AM3A 4DR7E 2HJJA 3M6AA 1O0WA 2R76A 2WBTA 5FWKA 4DUYI 2PRTA 1ELOA 4ZVIA 4ZYHA 4AQYE 3PYDA 5KL5A 1FI4A 3B78A 2EMBA 4IFDA 4MU3A 2Z5BA 1T4LB 1S4EA 4RPFA 4IZJB 4DR3I 2G7HA 4HACB 4OOGC 2NN6F 5LMNE 2YZTA 5KL4A 2EQ0A 5KL6A 1EH7A 2V87A 2YTFA 1MEYC 2BR2B 4NZVA 2O1TA 3DD6A 4MU4A 1I94E 3P1XA 4B3RI 2JY9A 2ODRC 5LL6R 2PNMA 2ODRD 2EM6A 1B63A 4DU8A 2EPKX 5FLXQ 3M85G 2IHR1 1XHKA 1JK1A 2JVAA 2EN4A 5KL7A 4LPFA 3IWDA 4GKJE 1NHJA 2EPAA 5CFFE 4RHBB 2KOUA 1PJQA 5DRRA 4LFAE 1N32E 2A25A 2R3VA 4B3SI 1STUA 3PRYA 2B9DA 2EPOA 2UUCI 2YTOA 3RMPA 2O3ZA 4IJDA 1ZBTA 2VQEI 3WU3A 1T38A 3DF6A 2J65A 3HPZA 1WUUA 2NN6E 4R1FA 4LF8I 2EPXA 2BB8A 2CT1A 4O24A 4X62E 5LLQA 4IZJA 3T1HI 2KHXA 1NCSA 2WZOA 2UXDI 4HACA 1GZ6A 4KHPE 2BM1A 3P06A 5C0XB 4B3TE 2DMYA 2EM4A 2FTXB 5IWAE 1UEKA 5C0XC 2BR2A 4JI3I 1G2FC 3M85D 4FN5A 2WP8B 2V83A 2M9AA 3QT7A 1KKHA 2PNLA 3QT8A 4LCGA 4BHBA 3JAMQ 2LCEA 3J80Q 4DPXA 4DV7E 2BA0G 4DPYA 2J7JA 2EZ6A 4JI1E 1IQOA 1DI2A 1ZM3A 2WW4A 4GKJI 3ZM7A 1IBKI 1KTVA 4JI0I 3KRNA 1NZ0A 1HNWE 4YHHE 3B4TA 2MDGA 4HYMA 4DR1E 1DARA 4NXMI 1ZM9A 1ZR9A 2L92A 4N3OA 5K36F 3VHTB 2EMIA 4X8WA 2C37B 3M99B 4WFTA 3J7AM 2Z5EA 1B62A 4FW9A 2JXPA 1TF3A 3C4BA 2DSYA 5C0XA 2ZM6E 1OYSA 2HGHA 2RTXA 4U3BA 2V88A 3EPJA 2V34A 1NHIA 2PO0B 2DB2A 3BBGA 3EQ1A 3K6QA 2LTRA 5AC5A 1Z0EA 1PIEA 4M1KA 2YTGA 1A1IA 4DR2E 2CGEA 2BA0D 1TN9A 1L4SA 5K36A 4B3MI 3B8HA 4R2DA 3BF2A 3BIDA 1H74A 2DMIA 1ZXMA 1XNQI 1T39A 2UXCE 2EN6A 3T1YI 2AE8A 2JT2A 2PO2B 2EM8A 4R2EA 1FNMA 3QT6A 2MKNA 1Z5CA 4NHRA 1XNRE 1FJGI 1USVA 1X47A 2ZBKB 5JEAB 4JI7I 4DV1E 2EOXA 1YH8A 4OKGA 2C37A 5DRQA 3PS1A 3C4TA 4KQVA 1Y4UA 2HHHE 5BR8I 1KYQA 1H73A 4EMDA 4R2RA 4DV6E 3ZZUA 2EL5A 1HNZI 2EM7A 3CDIA 4FW5A 4DV0I 2PO0A 4F6MA 4USMA 5JEAF 4IFDC 4M2ZA 4DV4E 1EH8A 2EOSA 4IFDD 2EPZA 1Z0WA 3HULA 3ZZTA 1J5EI 4LF7I 1WHQA 2M7QA 2DGCA 4R2PA 2LV2A 2V8QB 3EPKA 1DQ3A 5F3WA 4FWHA 2RS7A 4WUCA 4RH8A 5TSEA 1ZBQA 5AASA 2UUBE 2PO2A 4YY3E 4DV2I 1X49A 1XMOI 2EMZA 2EOJA 2VQFI 4OO1B 2YU8A 4DMIA 3ADGA 4DV3E 4FW3A 3P3EA 4WPYA 2RSIA 1UBDC 2JE6B 4DR6I 4R8OA 3Q6NA 2YT4A 3ZKBA 3HPSA 4XTJA 1YSAC 2WCC3 2NN6B 4DR7I 4BC7A 4WX9A 2EOMA 4M9VC 2NN6C 1PVGA 4JV5E 3NZKA 4AQYI 5JEAE 4OO1F 4IZKB 2JOBA 2GLIA 2IOPA 4DUZI 3OTOI 2EMXA 1XMQE 1UDQA 5K36B 5LMNI 4P52A 1H7SA 4JI6I 4WSGA 2C39B 4X64E 4PRVA 1I94I 1Z0BA 5AE1A 2ENAA 1Y6ZA 2A2DA 4F2JC 1USUA 4UTGA 3ADIA 4M0VA 1RHYA 2BBGA 3MSWA 5LMUE 1SR9A 4OO1A 2GQ0A 1Z0TA
chains in the Genus database with same CATH topology
4URLA 2F4VI 4M30A 1N0VC 2HK3A 4DR5E 2UU9E 4LFBE 4JI8I 4GKKE 4OX9E 1UILA 1Z5BA 1Y4SA 2AJ4A 4JI4E 2R42A 4DR3E 5IT9C 4BMJA 3PYFA 4P7AA 4DR4I 3VYXA 2K4VA 2CG9A 3KWRA 4IZKA 3AV0A 1BKNA 2LUQA 4X62I 3OMLA 5AE2A 3Q6MA 4KHPI 2M1SA 4B3TI 5IWAI 2DEJA 4X66E 2L3JA 3LPSA 4WUBA 1Z0VA 2Q2EB 1EA6A 1HR0I 4DV7I 1RREA 4JI1I 3ZZ0A 2LBSB 4DPUA 4JI2E 3F6HA 1HNWI 5DNYA 4DPWA 1KIJA 4BC9A 4TUGA 3AUZA 2XEXA 2E5LE 2FGGA 4LF4I 1IBLE 4L8NA 4L5NC 1N33E 2LJHA 2LMZA 1MU5A 2B3TB 2O1VA 3HQ1A 2HKJA 1D6TA 1QU6A 2BV3A 2L6MA 3LNUA 1IBMI 4DR2I 1PKPA 1IBKE 4JI0E 1N0UA 2X7IA 3PYGA 2UUAE 4K0KE 3J81C 5AE3A 2NPFA 2UXCI 4PRXA 2UXBE 4LF5I 2O1WA 4LF9E 3J7AG 4JI5I 3H09A 4KZSA 2LJPA 3PYEA 2H36X 4LFCE 5ADZA 1HK7A 4MYUA 4DV1I 4BCAA 3D4JA 1KVKA 1WXRA 2HHHI 2OI2A 1N34E 1FWLA 2B7TA 2Z5CB 1EKZA 4DV6I 4J8ZA 2V8PA 3FIGA 2JWOA 1HNXE 4R03A 2FV4B 2BM0A 1S16A 4X65I 4DV4I 1H72C 1A6FA 2MDRA 2L33A 1WHNA 