1HNWI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnwI00
4DR3E 2LJPA 1IBME 2E5LI 4JI4I 4LFCI 4LF4I 1NHIA 4KHPI 1ELOA 1PVGA 2UXBE 1IBKI 3LPSA 4HACA 1S4EA 4DR7I 5A2QC 2UXDE 2UUBI 4X66I 4JI5E 4GKJE 2A2DA 1MX0A 4DR3I 4GKKE 1IBMI 1KIJA 3WU6A 2XEXA 1B63A 2UXBI 3Q1QA 1FKAE 4K0KE 1Z0BA 2UXDI 3ZKDA 1ZM3A 4HACB 2X36A 4JI5I 4GKJI 4GKKI 1N36E 4DPYA 3ZZTA 4B3SE 4X62E 1XMOE 1XNQE 4WUDA 4P7AA 3B82A 4DR2E 1Z0TA 4K0KI 2DEIA 2V2VA 4M1KA 1HNXE 1EA6A 3PYDA 3J80C 1HR0E 4KQVA 1N36I 1S16A 2EFGA 4R1FA 4B3SI 4X62I 3OTOE 1XMOI 1XNQI 2WW4A 4DR2I 4JG4A 3WU4A 4LF6E 3ZZ0A 4DPTA 4OX9E 1HNXI 1NHHA 2OI2A 1HNWE 3WU5A 2UU9E 3ZKBA 4JYAE 1HR0I 1J5EE 3K1JA 4MYTA 2V8PA 4DUYE 2J7KA 2NPFA 4LF6I 4YY3E 3J81Q 1XNRE 4B3TE 1MU5A 4DPWA 4OX9I 1HNWI 4FWGA 2UU9I 4P52A 4JYAI 1J5EI 1KKHA 1WUUA 3M6AA 4JI8E 4DUYI 1KVKA 4YY3I 4DPXA 1XNRI 4B3TI 1RR9A 1IBLE 2AJ4A 1MG7A 4DV1E 3V5RA 3B78A 2HFSA 4RPFA 1FWLA 4YHHE 3JAMQ 4JI8I 2BM0A 4FW9A 1Z0VA 1Z5CA 2BM1A 1ZXMA 1N32E 5IT9Q 4URLA 4LF8E 3QT8A 1IBLI 1FJGE 5GMEA 4DV1I 4B3RE 4NXME 2UUAE 4HYMA 4DU7A 2UUCE 1NZ0A 4JI0E 4PRVA 4YHHI 1Z59A 4DUZE 1K47A 1N32I 3QT6A 4UT4A 4LF8I 2HK2A 5LMNE 4JI2E 1FJGI 5LL6R 2VQFE 4HXZA 4MYUA 4B3ME 5FLXQ 3J7AM 4B3RI 4NXMI 3H4LA 2UUAI 3J81C 2UUCI 4JI0I 1PIEA 4DU8A 2BV3A 4JI3E 4LF5E 1H74A 4DUZI 2R3VA 1VISA 4XTJA 2V2ZA 1KTVA 2ZBKB 3B8HA 2X7IA 5LMNI 4JI2I 5IWAE 1Z0CA 2VQFI 3LNUA 4B3MI 4DR5E 2E1RA 4DR4E 4FWDA 4PU9A 4AQYE 2VQEE 1D6TA 2HKJA 4JI3I 4LF5I 1FWKA 2UXCE 3OTOI 3PYEA 1Z5AA 5BR8E 4X65E 4DV4E 3ZZUA 1N33E 5IWAI 1ZXNA 5IT9C 3HULA 4JV5E 4JI1E 1U2RA 4DR4I 1Z0EA 4AQYI 1RREA 2VQEI 3T1HE 4ED4A 2UXCI 4DR1E 3PYFA 5L3JA 3K17A 4USMA 4Z7CA 5BR8I 4DV0E 4DV3E 2Q2EB 1EI1A 4X65I 4DV4I 1N33I 4I3HA 4JV5I 4X64E 4JI1I 2CZ9A 4JI6E 5FLXC 3T1HI 4LFBE 2V2QA 4HY1A 2HK3A 4DR1I 1N34E 1H73A 4DR6E 4DV0I 4DV3I 3PYGA 4FWHA 1HNZE 4X64I 3J7AG 3WU3A 4JI6I 1FNMA 5GMDA 4DV6E 4LFBI 3GONA 3LTOA 3ZM7A 2F4VE 1N34I 4Z7YA 4DR6I 2HFUA 4ZVIA 4DV5E 3CWVA 1H7SA 4JI7E 1NHJA 3F0NA 1HNZI 2HHHE 1H72C 1ZM4A 1B62A 2ZM6E 4DV6I 1I94E 1DARA 2F4VI 4WUBA 4LF7E 5A2QQ 4DV5I 1ZM2A 4FN5A 2A2CA 4JI7I 4LFAE 2GS8A 1OJ4A 2ZITA 1XMQE 2HHHI 3D4JA 4DV2E 1XHKA 3QT7A 3T1YE 2ZM6I 2HKEA 1I94I 2DEJA 1PKPA 4DV7E 4LF9E 3QT5A 2V34A 3V2UC 4LF7I 1Z0WA 4EMDA 3JAMC 4LFAI 4UTGA 5LMUE 4NXNE 1XMQI 4PRXA 4DR5I 4DV2I 3T1YI 1FI4A 4WUCA 1Z0GA 4DV7I 2E5LE 4JI4E 4LF9I 4LFCE 1A6FA 4LF4E 4KHPE 1IBKE 1Z5BA 4DPUA 1ZM9A 4USKA 4DXLA 2R42A 5LMUI 4NXNI 1N0UA 1H7UA 4DR7E 1N0VC 3J80Q 2VF3A 2UUBE 4X66E 1QZRA 1UEKA 1BKNA
chains in the Genus database with same CATH superfamily
