4NXME

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4nxmE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxmE02
1QU6A 1A6FA 4DV6E 2BM1A 1KKHA 4YHHE 1DARA 4WUBA 3QT6A 1XMQI 3PYEA 2LUQA 4B3SE 1HNXE 3K17A 4DV7E 1GQEA 2X36A 4DV4I 4JI6I 4DUYE 1IBLE 2UUBE 2VQEE 1MX0A 4JI8E 5BR8E 3ZZ0A 4K0KE 2CZ9A 2GS8A 4LFCI 2UU9E 4DU8A 1YYWA 1ZXNA 1KVKA 1NHHA 4DR3I 4DPYA 4DXLA 1ZM4A 2EFGA 2HHHI 2UXBI 2IHR1 1FJGE 3J81C 1FNMA 3OTOI 4OX9E 5GMEA 1WHQA 4DV3E 1NHIA 4JI4E 3ADGA 4DR6I 4FWHA 2VQFI 1I94E 1Z0TA 4DV3I 4USMA 3J7AG 4X65E 4DUZE 2YT4A 5IT9Q 1HNZI 4USKA 1I94I 4DU7A 4JI0I 3F0NA 1IBKI 1Z0WA 4DPWA 2MDRA 1H7UA 3C4BA 3C4TA 4DR4E 1U2RA 5LL6R 3V5RA 2V2ZA 3VYXA 3J80Q 4X64E 3ZM7A 3PYFA 4LF7E 4JI7I 2UXDI 3J81Q 3LLHA 4JI5I 4DV7I 2L3CA 4LFBI 2B7TA 2HKEA 4YHHI 2F4VI 2DEIA 4OOGC 2HFUA 1ZM3A 3LNUA 4LF6I 4DR5I 1ZBTA 3QT5A 2V2QA 4DR1E 4B3SI 1UEKA 2NUFA 2HK3A 3VYYA 2B3TB 2J7KA 4PRXA 4DV5E 4DV1E 4DUZI 1RR9A 2VQEI 2V2VA 4DR4I 1Z0EA 4X62E 1EI1A 2OI2A 4UT4A 1B62A 1Z59A 3ZKDA 1FJGI 4DV2E 2LTSA 4LFAI 2UXCI 4JV5E 1H72C 2DMYA 1T4OA 4KHPI 2UXCE 4JYAE 4URLA 4DV6I 4FW9A 4DR7E 4WYQB 4JI3I 1XNRI 1HNZE 1N33I 4OX9I 1BKNA 3ADIA 2LRSA 4M1KA 4JI3E 3GONA 4K0KI 3T1YE 1FWKA 3HTXA 1MG7A 4X65I 4LFCE 4JI6E 2ZM6I 1Z5CA 2JY9A 2WW4A 4AQYI 4DV0E 1K47A 4LFBE 1FWLA 1WHNA 2LBSB 3B78A 5LMNE 4LFAE 4NXNE 2F4VE 2HKJA 4JV5I 4LF5E 1YYKA 2LTRA 4LF6E 2LJHA 4JI2I 4LF9I 1H7SA 4NXNI 2LUPB 4KHPE 1WUUA 4P52A 5LMNI 1S16A 2V34A 1RREA 2X7IA 4B3MI 2Q2EB 2L2MA 2CPNA 4LF4I 2EZ6A 4DR1I 1ZM2A 2UUBI 3D4JA 2L2NA 4JI0E 4DV1I 4Z7YA 4DV5I 4JI4I 1J5EE 4XTJA 2DB2A 2ZITA 4LF8E 2E5LE 1NZ0A 4YY3I 5FLXC 2UUAE 2LJPA 4JI1E 2NUGA 1XMQE 2L2KB 4LF9E 1YZ9A 4I3HA 5LMUI 4EMDA 4WUCA 1DI2A 4MYUA 1N0VC 3B82A 5LMUE 1B63A 4DKKA 3QT7A 4PRVA 4WUDA 4GKKE 4PU9A 3J7AM 4DPUA 4GKKI 1J5EI 2XEXA 1H73A 1IBLI 3WU4A 1N36I 4M30A 1RQ0A 3JAMQ 2R3VA 4LF5I 3ZKBA 4GKJE 3J7Yp 4DR2I 4JI1I 4DV0I 5IWAI 2HHHE 2UXBE 4GKJI 2B7VA 1XNQE 1FI4A 2BV3A 1Z0GA 1HNWE 1X48A 2AJ4A 4JI5E 1XMOE 1T4LB 1RC7A 4RPFA 1X47A 3LTOA 2KHXA 2NUEA 3QT8A 4DR7I 5BR8I 4DR6E 1QZRA 4HXZA 4B3TE 2NPFA 4NXME 1IBME 1O0WA 3ADJA 1N34E 3PYDA 4HACA 1UILA 1ELOA 4HACB 4P7AA 1IBMI 2A2CA 2UUAI 4DV2I 4X8WA 1N0UA 2A2DA 2R42A 4M2ZA 4JG4A 3WU6A 3JAMC 3H4LA 3ADLA 1N33E 3V2UC 1MU5A 2VQFE 5GMDA 1HNXI 4DR5E 4DUYI 2ZBKB 4B3TI 4R1FA 4X66I 1N32E 4JI8I 4YY3E 2HK2A 1EKZA 4DPTA 1N34I 1NHJA 4WFTA 4KQVA 1ZM9A 4AQYE 4X64I 3B8HA 2RS7A 1X49A 1PKPA 1H74A 2HFSA 4X62I 5IWAE 4UTGA 5A2QC 3HULA 1Z0CA 2N3HA 1HNWI 2V8PA 1J26A 4HY1A 3LPSA 3J80C 3P1XA 4B3ME 4JYAI 2DEJA 3K1JA 1PIEA 2L33A 5FLXQ 1S4EA 4B3RE 1ZXMA 3ZZUA 3T1HI 2E1RA 1XNRE 1Z5AA 5CFFE 1VISA 2NA2A 5IT9C 1T4NA 5L3JA 1D6TA 3WU3A 4LF8I 2E5LI 2L3JA 4JI7E 1IBKE 3Q1QA 1Z5BA 4MYTA 2UUCI 2ZM6E 4DR3E 1HR0I 1OJ4A 1STUA 1XNQI 1PVGA 2UUCE 2JVAA 1KIJA 2UU9I 1Z0BA 1XMOI 4DR2E 4HYMA 2BM0A 1YYOA 4LF4E 3M6AA 4JI2E 1EA6A 3CWVA 4Z7CA 4FWGA 1N32I 4DV4E 4B3RI 3T1HE 1Z0VA 2VF3A 3OTOE 2RSMA 3T1YI 4NXMI 4ZVIA 5A2QQ 1XHKA 1UHZA 3PYGA 4FN5A 2N3GA 4X66E 1KTVA 1N36E 4DPXA 4ED4A 2RS6A 4FWDA 1HR0E 2RTXA 2DIXA 2UXDE 4LF7I 3ZZTA 3WU5A 1FKAE
chains in the Genus database with same CATH superfamily
5A69A 4BA2B 1QU6A 1A6FA 4DV6E 2IESA 2BM1A 2C38A 1KKHA 2EOZA 1X3CA 4YHHE 2E1MA 1DARA 4MDTA 2DGCA 4WUBA 4RH8A 3QT6A 3EPKA 3PYEA 1XMQI 4GEQB 3EPHA 2LUQA 4B3SE 2EMHA 1HNXE 3K17A 4DV7E 2YU8A 1GQEA 2X36A 4OZEA 4DV4I 1GZ6A 4JI6I 4DUYE 5AE3A 1TF6A 2JE6A 2PNMA 3PS3A 4IS9A 1IBLE 2UUBE 2YTFA 2VQEE 1N3GA 1MX0A 2NN6B 2EMKA 4ZYEA 4RHBB 5BR8E 4JI8E 2EL4A 1R6MA 2V8QB 3MSWA 3ZZ0A 4K0KE 2EOEA 2NN6A 4WXCA 2CZ9A 1P47A 2GS8A 4LFCI 2F8BA 4KZSA 2UU9E 4DU8A 2PO1B 4OO1C 2EMXA 4R2SA 1YYWA 1ZXNA 2EPMX 1KVKA 1QNTA 2V87A 4WPYA 4R2QA 1NHHA 5ELWA 4DR3I 3PS2A 3ECRA 4R2DA 4DPYA 1DGCA 2GO4A 5K36E 2EL5A 4LCFA 1EH8A 1Z1BA 2WBUA 4DXLA 1ZM4A 2EFGA 4BS9A 2HHHI 2UXBI 2IHR1 2V83A 5K36D 1FJGE 4IZJD 3J81C 3Q6NA 4FW7A 2EN8A 5AC4A 1A1FA 1FNMA 2PO0B 3OTOI 4LTYA 2Z5BA 4OX9E 5GMEA 1WHQA 4DV3E 1NHIA 4JI4E 4MQYA 3ADGA 2VRDA 3M99B 2L6MA 3QG5C 4DR6I 1YUJA 4MU4A 2Z5EA 4FWHA 2VQFI 1I94E 3K85A 1Z0TA 3J7AG 2GO3A 4OO1A 4USMA 4X65E 4DV3I 4DUZE 2YT4A 5KL7A 5IT9Q 2BA1D 2F1DA 1HNZI 4USKA 1TF3A 2GQ0A 1I94I 4DU7A 4JI0I 3F0NA 1IBKI 2WCC3 3AV0A 1Z0WA 4DPWA 2MDRA 4ZYGA 1H7UA 2LVHA 3C4BA 3C4TA 4DR4E 1U2RA 3CDIA 3HJCA 4HEIA 2EMCA 5LL6R 