4IFDD

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 73
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdD00
3CDJA 2NN6B 2WP8A 5JEAC 2NN6E 1R6MA 2BR2A 1OYPA 1OYRA 2JEBB 2PNZB 4OO1B 2PO2B 4AM3A 4BA1A 2JE6B 5C0XB 4OO1E 2PO1A 3H1CA 5C0XE 1OYSA 5K36F 4IFDF 2PO0A 3L7ZB 2NN6C 2C39A 1E3PA 5JEAF 2WP8B 4BA2A 2WNRA 1UDNA 2BR2B 3M7ND 2BA1D 2C37A 2JEAA 5C0XC 3M85D 3GMEA 4BA1B 2BA0D 1E3HA 2PO1B 5K36A 4IFDA 2NN6F 5K36D 2PO0B 4IFDD 1UDSA 4IFDE 2C38A 5JEAA 2C39B 5JEAD 3KRNA 4BA2B 4AIMA 4OO1F 4AIDA 2WNRB 3M7NG 2BA1G 5C0XF 4OO1C 2C37B 2JEAB 3M85G 2BA0G 3CDIA 2NN6A 5K36B 4IFDB 3DD6A 2NN6D 3U1KA 5K36E 3GLLA 2C38B 5JEAB 2JEBA 2PNZA 4OO1A 5JEAE 2PO2A 5C0XA 2JE6A 4OO1D 1UDQA 5C0XD 4NBQA 3B4TA 3HKMA 1UDOA 1R6LA 3L7ZA 5K36C 3GCMA 4IFDC
chains in the Genus database with same CATH superfamily
2UXDE 4JI5E 5DNXA 4JI4I 2GO3A 2NN6B 1RHYA 4Z7YA 4ZVIA 4LF9E 2LJPA 3WU4A 1YH8A 1J5EI 2UXDI 3PRYA 1OYRA 4DPTA 1EI1A 4IZJA 4BA1A 4DV2I 3GONA 2XEXA 1ZXMA 3PS3A 1N36E 4RPFA 3ZKBA 5K36F 1N32E 4IFDF 1RR9A 2PO0A 3HJCA 2UUAI 3L7ZB 1HNZE 4OKGA 4HYMA 4HACB 1N36I 1IBLE 1HNWI 2J65A 2E1RA 4I3HA 2A2CA 3P3GA 1ZM2A 3K85A 5C0XC 1MG7A 4ISAA 3PYEA 1RREA 5EKWA 4JV5I 4YY3E 1Z59A 4N3OA 2CGEA 4DR1E 3ZZTA 4LF6E 1H74A 1S16A 3K17A 4B3TE 1Y5YA 3PS1A 5DROA 1N34E 4FW6A 2C39B 2HK3A 4LF6I 3J7AM 5JEAD 4JG4A 4GQUA 4BA2B 2DEIA 4OO1F 4B3TI 2WNRB 5C0XF 1N34I 4DPWA 1UEKA 1H72C 1XHKA 2BV3A 3WU3A 4MDTA 5LL6R 4OX9E 2GS8A 1XNQE 2EFGA 3CDIA 2NN6A 5K36B 4IFDB 4OX9I 2DEJA 3GLLA 1XNQI 4HY1A 4LF5E 4LFAE 1NZ0A 4JI8E 1N0UA 1HR0E 4P52A 3ZZ0A 4LF8I 4LOMA 4LF5I 4NBQA 4K0KI 4LFAI 4JI8I 4KHPE 1HR0I 2X7IA 3HULA 1XNRI 4DV0E 4DR6E 3L7ZA 4NXME 3B78A 2F4VI 4HACA 2R42A 1B63A 4KHPI 4PRXA 4MU3A 3PYDA 4DV0I 5JEAC 1FKAE 1Z0CA 4MU0A 4DR6I 4NXMI 1Z0BA 2V2ZA 2OI2A 4DV5E 4DPYA 2PNZB 3QT7A 4OO1B 4B3ME 4JI0E 1IBKE 5C0XB 1Z5AA 2UU9E 2HK2A 4JYAE 2AE8A 4DV5I 3PS2A 1FNMA 4KQVA 3H4LA 4UT4A 2V34A 1XMOE 4B3MI 4JI0I 1IBKI 4DR7I 2GO4A 4JYAI 2UXBI 2UUBE 4DR3E 2C39A 3F0NA 1E3PA 5JEAF 4WUCA 4GKKI 2HFUA 4BA2A 1XMOI 3P3CA 2WNRA 1UDNA 3M7ND 2BA1D 4DV3E 2UUBI 4JI5I 4DR3I 3J81C 4M1KA 4GKJE 5ELWA 3UHMA 4USMA 2BM1A 4LF9I 2HKEA 