4DR3E 4OZEA 2LJPA 1IBME 2E5LI 4JI4I 4LFCI 3GCMA 4LF4I 1NHIA 4AIDA 4KHPI 1ELOA 1PVGA 2UXBE 1IBKI 4FW7A 3LPSA 5C0XB 1OYRA 4HACA 5JEAE 1S4EA 4DR7I 5A2QC 2O3ZA 2UXDE 4BA2A 2GQ0A 2IERA 2UUBI 4X66I 1OYSA 4JI5E 4J3DA 4GKJE 1MX0A 2A2DA 4DR3I 1Y4UA 4GKKE 1IBMI 1KIJA 2GO3A 5JEAD 3WU6A 3P76A 2XEXA 1B63A 2JE6A 2UXBI 5C0XC 3P3CA 3P3EA 4N3OA 3Q1QA 1FKAE 4K0KE 1Z0BA 2UXDI 5EL9A 3ZKDA 2PO0B 5JEAA 1ZM3A 4HACB 2X36A 4JI5I 4GKJI 3M85D 4OO1E 4GKKI 1N36E 4DPYA 4BA2B 3ZZTA 3GMEA 4B3SE 4X62E 4AM3A 1XMOE 3L7ZA 1XNQE 4WUDA 4P7AA 3B82A 4DR2E 3Q6MA 1Z0TA 1R6LA 5JEAF 4K0KI 2DEIA 4OO1D 2V2VA 4M1KA 2JE6B 1YHCA 3NZKA 1HNXE 1USUA 1EA6A 3KRNA 5DRQA 3PYDA 3J80C 1HR0E 4KQVA 1RHYA 1S16A 2EFGA 1N36I 5JEAB 4R1FA 4B3SI 4OO1A 2BR2A 4X62I 3OTOE 1XMOI 4U3BA 1XNQI 2WW4A 2Z5EA 4DR2I 4JG4A 3WU4A 4LF6E 3ZZ0A 4DPTA 4OX9E 1USVA 3L7ZB 1HNXI 1NHHA 2OI2A 1HNWE 3WU5A 2CGEA 3ZKBA 2UU9E 4JYAE 1HR0I 5JEAC 3B4TA 1J5EE 4OO1F 1Y5YA 3K1JA 2C39A 2PNMA 4MYTA 1E3PA 2JEAA 2V8PA 4DUYE 2J7KA 2NPFA 4LF6I 4YY3E 3J81Q 1XNRE 4B3TE 1MU5A 4OO1B 2BR2B 4DPWA 4OX9I 1HNWI 4FWGA 2UU9I 4P52A 4JYAI 1J5EI 1KKHA 2CVEA 4FW6A 1WUUA 5DRRA 3M6AA 4IZJD 4JI8E 2WNRA 4DUYI 1KVKA 4OO1C 2C37A 4U3DA 4YY3I 2C39B 4DPXA 1XNRI 4B3TI 1RR9A 1IBLE 2AJ4A 2JEAB 1MG7A 2BA0G 3PRYA 4DV1E 3V5RA 3B78A 2IESA 2HFSA 2J65A 2BA1D 4RPFA 1FWLA 4YHHE 3JAMQ 1P42A 4JI8I 2BM0A 4FW9A 1Z0VA 1Z5CA 2BM1A 1ZXMA 1N32E 2WP8A 5IT9Q 2O1TA 4URLA 4LF8E 3QT8A 3PS2A 4QNKA 1IBLI 1FJGE 2WNRB 5GMEA 2PNLA 4DV1I 4B3RE 4LCFA 4NXME 2UUAE 4HYMA 3GLLA 4DU7A 2UUCE 1NZ0A 2C37B 4JI0E 1VI7A 4PRVA 1E3HA 3H1CA 4YHHI 4IZKA 1Z59A 4DUZE 1K47A 1N32I 3QT6A 4UT4A 3P3GA 4LF8I 2HK2A 5LMNE 4JI2E 1FJGI 5LL6R 2VQFE 4HXZA 4MYUA 4B3ME 5FLXQ 3J7AM 4B3RI 4NXMI 3H4LA 2UUAI 3J81C 2WP8B 2O1VA 4FW4A 2UUCI 1YH8A 4JI0I 1PIEA 4DU8A 2BV3A 3M7ND 4JI3E 3U1KA 1H74A 4LF5E 4DUZI 2R3VA 1VISA 4XTJA 2AE8A 2V2ZA 5ELWA 1KTVA 2Z5CA 2ZBKB 3B8HA 2X7IA 5LMNI 4JI2I 5IWAE 1Z0CA 2VQFI 3LNUA 4IZKB 4B3MI 4DR5E 2E1RA 4DR4E 4FWDA 4PU9A 4AQYE 2VQEE 2Z5BA 1D6TA 2HKJA 2PO1A 4JI3I 4LF5I 1FWKA 4LCGA 2UXCE 3OTOI 3PYEA 1Z5AA 5BR8E 5C0XD 4X65E 4DV4E 3ZZUA 4OKGA 1N33E 3Q6NA 5IWAI 1ZXNA 5IT9C 3HULA 4JV5E 2IOPA 4JI1E 1U2RA 4QNJA 4DR4I 3CDIA 1Z0EA 2Z5CB 4AQYI 1RREA 2VQEI 3T1HE 3PS1A 3CDJA 4MU4A 4ED4A 2UXCI 4DR1E 1R6MA 3PYFA 5L3JA 3K17A 4USMA 4Z7CA 5BR8I 5K36E 4DV0E 4DV3E 2Z5BB 2VESA 2Q2EB 1EI1A 4X65I 4DV4I 2PO1B 4FW3A 1N33I 1OYPA 1UDOA 4I3HA 4MDTA 4JV5I 4X64E 4JI1I 2BA1G 4IZJA 5C0XF 2CZ9A 4JI6E 5FLXC 3T1HI 5K36D 4LFBE 1XXEA 2V2QA 4IFDE 4HY1A 3PS3A 2HK3A 4DR1I 2PO0A 1N34E 1H73A 4DR6E 4DV0I 4DV3I 3PYGA 1UDQA 5DRPA 4FWHA 5K36A 3DD6A 2PO2A 1HNZE 4IFDD 4X64I 3J7AG 2BA0D 3WU3A 4FW5A 1FNMA 4JI6I 5GMDA 2JEBA 4DV6E 3M85G 4LFBI 1Y4SA 3GONA 4MQYA 4NBQA 1UDSA 2NN6E 3LTOA 4IZJB 4MU1A 3ZM7A 4IFDA 2F4VE 1N34I 4Z7YA 4DR6I 5EKWA 2HFUA 4ZVIA 5K36F 1Y6ZA 2GO4A 3K85A 4DV5E 3CWVA 1H7SA 4JI7E 1NHJA 3F0NA 1HNZI 5DNLA 2NN6D 2HHHE 1H72C 4LCHA 2PNZA 1ZM4A 1B62A 2ZM6E 4DV6I 4MU3A 5K36B 1I94E 2PO2B 3UHMA 3M7NG 1DARA 4IFDF 2F4VI 2NN6A 2JEBB 2F1DA 4WUBA 4LF7E 