2JEBB 3V5RA 2YTOA 2V2ZA 3THOB 2BB8A 3VYXA 4GZNC 2EM4A 1YSAC 2EPZA 4MU0A 3J80Q 4X64E 2NN6F 3ZM7A 3PYFA 5IXMB 4BA1B 2Z5CA 5C0XC 4LF7E 4JI7I 3BF2A 2EM6A 2UXDI 2C38B 3J81Q 1YHCA 3LLHA 2DLQA 2ENHA 1LLMC 2JOBA 2I13A 4JI5I 5K36B 4DV7I 2L3CA 1ZR9A 4IFDE 4LFBI 2B7TA 2M1SA 2HKEA 4YHHI 2F4VI 2DEIA 4OOGC 2HFUA 5JEAA 2CT1A 2HJJA 2YRHA 4IFDB 3P06A 2WZOA 1ZM3A 1X6FA 3LNUA 2BR2A 4DR5I 5FWKA 4LF6I 1ZBTA 2GLIA 2V2QA 4DR1E 3QT5A 1UEKA 4B3SI 1UN6B 2NUFA 2HK3A 2PO0A 3VYYA 2B3TB 2J7KA 4LCGA 4DV1E 4DV5E 4PRXA 4NBQA 4OKGA 4DUZI 2BA1G 2YU5A 1RR9A 2DRPA 2VQEI 2O1TA 1X5WA 2EOSA 2M9AA 4FW5A 2V2VA 1NCSA 4DR4I 4IFDA 1JK1A 5JEAB 4ISAA 1IQSA 1BBOA 4TUGA 3HPZA 1Y4SA 1Z0EA 4X62E 2M7QA 1EI1A 2OI2A 3MHSC 3PS1A 4UT4A 2EPCA 5A6JA 2MKNA 4AIMA 1B62A 1Z59A 3GLLA 5KL5A 4DV2E 3ZKDA 2LTSA 1FJGI 3KZZA 2IOQA 4LFAI 2UXCI 4JV5E 1H72C 4L8NA 3LMLA 2DMYA 1T4OA 2YRMA 2CG9A 4KHPI 2UXCE 4JYAE 1USVA 4NHRA 4URLA 3GCMA 4DV6I 2WNRB 4FW9A 4DR7E 2LCEA 3U1YA 4WYQB 2V88A 4JI3I 2JYAA 1XNRI 1HNZE 1N33I 3NZKA 4OX9I 2D9HA 1X6HA 2EN7A 2YZTA 1BKNA 3ADIA 2LRSA 4P7DA 2EPPA 4BCAA 2J65A 2I9IA 1VI7A 4M1KA 4JI3E 2YSOA 3GONA 4K0KI 3T1YE 1KJKA 1FWKA 5JEAE 2VE7C 3HTXA 1MG7A 1SFEA 4X65I 3HXLA 3EPLA 4JI6E 1ZBQA 2EOQA 4LFCE 2ZM6I 5K36C 1OYSA 1Z5CA 2JY9A 2ADRA 2EOFA 2EPRA 4LPFA 5AE1A 2BBGA 2LV2A 2WW4A 2JP9A 1Y6ZA 3Q6MA 3VK6A 4QNKA 4AQYI 4DV0E 1K47A 2J7JA 4IFDD 2EM8A 4LFBE 1FWLA 1WHNA 3BBGA 3C6MA 4J8ZA 2LBSB 3B78A 1WJPA 2EPOA 1MEYC 5LMNE 4LFAE 4NXNE 2F4VE 2HKJA 5DRRA 4F6MA 2YTNA 2EMIA 4LF5E 1YYKA 4JV5I 3M7NG 2LTRA 3HPSA 2LJHA 4LF6E 2C39A 4BMJA 4JI2I 2PNZB 4LF9I 1H7SA 3C6KA 2LUPB 4KHPE 3RMPA 1G2FC 1WUUA 4P52A 4NXNI 5LMNI 1S16A 2R76A 2H36X 2O3ZA 2V34A 4WXDA 4FW6A 2YSPA 1UDOA 4F9BB 1RREA 2X7IA 4B3MI 2ENCA 1OYPA 2Q2EB 2L2MA 3BIDA 2CPNA 1PJQA 4LF4I 3L7ZA 1A1LA 5C0XB 4BBYA 2EZ6A 4DR1I 1FKAE 1ZM2A 2UUBI 3D4JA 2DSYA 2L2NA 5A6AA 4JI0E 4DV1I 4Z7YA 4DV5I 4JI4I 5DNYA 1J5EE 2ENAA 2EM2A 4XTJA 1EH7A 2EN4A 2DB2A 2IOPA 1A1JA 2V86A 2ZITA 4LF8E 2E5LE 2RQLA 2ELYA 1YH8A 3K6QA 1NZ0A 4MU1A 4N4RB 4YY3I 4FK5C 2EOIA 3IWCA 5TSEA 5FLXC 2JPAA 3HQ1A 4F2JC 2UUAE 2LJPA 5DROA 1EH6A 4O24A 1SR9A 4JI1E 4IFDC 4Q35B 5LLQA 3CDJA 2NUGA 1Y60A 1XMQE 4BHCA 2L2KB 4LF9E 4OO1D 1YZ9A 1ZAAC 4I3HA 5LMUI 4EMDA 2G7HA 4WUCA 1DI2A 4MYUA 2EM3A 1N0VC 2O1VA 3B82A 4QNJA 4LU9A 1NEIA 2YTDA 5LMUE 1B63A 2MC6A 4DKKA 3QT7A 4PRVA 2A25A 4WUDA 1DQ3A 5C0XD 4GKKE 4F54A 1MGTA 3F6GA 4PU9A 3J7AM 2EE8A 5K36A 2PNZA 1A1GA 1E3PA 2C39B 4DPUA 1T39A 4GKKI 1J5EI 5AC5A 2Z5CB 5DNXA 2XEXA 3DJWA 1H73A 2PNLA 1IBLI 3H1CA 4J3DA 5EL9A 1UDNA 3WU4A 2JEBA 1N36I 4MLVA 4M30A 1RQ0A 2LJUA 2EMLA 2LMZA 4HTGA 2EN3A 2R3VA 3JAMQ 1WRJA 4LF5I 3B4TA 3ZKBA 4R03A 2C37A 2EP3A 4GKJE 3J7Yp 4LCHA 4DR2I 4L5NC 4OO1E 2LO3A 4FW4A 2EORA 4BC7A 4F9CB 4JI1I 5IWAI 4DV0I 1RHYA 2HHHE 2UXBE 3AUZA 4GKJI 2B7VA 1GTKA 2EMFA 1XNQE 1FI4A 4MU3A 4IZKA 4AM3A 2BV3A 1Z0GA 2EMAA 1HK7A 1HNWE 1X48A 2EMZA 3JTZA 2AJ4A 2NN6E 4JI5E 4I8OA 2WBTA 3M85D 2M4IA 1XMOE 1T4LB 1RC7A 2YTGA 4RPFA 2O1WA 1X47A 3LTOA 4IJDA 2EMWA 1TN9A 2YWQA 2KHXA 2PRTA 2WNRA 2LT7A 5EKWA 2CVEA 2JEAB 2NUEA 4M9VC 2WP8A 4TUIA 2R1FA 5T6JA 5JEAC 3QT8A 3PRYA 2FGGA 3U1KA 4DR7I 2YTIA 2IERA 4R2PA 5BR8I 4O43A 4DR6E 2EN2A 1QZRA 4HXZA 4O5GA 4B3TE 2AE8A 4R2EA 4U3BA 5AASA 5DNLA 2NPFA 4NXME 2EOYA 1PJTA 2N8XA 1A1KA 1IBME 2JT2A 5C0XA 4OO1B 5KL3A 1O0WA 2EOJA 3ADJA 2EMBA 2MC5A 4NZVA 3GMEA 1N34E 3L7ZB 3PYDA 4HACA 2BA0G 4N3OA 1UILA 4KWYA 2EM9A 1ELOA 4HACB 4P7AA 5KL2A 1IBMI 4F9AB 3DF6A 1KYQA 2JXPA 2ODRC 2A2CA 2EQ1A 2EPUA 2YTJA 2EPKX 2EM5A 2ODRD 3UHMA 2UUAI 4R2RA 2E72A 2JWOA 3P3EA 4WSGA 4DV2I 5KL4A 2CGEA 2EN1A 2HGHA 2WBSA 5AE2A 4X8WA 1A1IA 1BB8A 1N0UA 2NABA 2A2DA 2PO2A 5K36F 3P3CA 2R42A 2VF1A 4M2ZA 2BR2B 3DD6A 4JG4A 3WU6A 2WP8B 3JAMC 1IMUA 3H4LA 4X9JA 3UK3C 1BBGA 3ADLA 2KOUA 1N33E 3V2UC 1MU5A 2VQFE 1R6LA 5GMDA 5JEAD 1HNXI 2B9DA 1XXEA 4BHBA 1F2IG 4DR5E 2CTDA 2HC5A 4DUYI 2EL6A 2DLKA 4DMIA 2ZBKB 4GQUA 2DMIA 4R1FA 4B3TI 2K4VA 4X66I 2EOXA 3IWBA 1N32E 2K7IA 2EOOA 4JI8I 2YTQA 4YY3E 2HK2A 2EPNA 1EKZA 4DPTA 1N34I 5A6BD 1PJSA 1NHJA 2JE6B 2LE2A 3HKMA 1ZU1A 2V89A 4WFTA 4KQVA 4R8OA 2C37B 1ZM9A 2CSHA 4AQYE 2PO2B 1RMDA 2L92A 4X64I 3B8HA 4Q28A 2RS7A 1UDQA 1X49A 3EPJA 1PKPA 1H74A 3VHTB 2EPLX 2RPCA 2HFSA 4X62I 5IWAE 4UTGA 5A2QC 4O4KA 4BA1A 1X6EA 2EOMA 3HULA 2EM7A 1Z0CA 2MKDA 2N3HA 