4NXME

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4nxmE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxmE02
1MX0A 4DKKA 4WFTA 2HHHE 2E1RA 2JVAA 4DV2I 4XTJA 2BV3A 1YYWA 1S4EA 2DEJA 1NHJA 1Z0BA 3Q1QA 2VF3A 1IBME 3T1HE 4X62I 1ZM2A 4LF7E 2VQFE 3ADGA 2NUFA 4DR6I 5FLXQ 4B3TI 4HY1A 1XMOI 1H7UA 4WYQB 2IHR1 4LF5E 4M1KA 4DR4E 1D6TA 1J26A 1Z0VA 3VYXA 1N0UA 4JV5I 3QT8A 3ZKBA 1IBKI 4GKKE 5LL6R 4FW9A 1XNQE 3D4JA 3OTOE 1N33E 4P52A 4JI2I 3P1XA 3VYYA 1OJ4A 4DU8A 1PKPA 1X47A 2UUBI 4UT4A 1FNMA 4KHPI 2V2VA 4M30A 4YY3E 2A2CA 4DV4I 1EKZA 3C4TA 2EZ6A 3LLHA 1XMQE 4JI3I 1Z5BA 4K0KI 4NXNI 1YZ9A 5IT9Q 3T1YE 4B3RI 1HR0I 1UHZA 2DIXA 1HNXI 4YHHI 4DV2E 1GQEA 4DV7E 1Z0CA 1X49A 2F4VI 1KTVA 4DV5I 2JY9A 4FWHA 1I94E 4FN5A 4WUDA 4LF4I 4LF8I 4AQYI 1N32I 4X8WA 2Q2EB 1KIJA 4PRXA 4B3TE 1BKNA 1XMOE 5L3JA 4JG4A 1N0VC 2L3CA 1HNZI 1ZBTA 4JI0E 4JV5E 1RQ0A 2LUPB 1MU5A 1IBKE 4JYAI 2UXCI 2HFSA 4DUYE 2VQEI 3C4BA 1Z59A 3LTOA 1RR9A 2X36A 4DV1I 2V2ZA 4JI2E 4HXZA 1B63A 4WUCA 3ZZUA 2HKEA 2UUBE 1H72C 4JI7I 4NXMI 4JI4E 4KHPE 1HNWE 1FWLA 4LFCI 4DR2I 3WU3A 4DV3E 4DV4E 4LF6I 5IT9C 2NUEA 2L2MA 1T4LB 2GS8A 3QT7A 3B8HA 1ELOA 4JI3E 4K0KE 1Z0GA 4RPFA 4NXNE 4X65E 4DPXA 2E5LI 4DPYA 1HR0E 1RC7A 5IWAE 4DR1I 2DEIA 1HNXE 1T4NA 4YHHE 2HK2A 3WU5A 2J7KA 2N3GA 4USMA 2R42A 4JI1I 1S16A 2B7TA 1IBLI 1DI2A 4LF4E 1Z0WA 4AQYE 3J7AM 1N32E 3J80Q 2RSMA 2HKJA 1PVGA 2V8PA 2B7VA 2L3JA 4UTGA 4DXLA 3ZZ0A 3PYDA 3V5RA 1ZM9A 3J81Q 4JYAE 2CZ9A 4DUZI 2YT4A 2BM0A 2VQEE 1WHQA 1KKHA 3PYFA 2LBSB 5BR8I 2HK3A 5GMDA 4DV1E 1J5EI 4GKJI 1IBMI 1H7SA 3T1HI 4LF9I 1UEKA 4X66I 2V34A 4NXME 3WU6A 5CFFE 3ZKDA 1Z0EA 2XEXA 4X62E 4LFBI 4LF6E 2BM1A 3ADIA 2LTRA 4HACA 4DV0I 4HACB 4DR6E 4B3MI 1YYOA 4DR3I 2DMYA 4DR5I 1YYKA 3LPSA 3J7Yp 2L2KB 1XNQI 1STUA 1MG7A 4P7AA 4DR1E 1U2RA 1ZXMA 1N34I 3J80C 4B3SI 4OX9I 4X64I 3V2UC 5GMEA 2UU9I 3QT5A 4DR7I 2RS6A 4JI1E 4DPUA 1IBLE 3ZZTA 3PYGA 5LMUI 1XHKA 2V2QA 1H74A 1K47A 4LFAI 2N3HA 2EFGA 2ZM6I 3J81C 1WHNA 2LRSA 4DV6I 2R3VA 4M2ZA 3B78A 2A2DA 4I3HA 2UUCI 4URLA 1XNRI 2NPFA 5LMNI 4KQVA 1Z5CA 1NZ0A 1ZM4A 1ZXNA 2OI2A 2LJHA 3T1YI 4DUZE 4MYUA 1NHIA 1O0WA 1QZRA 1Z5AA 3ADLA 3CWVA 4DV7I 5BR8E 2UUAI 1H73A 1UILA 1J5EE 4GKJE 1I94I 3K17A 4LF9E 4B3RE 1N36I 2WW4A 4ZVIA 4X66E 1Z0TA 4USKA 1FJGI 3B82A 1X48A 2UXBI 2F4VE 4JI5I 4DV5E 3PYEA 4FWGA 1VISA 1EA6A 2ZBKB 3ZM7A 2L33A 2LTSA 3ADJA 4LFBE 4LF8E 1EI1A 4JI0I 4DV0E 4JI8I 3GONA 4B3ME 4JI6I 1B62A 4DR3E 4DR5E 5A2QQ 2UXDI 1HNZE 4Z7CA 4DUYI 2CPNA 1FI4A 4OOGC 4HYMA 1PIEA 2HFUA 1N34E 4B3SE 4OX9E 2UXCE 2HHHI 4X64E 1KVKA 2UU9E 4JI4I 1FKAE 4DR7E 3JAMQ 1HNWI 2RS7A 5LMUE 2B3TB 4JI7E 4LFAE 1T4OA 4PU9A 2ZM6E 4DV3I 2DB2A 2KHXA 4DPWA 4LF7I 4DV6E 3QT6A 2VQFI 1WUUA 2UUCE 3WU4A 4LFCE 2LUQA 4DR2E 1XNRE 3HTXA 4DPTA 5LMNE 4LF5I 4DR4I 2L2NA 4PRVA 3H4LA 4X65I 4Z7YA 3M6AA 1ZM3A 4DU7A 5IWAI 4GKKI 1A6FA 3LNUA 2ZITA 5FLXC 3OTOI 2UUAE 4ED4A 1N33I 2E5LE 2X7IA 2MDRA 1NHHA 1N36E 2LJPA 4R1FA 1FJGE 2UXBE 4EMDA 4MYTA 4JI5E 3HULA 2NUGA 4WUBA 5A2QC 3F0NA 4YY3I 2RTXA 1QU6A 3J7AG 4JI8E 1FWKA 4JI6E 1DARA 1XMQI 2UXDE 3K1JA 3JAMC 2NA2A 1RREA 4FWDA 2AJ4A
chains in the Genus database with same CATH superfamily
1MX0A 4BCAA 4DKKA 2EPLX 4WFTA 2EL5A 2F8BA 3KZYA 3BF2A 3FIGA 2YTJA 2HHHE 1BB8A 1SR9A 2ENHA 2EOEA 2JVAA 2E1RA 4DV2I 1ZU1A 1ZBQA 2EE8A 2BV3A 1DQ3A 1YYWA 1S4EA 2NN6C 4FW4A 2DEJA 4XTJA 4OO1B 2NN6F 2HJJA 1NHJA 4R2AA 1Z0BA 2PNLA 3Q1QA 2VF3A 1IBME 5K36C 2EPRA 3T1HE 2LV2A 4X62I 5K36F 5K36B 2EOQA 2JE6A 1ZM2A 3CDIA 5A6BA 5A6KA 5C0XB 4LF7E 4N3OA 5KL6A 2C38A 2PO2A 4DR1I 4F2JC 2BR2B 2YSPA 2VQFE 2G7HA 3ADGA 4O4KA 2NUFA 4DR6I 5FLXQ 4B3TI 2EN3A 4R2CA 2EM8A 2YTDA 2DRPA 4HY1A 2YTQA 2Z5CA 4NBQA 1XMOI 3U1KA 1H7UA 4WYQB 2IHR1 4LF5E 4M1KA 4DR4E 1D6TA 3VHTB 5JEAC 1J26A 4GZNC 1Z0VA 2IOPA 1OYRA 3VYXA 4WSPA 5JEAF 1N0UA 1TN9A 4JV5I 1OYSA 2LVHA 1Y4SA 3QT8A 3ZKBA 4BC7A 2EPCA 1IBKI 4BA2A 2M9AA 5LL6R 4GKKE 4BBYA 3EPLA 2WNRA 4IZKB 2WP8A 2EM7A 3VK6A 3UHMA 4FW9A 1XNQE 3D4JA 3HKMA 3OTOE 1N33E 4BA1A 2O1VA 2E1MA 4Q28A 1E3HA 4IFDE 4P52A 2O1WA 4JI2I 3P1XA 3VYYA 4NHRA 1OJ4A 4DU8A 2LCEA 1PKPA 1X47A 2EP3A 2EPKX 2UUBI 4UT4A 3MSWA 2CTDA 1FNMA 2Z5BA 4KHPI 1ZAAC 2EPZA 2JEAA 2V2VA 3GCMA 1PDAA 4M30A 2R76A 4YY3E 4F54A 3EQ1A 2JEAB 4LOMA 4ISAA 2EOOA 4U3BA 2A2CA 2GO4A 1KJKA 4OZEA 2K7IA 2EMHA 2EOXA 1UBDC 4DV4I 1EKZA 3M7ND 