2BA0D 4DV3I 2PO1B 3QT5A 4GKJI 4FW5A 5K36A 4IFDA 4B3RE 3J80C 5IWAE 1BKNA 1UDSA 4IFDE 2Z5EA 3LTOA 2O3ZA 2PNLA 1XXEA 2VESA 3J81Q 3KRNA 4B3RI 1N32I 2J7KA 4AIMA 1D6TA 1FI4A 3QT8A 2ZM6E 3M7NG 2BA1G 2Z5CB 1HNZI 4UTGA 4OO1C 2F1DA 4QNJA 1IBLI 4X66E 3D4JA 4FWDA 2V2QA 1WUUA 4FWHA 4DV4E 4DR4E 3J80Q 2PNMA 2ZM6I 2BA0G 1H7UA 4YHHE 1MU5A 4IZKB 4X66I 4LPFA 3B8HA 4DV4I 3DD6A 3CWVA 3U1KA 2A2DA 1HK7A 4YHHI 4YY3I 4DXLA 4DR1I 5JEAB 2UXCE 4FW4A 2PNZA 5FWKA 2VQEE 4OO1A 5FLXC 5C0XA 1DARA 2BM0A 3T1HE 1USVA 1U2RA 1PKPA 1UDOA 2VQEI 3Q1QA 3LPSA 5DRQA 2CG9A 4ED4A 5LMUE 1PIEA 2UUCE 3T1HI 4FN5A 1Z5CA 4Z7CA 2Z5BB 1USUA 2NN6E 5LMUI 4U3DA 4DU7A 3T1YE 5FLXQ 5IT9C 2UUCI 3PYGA 1VI7A 4IZJD 2JE6B 3T1YI 4B3SE 2PO1A 3H1CA 1OYSA 5LMNE 4U3BA 1S4EA 1NHHA 4MYTA 1ZM4A 5IT9Q 4JI2E 5LMNI 1H73A 2WP8B 3U1YA 4X62E 1N0VC 1NHIA 2Z5CA 2IOQA 2BR2B 3WU6A 2HKJA 4JI2I 4LCFA 4X62I 4PU9A 2Q2EB 1I94E 2NPFA 1E3HA 4IZKA 5GMEA 4URLA 1ZXNA 1NHJA 4IS9A 1H7SA 2UU9I 3V2UC 2O1TA 5JEAA 4LFBE 2O1WA 4DUZE 2C37B 2O1UA 4HXZA 3NZKA 4X65E 2IESA 2JEAB 1HNXE 4FWGA 4JI4E 3P06A 4DUYE 2X36A 4LFCE 4LFBI 3M6AA 2GQ0A 4WUBA 2V2VA 4X65I 1HNXI 2WW4A 4DUYI 2Z5BA 4LFCI 2NN6D 1FWLA 1Y4SA 5K36E 5A2QC 3OTOE 4DV2E 5DRRA 2C38B 1EA6A 4X64E 4MYUA 1ZM9A 5IWAI 1N33E 1Z5BA 2VF3A 2JE6A 1UDQA 2UUAE 2R3VA 4NXNE 3OTOI 1KKHA 4DU8A 1KVKA 3B4TA 1IBME 3QT6A 3HKMA 4X64I 1HNWE 1R6LA 2E5LE 1N33I 1Y4UA 4MU1A 2IERA 1Y60A 3LNUA 5DRPA 4NXNI 1MX0A 5A2QQ 1YHCA 1IBMI 1KTVA 3CDJA 4FW3A 2WP8A 1Z0GA 4DR4I 2E5LI 1R6MA 2BR2A 1OYPA 4JV5E 3ZZUA 3WU5A 2JEBB 1B62A 4LCHA 2PO2B 4AM3A 1ZM3A 4OO1E 4WUDA 5C0XE 2UXCI 1Y6ZA 2ZITA 4MU4A 3P76A 3V5RA 4DPXA 4PRVA 3Q6NA 2NN6C 1FWKA 2AJ4A 5DNLA 4JI3E 1KIJA 5L3JA 3JAMC 5GMDA 2HFSA 4OZEA 4DV6E 3ZKDA 2VQFE 2C37A 4JI3I 1PVGA 2CZ9A 2JEAA 3Q6MA 4LF7E 3M85D 2IOPA 4R1FA 4IZJB 4DV6I 3GMEA 2VQFI 1QZRA 1Z0VA 4FW9A 4BA1B 4P7AA 4EMDA 3JAMQ 4LF7I 2NN6F 5K36D 2JT2A 2PO0B 4IFDD 4LF8E 2HHHE 4B3SI 2C38A 4K0KE 3ZM7A 1Z0WA 1Z0EA 3K1JA 1XNRE 4AIDA 4JI7I 2HHHI 4LCGA 4QNKA 4FW7A 2F4VE 1P42A 2V8PA 3M85G 1ELOA 1VISA 3J7AG 1K47A 1A6FA 4USKA 4DPUA 2O1VA 4LF4E 4J3DA 4DR5E 3PYFA 3B82A 1Z0TA 4DV7E 5BR8E 1I94I 1FJGE 4JI1E 4LF4I 2JEBA 4DR5I 5JEAE 5EL9A 2PO2A 1XMQE 4DV7I 5BR8I 4OO1D 4JI6E 4DV1E 4DR2E 4DR7E 1FJGI 2UXBE 4AQYE 4MQYA 4JI1I 4JI7E 2CVEA 5C0XD 2ZBKB 3P3EA 4XTJA 4GKKE 1XMQI 1OJ4A 4DUZI 4JI6I 4DV1I 4DR2I 5K36C 3GCMA 4IFDC 4AQYI 1J5EE