1P42A 5A6BA 1HNWI 4ZYDA 2EQ0A 2V8PA 1J26A 4HY1A 4BA2A 1G2DC 4WX9A 3LPSA 2VESA 3J80C 1UBDC 3ZOQB 3P1XA 4B3ME 1PDAA 2YTPA 3IWDA 2NN6D 4JYAI 3MHHC 1YUIA 2DEJA 5JEAF 3K1JA 3JU0A 1PIEA 2L33A 5FLXQ 2JOXA 1S4EA 4BC9A 5KL6A 4B3RE 1ZXMA 2EJ4A 3ZZUA 2E1RA 3T1HI 3M7ND 1XNRE 4AIDA 3THNA 2FTXB 5F3WA 1Z5AA 5DRPA 5CFFE 2FV4B 1VISA 4R2CA 2NA2A 5IT9C 1T4NA 5L3JA 1Y5YA 3P76A 1D6TA 3WU3A 4LF8I 2E5LI 2L3JA 2YRKA 4JI7E 4R2AA 1IBKE 3Q1QA 1Z5BA 4MYTA 5DRQA 2PO1A 2UUCI 2EPXA 2JR1A 2ZM6E 1A1HA 3EQ1A 1L4SA 4DR3E 2EWLA 1AH5A 1HR0I 2EOHA 1OJ4A 1STUA 2Q8UA 5A6KA 1Y4UA 1XNQI 1YPNA 5C0XF 3KZYA 1T38A 1PVGA 2UUCE 2NN6C 2JVAA 2YPNA 3BGHA 2EMGA 1KIJA 2UU9I 3L00A 4IZJB 1Z0BA 1XMOI 4DR2E 1IQOA 4HYMA 2ELZA 2EM0A 4M0VA 4WSPA 4IZJA 5C0XE 4OO1F 4P78A 3FIGA 2EN6A 2L8TA 2MDGA 1YYOA 1USUA 2BM0A 2EPAA 4LF4E 3M6AA 1AAYA 4JI2E 3P3GA 1B69A 2BA0D 2JEAA 3H09A 1EA6A 3CWVA 4Z7CA 2GHFA 3F6HA 1JK2A 4FWGA 1WXRA 1N32I 4DV4E 1UDSA 4B3RI 3T1HE 3KWRA 1Z0VA 2VF3A 4LOMA 3OTOE 1OYRA 2RSMA 3T1YI 2EQ3A 4ZYHA 4NXMI 4ZVIA 4U3DA 5ADZA 3TQMA 1E3HA 1XHKA 1UHZA 3PYGA 4FN5A 5A2QQ 2N3GA 4IZKB 4MLQA 2YTEA 4X66E 1KTVA 4FW3A 3KRNA 4IS1C 5IV8B 1N36E 4DPXA 4ED4A 2EMYA 2RS6A 2V85A 3OMLA 4FWDA 4IFDF 2RSIA 1HR0E 2RTXA 4F6NA 2DIXA 1YFHA 2UXDE 2Z5BB 3ZZTA 4LF7I 3WU5A 2GPIA 3M85G 2O1UA 2KONA
chains in the Genus database with same CATH topology
1QU6A 1A6FA 4DV6E 2BM1A 1KKHA 4YHHE 2E1MA 1DARA 4WUBA 3QT6A 1XMQI 3PYEA 4GEQB 2LUQA 4B3SE 1HNXE 3K17A 4DV7E 1GQEA 2X36A 4DV4I 1GZ6A 4JI6I 4DUYE 5AE3A 2PNMA 1IBLE 2UUBE 2VQEE 1MX0A 4JI8E 5BR8E 2V8QB 3MSWA 3ZZ0A 4K0KE 2CZ9A 2GS8A 4LFCI 2F8BA 4KZSA 2UU9E 4DU8A 1YYWA 1ZXNA 1KVKA 2V87A 4WPYA 1NHHA 4DR3I 4DPYA 4DXLA 1ZM4A 2EFGA 4BS9A 2HHHI 2UXBI 2V83A 2IHR1 1FJGE 4IZJD 3J81C 3Q6NA 1FNMA 3OTOI 4LTYA 2Z5BA 4OX9E 5GMEA 1WHQA 4DV3E 1NHIA 4JI4E 3ADGA 2L6MA 4DR6I 2Z5EA 4FWHA 2VQFI 1I94E 3K85A 1Z0TA 3J7AG 4USMA 4DV3I 4X65E 4DUZE 2YT4A 5IT9Q 1HNZI 4USKA 2GQ0A 1I94I 4DU7A 4JI0I 3F0NA 1IBKI 3AV0A 1Z0WA 4DPWA 2MDRA 1H7UA 3C4BA 3C4TA 4DR4E 1U2RA 3HJCA 5LL6R 3V5RA 2V2ZA 3VYXA 3J80Q 4X64E 3ZM7A 3PYFA 2Z5CA 4LF7E 4JI7I 2UXDI 3J81Q 3LLHA 2JOBA 4JI5I 4DV7I 2L3CA 4LFBI 2B7TA 2M1SA 2HKEA 4YHHI 2F4VI 2DEIA 4OOGC 2HFUA 3P06A 2WZOA 1ZM3A 3LNUA 4LF6I 4DR5I 5FWKA 1ZBTA 3QT5A 2V2QA 4DR1E 4B3SI 1UEKA 2NUFA 2HK3A 3VYYA 2B3TB 2J7KA 4DV5E 4DV1E 4PRXA 4DUZI 1RR9A 2VQEI 2O1TA 2V2VA 4DR4I 4TUGA 3HPZA 1Y4SA 1Z0EA 4X62E 2M7QA 1EI1A 2OI2A 4UT4A 1B62A 1Z59A 3ZKDA 1FJGI 4DV2E 2LTSA 2IOQA 4LFAI 2UXCI 4JV5E 1H72C 4L8NA 3LMLA 2DMYA 1T4OA 2CG9A 4KHPI 2UXCE 4JYAE 1USVA 4URLA 4DV6I 4FW9A 4DR7E 4WYQB 2V88A 4JI3I 1XNRI 1HNZE 1N33I 4OX9I 2YZTA 1BKNA 3ADIA 2LRSA 4P7DA 4BCAA 4M1KA 4JI3E 3GONA 4K0KI 3T1YE 1FWKA 2VE7C 3HTXA 1MG7A 4X65I 3HXLA 4LFCE 4JI6E 1ZBQA 2ZM6I 1Z5CA 2JY9A 5AE1A 2WW4A 1Y6ZA 3Q6MA 3VK6A 4AQYI 4DV0E 1K47A 4LFBE 1FWLA 1WHNA 4J8ZA 2LBSB 3B78A 5LMNE 4LFAE 4NXNE 2F4VE 2HKJA 4JV5I 4LF5E 1YYKA 2LTRA 3HPSA 2LJHA 4LF6E 4BMJA 4JI2I 4LF9I 1H7SA 4NXNI 2LUPB 4KHPE 1WUUA 3RMPA 4P52A 5LMNI 1S16A 2H36X 2V34A 4F9BB 1RREA 2X7IA 4B3MI 2Q2EB 2L2MA 2CPNA 4LF4I 4BBYA 2EZ6A 4DR1I 1ZM2A 2UUBI 3D4JA 2DSYA 2L2NA 4JI0E 4DV1I 4Z7YA 4DV5I 4JI4I 5DNYA 1J5EE 4XTJA 2DB2A 2IOPA 2V86A 2ZITA 4LF8E 2E5LE 3K6QA 1NZ0A 4YY3I 3IWCA 5FLXC 3HQ1A 2UUAE 2LJPA 1SR9A 4JI1E 2NUGA 1XMQE 2L2KB 4LF9E 1YZ9A 4I3HA 5LMUI 4EMDA 2G7HA 4WUCA 1DI2A 4MYUA 1N0VC 2O1VA 3B82A 4LU9A 5LMUE 1B63A 2MC6A 4DKKA 3QT7A 4PRVA 4WUDA 1DQ3A 4GKKE 4F54A 3F6GA 4PU9A 3J7AM 4DPUA 4GKKI 1J5EI 2Z5CB 2XEXA 3DJWA 1H73A 2PNLA 1IBLI 3WU4A 1N36I 4M30A 1RQ0A 2LMZA 3JAMQ 2R3VA 4LF5I 3ZKBA 4R03A 4GKJE 3J7Yp 4DR2I 4L5NC 4BC7A 4JI1I 4F9CB 4DV0I 5IWAI 2HHHE 2UXBE 3AUZA 4GKJI 2B7VA 1XNQE 1FI4A 4IZKA 2BV3A 1Z0GA 1HK7A 1HNWE 1X48A 3JTZA 2AJ4A 4JI5E 4I8OA 2M4IA 1XMOE 1T4LB 1RC7A 4RPFA 2O1WA 1X47A 3LTOA 2KHXA 2NUEA 4TUIA 5T6JA 3QT8A 3PRYA 2FGGA 4DR7I 5BR8I 4DR6E 1QZRA 4HXZA 4B3TE 5AASA 2NPFA 4NXME 1IBME 1O0WA 3ADJA 2MC5A 1N34E 3PYDA 4HACA 4N3OA 1UILA 1ELOA 4HACB 4P7AA 1IBMI 4F9AB 3DF6A 2ODRC 2A2CA 2ODRD 2UUAI 2JWOA 4DV2I 2CGEA 5AE2A 4X8WA 1N0UA 2A2DA 2R42A 2VF1A 4M2ZA 4JG4A 3WU6A 3JAMC 3H4LA 3ADLA 2KOUA 1N33E 3V2UC 1MU5A 2VQFE 5GMDA 1HNXI 2B9DA 4DR5E 4DUYI 4DMIA 2ZBKB 4B3TI 4R1FA 2K4VA 4X66I 1N32E 3IWBA 4JI8I 4YY3E 2HK2A 1EKZA 4DPTA 1N34I 1NHJA 2LE2A 2V89A 4WFTA 