2LUPB 4HXZA 1N36E 2L2NA 4USKA 3HTXA 3B82A 4LTYA 3H4LA 4I8OA 4I3HA 3ZKDA 5BR8E 3LTOA 4Z7CA 4F54A 3K1JA 1Z0CA 2IOQA 4JV5I 1YYOA 4F9CB 1U2RA 2V2QA 3HXLA 5FLXC 4LF6E 4LF7E 1K47A 4P7DA 4DXLA 1XMQI 2VF3A 4JYAE 2J7KA 2A2CA 3Q1QA 2RSMA 4IZJD 2L2MA 4X64I 3IWBA 2VQFE 2JR1A 2EFGA 4NXNE 4BBYA 1T4OA 4WUDA 3LLHA 4WYQB 5GMDA 5LMUI 2GS8A 4LU9A 4DUYE 4DR5I 2UU9I 4GKJI 2VE7C 3VYYA 2VF1A 4LFBI 4LFAI 4GKKI 4OX9I 1N32I 4DKKA 4DPTA 1RC7A 4DUZE 4JI4I 1X48A 3OTOE 3CWVA 3VK6A 2F8BA 1T4NA 2CPNA 1Z5AA 1GQEA 5A2QC 1OJ4A 3V2UC 4JI6E 3ZOQB 3F0NA 3J80C 2LE2A 1UHZA 3JAMC 4B3RE 2MC5A 2O1UA 4X66I 2F4VE 4FWGA 1YYKA 3ADJA 3QT5A 4ED4A 4JI8E 2DEIA 4B3SE 1RQ0A 2UUCE 3GONA 4JI2I 3ADLA 2M4IA 4DR4E 3HJCA 2VQEE 2LRSA 4LF8E 4YHHI 2L3CA 4PU9A 1MG7A 1YZ9A 4DR1I 3T1HE 3DJWA 2E5LI 2UXDE 2N3HA 1IBLI 4P78A 4TUIA 2NUEA 1Z0GA 2HFSA 4MYTA 4HY1A 3V5RA 4JI3E 3LMLA 4F9AB 1J26A 1EI1A 5L3JA 5IT9Q 1N33I 2ZM6I 5A2QQ 2HFUA 1HR0E 4DV5E 1NHHA 4FWDA 2UUAI 4K0KI 1H7UA 2LTSA 2V86A 3JU0A 3J7Yp 1FWKA 1Z59A 2UXBI 2DIXA 4NXME 4LF4E 2HKEA 4LF9I 1ZM4A 2JOXA 1XNRI 4LFCI 4Z7YA 2X36A 3IWCA 2KONA 2RS6A 4DU7A 1N34I 1IBME 2B7VA 2MC6A 1HNXI 2N3GA 1RR9A 4B3ME 2E1RA 2V85A 1XNQE 2E1MA 4LF5E 3T1YE 1ZM2A 2HK2A 4JI5E 1N36I 2V89A 5GMEA 1MX0A 2ZITA 3K85A 3JTZA 1FJGE 2UUBI 2EWLA 4JI7E 4YY3I 3F6GA 1ZXNA 4DV3I 3J81Q 3WU6A 4GEQB 1QZRA 2L2KB 1HNZE 4Q28A 4DV0E 2NA2A 2Z5BB 4BS9A 4UT4A 4X65E 2Z5CA 4LF6I 1VISA 2V2ZA 1J5EE 3WU4A 1FKAE 4JYAI 2V2VA 2CZ9A 4F9BB 4DV2E 1XMOE 1YYWA 4NXNI 3K17A 4WSPA 4JG4A 2NUFA 5T6JA 3WU5A 4DR6E 2L8TA 2NUGA 4DR7E 4DUYI 3M6AA 1O0WA 5FWKA 1ELOA 4ZVIA 4AQYE 3PYDA 1FI4A 3B78A 2Z5BA 1T4LB 1S4EA 4RPFA 4IZJB 4DR3I 2G7HA 4HACB 4OOGC 5LMNE 2YZTA 2V87A 2O1TA 1I94E 3P1XA 4B3RI 2JY9A 2ODRC 5LL6R 2PNMA 2ODRD 1B63A 4DU8A 5FLXQ 2IHR1 1XHKA 2JVAA 3IWDA 4GKJE 1NHJA 5CFFE 2KOUA 4LFAE 1N32E 2R3VA 4B3SI 1STUA 3PRYA 2B9DA 2UUCI 3RMPA 1ZBTA 2VQEI 3WU3A 3DF6A 3HPZA 1WUUA 4LF8I 4R1FA 4X62E 4IZJA 3T1HI 2KHXA 2WZOA 2UXDI 4HACA 1GZ6A 4KHPE 2BM1A 3P06A 4B3TE 2DMYA 5IWAE 2FTXB 1UEKA 4JI3I 4FN5A 2V83A 3QT7A 1KKHA 2PNLA 3QT8A 3J80Q 3JAMQ 4DPXA 4DV7E 4DPYA 4DV5I 2EZ6A 1ZM3A 4JI1E 2WW4A 1DI2A 3ZM7A 1IBKI 1KTVA 4JI0I 1NZ0A 1HNWE 4YHHE 4HYMA 4DR1E 1DARA 4NXMI 1ZM9A 2L92A 4N3OA 4X8WA 4WFTA 3J7AM 2Z5EA 1B62A 4FW9A 3C4BA 2DSYA 2ZM6E 2RTXA 2V88A 2V34A 1NHIA 2DB2A 3K6QA 2LTRA 1Z0EA 1PIEA 4M1KA 4DR2E 2CGEA 4B3MI 3B8HA 1H74A 1ZXMA 1XNQI 2UXCE 3T1YI 1FNMA 3QT6A 1Z5CA 1XNRE 1FJGI 1USVA 1X47A 2ZBKB 4JI7I 4DV1E 3C4TA 4KQVA 1Y4UA 2HHHE 5BR8I 1H73A 4EMDA 4DV6E 3ZZUA 1HNZI 4DV0I 4USMA 4M2ZA 4DV4E 1Z0WA 3HULA 3ZZTA 1J5EI 4LF7I 1WHQA 2M7QA 5F3WA 2V8QB 1DQ3A 4FWHA 2RS7A 4WUCA 1ZBQA 5AASA 2UUBE 4YY3E 4DV2I 1X49A 1XMOI 2VQFI 4DMIA 3ADGA 4DV3E 4WPYA 4DR6I 4R8OA 3Q6NA 2YT4A 3ZKBA 3HPSA 4XTJA 4DR7I 4BC7A 1PVGA 4JV5E 4AQYI 4IZKB 2JOBA 2IOPA 4DUZI 3OTOI 1XMQE 5LMNI 4P52A 1H7SA 4JI6I 4X64E 4PRVA 1I94I 1Z0BA 5AE1A 1Y6ZA 2A2DA 1USUA 4UTGA 3ADIA 4M0VA 3MSWA 5LMUE 1SR9A 2GQ0A 1Z0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URL A;  2F4V I;  4M30 A;  1N0V C;  2HK3 A;  4DR5 E;  2UU9 E;  4LFB E;  4JI8 I;  4GKK E;  4OX9 E;  1UIL A;  1Z5B A;  2AJ4 A;  4JI4 E;  2R42 A;  4DR3 E;  3PYF A;  5IT9 C;  4P7A A;  4DR4 I;  3VYX A;  1BKN A;  2LUQ A;  4X62 I;  4KHP I;  4B3T I;  5IWA I;  2DEJ A;  4X66 E;  2L3J A;  3LPS A;  4WUB A;  1Z0V A;  2Q2E B;  1EA6 A;  1HR0 