chains in the Genus database with same CATH topology
3CDJA 2NN6B 2WP8A 5JEAC 2NN6E 1R6MA 2BR2A 1OYPA 1OYRA 2JEBB 2PNZB 4OO1B 2PO2B 4AM3A 4BA1A 2JE6B 5C0XB 4OO1E 2PO1A 3H1CA 5C0XE 1OYSA 5K36F 4IFDF 2PO0A 3L7ZB 2NN6C 2C39A 1E3PA 5JEAF 2WP8B 4BA2A 2WNRA 1UDNA 2BR2B 3M7ND 2BA1D 2C37A 2JEAA 5C0XC 3M85D 3GMEA 4BA1B 2BA0D 1E3HA 2PO1B 5K36A 4IFDA 2NN6F 5K36D 2PO0B 4IFDD 1UDSA 4IFDE 2C38A 5JEAA 2C39B 5JEAD 3KRNA 4BA2B 4AIMA 4OO1F 4AIDA 2WNRB 3M7NG 2BA1G 5C0XF 4OO1C 2C37B 2JEAB 3M85G 2BA0G 3CDIA 2NN6A 5K36B 4IFDB 3DD6A 2NN6D 3U1KA 5K36E 3GLLA 2C38B 5JEAB 2JEBA 2PNZA 4OO1A 5JEAE 2PO2A 5C0XA 2JE6A 4OO1D 1UDQA 5C0XD 4NBQA 3B4TA 3HKMA 1UDOA 1R6LA 3L7ZA 5K36C 3GCMA 4IFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDJ A;  2NN6 B;  2WP8 A;  5JEA C;  2NN6 E;  1R6M A;  2BR2 A;  1OYP A;  1OYR A;  2JEB B;  2PNZ B;  4OO1 B;  2PO2 B;  4AM3 A;  4BA1 A;  2JE6 B;  5C0X B;  4OO1 E;  2PO1 A;  3H1C A;  5C0X E;  1OYS A;  5K36 F;  4IFD F;  2PO0 A;  3L7Z B;  2NN6 C;  2C39 A;  1E3P A;  5JEA F;  2WP8 B;  4BA2 A;  2WNR A;  1UDN A;  2BR2 B;  3M7N D;  2BA1 D;  2C37 A;  2JEA A;  5C0X C;  3M85 D;  3GME A;  4BA1 B;  2BA0 D;  1E3H A;  2PO1 B;  5K36 A;  4IFD A;  2NN6 F;  5K36 D;  2PO0 B;  4IFD D;  1UDS A;  4IFD E;  2C38 A;  5JEA A;  2C39 B;  5JEA D;  3KRN A;  4BA2 B;  4AIM A;  4OO1 F;  4AID A;  2WNR B;  3M7N G;  2BA1 G;  5C0X F;  4OO1 C;  2C37 B;  2JEA B;  3M85 G;  2BA0 G;  3CDI A;  2NN6 A;  5K36 B;  4IFD B;  3DD6 A;  2NN6 D;  3U1K A;  5K36 E;  3GLL A;  2C38 B;  5JEA B;  2JEB A;  2PNZ A;  4OO1 A;  5JEA E;  2PO2 A;  5C0X A;  2JE6 A;  4OO1 D;  1UDQ A;  5C0X D;  4NBQ A;  3B4T A;  3HKM A;  1UDO A;  1R6L A;  3L7Z A;  5K36 C;  3GCM A;  4IFD C; 
#chains in the Genus database with same CATH topology