3C4TA 5EKWA 2EQ0A 2EZ6A 2NABA 3LLHA 2YTFA 4I8OA 4GEQB 1XMQE 4OO1E 1A1JA 3OTOI 1X6FA 3P76A 1L4SA 3PS2A 2RPCA 5A6BD 2DSYA 4JI3I 2V83A 1Z5BA 4K0KI 5F3WA 2O3ZA 2B9DA 2DMIA 1UDNA 4NXNI 5C0XE 2EPMX 1YZ9A 1Y5YA 5IT9Q 2PO0A 3T1YE 2HC5A 4B3RI 1HR0I 1UHZA 2DIXA 1HNXI 2EM5A 4YHHI 2M7QA 2V85A 4DV2E 1GQEA 2V88A 4L5NC 4DV7E 2PNZA 2EMFA 2H36X 1Z0CA 4FW6A 1X49A 2F4VI 1KTVA 1R6MA 4DV5I 2JY9A 4FWHA 1I94E 4FN5A 4U3DA 2CT1A 3F6HA 2ELZA 3L00A 4WUDA 4LF4I 4FW5A 1PJTA 1IMUA 2EORA 4AQYI 1T38A 5DNLA 4LF8I 1N32I 1Z1BA 4HTGA 4X8WA 2V87A 2BA1D 2YTNA 4MQYA 3IWDA 2Q2EB 1X6EA 2GHFA 2Q8UA 1KIJA 3L7ZA 2EMWA 4B3TE 4PRXA 1BKNA 4AIDA 1XMOE 5L3JA 4JG4A 1N0VC 2L3CA 2J65A 1HNZI 3IWCA 4IFDA 2JEBA 2JOBA 1ZBTA 4JI0E 4RH8A 5DRPA 4ZYHA 1IQSA 4JV5E 1RQ0A 2LMZA 2LUPB 1MU5A 1IBKE 4JYAI 1UDQA 2UXCI 3JTZA 2HFSA 4DUYE 2VQEI 2MKDA 3ECRA 3C4BA 3MHHC 5AE3A 1Z59A 3LTOA 1TF6A 1RR9A 2X36A 4DV1I 2V2ZA 3U1YA 1USUA 4JI2E 4HXZA 1B63A 4WUCA 1F2IG 3ZZUA 2EQ3A 2HKEA 2UUBE 1H72C 2EOYA 3DJWA 5A6AA 3P06A 3QG5C 4JI7I 4NXMI 4RHBB 4FW7A 4WX9A 4JI4E 4KHPE 1HNWE 4OO1A 4NZVA 3BBGA 2NN6B 2EN2A 2EPUA 1FWLA 1A1GA 4LFCI 4DR2I 3WU3A 2EMCA 3RMPA 5K36A 2PRTA 3THOB 5IV8B 5C0XA 4DV3E 2JOXA 4DV4E 5AC5A 4LF6I 2BR2A 2RSIA 5IT9C 4AIMA 3IWBA 2NUEA 2O1TA 2L2MA 1HK7A 1T4LB 3PS1A 1YPNA 2GS8A 2EPNA 1A1LA 3QT7A 4GQUA 2EMZA 3B8HA 4Q35B 1ELOA 4JI3E 3MHSC 4MU0A 4K0KE 2EMGA 4L8NA 1Z0GA 4RPFA 2BBGA 2VF1A 3CDJA 4NXNE 5JEAA 1ZR9A 4MLVA 2JT2A 4X65E 2CG9A 4DPXA 5JEAB 2E5LI 1TF3A 4DPYA 1GTKA 1HR0E 1RC7A 5IWAE 2C39B 2EMKA 2DEIA 5DNXA 3KZZA 4BHBA 3HQ1A 1HNXE 1T4NA 4YHHE 2EM2A 4FW3A 4IZKA 1Y6ZA 2HK2A 3WU5A 4IFDD 2J7KA 2N3GA 2MKNA 4AM3A 1PJSA 3C6MA 3C6KA 4F9CB 2R42A 4USMA 2FV4B 1VI7A 2K4VA 3GMEA 4JI1I 1S16A 2YU8A 3M85D 2B7TA 1A1IA 1IBLI 2EL6A 1DI2A 4LF4E 2JWOA 1Z0WA 4AQYE 3J7AM 1N32E 2BB8A 2JR1A 4J8ZA 4QNKA 3J80Q 2RSMA 3KWRA 2JP9A 3EPKA 2EOZA 2HKJA 2FGGA 1G2FC 1UDOA 3PRYA 1PVGA 2V8PA 1BBGA 2B7VA 2L3JA 4UTGA 4DXLA 3ZZ0A 2EPPA 3PYDA 5TSEA 2LJUA 1IQOA 3V5RA 4BC9A 2GO3A 2WBTA 3P3EA 4OO1D 1ZM9A 2EOFA 4R2SA 1RHYA 3J81Q 3HJCA 4BMJA 2EM9A 1PJQA 3HXLA 1EH8A 4JYAE 5K36D 2CZ9A 2NN6E 2LO3A 2YT4A 2BM0A 2VQEE 1WHQA 1KKHA 2PNMA 3P3GA 3PYFA 5C0XD 2IESA 2LBSB 2BA0D 5K36E 5BR8I 2HK3A 5GMDA 4DV1E 2EN6A 1J5EI 4LU9A 3PS3A 4GKJI 1IBMI 1H7SA 4IZJA 3T1HI 4LF9I 5AASA 4IZJB 1UEKA 4X66I 2V34A 4NXME 3WU6A 5CFFE 2EQ1A 2DLKA 3ZKDA 4WSGA 3AV0A 5JEAD 1A1FA 1Z0EA 4LTYA 3K6QA 1X5WA 1MGTA 2EPAA 2XEXA 2V86A 5AE1A 4X62E 5JEAE 4R03A 2BA1G 2MC5A 2CGEA 4LFBI 4LF6E 4X9JA 2BM1A 3ADIA 2F1DA 4MU3A 2R1FA 2LTRA 4HACA 2EOHA 5IXMB 4DV0I 2MDGA 4HACB 4DR6E 4DUZI 2ELYA 1YYOA 4B3MI 2VESA 4WPYA 1EH6A 2DMYA 4ZYEA 4DR3I 4DR5I 1YYKA 2IOQA 2WCC3 3LPSA 3J7Yp 2RQLA 2L2KB 1XNQI 2M4IA 1STUA 2EMLA 1MG7A 2GLIA 5KL7A 4MDTA 4P7AA 1YSAC 4DR1E 1U2RA 2EMAA 1ZXMA 3H09A 2ADRA 2EMXA 1N34I 3J80C 4B3SI 4OX9I 4X64I 2PO1B 3V2UC 5AC4A 2I9IA 1G2DC 5GMEA 2UU9I 3DF6A 3QT5A 4DR7I 2RS6A 4JI1E 4DPUA 1QNTA 1WXRA 1IBLE 3ZZTA 1JK1A 3PYGA 5LMUI 4P7DA 3NZKA 1XHKA 2V89A 2VRDA 2V2QA 1H74A 1K47A 1JK2A 2N3HA 2YTGA 2EFGA 2ZM6I 2V8QB 1Y60A 4LFAI 3J81C 1WHNA 2LRSA 2ODRD 1Y4UA 2R3VA 2WBUA 4M2ZA 3K85A 3B78A 2A2DA 4DV6I 4F9BB 2NN6A 4I3HA 2UUCI 2EM3A 2L92A 4URLA 5ADZA 4IZJD 1XNRI 2EOMA 2NPFA 5LMNI 2LE2A 4IS9A 2DLQA 3DD6A 4KQVA 5FWKA 2L6MA 1Z5CA 1NZ0A 1ZM4A 4DMIA 1YUJA 1ZXNA 2EMYA 2OI2A 2LJHA 1AH5A 4R2QA 3T1YI 1E3PA 3JU0A 4DUZE 4MYUA 1N3GA 2YRKA 1NHIA 1NCSA 1O0WA 1QZRA 1Z5AA 3ADLA 3CWVA 5KL4A 5EL9A 4DV7I 5BR8E 4OO1C 3LMLA 3F6GA 1B69A 4OO1F 1YH8A 4O43A 2UUAI 1H73A 4LCGA 1UILA 1J5EE 4GKJE 1I94I 3K17A 2C39A 4LF9E 2HGHA 5T6JA 4B3RE 3B4TA 1N36I 2WW4A 4ZVIA 5C0XC 4X66E 3THNA 3HPZA 1Z0TA 4USKA 3TQMA 2JE6B 5C0XF 3Q6MA 1FJGI 2A25A 3M85G 3B82A 3M99B 1X48A 3EPJA 4TUIA 2UXBI 2C38B 2PO2B 2F4VE 4JI5I 4DV5E 2EWLA 4BHCA 3PYEA 2WBSA 4FWGA 1VISA 5AE2A 1EA6A 2ZBKB 3ZM7A 2L33A 2LTSA 1NEIA 2YU5A 3ADJA 4LPFA 5DRRA 1LLMC 4LFBE 4LF8E 2Z5CB 1EI1A 2YRHA 5KL2A 2GPIA 4JI0I 2D9HA 4QNJA 2EN7A 4R2EA 4BS9A 5DRQA 4DV0E 2GQ0A 4JI8I 3GONA 2YTIA 4B3ME 3BIDA 1P47A 1B62A 2JYAA 4JI6I 3M7NG 4DR3E 4DR5E 5A2QQ 4MU4A 4BA2B 2UXDI 1HNZE 2WNRB 4Z7CA 2WP8B 4DUYI 4M9VC 4MU1A 2CPNA 2EOIA 1MEYC 3GLLA 4R2PA 1P42A 4KZSA 2NN6D 4BA1B 1UDSA 1FI4A 2BA0G 4O5GA 4OOGC 5ELWA 4HYMA 2YSOA 1PIEA 2HFUA 1N34E 4B3SE 4OX9E 2UXCE 4J3DA 4X64E 5DROA 2HHHI 1A1HA 