4DV2I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2I00
4KHPE 4X62I 1HNXE 4JG4A 1Z0VA 2UXDE 4JYAE 2ZM6I 4B3ME 4DR4E 3V2UC 2R42A 4WUDA 4JI7E 4B3TI 3J81C 1FI4A 4DPTA 1EI1A 1N36I 2E5LE 5IT9Q 1HNZI 2VQFI 4PRXA 4AQYE 3K1JA 2LJPA 1Z5AA 4UT4A 3LPSA 3F0NA 4MYUA 1NZ0A 4JI6I 3J80C 4DV3E 4JI0E 4FWGA 4ED4A 1N33E 3QT6A 1D6TA 4B3RI 4LF8E 4LF6I 1XNQI 1Z0GA 1XHKA 1N32I 2UUBI 4WUBA 1Z5CA 4RPFA 4FW9A 4JI2I 1Z0WA 4DV4I 4DV7E 2V8PA 1ELOA 2EFGA 1KVKA 2UUCE 1K47A 3ZZUA 1Z0BA 1NHJA 4PU9A 3ZZTA 1B62A 2R3VA 4DUYI 5LMNI 1HNWE 4DR2I 4PRVA 2XEXA 2X7IA 4DR1I 4JI1I 2E1RA 1N34E 2VQEI 2HHHE 4R1FA 4NXNI 4DV0I 4JV5E 4LF7I 2HK2A 4B3SI 5L3JA 2WW4A 4EMDA 4NXNE 2UUAI 2V2QA 4LFBI 1MG7A 3V5RA 4JI5I 4WUCA 1XMQI 2V2VA 4JI3I 1FJGE 3T1YI 1UEKA 3T1HE 4LF5E 3Q1QA 4HACB 1RREA 4ZVIA 3M6AA 1Z5BA 1J5EI 4JI4I 4LF4E 3OTOE 4KQVA 1H74A 1FWKA 2V2ZA 4DR5I 4YHHI 4NXMI 4DR3I 4X62E 3J80Q 1XNRI 3H4LA 1KKHA 1S4EA 2ZM6E 4DPXA 1S16A 5A2QC 4B3TE 2HKEA 2BV3A 1N36E 1HNZE 1Z0EA 3LTOA 4M1KA 4DR7I 4LF9I 2VQFE 1H72C 4X66I 3PYDA 4USMA 1HR0I 2F4VI 3WU4A 4HYMA 1RR9A 2A2DA 1KIJA 1I94I 4X66E 2F4VE 4I3HA 4JI6E 2X36A 5BR8I 1H73A 1I94E 2AJ4A 1ZM9A 4LFCI 4B3RE 4X65I 3B8HA 3J7AM 4LF6E 1XNQE 4LFCE 1N32E 4X64I 2UUBE 2HK3A 2BM1A 2UXBI 4DU7A 1N0UA 5GMDA 4JI2E 4GKKI 1QZRA 4DV4E 1N0VC 3ZZ0A 4DPWA 2UXCI 1H7SA 1XMOI 1B63A 2UU9I 4DUYE 5LMNE 3B78A 4JI8I 4DR2E 3QT5A 1IBLI 2HKJA 3JAMQ 1NHIA 4JI8E 4DR1E 1ZXMA 4JI1E 2VQEE 3WU5A 2ZBKB 1EA6A 4DV0E 4DV6I 4DV5I 5GMEA 4LF7E 4B3SE 4FWHA 1OJ4A 4UTGA 3CWVA 2UUAE 4LFAI 4LFBE 4JI5E 3J81Q 5FLXC 3QT8A 1ZXNA 3PYFA 1XMQE 4JI3E 1KTVA 2NPFA 4HY1A 5A2QQ 1FWLA 4YY3I 3T1YE 5LMUI 1U2RA 4DR6I 4K0KI 4P7AA 2CZ9A 5LL6R 1J5EE 4JI4E 2HFUA 4DUZI 3ZM7A 3WU3A 5IWAI 4DR5E 4YHHE 4NXME 4DR3E 4DPUA 1HNXI 2UXDI 1XNRE 4OX9I 4JYAI 1NHHA 4HXZA 4B3MI 4DR4I 4JI7I 1ZM2A 4OX9E 2J7KA 2E5LI 1ZM3A 2DEIA 1MX0A 1Z0CA 4DR7E 4LF9E 1PVGA 4AQYI 1HR0E 4HACA 2DEJA 1IBKI 2ZITA 3K17A 3WU6A 4FWDA 5BR8E 1IBKE 4MYTA 4JI0I 4DV3I 1N33I 2V34A 4P52A 4X65E 4LF8I 4XTJA 4Z7YA 4X64E 3PYEA 2UXBE 5IT9C 4DU8A 4GKKE 1FNMA 1H7UA 4DV7I 2UXCE 1XMOE 2UUCI 3J7AG 4GKJI 5FLXQ 1IBMI 1PKPA 2UU9E 2BM0A 1A6FA 1HNWI 4GKJE 1MU5A 2HFSA 1IBME 1IBLE 1WUUA 3D4JA 1FKAE 1N34I 4Z7CA 1PIEA 1BKNA 2HHHI 2OI2A 4DV6E 1Z59A 4DV5E 4JV5I 3ZKBA 2Q2EB 3HULA 4LFAE 4USKA 3QT7A 2VF3A 3LNUA 1FJGI 4YY3E 3ZKDA 3T1HI 5LMUE 4LF5I 4DV1I 4FN5A 2A2CA 3PYGA 4DR6E 4K0KE 2GS8A 3JAMC 3GONA 1DARA 4DV2I 4URLA 4DV1E 4DXLA 1VISA 4LF4I 4DPYA 4DUZE 1ZM4A 4KHPI 3OTOI 1Z0TA 4DV2E 5IWAE 3B82A
chains in the Genus database with same CATH superfamily
