4IFDD

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
b'MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 73
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdD00
5K36D 5JEAC 1E3PA 5JEAE 4BA2B 2PNZA 2WP8A 4BA1B 2PO1B 3L7ZA 2BA0D 3M7ND 2WNRA 2JE6A 2C39B 3DD6A 5JEAA 4OO1F 1UDSA 3GLLA 2NN6B 1UDQA 5C0XB 4IFDA 1UDOA 2PO0A 2BA1G 2JEAB 3GCMA 5K36B 1R6LA 1E3HA 1R6MA 2C38A 2NN6F 5C0XF 4AIDA 2C37A 5JEAD 4IFDC 4OO1B 5K36F 4AIMA 4AM3A 4IFDE 4IFDD 4BA1A 2PO2B 4NBQA 2BA1D 2C39A 2PNZB 2JEBB 2BR2A 5C0XA 3H1CA 1OYSA 3CDIA 2JE6B 5JEAB 3GMEA 2NN6C 4BA2A 4OO1A 5JEAF 5C0XC 2PO1A 2NN6E 5C0XE 2C38B 5K36C 2C37B 5K36E 2WP8B 3L7ZB 2NN6A 3B4TA 2WNRB 4OO1C 2JEAA 2JEBA 3KRNA 4OO1E 4OO1D 5K36A 1OYPA 4IFDB 3HKMA 2PO0B 2BA0G 3M7NG 2BR2B 3M85D 1UDNA 3CDJA 2NN6D 1OYRA 5C0XD 4IFDF 3U1KA 3M85G 2PO2A
chains in the Genus database with same CATH superfamily
1HR0E 5K36D 4KHPE 3PS3A 1IBME 4JI3I 3OTOI 4HYMA 4DXLA 1HNZE 1E3PA 2F4VI 4DV6I 1Z0EA 4HXZA 3J80Q 2WNRA 4DPTA 3UHMA 4DV0I 1N33E 2C39B 3DD6A 3GLLA 2O1UA 2V2QA 5DRPA 5C0XB 4OX9E 4I3HA 4DR3I 4DU7A 5DNLA 1YH8A 2GO4A 3GCMA 3HJCA 4DV2I 5EL9A 4MDTA 4KHPI 1IBMI 4FW6A 2VQEI 3LPSA 1HNZI 4LFCI 1KTVA 5JEAD 5K36F 4AIMA 4FWGA 1NHJA 5IWAE 4IFDE 3WU6A 4JI8E 4LF5E 4IFDD 5A2QQ 1H7SA 4DUYE 4JI7E 4BA1A 4NBQA 2LJPA 1HNWE 4FW4A 1U2RA 3PS2A 4JI4E 4DPXA 3WU4A 2GS8A 3H1CA 2VESA 4Z7CA 3P06A 2V34A 4DUZE 4B3TI 1B63A 4B3SE 3ZKBA 5IWAI 4X66E 4LF5I 1A6FA 4IS9A 4DR7I 5JEAF 4DUYI 4DV3I 4JV5I 4JI7I 4JYAE 4X65E 2HHHI 2E5LI 1HK7A 1HNWI 4IZJD 5C0XE 2CVEA 4Z7YA 4JI4I 3ZZ0A 3WU3A 4ISAA 1VI7A 4FW5A 4PRXA 3L7ZB 3J7AM 4GKKE 3B4TA 4OO1C 4HACA 1FI4A 4DV7E 1EI1A 1MU5A 4HY1A 2DEJA 5DNXA 2HKJA 1FKAE 2HK3A 2BM0A 1OYPA 4P52A 2IESA 4LF4E 1USVA 4YY3E 4X66I 1FWKA 4DPUA 1BKNA 3CDJA 2NN6D 4IZKA 5BR8E 1XMOE 4U3DA 4LF6I 3M85G 2PO2A 2CG9A 2Z5BA 4WUBA 5DRQA 1ELOA 1PIEA 3JAMC 1Z0GA 4MYUA 4GKKI 2PNZA 4DV7I 1NHHA 5LMUI 2J65A 4ZVIA 3ZKDA 2CZ9A 1Y4UA 2JE6A 4LF4I 4YY3I 2O1VA 3PYGA 4FW9A 1J5EI 1UDQA 2UUBE 1N36E 3LNUA 4YHHE 4LCFA 5BR8I 2Z5EA 3P3EA 5FLXC 1QZRA 1R6MA 2NN6F 1Y6ZA 1XHKA 3PYDA 3K17A 4OO1B 3P3CA 2ZITA 1KVKA 4AM3A 2UXDE 4IZKB 4R1FA 2UUAE 1PKPA 2PO2B 