4IFDD

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 73
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdD00
1R6LA 1OYPA 2JEBB 4OO1A 1UDSA 1UDQA 5C0XF 2PNZB 4AIMA 3M7NG 2NN6B 2NN6E 3GCMA 2PNZA 2WP8B 4IFDE 4OO1E 2WP8A 2BA1D 3M85D 1R6MA 1UDOA 5JEAC 5C0XD 5K36C 2PO2A 5C0XB 4BA2B 4BA1A 2PO0B 3DD6A 4AIDA 2JE6A 1UDNA 5C0XA 4BA2A 2PO0A 1E3HA 2NN6C 3GMEA 3CDIA 5JEAD 4IFDC 5K36D 2JEAA 2BA0D 4OO1C 5JEAF 2PO2B 5K36F 4BA1B 5JEAA 5K36A 3CDJA 2WNRB 2BA1G 3L7ZB 3M85G 1OYRA 2JE6B 2PO1A 5C0XE 2WNRA 3H1CA 3L7ZA 3GLLA 4IFDF 2JEAB 4AM3A 4OO1F 3B4TA 2BR2A 5JEAB 5K36B 5JEAE 2C39B 2C38B 5K36E 4NBQA 2C37B 2PO1B 2JEBA 2BA0G 3M7ND 2C39A 2C38A 2NN6D 2C37A 4IFDD 5C0XC 4IFDB 1E3PA 2NN6F 4OO1D 2BR2B 1OYSA 3KRNA 2NN6A 4OO1B 3U1KA 3HKMA 4IFDA
chains in the Genus database with same CATH superfamily
1IBLI 2UXDI 5DROA 4GKKE 4DV4E 1UDSA 5EKWA 2J7KA 1UDQA 1XHKA 1FWLA 3PS2A 4QNJA 4N3OA 5C0XF 3WU6A 2PNZB 4JI1E 1XNRE 2VQEE 3P3EA 3Q6MA 4DV1E 4NXMI 3D4JA 5IWAI 4X64E 3J7AM 1ZM9A 2NN6B 3Q1QA 1Z0CA 1USVA 2WP8B 4FWDA 3ZM7A 1WUUA 4NXNE 4DR4I 5L3JA 3T1YI 1H7UA 2F4VI 3M6AA 1ZXMA 3JAMQ 2HFUA 2V8PA 4LF8I 4LF5I 2BA1D 2Q2EB 1IBKE 4LF4E 5JEAC 2UXCE 1XXEA 2PO2A 4DR1I 1Z0GA 4HACB 3DD6A 4PRVA 1I94E 1Y4UA 2X36A 1FJGI 4MU0A 4LF9I 3U1YA 4X62E 2JE6A 3CWVA 4LF7I 3ZKBA 5DRQA 1E3HA 2CZ9A 4K0KI 3PS3A 4OZEA 4FW9A 4JI8E 5BR8E 2BA0D 2GQ0A 3UHMA 3PS1A 4BA1B 4DR5E 5K36A 3CDJA 4JV5E 3NZKA 4JI7E 1HNXI 1YHCA 4B3RI 4B3SE 4LFCE 1MX0A 4YY3I 3P76A 3L7ZA 1ELOA 2DEJA 4JI0I 3ZZUA 2BM0A 4DV6I 4FW4A 1RHYA 2VESA 3K17A 5IT9Q 1YH8A 3B4TA 5JEAB 1N34I 3OTOI 1Y6ZA 4DPTA 2VQFE 1HNZI 1HR0E 2UUCE 2PO1B 2JEBA 4OKGA 4X65E 4IZJA 2C38A 4LCHA 2NN6D 2LJPA 3P06A 4IFDD 1DARA 4IS9A 4PU9A 4Z7YA 4LF6E 1RREA 2NN6F 4DU7A 3LTOA 3WU4A 1QZRA 2ZM6E 4DV0E 3F0NA 4JI6I 1H73A 2V2QA 2IOPA 1OYPA 4DR2I 2UXBI 4OO1A 2V34A 1Y4SA 4DV2I 1H72C 3LPSA 2E5LE 1Y60A 2CGEA 4FW6A 1ZM2A 2OI2A 4YHHE 5ELWA 4LCGA 4RPFA 5FLXC 4LCFA 4HY1A 1XMOE 1N36I 4DR7I 5A2QQ 4U3BA 4KQVA 1UEKA 2AJ4A 2Z5CB 3HJCA 4WUBA 4URLA 4JI4I 2Z5BA 3M85D 2A2CA 4DUZE 3J80C 1NZ0A 2XEXA 5C0XD 1U2RA 1H74A 4JYAE 4IZKB 2BM1A 4DUYE 4LFAI 4B3ME 3J81Q 4DR6E 4MU1A 4GKJI 