2JT2A 5A2QQ 4DV5I 1ZM2A 4FN5A 2A2CA 4MU0A 4JI7I 4LFAE 2GS8A 1OJ4A 2ZITA 5DROA 1XMQE 4IFDB 2HHHI 3D4JA 4DV2E 1XHKA 3QT7A 3T1YE 5K36C 4BA1A 2ZM6I 5C0XE 2HKEA 1I94I 2CG9A 2DEJA 1PKPA 4DV7E 2NN6F 2O1WA 4LF9E 3QT5A 3HKMA 2V34A 3V2UC 2PNZB 4AIMA 4LF7I 4LPFA 1Z0WA 1HK7A 5DNXA 4EMDA 3JAMC 4IFDC 4LFAI 2C38A 4UTGA 5LMUE 4NXNE 1XMQI 4PRXA 2NN6B 4DR5I 4DV2I 3T1YI 1FI4A 4WUCA 4LOMA 4GQUA 1Z0GA 3P06A 5C0XA 4DV7I 2E5LE 1Y60A 4JI4E 4LF9I 2IOQA 4LFCE 1A6FA 4LF4E 4BA1B 4KHPE 1IBKE 3U1YA 1Z5BA 4DPUA 1ZM9A 5FWKA 4ISAA 4USKA 4DXLA 2NN6C 2R42A 5LMUI 4NXNI 1N0UA 1H7UA 4DR7E 1N0VC 3J80Q 2VF3A 1UDNA 2UUBE 4X66E 1QZRA 1UEKA 4IS9A 3HJCA 2O1UA 2C38B 1BKNA
chains in the Genus database with same CATH topology
4DR3E 2LJPA 1IBME 2E5LI 4JI4I 4LFCI 4LF4I 1NHIA 4KHPI 1ELOA 1PVGA 2UXBE 1IBKI 3LPSA 4HACA 1S4EA 4DR7I 5A2QC 2UXDE 2GQ0A 2UUBI 4X66I 4JI5E 4GKJE 2A2DA 1MX0A 4DR3I 1Y4UA 4GKKE 1IBMI 1KIJA 3WU6A 2XEXA 1B63A 2UXBI 4N3OA 3Q1QA 1FKAE 4K0KE 1Z0BA 2UXDI 3ZKDA 1ZM3A 4HACB 2X36A 4JI5I 4GKJI 4GKKI 1N36E 4DPYA 3ZZTA 4B3SE 4X62E 1XMOE 1XNQE 4WUDA 4P7AA 3B82A 4DR2E 3Q6MA 1Z0TA 4K0KI 2DEIA 2V2VA 4M1KA 1HNXE 1USUA 1EA6A 3PYDA 3J80C 1HR0E 4KQVA 1N36I 1S16A 2EFGA 4R1FA 4B3SI 4X62I 3OTOE 1XMOI 1XNQI 2WW4A 2Z5EA 4DR2I 4JG4A 3WU4A 4LF6E 3ZZ0A 4DPTA 4OX9E 1USVA 1HNXI 1NHHA 2OI2A 1HNWE 3WU5A 2CGEA 3ZKBA 2UU9E 4JYAE 1HR0I 1J5EE 3K1JA 2PNMA 4MYTA 2V8PA 4DUYE 2J7KA 2NPFA 4LF6I 4YY3E 3J81Q 1XNRE 4B3TE 1MU5A 4DPWA 4OX9I 1HNWI 4FWGA 2UU9I 4P52A 4JYAI 1J5EI 1KKHA 1WUUA 3M6AA 4IZJD 4JI8E 4DUYI 1KVKA 4YY3I 4DPXA 1XNRI 4B3TI 1RR9A 1IBLE 2AJ4A 1MG7A 3PRYA 4DV1E 3V5RA 3B78A 2HFSA 4RPFA 1FWLA 4YHHE 3JAMQ 4JI8I 2BM0A 4FW9A 1Z0VA 1Z5CA 2BM1A 1ZXMA 1N32E 5IT9Q 2O1TA 4URLA 4LF8E 3QT8A 1IBLI 1FJGE 5GMEA 2PNLA 4DV1I 4B3RE 4NXME 2UUAE 4HYMA 4DU7A 2UUCE 1NZ0A 4JI0E 4PRVA 4YHHI 4IZKA 1Z59A 4DUZE 1K47A 1N32I 3QT6A 4UT4A 4LF8I 2HK2A 5LMNE 4JI2E 1FJGI 5LL6R 2VQFE 4HXZA 4MYUA 4B3ME 5FLXQ 3J7AM 4B3RI 4NXMI 3H4LA 2UUAI 3J81C 2O1VA 2UUCI 4JI0I 1PIEA 4DU8A 2BV3A 4JI3E 4LF5E 1H74A 4DUZI 2R3VA 1VISA 4XTJA 2V2ZA 1KTVA 2Z5CA 2ZBKB 3B8HA 2X7IA 5LMNI 4JI2I 5IWAE 1Z0CA 2VQFI 3LNUA 4IZKB 4B3MI 4DR5E 2E1RA 4DR4E 4FWDA 4PU9A 4AQYE 2VQEE 2Z5BA 1D6TA 2HKJA 4JI3I 4LF5I 1FWKA 2UXCE 3OTOI 3PYEA 1Z5AA 5BR8E 4X65E 4DV4E 3ZZUA 1N33E 3Q6NA 5IWAI 1ZXNA 5IT9C 3HULA 4JV5E 2IOPA 4JI1E 1U2RA 4DR4I 1Z0EA 2Z5CB 4AQYI 1RREA 2VQEI 3T1HE 4ED4A 2UXCI 4DR1E 3PYFA 5L3JA 3K17A 4USMA 4Z7CA 5BR8I 4DV0E 4DV3E 2Z5BB 4X65I 1EI1A 2Q2EB 4DV4I 1N33I 4I3HA 4JV5I 4X64E 4JI1I 4IZJA 2CZ9A 4JI6E 5FLXC 3T1HI 4LFBE 2V2QA 4HY1A 2HK3A 4DR1I 1N34E 1H73A 4DR6E 4DV0I 4DV3I 3PYGA 4FWHA 1HNZE 4X64I 3J7AG 3WU3A 4JI6I 1FNMA 5GMDA 4DV6E 4LFBI 1Y4SA 3GONA 3LTOA 4IZJB 3ZM7A 2F4VE 1N34I 4Z7YA 4DR6I 2HFUA 4ZVIA 1Y6ZA 3K85A 4DV5E 3CWVA 1H7SA 4JI7E 1NHJA 