3AUZA 2YWQA 4TUGA 4F9AB 2WZOA 1KVKA 2UU9E 5LLQA 3EPHA 1FKAE 4DR7E 2Z5BB 2EM6A 2L8TA 2EN4A 2M1SA 3JAMQ 4JI4I 1HNWI 2RS7A 4ZYGA 2N8XA 1XXEA 5LMUE 1RMDA 2C37A 2B3TB 1X6HA 2J7JA 2VE7C 4JI7E 2C37B 4LFAE 1T4OA 4PU9A 2ZM6E 4DV3I 2DB2A 2EOSA 2KHXA 2EPXA 2KOUA 2YPNA 2CVEA 4DV6E 4DPWA 4LF7I 3QT6A 1KYQA 2ENAA 3ZOQB 1USVA 5A69A 2VQFI 1WUUA 4HEIA 2UUCE 3WU4A 4F6MA 4R2DA 1AAYA 4LFCE 3Q6NA 2LUQA 4DR2E 1YFHA 1XNRE 3HTXA 4IJDA 4OKGA 4DPTA 2EN8A 2ENCA 5LMNE 5KL5A 4LF5I 2ODRC 4DR4I 2L2NA 4PRVA 4ZYDA 2CSHA 4P78A 3H4LA 2MC6A 4Z7YA 1YHCA 3M6AA 4X65I 5KL3A 1ZM3A 2PO0B 2Z5EA 4DU7A 2EN1A 1OYPA 5IWAI 3P3CA 4GKKI 1SFEA 4N4RB 1A6FA 2EJ4A 4LCFA 3OMLA 3LNUA 4O24A 4R2RA 2EM0A 3H1CA 5A6JA 2JPAA 2ZITA 5DNYA 2PNZB 2JXPA 5FLXC 2UUAE 4ED4A 1EH7A 2EOJA 2EMIA 4FK5C 4WXDA 2EM4A 4IS1C 2E5LE 4LCHA 1N33I 2X7IA 2MDRA 1NHHA 1N36E 2DGCA 4R8OA 2LJPA 4R1FA 1FJGE 4KWYA 3HPSA 2PO1A 1GZ6A 2AE8A 3UK3C 2UXBE 4EMDA 4MYTA 4JI5E 3HULA 4F6NA 1BBOA 2KONA 2IERA 2NUGA 1X3CA 4WUBA 5A2QC 2LT7A 1R6LA 3F0NA 4YY3I 3L7ZB 1DGCA 2RTXA 2YTEA 1T39A 4IFDC 4M0VA 1QU6A 4IFDF 4IFDB 3J7AG 2E72A 2JEBB 3BGHA 2YRMA 4JI8E 1WRJA 1FWKA 2EPOA 1WJPA 1YUIA 4JI6E 2EMBA 1DARA 3KRNA 1XMQI 1UN6B 2YTPA 2UXDE 3K1JA 2YTOA 2I13A 2EL4A 3JAMC 2NA2A 2YZTA 4WXCA 2O1UA 1RREA 4FWDA 1A1KA 4MLQA 2AJ4A 2FTXB
chains in the Genus database with same CATH topology
1MX0A 4BCAA 4DKKA 4WFTA 2F8BA 3FIGA 2HHHE 1SR9A 2E1RA 2JVAA 4DV2I 1ZBQA 4XTJA 2BV3A 1DQ3A 1YYWA 1S4EA 2DEJA 1NHJA 1Z0BA 2PNLA 3Q1QA 2VF3A 1IBME 3T1HE 4X62I 1ZM2A 4LF7E 4N3OA 2VQFE 2G7HA 3ADGA 2NUFA 4DR6I 5FLXQ 4B3TI 4HY1A 1XMOI 2Z5CA 1H7UA 4WYQB 2IHR1 4LF5E 4M1KA 4DR4E 1D6TA 1J26A 1Z0VA 2IOPA 3VYXA 4WSPA 1N0UA 4JV5I 3QT8A 1Y4SA 3ZKBA 4BC7A 1IBKI 5LL6R 4GKKE 4BBYA 4IZKB 3VK6A 4FW9A 1XNQE 3D4JA 3OTOE 1N33E 2O1VA 2E1MA 4Q28A 4P52A 2O1WA 4JI2I 3P1XA 3VYYA 1OJ4A 4DU8A 1PKPA 1X47A 2UUBI 4UT4A 3MSWA 1FNMA 2Z5BA 4KHPI 2V2VA 4M30A 4YY3E 4F54A 2A2CA 4DV4I 1EKZA 3C4TA 2EZ6A 3LLHA 4I8OA 4GEQB 1XMQE 2DSYA 4JI3I 2V83A 1Z5BA 4K0KI 5F3WA 2B9DA 4NXNI 1YZ9A 5IT9Q 3T1YE 4B3RI 1HR0I 1UHZA 2DIXA 1HNXI 4YHHI 2M7QA 2V85A 4DV2E 1GQEA 2V88A 4L5NC 4DV7E 1Z0CA 2H36X 1X49A 2F4VI 1KTVA 4DV5I 2JY9A 4FWHA 1I94E 4FN5A 3F6HA 4WUDA 4LF4I 4LF8I 4AQYI 1N32I 4X8WA 2V87A 3IWDA 2Q2EB 1KIJA 4PRXA 4B3TE 1BKNA 1XMOE 5L3JA 4JG4A 1N0VC 2L3CA 1HNZI 3IWCA 2JOBA 1ZBTA 4JI0E 4JV5E 1RQ0A 2LMZA 2LUPB 1MU5A 1IBKE 4JYAI 2UXCI 3JTZA 2HFSA 4DUYE 2VQEI 3C4BA 1Z59A 5AE3A 3LTOA 1RR9A 2X36A 4DV1I 2V2ZA 1USUA 4JI2E 4HXZA 1B63A 4WUCA 3ZZUA 2HKEA 2UUBE 1H72C 3DJWA 3P06A 4JI7I 4NXMI 4JI4E 4KHPE 1HNWE 1FWLA 4LFCI 4DR2I 3WU3A 3RMPA 4DV3E 2JOXA 4DV4E 4LF6I 5IT9C 3IWBA 2NUEA 2O1TA 2L2MA 1HK7A 1T4LB 2GS8A 3QT7A 3B8HA 1ELOA 4JI3E 4K0KE 4L8NA 1Z0GA 4RPFA 2VF1A 4NXNE 4X65E 2CG9A 4DPXA 2E5LI 4DPYA 1HR0E 1RC7A 5IWAE 4DR1I 2DEIA 4IZKA 3HQ1A 1HNXE 1T4NA 4YHHE 1Y6ZA 2HK2A 3WU5A 2J7KA 2N3GA 4F9CB 4USMA 2R42A 2FV4B 2K4VA 4JI1I 1S16A 2B7TA 1IBLI 1DI2A 4LF4E 2JWOA 1Z0WA 4AQYE 3J7AM 1N32E 2JR1A 4J8ZA 3J80Q 2RSMA 3KWRA 2HKJA 2FGGA 3PRYA 1PVGA 2V8PA 2B7VA 2L3JA 4UTGA 4DXLA 3ZZ0A 3PYDA 3V5RA 4BC9A 1ZM9A 3J81Q 3HJCA 4BMJA 3HXLA 4JYAE 2CZ9A 4DUZI 2YT4A 2BM0A 2VQEE 1WHQA 1KKHA 2PNMA 3PYFA 2LBSB 5BR8I 2HK3A 5GMDA 4DV1E 1J5EI 4LU9A 4GKJI 1IBMI 1H7SA 4IZJA 3T1HI 4LF9I 5AASA 4IZJB 1UEKA 4X66I 2V34A 4NXME 3WU6A 5CFFE 3ZKDA 3AV0A 1Z0EA 4LTYA 3K6QA 2XEXA 2V86A 5AE1A 4X62E 4R03A 2MC5A 2CGEA 4LFBI 4LF6E 2BM1A 3ADIA 2LTRA 4HACA 4DV0I 4HACB 4DR6E 4B3MI 1YYOA 4WPYA 4DR3I 2DMYA 4DR5I 1YYKA 2IOQA 3LPSA 3J7Yp 2L2KB 1XNQI 2M4IA 1STUA 1MG7A 4P7AA 4DR1E 1U2RA 1ZXMA 3H09A 1N34I 3J80C 4B3SI 4OX9I 4X64I 3V2UC 5GMEA 2UU9I 3DF6A 3QT5A 4DR7I 2RS6A 4JI1E 4DPUA 1WXRA 1IBLE 3ZZTA 3PYGA 5LMUI 4P7DA 1XHKA 2V89A 2V2QA 1H74A 1K47A 4LFAI 2N3HA 2EFGA 2ZM6I 2V8QB 3J81C 1WHNA 2LRSA 2ODRD 1Y4UA 2R3VA 4M2ZA 3K85A 4DV6I 3B78A 2A2DA 4F9BB 4I3HA 2UUCI 2L92A 4URLA 5ADZA 4IZJD 1XNRI 2NPFA 5LMNI 2LE2A 4KQVA 5FWKA 2L6MA 1Z5CA 1NZ0A 1ZM4A 4DMIA 1ZXNA 2OI2A 2LJHA 3T1YI 3JU0A 4DUZE 4MYUA 1NHIA 1O0WA 1QZRA 1Z5AA 3ADLA 3CWVA 4DV7I 5BR8E 3LMLA 3F6GA 2UUAI 1H73A 1UILA 1J5EE 4GKJE 1I94I 3K17A 4LF9E 5T6JA 4B3RE 1N36I 2WW4A 4ZVIA 4X66E 3HPZA 1Z0TA 4USKA 3Q6MA 1FJGI 3B82A 1X48A 2UXBI 4TUIA 2F4VE 4JI5I 4DV5E 2EWLA 3PYEA 4FWGA 1VISA 1EA6A 5AE2A 2ZBKB 3ZM7A 2L33A 2LTSA 3ADJA 