2PO1A 4KHPE 1USVA 1Y4SA 3PS1A 4X62I 4IZJA 4JG4A 1Z0VA 1HNXE 2UXDE 4LCHA 5C0XC 4JYAE 5C0XE 2JEAA 3L7ZA 2ZM6I 4B3ME 4DR4E 3V2UC 4IFDC 4IFDE 2R42A 2WNRB 4WUDA 2NN6D 4JI7E 3J81C 4B3TI 1FI4A 3GLLA 4DPTA 1EI1A 1N36I 1RHYA 2E5LE 5IT9Q 2PNZA 1HNZI 2VQFI 4PRXA 4AQYE 3K1JA 2LJPA 1Z5AA 4UT4A 3LPSA 4OO1A 3F0NA 4MYUA 1NZ0A 4JI6I 4GQUA 3J80C 3PRYA 4DV3E 4JI0E 1USUA 4FWGA 4ED4A 1N33E 4OO1C 3QT6A 1Y60A 4OO1E 1D6TA 4B3RI 2PNLA 4LCFA 4LF8E 4LF6I 5JEAC 2IOPA 1XNQI 2JE6A 1Z0GA 3GCMA 1XHKA 1N32I 2UUBI 3PS3A 4QNJA 4WUBA 1UDOA 1Z5CA 4RPFA 4FW9A 4JI2I 4BA2A 2BA1G 1Z0WA 4DV4I 3P76A 4DV7E 2V8PA 1ELOA 2EFGA 1KVKA 3PS2A 2UUCE 1K47A 3ZZUA 1Z0BA 1NHJA 4PU9A 3ZZTA 1B62A 2R3VA 2JT2A 4DUYI 5LMNI 1HNWE 5K36A 4MDTA 4DR2I 4PRVA 2JEBB 2XEXA 1P42A 2X7IA 4DR1I 3U1YA 3H1CA 4J3DA 4JI1I 2E1RA 5DRQA 1N34E 5C0XB 2VQEI 2HHHE 4R1FA 2NN6F 4IFDB 4NXNI 4DV0I 1Y6ZA 4JV5E 2C39A 4MU1A 4LF7I 2HK2A 4B3SI 5L3JA 2WW4A 4EMDA 4NXNE 4FW4A 2UUAI 2V2QA 1E3HA 4LFBI 1MG7A 3V5RA 4JI5I 4WUCA 4FW5A 4AIDA 1XMQI 2V2VA 4JI3I 4FW3A 1FJGE 3T1YI 1UEKA 3T1HE 3UHMA 2PNZB 4LF5E 3Q1QA 4HACB 3GMEA 1RREA 4ZVIA 1OYPA 3M6AA 1Z5BA 4OO1B 1J5EI 4JI4I 3CDIA 4LF4E 3OTOE 4KQVA 4OZEA 1H74A 5DRPA 5JEAB 1FWKA 2V2ZA 1OYRA 3Q6NA 4DR5I 2CVEA 4YHHI 4NXMI 4DR3I 4X62E 3J80Q 1XNRI 3H4LA 1KKHA 4FW6A 1S4EA 2ZM6E 1E3PA 4DPXA 1S16A 5A2QC 4B3TE 2JE6B 2HKEA 1YHCA 2BV3A 5JEAF 1N36E 4FW7A 2GQ0A 2O1UA 4IZKA 1HNZE 5C0XD 2BR2A 1Z0EA 3LTOA 4M1KA 4DR7I 4LF9I 4IFDD 3P06A 1H72C 2VQFE 4X66I 3PYDA 4USMA 2C38A 2PO2A 1HR0I 3WU4A 2F4VI 4HYMA 1RR9A 2A2DA 3M85G 1KIJA 1I94I 4X66E 2F4VE 4I3HA 5DROA 3CDJA 5DNLA 4JI6E 2X36A 3M7NG 5BR8I 1H73A 1I94E 2AE8A 2AJ4A 1ZM9A 4LFCI 4B3RE 2O1TA 4X65I 1VI7A 4LCGA 3B8HA 3J7AM 4LF6E 4BA1B 1XNQE 4LFCE 2C37A 1N32E 4X64I 2UUBE 2HK3A 2BM1A 2UXBI 3NZKA 4DU7A 1N0UA 5GMDA 4JI2E 4OO1D 4GKKI 1QZRA 2PO0A 4DV4E 1N0VC 3ZZ0A 4DPWA 2UXCI 1H7SA 5JEAD 1XMOI 1B63A 1Y5YA 2UU9I 4DUYE 5LMNE 4OKGA 3B78A 4JI8I 4U3BA 2BA0D 4DR2E 3QT5A 1IBLI 2HKJA 3JAMQ 1NHIA 3HKMA 4JI8E 4DR1E 4U3DA 1ZXMA 5K36C 4JI1E 5K36E 2VQEE 2PO1B 2PNMA 3WU5A 2ZBKB 1EA6A 4IZJB 4DV0E 4DV6I 4DV5I 2O1VA 5GMEA 4LF7E 2JEAB 3L7ZB 4B3SE 4FWHA 1OJ4A 4UTGA 5C0XF 3CWVA 2UUAE 4LFAI 4IFDF 4LFBE 4JI5E 3J81Q 5FLXC 3QT8A 1ZXNA 3PYFA 4NBQA 1XMQE 4JI3E 1KTVA 1R6MA 5DNXA 2NPFA 4HY1A 5A2QQ 1FWLA 4YY3I 4ISAA 3T1YE 5LMUI 4IZKB 2NN6A 2BR2B 1UDNA 2Z5BA 1U2RA 4DR6I 4K0KI 4P7AA 2C38B 2CZ9A 5LL6R 3B4TA 1J5EE 4JI4E 3U1KA 2HFUA 4DUZI 3ZM7A 2CG9A 3WU3A 5IWAI 2NN6C 2NN6E 4DR5E 4YHHE 5EKWA 4NXME 4DR3E 4OO1F 2WP8A 4DPUA 1HNXI 2UXDI 1OYSA 1XNRE 4OX9I 4JYAI 1NHHA 4HXZA 4LPFA 4B3MI 4DR4I 4JI7I 4BA2B 1ZM2A 2C37B 2O1WA 4OX9E 1XXEA 2J65A 4MQYA 2J7KA 2BA1D 2E5LI 1ZM3A 2DEIA 1MX0A 2PO0B 1HK7A 2F1DA 1Z0CA 4DR7E 4LF9E 3P3EA 1PVGA 4AQYI 4IZJD 5K36B 1HR0E 4HACA 2DEJA 5DRRA 2Z5CA 1IBKI 2ZITA 4AM3A 3K17A 3WU6A 4FWDA 5BR8E 1UDQA 1IBKE 4MU0A 4MYTA 4JI0I 4DV3I 5JEAA 1N33I 2V34A 4P52A 4N3OA 2C39B 4X65E 5K36F 4LF8I 4XTJA 2WNRA 4Z7YA 4X64E 3PYEA 2UXBE 5IT9C 4DU8A 4IS9A 5JEAE 3P3CA 4GKKE 1FNMA 1H7UA 4DV7I 5FWKA 2UXCE 1XMOE 