3F0NA 1HNZI 2HHHE 1H72C 1ZM4A 1B62A 2ZM6E 4DV6I 1I94E 1DARA 2F4VI 4WUBA 4LF7E 5A2QQ 4DV5I 1ZM2A 4FN5A 2A2CA 4JI7I 4LFAE 2GS8A 1OJ4A 2ZITA 1XMQE 2HHHI 3D4JA 4DV2E 1XHKA 3QT7A 3T1YE 2ZM6I 2HKEA 1I94I 2CG9A 2DEJA 1PKPA 4DV7E 2O1WA 4LF9E 3QT5A 2V34A 3V2UC 4LF7I 1Z0WA 1HK7A 4EMDA 3JAMC 4LFAI 4UTGA 5LMUE 4NXNE 1XMQI 4PRXA 4DR5I 4DV2I 3T1YI 1FI4A 4WUCA 1Z0GA 3P06A 4DV7I 2E5LE 4JI4E 4LF9I 4LFCE 2IOQA 1A6FA 4LF4E 4KHPE 1IBKE 1Z5BA 4DPUA 1ZM9A 5FWKA 4USKA 4DXLA 2R42A 5LMUI 4NXNI 1N0UA 1H7UA 4DR7E 1N0VC 3J80Q 2VF3A 2UUBE 4X66E 1QZRA 1UEKA 3HJCA 2O1UA 1BKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 E;  2LJP A;  1IBM E;  2E5L I;  4JI4 I;  4LFC I;  4LF4 I;  1NHI A;  4KHP I;  1ELO A;  1PVG A;  2UXB E;  1IBK I;  3LPS A;  4HAC A;  1S4E A;  4DR7 I;  5A2Q C;  2UXD E;  2UUB I;  4X66 I;  4JI5 E;  4GKJ E;  2A2D A;  1MX0 A;  4DR3 I;  4GKK E;  1IBM I;  1KIJ A;  3WU6 A;  2XEX A;  1B63 A;  2UXB I;  3Q1Q A;  1FKA E;  4K0K E;  1Z0B A;  2UXD I;  3ZKD A;  1ZM3 A;  4HAC B;  2X36 A;  4JI5 I;  4GKJ I;  4GKK I;  1N36 E;  4DPY A;  3ZZT A;  4B3S E;  4X62 E;  1XMO E;  1XNQ E;  4WUD A;  4P7A A;  3B82 A;  4DR2 E;  1Z0T A;  4K0K I;  2DEI A;  2V2V A;  4M1K A;  1HNX E;  1EA6 A;  3PYD A;  3J80 C;  1HR0 E;  4KQV A;  1N36 I;  1S16 A;  2EFG A;  4R1F A;  4B3S I;  4X62 I;  3OTO E;  1XMO I;  1XNQ I;  2WW4 A;  4DR2 I;  4JG4 A;  3WU4 A;  4LF6 E;  3ZZ0 A;  4DPT A;  4OX9 E;  1HNX I;  1NHH A;  2OI2 A;  1HNW E;  3WU5 A;  2UU9 E;  3ZKB A;  4JYA E;  1HR0 I;  1J5E E;  3K1J A;  4MYT A;  2V8P A;  4DUY E;  2J7K A;  2NPF A;  4LF6 I;  4YY3 E;  3J81 Q;  1XNR E;  4B3T E;  1MU5 A;  4DPW A;  4OX9 I;  1HNW I;  4FWG A;  2UU9 I;  4P52 A;  4JYA I;  1J5E I;  1KKH A;  1WUU A;  3M6A A;  4JI8 E;  4DUY I;  1KVK A;  4YY3 I;  4DPX A;  1XNR I;  4B3T I;  1RR9 A;  1IBL E;  2AJ4 A;  1MG7 A;  4DV1 E;  3V5R A;  3B78 A;  2HFS A;  4RPF A;  1FWL A;  4YHH E;  3JAM Q;  4JI8 I;  2BM0 A;  4FW9 A;  1Z0V A;  1Z5C A;  2BM1 A;  1ZXM A;  1N32 E;  5IT9 Q;  4URL A;  4LF8 E;  3QT8 A;  1IBL I;  1FJG E;  5GME A;  4DV1 I;  4B3R E;  4NXM E;  2UUA E;  4HYM A;  4DU7 A;  2UUC E;  1NZ0 A;  4JI0 E;  4PRV A;  4YHH I;  1Z59 A;  4DUZ E;  1K47 A;  1N32 I;  3QT6 A;  4UT4 A;  4LF8 I;  2HK2 A;  5LMN E;  4JI2 E;  1FJG I;  5LL6 R;  2VQF E;  4HXZ A;  4MYU A;  4B3M E;  5FLX Q;  3J7A M;  4B3R I;  4NXM I;  3H4L A;  2UUA I;  3J81 C;  2UUC I;  4JI0 I;  1PIE A;  4DU8 A;  2BV3 A;  4JI3 E;  4LF5 E;  1H74 A;  4DUZ I;  2R3V A;  1VIS A;  4XTJ A;  2V2Z A;  1KTV A;  2ZBK B;  3B8H A;  2X7I A;  5LMN I;  4JI2 I;  5IWA E;  1Z0C A;  2VQF I;  3LNU A;  4B3M I;  4DR5 E;  2E1R A;  4DR4 E;  4FWD A;  4PU9 A;  4AQY E;  2VQE E;  1D6T A;  2HKJ A;  4JI3 I;  4LF5 I;  1FWK A;  2UXC E;  3OTO I;  3PYE A;  1Z5A A;  5BR8 E;  4X65 E;  4DV4 E;  3ZZU A;  