4LFBE 4LF8E 2Z5CB 1EI1A 4JI0I 4BS9A 4DV0E 2GQ0A 4JI8I 3GONA 4B3ME 4JI6I 1B62A 4DR3E 4DR5E 5A2QQ 2UXDI 1HNZE 4Z7CA 4DUYI 2CPNA 4KZSA 1FI4A 4OOGC 4HYMA 1PIEA 2HFUA 1N34E 4B3SE 4OX9E 2UXCE 2HHHI 4X64E 3AUZA 4TUGA 4F9AB 2WZOA 1KVKA 2UU9E 2Z5BB 4JI4I 1FKAE 4DR7E 3JAMQ 1HNWI 2L8TA 2M1SA 2RS7A 5LMUE 2B3TB 2VE7C 4JI7E 4LFAE 1T4OA 4PU9A 2ZM6E 4DV3I 2DB2A 2KHXA 2KOUA 4DPWA 4LF7I 4DV6E 3QT6A 3ZOQB 1USVA 2VQFI 1WUUA 2UUCE 3WU4A 4LFCE 3Q6NA 2LUQA 4DR2E 1XNRE 3HTXA 4DPTA 5LMNE 4LF5I 2ODRC 4DR4I 2L2NA 4PRVA 4P78A 3H4LA 2MC6A 4Z7YA 4X65I 3M6AA 1ZM3A 2Z5EA 4DU7A 5IWAI 4GKKI 1A6FA 3OMLA 3LNUA 2ZITA 5DNYA 5FLXC 3OTOI 2UUAE 4ED4A 1N33I 2E5LE 2X7IA 2MDRA 1NHHA 1N36E 4R8OA 2LJPA 4R1FA 1FJGE 3HPSA 1GZ6A 2UXBE 4EMDA 4MYTA 4JI5E 3HULA 2KONA 2NUGA 4WUBA 5A2QC 3F0NA 4YY3I 2RTXA 4M0VA 1QU6A 3J7AG 4JI8E 1FWKA 4JI6E 1DARA 1XMQI 2UXDE 3K1JA 3JAMC 2NA2A 2YZTA 2O1UA 1RREA 4FWDA 2AJ4A 2FTXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX0 A;  4DKK A;  4WFT A;  2HHH E;  2E1R A;  2JVA A;  4DV2 I;  4XTJ A;  2BV3 A;  1YYW A;  1S4E A;  2DEJ A;  1NHJ A;  1Z0B A;  3Q1Q A;  2VF3 A;  1IBM E;  3T1H E;  4X62 I;  1ZM2 A;  4LF7 E;  2VQF E;  3ADG A;  2NUF A;  4DR6 I;  5FLX Q;  4B3T I;  4HY1 A;  1XMO I;  1H7U A;  4WYQ B;  2IHR 1;  4LF5 E;  4M1K A;  4DR4 E;  1D6T A;  1J26 A;  1Z0V A;  3VYX A;  1N0U A;  4JV5 I;  3QT8 A;  3ZKB A;  1IBK I;  4GKK E;  5LL6 R;  4FW9 A;  1XNQ E;  3D4J A;  3OTO E;  1N33 E;  4P52 A;  4JI2 I;  3P1X A;  3VYY A;  1OJ4 A;  4DU8 A;  1PKP A;  1X47 A;  2UUB I;  4UT4 A;  1FNM A;  4KHP I;  2V2V A;  4M30 A;  4YY3 E;  2A2C A;  4DV4 I;  1EKZ A;  3C4T A;  2EZ6 A;  3LLH A;  1XMQ E;  4JI3 I;  1Z5B A;  4K0K I;  4NXN I;  1YZ9 A;  5IT9 Q;  3T1Y E;  4B3R I;  1HR0 I;  1UHZ A;  2DIX A;  1HNX I;  4YHH I;  4DV2 E;  1GQE A;  4DV7 E;  1Z0C A;  1X49 A;  2F4V I;  1KTV A;  4DV5 I;  2JY9 A;  4FWH A;  1I94 E;  4FN5 A;  4WUD A;  4LF4 I;  4LF8 I;  4AQY I;  1N32 I;  4X8W A;  2Q2E B;  1KIJ A;  4PRX A;  4B3T E;  1BKN A;  1XMO E;  5L3J A;  4JG4 A;  1N0V C;  2L3C A;  1HNZ I;  1ZBT A;  4JI0 E;  4JV5 E;  1RQ0 A;  2LUP B;  1MU5 A;  1IBK E;  4JYA I;  2UXC I;  2HFS A;  4DUY E;  2VQE I;  3C4B A;  1Z59 A;  3LTO A;  1RR9 A;  2X36 A;  4DV1 I;  2V2Z A;  4JI2 E;  4HXZ A;  1B63 A;  4WUC A;  3ZZU A;  2HKE A;  2UUB E;  1H72 C;  4JI7 I;  4NXM I;  4JI4 E;  4KHP E;  1HNW E;  1FWL A;  4LFC I;  4DR2 I;  3WU3 A;  4DV3 E;  4DV4 E;  4LF6 I;  5IT9 C;  2NUE A;  2L2M A;  1T4L B;  2GS8 A;  3QT7 A;  3B8H A;  1ELO A;  4JI3 E;  4K0K E;  1Z0G A;  4RPF A;  4NXN E;  4X65 E;  4DPX A;  2E5L I;  4DPY A;  1HR0 E;  1RC7 A;  5IWA E;  4DR1 I;  2DEI A;  1HNX E;  1T4N A;  4YHH E;  2HK2 A;  3WU5 A;  2J7K A;  2N3G A;  4USM A;  2R42 A;  4JI1 I;  1S16 A;  2B7T A;  1IBL I;  1DI2 A;  4LF4 E;  1Z0W A;  4AQY E;  3J7A M;  1N32 E;  3J80 Q;  2RSM A;  2HKJ A;  1PVG A;  2V8P A;  2B7V A;  2L3J A;  4UTG A;  4DXL A;  3ZZ0 A;  3PYD A;  3V5R A;  1ZM9 A;  3J81 Q;  4JYA E;  2CZ9 A;  4DUZ I;  2YT4 A;  2BM0 A;  2VQE E;  1WHQ A;  1KKH A;  3PYF A;  2LBS B;  5BR8 I;  2HK3 A;  5GMD A;  4DV1 E;  1J5E I;  4GKJ I;  1IBM I;  1H7S A;  3T1H I;  4LF9 I;  1UEK A;  4X66 I;  2V34 A;  4NXM E;  3WU6 A;  5CFF E;  3ZKD A;  1Z0E A;  2XEX A;  4X62 E;  4LFB I;  4LF6 E;  2BM1 A;  3ADI A;  2LTR A;  4HAC A;  4DV0 I;  4HAC B;  4DR6 E;  4B3M I;  1YYO A;  4DR3 I;  2DMY A;  4DR5 I;  1YYK A;  3LPS A;  3J7Y p;  2L2K B;  1XNQ I;  1STU A;  1MG7 A;  4P7A A;  4DR1 E;  1U2R A;  1ZXM A;  1N34 I;  3J80 C;  4B3S I;  4OX9 I;  4X64 I;  3V2U C;  5GME A;  2UU9 I;  3QT5 A;  4DR7 I;  2RS6 A;  4JI1 E;  4DPU A;  1IBL E;  3ZZT A;  3PYG A;  5LMU I;  1XHK A;  2V2Q A;  1H74 A;  1K47 A;  4LFA I;  2N3H A;  2EFG A;  2ZM6 I;  3J81 C;  1WHN A;  2LRS A;  4DV6 I;  2R3V A;  4M2Z A;  3B78 A;  2A2D A;  4I3H A;  2UUC I;  4URL A;  1XNR I;  2NPF A;  5LMN I;  4KQV A;  1Z5C A;  1NZ0 A;  1ZM4 A;  1ZXN A;  2OI2 A;  2LJH A;  3T1Y I;  4DUZ E;  4MYU A;  1NHI A;  1O0W A;  1QZR A;  1Z5A A;  3ADL A;  3CWV A;  4DV7 I;  5BR8 E;  2UUA I;  1H73 A;  1UIL A;  1J5E E;  4GKJ E;  1I94 I;  3K17 A;  4LF9 E;  4B3R E;  1N36 I;  2WW4 A;  4ZVI A;  4X66 E;  1Z0T A;  4USK A;  1FJG I;  3B82 A;  1X48 A;  2UXB I;  2F4V E;  4JI5 I;  4DV5 E;  3PYE A;  4FWG A;  1VIS A;  1EA6 A;  2ZBK B;  3ZM7 A;  2L33 A;  