4QNKA 2Z5BB 4M1KA 2PNMA 1N0UA 4DV5E 4JI1E 2JT2A 3J81C 2HK2A 2UUBI 1N36I 2E1RA 4DR6E 2PNZB 2BM1A 4YHHI 4DR2E 3CDIA 2ZM6E 1HR0I 2GQ0A 1NHIA 2JE6B 3PS1A 2V2ZA 3B82A 3LTOA 4ED4A 4KQVA 4MU0A 4MU1A 2UXDI 4WUDA 4LF9E 4DPYA 2UUAI 4X64E 1N33I 4J3DA 4DV5I 4JI1I 2UU9E 1Z0BA 4PRVA 5K36C 2Z5CA 3M6AA 1KIJA 4OKGA 4EMDA 4FWDA 4DR6I 4OX9I 4B3RE 2UXCE 4DR2I 4DU8A 1HNXE 4DR5E 2WNRB 4B3ME 2ZM6I 2X36A 2UUCE 1S4EA 2IOPA 1Z59A 2JEBA 4MU4A 4OO1E 4OO1D 5K36A 4K0KE 1Z0VA 4FN5A 5LMNE 2X7IA 3HULA 4LFBE 2V2VA 4U3BA 4NXME 4JI8I 4LF9I 4LF8E 1XXEA 1D6TA 4X64I 1OYRA 4MU3A 5C0XD 2UU9I 4IFDF 5ELWA 1ZM2A 4JI2E 4N3OA 4FWHA 4DV4E 1Y60A 1N0VC 2HFSA 4B3RI 2UXCI 4DR1E 5JEAC 1HNXI 4FW3A 1I94E 2Q2EB 4B3MI 3V5RA 2WP8A 4BA1B 3T1HE 1ZM9A 1H72C 2A2DA 4DUZI 3T1YE 2J7KA 3B78A 4K0KI 2ZBKB 4B3SI 5LMNI 2O3ZA 3J80C 4LFBI 3J7AG 3K1JA 3PRYA 1Y4SA 5JEAA 3Q6NA 4OO1F 4FW7A 3J81Q 2O1WA 4X62E 1UDSA 4JYAI 4IFDA 4X65I 2AJ4A 1VISA 2PO0A 4LCGA 3ZZUA 2UXBE 5K36B 1RR9A 4UTGA 1E3HA 2C38A 3B8HA 5IT9C 5C0XF 1DARA 1RHYA 4AIDA 1XNQE 3QT7A 2HKEA 4LOMA 1N32E 1FJGE 4GKJE 2BA1D 5A2QC 4JI0E 4X62I 2AE8A 4RPFA 3K85A 2GO3A 1IBLE 4HACB 2CGEA 2C39A 1XMOI 3OTOE 4IZJA 5C0XA 3Q6MA 1OYSA 1Y5YA 5FWKA 5JEAB 1N34E 4OZEA 3WU5A 1P42A 4P7AA 1UEKA 1ZM3A 2NN6C 4BA2A 1WUUA 4DV1E 2PO1A 1MX0A 4GKJI 3D4JA 5GMDA 2C38B 4DR3E 4JI0I 3U1YA 4LCHA 3Q1QA 4DV2E 1IBLI 4LFAE 5K36E 1ZM4A 2DEIA 5DROA 2NN6A 2EFGA 2VQEE 4LFCE 2JEAA 1H73A 1ZXMA 1YHCA 3GONA 1N34I 3PYFA 2BV3A 4URLA 5DRRA 1Z0WA 4JI5E 2IERA 4IZJB 4DV1I 4MQYA 3M85D 4GQUA 1XNRE 4LPFA 5IT9Q 4LFAI 3JAMQ 1Z0TA 1XMQE 4B3TE 1MG7A 5JEAE 4BA2B 3H4LA 2R42A 2PO1B 3L7ZA 2BA0D 3M7ND 4PU9A 4DR7E 4DV3E 4JV5E 1OJ4A 1H7UA 2HHHE 2E5LE 1RREA 2OI2A 1KKHA 4JI5I 2NN6B 4WUCA 4JG4A 1XNRI 1UDOA 4XTJA 2BA1G 2JEAB 5FLXQ 1FWLA 1R6LA 1S16A 2V8PA 3F0NA 2IOQA 4JI6E 1XMQI 4DR5I 2C37A 2HFUA 1USUA 4AQYE 4IFDC 2UUCI 3V2UC 1K47A 3ZM7A 2Z5CB 3PYEA 1IBKE 4DR4E 1Z5CA 3CWVA 4NXMI 5EKWA 5L3JA 4LF8I 4LF6E 1Z5AA 4MYTA 4LF7E 1PVGA 2R3VA 2F1DA 2JEBB 4USMA 2A2CA 4DPWA 2BR2A 4JI2I 1B62A 4DV4I 1EA6A 5LL6R 5LMUE 4DR1I 4JI6I 1NZ0A 3ZZTA 3GMEA 1I94I 3QT8A 4AQYI 3T1HI 4QNJA 3T1YI 1J5EE 4OO1A 5C0XC 1IBKI 4DR4I 2XEXA 2NN6E 3QT5A 4NXNE 2VQFE 4LF7I 2C37B 2O1TA 2NPFA 3NZKA 2WP8B 4UT4A 2PNLA 4JI3E 2UXBI 2F4VE 3P3GA 4DV6E 3KRNA 3QT6A 1ZXNA 3P76A 1Z0CA 1FNMA 1XNQI 4IFDB 3HKMA 4DV0E 2PO0B 2BA0G 3M7NG 4USKA 5GMEA 1H74A 2BR2B 1N32I 1UDNA 1FJGI 1Z5BA 4NXNI 2VQFI 2VF3A 3U1KA 2WW4A