1N33 E;  5IWA I;  1ZXN A;  5IT9 C;  3HUL A;  4JV5 E;  4JI1 E;  1U2R A;  4DR4 I;  1Z0E A;  4AQY I;  1RRE A;  2VQE I;  3T1H E;  4ED4 A;  2UXC I;  4DR1 E;  3PYF A;  5L3J A;  3K17 A;  4USM A;  4Z7C A;  5BR8 I;  4DV0 E;  4DV3 E;  2Q2E B;  1EI1 A;  4X65 I;  4DV4 I;  1N33 I;  4I3H A;  4JV5 I;  4X64 E;  4JI1 I;  2CZ9 A;  4JI6 E;  5FLX C;  3T1H I;  4LFB E;  2V2Q A;  4HY1 A;  2HK3 A;  4DR1 I;  1N34 E;  1H73 A;  4DR6 E;  4DV0 I;  4DV3 I;  3PYG A;  4FWH A;  1HNZ E;  4X64 I;  3J7A G;  3WU3 A;  4JI6 I;  1FNM A;  5GMD A;  4DV6 E;  4LFB I;  3GON A;  3LTO A;  3ZM7 A;  2F4V E;  1N34 I;  4Z7Y A;  4DR6 I;  2HFU A;  4ZVI A;  4DV5 E;  3CWV A;  1H7S A;  4JI7 E;  1NHJ A;  3F0N A;  1HNZ I;  2HHH E;  1H72 C;  1ZM4 A;  1B62 A;  2ZM6 E;  4DV6 I;  1I94 E;  1DAR A;  2F4V I;  4WUB A;  4LF7 E;  5A2Q Q;  4DV5 I;  1ZM2 A;  4FN5 A;  2A2C A;  4JI7 I;  4LFA E;  2GS8 A;  1OJ4 A;  2ZIT A;  1XMQ E;  2HHH I;  3D4J A;  4DV2 E;  1XHK A;  3QT7 A;  3T1Y E;  2ZM6 I;  2HKE A;  1I94 I;  2DEJ A;  1PKP A;  4DV7 E;  4LF9 E;  3QT5 A;  2V34 A;  3V2U C;  4LF7 I;  1Z0W A;  4EMD A;  3JAM C;  4LFA I;  4UTG A;  5LMU E;  4NXN E;  1XMQ I;  4PRX A;  4DR5 I;  4DV2 I;  3T1Y I;  1FI4 A;  4WUC A;  1Z0G A;  4DV7 I;  2E5L E;  4JI4 E;  4LF9 I;  4LFC E;  1A6F A;  4LF4 E;  4KHP E;  1IBK E;  1Z5B A;  4DPU A;  1ZM9 A;  4USK A;  4DXL A;  2R42 A;  5LMU I;  4NXN I;  1N0U A;  1H7U A;  4DR7 E;  1N0V C;  3J80 Q;  2VF3 A;  2UUB E;  4X66 E;  1QZR A;  1UEK A;  1BKN A; 
#chains in the Genus database with same CATH topology
 4DR3 E;  4OZE A;  2LJP A;  1IBM E;  2E5L I;  4JI4 I;  4LFC I;  3GCM A;  4LF4 I;  1NHI A;  4AID A;  4KHP I;  1ELO A;  1PVG A;  2UXB E;  1IBK I;  4FW7 A;  3LPS A;  5C0X B;  1OYR A;  4HAC A;  5JEA E;  1S4E A;  4DR7 I;  5A2Q C;  2O3Z A;  2UXD E;  4BA2 A;  2GQ0 A;  2IER A;  2UUB I;  4X66 I;  1OYS A;  4JI5 E;  4J3D A;  4GKJ E;  1MX0 A;  2A2D A;  4DR3 I;  1Y4U A;  4GKK E;  1IBM I;  1KIJ A;  2GO3 A;  5JEA D;  3WU6 A;  3P76 A;  2XEX A;  1B63 A;  2JE6 A;  2UXB I;  5C0X C;  3P3C A;  3P3E A;  4N3O A;  3Q1Q A;  1FKA E;  4K0K E;  1Z0B A;  2UXD I;  5EL9 A;  3ZKD A;  2PO0 B;  5JEA A;  1ZM3 A;  4HAC B;  2X36 A;  4JI5 I;  4GKJ I;  3M85 D;  4OO1 E;  4GKK I;  1N36 E;  4DPY A;  4BA2 B;  3ZZT A;  3GME A;  4B3S E;  4X62 E;  4AM3 A;  1XMO E;  3L7Z A;  1XNQ E;  4WUD A;  4P7A A;  3B82 A;  4DR2 E;  3Q6M A;  1Z0T A;  1R6L A;  5JEA F;  4K0K I;  2DEI A;  4OO1 D;  2V2V A;  4M1K A;  2JE6 B;  1YHC A;  3NZK A;  1HNX E;  1USU A;  1EA6 A;  3KRN A;  5DRQ A;  3PYD A;  3J80 C;  1HR0 E;  4KQV A;  1RHY A;  1S16 A;  2EFG A;  1N36 I;  5JEA B;  4R1F A;  4B3S I;  4OO1 A;  2BR2 A;  4X62 I;  3OTO E;  1XMO I;  4U3B A;  1XNQ I;  2WW4 A;  2Z5E A;  4DR2 I;  4JG4 A;  3WU4 A;  4LF6 E;  3ZZ0 A;  4DPT A;  4OX9 E;  1USV A;  3L7Z