I;  4DV7 I;  1RRE A;  4JI1 I;  3ZZ0 A;  2LBS B;  4DPU A;  4JI2 E;  1HNW I;  4DPW A;  1KIJ A;  2XEX A;  2E5L E;  4LF4 I;  1IBL E;  1N33 E;  2LJH A;  1MU5 A;  2B3T B;  2HKJ A;  1D6T A;  1QU6 A;  2BV3 A;  1IBM I;  4DR2 I;  1PKP A;  1IBK E;  4JI0 E;  1N0U A;  2X7I A;  3PYG A;  2UUA E;  4K0K E;  3J81 C;  2NPF A;  2UXC I;  4PRX A;  2UXB E;  4LF5 I;  4LF9 E;  4JI5 I;  3J7A G;  2LJP A;  3PYE A;  4LFC E;  4MYU A;  4DV1 I;  3D4J A;  1KVK A;  2HHH I;  2OI2 A;  1N34 E;  1FWL A;  2B7T A;  4DV6 I;  1EKZ A;  2V8P A;  1HNX E;  2BM0 A;  1S16 A;  4X65 I;  4DV4 I;  1H72 C;  1A6F A;  2MDR A;  2L33 A;  1WHN A;  2LUP B;  4HXZ A;  1N36 E;  2L2N A;  4USK A;  3HTX A;  3B82 A;  3H4L A;  4I3H A;  3ZKD A;  5BR8 E;  3LTO A;  4Z7C A;  3K1J A;  1Z0C A;  5LMU E;  4JV5 I;  1YYO A;  1U2R A;  2V2Q A;  4LF6 E;  5FLX C;  4LF7 E;  1K47 A;  4DXL A;  1XMQ I;  2VF3 A;  4JYA E;  2J7K A;  2A2C A;  3Q1Q A;  2RSM A;  2L2M A;  4X64 I;  2VQF E;  2EFG A;  4NXN E;  1T4O A;  4WUD A;  3LLH A;  4WYQ B;  5GMD A;  5LMU I;  2GS8 A;  4DUY E;  4DR5 I;  2UU9 I;  4GKJ I;  3VYY A;  4LFB I;  4LFA I;  4GKK I;  4OX9 I;  1N32 I;  4DKK A;  4DPT A;  1RC7 A;  4DUZ E;  4JI4 I;  1X48 A;  3OTO E;  3CWV A;  1T4N A;  2CPN A;  1Z5A A;  1GQE A;  1OJ4 A;  3V2U C;  5A2Q C;  4JI6 E;  3F0N A;  3J80 C;  1UHZ A;  3JAM C;  4B3R E;  4X66 I;  2F4V E;  4FWG A;  1YYK A;  3ADJ A;  3QT5 A;  4ED4 A;  4JI8 E;  2DEI A;  4B3S E;  1RQ0 A;  2UUC E;  3GON A;  4JI2 I;  3ADL A;  4DR4 E;  2VQE E;  2LRS A;  4LF8 E;  4YHH I;  2L3C A;  4PU9 A;  1MG7 A;  1YZ9 A;  4DR1 I;  3T1H E;  2E5L I;  2UXD E;  2N3H A;  1IBL I;  2NUE A;  1Z0G A;  2HFS A;  4MYT A;  4HY1 A;  3V5R A;  4JI3 E;  5IT9 Q;  5L3J A;  1J26 A;  1EI1 A;  1N33 I;  2ZM6 I;  5A2Q Q;  2HFU A;  1HR0 E;  4DV5 E;  1NHH A;  4FWD A;  2UUA I;  4K0K I;  1H7U A;  2LTS A;  3J7Y p;  1FWK A;  1Z59 A;  2UXB I;  2DIX A;  4NXM E;  4LF4 E;  2HKE A;  4LF9 I;  1ZM4 A;  1XNR I;  4LFC I;  4Z7Y A;  2X36 A;  2RS6 A;  4DU7 A;  1N34 I;  1IBM E;  2B7V A;  1HNX I;  2N3G A;  1RR9 A;  4B3M E;  2E1R A;  1XNQ E;  4LF5 E;  3T1Y E;  1ZM2 A;  2HK2 A;  4JI5 E;  1N36 I;  5GME A;  1MX0 A;  2ZIT A;  1FJG E;  2UUB I;  4JI7 E;  4YY3 I;  1ZXN A;  4DV3 I;  3J81 Q;  3WU6 A;  1QZR A;  2L2K B;  1HNZ E;  4DV0 E;  2NA2 A;  4UT4 A;  4X65 E;  4LF6 I;  1VIS A;  2V2Z A;  1J5E E;  3WU4 A;  1FKA E;  4JYA I;  2V2V A;  2CZ9 A;  4DV2 E;  1XMO E;  1YYW A;  4NXN I;  3K17 A;  4JG4 A;  2NUF A;  3WU5 A;  4DR6 E;  2NUG A;  4DR7 E;  4DUY I;  3M6A A;  1O0W A;  1ELO A;  4ZVI A;  4AQY E;  3PYD A;  1FI4 A;  3B78 A;  4DR3 I;  1T4L B;  1S4E A;  4RPF A;  4HAC B;  4OOG C;  5LMN E;  1I94 E;  3P1X A;  4B3R I;  2JY9 A;  5LL6 R;  1B63 A;  4DU8 A;  5FLX Q;  2IHR 1;  1XHK A;  2JVA A;  4GKJ E;  1NHJ A;  5CFF E;  4LFA E;  1N32 E;  2R3V A;  4B3S I;  1STU A;  2UUC I;  1ZBT A;  2VQE I;  3WU3 A;  1WUU A;  4LF8 I;  4R1F A;  4X62 E;  3T1H I;  2KHX A;  2UXD I;  4HAC A;  4KHP E;  2BM1 A;  4B3T E;  2DMY A;  5IWA E;  1UEK A;  4JI3 I;  4FN5 A;  3QT7 A;  1KKH A;  3QT8 A;  3J80 Q;  3JAM Q;  4DPX A;  4DV7 E;  4DPY A;  4DV5 I;  2EZ6 A;  1ZM3 A;  4JI1 E;  2WW4 A;  1DI2 A;  3ZM7 A;  1IBK I;  1KTV A;  4JI0 I;  1NZ0 A;  1HNW E;  4YHH E;  4HYM A;  4DR1 E;  1DAR A;  4NXM I;  1ZM9 A;  4X8W A;  4WFT A;  3J7A M;  1B62 A;  4FW9 A;  3C4B A;  2ZM6 E;  2RTX A;  2V34 A;  