4KQVA 4R8OA 1ZM9A 4AQYE 4X64I 2L92A 3B8HA 4Q28A 2RS7A 1X49A 1PKPA 1H74A 2HFSA 4X62I 5IWAE 4UTGA 5A2QC 3HULA 1Z0CA 2N3HA 1HNWI 2V8PA 1J26A 4HY1A 3LPSA 3J80C 3ZOQB 3P1XA 4B3ME 3IWDA 4JYAI 2DEJA 3K1JA 1PIEA 3JU0A 2L33A 5FLXQ 2JOXA 1S4EA 4BC9A 4B3RE 1ZXMA 3ZZUA 3T1HI 2E1RA 1XNRE 2FTXB 5F3WA 1Z5AA 5CFFE 2FV4B 1VISA 2NA2A 5IT9C 1T4NA 5L3JA 1D6TA 3WU3A 4LF8I 2E5LI 2L3JA 4JI7E 1IBKE 3Q1QA 1Z5BA 4MYTA 2UUCI 2ZM6E 2JR1A 4DR3E 2EWLA 1HR0I 1OJ4A 1STUA 1Y4UA 1XNQI 1PVGA 2UUCE 2JVAA 1KIJA 2UU9I 4IZJB 1Z0BA 1XMOI 4DR2E 4HYMA 4M0VA 4WSPA 4IZJA 4P78A 3FIGA 2BM0A 2L8TA 1YYOA 1USUA 4LF4E 3M6AA 4JI2E 3H09A 1EA6A 3CWVA 4Z7CA 3F6HA 4FWGA 1N32I 1WXRA 4DV4E 4B3RI 3T1HE 3KWRA 1Z0VA 2VF3A 3OTOE 2RSMA 3T1YI 4NXMI 4ZVIA 5ADZA 5A2QQ 1XHKA 1UHZA 3PYGA 4FN5A 2N3GA 4IZKB 4X66E 1KTVA 1N36E 4DPXA 4ED4A 2RS6A 2V85A 3OMLA 4FWDA 1HR0E 2RTXA 2DIXA 2UXDE 2Z5BB 3ZZTA 4LF7I 3WU5A 1FKAE 2O1UA 2KONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU6 A;  1A6F A;  4DV6 E;  2BM1 A;  1KKH A;  4YHH E;  1DAR A;  4WUB A;  3QT6 A;  1XMQ I;  3PYE A;  2LUQ A;  4B3S E;  1HNX E;  3K17 A;  4DV7 E;  1GQE A;  2X36 A;  4DV4 I;  4JI6 I;  4DUY E;  1IBL E;  2UUB E;  2VQE E;  1MX0 A;  4JI8 E;  5BR8 E;  3ZZ0 A;  4K0K E;  2CZ9 A;  2GS8 A;  4LFC I;  2UU9 E;  4DU8 A;  1YYW A;  1ZXN A;  1KVK A;  1NHH A;  4DR3 I;  4DPY A;  4DXL A;  1ZM4 A;  2EFG A;  2HHH I;  2UXB I;  2IHR 1;  1FJG E;  3J81 C;  1FNM A;  3OTO I;  4OX9 E;  5GME A;  1WHQ A;  4DV3 E;  1NHI A;  4JI4 E;  3ADG A;  4DR6 I;  4FWH A;  2VQF I;  1I94 E;  1Z0T A;  4DV3 I;  4USM A;  3J7A G;  4X65 E;  4DUZ E;  2YT4 A;  5IT9 Q;  1HNZ I;  4USK A;  1I94 I;  4DU7 A;  4JI0 I;  3F0N A;  1IBK I;  1Z0W A;  4DPW A;  2MDR A;  1H7U A;  3C4B A;  3C4T A;  4DR4 E;  1U2R A;  5LL6 R;  3V5R A;  2V2Z A;  3VYX A;  3J80 Q;  4X64 E;  3ZM7 A;  3PYF A;  4LF7 E;  4JI7 I;  2UXD I;  3J81 Q;  3LLH A;  4JI5 I;  4DV7 I;  2L3C A;  4LFB I;  2B7T A;  2HKE A;  4YHH I;  2F4V I;  2DEI A;  4OOG C;  2HFU A;  1ZM3 A;  3LNU A;  4LF6 I;  4DR5 I;  1ZBT A;  3QT5 A;  2V2Q A;  4DR1 E;  4B3S I;  1UEK A;  2NUF A;  2HK3 A;  3VYY A;  2B3T B;  2J7K A;  4PRX A;  4DV5 E;  4DV1 E;  4DUZ I;  1RR9 A;  2VQE I;  2V2V A;  4DR4 I;  1Z0E A;  4X62 E;  1EI1 A;  2OI2 A;  4UT4 A;  1B62 A;  1Z59 A;  3ZKD A;  1FJG I;  4DV2 E;  2LTS A;  4LFA I;  2UXC I;  4JV5 E;  1H72 C;  2DMY A;  1T4O A;  4KHP I;  2UXC E;  4JYA E;  4URL A;  4DV6 I;  4FW9 A;  4DR7 E;  4WYQ B;  4JI3 I;  1XNR I;  1HNZ E;  1N33 I;  4OX9 I;  1BKN A;  3ADI A;  2LRS A;  4M1K A;  4JI3 E;  3GON A;  4K0K I;  3T1Y E;  1FWK A;  3HTX A;  1MG7 A;  4X65 I;  4LFC E;  4JI6 E;  2ZM6 I;  1Z5C A;  2JY9 A;  2WW4 A;  4AQY I;  4DV0 E;  1K47 A;  4LFB E;  1FWL A;  1WHN A;  2LBS B;  3B78 A;  5LMN E;  4LFA E;  4NXN E;  2F4V E;  2HKJ A;  4JV5 I;  4LF5 E;  1YYK A;  2LTR A;  4LF6 E;  2LJH A;  4JI2 I;  4LF9 I;  1H7S A;  4NXN I;  2LUP B;  4KHP E;  1WUU A;  4P52 A;  5LMN I;  1S16 A;  2V34 A;  1RRE A;  2X7I A;  4B3M I;  2Q2E B;  2L2M A;  2CPN A;  4LF4 I;  2EZ6 A;  4DR1 I;  1ZM2 A;  2UUB I;  3D4J A;  2L2N A;  4JI0 E;  4DV1 I;  4Z7Y A;  4DV5 I;  4JI4 I;  1J5E E;  4XTJ A;  2DB2 A;  2ZIT A;  4LF8 E;  2E5L E;  1NZ0 A;  4YY3 I;  5FLX C;  2UUA E;  2LJP A;  4JI1 E;  2NUG A;  1XMQ E;  2L2K B;  4LF9 E;  1YZ9 A;  4I3H A;  5LMU I;  4EMD A;  4WUC A;  1DI2 A;  4MYU A;  1N0V C;  3B82 A;  5LMU E;  1B63 A;  4DKK A;  3QT7 A;  4PRV A;  4WUD A;  4GKK E;  4PU9 A;  3J7A M;  4DPU A;  4GKK I;  1J5E I;  2XEX A;  1H73 A;  1IBL I;  3WU4 A;  1N36 I;  4M30 A;  1RQ0 A;  3JAM Q;  2R3V A;  4LF5 I;  3ZKB A;  4GKJ E;  3J7Y p;  4DR2 I;  4JI1 I;  4DV0 I;  5IWA I;  2HHH E;  2UXB E;  4GKJ I;  2B7V A;  1XNQ E;  1FI4 A;  2BV3 A;  1Z0G A;  1HNW E;  1X48 A;  2AJ4 A;  4JI5 E;  1XMO E;  1T4L B;  1RC7 A;  4RPF A;  1X47 A;  3LTO A;  2KHX A;  2NUE A;  3QT8 A;  4DR7 I;  5BR8 I;  4DR6 E;  1QZR A;  4HXZ A;  4B3T E;  2NPF A;  4NXM E;  1IBM E;  1O0W A;  3ADJ A;  1N34 E;  3PYD A;  4HAC A;  1UIL A;  1ELO A;  4HAC B;  4P7A A;  1IBM I;  2A2C A;  2UUA I;  4DV2 I;  4X8W A;  1N0U A;  2A2D A;  2R42 A;  4M2Z A;  4JG4 A;  3WU6 A;  3JAM C;  3H4L A;  3ADL A;  1N33 E;  3V2U C;  1MU5 A;  2VQF E;  5GMD A;  1HNX I;  4DR5 E;  4DUY I;  2ZBK B;  4B3T I;  4R1F A;  4X66 I;  1N32 E;  4JI8 I;  4YY3 E;  2HK2 A;  