B;  1HNX I;  1NHH A;  2OI2 A;  1HNW E;  3WU5 A;  2CGE A;  3ZKB A;  2UU9 E;  4JYA E;  1HR0 I;  5JEA C;  3B4T A;  1J5E E;  4OO1 F;  1Y5Y A;  3K1J A;  2C39 A;  2PNM A;  4MYT A;  1E3P A;  2JEA A;  2V8P A;  4DUY E;  2J7K A;  2NPF A;  4LF6 I;  4YY3 E;  3J81 Q;  1XNR E;  4B3T E;  1MU5 A;  4OO1 B;  2BR2 B;  4DPW A;  4OX9 I;  1HNW I;  4FWG A;  2UU9 I;  4P52 A;  4JYA I;  1J5E I;  1KKH A;  2CVE A;  4FW6 A;  1WUU A;  5DRR A;  3M6A A;  4IZJ D;  4JI8 E;  2WNR A;  4DUY I;  1KVK A;  4OO1 C;  2C37 A;  4U3D A;  4YY3 I;  2C39 B;  4DPX A;  1XNR I;  4B3T I;  1RR9 A;  1IBL E;  2AJ4 A;  2JEA B;  1MG7 A;  2BA0 G;  3PRY A;  4DV1 E;  3V5R A;  3B78 A;  2IES A;  2HFS A;  2J65 A;  2BA1 D;  4RPF A;  1FWL A;  4YHH E;  3JAM Q;  1P42 A;  4JI8 I;  2BM0 A;  4FW9 A;  1Z0V A;  1Z5C A;  2BM1 A;  1ZXM A;  1N32 E;  2WP8 A;  5IT9 Q;  2O1T A;  4URL A;  4LF8 E;  3QT8 A;  3PS2 A;  4QNK A;  1IBL I;  1FJG E;  2WNR B;  5GME A;  2PNL A;  4DV1 I;  4B3R E;  4LCF A;  4NXM E;  2UUA E;  4HYM A;  3GLL A;  4DU7 A;  2UUC E;  1NZ0 A;  2C37 B;  4JI0 E;  1VI7 A;  4PRV A;  1E3H A;  3H1C A;  4YHH I;  4IZK A;  1Z59 A;  4DUZ E;  1K47 A;  1N32 I;  3QT6 A;  4UT4 A;  3P3G A;  4LF8 I;  2HK2 A;  5LMN E;  4JI2 E;  1FJG I;  5LL6 R;  2VQF E;  4HXZ A;  4MYU A;  4B3M E;  5FLX Q;  3J7A M;  4B3R I;  4NXM I;  3H4L A;  2UUA I;  3J81 C;  2WP8 B;  2O1V A;  4FW4 A;  2UUC I;  1YH8 A;  4JI0 I;  1PIE A;  4DU8 A;  2BV3 A;  3M7N D;  4JI3 E;  3U1K A;  1H74 A;  4LF5 E;  4DUZ I;  2R3V A;  1VIS A;  4XTJ A;  2AE8 A;  2V2Z A;  5ELW A;  1KTV A;  2Z5C A;  2ZBK B;  3B8H A;  2X7I A;  5LMN I;  4JI2 I;  5IWA E;  1Z0C A;  2VQF I;  3LNU A;  4IZK B;  4B3M I;  4DR5 E;  2E1R A;  4DR4 E;  4FWD A;  4PU9 A;  4AQY E;  2VQE E;  2Z5B A;  1D6T A;  2HKJ A;  2PO1 A;  4JI3 I;  4LF5 I;  1FWK A;  4LCG A;  2UXC E;  3OTO I;  3PYE A;  1Z5A A;  5BR8 E;  5C0X D;  4X65 E;  4DV4 E;  3ZZU A;  4OKG A;  1N33 E;  3Q6N A;  5IWA I;  1ZXN A;  5IT9 C;  3HUL A;  4JV5 E;  2IOP A;  4JI1 E;  1U2R A;  4QNJ A;  4DR4 I;  3CDI A;  1Z0E A;  2Z5C B;  4AQY I;  1RRE A;  2VQE I;  3T1H E;  3PS1 A;  3CDJ A;  4MU4 A;  4ED4 A;  2UXC I;  4DR1 E;  1R6M A;  3PYF A;  5L3J A;  3K17 A;  4USM A;  4Z7C A;  5BR8 I;  5K36 E;  4DV0 E;  4DV3 E;  2Z5B B;  2VES A;  2Q2E B;  1EI1 A;  4X65 I;  4DV4 I;  2PO1 B;  4FW3 A;  1N33 I;  1OYP A;  1UDO A;  4I3H A;  4MDT A;  4JV5 I;  4X64 E;  4JI1 I;  2BA1 G;  4IZJ A;  5C0X F;  2CZ9 A;  4JI6 E;  5FLX C;  3T1H I;  5K36 D;  4LFB E;  1XXE A;  2V2Q A;  4IFD E;  4HY1 A;  3PS3 A;  2HK3 A;  4DR1 I;  2PO0 A;  1N34 E;  1H73 A;  4DR6 E;  4DV0 I;  4DV3 I;  3PYG A;  1UDQ A;  5DRP A;  4FWH A;  5K36 A;  3DD6 A;  2PO2 A;  1HNZ E;  4IFD D;  4X64 I;  3J7A G;  2BA0 D;  3WU3 A;  4FW5 A;  1FNM A;  4JI6 I;  5GMD A;  2JEB A;  4DV6 E;  3M85 G;  4LFB I;  1Y4S