1NHI A;  2DB2 A;  2LTR A;  1Z0E A;  1PIE A;  4M1K A;  4DR2 E;  4B3M I;  3B8H A;  1H74 A;  1ZXM A;  1XNQ I;  2UXC E;  3T1Y I;  1FNM A;  3QT6 A;  1Z5C A;  1XNR E;  1FJG I;  1X47 A;  2ZBK B;  4JI7 I;  4DV1 E;  3C4T A;  4KQV A;  5BR8 I;  2HHH E;  1H73 A;  4EMD A;  4DV6 E;  3ZZU A;  1HNZ I;  4DV0 I;  4USM A;  4M2Z A;  4DV4 E;  1Z0W A;  3HUL A;  3ZZT A;  1J5E I;  4LF7 I;  1WHQ A;  4FWH A;  2RS7 A;  4WUC A;  2UUB E;  4YY3 E;  4DV2 I;  1X49 A;  1XMO I;  2VQF I;  3ADG A;  4DV3 E;  4DR6 I;  2YT4 A;  3ZKB A;  4XTJ A;  4DR7 I;  1PVG A;  4JV5 E;  4AQY I;  4DUZ I;  3OTO I;  1XMQ E;  5LMN I;  4P52 A;  1H7S A;  4JI6 I;  4X64 E;  4PRV A;  1I94 I;  1Z0B A;  2A2D A;  4UTG A;  3ADI A;  3LNU A;  1Z0T A; 
#chains in the Genus database with same CATH topology
 1UN6 B;  4URL A;  2EMK A;  4M30 A;  2F4V I;  1N0V C;  2HK3 A;  4DR5 E;  2EN7 A;  2UU9 E;  4LFB E;  2EM9 A;  4JI8 I;  2JEA B;  4GKK E;  2JE6 A;  4OX9 E;  1UIL A;  1Z5B A;  1Y4S A;  2AJ4 A;  4OO1 E;  2NN6 A;  2EN2 A;  4JI4 E;  2R42 A;  4DR3 E;  4X9J A;  4BMJ A;  5IT9 C;  4O5G A;  1UDS A;  3PYF A;  4P7A A;  1BBG A;  1WJP A;  3VYX A;  4DR4 I;  2K4V A;  2CG9 A;  3KWR A;  2LO3 A;  4IZK A;  3AV0 A;  1BKN A;  3TQM A;  2LUQ A;  5A6J A;  1OYR A;  4X62 I;  3L00 A;  2YTQ A;  3OML A;  5AE2 A;  2ELZ A;  4MLQ A;  3Q6M A;  4KHP I;  2M1S A;  4B3T I;  5IWA I;  2DEJ A;  4MU1 A;  3EPH A;  4X66 E;  1ZAA C;  4IS1 C;  4WXD A;  5IV8 B;  2L3J A;  3LPS A;  5C0X D;  1LLM C;  1YHC A;  5DRO A;  2BA1 G;  3UK3 C;  4WUB A;  2EOI A;  4FW4 A;  2YSO A;  2EMC A;  1RMD A;  1Z0V A;  2Q2E B;  2EML A;  1EA6 A;  4BA1 B;  4R2C A;  4BHC A;  4MQY A;  2PNZ B;  1RRE A;  4DV7 I;  1HR0 I;  4JI1 I;  2EOQ A;  3ZZ0 A;  2LBS B;  4DPU A;  4JI2 E;  5K36 C;  3F6H A;  5A6K A;  2JEA A;  1VI7 A;  5DNY A;  4DPW A;  1HNW I;  2DLK A;  4ZYD A;  1KIJ A;  2MKD A;  4BC9 A;  4TUG A;  5AC4 A;  3AUZ A;  2XEX A;  2E5L E;  2FGG A;  4LF4 I;  1IBL E;  1X6F A;  2LJU A;  4L8N A;  2EMG A;  5KL2 A;  4L5N C;  1N33 E;  2LJH A;  2LMZ A;  4FK5 C;  1MU5 A;  2B3T B;  1N3G A;  3HQ1 A;  2EL6 A;  4KWY A;  2O1V A;  4GQU A;  4MU0 A;  2HKJ A;  1D6T A;  1QU6 A;  2BV3 A;  3GCM A;  2L6M A;  3LNU A;  1IBM I;  1TF6 A;  2EPP A;  4DR2 I;  1PKP A;  2GHF A;  1IBK E;  2WP8 A;  4JI0 E;  3P76 A;  1PDA A;  1N0U A;  2X7I A;  3PYG A;  4BA1 A;  2UUA E;  4K0K E;  2PNZ A;  1G2D C;  3J81 C;  1SFE A;  5AE3 A;  1YUJ A;  2I13 A;  2YTE A;  4PRX A;  2YSP A;  2NPF A;  2UXB E;  4N4R B;  2UXC I;  4MDT A;  3MHS C;  4LF5 I;  1P42 A;  4FW7 A;  2O1W A;  4LF9 E;  3J7A G;  4JI5 I;  3H09 A;  4KZS A;  2LJP A;  1B69 A;  1A1J A;  3PYE A;  1MGT A;  2H36 X;  4HEI A;  4LFC E;  5ADZ A;  1HK7 A;  4MYU A;  4QNK A;  4BCA A;  4DV1 I;  3D4J A;  1WRJ A;  1KVK A;  5JEA C;  3C6K A;  1WXR A;  2HHH I;  1X6H A;  2OI2 A;  1N34 E;  4R2Q A;  1FWL A;  2B7T A;  2Z5C B;  1EKZ A;  4DV6 I;  3M7N G;  3KZZ A;  4J8Z A;  2V8P A;  3FIG A;  1Y60 A;  2JWO A;  4O43 A;  2ENH A;  1A1L A;  2EQ1 A;  1HNX E;  2CVE A;  4R03 A;  2JP9 A;  2FV4 B;  2BM0 A;  1S16 A;  4X65 I;  4DV4 I;  4HTG A;  2EE8 A;  1H72 C;  1A6F A;  2MDR A;  2L33 A;  1WHN A;  4ZYE A;  2EM3 A;  2LUP B;  4HXZ A;  1N36 E;  2L2N A;  1DGC A;  2YTP A;  2C38 B;  4USK A;  3HTX A;  2Q8U A;  3B82 A;  1NEI A;  4LFB I;  2EP3 A;  4LTY A;  1UDN A;  2WNR B;  3H4L A;  4I8O A;  3H1C A;  3PS3 A;  4I3H