2GO4A 4MU3A 2UUCI 5ELWA 3J7AG 4GKJI 5FLXQ 1IBMI 1PKPA 2UU9E 1R6LA 2BM0A 1A6FA 1HNWI 4GKJE 1MU5A 2NN6B 2HFSA 3Q6MA 1IBME 1UDSA 2Z5BB 1IBLE 1WUUA 3D4JA 1FKAE 1Y4UA 2VESA 1N34I 4Z7CA 1PIEA 1BKNA 4MU4A 2HHHI 4LOMA 2OI2A 2O3ZA 3KRNA 4QNKA 2Z5EA 4DV6E 1Z59A 3DD6A 4DV5E 4JV5I 1YH8A 3ZKBA 2WP8B 4BA1A 5K36D 2Q2EB 3HULA 4LFAE 2CGEA 4USKA 3QT7A 2VF3A 3LNUA 2IESA 1FJGI 4YY3E 3ZKDA 3HJCA 2GO3A 3T1HI 5LMUE 4LF5I 2PO2B 4DV1I 4FN5A 2JEBA 2A2CA 2BA0G 2IOQA 3PYGA 4DR6E 4K0KE 2GS8A 3JAMC 3GONA 1DARA 4DV2I 4URLA 4DV1E 3M85D 4DXLA 1VISA 4AIMA 3P3GA 5C0XA 4LF4I 4DPYA 4DUZE 1ZM4A 4KHPI 2Z5CB 3OTOI 1Z0TA 4DV2E 5IWAE 5EL9A 3M7ND 4IFDA 3K85A 3B82A 2IERA
chains in the Genus database with same CATH topology
4KHPE 1USVA 1Y4SA 4X62I 4IZJA 4JG4A 1Z0VA 1HNXE 2UXDE 4JYAE 2ZM6I 4B3ME 4DR4E 3V2UC 2R42A 4WUDA 4JI7E 4B3TI 3J81C 1FI4A 4DPTA 1EI1A 1N36I 2E5LE 5IT9Q 1HNZI 2VQFI 4PRXA 4AQYE 3K1JA 2LJPA 1Z5AA 4UT4A 3LPSA 3F0NA 4MYUA 1NZ0A 4JI6I 3J80C 3PRYA 4DV3E 4JI0E 1USUA 4FWGA 4ED4A 1N33E 3QT6A 1D6TA 4B3RI 2PNLA 4LF8E 4LF6I 2IOPA 1XNQI 1Z0GA 1XHKA 1N32I 2UUBI 4WUBA 1Z5CA 4RPFA 4FW9A 4JI2I 1Z0WA 4DV4I 4DV7E 2V8PA 1ELOA 2EFGA 1KVKA 2UUCE 1K47A 3ZZUA 1Z0BA 1NHJA 4PU9A 3ZZTA 1B62A 2R3VA 4DUYI 5LMNI 1HNWE 4DR2I 4PRVA 2XEXA 2X7IA 4DR1I 4JI1I 2E1RA 1N34E 2VQEI 2HHHE 4R1FA 4NXNI 4DV0I 1Y6ZA 4JV5E 4LF7I 2HK2A 4B3SI 5L3JA 2WW4A 4EMDA 4NXNE 2UUAI 2V2QA 4LFBI 1MG7A 3V5RA 4JI5I 4WUCA 1XMQI 2V2VA 4JI3I 1FJGE 3T1YI 1UEKA 3T1HE 4LF5E 3Q1QA 4HACB 1RREA 4ZVIA 3M6AA 1Z5BA 1J5EI 4JI4I 4LF4E 3OTOE 4KQVA 1H74A 1FWKA 2V2ZA 3Q6NA 4DR5I 4YHHI 4NXMI 4DR3I 4X62E 3J80Q 1XNRI 3H4LA 1KKHA 1S4EA 2ZM6E 4DPXA 1S16A 5A2QC 4B3TE 2HKEA 2BV3A 1N36E 2GQ0A 2O1UA 4IZKA 1HNZE 1Z0EA 3LTOA 4M1KA 4DR7I 4LF9I 3P06A 1H72C 2VQFE 4X66I 3PYDA 4USMA 1HR0I 2F4VI 3WU4A 4HYMA 1RR9A 2A2DA 1KIJA 1I94I 4X66E 2F4VE 4I3HA 4JI6E 2X36A 5BR8I 1H73A 1I94E 2AJ4A 1ZM9A 4LFCI 4B3RE 2O1TA 4X65I 3B8HA 3J7AM 4LF6E 1XNQE 4LFCE 1N32E 4X64I 2UUBE 2HK3A 2BM1A 2UXBI 4DU7A 1N0UA 5GMDA 4JI2E 4GKKI 1QZRA 4DV4E 1N0VC 3ZZ0A 4DPWA 2UXCI 1H7SA 1XMOI 1B63A 2UU9I 4DUYE 5LMNE 3B78A 4JI8I 4DR2E 3QT5A 1IBLI 2HKJA 3JAMQ 1NHIA 4JI8E 4DR1E 1ZXMA 4JI1E 2VQEE 2PNMA 3WU5A 2ZBKB 1EA6A 4IZJB 4DV0E 4DV6I 4DV5I 2O1VA 5GMEA 4LF7E 4B3SE 4FWHA 1OJ4A 4UTGA 3CWVA 2UUAE 4LFAI 4LFBE 4JI5E 3J81Q 5FLXC 3QT8A 1ZXNA 3PYFA 1XMQE 4JI3E 1KTVA 2NPFA 4HY1A 5A2QQ 1FWLA 4YY3I 3T1YE 5LMUI 4IZKB 2Z5BA 1U2RA 4DR6I 4K0KI 4P7AA 2CZ9A 5LL6R 1J5EE 4JI4E 2HFUA 4DUZI 3ZM7A 2CG9A 3WU3A 5IWAI 4DR5E 4YHHE 4NXME 4DR3E 4DPUA 1HNXI 2UXDI 1XNRE 4OX9I 4JYAI 1NHHA 4HXZA 4B3MI 4DR4I 4JI7I 1ZM2A 2O1WA 4OX9E 2J7KA 2E5LI 1ZM3A 2DEIA 1MX0A 1HK7A 1Z0CA 4DR7E 4LF9E 1PVGA 4AQYI 4IZJD 1HR0E 4HACA 2DEJA 2Z5CA 1IBKI 2ZITA 3K17A 3WU6A 4FWDA 5BR8E 1IBKE 4MYTA 4JI0I 4DV3I 1N33I 2V34A 4P52A 4N3OA 