A;  3GON A;  4MQY A;  4NBQ A;  1UDS A;  2NN6 E;  3LTO A;  4IZJ B;  4MU1 A;  3ZM7 A;  4IFD A;  2F4V E;  1N34 I;  4Z7Y A;  4DR6 I;  5EKW A;  2HFU A;  4ZVI A;  5K36 F;  1Y6Z A;  2GO4 A;  3K85 A;  4DV5 E;  3CWV A;  1H7S A;  4JI7 E;  1NHJ A;  3F0N A;  1HNZ I;  5DNL A;  2NN6 D;  2HHH E;  1H72 C;  4LCH A;  2PNZ A;  1ZM4 A;  1B62 A;  2ZM6 E;  4DV6 I;  4MU3 A;  5K36 B;  1I94 E;  2PO2 B;  3UHM A;  3M7N G;  1DAR A;  4IFD F;  2F4V I;  2NN6 A;  2JEB B;  2F1D A;  4WUB A;  4LF7 E;  2JT2 A;  5A2Q Q;  4DV5 I;  1ZM2 A;  4FN5 A;  2A2C A;  4MU0 A;  4JI7 I;  4LFA E;  2GS8 A;  1OJ4 A;  2ZIT A;  5DRO A;  1XMQ E;  4IFD B;  2HHH I;  3D4J A;  4DV2 E;  1XHK A;  3QT7 A;  3T1Y E;  5K36 C;  4BA1 A;  2ZM6 I;  5C0X E;  2HKE A;  1I94 I;  2CG9 A;  2DEJ A;  1PKP A;  4DV7 E;  2NN6 F;  2O1W A;  4LF9 E;  3QT5 A;  3HKM A;  2V34 A;  3V2U C;  2PNZ B;  4AIM A;  4LF7 I;  4LPF A;  1Z0W A;  1HK7 A;  5DNX A;  4EMD A;  3JAM C;  4IFD C;  4LFA I;  2C38 A;  4UTG A;  5LMU E;  4NXN E;  1XMQ I;  4PRX A;  2NN6 B;  4DR5 I;  4DV2 I;  3T1Y I;  1FI4 A;  4WUC A;  4LOM A;  4GQU A;  1Z0G A;  3P06 A;  5C0X A;  4DV7 I;  2E5L E;  1Y60 A;  4JI4 E;  4LF9 I;  2IOQ A;  4LFC E;  1A6F A;  4LF4 E;  4BA1 B;  4KHP E;  1IBK E;  3U1Y A;  1Z5B A;  4DPU A;  1ZM9 A;  5FWK A;  4ISA A;  4USK A;  4DXL A;  2NN6 C;  2R42 A;  5LMU I;  4NXN I;  1N0U A;  1H7U A;  4DR7 E;  1N0V C;  3J80 Q;  2VF3 A;  1UDN A;  2UUB E;  4X66 E;  1QZR A;  1UEK A;  4IS9 A;  3HJC A;  2O1U A;  2C38 B;  1BKN A; 
#chains in the Genus database with same CATH homology
 4DR3 E;  2LJP A;  1IBM E;  2E5L I;  4JI4 I;  4LFC I;  4LF4 I;  1NHI A;  4KHP I;  1ELO A;  1PVG A;  2UXB E;  1IBK I;  3LPS A;  4HAC A;  1S4E A;  4DR7 I;  5A2Q C;  2UXD E;  2GQ0 A;  2UUB I;  4X66 I;  4JI5 E;  4GKJ E;  2A2D A;  1MX0 A;  4DR3 I;  1Y4U A;  4GKK E;  1IBM I;  1KIJ A;  3WU6 A;  2XEX A;  1B63 A;  2UXB I;  4N3O A;  3Q1Q A;  1FKA E;  4K0K E;  1Z0B A;  2UXD I;  3ZKD A;  1ZM3 A;  4HAC B;  2X36 A;  4JI5 I;  4GKJ I;  4GKK I;  1N36 E;  4DPY A;  3ZZT A;  4B3S E;  4X62 E;  1XMO E;  1XNQ E;  4WUD A;  4P7A A;  3B82 A;  4DR2 E;  3Q6M A;  1Z0T A;  4K0K I;  2DEI A;  2V2V A;  4M1K A;  1HNX E;  1USU A;  1EA6 A;  3PYD A;  3J80 C;  1HR0 E;  4KQV A;  1N36 I;  1S16 A;  2EFG A;  4R1F A;  4B3S I;  4X62 I;  3OTO E;  1XMO I;  1XNQ I;  2WW4 A;  2Z5E A;  4DR2 I;  4JG4 A;  3WU4 A;  4LF6 E;  3ZZ0 A;  4DPT A;  4OX9 E;  1USV A;  1HNX I;  1NHH A;  2OI2 A;  1HNW E;  3WU5 A;  2CGE A;  3ZKB A;  2UU9 E;  4JYA E;  1HR0 I;  1J5E E;  3K1J A;  2PNM A;  4MYT A;  2V8P A;  4DUY E;  2J7K A;  2NPF A;  4LF6 I;  4YY3 E;  3J81 Q;  1XNR E;  4B3T E;  1MU5 A;  4DPW A;  4OX9 I;  1HNW I;  4FWG A;  2UU9 I;  4P52 A;  4JYA I;  1J5E I;  1KKH A;  1WUU A;  3M6A A;  4IZJ D;  4JI8 E;  4DUY I;  1KVK A;  4YY3 I;  