A;  2YTN A;  2ENC A;  2RQL A;  5BR8 E;  3ZKD A;  4OO1 C;  2JPA A;  3LTO A;  5EL9 A;  4F54 A;  4Z7C A;  5JEA A;  3K1J A;  2D9H A;  1Z0C A;  2EPM X;  2EM5 A;  3U1Y A;  2VES A;  2E72 A;  3CDJ A;  2IOQ A;  4JV5 I;  3EPL A;  2EMF A;  1YYO A;  2NN6 D;  4F9C B;  1U2R A;  2V2Q A;  3HXL A;  2EPL X;  5FLX C;  4LF6 E;  4LF7 E;  1K47 A;  4P7D A;  1X3C A;  1X6E A;  1YUI A;  4DXL A;  1XMQ I;  2VF3 A;  3GLL A;  4JYA E;  2J7K A;  2EMW A;  3MHH C;  1GTK A;  2A2C A;  4IFD F;  3Q1Q A;  2RSM A;  4IZJ D;  2L2M A;  4X64 I;  3IWB A;  2VQF E;  5A6A A;  2JR1 A;  1Z1B A;  2EFG A;  3PS2 A;  2EMY A;  4GZN C;  4NXN E;  4BBY A;  1R6M A;  1T4O A;  2C38 A;  4WUD A;  3U1K A;  3LLH A;  4WYQ B;  5GMD A;  2YTD A;  5LMU I;  1A1K A;  2GS8 A;  2EOO A;  3HKM A;  4LU9 A;  4WXC A;  2WNR A;  3P3C A;  3UHM A;  2YRM A;  3BGH A;  4DUY E;  4DR5 I;  2VE7 C;  3VYY A;  2VF1 A;  2VRD A;  1E3H A;  2UU9 I;  4LFA I;  4OX9 I;  4GKK I;  1N32 I;  5DNL A;  4DKK A;  4DPT A;  1RC7 A;  4DUZ E;  4JI4 I;  1X48 A;  3OTO E;  3CWV A;  2EN8 A;  3VK6 A;  2F8B A;  1T4N A;  4F6N A;  2CPN A;  1Z5A A;  4O4K A;  1GQE A;  5A2Q C;  1OJ4 A;  3V2U C;  4IFD E;  2R1F A;  4JI6 E;  3ZOQ B;  3F0N A;  3J80 C;  2EPR A;  1UHZ A;  2LE2 A;  3JAM C;  5A69 A;  1A1G A;  2JEB B;  5EKW A;  4B3R E;  2MC5 A;  2O1U A;  2YRH A;  4X66 I;  2EJ4 A;  2C39 A;  5A6B A;  2EN3 A;  2WBS A;  5DNX A;  4LCF A;  2F4V E;  2F1D A;  4BA2 B;  4FWG A;  1YYK A;  3ADJ A;  3QT5 A;  2EPC A;  4ED4 A;  4JI8 E;  2DEI A;  4AID A;  2ADR A;  4B3S E;  1RQ0 A;  2UUC E;  3GON A;  4JI2 I;  3ADL A;  2M4I A;  2EOE A;  4DR4 E;  2EPU A;  3HJC A;  2VQE E;  2WBU A;  5K36 D;  2LRS A;  1PJS A;  4LF8 E;  4YHH I;  2ELY A;  3THN A;  2L3C A;  1MG7 A;  4PU9 A;  2EM0 A;  3THO B;  1YZ9 A;  4DR1 I;  1AH5 A;  3T1H E;  3DJW A;  2E5L I;  2UXD E;  2N3H A;  1IBL I;  4P78 A;  4TUI A;  2NUE A;  1Z0G A;  3ECR A;  2HFS A;  4MYT A;  4HY1 A;  3V5R A;  4JI3 E;  3LML A;  4F9A B;  1J26 A;  1EI1 A;  2JEB A;  5L3J A;  5IT9 Q;  2YTJ A;  1N33 I;  1R6L A;  2ZM6 I;  5A2Q Q;  1QNT A;  2DRP A;  1YPN A;  2HFU A;  3L7Z B;  1HR0 E;  1P47 A;  2BA1 D;  5C0X F;  5DRP A;  4DV5 E;  1NHH A;  4BA2 A;  1YFH A;  2K7I A;  1BB8 A;  4FWD A;  2UUA I;  4K0K I;  1H7U A;  2LTS A;  2V86 A;  3JU0 A;  4R2A A;  2EN1 A;  3J7Y p;  1FWK A;  4ISA A;  1Z59 A;  2YWQ A;  2DIX A;  2UXB I;  1ZU1 A;  4NXM E;  3KZY A;  4LF4 E;  2HKE A;  2RPC A;  2IES A;  1ZM4 A;  4LF9 I;  1A1F A;  2JOX A;  4DV5 I;  2EPN A;  1XNR I;  1OYP A;  4LFC I;  4Z7Y A;  2YU5 A;  2X36 A;  4U3D A;  4AIM A;  3IWC A;  2KON A;  2RS6 A;  4DU7 A;  2EMH A;  1N34 I;  2EOY A;  5JEA D;  2YPN A;  5C0X E;  1IBM E;  4IS9 A;  3GME A;  2B7V A;  2MC6 A;  1HNX I;  3L7Z A;  2N3G A;  2GO3 A;  2YRK A;  1RR9 A;  3QG5 C;  2I9I A;  3C6M A;  1X5W A;  2V85 A;  2YTI A;  4B3M E;  5IXM B;  1IMU A;  2E1R A;  1XNQ E;  2E1M A;  1XXE A;  1EH6 A;  1IQS A;  3T1Y E;  2DLQ A;  4LF5 E;  4QNJ A;  2EMA A;  1ZM2 A;  5K36 E;  2HK2 A;  2CSH A;  4JI5 E;  2GO4 A;  2V89 A;  4LCH A;  5GME A;  1A1H A;  1N36 I;  1BBO A;  1MX0 A;  2ZIT A;  1AAY A;  1E3P A;  3K85 A;  3JTZ A;  1FJG E;  2UUB I;  2PO1 B;  2EWL A;  2N8X A;  4JI7 E;  1KJK A;  3F6G A;  4YY3 I;  2EM2 A;  1ZXN A;  5ELW A;  3J81 Q;  4DV3 I;  2GPI A;  1Y5Y A;  4FW6 A;  2JYA A;  4OO1 D;  3P3G A;  3WU6 A;  2EQ3 A;  4GEQ B;  1QZR A;  2L2K B;  