4X65E 4LF8I 4XTJA 4Z7YA 4X64E 3PYEA 2UXBE 5IT9C 4DU8A 4GKKE 1FNMA 1H7UA 4DV7I 5FWKA 2UXCE 1XMOE 2UUCI 3J7AG 4GKJI 5FLXQ 1IBMI 1PKPA 2UU9E 2BM0A 1A6FA 1HNWI 4GKJE 1MU5A 2HFSA 3Q6MA 1IBME 2Z5BB 1IBLE 1WUUA 3D4JA 1FKAE 1Y4UA 1N34I 4Z7CA 1PIEA 1BKNA 2HHHI 2OI2A 2Z5EA 4DV6E 1Z59A 4DV5E 4JV5I 3ZKBA 2Q2EB 3HULA 4LFAE 2CGEA 4USKA 3QT7A 2VF3A 3LNUA 1FJGI 4YY3E 3ZKDA 3HJCA 3T1HI 5LMUE 4LF5I 4DV1I 4FN5A 2A2CA 2IOQA 3PYGA 4DR6E 4K0KE 2GS8A 3JAMC 3GONA 1DARA 4DV2I 4URLA 4DV1E 4DXLA 1VISA 4LF4I 4DPYA 4DUZE 1ZM4A 4KHPI 2Z5CB 3OTOI 1Z0TA 4DV2E 5IWAE 3K85A 3B82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP E;  4X62 I;  1HNX E;  4JG4 A;  1Z0V A;  2UXD E;  4JYA E;  2ZM6 I;  4B3M E;  4DR4 E;  3V2U C;  2R42 A;  4WUD A;  4JI7 E;  4B3T I;  3J81 C;  1FI4 A;  4DPT A;  1EI1 A;  1N36 I;  2E5L E;  5IT9 Q;  1HNZ I;  2VQF I;  4PRX A;  4AQY E;  3K1J A;  2LJP A;  1Z5A A;  4UT4 A;  3LPS A;  3F0N A;  4MYU A;  1NZ0 A;  4JI6 I;  3J80 C;  4DV3 E;  4JI0 E;  4FWG A;  4ED4 A;  1N33 E;  3QT6 A;  1D6T A;  4B3R I;  4LF8 E;  4LF6 I;  1XNQ I;  1Z0G A;  1XHK A;  1N32 I;  2UUB I;  4WUB A;  1Z5C A;  4RPF A;  4FW9 A;  4JI2 I;  1Z0W A;  4DV4 I;  4DV7 E;  2V8P A;  1ELO A;  2EFG A;  1KVK A;  2UUC E;  1K47 A;  3ZZU A;  1Z0B A;  1NHJ A;  4PU9 A;  3ZZT A;  1B62 A;  2R3V A;  4DUY I;  5LMN I;  1HNW E;  4DR2 I;  4PRV A;  2XEX A;  2X7I A;  4DR1 I;  4JI1 I;  2E1R A;  1N34 E;  2VQE I;  2HHH E;  4R1F A;  4NXN I;  4DV0 I;  4JV5 E;  4LF7 I;  2HK2 A;  4B3S I;  5L3J A;  2WW4 A;  4EMD A;  4NXN E;  2UUA I;  2V2Q A;  4LFB I;  1MG7 A;  3V5R A;  4JI5 I;  4WUC A;  1XMQ I;  2V2V A;  4JI3 I;  1FJG E;  3T1Y I;  1UEK A;  3T1H E;  4LF5 E;  3Q1Q A;  4HAC B;  1RRE A;  4ZVI A;  3M6A A;  1Z5B A;  1J5E I;  4JI4 I;  4LF4 E;  3OTO E;  4KQV A;  1H74 A;  1FWK A;  2V2Z A;  4DR5 I;  4YHH I;  4NXM I;  4DR3 I;  4X62 E;  3J80 Q;  1XNR I;  3H4L A;  1KKH A;  1S4E A;  2ZM6 E;  4DPX A;  1S16 A;  5A2Q C;  4B3T E;  2HKE A;  2BV3 A;  1N36 E;  1HNZ E;  1Z0E A;  3LTO A;  4M1K A;  4DR7 I;  4LF9 I;  2VQF E;  1H72 C;  4X66 I;  3PYD A;  4USM A;  1HR0 I;  2F4V I;  3WU4 A;  4HYM A;  1RR9 A;  2A2D A;  1KIJ A;  1I94 I;  4X66 E;  2F4V E;  4I3H A;  4JI6 E;  2X36 A;  5BR8 I;  1H73 A;  1I94 E;  2AJ4 A;  1ZM9 A;  4LFC I;  4B3R E;  4X65 I;  3B8H A;  3J7A M;  4LF6 E;  1XNQ E;  4LFC E;  1N32 E;  4X64 I;  2UUB E;  2HK3 A;  2BM1 A;  2UXB I;  4DU7 A;  1N0U A;  5GMD A;  4JI2 E;  4GKK I;  1QZR A;  4DV4 E;  1N0V C;  3ZZ0 A;  4DPW A;  2UXC I;  1H7S A;  1XMO I;  1B63 A;  2UU9 I;  4DUY E;  5LMN E;  3B78 A;  4JI8 I;  4DR2 E;  3QT5 A;  1IBL I;  2HKJ A;  3JAM Q;  1NHI A;  4JI8 E;  4DR1 E;  1ZXM A;  4JI1 E;  2VQE E;  3WU5 A;  2ZBK B;  1EA6 A;  4DV0 E;  4DV6 I;  4DV5 I;  5GME A;  4LF7 E;  4B3S E;  4FWH A;  1OJ4 A;  4UTG A;  3CWV A;  