 2UXD E;  4JI5 E;  5DNX A;  4JI4 I;  2GO3 A;  2NN6 B;  1RHY A;  4Z7Y A;  4ZVI A;  4LF9 E;  2LJP A;  3WU4 A;  1YH8 A;  1J5E I;  2UXD I;  3PRY A;  1OYR A;  4DPT A;  1EI1 A;  4IZJ A;  4BA1 A;  4DV2 I;  3GON A;  2XEX A;  1ZXM A;  3PS3 A;  1N36 E;  4RPF A;  3ZKB A;  5K36 F;  1N32 E;  4IFD F;  1RR9 A;  2PO0 A;  3HJC A;  2UUA I;  3L7Z B;  1HNZ E;  4OKG A;  4HYM A;  4HAC B;  1N36 I;  1IBL E;  1HNW I;  2J65 A;  2E1R A;  4I3H A;  2A2C A;  3P3G A;  1ZM2 A;  3K85 A;  5C0X C;  1MG7 A;  4ISA A;  3PYE A;  1RRE A;  5EKW A;  4JV5 I;  4YY3 E;  1Z59 A;  4N3O A;  2CGE A;  4DR1 E;  3ZZT A;  4LF6 E;  1H74 A;  1S16 A;  3K17 A;  4B3T E;  1Y5Y A;  3PS1 A;  5DRO A;  1N34 E;  4FW6 A;  2C39 B;  2HK3 A;  4LF6 I;  3J7A M;  5JEA D;  4JG4 A;  4GQU A;  4BA2 B;  2DEI A;  4OO1 F;  4B3T I;  2WNR B;  5C0X F;  1N34 I;  4DPW A;  1UEK A;  1H72 C;  1XHK A;  2BV3 A;  3WU3 A;  4MDT A;  5LL6 R;  4OX9 E;  2GS8 A;  1XNQ E;  2EFG A;  3CDI A;  2NN6 A;  5K36 B;  4IFD B;  4OX9 I;  2DEJ A;  3GLL A;  1XNQ I;  4HY1 A;  4LF5 E;  4LFA E;  1NZ0 A;  4JI8 E;  1N0U A;  1HR0 E;  4P52 A;  3ZZ0 A;  4LF8 I;  4LOM A;  4LF5 I;  4NBQ A;  4K0K I;  4LFA I;  4JI8 I;  4KHP E;  1HR0 I;  2X7I A;  3HUL A;  1XNR I;  4DV0 E;  4DR6 E;  3L7Z A;  4NXM E;  3B78 A;  2F4V I;  4HAC A;  2R42 A;  1B63 A;  4KHP I;  4PRX A;  4MU3 A;  3PYD A;  4DV0 I;  5JEA C;  1FKA E;  1Z0C A;  4MU0 A;  4DR6 I;  4NXM I;  1Z0B A;  2V2Z A;  2OI2 A;  4DV5 E;  4DPY A;  2PNZ B;  3QT7 A;  4OO1 B;  4B3M E;  4JI0 E;  1IBK E;  5C0X B;  1Z5A A;  2UU9 E;  2HK2 A;  4JYA E;  2AE8 A;  4DV5 I;  3PS2 A;  1FNM A;  4KQV A;  3H4L A;  4UT4 A;  2V34 A;  1XMO E;  4B3M I;  4JI0 I;  1IBK I;  4DR7 I;  2GO4 A;  4JYA I;  2UXB I;  2UUB E;  4DR3 E;  2C39 A;  3F0N A;  1E3P A;  5JEA F;  4WUC A;  4GKK I;  2HFU A;  4BA2 A;  1XMO I;  3P3C A;  2WNR A;  1UDN A;  3M7N D;  2BA1 D;  4DV3 E;  2UUB I;  4JI5 I;  4DR3 I;  3J81 C;  4M1K A;  4GKJ E;  5ELW A;  3UHM A;  4USM A;  2BM1 A;  4LF9 I;  2HKE A;  2BA0 D;  4DV3 I;  2PO1 B;  3QT5 A;  4GKJ I;  4FW5 A;  5K36 A;  4IFD A;  4B3R E;  3J80 C;  5IWA E;  1BKN A;  1UDS A;  4IFD E;  2Z5E A;  3LTO A;  2O3Z A;  2PNL A;  1XXE A;  2VES A;  3J81 Q;  3KRN A;  4B3R I;  1N32 I;  2J7K A;  4AIM A;  1D6T A;  1FI4 A;  3QT8 A;  2ZM6 E;  3M7N G;  2BA1 G;  2Z5C B;  1HNZ I;  4UTG A;  