4BA2A 4MU3A 3PYEA 4B3TE 3GMEA 5JEAD 4HXZA 4MDTA 1N32E 4DV7E 4DR3E 1B63A 4DV4I 4GKKI 4OO1C 1ZXNA 3P3CA 5JEAF 4AQYE 2R3VA 2UUBE 4LF5E 4LFBI 4JI1I 5LMUE 4JI3E 2VQEI 4DV1I 4P7AA 2GS8A 3L7ZB 1OYRA 4X64I 4DPUA 4JI2E 2A2DA 2R42A 2WW4A 4NXNI 3H1CA 1HNWI 4FWHA 2JEAB 4KHPE 5LMNE 1J5EE 1IBKI 4LF4I 4P52A 2UXCI 2C38B 5K36E 3H4LA 1XMQE 1I94I 2C39A 4ED4A 4X62I 3JAMC 3J7AG 1IBME 2EFGA 3QT8A 4MYUA 5DNXA 2PNMA 1E3PA 3V5RA 4FW3A 2BR2B 5LL6R 4DPYA 1OYSA 2UUAE 1N33E 3WU3A 2NN6A 5BR8I 4OO1B 4IFDA 4MYTA 2HHHE 4DR5I 4LPFA 4X66E 4JV5I 1Z5CA 4JI7I 4DV5E 3OTOE 4LFCI 1XNQE 5GMDA 1PVGA 2V2ZA 3PYGA 3M7NG 4HACA 4XTJA 3GCMA 4JI5E 2Z5BB 1Y5YA 5DNLA 4PRXA 3V2UC 4OO1E 4QNKA 2VQFI 3WU5A 1HR0I 2UUCI 1R6MA 2NPFA 4X65I 2UXBE 1BKNA 2O1TA 3T1HI 4DU8A 1NHIA 5K36C 4DV2E 4BA2B 3B82A 1RR9A 4BA1A 2CVEA 3B8HA 5IT9C 4LF6I 2HK2A 1Z0VA 3PYDA 2ZM6I 4DV0I 1UDNA 5C0XA 4DV3E 2IERA 2PO0A 1Z0TA 4DPWA 2NN6C 2O3ZA 3CDIA 4IFDC 2ZBKB 1ZM3A 3ZKDA 1ZM4A 2PO2B 4WUDA 2IESA 2V2VA 1IBLE 5JEAA 4ZVIA 4R1FA 2UXDE 4YHHI 2BA1G 2UU9I 3Q6NA 2JE6B 1Z0WA 2PO1A 4OX9I 2ZITA 1S16A 2WNRA 3GLLA 1B62A 4NXME 5IWAE 1D6TA 1Z5AA 3P3GA 4OO1F 4DR4E 4JG4A 4DUZI 3T1YE 2F4VE 1NHHA 5K36B 2E1RA 2C39B 4JYAI 4LF8E 3PRYA 4DUYI 2HK3A 4NBQA 2IOQA 2BA0G 4B3MI 1Z0EA 1XNRI 1KKHA 4LFBE 5A2QC 1KVKA 4DR6I 1H7SA 4UT4A 5DRPA 2JT2A 1VI7A 4FW7A 4FWGA 2C37A 4DR1E 3ZZ0A 5C0XC 1Z5BA 4B3TI 1VISA 4IFDB 1N32I 1FJGE 4HYMA 4DV7I 1HNWE 4DR3I 4LF9E 2J65A 4LF7E 1S4EA 2X7IA 3U1KA 2PNLA 4AQYI 3HKMA 4MU4A 2UUBI 4K0KE 1R6LA 4JI3I 5LMUI 2JEBB 2Z5CA 1FI4A 3J81C 4IZJB 4J3DA 4JI2I 4MQYA 4DPXA 1Z0BA 2DEIA 2HKEA 4AIMA 1FKAE 4IZKA 1HNXE 4B3RE 1KIJA 2NN6E 4KHPI 2PNZA 4YY3E 1MU5A 1NHJA 5LMNI 1J5EI 4IFDE 4JI8I 4JI0E 4DV6E 3HULA 3PYFA 3K1JA 2WP8A 2CG9A 4I3HA 4WUCA 1XMQI 3QT6A 5FWKA 1UDOA 1OJ4A 1N34E 3QT5A 4LOMA 3B78A 4UTGA 1K47A 4B3SI 5C0XB 1IBMI 2F1DA 1HNZE 4U3DA 2PO0B 4AIDA 2UUAI 1N33I 5GMEA 4Z7CA 2HHHI 1PKPA 4EMDA 4X66I 5K36D 1PIEA 4DXLA 5FLXQ 4JI6E 2JEAA 2O1VA 4DV5I 1N0VC 5K36F 1XNQI 3LNUA 4FN5A 1A6FA 4DR2E 2BV3A 2WNRB 4USKA 3M85G 3T1HE 2GO3A 5C0XE 3QT7A 4JI5I 4FW5A 3J80Q 2O1UA 2GO4A 4IFDF 1EA6A 4AM3A 1FNMA 4ISAA 1N36E 2AE8A 4DR7E 2BR2A 4IZJD 1N0UA 2HKJA 5EL9A 1MG7A 5JEAE 3GONA 4USMA 5DRRA 2E5LI 4JI4E 1KTVA 2C37B 4GQUA 1Z59A 3M7ND 1USUA 2VF3A 1HK7A 3ZZTA 4DV3I 2UU9E 2O1WA 1XMOI 4LFAE 1P42A 4OX9E 1EI1A 4OO1D 4GKJE 1FWKA 3KRNA 2HFSA 3K85A 4M1KA 2Z5EA