2UUA E;  4LFA I;  4LFB E;  4JI5 E;  3J81 Q;  5FLX C;  3QT8 A;  1ZXN A;  3PYF A;  1XMQ E;  4JI3 E;  1KTV A;  2NPF A;  4HY1 A;  5A2Q Q;  1FWL A;  4YY3 I;  3T1Y E;  5LMU I;  1U2R A;  4DR6 I;  4K0K I;  4P7A A;  2CZ9 A;  5LL6 R;  1J5E E;  4JI4 E;  2HFU A;  4DUZ I;  3ZM7 A;  3WU3 A;  5IWA I;  4DR5 E;  4YHH E;  4NXM E;  4DR3 E;  4DPU A;  1HNX I;  2UXD I;  1XNR E;  4OX9 I;  4JYA I;  1NHH A;  4HXZ A;  4B3M I;  4DR4 I;  4JI7 I;  1ZM2 A;  4OX9 E;  2J7K A;  2E5L I;  1ZM3 A;  2DEI A;  1MX0 A;  1Z0C A;  4DR7 E;  4LF9 E;  1PVG A;  4AQY I;  1HR0 E;  4HAC A;  2DEJ A;  1IBK I;  2ZIT A;  3K17 A;  3WU6 A;  4FWD A;  5BR8 E;  1IBK E;  4MYT A;  4JI0 I;  4DV3 I;  1N33 I;  2V34 A;  4P52 A;  4X65 E;  4LF8 I;  4XTJ A;  4Z7Y A;  4X64 E;  3PYE A;  2UXB E;  5IT9 C;  4DU8 A;  4GKK E;  1FNM A;  1H7U A;  4DV7 I;  2UXC E;  1XMO E;  2UUC I;  3J7A G;  4GKJ I;  5FLX Q;  1IBM I;  1PKP A;  2UU9 E;  2BM0 A;  1A6F A;  1HNW I;  4GKJ E;  1MU5 A;  2HFS A;  1IBM E;  1IBL E;  1WUU A;  3D4J A;  1FKA E;  1N34 I;  4Z7C A;  1PIE A;  1BKN A;  2HHH I;  2OI2 A;  4DV6 E;  1Z59 A;  4DV5 E;  4JV5 I;  3ZKB A;  2Q2E B;  3HUL A;  4LFA E;  4USK A;  3QT7 A;  2VF3 A;  3LNU A;  1FJG I;  4YY3 E;  3ZKD A;  3T1H I;  5LMU E;  4LF5 I;  4DV1 I;  4FN5 A;  2A2C A;  3PYG A;  4DR6 E;  4K0K E;  2GS8 A;  3JAM C;  3GON A;  1DAR A;  4DV2 I;  4URL A;  4DV1 E;  4DXL A;  1VIS A;  4LF4 I;  4DPY A;  4DUZ E;  1ZM4 A;  4KHP I;  3OTO I;  1Z0T A;  4DV2 E;  5IWA E;  3B82 A; 
#chains in the Genus database with same CATH topology
 2PO1 A;  4KHP E;  1USV A;  1Y4S A;  3PS1 A;  4X62 I;  4IZJ A;  4JG4 A;  1Z0V A;  1HNX E;  2UXD E;  4LCH A;  5C0X C;  4JYA E;  5C0X E;  2JEA A;  3L7Z A;  2ZM6 I;  4B3M E;  4DR4 E;  3V2U C;  4IFD C;  4IFD E;  2R42 A;  2WNR B;  4WUD A;  2NN6 D;  4JI7 E;  3J81 C;  4B3T I;  1FI4 A;  3GLL A;  4DPT A;  1EI1 A;  1N36 I;  1RHY A;  2E5L E;  5IT9 Q;  2PNZ A;  1HNZ I;  2VQF I;  4PRX A;  4AQY E;  3K1J A;  2LJP A;  1Z5A A;  4UT4 A;  3LPS A;  4OO1 A;  3F0N A;  4MYU A;  1NZ0 A;  4JI6 I;  4GQU A;  3J80 C;  3PRY A;  4DV3 E;  4JI0 E;  1USU A;  4FWG A;  4ED4 A;  1N33 E;  4OO1 C;  3QT6 A;  1Y60 A;  4OO1 E;  1D6T A;  4B3R I;  2PNL A;  4LCF A;  4LF8 E;  4LF6 I;  5JEA C;  2IOP A;  1XNQ I;  2JE6 A;  1Z0G A;  3GCM A;  1XHK A;  1N32 I;  2UUB I;  3PS3 A;  4QNJ A;  4WUB A;  1UDO A;  1Z5C A;  4RPF A;  4FW9 A;  4JI2 I;  4BA2 A;  2BA1 G;  1Z0W A;  4DV4 I;  3P76 A;  4DV7 E;  2V8P A;  1ELO A;  2EFG A;  1KVK A;  3PS2 A;  2UUC E;  1K47 A;  3ZZU A;  1Z0B A;  1NHJ A;  4PU9 A;  3ZZT A;  1B62 A;  2R3V A;  2JT2 A;  4DUY I;  5LMN I;  1HNW E;  5K36 A;  4MDT A;  4DR2 I;  4PRV A;  2JEB B;  2XEX A;  1P42 A;  2X7I A;  4DR1 I;  3U1Y A;  3H1C A;  4J3D A;  4JI1 I;  2E1R A;  5DRQ A;  1N34 E;  5C0X B;  2VQE I;  2HHH E;  4R1F