1EKZ A;  4DPT A;  1N34 I;  1NHJ A;  4WFT A;  4KQV A;  1ZM9 A;  4AQY E;  4X64 I;  3B8H A;  2RS7 A;  1X49 A;  1PKP A;  1H74 A;  2HFS A;  4X62 I;  5IWA E;  4UTG A;  5A2Q C;  3HUL A;  1Z0C A;  2N3H A;  1HNW I;  2V8P A;  1J26 A;  4HY1 A;  3LPS A;  3J80 C;  3P1X A;  4B3M E;  4JYA I;  2DEJ A;  3K1J A;  1PIE A;  2L33 A;  5FLX Q;  1S4E A;  4B3R E;  1ZXM A;  3ZZU A;  3T1H I;  2E1R A;  1XNR E;  1Z5A A;  5CFF E;  1VIS A;  2NA2 A;  5IT9 C;  1T4N A;  5L3J A;  1D6T A;  3WU3 A;  4LF8 I;  2E5L I;  2L3J A;  4JI7 E;  1IBK E;  3Q1Q A;  1Z5B A;  4MYT A;  2UUC I;  2ZM6 E;  4DR3 E;  1HR0 I;  1OJ4 A;  1STU A;  1XNQ I;  1PVG A;  2UUC E;  2JVA A;  1KIJ A;  2UU9 I;  1Z0B A;  1XMO I;  4DR2 E;  4HYM A;  2BM0 A;  1YYO A;  4LF4 E;  3M6A A;  4JI2 E;  1EA6 A;  3CWV A;  4Z7C A;  4FWG A;  1N32 I;  4DV4 E;  4B3R I;  3T1H E;  1Z0V A;  2VF3 A;  3OTO E;  2RSM A;  3T1Y I;  4NXM I;  4ZVI A;  5A2Q Q;  1XHK A;  1UHZ A;  3PYG A;  4FN5 A;  2N3G A;  4X66 E;  1KTV A;  1N36 E;  4DPX A;  4ED4 A;  2RS6 A;  4FWD A;  1HR0 E;  2RTX A;  2DIX A;  2UXD E;  4LF7 I;  3ZZT A;  3WU5 A;  1FKA E; 
#chains in the Genus database with same CATH topology
 5A69 A;  4BA2 B;  1QU6 A;  1A6F A;  4DV6 E;  2IES A;  2BM1 A;  2C38 A;  1KKH A;  2EOZ A;  1X3C A;  4YHH E;  2E1M A;  1DAR A;  4MDT A;  2DGC A;  4WUB A;  4RH8 A;  3QT6 A;  3EPK A;  3PYE A;  1XMQ I;  4GEQ B;  3EPH A;  2LUQ A;  4B3S E;  2EMH A;  1HNX E;  3K17 A;  4DV7 E;  2YU8 A;  1GQE A;  2X36 A;  4OZE A;  4DV4 I;  1GZ6 A;  4JI6 I;  4DUY E;  5AE3 A;  1TF6 A;  2JE6 A;  2PNM A;  3PS3 A;  4IS9 A;  1IBL E;  2UUB E;  2YTF A;  2VQE E;  1N3G A;  1MX0 A;  2NN6 B;  2EMK A;  4ZYE A;  4RHB B;  5BR8 E;  4JI8 E;  2EL4 A;  1R6M A;  2V8Q B;  3MSW A;  3ZZ0 A;  4K0K E;  2EOE A;  2NN6 A;  4WXC A;  2CZ9 A;  1P47 A;  2GS8 A;  4LFC I;  2F8B A;  4KZS A;  2UU9 E;  4DU8 A;  2PO1 B;  4OO1 C;  2EMX A;  4R2S A;  1YYW A;  1ZXN A;  2EPM X;  1KVK A;  1QNT A;  2V87 A;  4WPY A;  4R2Q A;  1NHH A;  5ELW A;  4DR3 I;  3PS2 A;  3ECR A;  4R2D A;  4DPY A;  1DGC A;  2GO4 A;  5K36 E;  2EL5 A;  4LCF A;  1EH8 A;  1Z1B A;  2WBU A;  4DXL A;  1ZM4 A;  2EFG A;  4BS9 A;  2HHH I;  2UXB I;  2IHR 1;  2V83 A;  5K36 D;  1FJG E;  4IZJ D;  3J81 C;  3Q6N A;  4FW7 A;  2EN8 A;  5AC4 A;  1A1F A;  1FNM A;  2PO0 B;  3OTO I;  4LTY A;  2Z5B A;  4OX9 E;  5GME A;  1WHQ A;  4DV3 E;  1NHI A;  4JI4 E;  4MQY A;  3ADG A;  2VRD A;  3M99 B;  2L6M A;  3QG5 C;  4DR6 I;  1YUJ A;  4MU4 A;  2Z5E A;  4FWH A;  2VQF I;  1I94 E;  3K85 A;  1Z0T A;  3J7A G;  2GO3 A;  4OO1 A;  4USM A;  4X65 E;  4DV3 I;  4DUZ E;  2YT4 A;  5KL7 A;  5IT9 Q;  2BA1 D;  2F1D A;  1HNZ I;  4USK A;  1TF3 A;  2GQ0 A;  1I94 I;  4DU7 A;  4JI0 I;  3F0N A;  1IBK I;  2WCC 3;  3AV0 A;  1Z0W A;  4DPW A;  2MDR A;  4ZYG A;  1H7U A;  2LVH A;  3C4B A;  3C4T A;  4DR4 E;  1U2R A;  3CDI A;  3HJC A;  4HEI A;  2EMC A;  5LL6 R;  2JEB B;  3V5R A;  2YTO A;  2V2Z A;  3THO B;  2BB8 A;  3VYX A;  4GZN C;  2EM4 A;  1YSA C;  2EPZ A;  4MU0 A;  3J80 Q;  4X64 E;  2NN6 F;  3ZM7 A;  3PYF A;  5IXM B;  4BA1 B;  2Z5C A;  5C0X C;  4LF7 E;  4JI7 I;  3BF2 A;  2EM6 A;  2UXD I;  2C38 B;  3J81 Q;  1YHC A;  3LLH A;  2DLQ A;  2ENH A;  1LLM C;  2JOB A;  2I13 A;  4JI5 I;  5K36 B;  4DV7 I;  2L3C A;  1ZR9 A;  4IFD E;  4LFB I;  2B7T A;  2M1S A;  2HKE A;  4YHH I;  2F4V I;  2DEI A;  4OOG C;  2HFU A;  5JEA A;  2CT1 A;  2HJJ A;  2YRH A;  4IFD B;  3P06 A;  2WZO A;  1ZM3 A;  1X6F A;  3LNU A;  2BR2 A;  4DR5 I;  5FWK A;  4LF6 I;  1ZBT A;  2GLI A;  2V2Q A;  4DR1 E;  3QT5 A;  1UEK A;  4B3S I;  1UN6 B;  2NUF A;  2HK3 A;  2PO0 A;  3VYY A;  2B3T B;  2J7K A;  4LCG A;  4DV1 E;  4DV5 E;  4PRX A;  4NBQ A;  4OKG A;  4DUZ I;  2BA1 G;  2YU5 A;  1RR9 A;  2DRP A;  2VQE I;  2O1T A;  1X5W A;  2EOS A;  2M9A A;  4FW5 A;  2V2V A;  1NCS A;  4DR4 I;  4IFD A;  1JK1 A;  5JEA B;  4ISA A;  1IQS A;  1BBO A;  4TUG A;  3HPZ A;  1Y4S A;  1Z0E A;  4X62 E;  2M7Q A;  1EI1 A;  2OI2 A;  3MHS C;  3PS1 A;  4UT4 A;  2EPC A;  5A6J A;  2MKN A;  4AIM A;  1B62 A;  1Z59 A;  3GLL A;  5KL5 A;  4DV2 E;  3ZKD A;  2LTS A;  1FJG I;  3KZZ A;  2IOQ A;  4LFA I;  2UXC I;  4JV5 E;  1H72 C;  4L8N A;  3LML A;  2DMY A;  1T4O A;  2YRM A;  2CG9 A;  4KHP I;  2UXC E;  4JYA E;  1USV A;  4NHR A;  4URL A;  3GCM A;  4DV6 I;  2WNR B;  