2LTS A;  3ADJ A;  4LFB E;  4LF8 E;  1EI1 A;  4JI0 I;  4DV0 E;  4JI8 I;  3GON A;  4B3M E;  4JI6 I;  1B62 A;  4DR3 E;  4DR5 E;  5A2Q Q;  2UXD I;  1HNZ E;  4Z7C A;  4DUY I;  2CPN A;  1FI4 A;  4OOG C;  4HYM A;  1PIE A;  2HFU A;  1N34 E;  4B3S E;  4OX9 E;  2UXC E;  2HHH I;  4X64 E;  1KVK A;  2UU9 E;  4JI4 I;  1FKA E;  4DR7 E;  3JAM Q;  1HNW I;  2RS7 A;  5LMU E;  2B3T B;  4JI7 E;  4LFA E;  1T4O A;  4PU9 A;  2ZM6 E;  4DV3 I;  2DB2 A;  2KHX A;  4DPW A;  4LF7 I;  4DV6 E;  3QT6 A;  2VQF I;  1WUU A;  2UUC E;  3WU4 A;  4LFC E;  2LUQ A;  4DR2 E;  1XNR E;  3HTX A;  4DPT A;  5LMN E;  4LF5 I;  4DR4 I;  2L2N A;  4PRV A;  3H4L A;  4X65 I;  4Z7Y A;  3M6A A;  1ZM3 A;  4DU7 A;  5IWA I;  4GKK I;  1A6F A;  3LNU A;  2ZIT A;  5FLX C;  3OTO I;  2UUA E;  4ED4 A;  1N33 I;  2E5L E;  2X7I A;  2MDR A;  1NHH A;  1N36 E;  2LJP A;  4R1F A;  1FJG E;  2UXB E;  4EMD A;  4MYT A;  4JI5 E;  3HUL A;  2NUG A;  4WUB A;  5A2Q C;  3F0N A;  4YY3 I;  2RTX A;  1QU6 A;  3J7A G;  4JI8 E;  1FWK A;  4JI6 E;  1DAR A;  1XMQ I;  2UXD E;  3K1J A;  3JAM C;  2NA2 A;  1RRE A;  4FWD A;  2AJ4 A; 
#chains in the Genus database with same CATH topology
 1MX0 A;  4BCA A;  4DKK A;  2EPL X;  4WFT A;  2EL5 A;  2F8B A;  3KZY A;  3BF2 A;  3FIG A;  2YTJ A;  2HHH E;  1BB8 A;  1SR9 A;  2ENH A;  2EOE A;  2JVA A;  2E1R A;  4DV2 I;  1ZU1 A;  1ZBQ A;  2EE8 A;  2BV3 A;  1DQ3 A;  1YYW A;  1S4E A;  2NN6 C;  4FW4 A;  2DEJ A;  4XTJ A;  4OO1 B;  2NN6 F;  2HJJ A;  1NHJ A;  4R2A A;  1Z0B A;  2PNL A;  3Q1Q A;  2VF3 A;  1IBM E;  5K36 C;  2EPR A;  3T1H E;  2LV2 A;  4X62 I;  5K36 F;  5K36 B;  2EOQ A;  2JE6 A;  1ZM2 A;  3CDI A;  5A6B A;  5A6K A;  5C0X B;  4LF7 E;  4N3O A;  5KL6 A;  2C38 A;  2PO2 A;  4DR1 I;  4F2J C;  2BR2 B;  2YSP A;  2VQF E;  2G7H A;  3ADG A;  4O4K A;  2NUF A;  4DR6 I;  5FLX Q;  4B3T I;  2EN3 A;  4R2C A;  2EM8 A;  2YTD A;  2DRP A;  4HY1 A;  2YTQ A;  2Z5C A;  4NBQ A;  1XMO I;  3U1K A;  1H7U A;  4WYQ B;  2IHR 1;  4LF5 E;  4M1K A;  4DR4 E;  1D6T A;  3VHT B;  5JEA C;  1J26 A;  4GZN C;  1Z0V A;  2IOP A;  1OYR A;  3VYX A;  4WSP A;  5JEA F;  1N0U A;  1TN9 A;  4JV5 I;  1OYS A;  2LVH A;  1Y4S A;  3QT8 A;  3ZKB A;  4BC7 A;  2EPC A;  1IBK I;  4BA2 A;  2M9A A;  5LL6 R;  4GKK E;  4BBY A;  3EPL A;  2WNR A;  4IZK B;  2WP8 A;  2EM7 A;  3VK6 A;  3UHM A;  4FW9 A;  1XNQ E;  3D4J A;  3HKM A;  3OTO E;  1N33 E;  4BA1 A;  2O1V A;  2E1M A;  4Q28 A;  1E3H A;  4IFD E;  4P52 A;  2O1W A;  4JI2 I;  3P1X A;  3VYY A;  4NHR A;  1OJ4 A;  4DU8 A;  2LCE A;  1PKP A;  1X47 A;  2EP3 A;  2EPK X;  2UUB I;  4UT4 A;  3MSW A;  2CTD A;  1FNM A;  2Z5B A;  4KHP I;  1ZAA C;  2EPZ A;  2JEA A;  2V2V A;  3GCM A;  1PDA A;  4M30 A;  2R76 A;  4YY3 E;  4F54 A;  3EQ1 A;  2JEA B;  4LOM A;  4ISA A;  2EOO A;  4U3B A;  2A2C A;  2GO4 A;  1KJK A;  4OZE A;  2K7I A;  2EMH A;  2EOX A;  1UBD C;  4DV4 I;  1EKZ A;  3M7N D;  3C4T A;  5EKW A;  2EQ0 A;  2EZ6 A;  2NAB A;  3LLH A;  2YTF A;  4I8O A;  4GEQ B;  1XMQ E;  4OO1 E;  1A1J A;  3OTO I;  1X6F A;  3P76 A;  1L4S A;  3PS2 A;  2RPC A;  5A6B D;  2DSY A;  4JI3 I;  2V83 A;  1Z5B A;  4K0K I;  5F3W A;  2O3Z A;  2B9D A;  2DMI A;  1UDN A;  4NXN I;  5C0X E;  2EPM X;  1YZ9 A;  1Y5Y A;  5IT9 Q;  2PO0 A;  3T1Y E;  2HC5 A;  4B3R I;  1HR0 I;  1UHZ A;  2DIX A;  1HNX I;  2EM5 A;  4YHH I;  2M7Q A;  2V85 A;  4DV2 E;  1GQE A;  2V88 A;  4L5N C;  4DV7 E;  2PNZ A;  2EMF A;  2H36 X;  1Z0C A;  4FW6 A;  1X49 A;  2F4V I;  1KTV A;  1R6M A;  4DV5 I;  2JY9 A;  4FWH A;  1I94 E;  4FN5 A;  4U3D A;  2CT1 A;  3F6H A;  2ELZ A;  3L00 A;  4WUD A;  4LF4 I;  4FW5 A;  1PJT A;  1IMU A;  2EOR A;  4AQY I;  1T38 A;  5DNL A;  4LF8 I;  1N32 I;  1Z1B A;  4HTG A;  4X8W A;  2V87 A;  2BA1 D;  2YTN A;  4MQY A;  3IWD A;  2Q2E B;  1X6E A;  2GHF A;  2Q8U A;  1KIJ A;  3L7Z A;  2EMW A;  4B3T E;  4PRX A;  1BKN A;  4AID A;  1XMO E;  5L3J A;  4JG4 A;  1N0V C;  2L3C A;  2J65 A;  1HNZ I;  3IWC A;  4IFD A;  2JEB A;  2JOB A;  1ZBT A;  4JI0 E;  4RH8 A;  5DRP A;  4ZYH A;  1IQS A;  4JV5 E;  1RQ0 A;  2LMZ A;  2LUP B;  1MU5 A;  1IBK E;  4JYA I;  1UDQ A;  2UXC I;  3JTZ A;  2HFS A;  4DUY E;  2VQE I;  2MKD A;  3ECR A;  3C4B A;  3MHH C;  5AE3 A;  1Z59 A;  3LTO A;  1TF6 A;  1RR9 A;  2X36 A;  4DV1 I;  2V2Z A;  3U1Y A;  1USU A;  4JI2 E;  4HXZ A;  1B63 A;  