1HNZ E;  4Q28 A;  2IER A;  4IFD B;  4DV0 E;  2NA2 A;  2Z5B B;  1F2I G;  4BS9 A;  3M7N D;  4ZYG A;  4UT4 A;  4X65 E;  2Z5C A;  1PJT A;  4LF6 I;  1VIS A;  2LT7 A;  1J5E E;  1JK2 A;  2V2Z A;  1FKA E;  2EOF A;  5KL3 A;  3WU4 A;  4JYA I;  2V2V A;  1UDO A;  2CZ9 A;  4F9B B;  4OZE A;  4J3D A;  4Q35 B;  2EOH A;  2NAB A;  4R2S A;  4DV2 E;  1XMO E;  4LOM A;  2EOZ A;  1YYW A;  4NXN I;  3K17 A;  2EL4 A;  4WSP A;  4JG4 A;  4MLV A;  5T6J A;  5A6B D;  2LVH A;  2NUF A;  3WU5 A;  2PO1 A;  4DR6 E;  2L8T A;  2EOR A;  2CTD A;  4NBQ A;  2HC5 A;  2NUG A;  4AM3 A;  4DR7 E;  2HJJ A;  3M6A A;  1O0W A;  2R76 A;  2WBT A;  5FWK A;  4DUY I;  2PRT A;  1ELO A;  4ZVI A;  4ZYH A;  4AQY E;  3PYD A;  5KL5 A;  1FI4 A;  3B78 A;  2EMB A;  4IFD A;  4MU3 A;  2Z5B A;  1T4L B;  1S4E A;  4RPF A;  4IZJ B;  4DR3 I;  2G7H A;  4HAC B;  4OOG C;  2NN6 F;  5LMN E;  2YZT A;  5KL4 A;  2EQ0 A;  5KL6 A;  1EH7 A;  2V87 A;  2YTF A;  1MEY C;  2BR2 B;  4NZV A;  2O1T A;  3DD6 A;  4MU4 A;  1I94 E;  3P1X A;  4B3R I;  2JY9 A;  2ODR C;  5LL6 R;  2PNM A;  2ODR D;  2EM6 A;  1B63 A;  4DU8 A;  2EPK X;  5FLX Q;  3M85 G;  2IHR 1;  1XHK A;  1JK1 A;  2JVA A;  2EN4 A;  5KL7 A;  4LPF A;  3IWD A;  4GKJ E;  1NHJ A;  2EPA A;  5CFF E;  4RHB B;  2KOU A;  1PJQ A;  5DRR A;  4LFA E;  1N32 E;  2A25 A;  2R3V A;  4B3S I;  1STU A;  3PRY A;  2B9D A;  2EPO A;  2UUC I;  2YTO A;  3RMP A;  2O3Z A;  4IJD A;  1ZBT A;  2VQE I;  3WU3 A;  1T38 A;  3DF6 A;  2J65 A;  3HPZ A;  1WUU A;  2NN6 E;  4R1F A;  4LF8 I;  2EPX A;  2BB8 A;  2CT1 A;  4O24 A;  4X62 E;  5LLQ A;  4IZJ A;  3T1H I;  2KHX A;  1NCS A;  2WZO A;  2UXD I;  4HAC A;  1GZ6 A;  4KHP E;  2BM1 A;  3P06 A;  5C0X B;  4B3T E;  2DMY A;  2EM4 A;  2FTX B;  5IWA E;  1UEK A;  5C0X C;  2BR2 A;  4JI3 I;  1G2F C;  3M85 D;  4FN5 A;  2WP8 B;  2V83 A;  2M9A A;  3QT7 A;  1KKH A;  2PNL A;  3QT8 A;  4LCG A;  4BHB A;  3JAM Q;  2LCE A;  3J80 Q;  4DPX A;  4DV7 E;  2BA0 G;  4DPY A;  2J7J A;  2EZ6 A;  4JI1 E;  1IQO A;  1DI2 A;  1ZM3 A;  2WW4 A;  4GKJ I;  3ZM7 A;  1IBK I;  1KTV A;  4JI0 I;  3KRN A;  1NZ0 A;  1HNW E;  4YHH E;  3B4T A;  2MDG A;  4HYM A;  4DR1 E;  1DAR A;  4NXM I;  1ZM9 A;  1ZR9 A;  2L92 A;  4N3O A;  5K36 F;  3VHT B;  2EMI A;  4X8W A;  2C37 B;  3M99 B;  4WFT A;  3J7A M;  2Z5E A;  1B62 A;  4FW9 A;  2JXP A;  1TF3 A;  3C4B A;  2DSY A;  5C0X A;  2ZM6 E;  1OYS A;  2HGH A;  2RTX A;  4U3B A;  2V88 A;  3EPJ A;  2V34 A;  1NHI A;  2PO0 B;  2DB2 A;  3BBG A;  3EQ1 A;  3K6Q A;  2LTR A;  5AC5 A;  1Z0E A;  1PIE A;  4M1K A;  2YTG A;  1A1I A;  4DR2 E;  2CGE A;  2BA0 D;  1TN9 A;  1L4S A;  5K36 A;  4B3M I;  3B8H A;  4R2D A;  3BF2 A;  3BID A;  1H74 A;  2DMI A;  1ZXM A;  1XNQ I;  1T39 A;  2UXC E;  2EN6 A;  3T1Y I;  2AE8 A;  2JT2 A;  2PO2 B;  2EM8 A;  4R2E A;  1FNM A;  3QT6 A;  2MKN A;  1Z5C A;  4NHR A;  1XNR E;  1FJG I;  1USV A;  1X47 A;  2ZBK B;  5JEA B;  4JI7 I;  4DV1 E;  2EOX A;  1YH8 A;  4OKG A;  2C37 A;  5DRQ A;  3PS1 A;  3C4T A;  4KQV A;  1Y4U A;  2HHH E;  5BR8 I;  1KYQ A;  1H73 A;  4EMD A;  4R2R A;  4DV6 E;  3ZZU A;  2EL5 A;  1HNZ I;  2EM7 A;  3CDI A;  4FW5 A;  4DV0 I;  2PO0 A;  4F6M A;  4USM A;  5JEA F;  4IFD C;  4M2Z A;  4DV4 E;  1EH8 A;  2EOS A;  4IFD D;  2EPZ A;  1Z0W A;  3HUL A;  3ZZT A;  1J5E I;  4LF7 I;  1WHQ A;  2M7Q A;  2DGC A;  4R2P A;  2LV2 A;  2V8Q B;  3EPK A;  1DQ3 A;  5F3W