4OO1 C;  2F1D A;  4QNJ A;  1IBL I;  4X66 E;  3D4J A;  4FWD A;  2V2Q A;  1WUU A;  4FWH A;  4DV4 E;  4DR4 E;  3J80 Q;  2PNM A;  2ZM6 I;  2BA0 G;  1H7U A;  4YHH E;  1MU5 A;  4IZK B;  4X66 I;  4LPF A;  3B8H A;  4DV4 I;  3DD6 A;  3CWV A;  3U1K A;  2A2D A;  1HK7 A;  4YHH I;  4YY3 I;  4DXL A;  4DR1 I;  5JEA B;  2UXC E;  4FW4 A;  2PNZ A;  5FWK A;  2VQE E;  4OO1 A;  5FLX C;  5C0X A;  1DAR A;  2BM0 A;  3T1H E;  1USV A;  1U2R A;  1PKP A;  1UDO A;  2VQE I;  3Q1Q A;  3LPS A;  5DRQ A;  2CG9 A;  4ED4 A;  5LMU E;  1PIE A;  2UUC E;  3T1H I;  4FN5 A;  1Z5C A;  4Z7C A;  2Z5B B;  1USU A;  2NN6 E;  5LMU I;  4U3D A;  4DU7 A;  3T1Y E;  5FLX Q;  5IT9 C;  2UUC I;  3PYG A;  1VI7 A;  4IZJ D;  2JE6 B;  3T1Y I;  4B3S E;  2PO1 A;  3H1C A;  1OYS A;  5LMN E;  4U3B A;  1S4E A;  1NHH A;  4MYT A;  1ZM4 A;  5IT9 Q;  4JI2 E;  5LMN I;  1H73 A;  2WP8 B;  3U1Y A;  4X62 E;  1N0V C;  1NHI A;  2Z5C A;  2IOQ A;  2BR2 B;  3WU6 A;  2HKJ A;  4JI2 I;  4LCF A;  4X62 I;  4PU9 A;  2Q2E B;  1I94 E;  2NPF A;  1E3H A;  4IZK A;  5GME A;  4URL A;  1ZXN A;  1NHJ A;  4IS9 A;  1H7S A;  2UU9 I;  3V2U C;  2O1T A;  5JEA A;  4LFB E;  2O1W A;  4DUZ E;  2C37 B;  2O1U A;  4HXZ A;  3NZK A;  4X65 E;  2IES A;  2JEA B;  1HNX E;  4FWG A;  4JI4 E;  3P06 A;  4DUY E;  2X36 A;  4LFC E;  4LFB I;  3M6A A;  2GQ0 A;  4WUB A;  2V2V A;  4X65 I;  1HNX I;  2WW4 A;  4DUY I;  2Z5B A;  4LFC I;  2NN6 D;  1FWL A;  1Y4S A;  5K36 E;  5A2Q C;  3OTO E;  4DV2 E;  5DRR A;  2C38 B;  1EA6 A;  4X64 E;  4MYU A;  1ZM9 A;  5IWA I;  1N33 E;  1Z5B A;  2VF3 A;  2JE6 A;  1UDQ A;  2UUA E;  2R3V A;  4NXN E;  3OTO I;  1KKH A;  4DU8 A;  1KVK A;  3B4T A;  1IBM E;  3QT6 A;  3HKM A;  4X64 I;  1HNW E;  1R6L A;  2E5L E;  1N33 I;  1Y4U A;  4MU1 A;  2IER A;  1Y60 A;  3LNU A;  5DRP A;  4NXN I;  1MX0 A;  5A2Q Q;  1YHC A;  1IBM I;  1KTV A;  3CDJ A;  4FW3 A;  2WP8 A;  1Z0G A;  4DR4 I;  2E5L I;  1R6M A;  2BR2 A;  1OYP A;  4JV5 E;  3ZZU A;  3WU5 A;  2JEB B;  1B62 A;  4LCH A;  2PO2 B;  4AM3 A;  1ZM3 A;  4OO1 E;  4WUD A;  5C0X E;  2UXC I;  1Y6Z A;  2ZIT A;  4MU4 A;  3P76 A;  3V5R A;  4DPX A;  4PRV A;  3Q6N A;  2NN6 C;  1FWK A;  2AJ4 A;  