4WUC A;  1F2I G;  3ZZU A;  2EQ3 A;  2HKE A;  2UUB E;  1H72 C;  2EOY A;  3DJW A;  5A6A A;  3P06 A;  3QG5 C;  4JI7 I;  4NXM I;  4RHB B;  4FW7 A;  4WX9 A;  4JI4 E;  4KHP E;  1HNW E;  4OO1 A;  4NZV A;  3BBG A;  2NN6 B;  2EN2 A;  2EPU A;  1FWL A;  1A1G A;  4LFC I;  4DR2 I;  3WU3 A;  2EMC A;  3RMP A;  5K36 A;  2PRT A;  3THO B;  5IV8 B;  5C0X A;  4DV3 E;  2JOX A;  4DV4 E;  5AC5 A;  4LF6 I;  2BR2 A;  2RSI A;  5IT9 C;  4AIM A;  3IWB A;  2NUE A;  2O1T A;  2L2M A;  1HK7 A;  1T4L B;  3PS1 A;  1YPN A;  2GS8 A;  2EPN A;  1A1L A;  3QT7 A;  4GQU A;  2EMZ A;  3B8H A;  4Q35 B;  1ELO A;  4JI3 E;  3MHS C;  4MU0 A;  4K0K E;  2EMG A;  4L8N A;  1Z0G A;  4RPF A;  2BBG A;  2VF1 A;  3CDJ A;  4NXN E;  5JEA A;  1ZR9 A;  4MLV A;  2JT2 A;  4X65 E;  2CG9 A;  4DPX A;  5JEA B;  2E5L I;  1TF3 A;  4DPY A;  1GTK A;  1HR0 E;  1RC7 A;  5IWA E;  2C39 B;  2EMK A;  2DEI A;  5DNX A;  3KZZ A;  4BHB A;  3HQ1 A;  1HNX E;  1T4N A;  4YHH E;  2EM2 A;  4FW3 A;  4IZK A;  1Y6Z A;  2HK2 A;  3WU5 A;  4IFD D;  2J7K A;  2N3G A;  2MKN A;  4AM3 A;  1PJS A;  3C6M A;  3C6K A;  4F9C B;  2R42 A;  4USM A;  2FV4 B;  1VI7 A;  2K4V A;  3GME A;  4JI1 I;  1S16 A;  2YU8 A;  3M85 D;  2B7T A;  1A1I A;  1IBL I;  2EL6 A;  1DI2 A;  4LF4 E;  2JWO A;  1Z0W A;  4AQY E;  3J7A M;  1N32 E;  2BB8 A;  2JR1 A;  4J8Z A;  4QNK A;  3J80 Q;  2RSM A;  3KWR A;  2JP9 A;  3EPK A;  2EOZ A;  2HKJ A;  2FGG A;  1G2F C;  1UDO A;  3PRY A;  1PVG A;  2V8P A;  1BBG A;  2B7V A;  2L3J A;  4UTG A;  4DXL A;  3ZZ0 A;  2EPP A;  3PYD A;  5TSE A;  2LJU A;  1IQO A;  3V5R A;  4BC9 A;  2GO3 A;  2WBT A;  3P3E A;  4OO1 D;  1ZM9 A;  2EOF A;  4R2S A;  1RHY A;  3J81 Q;  3HJC A;  4BMJ A;  2EM9 A;  1PJQ A;  3HXL A;  1EH8 A;  4JYA E;  5K36 D;  2CZ9 A;  2NN6 E;  2LO3 A;  2YT4 A;  2BM0 A;  2VQE E;  1WHQ A;  1KKH A;  2PNM A;  3P3G A;  3PYF A;  5C0X D;  2IES A;  2LBS B;  2BA0 D;  5K36 E;  5BR8 I;  2HK3 A;  5GMD A;  4DV1 E;  2EN6 A;  1J5E I;  4LU9 A;  3PS3 A;  4GKJ I;  1IBM I;  1H7S A;  4IZJ A;  3T1H I;  4LF9 I;  5AAS A;  4IZJ B;  1UEK A;  4X66 I;  2V34 A;  4NXM E;  3WU6 A;  5CFF E;  2EQ1 A;  2DLK A;  3ZKD A;  4WSG A;  3AV0 A;  5JEA D;  1A1F A;  1Z0E A;  4LTY A;  3K6Q A;  1X5W A;  1MGT A;  2EPA A;  2XEX A;  2V86 A;  5AE1 A;  4X62 E;  5JEA E;  4R03 A;  2BA1 G;  2MC5 A;  2CGE A;  4LFB I;  4LF6 E;  4X9J A;  2BM1 A;  3ADI A;  2F1D A;  4MU3 A;  2R1F A;  2LTR A;  4HAC A;  2EOH A;  5IXM B;  4DV0 I;  2MDG A;  4HAC B;  4DR6 E;  4DUZ I;  2ELY A;  1YYO A;  4B3M I;  2VES A;  4WPY A;  1EH6 A;  2DMY A;  4ZYE A;  4DR3 I;  4DR5 I;  1YYK A;  2IOQ A;  2WCC 3;  3LPS A;  3J7Y p;  2RQL A;  2L2K B;  1XNQ I;  2M4I A;  1STU A;  2EML A;  1MG7 A;  2GLI A;  5KL7 A;  4MDT A;  4P7A A;  1YSA C;  4DR1 E;  1U2R A;  2EMA A;  1ZXM A;  3H09 A;  2ADR A;  2EMX A;  1N34 I;  3J80 C;  4B3S I;  4OX9 I;  4X64 I;  2PO1 B;  3V2U C;  5AC4 A;  2I9I A;  1G2D C;  5GME A;  2UU9 I;  3DF6 A;  3QT5 A;  4DR7 I;  2RS6 A;  4JI1 E;  4DPU A;  1QNT A;  1WXR A;  1IBL E;  3ZZT A;  1JK1 A;  3PYG A;  5LMU I;  4P7D A;  3NZK A;  1XHK A;  2V89 A;  2VRD A;  2V2Q A;  1H74 A;  1K47 A;  1JK2 A;  2N3H A;  2YTG A;  2EFG A;  2ZM6 I;  2V8Q B;  1Y60 A;  4LFA I;  3J81 C;  1WHN A;  2LRS A;  2ODR D;  1Y4U A;  2R3V A;  2WBU A;  4M2Z A;  3K85 A;  3B78 A;  2A2D A;  4DV6 I;  4F9B B;  2NN6 A;  4I3H A;  2UUC I;  2EM3 A;  2L92 A;  4URL A;  5ADZ A;  4IZJ D;  1XNR I;  2EOM A;  2NPF A;  5LMN I;  2LE2 A;  4IS9 A;  2DLQ A;  3DD6 A;  4KQV A;  5FWK A;  2L6M A;  1Z5C A;  1NZ0 A;  1ZM4 A;  4DMI A;  1YUJ A;  1ZXN A;  2EMY A;  2OI2 A;  2LJH A;  1AH5 A;  4R2Q A;  3T1Y I;  1E3P A;  3JU0 A;  4DUZ E;  4MYU A;  1N3G A;  2YRK A;  1NHI A;  1NCS A;  1O0W A;  1QZR A;  1Z5A A;  3ADL A;  3CWV A;  5KL4 A;  5EL9 A;  4DV7 I;  5BR8 E;  4OO1 C;  3LML A;  3F6G A;  1B69 A;  4OO1 F;  1YH8 A;  4O43 A;  2UUA I;  1H73 A;  4LCG A;  1UIL A;  1J5E E;  4GKJ E;  1I94 I;  3K17 A;  2C39 A;  4LF9 E;  2HGH A;  5T6J A;  4B3R E;  3B4T A;  1N36 I;  2WW4 A;  4ZVI A;  5C0X C;  4X66 E;  3THN A;  3HPZ A;  1Z0T A;  4USK A;  3TQM A;  2JE6 B;  5C0X F;  3Q6M A;  1FJG I;  2A25 A;  3M85 G;  3B82 A;  3M99 B;  1X48 A;  3EPJ A;  4TUI A;  2UXB I;  2C38 B;  2PO2 B;  2F4V E;  4JI5 I;  4DV5 E;  2EWL A;  4BHC A;  3PYE A;  2WBS A;  4FWG A;  1VIS A;  5AE2 A;  