A;  4FWH A;  2RS7 A;  4WUC A;  4RH8 A;  5TSE A;  1ZBQ A;  5AAS A;  2UUB E;  2PO2 A;  4YY3 E;  4DV2 I;  1X49 A;  1XMO I;  2EMZ A;  2EOJ A;  2VQF I;  4OO1 B;  2YU8 A;  4DMI A;  3ADG A;  4DV3 E;  4FW3 A;  3P3E A;  4WPY A;  2RSI A;  1UBD C;  2JE6 B;  4DR6 I;  4R8O A;  3Q6N A;  2YT4 A;  3ZKB A;  3HPS A;  4XTJ A;  1YSA C;  2WCC 3;  2NN6 B;  4DR7 I;  4BC7 A;  4WX9 A;  2EOM A;  4M9V C;  2NN6 C;  1PVG A;  4JV5 E;  3NZK A;  4AQY I;  5JEA E;  4OO1 F;  4IZK B;  2JOB A;  2GLI A;  2IOP A;  4DUZ I;  3OTO I;  2EMX A;  1XMQ E;  1UDQ A;  5K36 B;  5LMN I;  4P52 A;  1H7S A;  4JI6 I;  4WSG A;  2C39 B;  4X64 E;  4PRV A;  1I94 I;  1Z0B A;  5AE1 A;  2ENA A;  1Y6Z A;  2A2D A;  4F2J C;  1USU A;  4UTG A;  3ADI A;  4M0V A;  1RHY A;  2BBG A;  3MSW A;  5LMU E;  1SR9 A;  4OO1 A;  2GQ0 A;  1Z0T A; 
#chains in the Genus database with same CATH homology
 4URL A;  2F4V I;  4M30 A;  1N0V C;  2HK3 A;  4DR5 E;  2UU9 E;  4LFB E;  4JI8 I;  4GKK E;  4OX9 E;  1UIL A;  1Z5B A;  1Y4S A;  2AJ4 A;  4JI4 E;  2R42 A;  4DR3 E;  5IT9 C;  4BMJ A;  3PYF A;  4P7A A;  4DR4 I;  3VYX A;  2K4V A;  2CG9 A;  3KWR A;  4IZK A;  3AV0 A;  1BKN A;  2LUQ A;  4X62 I;  3OML A;  5AE2 A;  3Q6M A;  4KHP I;  2M1S A;  4B3T I;  5IWA I;  2DEJ A;  4X66 E;  2L3J A;  3LPS A;  4WUB A;  1Z0V A;  2Q2E B;  1EA6 A;  1HR0 I;  4DV7 I;  1RRE A;  4JI1 I;  3ZZ0 A;  2LBS B;  4DPU A;  4JI2 E;  3F6H A;  1HNW I;  5DNY A;  4DPW A;  1KIJ A;  4BC9 A;  4TUG A;  3AUZ A;  2XEX A;  2E5L E;  2FGG A;  4LF4 I;  1IBL E;  4L8N A;  4L5N C;  1N33 E;  2LJH A;  2LMZ A;  1MU5 A;  2B3T B;  2O1V A;  3HQ1 A;  2HKJ A;  1D6T A;  1QU6 A;  2BV3 A;  2L6M A;  3LNU A;  1IBM I;  4DR2 I;  1PKP A;  1IBK E;  4JI0 E;  1N0U A;  2X7I A;  3PYG A;  2UUA E;  4K0K E;  3J81 C;  5AE3 A;  2NPF A;  2UXC I;  4PRX A;  2UXB E;  4LF5 I;  2O1W A;  4LF9 E;  3J7A G;  4JI5 I;  3H09 A;  4KZS A;  2LJP A;  3PYE A;  2H36 X;  4LFC E;  5ADZ A;  1HK7 A;  4MYU A;  4DV1 I;  4BCA A;  3D4J A;  1KVK A;  1WXR A;  2HHH I;  2OI2 A;  1N34 E;  1FWL A;  2B7T A;  2Z5C B;  1EKZ A;  4DV6 I;  4J8Z A;  2V8P A;  3FIG A;  2JWO A;  1HNX E;  4R03 A;  2FV4 B;  2BM0 A;  1S16 A;  4X65 I;  4DV4 I;  1H72 C;  1A6F A;  2MDR A;  2L33 A;  1WHN A;  2LUP B;  4HXZ A;  1N36 E;  2L2N A;  4USK A;  3HTX A;  3B82 A;  4LTY A;  3H4L A;  4I8O A;  4I3H A;  3ZKD A;  5BR8 E;  3LTO A;  4Z7C A;  4F54 A;  3K1J A;  1Z0C A;  2IOQ A;  4JV5 I;  1YYO A;  4F9C B;  1U2R A;  2V2Q A;  3HXL A;  5FLX C;  4LF6 E;  4LF7 E;  1K47 A;  4P7D A;  4DXL A;  1XMQ I;  2VF3 A;  4JYA E;  2J7K A;  2A2C A;  3Q1Q A;  2RSM A;  4IZJ D;  2L2M A;  4X64 I;  3IWB A;  2VQF E;  2JR1 A;  2EFG A;  4NXN E;  4BBY A;  1T4O A;  4WUD A;  3LLH A;  4WYQ B;  5GMD A;  5LMU I;  2GS8 A;  4LU9 A;  4DUY E;  4DR5 I;  2UU9 I;  4GKJ I;  2VE7 C;  3VYY A;  2VF1 A;  4LFB I;  4LFA I;  4GKK I;  4OX9 I;  1N32 I;  4DKK A;  4DPT A;  1RC7 A;  4DUZ E;  4JI4 I;  1X48 A;  3OTO E;  3CWV A;  3VK6 A;  2F8B A;  1T4N A;  2CPN A;  1Z5A A;  1GQE A;  5A2Q C;  1OJ4 A;  3V2U C;  4JI6 E;  3ZOQ B;  3F0N A;  3J80 C;  2LE2 A;  1UHZ A;  3JAM C;  4B3R E;  2MC5 A;  2O1U A;  4X66 I;  2F4V E;  4FWG A;  1YYK A;  3ADJ A;  3QT5 A;  4ED4 A;  4JI8 E;  2DEI A;  4B3S E;  1RQ0 A;  2UUC E;  3GON A;  4JI2 I;  3ADL A;  2M4I A;  4DR4 E;  3HJC A;  2VQE E;  2LRS A;  4LF8 E;  4YHH I;  2L3C A;  4PU9 A;  1MG7 A;  