chains in the Genus database with same CATH topology
5K36D 5JEAC 1E3PA 5JEAE 4BA2B 2PNZA 2WP8A 4BA1B 2PO1B 3L7ZA 2BA0D 3M7ND 2WNRA 2JE6A 2C39B 3DD6A 5JEAA 4OO1F 1UDSA 3GLLA 2NN6B 1UDQA 5C0XB 4IFDA 1UDOA 2PO0A 2BA1G 2JEAB 3GCMA 5K36B 1R6LA 1E3HA 1R6MA 2C38A 2NN6F 5C0XF 4AIDA 2C37A 5JEAD 4IFDC 4OO1B 5K36F 4AIMA 4AM3A 4IFDE 4IFDD 4BA1A 2PO2B 4NBQA 2BA1D 2C39A 2PNZB 2JEBB 2BR2A 5C0XA 3H1CA 1OYSA 3CDIA 2JE6B 5JEAB 3GMEA 2NN6C 4BA2A 4OO1A 5JEAF 5C0XC 2PO1A 2NN6E 5C0XE 2C38B 5K36C 2C37B 5K36E 2WP8B 3L7ZB 2NN6A 3B4TA 2WNRB 4OO1C 2JEAA 2JEBA 3KRNA 4OO1E 4OO1D 5K36A 1OYPA 4IFDB 3HKMA 2PO0B 2BA0G 3M7NG 2BR2B 3M85D 1UDNA 3CDJA 2NN6D 1OYRA 5C0XD 4IFDF 3U1KA 3M85G 2PO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 D;  5JEA C;  1E3P A;  5JEA E;  4BA2 B;  2PNZ A;  2WP8 A;  4BA1 B;  2PO1 B;  3L7Z A;  2BA0 D;  3M7N D;  2WNR A;  2JE6 A;  2C39 B;  3DD6 A;  5JEA A;  4OO1 F;  1UDS A;  3GLL A;  2NN6 B;  1UDQ A;  5C0X B;  4IFD A;  1UDO A;  2PO0 A;  2BA1 G;  2JEA B;  3GCM A;  5K36 B;  1R6L A;  1E3H A;  1R6M A;  2C38 A;  2NN6 F;  5C0X F;  4AID A;  2C37 A;  5JEA D;  4IFD C;  4OO1 B;  5K36 F;  4AIM A;  4AM3 A;  4IFD E;  4IFD D;  4BA1 A;  2PO2 B;  4NBQ A;  2BA1 D;  2C39 A;  2PNZ B;  2JEB B;  2BR2 A;  5C0X A;  3H1C A;  1OYS A;  3CDI A;  2JE6 B;  5JEA B;  3GME A;  2NN6 C;  4BA2 A;  4OO1 A;  5JEA F;  5C0X C;  2PO1 A;  2NN6 E;  5C0X E;  2C38 B;  5K36 C;  2C37 B;  5K36 E;  2WP8 B;  3L7Z B;  2NN6 A;  3B4T A;  2WNR B;  4OO1 C;  2JEA A;  2JEB A;  3KRN A;  4OO1 E;  4OO1 D;  5K36 A;  1OYP A;  4IFD B;  3HKM A;  2PO0 B;  2BA0 G;  3M7N G;  2BR2 B;  3M85 D;  1UDN A;  3CDJ A;  2NN6 D;  1OYR A;  5C0X D;  4IFD F;  3U1K A;  3M85 G;  2PO2 A; 
#chains in the Genus database with same CATH topology