chains in the Genus database with same CATH topology
1R6LA 1OYPA 2JEBB 4OO1A 1UDSA 1UDQA 5C0XF 2PNZB 4AIMA 3M7NG 2NN6B 2NN6E 3GCMA 2PNZA 2WP8B 4IFDE 4OO1E 2WP8A 2BA1D 3M85D 1R6MA 1UDOA 5JEAC 5C0XD 5K36C 2PO2A 5C0XB 4BA2B 4BA1A 2PO0B 3DD6A 4AIDA 2JE6A 1UDNA 5C0XA 4BA2A 2PO0A 1E3HA 2NN6C 3GMEA 3CDIA 5JEAD 4IFDC 5K36D 2JEAA 2BA0D 4OO1C 5JEAF 2PO2B 5K36F 4BA1B 5JEAA 5K36A 3CDJA 2WNRB 2BA1G 3L7ZB 3M85G 1OYRA 2JE6B 2PO1A 5C0XE 2WNRA 3H1CA 3L7ZA 3GLLA 4IFDF 2JEAB 4AM3A 4OO1F 3B4TA 2BR2A 5JEAB 5K36B 5JEAE 2C39B 2C38B 5K36E 4NBQA 2C37B 2PO1B 2JEBA 2BA0G 3M7ND 2C39A 2C38A 2NN6D 2C37A 4IFDD 5C0XC 4IFDB 1E3PA 2NN6F 4OO1D 2BR2B 1OYSA 3KRNA 2NN6A 4OO1B 3U1KA 3HKMA 4IFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6L A;  1OYP A;  2JEB B;  4OO1 A;  1UDS A;  1UDQ A;  5C0X F;  2PNZ B;  4AIM A;  3M7N G;  2NN6 B;  2NN6 E;  3GCM A;  2PNZ A;  2WP8 B;  4IFD E;  4OO1 E;  2WP8 A;  2BA1 D;  3M85 D;  1R6M A;  1UDO A;  5JEA C;  5C0X D;  5K36 C;  2PO2 A;  5C0X B;  4BA2 B;  4BA1 A;  2PO0 B;  3DD6 A;  4AID A;  2JE6 A;  1UDN A;  5C0X A;  4BA2 A;  2PO0 A;  1E3H A;  2NN6 C;  3GME A;  3CDI A;  5JEA D;  4IFD C;  5K36 D;  2JEA A;  2BA0 D;  4OO1 C;  5JEA F;  2PO2 B;  5K36 F;  4BA1 B;  5JEA A;  5K36 A;  3CDJ A;  2WNR B;  2BA1 G;  3L7Z B;  3M85 G;  1OYR A;  2JE6 B;  2PO1 A;  5C0X E;  2WNR A;  3H1C A;  3L7Z A;  3GLL A;  4IFD F;  2JEA B;  4AM3 A;  4OO1 F;  3B4T A;  2BR2 A;  5JEA B;  5K36 B;  5JEA E;  2C39 B;  2C38 B;  5K36 E;  4NBQ A;  2C37 B;  2PO1 B;  2JEB A;  2BA0 G;  3M7N D;  2C39 A;  2C38 A;  2NN6 D;  2C37 A;  4IFD D;  5C0X C;  4IFD B;  1E3P A;  2NN6 F;  4OO1 D;  2BR2 B;  1OYS A;  3KRN A;  2NN6 A;  4OO1 B;  3U1K A;  3HKM A;  4IFD A; 
#chains in the Genus database with same CATH topology