A;  2NN6 F;  4IFD B;  4NXN I;  4DV0 I;  1Y6Z A;  4JV5 E;  2C39 A;  4MU1 A;  4LF7 I;  2HK2 A;  4B3S I;  5L3J A;  2WW4 A;  4EMD A;  4NXN E;  4FW4 A;  2UUA I;  2V2Q A;  1E3H A;  4LFB I;  1MG7 A;  3V5R A;  4JI5 I;  4WUC A;  4FW5 A;  4AID A;  1XMQ I;  2V2V A;  4JI3 I;  4FW3 A;  1FJG E;  3T1Y I;  1UEK A;  3T1H E;  3UHM A;  2PNZ B;  4LF5 E;  3Q1Q A;  4HAC B;  3GME A;  1RRE A;  4ZVI A;  1OYP A;  3M6A A;  1Z5B A;  4OO1 B;  1J5E I;  4JI4 I;  3CDI A;  4LF4 E;  3OTO E;  4KQV A;  4OZE A;  1H74 A;  5DRP A;  5JEA B;  1FWK A;  2V2Z A;  1OYR A;  3Q6N A;  4DR5 I;  2CVE A;  4YHH I;  4NXM I;  4DR3 I;  4X62 E;  3J80 Q;  1XNR I;  3H4L A;  1KKH A;  4FW6 A;  1S4E A;  2ZM6 E;  1E3P A;  4DPX A;  1S16 A;  5A2Q C;  4B3T E;  2JE6 B;  2HKE A;  1YHC A;  2BV3 A;  5JEA F;  1N36 E;  4FW7 A;  2GQ0 A;  2O1U A;  4IZK A;  1HNZ E;  5C0X D;  2BR2 A;  1Z0E A;  3LTO A;  4M1K A;  4DR7 I;  4LF9 I;  4IFD D;  3P06 A;  1H72 C;  2VQF E;  4X66 I;  3PYD A;  4USM A;  2C38 A;  2PO2 A;  1HR0 I;  3WU4 A;  2F4V I;  4HYM A;  1RR9 A;  2A2D A;  3M85 G;  1KIJ A;  1I94 I;  4X66 E;  2F4V E;  4I3H A;  5DRO A;  3CDJ A;  5DNL A;  4JI6 E;  2X36 A;  3M7N G;  5BR8 I;  1H73 A;  1I94 E;  2AE8 A;  2AJ4 A;  1ZM9 A;  4LFC I;  4B3R E;  2O1T A;  4X65 I;  1VI7 A;  4LCG A;  3B8H A;  3J7A M;  4LF6 E;  4BA1 B;  1XNQ E;  4LFC E;  2C37 A;  1N32 E;  4X64 I;  2UUB E;  2HK3 A;  2BM1 A;  2UXB I;  3NZK A;  4DU7 A;  1N0U A;  5GMD A;  4JI2 E;  4OO1 D;  4GKK I;  1QZR A;  2PO0 A;  4DV4 E;  1N0V C;  3ZZ0 A;  4DPW A;  2UXC I;  1H7S A;  5JEA D;  1XMO I;  1B63 A;  1Y5Y A;  2UU9 I;  4DUY E;  5LMN E;  4OKG A;  3B78 A;  4JI8 I;  4U3B A;  2BA0 D;  4DR2 E;  3QT5 A;  1IBL I;  2HKJ A;  3JAM Q;  1NHI A;  3HKM A;  4JI8 E;  4DR1 E;  4U3D A;  1ZXM A;  5K36 C;  4JI1 E;  5K36 E;  2VQE E;  2PO1 B;  2PNM A;  3WU5 A;  2ZBK B;  1EA6 A;  4IZJ B;  4DV0 E;  4DV6 I;  4DV5 I;  2O1V A;  5GME A;  4LF7 E;  2JEA B;  3L7Z B;  4B3S E;  4FWH A;  1OJ4 A;  4UTG A;  5C0X F;  3CWV A;  2UUA E;  4LFA I;  4IFD F;  4LFB E;  4JI5 E;  3J81 Q;  5FLX C;  3QT8 A;  1ZXN A;  3PYF A;  4NBQ A;  1XMQ E;  4JI3 E;  1KTV A;  1R6M A;  5DNX A;  2NPF A;  4HY1 A;  5A2Q Q;  1FWL A;  4YY3 I;  4ISA A;  3T1Y E;  5LMU I;  4IZK B;  2NN6 A;  2BR2 B;  1UDN A;  2Z5B A;  1U2R A;  4DR6 I;  4K0K I;  4P7A A;  2C38 B;  2CZ9 A;  5LL6 R;  3B4T A;  1J5E E;  4JI4 E;  3U1K A;  2HFU A;  4DUZ I;  3ZM7 A;  2CG9 A;  3WU3 A;  5IWA I;  2NN6 C;  2NN6 E;  4DR5 E;  4YHH E;  5EKW A;  4NXM E;  4DR3 E;  4OO1 F;  2WP8 A;  4DPU A;  1HNX I;  2UXD I;  1OYS A;  1XNR E;  4OX9 I;  4JYA I;  1NHH A;  4HXZ A;  4LPF A;  4B3M I;  4DR4 I;  4JI7 I;  4BA2 B;  1ZM2 A;  2C37 B;  2O1W A;  4OX9 E;  1XXE A;  2J65 A;  4MQY A;  2J7K A;  2BA1 D;  2E5L I;  1ZM3 A;  2DEI A;  1MX0 A;  2PO0 B;  1HK7 A;  2F1D A;  1Z0C