 1HR0 E;  5K36 D;  4KHP E;  3PS3 A;  1IBM E;  4JI3 I;  3OTO I;  4HYM A;  4DXL A;  1HNZ E;  1E3P A;  2F4V I;  4DV6 I;  1Z0E A;  4HXZ A;  3J80 Q;  2WNR A;  4DPT A;  3UHM A;  4DV0 I;  1N33 E;  2C39 B;  3DD6 A;  3GLL A;  2O1U A;  2V2Q A;  5DRP A;  5C0X B;  4OX9 E;  4I3H A;  4DR3 I;  4DU7 A;  5DNL A;  1YH8 A;  2GO4 A;  3GCM A;  3HJC A;  4DV2 I;  5EL9 A;  4MDT A;  4KHP I;  1IBM I;  4FW6 A;  2VQE I;  3LPS A;  1HNZ I;  4LFC I;  1KTV A;  5JEA D;  5K36 F;  4AIM A;  4FWG A;  1NHJ A;  5IWA E;  4IFD E;  3WU6 A;  4JI8 E;  4LF5 E;  4IFD D;  5A2Q Q;  1H7S A;  4DUY E;  4JI7 E;  4BA1 A;  4NBQ A;  2LJP A;  1HNW E;  4FW4 A;  1U2R A;  3PS2 A;  4JI4 E;  4DPX A;  3WU4 A;  2GS8 A;  3H1C A;  2VES A;  4Z7C A;  3P06 A;  2V34 A;  4DUZ E;  4B3T I;  1B63 A;  4B3S E;  3ZKB A;  5IWA I;  4X66 E;  4LF5 I;  1A6F A;  4IS9 A;  4DR7 I;  5JEA F;  4DUY I;  4DV3 I;  4JV5 I;  4JI7 I;  4JYA E;  4X65 E;  2HHH I;  2E5L I;  1HK7 A;  1HNW I;  4IZJ D;  5C0X E;  2CVE A;  4Z7Y A;  4JI4 I;  3ZZ0 A;  3WU3 A;  4ISA A;  1VI7 A;  4FW5 A;  4PRX A;  3L7Z B;  3J7A M;  4GKK E;  3B4T A;  4OO1 C;  4HAC A;  1FI4 A;  4DV7 E;  1EI1 A;  1MU5 A;  4HY1 A;  2DEJ A;  5DNX A;  2HKJ A;  1FKA E;  2HK3 A;  2BM0 A;  1OYP A;  4P52 A;  2IES A;  4LF4 E;  1USV A;  4YY3 E;  4X66 I;  1FWK A;  4DPU A;  1BKN A;  3CDJ A;  2NN6 D;  4IZK A;  5BR8 E;  1XMO E;  4U3D A;  4LF6 I;  3M85 G;  2PO2 A;  2CG9 A;  2Z5B A;  4WUB A;  5DRQ A;  1ELO A;  1PIE A;  3JAM C;  1Z0G A;  4MYU A;  4GKK I;  2PNZ A;  4DV7 I;  1NHH A;  5LMU I;  2J65 A;  4ZVI A;  3ZKD A;  2CZ9 A;  1Y4U A;  2JE6 A;  4LF4 I;  4YY3 I;  2O1V A;  3PYG A;  4FW9 A;  1J5E I;  1UDQ A;  2UUB E;  1N36 E;  3LNU A;  4YHH E;  4LCF A;  5BR8 I;  2Z5E A;  3P3E A;  5FLX C;  1QZR A;  1R6M A;  2NN6 F;  1Y6Z A;  1XHK A;  3PYD A;  3K17 A;  4OO1 B;  3P3C A;  2ZIT A;  1KVK A;  4AM3 A;  2UXD E;  4IZK B;  4R1F A;  2UUA E;  1PKP A;  2PO2 B;  4QNK A;  2Z5B B;  4M1K A;  2PNM A;  1N0U A;  4DV5 E;  4JI1 E;  2JT2 A;  3J81 C;  2HK2 A;  2UUB I;  1N36 I;  2E1R A;  4DR6 E;  2PNZ B;  2BM1 A;  4YHH I;  4DR2 E;  3CDI A;  2ZM6 E;  1HR0 I;  2GQ0 A;  1NHI A;  2JE6 B;  3PS1 A;  2V2Z A;  3B82 A;  3LTO A;  4ED4 A;  4KQV A;  4MU0 A;  4MU1 A;  2UXD I;  4WUD A;  4LF9 E;  4DPY A;  2UUA I;  4X64 E;  1N33 I;  4J3D A;  4DV5 I;  