1EA6 A;  2ZBK B;  3ZM7 A;  2L33 A;  2LTS A;  1NEI A;  2YU5 A;  3ADJ A;  4LPF A;  5DRR A;  1LLM C;  4LFB E;  4LF8 E;  2Z5C B;  1EI1 A;  2YRH A;  5KL2 A;  2GPI A;  4JI0 I;  2D9H A;  4QNJ A;  2EN7 A;  4R2E A;  4BS9 A;  5DRQ A;  4DV0 E;  2GQ0 A;  4JI8 I;  3GON A;  2YTI A;  4B3M E;  3BID A;  1P47 A;  1B62 A;  2JYA A;  4JI6 I;  3M7N G;  4DR3 E;  4DR5 E;  5A2Q Q;  4MU4 A;  4BA2 B;  2UXD I;  1HNZ E;  2WNR B;  4Z7C A;  2WP8 B;  4DUY I;  4M9V C;  4MU1 A;  2CPN A;  2EOI A;  1MEY C;  3GLL A;  4R2P A;  1P42 A;  4KZS A;  2NN6 D;  4BA1 B;  1UDS A;  1FI4 A;  2BA0 G;  4O5G A;  4OOG C;  5ELW A;  4HYM A;  2YSO A;  1PIE A;  2HFU A;  1N34 E;  4B3S E;  4OX9 E;  2UXC E;  4J3D A;  4X64 E;  5DRO A;  2HHH I;  1A1H A;  3AUZ A;  2YWQ A;  4TUG A;  4F9A B;  2WZO A;  1KVK A;  2UU9 E;  5LLQ A;  3EPH A;  1FKA E;  4DR7 E;  2Z5B B;  2EM6 A;  2L8T A;  2EN4 A;  2M1S A;  3JAM Q;  4JI4 I;  1HNW I;  2RS7 A;  4ZYG A;  2N8X A;  1XXE A;  5LMU E;  1RMD A;  2C37 A;  2B3T B;  1X6H A;  2J7J A;  2VE7 C;  4JI7 E;  2C37 B;  4LFA E;  1T4O A;  4PU9 A;  2ZM6 E;  4DV3 I;  2DB2 A;  2EOS A;  2KHX A;  2EPX A;  2KOU A;  2YPN A;  2CVE A;  4DV6 E;  4DPW A;  4LF7 I;  3QT6 A;  1KYQ A;  2ENA A;  3ZOQ B;  1USV A;  5A69 A;  2VQF I;  1WUU A;  4HEI A;  2UUC E;  3WU4 A;  4F6M A;  4R2D A;  1AAY A;  4LFC E;  3Q6N A;  2LUQ A;  4DR2 E;  1YFH A;  1XNR E;  3HTX A;  4IJD A;  4OKG A;  4DPT A;  2EN8 A;  2ENC A;  5LMN E;  5KL5 A;  4LF5 I;  2ODR C;  4DR4 I;  2L2N A;  4PRV A;  4ZYD A;  2CSH A;  4P78 A;  3H4L A;  2MC6 A;  4Z7Y A;  1YHC A;  3M6A A;  4X65 I;  5KL3 A;  1ZM3 A;  2PO0 B;  2Z5E A;  4DU7 A;  2EN1 A;  1OYP A;  5IWA I;  3P3C A;  4GKK I;  1SFE A;  4N4R B;  1A6F A;  2EJ4 A;  4LCF A;  3OML A;  3LNU A;  4O24 A;  4R2R A;  2EM0 A;  3H1C A;  5A6J A;  2JPA A;  2ZIT A;  5DNY A;  2PNZ B;  2JXP A;  5FLX C;  2UUA E;  4ED4 A;  1EH7 A;  2EOJ A;  2EMI A;  4FK5 C;  4WXD A;  2EM4 A;  4IS1 C;  2E5L E;  4LCH A;  1N33 I;  2X7I A;  2MDR A;  1NHH A;  1N36 E;  2DGC A;  4R8O A;  2LJP A;  4R1F A;  1FJG E;  4KWY A;  3HPS A;  2PO1 A;  1GZ6 A;  2AE8 A;  3UK3 C;  2UXB E;  4EMD A;  4MYT A;  4JI5 E;  3HUL A;  4F6N A;  1BBO A;  2KON A;  2IER A;  2NUG A;  1X3C A;  4WUB A;  5A2Q C;  2LT7 A;  1R6L A;  3F0N A;  4YY3 I;  3L7Z B;  1DGC A;  2RTX A;  2YTE A;  1T39 A;  4IFD C;  4M0V A;  1QU6 A;  4IFD F;  4IFD B;  3J7A G;  2E72 A;  2JEB B;  3BGH A;  2YRM A;  4JI8 E;  1WRJ A;  1FWK A;  2EPO A;  1WJP A;  1YUI A;  4JI6 E;  2EMB A;  1DAR A;  3KRN A;  1XMQ I;  1UN6 B;  2YTP A;  2UXD E;  3K1J A;  2YTO A;  2I13 A;  2EL4 A;  3JAM C;  2NA2 A;  2YZT A;  4WXC A;  2O1U A;  1RRE A;  4FWD A;  1A1K A;  4MLQ A;  2AJ4 A;  2FTX B; 
#chains in the Genus database with same CATH homology
 1MX0 A;  4BCA A;  4DKK A;  4WFT A;  2F8B A;  3FIG A;  2HHH E;  1SR9 A;  2E1R A;  2JVA A;  4DV2 I;  1ZBQ A;  4XTJ A;  2BV3 A;  1DQ3 A;  1YYW A;  1S4E A;  2DEJ A;  1NHJ A;  1Z0B A;  2PNL A;  3Q1Q A;  2VF3 A;  1IBM E;  3T1H E;  4X62 I;  1ZM2 A;  4LF7 E;  4N3O A;  2VQF E;  2G7H A;  3ADG A;  2NUF A;  4DR6 I;  5FLX Q;  4B3T I;  4HY1 A;  1XMO I;  2Z5C A;  1H7U A;  4WYQ B;  2IHR 1;  4LF5 E;  4M1K A;  4DR4 E;  1D6T A;  1J26 A;  1Z0V A;  2IOP A;  3VYX A;  4WSP A;  1N0U A;  4JV5 I;  3QT8 A;  1Y4S A;  3ZKB A;  4BC7 A;  1IBK I;  5LL6 R;  4GKK E;  4BBY A;  4IZK B;  3VK6 A;  4FW9 A;  1XNQ E;  3D4J A;  3OTO E;  1N33 E;  2O1V A;  2E1M A;  4Q28 A;  4P52 A;  2O1W A;  4JI2 I;  3P1X A;  3VYY A;  1OJ4 A;  4DU8 A;  1PKP A;  1X47 A;  2UUB I;  4UT4 A;  3MSW A;  1FNM A;  2Z5B A;  4KHP I;  2V2V A;  4M30 A;  4YY3 E;  4F54 A;  2A2C A;  4DV4 I;  1EKZ A;  3C4T A;  2EZ6 A;  3LLH A;  4I8O A;  4GEQ B;  1XMQ E;  2DSY A;  4JI3 I;  2V83 A;  1Z5B A;  4K0K I;  5F3W A;  2B9D A;  4NXN I;  1YZ9 A;  5IT9 Q;  3T1Y E;  4B3R I;  1HR0 I;  1UHZ A;  2DIX A;  1HNX I;  4YHH I;  2M7Q A;  2V85 A;  4DV2 E;  1GQE A;  2V88 A;  4L5N C;  4DV7 E;  1Z0C A;  2H36 X;  1X49 A;  2F4V I;  1KTV A;  4DV5 I;  2JY9 A;  4FWH A;  1I94 E;  4FN5 A;  3F6H A;  4WUD A;  4LF4 I;  4LF8 I;  4AQY I;  1N32 I;  4X8W A;  2V87 A;  3IWD A;  2Q2E B;  1KIJ A;  4PRX A;  4B3T E;  1BKN A;  1XMO E;  5L3J A;  4JG4 A;  1N0V C;  2L3C A;  1HNZ I;  3IWC A;  2JOB A;  1ZBT A;  4JI0 E;  4JV5 E;  1RQ0 A;  2LMZ A;  2LUP B;  1MU5 A;  1IBK