A;  4DR7 E;  4LF9 E;  3P3E A;  1PVG A;  4AQY I;  4IZJ D;  5K36 B;  1HR0 E;  4HAC A;  2DEJ A;  5DRR A;  2Z5C A;  1IBK I;  2ZIT A;  4AM3 A;  3K17 A;  3WU6 A;  4FWD A;  5BR8 E;  1UDQ A;  1IBK E;  4MU0 A;  4MYT A;  4JI0 I;  4DV3 I;  5JEA A;  1N33 I;  2V34 A;  4P52 A;  4N3O A;  2C39 B;  4X65 E;  5K36 F;  4LF8 I;  4XTJ A;  2WNR A;  4Z7Y A;  4X64 E;  3PYE A;  2UXB E;  5IT9 C;  4DU8 A;  4IS9 A;  5JEA E;  3P3C A;  4GKK E;  1FNM A;  1H7U A;  4DV7 I;  5FWK A;  2UXC E;  1XMO E;  2GO4 A;  4MU3 A;  2UUC I;  5ELW A;  3J7A G;  4GKJ I;  5FLX Q;  1IBM I;  1PKP A;  2UU9 E;  1R6L A;  2BM0 A;  1A6F A;  1HNW I;  4GKJ E;  1MU5 A;  2NN6 B;  2HFS A;  3Q6M A;  1IBM E;  1UDS A;  2Z5B B;  1IBL E;  1WUU A;  3D4J A;  1FKA E;  1Y4U A;  2VES A;  1N34 I;  4Z7C A;  1PIE A;  1BKN A;  4MU4 A;  2HHH I;  4LOM A;  2OI2 A;  2O3Z A;  3KRN A;  4QNK A;  2Z5E A;  4DV6 E;  1Z59 A;  3DD6 A;  4DV5 E;  4JV5 I;  1YH8 A;  3ZKB A;  2WP8 B;  4BA1 A;  5K36 D;  2Q2E B;  3HUL A;  4LFA E;  2CGE A;  4USK A;  3QT7 A;  2VF3 A;  3LNU A;  2IES A;  1FJG I;  4YY3 E;  3ZKD A;  3HJC A;  2GO3 A;  3T1H I;  5LMU E;  4LF5 I;  2PO2 B;  4DV1 I;  4FN5 A;  2JEB A;  2A2C A;  2BA0 G;  2IOQ A;  3PYG A;  4DR6 E;  4K0K E;  2GS8 A;  3JAM C;  3GON A;  1DAR A;  4DV2 I;  4URL A;  4DV1 E;  3M85 D;  4DXL A;  1VIS A;  4AIM A;  3P3G A;  5C0X A;  4LF4 I;  4DPY A;  4DUZ E;  1ZM4 A;  4KHP I;  2Z5C B;  3OTO I;  1Z0T A;  4DV2 E;  5IWA E;  5EL9 A;  3M7N D;  4IFD A;  3K85 A;  3B82 A;  2IER A; 
#chains in the Genus database with same CATH homology
 4KHP E;  1USV A;  1Y4S A;  4X62 I;  4IZJ A;  4JG4 A;  1Z0V A;  1HNX E;  2UXD E;  4JYA E;  2ZM6 I;  4B3M E;  4DR4 E;  3V2U C;  2R42 A;  4WUD A;  4JI7 E;  4B3T I;  3J81 C;  1FI4 A;  4DPT A;  1EI1 A;  1N36 I;  2E5L E;  5IT9 Q;  1HNZ I;  2VQF I;  4PRX A;  4AQY E;  3K1J A;  2LJP A;  1Z5A A;  4UT4 A;  3LPS A;  3F0N A;  4MYU A;  1NZ0 A;  4JI6 I;  3J80 C;  3PRY A;  4DV3 E;  4JI0 E;  1USU A;  4FWG A;  4ED4 A;  1N33 E;  3QT6 A;  1D6T A;  4B3R I;  2PNL A;  4LF8 E;  4LF6 I;  2IOP A;  1XNQ I;  1Z0G A;  1XHK A;  1N32 I;  2UUB I;  4WUB A;  1Z5C A;  4RPF A;  4FW9 A;  4JI2 I;  1Z0W A;  4DV4 I;  4DV7 E;  2V8P A;  1ELO A;  2EFG A;  1KVK A;  2UUC E;  1K47 A;  3ZZU A;  1Z0B A;  1NHJ A;  4PU9 A;  3ZZT A;  1B62 A;  2R3V A;  4DUY I;  5LMN I;  1HNW E;  4DR2 I;  4PRV A;  2XEX A;  2X7I A;  4DR1 I;  4JI1 I;  2E1R A;  1N34 E;  2VQE I;  2HHH E;  4R1F A;  4NXN I;  4DV0 I;  1Y6Z A;  4JV5 E;  4LF7 I;  2HK2 A;  4B3S I;  5L3J A;  2WW4 A;  4EMD A;  4NXN E;  2UUA I;  2V2Q A;  4LFB I;  1MG7 A;  3V5R A;  4JI5 I;  4WUC A;  1XMQ I;  2V2V A;  4JI3 I;  1FJG E;  3T1Y I;  1UEK A;  3T1H E;  4LF5 E;  3Q1Q A;  4HAC B;  1RRE A;  4ZVI A;  3M6A A;  1Z5B A;  1J5E I;  4JI4 I;  4LF4 E;  3OTO E;  4KQV A;  1H74 A;  1FWK A;  2V2Z A;  3Q6N A;  4DR5 I;  4YHH I;  4NXM I;  4DR3 I;  4X62 E;  3J80 Q;  1XNR I;  3H4L A;  1KKH A;  1S4E A;  2ZM6 E;  4DPX A;  1S16 A;  5A2Q C;  4B3T E;  2HKE A;  2BV3 A;  1N36 E;  2GQ0 A;  2O1U A;  4IZK A;  1HNZ E;  1Z0E A;  3LTO A;  4M1K A;  4DR7 I;  4LF9 I;  3P06 A;  1H72 C;  2VQF E;  4X66 I;  3PYD A;  4USM A;  1HR0 I;  2F4V I;  3WU4 A;  4HYM A;  1RR9 A;  2A2D A;  1KIJ A;  1I94 I;  4X66 E;  2F4V E;  4I3H A;  4JI6 E;  2X36 A;  5BR8 I;  1H73 A;  1I94 E;  2AJ4 A;  1ZM9 A;  4LFC I;  4B3R E;  2O1T A;  4X65 I;  3B8H A;  3J7A M;  4LF6 E;  1XNQ E;  4LFC E;  1N32 E;  4X64 I;  2UUB E;  2HK3 A;  2BM1 A;  2UXB I;  4DU7 A;  1N0U A;  5GMD A;  4JI2 E;  4GKK I;  1QZR A;  4DV4 E;  1N0V C;  3ZZ0 A;  4DPW A;  2UXC I;  1H7S A;  1XMO I;  1B63 A;  2UU9 I;  4DUY E;  5LMN E;  3B78 A;  4JI8 I;  4DR2 E;  3QT5 A;  1IBL I;  2HKJ A;  3JAM Q;  1NHI A;  4JI8 E;  4DR1 E;  1ZXM A;  4JI1 E;  2VQE E;  2PNM A;  3WU5 A;  2ZBK B;  1EA6 A;  4IZJ B;  4DV0 E;  4DV6 I;  4DV5 I;  2O1V A;  5GME A;  4LF7 E;  4B3S E;  4FWH A;  1OJ4 A;  4UTG A;  3CWV A;  2UUA E;  4LFA I;  4LFB E;  4JI5 E;  3J81 Q;  5FLX C;  3QT8 A;  1ZXN A;  3PYF A;  1XMQ E;  4JI3 E;  1KTV A;  2NPF A;  4HY1 A;  5A2Q Q;  1FWL A;  4YY3 I;  3T1Y E;  5LMU I;  4IZK B;  2Z5B A;  1U2R A;  4DR6 I;  4K0K I;  4P7A A;  2CZ9 A;  5LL6 R;  1J5E E;  4JI4 E;  2HFU A;  4DUZ I;  3ZM7 A;  2CG9 A;  3WU3 A;  5IWA I;  4DR5 E;  4YHH E;  4NXM E;  4DR3 E;  4DPU A;  1HNX I;  2UXD I;  1XNR E;  4OX9 I;  4JYA I;  1NHH A;  4HXZ A;  4B3M I;  4DR4 I;  4JI7 I;  1ZM2 A;  2O1W A;  4OX9 E;  2J7K A;  2E5L I;  1ZM3 A;  2DEI A;  1MX0 A;  1HK7 A;  1Z0C A;  4DR7 E;  4LF9 E;  1PVG A;  4AQY I;  4IZJ D;  1HR0 E;  4HAC A;  2DEJ A;  2Z5C A;  1IBK I;  2ZIT A;  3K17 A;  3WU6 A;  4FWD A;  5BR8 E;  1IBK E;  4MYT A;  4JI0 I;  4DV3 I;  1N33 I;  2V34 A;  4P52 A;  4N3O A;  4X65 E;  4LF8 I;  4XTJ A;  4Z7Y A;  4X64 E;  3PYE A;  2UXB E;  5IT9 C;  4DU8 A;  4GKK E;  1FNM A;  1H7U A;  4DV7 I;  5FWK A;  2UXC E;  1XMO E;  2UUC I;  3J7A G;  4GKJ I;  5FLX Q;  1IBM I;  1PKP A;  2UU9 E;  2BM0 A;  1A6F A;  1HNW I;  4GKJ E;  1MU5 A;  2HFS A;  3Q6M A;  1IBM E;  2Z5B B;  1IBL E;  1WUU A;  3D4J A;  1FKA E;  1Y4U A;  1N34 I;  4Z7C A;  1PIE A;  1BKN A;  2HHH I;  2OI2 A;  2Z5E A;  4DV6 E;  1Z59 A;  4DV5 E;  4JV5 I;  3ZKB A;  2Q2E B;  3HUL A;  4LFA E;  2CGE A;  4USK A;  3QT7 A;  2VF3 A;  3LNU A;  1FJG I;  4YY3 E;  3ZKD A;  3HJC A;  3T1H I;  5LMU E;  4LF5 I;  4DV1 I;  4FN5 A;  2A2C A;  2IOQ A;  3PYG A;  4DR6 E;  4K0K E;  2GS8 A;  3JAM C;  3GON A;  1DAR A;  4DV2 I;  4URL A;  4DV1 E;  4DXL A;  1VIS A;  4LF4 I;  4DPY A;  4DUZ E;  1ZM4 A;  4KHP I;  2Z5C B;  3OTO I;  1Z0T A;  4DV2 E;  5IWA E;  3K85 A;  3B82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...