4FW9 A;  4DR7 E;  2LCE A;  3U1Y A;  4WYQ B;  2V88 A;  4JI3 I;  2JYA A;  1XNR I;  1HNZ E;  1N33 I;  3NZK A;  4OX9 I;  2D9H A;  1X6H A;  2EN7 A;  2YZT A;  1BKN A;  3ADI A;  2LRS A;  4P7D A;  2EPP A;  4BCA A;  2J65 A;  2I9I A;  1VI7 A;  4M1K A;  4JI3 E;  2YSO A;  3GON A;  4K0K I;  3T1Y E;  1KJK A;  1FWK A;  5JEA E;  2VE7 C;  3HTX A;  1MG7 A;  1SFE A;  4X65 I;  3HXL A;  3EPL A;  4JI6 E;  1ZBQ A;  2EOQ A;  4LFC E;  2ZM6 I;  5K36 C;  1OYS A;  1Z5C A;  2JY9 A;  2ADR A;  2EOF A;  2EPR A;  4LPF A;  5AE1 A;  2BBG A;  2LV2 A;  2WW4 A;  2JP9 A;  1Y6Z A;  3Q6M A;  3VK6 A;  4QNK A;  4AQY I;  4DV0 E;  1K47 A;  2J7J A;  4IFD D;  2EM8 A;  4LFB E;  1FWL A;  1WHN A;  3BBG A;  3C6M A;  4J8Z A;  2LBS B;  3B78 A;  1WJP A;  2EPO A;  1MEY C;  5LMN E;  4LFA E;  4NXN E;  2F4V E;  2HKJ A;  5DRR A;  4F6M A;  2YTN A;  2EMI A;  4LF5 E;  1YYK A;  4JV5 I;  3M7N G;  2LTR A;  3HPS A;  2LJH A;  4LF6 E;  2C39 A;  4BMJ A;  4JI2 I;  2PNZ B;  4LF9 I;  1H7S A;  3C6K A;  2LUP B;  4KHP E;  3RMP A;  1G2F C;  1WUU A;  4P52 A;  4NXN I;  5LMN I;  1S16 A;  2R76 A;  2H36 X;  2O3Z A;  2V34 A;  4WXD A;  4FW6 A;  2YSP A;  1UDO A;  4F9B B;  1RRE A;  2X7I A;  4B3M I;  2ENC A;  1OYP A;  2Q2E B;  2L2M A;  3BID A;  2CPN A;  1PJQ A;  4LF4 I;  3L7Z A;  1A1L A;  5C0X B;  4BBY A;  2EZ6 A;  4DR1 I;  1FKA E;  1ZM2 A;  2UUB I;  3D4J A;  2DSY A;  2L2N A;  5A6A A;  4JI0 E;  4DV1 I;  4Z7Y A;  4DV5 I;  4JI4 I;  5DNY A;  1J5E E;  2ENA A;  2EM2 A;  4XTJ A;  1EH7 A;  2EN4 A;  2DB2 A;  2IOP A;  1A1J A;  2V86 A;  2ZIT A;  4LF8 E;  2E5L E;  2RQL A;  2ELY A;  1YH8 A;  3K6Q A;  1NZ0 A;  4MU1 A;  4N4R B;  4YY3 I;  4FK5 C;  2EOI A;  3IWC A;  5TSE A;  5FLX C;  2JPA A;  3HQ1 A;  4F2J C;  2UUA E;  2LJP A;  5DRO A;  1EH6 A;  4O24 A;  1SR9 A;  4JI1 E;  4IFD C;  4Q35 B;  5LLQ A;  3CDJ A;  2NUG A;  1Y60 A;  1XMQ E;  4BHC A;  2L2K B;  4LF9 E;  4OO1 D;  1YZ9 A;  1ZAA C;  4I3H A;  5LMU I;  4EMD A;  2G7H A;  4WUC A;  1DI2 A;  4MYU A;  2EM3 A;  1N0V C;  2O1V A;  3B82 A;  4QNJ A;  4LU9 A;  1NEI A;  2YTD A;  5LMU E;  1B63 A;  2MC6 A;  4DKK A;  3QT7 A;  4PRV A;  2A25 A;  4WUD A;  1DQ3 A;  5C0X D;  4GKK E;  4F54 A;  1MGT A;  3F6G A;  4PU9 A;  3J7A M;  2EE8 A;  5K36 A;  2PNZ A;  1A1G A;  1E3P A;  2C39 B;  4DPU A;  1T39 A;  4GKK I;  1J5E I;  5AC5 A;  2Z5C B;  5DNX A;  2XEX A;  3DJW A;  1H73 A;  2PNL A;  1IBL I;  3H1C A;  4J3D A;  5EL9 A;  1UDN A;  3WU4 A;  2JEB A;  1N36 I;  4MLV A;  4M30 A;  1RQ0 A;  2LJU A;  2EML A;  2LMZ A;  4HTG A;  2EN3 A;  2R3V A;  3JAM Q;  1WRJ A;  4LF5 I;  3B4T A;  3ZKB A;  4R03 A;  2C37 A;  2EP3 A;  4GKJ E;  3J7Y p;  4LCH A;  4DR2 I;  4L5N C;  4OO1 E;  2LO3 A;  4FW4 A;  2EOR A;  4BC7 A;  4F9C B;  4JI1 I;  5IWA I;  4DV0 I;  1RHY A;  2HHH E;  2UXB E;  3AUZ A;  4GKJ I;  2B7V A;  1GTK A;  2EMF A;  1XNQ E;  1FI4 A;  4MU3 A;  4IZK A;  4AM3 A;  2BV3 A;  1Z0G A;  2EMA A;  1HK7 A;  1HNW E;  1X48 A;  2EMZ A;  3JTZ A;  2AJ4 A;  2NN6 E;  4JI5 E;  4I8O A;  2WBT A;  3M85 D;  2M4I A;  1XMO E;  1T4L B;  1RC7 A;  2YTG A;  4RPF A;  2O1W A;  1X47 A;  3LTO A;  4IJD A;  2EMW A;  1TN9 A;  2YWQ A;  2KHX A;  2PRT A;  2WNR A;  2LT7 A;  5EKW A;  2CVE A;  2JEA B;  2NUE A;  4M9V C;  2WP8 A;  4TUI A;  2R1F A;  5T6J A;  5JEA C;  3QT8 A;  3PRY A;  2FGG A;  3U1K A;  4DR7 I;  2YTI A;  2IER A;  4R2P A;  5BR8 I;  4O43 A;  4DR6 E;  2EN2 A;  1QZR A;  4HXZ A;  4O5G A;  4B3T E;  2AE8 A;  4R2E A;  4U3B A;  5AAS A;  5DNL A;  2NPF A;  4NXM E;  2EOY A;  1PJT A;  2N8X A;  1A1K A;  1IBM E;  2JT2 A;  5C0X A;  4OO1 B;  5KL3 A;  1O0W A;  2EOJ A;  3ADJ A;  2EMB A;  2MC5 A;  4NZV A;  3GME A;  1N34 E;  3L7Z B;  3PYD A;  4HAC A;  2BA0 G;  4N3O A;  1UIL A;  4KWY A;  2EM9 A;  1ELO A;  4HAC B;  4P7A A;  5KL2 A;  1IBM I;  4F9A B;  3DF6 A;  1KYQ A;  2JXP A;  2ODR C;  2A2C A;  2EQ1 A;  2EPU A;  2YTJ A;  2EPK X;  2EM5 A;  2ODR D;  3UHM A;  2UUA I;  4R2R A;  2E72 A;  2JWO A;  3P3E A;  4WSG A;  4DV2 I;  5KL4 A;  2CGE A;  2EN1 A;  2HGH A;  2WBS A;  5AE2 A;  4X8W A;  1A1I A;  1BB8 A;  1N0U A;  2NAB A;  2A2D A;  2PO2 A;  5K36 F;  3P3C A;  2R42 A;  2VF1 A;  4M2Z A;  2BR2 B;  3DD6 A;  4JG4 A;  3WU6 A;  2WP8 B;  3JAM C;  1IMU A;  3H4L A;  4X9J A;  3UK3 C;  1BBG A;  3ADL A;  2KOU A;  1N33 E;  3V2U C;  1MU5 A;  2VQF E;  1R6L A;  