1YZ9 A;  4DR1 I;  3T1H E;  3DJW A;  2E5L I;  2UXD E;  2N3H A;  1IBL I;  4P78 A;  4TUI A;  2NUE A;  1Z0G A;  2HFS A;  4MYT A;  4HY1 A;  3V5R A;  4JI3 E;  3LML A;  4F9A B;  1J26 A;  1EI1 A;  5L3J A;  5IT9 Q;  1N33 I;  2ZM6 I;  5A2Q Q;  2HFU A;  1HR0 E;  4DV5 E;  1NHH A;  4FWD A;  2UUA I;  4K0K I;  1H7U A;  2LTS A;  2V86 A;  3JU0 A;  3J7Y p;  1FWK A;  1Z59 A;  2UXB I;  2DIX A;  4NXM E;  4LF4 E;  2HKE A;  4LF9 I;  1ZM4 A;  2JOX A;  1XNR I;  4LFC I;  4Z7Y A;  2X36 A;  3IWC A;  2KON A;  2RS6 A;  4DU7 A;  1N34 I;  1IBM E;  2B7V A;  2MC6 A;  1HNX I;  2N3G A;  1RR9 A;  4B3M E;  2E1R A;  2V85 A;  1XNQ E;  2E1M A;  4LF5 E;  3T1Y E;  1ZM2 A;  2HK2 A;  4JI5 E;  1N36 I;  2V89 A;  5GME A;  1MX0 A;  2ZIT A;  3K85 A;  3JTZ A;  1FJG E;  2UUB I;  2EWL A;  4JI7 E;  4YY3 I;  3F6G A;  1ZXN A;  4DV3 I;  3J81 Q;  3WU6 A;  4GEQ B;  1QZR A;  2L2K B;  1HNZ E;  4Q28 A;  4DV0 E;  2NA2 A;  2Z5B B;  4BS9 A;  4UT4 A;  4X65 E;  2Z5C A;  4LF6 I;  1VIS A;  2V2Z A;  1J5E E;  3WU4 A;  1FKA E;  4JYA I;  2V2V A;  2CZ9 A;  4F9B B;  4DV2 E;  1XMO E;  1YYW A;  4NXN I;  3K17 A;  4WSP A;  4JG4 A;  2NUF A;  5T6J A;  3WU5 A;  4DR6 E;  2L8T A;  2NUG A;  4DR7 E;  4DUY I;  3M6A A;  1O0W A;  5FWK A;  1ELO A;  4ZVI A;  4AQY E;  3PYD A;  1FI4 A;  3B78 A;  2Z5B A;  1T4L B;  1S4E A;  4RPF A;  4IZJ B;  4DR3 I;  2G7H A;  4HAC B;  4OOG C;  5LMN E;  2YZT A;  2V87 A;  2O1T A;  1I94 E;  3P1X A;  4B3R I;  2JY9 A;  2ODR C;  5LL6 R;  2PNM A;  2ODR D;  1B63 A;  4DU8 A;  5FLX Q;  2IHR 1;  1XHK A;  2JVA A;  3IWD A;  4GKJ E;  1NHJ A;  5CFF E;  2KOU A;  4LFA E;  1N32 E;  2R3V A;  4B3S I;  1STU A;  3PRY A;  2B9D A;  2UUC I;  3RMP A;  1ZBT A;  2VQE I;  3WU3 A;  3DF6 A;  3HPZ A;  1WUU A;  4LF8 I;  4R1F A;  4X62 E;  4IZJ A;  3T1H I;  2KHX A;  2WZO A;  2UXD I;  4HAC A;  1GZ6 A;  4KHP E;  2BM1 A;  3P06 A;  4B3T E;  2DMY A;  5IWA E;  2FTX B;  1UEK A;  4JI3 I;  4FN5 A;  2V83 A;  3QT7 A;  1KKH A;  2PNL A;  3QT8 A;  3J80 Q;  3JAM Q;  4DPX A;  4DV7 E;  4DPY A;  4DV5 I;  2EZ6 A;  1ZM3 A;  4JI1 E;  2WW4 A;  1DI2 A;  3ZM7 A;  1IBK I;  1KTV A;  4JI0 I;  1NZ0 A;  1HNW E;  4YHH E;  4HYM A;  4DR1 E;  1DAR A;  4NXM I;  1ZM9 A;  2L92 A;  4N3O A;  4X8W A;  4WFT A;  3J7A M;  2Z5E A;  1B62 A;  4FW9 A;  3C4B A;  2DSY A;  2ZM6 E;  2RTX A;  2V88 A;  2V34 A;  1NHI A;  2DB2 A;  3K6Q A;  2LTR A;  1Z0E A;  1PIE A;  4M1K A;  4DR2 E;  2CGE A;  4B3M I;  3B8H A;  1H74 A;  1ZXM A;  1XNQ I;  2UXC E;  3T1Y I;  1FNM A;  3QT6 A;  1Z5C A;  1XNR E;  1FJG I;  1USV A;  1X47 A;  2ZBK B;  4JI7 I;  4DV1 E;  3C4T A;  4KQV A;  1Y4U A;  2HHH E;  5BR8 I;  1H73 A;  4EMD A;  4DV6 E;  3ZZU A;  1HNZ I;  4DV0 I;  4USM A;  4M2Z A;  4DV4 E;  1Z0W A;  3HUL A;  3ZZT A;  1J5E I;  4LF7 I;  1WHQ A;  2M7Q A;  5F3W A;  2V8Q B;  1DQ3 A;  4FWH A;  2RS7 A;  4WUC A;  1ZBQ A;  5AAS A;  2UUB E;  4YY3 E;  4DV2 I;  1X49 A;  1XMO I;  2VQF I;  4DMI A;  3ADG A;  4DV3 E;  4WPY A;  4DR6 I;  4R8O A;  3Q6N A;  2YT4 A;  3ZKB A;  3HPS A;  4XTJ A;  4DR7 I;  4BC7 A;  1PVG A;  4JV5 E;  4AQY I;  4IZK B;  2JOB A;  2IOP A;  4DUZ I;  3OTO I;  1XMQ E;  5LMN I;  4P52 A;  1H7S A;  4JI6 I;  4X64 E;  4PRV A;  1I94 I;  1Z0B A;  5AE1 A;  1Y6Z A;  2A2D A;  1USU A;  4UTG A;  3ADI A;  4M0V A;  3MSW A;  5LMU E;  1SR9 A;  2GQ0 A;  1Z0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...