4DPX A;  1XNR I;  4B3T I;  1RR9 A;  1IBL E;  2AJ4 A;  1MG7 A;  3PRY A;  4DV1 E;  3V5R A;  3B78 A;  2HFS A;  4RPF A;  1FWL A;  4YHH E;  3JAM Q;  4JI8 I;  2BM0 A;  4FW9 A;  1Z0V A;  1Z5C A;  2BM1 A;  1ZXM A;  1N32 E;  5IT9 Q;  2O1T A;  4URL A;  4LF8 E;  3QT8 A;  1IBL I;  1FJG E;  5GME A;  2PNL A;  4DV1 I;  4B3R E;  4NXM E;  2UUA E;  4HYM A;  4DU7 A;  2UUC E;  1NZ0 A;  4JI0 E;  4PRV A;  4YHH I;  4IZK A;  1Z59 A;  4DUZ E;  1K47 A;  1N32 I;  3QT6 A;  4UT4 A;  4LF8 I;  2HK2 A;  5LMN E;  4JI2 E;  1FJG I;  5LL6 R;  2VQF E;  4HXZ A;  4MYU A;  4B3M E;  5FLX Q;  3J7A M;  4B3R I;  4NXM I;  3H4L A;  2UUA I;  3J81 C;  2O1V A;  2UUC I;  4JI0 I;  1PIE A;  4DU8 A;  2BV3 A;  4JI3 E;  4LF5 E;  1H74 A;  4DUZ I;  2R3V A;  1VIS A;  4XTJ A;  2V2Z A;  1KTV A;  2Z5C A;  2ZBK B;  3B8H A;  2X7I A;  5LMN I;  4JI2 I;  5IWA E;  1Z0C A;  2VQF I;  3LNU A;  4IZK B;  4B3M I;  4DR5 E;  2E1R A;  4DR4 E;  4FWD A;  4PU9 A;  4AQY E;  2VQE E;  2Z5B A;  1D6T A;  2HKJ A;  4JI3 I;  4LF5 I;  1FWK A;  2UXC E;  3OTO I;  3PYE A;  1Z5A A;  5BR8 E;  4X65 E;  4DV4 E;  3ZZU A;  1N33 E;  3Q6N A;  5IWA I;  1ZXN A;  5IT9 C;  3HUL A;  4JV5 E;  2IOP A;  4JI1 E;  1U2R A;  4DR4 I;  1Z0E A;  2Z5C B;  4AQY I;  1RRE A;  2VQE I;  3T1H E;  4ED4 A;  2UXC I;  4DR1 E;  3PYF A;  5L3J A;  3K17 A;  4USM A;  4Z7C A;  5BR8 I;  4DV0 E;  4DV3 E;  2Z5B B;  4X65 I;  1EI1 A;  2Q2E B;  4DV4 I;  1N33 I;  4I3H A;  4JV5 I;  4X64 E;  4JI1 I;  4IZJ A;  2CZ9 A;  4JI6 E;  5FLX C;  3T1H I;  4LFB E;  2V2Q A;  4HY1 A;  2HK3 A;  4DR1 I;  1N34 E;  1H73 A;  4DR6 E;  4DV0 I;  4DV3 I;  3PYG A;  4FWH A;  1HNZ E;  4X64 I;  3J7A G;  3WU3 A;  4JI6 I;  1FNM A;  5GMD A;  4DV6 E;  4LFB I;  1Y4S A;  3GON A;  3LTO A;  4IZJ B;  3ZM7 A;  2F4V E;  1N34 I;  4Z7Y A;  4DR6 I;  2HFU A;  4ZVI A;  1Y6Z A;  3K85 A;  4DV5 E;  3CWV A;  1H7S A;  4JI7 E;  1NHJ A;  3F0N A;  1HNZ I;  2HHH E;  1H72 C;  1ZM4 A;  1B62 A;  2ZM6 E;  4DV6 I;  1I94 E;  1DAR A;  2F4V I;  4WUB A;  4LF7 E;  5A2Q Q;  4DV5 I;  1ZM2 A;  4FN5 A;  2A2C A;  4JI7 I;  4LFA E;  2GS8 A;  1OJ4 A;  2ZIT A;  1XMQ E;  2HHH I;  3D4J A;  4DV2 E;  1XHK A;  3QT7 A;  3T1Y E;  2ZM6 I;  2HKE A;  1I94 I;  2CG9 A;  2DEJ A;  1PKP A;  4DV7 E;  2O1W A;  4LF9 E;  3QT5 A;  2V34 A;  3V2U C;  4LF7 I;  1Z0W A;  1HK7 A;  4EMD A;  3JAM C;  4LFA I;  4UTG A;  5LMU E;  4NXN E;  1XMQ I;  4PRX A;  4DR5 I;  4DV2 I;  3T1Y I;  1FI4 A;  4WUC A;  1Z0G A;  3P06 A;  4DV7 I;  2E5L E;  4JI4 E;  4LF9 I;  4LFC E;  2IOQ A;  1A6F A;  4LF4 E;  4KHP E;  1IBK E;  1Z5B A;  4DPU A;  1ZM9 A;  5FWK A;  4USK A;  4DXL A;  2R42 A;  5LMU I;  4NXN I;  1N0U A;  1H7U A;  4DR7 E;  1N0V C;  3J80 Q;  2VF3 A;  2UUB E;  4X66 E;  1QZR A;  1UEK A;  3HJC A;  2O1U A;  1BKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...