 1IBL I;  2UXD I;  5DRO A;  4GKK E;  4DV4 E;  1UDS A;  5EKW A;  2J7K A;  1UDQ A;  1XHK A;  1FWL A;  3PS2 A;  4QNJ A;  4N3O A;  5C0X F;  3WU6 A;  2PNZ B;  4JI1 E;  1XNR E;  2VQE E;  3P3E A;  3Q6M A;  4DV1 E;  4NXM I;  3D4J A;  5IWA I;  4X64 E;  3J7A M;  1ZM9 A;  2NN6 B;  3Q1Q A;  1Z0C A;  1USV A;  2WP8 B;  4FWD A;  3ZM7 A;  1WUU A;  4NXN E;  4DR4 I;  5L3J A;  3T1Y I;  1H7U A;  2F4V I;  3M6A A;  1ZXM A;  3JAM Q;  2HFU A;  2V8P A;  4LF8 I;  4LF5 I;  2BA1 D;  2Q2E B;  1IBK E;  4LF4 E;  5JEA C;  2UXC E;  1XXE A;  2PO2 A;  4DR1 I;  1Z0G A;  4HAC B;  3DD6 A;  4PRV A;  1I94 E;  1Y4U A;  2X36 A;  1FJG I;  4MU0 A;  4LF9 I;  3U1Y A;  4X62 E;  2JE6 A;  3CWV A;  4LF7 I;  3ZKB A;  5DRQ A;  1E3H A;  2CZ9 A;  4K0K I;  3PS3 A;  4OZE A;  4FW9 A;  4JI8 E;  5BR8 E;  2BA0 D;  2GQ0 A;  3UHM A;  3PS1 A;  4BA1 B;  4DR5 E;  5K36 A;  3CDJ A;  4JV5 E;  3NZK A;  4JI7 E;  1HNX I;  1YHC A;  4B3R I;  4B3S E;  4LFC E;  1MX0 A;  4YY3 I;  3P76 A;  3L7Z A;  1ELO A;  2DEJ A;  4JI0 I;  3ZZU A;  2BM0 A;  4DV6 I;  4FW4 A;  1RHY A;  2VES A;  3K17 A;  5IT9 Q;  1YH8 A;  3B4T A;  5JEA B;  1N34 I;  3OTO I;  1Y6Z A;  4DPT A;  2VQF E;  1HNZ I;  1HR0 E;  2UUC E;  2PO1 B;  2JEB A;  4OKG A;  4X65 E;  4IZJ A;  2C38 A;  4LCH A;  2NN6 D;  2LJP A;  3P06 A;  4IFD D;  1DAR A;  4IS9 A;  4PU9 A;  4Z7Y A;  4LF6 E;  1RRE A;  2NN6 F;  4DU7 A;  3LTO A;  3WU4 A;  1QZR A;  2ZM6 E;  4DV0 E;  3F0N A;  4JI6 I;  1H73 A;  2V2Q A;  2IOP A;  1OYP A;  4DR2 I;  2UXB I;  4OO1 A;  2V34 A;  1Y4S A;  4DV2 I;  1H72 C;  3LPS A;  2E5L E;  1Y60 A;  2CGE A;  4FW6 A;  1ZM2 A;  2OI2 A;  4YHH E;  5ELW A;  4LCG A;  4RPF A;  5FLX C;  4LCF A;  4HY1 A;  1XMO E;  1N36 I;  4DR7 I;  5A2Q Q;  4U3B A;  4KQV A;  1UEK A;  2AJ4 A;  2Z5C B;  3HJC A;  4WUB A;  4URL A;  4JI4 I;  2Z5B A;  3M85 D;  2A2C A;  4DUZ E;  3J80 C;  1NZ0 A;  2XEX A;  5C0X D;  1U2R A;  1H74 A;  4JYA E;  4IZK B;  2BM1 A;  4DUY E;  4LFA I;  4B3M E;  3J81 Q;  4DR6 E;  4MU1 A;  4GKJ I;  4BA2 A;  4MU3 A;  3PYE A;  4B3T E;  3GME A;  5JEA D;  4HXZ A;  4MDT A;  1N32 E;  4DV7 E;  4DR3 E;  1B63 A;  4DV4 I;  4GKK I;  4OO1 C;  1ZXN A;  3P3C A;  5JEA F;  4AQY E;  2R3V A;  2UUB E;  4LF5 E;  4LFB I;  4JI1 I;  5LMU E;  4JI3 E;  2VQE I;  4DV1 I;  4P7A A;  2GS8 A;  3L7Z B;  1OYR A;  4X64 I;  4DPU A;  4JI2 E;  