5DNL A;  4JI3 E;  1KIJ A;  5L3J A;  3JAM C;  5GMD A;  2HFS A;  4OZE A;  4DV6 E;  3ZKD A;  2VQF E;  2C37 A;  4JI3 I;  1PVG A;  2CZ9 A;  2JEA A;  3Q6M A;  4LF7 E;  3M85 D;  2IOP A;  4R1F A;  4IZJ B;  4DV6 I;  3GME A;  2VQF I;  1QZR A;  1Z0V A;  4FW9 A;  4BA1 B;  4P7A A;  4EMD A;  3JAM Q;  4LF7 I;  2NN6 F;  5K36 D;  2JT2 A;  2PO0 B;  4IFD D;  4LF8 E;  2HHH E;  4B3S I;  2C38 A;  4K0K E;  3ZM7 A;  1Z0W A;  1Z0E A;  3K1J A;  1XNR E;  4AID A;  4JI7 I;  2HHH I;  4LCG A;  4QNK A;  4FW7 A;  2F4V E;  1P42 A;  2V8P A;  3M85 G;  1ELO A;  1VIS A;  3J7A G;  1K47 A;  1A6F A;  4USK A;  4DPU A;  2O1V A;  4LF4 E;  4J3D A;  4DR5 E;  3PYF A;  3B82 A;  1Z0T A;  4DV7 E;  5BR8 E;  1I94 I;  1FJG E;  4JI1 E;  4LF4 I;  2JEB A;  4DR5 I;  5JEA E;  5EL9 A;  2PO2 A;  1XMQ E;  4DV7 I;  5BR8 I;  4OO1 D;  4JI6 E;  4DV1 E;  4DR2 E;  4DR7 E;  1FJG I;  2UXB E;  4AQY E;  4MQY A;  4JI1 I;  4JI7 E;  2CVE A;  5C0X D;  2ZBK B;  3P3E A;  4XTJ A;  4GKK E;  1XMQ I;  1OJ4 A;  4DUZ I;  4JI6 I;  4DV1 I;  4DR2 I;  5K36 C;  3GCM A;  4IFD C;  4AQY I;  1J5E E; 
#chains in the Genus database with same CATH homology
 3CDJ A;  2NN6 B;  2WP8 A;  5JEA C;  2NN6 E;  1R6M A;  2BR2 A;  1OYP A;  1OYR A;  2JEB B;  2PNZ B;  4OO1 B;  2PO2 B;  4AM3 A;  4BA1 A;  2JE6 B;  5C0X B;  4OO1 E;  2PO1 A;  3H1C A;  5C0X E;  1OYS A;  5K36 F;  4IFD F;  2PO0 A;  3L7Z B;  2NN6 C;  2C39 A;  1E3P A;  5JEA F;  2WP8 B;  4BA2 A;  2WNR A;  1UDN A;  2BR2 B;  3M7N D;  2BA1 D;  2C37 A;  2JEA A;  5C0X C;  3M85 D;  3GME A;  4BA1 B;  2BA0 D;  1E3H A;  2PO1 B;  5K36 A;  4IFD A;  2NN6 F;  5K36 D;  2PO0 B;  4IFD D;  1UDS A;  4IFD E;  2C38 A;  5JEA A;  2C39 B;  5JEA D;  3KRN A;  4BA2 B;  4AIM A;  4OO1 F;  4AID A;  2WNR B;  3M7N G;  2BA1 G;  5C0X F;  4OO1 C;  2C37 B;  2JEA B;  3M85 G;  2BA0 G;  3CDI A;  2NN6 A;  5K36 B;  4IFD B;  3DD6 A;  2NN6 D;  3U1K A;  5K36 E;  3GLL A;  2C38 B;  5JEA B;  2JEB A;  2PNZ A;  4OO1 A;  5JEA E;  2PO2 A;  5C0X A;  2JE6 A;  4OO1 D;  1UDQ A;  5C0X D;  4NBQ A;  3B4T A;  3HKM A;  1UDO A;  1R6L A;  3L7Z A;  5K36 C;  3GCM A;  4IFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...