4JI1 I;  2UU9 E;  1Z0B A;  4PRV A;  5K36 C;  2Z5C A;  3M6A A;  1KIJ A;  4OKG A;  4EMD A;  4FWD A;  4DR6 I;  4OX9 I;  4B3R E;  2UXC E;  4DR2 I;  4DU8 A;  1HNX E;  4DR5 E;  2WNR B;  4B3M E;  2ZM6 I;  2X36 A;  2UUC E;  1S4E A;  2IOP A;  1Z59 A;  2JEB A;  4MU4 A;  4OO1 E;  4OO1 D;  5K36 A;  4K0K E;  1Z0V A;  4FN5 A;  5LMN E;  2X7I A;  3HUL A;  4LFB E;  2V2V A;  4U3B A;  4NXM E;  4JI8 I;  4LF9 I;  4LF8 E;  1XXE A;  1D6T A;  4X64 I;  1OYR A;  4MU3 A;  5C0X D;  2UU9 I;  4IFD F;  5ELW A;  1ZM2 A;  4JI2 E;  4N3O A;  4FWH A;  4DV4 E;  1Y60 A;  1N0V C;  2HFS A;  4B3R I;  2UXC I;  4DR1 E;  5JEA C;  1HNX I;  4FW3 A;  1I94 E;  2Q2E B;  4B3M I;  3V5R A;  2WP8 A;  4BA1 B;  3T1H E;  1ZM9 A;  1H72 C;  2A2D A;  4DUZ I;  3T1Y E;  2J7K A;  3B78 A;  4K0K I;  2ZBK B;  4B3S I;  5LMN I;  2O3Z A;  3J80 C;  4LFB I;  3J7A G;  3K1J A;  3PRY A;  1Y4S A;  5JEA A;  3Q6N A;  4OO1 F;  4FW7 A;  3J81 Q;  2O1W A;  4X62 E;  1UDS A;  4JYA I;  4IFD A;  4X65 I;  2AJ4 A;  1VIS A;  2PO0 A;  4LCG A;  3ZZU A;  2UXB E;  5K36 B;  1RR9 A;  4UTG A;  1E3H A;  2C38 A;  3B8H A;  5IT9 C;  5C0X F;  1DAR A;  1RHY A;  4AID A;  1XNQ E;  3QT7 A;  2HKE A;  4LOM A;  1N32 E;  1FJG E;  4GKJ E;  2BA1 D;  5A2Q C;  4JI0 E;  4X62 I;  2AE8 A;  4RPF A;  3K85 A;  2GO3 A;  1IBL E;  4HAC B;  2CGE A;  2C39 A;  1XMO I;  3OTO E;  4IZJ A;  5C0X A;  3Q6M A;  1OYS A;  1Y5Y A;  5FWK A;  5JEA B;  1N34 E;  4OZE A;  3WU5 A;  1P42 A;  4P7A A;  1UEK A;  1ZM3 A;  2NN6 C;  4BA2 A;  1WUU A;  4DV1 E;  2PO1 A;  1MX0 A;  4GKJ I;  3D4J A;  5GMD A;  2C38 B;  4DR3 E;  4JI0 I;  3U1Y A;  4LCH A;  3Q1Q A;  4DV2 E;  1IBL I;  4LFA E;  5K36 E;  1ZM4 A;  2DEI A;  5DRO A;  2NN6 A;  2EFG A;  2VQE E;  4LFC E;  2JEA A;  1H73 A;  1ZXM A;  1YHC A;  3GON A;  1N34 I;  3PYF A;  2BV3 A;  4URL A;  5DRR A;  1Z0W A;  4JI5 E;  2IER A;  4IZJ B;  4DV1 I;  4MQY A;  3M85 D;  4GQU A;  1XNR E;  4LPF A;  5IT9 Q;  4LFA I;  3JAM Q;  1Z0T A;  1XMQ E;  4B3T E;  1MG7 A;  5JEA E;  4BA2 B;  3H4L A;  2R42 A;  2PO1 B;  3L7Z A;  2BA0 D;  3M7N D;  4PU9 A;  4DR7 E;  4DV3 E;  4JV5 E;  1OJ4 A;  1H7U A;  2HHH E;  2E5L E;  1RRE A;  2OI2 A;  1KKH A;  4JI5 I;  