2A2D A;  2R42 A;  2WW4 A;  4NXN I;  3H1C A;  1HNW I;  4FWH A;  2JEA B;  4KHP E;  5LMN E;  1J5E E;  1IBK I;  4LF4 I;  4P52 A;  2UXC I;  2C38 B;  5K36 E;  3H4L A;  1XMQ E;  1I94 I;  2C39 A;  4ED4 A;  4X62 I;  3JAM C;  3J7A G;  1IBM E;  2EFG A;  3QT8 A;  4MYU A;  5DNX A;  2PNM A;  1E3P A;  3V5R A;  4FW3 A;  2BR2 B;  5LL6 R;  4DPY A;  1OYS A;  2UUA E;  1N33 E;  3WU3 A;  2NN6 A;  5BR8 I;  4OO1 B;  4IFD A;  4MYT A;  2HHH E;  4DR5 I;  4LPF A;  4X66 E;  4JV5 I;  1Z5C A;  4JI7 I;  4DV5 E;  3OTO E;  4LFC I;  1XNQ E;  5GMD A;  1PVG A;  2V2Z A;  3PYG A;  3M7N G;  4HAC A;  4XTJ A;  3GCM A;  4JI5 E;  2Z5B B;  1Y5Y A;  5DNL A;  4PRX A;  3V2U C;  4OO1 E;  4QNK A;  2VQF I;  3WU5 A;  1HR0 I;  2UUC I;  1R6M A;  2NPF A;  4X65 I;  2UXB E;  1BKN A;  2O1T A;  3T1H I;  4DU8 A;  1NHI A;  5K36 C;  4DV2 E;  4BA2 B;  3B82 A;  1RR9 A;  4BA1 A;  2CVE A;  3B8H A;  5IT9 C;  4LF6 I;  2HK2 A;  1Z0V A;  3PYD A;  2ZM6 I;  4DV0 I;  1UDN A;  5C0X A;  4DV3 E;  2IER A;  2PO0 A;  1Z0T A;  4DPW A;  2NN6 C;  2O3Z A;  3CDI A;  4IFD C;  2ZBK B;  1ZM3 A;  3ZKD A;  1ZM4 A;  2PO2 B;  4WUD A;  2IES A;  2V2V A;  1IBL E;  5JEA A;  4ZVI A;  4R1F A;  2UXD E;  4YHH I;  2BA1 G;  2UU9 I;  3Q6N A;  2JE6 B;  1Z0W A;  2PO1 A;  4OX9 I;  2ZIT A;  1S16 A;  2WNR A;  3GLL A;  1B62 A;  4NXM E;  5IWA E;  1D6T A;  1Z5A A;  3P3G A;  4OO1 F;  4DR4 E;  4JG4 A;  4DUZ I;  3T1Y E;  2F4V E;  1NHH A;  5K36 B;  2E1R A;  2C39 B;  4JYA I;  4LF8 E;  3PRY A;  4DUY I;  2HK3 A;  4NBQ A;  2IOQ A;  2BA0 G;  4B3M I;  1Z0E A;  1XNR I;  1KKH A;  4LFB E;  5A2Q C;  1KVK A;  4DR6 I;  1H7S A;  4UT4 A;  5DRP A;  2JT2 A;  1VI7 A;  4FW7 A;  4FWG A;  2C37 A;  4DR1 E;  3ZZ0 A;  5C0X C;  1Z5B A;  4B3T I;  1VIS A;  4IFD B;  1N32 I;  1FJG E;  4HYM A;  4DV7 I;  1HNW E;  4DR3 I;  4LF9 E;  2J65 A;  4LF7 E;  1S4E A;  2X7I A;  3U1K A;  2PNL A;  4AQY I;  3HKM A;  4MU4 A;  2UUB I;  4K0K E;  1R6L A;  4JI3 I;  5LMU I;  2JEB B;  2Z5C A;  1FI4 A;  3J81 C;  4IZJ B;  4J3D A;  4JI2 I;  4MQY A;  4DPX A;  1Z0B A;  2DEI A;  2HKE A;  4AIM A;  1FKA E;  4IZK A;  1HNX E;  4B3R E;  1KIJ A;  2NN6 E;  4KHP I;  2PNZ A;  4YY3 E;  1MU5 A;  