E;  4JYA I;  2UXC I;  3JTZ A;  2HFS A;  4DUY E;  2VQE I;  3C4B A;  1Z59 A;  5AE3 A;  3LTO A;  1RR9 A;  2X36 A;  4DV1 I;  2V2Z A;  1USU A;  4JI2 E;  4HXZ A;  1B63 A;  4WUC A;  3ZZU A;  2HKE A;  2UUB E;  1H72 C;  3DJW A;  3P06 A;  4JI7 I;  4NXM I;  4JI4 E;  4KHP E;  1HNW E;  1FWL A;  4LFC I;  4DR2 I;  3WU3 A;  3RMP A;  4DV3 E;  2JOX A;  4DV4 E;  4LF6 I;  5IT9 C;  3IWB A;  2NUE A;  2O1T A;  2L2M A;  1HK7 A;  1T4L B;  2GS8 A;  3QT7 A;  3B8H A;  1ELO A;  4JI3 E;  4K0K E;  4L8N A;  1Z0G A;  4RPF A;  2VF1 A;  4NXN E;  4X65 E;  2CG9 A;  4DPX A;  2E5L I;  4DPY A;  1HR0 E;  1RC7 A;  5IWA E;  4DR1 I;  2DEI A;  4IZK A;  3HQ1 A;  1HNX E;  1T4N A;  4YHH E;  1Y6Z A;  2HK2 A;  3WU5 A;  2J7K A;  2N3G A;  4F9C B;  4USM A;  2R42 A;  2FV4 B;  2K4V A;  4JI1 I;  1S16 A;  2B7T A;  1IBL I;  1DI2 A;  4LF4 E;  2JWO A;  1Z0W A;  4AQY E;  3J7A M;  1N32 E;  2JR1 A;  4J8Z A;  3J80 Q;  2RSM A;  3KWR A;  2HKJ A;  2FGG A;  3PRY A;  1PVG A;  2V8P A;  2B7V A;  2L3J A;  4UTG A;  4DXL A;  3ZZ0 A;  3PYD A;  3V5R A;  4BC9 A;  1ZM9 A;  3J81 Q;  3HJC A;  4BMJ A;  3HXL A;  4JYA E;  2CZ9 A;  4DUZ I;  2YT4 A;  2BM0 A;  2VQE E;  1WHQ A;  1KKH A;  2PNM A;  3PYF A;  2LBS B;  5BR8 I;  2HK3 A;  5GMD A;  4DV1 E;  1J5E I;  4LU9 A;  4GKJ I;  1IBM I;  1H7S A;  4IZJ A;  3T1H I;  4LF9 I;  5AAS A;  4IZJ B;  1UEK A;  4X66 I;  2V34 A;  4NXM E;  3WU6 A;  5CFF E;  3ZKD A;  3AV0 A;  1Z0E A;  4LTY A;  3K6Q A;  2XEX A;  2V86 A;  5AE1 A;  4X62 E;  4R03 A;  2MC5 A;  2CGE A;  4LFB I;  4LF6 E;  2BM1 A;  3ADI A;  2LTR A;  4HAC A;  4DV0 I;  4HAC B;  4DR6 E;  4B3M I;  1YYO A;  4WPY A;  4DR3 I;  2DMY A;  4DR5 I;  1YYK A;  2IOQ A;  3LPS A;  3J7Y p;  2L2K B;  1XNQ I;  2M4I A;  1STU A;  1MG7 A;  4P7A A;  4DR1 E;  1U2R A;  1ZXM A;  3H09 A;  1N34 I;  3J80 C;  4B3S I;  4OX9 I;  4X64 I;  3V2U C;  5GME A;  2UU9 I;  3DF6 A;  3QT5 A;  4DR7 I;  2RS6 A;  4JI1 E;  4DPU A;  1WXR A;  1IBL E;  3ZZT A;  3PYG A;  5LMU I;  4P7D A;  1XHK A;  2V89 A;  2V2Q A;  1H74 A;  1K47 A;  4LFA I;  2N3H A;  2EFG A;  2ZM6 I;  2V8Q B;  3J81 C;  1WHN A;  2LRS A;  2ODR D;  1Y4U A;  2R3V A;  4M2Z A;  3K85 A;  4DV6 I;  3B78 A;  2A2D A;  4F9B B;  4I3H A;  2UUC I;  2L92 A;  4URL A;  5ADZ A;  4IZJ D;  1XNR I;  2NPF A;  5LMN I;  2LE2 A;  4KQV A;  5FWK A;  2L6M A;  1Z5C A;  1NZ0 A;  1ZM4 A;  4DMI A;  1ZXN A;  2OI2 A;  2LJH A;  3T1Y I;  3JU0 A;  4DUZ E;  4MYU A;  1NHI A;  1O0W A;  1QZR A;  1Z5A A;  3ADL A;  3CWV A;  4DV7 I;  5BR8 E;  3LML A;  3F6G A;  2UUA I;  1H73 A;  1UIL A;  1J5E E;  4GKJ E;  1I94 I;  3K17 A;  4LF9 E;  5T6J A;  4B3R E;  1N36 I;  2WW4 A;  4ZVI A;  4X66 E;  3HPZ A;  1Z0T A;  4USK A;  3Q6M A;  1FJG I;  3B82 A;  1X48 A;  2UXB I;  4TUI A;  2F4V E;  4JI5 I;  4DV5 E;  2EWL A;  3PYE A;  4FWG A;  1VIS A;  1EA6 A;  5AE2 A;  2ZBK B;  3ZM7 A;  2L33 A;  2LTS A;  3ADJ A;  4LFB E;  4LF8 E;  2Z5C B;  1EI1 A;  4JI0 I;  4BS9 A;  4DV0 E;  2GQ0 A;  4JI8 I;  3GON A;  4B3M E;  4JI6 I;  1B62 A;  4DR3 E;  4DR5 E;  5A2Q Q;  2UXD I;  1HNZ E;  4Z7C A;  4DUY I;  2CPN A;  4KZS A;  1FI4 A;  4OOG C;  4HYM A;  1PIE A;  2HFU A;  1N34 E;  4B3S E;  4OX9 E;  2UXC E;  2HHH I;  4X64 E;  3AUZ A;  4TUG A;  4F9A B;  2WZO A;  1KVK A;  2UU9 E;  2Z5B B;  4JI4 I;  1FKA E;  4DR7 E;  3JAM Q;  1HNW I;  2L8T A;  2M1S A;  2RS7 A;  5LMU E;  2B3T B;  2VE7 C;  4JI7 E;  4LFA E;  1T4O A;  4PU9 A;  2ZM6 E;  4DV3 I;  2DB2 A;  2KHX A;  2KOU A;  4DPW A;  4LF7 I;  4DV6 E;  3QT6 A;  3ZOQ B;  1USV A;  2VQF I;  1WUU A;  2UUC E;  3WU4 A;  4LFC E;  3Q6N A;  2LUQ A;  4DR2 E;  1XNR E;  3HTX A;  4DPT A;  5LMN E;  4LF5 I;  2ODR C;  4DR4 I;  2L2N A;  4PRV A;  4P78 A;  3H4L A;  2MC6 A;  4Z7Y A;  4X65 I;  3M6A A;  1ZM3 A;  2Z5E A;  4DU7 A;  5IWA I;  4GKK I;  1A6F A;  3OML A;  3LNU A;  2ZIT A;  5DNY A;  5FLX C;  3OTO I;  2UUA E;  4ED4 A;  1N33 I;  2E5L E;  2X7I A;  2MDR A;  1NHH A;  1N36 E;  4R8O A;  2LJP A;  4R1F A;  1FJG E;  3HPS A;  1GZ6 A;  2UXB E;  4EMD A;  4MYT A;  4JI5 E;  3HUL A;  2KON A;  2NUG A;  4WUB A;  5A2Q C;  3F0N A;  4YY3 I;  2RTX A;  4M0V A;  1QU6 A;  3J7A G;  4JI8 E;  1FWK A;  4JI6 E;  1DAR A;  1XMQ I;  2UXD E;  3K1J A;  3JAM C;  2NA2 A;  2YZT A;  2O1U A;  1RRE A;  4FWD A;  2AJ4 A;  2FTX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...