2NN6 B;  4WUC A;  4JG4 A;  1XNR I;  1UDO A;  4XTJ A;  2BA1 G;  2JEA B;  5FLX Q;  1FWL A;  1R6L A;  1S16 A;  2V8P A;  3F0N A;  2IOQ A;  4JI6 E;  1XMQ I;  4DR5 I;  2C37 A;  2HFU A;  1USU A;  4AQY E;  4IFD C;  2UUC I;  3V2U C;  1K47 A;  3ZM7 A;  2Z5C B;  3PYE A;  1IBK E;  4DR4 E;  1Z5C A;  3CWV A;  4NXM I;  5EKW A;  5L3J A;  4LF8 I;  4LF6 E;  1Z5A A;  4MYT A;  4LF7 E;  1PVG A;  2R3V A;  2F1D A;  2JEB B;  4USM A;  2A2C A;  4DPW A;  2BR2 A;  4JI2 I;  1B62 A;  4DV4 I;  1EA6 A;  5LL6 R;  5LMU E;  4DR1 I;  4JI6 I;  1NZ0 A;  3ZZT A;  3GME A;  1I94 I;  3QT8 A;  4AQY I;  3T1H I;  4QNJ A;  3T1Y I;  1J5E E;  4OO1 A;  5C0X C;  1IBK I;  4DR4 I;  2XEX A;  2NN6 E;  3QT5 A;  4NXN E;  2VQF E;  4LF7 I;  2C37 B;  2O1T A;  2NPF A;  3NZK A;  2WP8 B;  4UT4 A;  2PNL A;  4JI3 E;  2UXB I;  2F4V E;  3P3G A;  4DV6 E;  3KRN A;  3QT6 A;  1ZXN A;  3P76 A;  1Z0C A;  1FNM A;  1XNQ I;  4IFD B;  3HKM A;  4DV0 E;  2PO0 B;  2BA0 G;  3M7N G;  4USK A;  5GME A;  1H74 A;  2BR2 B;  1N32 I;  1UDN A;  1FJG I;  1Z5B A;  4NXN I;  2VQF I;  2VF3 A;  3U1K A;  2WW4 A; 
#chains in the Genus database with same CATH homology
 5K36 D;  5JEA C;  1E3P A;  5JEA E;  4BA2 B;  2PNZ A;  2WP8 A;  4BA1 B;  2PO1 B;  3L7Z A;  2BA0 D;  3M7N D;  2WNR A;  2JE6 A;  2C39 B;  3DD6 A;  5JEA A;  4OO1 F;  1UDS A;  3GLL A;  2NN6 B;  1UDQ A;  5C0X B;  4IFD A;  1UDO A;  2PO0 A;  2BA1 G;  2JEA B;  3GCM A;  5K36 B;  1R6L A;  1E3H A;  1R6M A;  2C38 A;  2NN6 F;  5C0X F;  4AID A;  2C37 A;  5JEA D;  4IFD C;  4OO1 B;  5K36 F;  4AIM A;  4AM3 A;  4IFD E;  4IFD D;  4BA1 A;  2PO2 B;  4NBQ A;  2BA1 D;  2C39 A;  2PNZ B;  2JEB B;  2BR2 A;  5C0X A;  3H1C A;  1OYS A;  3CDI A;  2JE6 B;  5JEA B;  3GME A;  2NN6 C;  4BA2 A;  4OO1 A;  5JEA F;  5C0X C;  2PO1 A;  2NN6 E;  5C0X E;  2C38 B;  5K36 C;  2C37 B;  5K36 E;  2WP8 B;  3L7Z B;  2NN6 A;  3B4T A;  2WNR B;  4OO1 C;  2JEA A;  2JEB A;  3KRN A;  4OO1 E;  4OO1 D;  5K36 A;  1OYP A;  4IFD B;  3HKM A;  2PO0 B;  2BA0 G;  3M7N G;  2BR2 B;  3M85 D;  1UDN A;  3CDJ A;  2NN6 D;  1OYR A;  5C0X D;  4IFD F;  3U1K A;  3M85 G;  2PO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...