1NHJ A;  5LMN I;  1J5E I;  4IFD E;  4JI8 I;  4JI0 E;  4DV6 E;  3HUL A;  3PYF A;  3K1J A;  2WP8 A;  2CG9 A;  4I3H A;  4WUC A;  1XMQ I;  3QT6 A;  5FWK A;  1UDO A;  1OJ4 A;  1N34 E;  3QT5 A;  4LOM A;  3B78 A;  4UTG A;  1K47 A;  4B3S I;  5C0X B;  1IBM I;  2F1D A;  1HNZ E;  4U3D A;  2PO0 B;  4AID A;  2UUA I;  1N33 I;  5GME A;  4Z7C A;  2HHH I;  1PKP A;  4EMD A;  4X66 I;  5K36 D;  1PIE A;  4DXL A;  5FLX Q;  4JI6 E;  2JEA A;  2O1V A;  4DV5 I;  1N0V C;  5K36 F;  1XNQ I;  3LNU A;  4FN5 A;  1A6F A;  4DR2 E;  2BV3 A;  2WNR B;  4USK A;  3M85 G;  3T1H E;  2GO3 A;  5C0X E;  3QT7 A;  4JI5 I;  4FW5 A;  3J80 Q;  2O1U A;  2GO4 A;  4IFD F;  1EA6 A;  4AM3 A;  1FNM A;  4ISA A;  1N36 E;  2AE8 A;  4DR7 E;  2BR2 A;  4IZJ D;  1N0U A;  2HKJ A;  5EL9 A;  1MG7 A;  5JEA E;  3GON A;  4USM A;  5DRR A;  2E5L I;  4JI4 E;  1KTV A;  2C37 B;  4GQU A;  1Z59 A;  3M7N D;  1USU A;  2VF3 A;  1HK7 A;  3ZZT A;  4DV3 I;  2UU9 E;  2O1W A;  1XMO I;  4LFA E;  1P42 A;  4OX9 E;  1EI1 A;  4OO1 D;  4GKJ E;  1FWK A;  3KRN A;  2HFS A;  3K85 A;  4M1K A;  2Z5E A; 
#chains in the Genus database with same CATH homology
 1R6L A;  1OYP A;  2JEB B;  4OO1 A;  1UDS A;  1UDQ A;  5C0X F;  2PNZ B;  4AIM A;  3M7N G;  2NN6 B;  2NN6 E;  3GCM A;  2PNZ A;  2WP8 B;  4IFD E;  4OO1 E;  2WP8 A;  2BA1 D;  3M85 D;  1R6M A;  1UDO A;  5JEA C;  5C0X D;  5K36 C;  2PO2 A;  5C0X B;  4BA2 B;  4BA1 A;  2PO0 B;  3DD6 A;  4AID A;  2JE6 A;  1UDN A;  5C0X A;  4BA2 A;  2PO0 A;  1E3H A;  2NN6 C;  3GME A;  3CDI A;  5JEA D;  4IFD C;  5K36 D;  2JEA A;  2BA0 D;  4OO1 C;  5JEA F;  2PO2 B;  5K36 F;  4BA1 B;  5JEA A;  5K36 A;  3CDJ A;  2WNR B;  2BA1 G;  3L7Z B;  3M85 G;  1OYR A;  2JE6 B;  2PO1 A;  5C0X E;  2WNR A;  3H1C A;  3L7Z A;  3GLL A;  4IFD F;  2JEA B;  4AM3 A;  4OO1 F;  3B4T A;  2BR2 A;  5JEA B;  5K36 B;  5JEA E;  2C39 B;  2C38 B;  5K36 E;  4NBQ A;  2C37 B;  2PO1 B;  2JEB A;  2BA0 G;  3M7N D;  2C39 A;  2C38 A;  2NN6 D;  2C37 A;  4IFD D;  5C0X C;  4IFD B;  1E3P A;  2NN6 F;  4OO1 D;  2BR2 B;  1OYS A;  3KRN A;  2NN6 A;  4OO1 B;  3U1K A;  3HKM A;  4IFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...