5GMD A;  5JEA D;  1HNX I;  2B9D A;  1XXE A;  4BHB A;  1F2I G;  4DR5 E;  2CTD A;  2HC5 A;  4DUY I;  2EL6 A;  2DLK A;  4DMI A;  2ZBK B;  4GQU A;  2DMI A;  4R1F A;  4B3T I;  2K4V A;  4X66 I;  2EOX A;  3IWB A;  1N32 E;  2K7I A;  2EOO A;  4JI8 I;  2YTQ A;  4YY3 E;  2HK2 A;  2EPN A;  1EKZ A;  4DPT A;  1N34 I;  5A6B D;  1PJS A;  1NHJ A;  2JE6 B;  2LE2 A;  3HKM A;  1ZU1 A;  2V89 A;  4WFT A;  4KQV A;  4R8O A;  2C37 B;  1ZM9 A;  2CSH A;  4AQY E;  2PO2 B;  1RMD A;  2L92 A;  4X64 I;  3B8H A;  4Q28 A;  2RS7 A;  1UDQ A;  1X49 A;  3EPJ A;  1PKP A;  1H74 A;  3VHT B;  2EPL X;  2RPC A;  2HFS A;  4X62 I;  5IWA E;  4UTG A;  5A2Q C;  4O4K A;  4BA1 A;  1X6E A;  2EOM A;  3HUL A;  2EM7 A;  1Z0C A;  2MKD A;  2N3H A;  1P42 A;  5A6B A;  1HNW I;  4ZYD A;  2EQ0 A;  2V8P A;  1J26 A;  4HY1 A;  4BA2 A;  1G2D C;  4WX9 A;  3LPS A;  2VES A;  3J80 C;  1UBD C;  3ZOQ B;  3P1X A;  4B3M E;  1PDA A;  2YTP A;  3IWD A;  2NN6 D;  4JYA I;  3MHH C;  1YUI A;  2DEJ A;  5JEA F;  3K1J A;  3JU0 A;  1PIE A;  2L33 A;  5FLX Q;  2JOX A;  1S4E A;  4BC9 A;  5KL6 A;  4B3R E;  1ZXM A;  2EJ4 A;  3ZZU A;  2E1R A;  3T1H I;  3M7N D;  1XNR E;  4AID A;  3THN A;  2FTX B;  5F3W A;  1Z5A A;  5DRP A;  5CFF E;  2FV4 B;  1VIS A;  4R2C A;  2NA2 A;  5IT9 C;  1T4N A;  5L3J A;  1Y5Y A;  3P76 A;  1D6T A;  3WU3 A;  4LF8 I;  2E5L I;  2L3J A;  2YRK A;  4JI7 E;  4R2A A;  1IBK E;  3Q1Q A;  1Z5B A;  4MYT A;  5DRQ A;  2PO1 A;  2UUC I;  2EPX A;  2JR1 A;  2ZM6 E;  1A1H A;  3EQ1 A;  1L4S A;  4DR3 E;  2EWL A;  1AH5 A;  1HR0 I;  2EOH A;  1OJ4 A;  1STU A;  2Q8U A;  5A6K A;  1Y4U A;  1XNQ I;  1YPN A;  5C0X F;  3KZY A;  1T38 A;  1PVG A;  2UUC E;  2NN6 C;  2JVA A;  2YPN A;  3BGH A;  2EMG A;  1KIJ A;  2UU9 I;  3L00 A;  4IZJ B;  1Z0B A;  1XMO I;  4DR2 E;  1IQO A;  4HYM A;  2ELZ A;  2EM0 A;  4M0V A;  4WSP A;  4IZJ A;  5C0X E;  4OO1 F;  4P78 A;  3FIG A;  2EN6 A;  2L8T A;  2MDG A;  1YYO A;  1USU A;  2BM0 A;  2EPA A;  4LF4 E;  3M6A A;  1AAY A;  4JI2 E;  3P3G A;  1B69 A;  2BA0 D;  2JEA A;  3H09 A;  1EA6 A;  3CWV A;  4Z7C A;  2GHF A;  3F6H A;  1JK2 A;  4FWG A;  1WXR A;  1N32 I;  4DV4 E;  1UDS A;  4B3R I;  3T1H E;  3KWR A;  1Z0V A;  2VF3 A;  4LOM A;  3OTO E;  1OYR A;  2RSM A;  3T1Y I;  2EQ3 A;  4ZYH A;  4NXM I;  4ZVI A;  4U3D A;  5ADZ A;  3TQM A;  1E3H A;  1XHK A;  1UHZ A;  3PYG A;  4FN5 A;  5A2Q Q;  2N3G A;  4IZK B;  4MLQ A;  2YTE A;  4X66 E;  1KTV A;  4FW3 A;  3KRN A;  4IS1 C;  5IV8 B;  1N36 E;  4DPX A;  4ED4 A;  2EMY A;  2RS6 A;  2V85 A;  3OML A;  4FWD A;  4IFD F;  2RSI A;  1HR0 E;  2RTX A;  4F6N A;  2DIX A;  1YFH A;  2UXD E;  2Z5B B;  3ZZT A;  4LF7 I;  3WU5 A;  2GPI A;  3M85 G;  2O1U A;  2KON A; 
#chains in the Genus database with same CATH homology
 1QU6 A;  1A6F A;  4DV6 E;  2BM1 A;  1KKH A;  4YHH E;  2E1M A;  1DAR A;  4WUB A;  3QT6 A;  1XMQ I;  3PYE A;  4GEQ B;  2LUQ A;  4B3S E;  1HNX E;  3K17 A;  4DV7 E;  1GQE A;  2X36 A;  4DV4 I;  1GZ6 A;  4JI6 I;  4DUY E;  5AE3 A;  2PNM A;  1IBL E;  2UUB E;  2VQE E;  1MX0 A;  4JI8 E;  5BR8 E;  2V8Q B;  3MSW A;  3ZZ0 A;  4K0K E;  2CZ9 A;  2GS8 A;  4LFC I;  2F8B A;  4KZS A;  2UU9 E;  4DU8 A;  1YYW A;  1ZXN A;  1KVK A;  2V87 A;  4WPY A;  1NHH A;  4DR3 I;  4DPY A;  4DXL A;  1ZM4 A;  2EFG A;  4BS9 A;  2HHH I;  2UXB I;  2V83 A;  2IHR 1;  1FJG E;  4IZJ D;  3J81 C;  3Q6N A;  1FNM A;  3OTO I;  4LTY A;  2Z5B A;  4OX9 E;  5GME A;  1WHQ A;  4DV3 E;  1NHI A;  4JI4 E;  3ADG A;  2L6M A;  4DR6 I;  2Z5E A;  4FWH A;  2VQF I;  1I94 E;  3K85 A;  1Z0T A;  3J7A G;  4USM A;  4DV3 I;  4X65 E;  4DUZ E;  2YT4 A;  5IT9 Q;  1HNZ I;  4USK A;  2GQ0 A;  1I94 I;  4DU7 A;  4JI0 I;  3F0N A;  1IBK I;  3AV0 A;  1Z0W A;  4DPW A;  2MDR A;  1H7U A;  3C4B A;  3C4T A;  4DR4 E;  1U2R A;  3HJC A;  5LL6 R;  3V5R A;  2V2Z A;  3VYX A;  3J80 Q;  4X64 E;  3ZM7 A;  3PYF A;  2Z5C A;  4LF7 E;  4JI7 I;  2UXD I;  3J81 Q;  3LLH A;  2JOB A;  4JI5 I;  4DV7 I;  2L3C A;  4LFB I;  2B7T A;  2M1S A;  2HKE A;  4YHH I;  2F4V I;  2DEI A;  4OOG C;  2HFU A;  3P06 A;  2WZO A;  1ZM3 A;  3LNU A;  4LF6 I;  4DR5 I;  5FWK A;  1ZBT A;  3QT5 A;  2V2Q A;  4DR1 E;  4B3S I;  1UEK A;  2NUF A;  2HK3 A;  3VYY A;  2B3T B;  2J7K A;  4DV5 E;  4DV1 E;  4PRX A;  4DUZ I;  1RR9 A;  2VQE I;  2O1T A;  2V2V A;  4DR4 I;  4TUG A;  3HPZ A;  1Y4S A;  1Z0E A;  4X62 E;  2M7Q A;  1EI1 A;  2OI2 A;  4UT4 A;  1B62 A;  1Z59 A;  3ZKD A;  1FJG I;  4DV2 E;  2LTS A;  2IOQ A;  4LFA I;  2UXC I;  4JV5 E;  1H72 C;  4L8N A;  3LML A;  2DMY A;  1T4O A;  2CG9 A;  4KHP I;  2UXC E;  4JYA E;  1USV A;  4URL A;  4DV6 I;  4FW9 A;  4DR7 E;  4WYQ B;  2V88 A;  4JI3 I;  1XNR I;  1HNZ E;  1N33 I;  4OX9 I;  2YZT A;  1BKN A;  3ADI A;  2LRS A;  4P7D A;  4BCA A;  4M1K A;  4JI3 E;  3GON A;  4K0K I;  3T1Y E;  1FWK A;  2VE7 C;  3HTX A;  1MG7 A;  4X65 I;  3HXL A;  4LFC E;  4JI6 E;  1ZBQ A;  2ZM6 I;  1Z5C A;  2JY9 A;  5AE1 A;  2WW4 A;  1Y6Z A;  3Q6M A;  3VK6 A;  4AQY I;  4DV0 E;  1K47 A;  4LFB E;  1FWL A;  1WHN A;  4J8Z A;  2LBS B;  3B78 A;  5LMN E;  4LFA E;  4NXN E;  2F4V E;  2HKJ A;  4JV5 I;  4LF5 E;  1YYK A;  2LTR A;  3HPS A;  2LJH A;  4LF6 E;  4BMJ A;  4JI2 I;  4LF9 I;  1H7S A;  4NXN I;  2LUP B;  4KHP E;  1WUU A;  3RMP A;  4P52 A;  5LMN I;  1S16 A;  2H36 X;  2V34 A;  4F9B B;  1RRE A;  2X7I A;  4B3M I;  2Q2E B;  2L2M A;  2CPN A;  4LF4 I;  4BBY A;  2EZ6 A;  4DR1 I;  1ZM2 A;  2UUB I;  3D4J A;  2DSY A;  2L2N A;  4JI0 E;  4DV1 I;  4Z7Y A;  4DV5 I;  4JI4 I;  5DNY A;  1J5E E;  4XTJ A;  2DB2 A;  2IOP A;  2V86 A;  2ZIT A;  4LF8 E;  2E5L E;  3K6Q A;  1NZ0 A;  4YY3 I;  3IWC A;  5FLX C;  3HQ1 A;  2UUA E;  2LJP A;  1SR9 A;  4JI1 E;  2NUG A;  1XMQ E;  2L2K B;  4LF9 E;  1YZ9 A;  4I3H A;  5LMU I;  4EMD A;  2G7H A;  4WUC A;  1DI2 A;  4MYU A;  1N0V C;  2O1V A;  3B82 A;  4LU9 A;  5LMU E;  1B63 A;  2MC6 A;  4DKK A;  3QT7 A;  4PRV A;  4WUD A;  1DQ3 A;  4GKK E;  4F54 A;  3F6G A;  4PU9 A;  3J7A M;  4DPU A;  4GKK I;  1J5E I;  2Z5C B;  2XEX A;  3DJW A;  1H73 A;  2PNL A;  1IBL I;  3WU4 A;  1N36 I;  4M30 A;  1RQ0 A;  2LMZ A;  3JAM Q;  2R3V A;  4LF5 I;  3ZKB A;  4R03 A;  4GKJ E;  3J7Y p;  4DR2 I;  4L5N C;  4BC7 A;  4JI1 I;  4F9C B;  4DV0 I;  5IWA I;  2HHH E;  2UXB E;  3AUZ A;  4GKJ I;  2B7V A;  1XNQ E;  1FI4 A;  4IZK A;  2BV3 A;  1Z0G A;  1HK7 A;  1HNW E;  1X48 A;  3JTZ A;  2AJ4 A;  4JI5 E;  4I8O A;  2M4I A;  1XMO E;  1T4L B;  1RC7 A;  4RPF A;  2O1W A;  1X47 A;  3LTO A;  2KHX A;  2NUE A;  4TUI A;  5T6J A;  3QT8 A;  3PRY A;  2FGG A;  4DR7 I;  5BR8 I;  4DR6 E;  1QZR A;  4HXZ A;  4B3T E;  5AAS A;  2NPF A;  4NXM E;  1IBM E;  1O0W A;  3ADJ A;  2MC5 A;  1N34 E;  3PYD A;  4HAC A;  4N3O A;  1UIL A;  1ELO A;  4HAC B;  4P7A A;  1IBM I;  4F9A B;  3DF6 A;  2ODR C;  2A2C A;  2ODR D;  2UUA I;  2JWO A;  4DV2 I;  2CGE A;  5AE2 A;  4X8W A;  1N0U A;  2A2D A;  2R42 A;  2VF1 A;  4M2Z A;  4JG4 A;  3WU6 A;  3JAM C;  3H4L A;  3ADL A;  2KOU A;  1N33 E;  3V2U C;  1MU5 A;  2VQF E;  5GMD A;  1HNX I;  2B9D A;  4DR5 E;  4DUY I;  4DMI A;  2ZBK B;  4B3T I;  4R1F A;  2K4V A;  4X66 I;  1N32 E;  3IWB A;  4JI8 I;  4YY3 E;  2HK2 A;  1EKZ A;  4DPT A;  1N34 I;  1NHJ A;  2LE2 A;  2V89 A;  4WFT A;  4KQV A;  4R8O A;  1ZM9 A;  4AQY E;  4X64 I;  2L92 A;  3B8H A;  4Q28 A;  2RS7 A;  1X49 A;  1PKP A;  1H74 A;  2HFS A;  4X62 I;  5IWA E;  4UTG A;  5A2Q C;  3HUL A;  1Z0C A;  2N3H A;  1HNW I;  2V8P A;  1J26 A;  4HY1 A;  3LPS A;  3J80 C;  3ZOQ B;  3P1X A;  4B3M E;  3IWD A;  4JYA I;  2DEJ A;  3K1J A;  1PIE A;  3JU0 A;  2L33 A;  5FLX Q;  2JOX A;  1S4E A;  4BC9 A;  4B3R E;  1ZXM A;  3ZZU A;  3T1H I;  2E1R A;  1XNR E;  2FTX B;  5F3W A;  1Z5A A;  5CFF E;  2FV4 B;  1VIS A;  2NA2 A;  5IT9 C;  1T4N A;  5L3J A;  1D6T A;  3WU3 A;  4LF8 I;  2E5L I;  2L3J A;  4JI7 E;  1IBK E;  3Q1Q A;  1Z5B A;  4MYT A;  2UUC I;  2ZM6 E;  2JR1 A;  4DR3 E;  2EWL A;  1HR0 I;  1OJ4 A;  1STU A;  1Y4U A;  1XNQ I;  1PVG A;  2UUC E;  2JVA A;  1KIJ A;  2UU9 I;  4IZJ B;  1Z0B A;  1XMO I;  4DR2 E;  4HYM A;  4M0V A;  4WSP A;  4IZJ A;  4P78 A;  3FIG A;  2BM0 A;  2L8T A;  1YYO A;  1USU A;  4LF4 E;  3M6A A;  4JI2 E;  3H09 A;  1EA6 A;  3CWV A;  4Z7C A;  3F6H A;  4FWG A;  1N32 I;  1WXR A;  4DV4 E;  4B3R I;  3T1H E;  3KWR A;  1Z0V A;  2VF3 A;  3OTO E;  2RSM A;  3T1Y I;  4NXM I;  4ZVI A;  5ADZ A;  5A2Q Q;  1XHK A;  1UHZ A;  3PYG A;  4FN5 A;  2N3G A;  4IZK B;  4X66 E;  1KTV A;  1N36 E;  4DPX A;  4ED4 A;  2RS6 A;  2V85 A;  3OML A;  4FWD A;  1HR0 E;  2RTX A;  2DIX A;  2UXD E;  2Z5B B;  3ZZT A;  4LF7 I;  3WU5 A;  1FKA E;  2O1U A;  2KON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...