4DV2I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2I00
1ZM2A 4ED4A 1Z59A 4YHHI 2HK3A 4B3RI 4JI0I 4X64E 3PYEA 2HHHI 4URLA 2DEIA 1Z0BA 3ZZTA 4JI4E 1NHIA 4USMA 1FKAE 2V2VA 2VF3A 2X7IA 1H72C 5BR8E 2VQFI 2DEJA 1MX0A 1Z0EA 4WUDA 4DV4I 2NPFA 4LFCE 1PKPA 1N32I 4DV3I 4ZVIA 1KIJA 2V2ZA 1A6FA 3M6AA 1MG7A 2ZITA 4LF5I 4B3RE 2UXDI 4GKKI 2HK2A 1Z0VA 4JV5I 4M1KA 1N34E 4MYUA 2UUBE 1H74A 4DPUA 4JI1I 1FJGE 1J5EE 4DR4E 1XHKA 4DV3E 4DV4E 1ZXNA 4B3TE 4JYAI 4JI3I 1KVKA 4JI7I 1HNZE 2UXBE 4NXME 1U2RA 3WU5A 2F4VI 5L3JA 2EFGA 4DR6E 1HNWE 4X66E 2BV3A 1IBLE 1IBMI 5LMUE 3H4LA 2OI2A 1H7SA 4X65I 4JG4A 4X65E 2R3VA 4WUCA 4AQYE 1DARA 4X66I 4DR3E 2UUCE 1S16A 1S4EA 2E5LE 4LF4E 4R1FA 4WUBA 1I94E 1Z0WA 4DXLA 2UU9I 4K0KI 3J7AG 2GS8A 3WU3A 2UXDE 2ZBKB 1B63A 3OTOI 4OX9E 4DU8A 4OX9I 1H73A 1ZM4A 5FLXQ 1Z0CA 1N33I 2BM0A 4YY3I 4K0KE 5FLXC 1FNMA 3JAMQ 1N34I 4X62E 2X36A 1HNXE 4DV7E 4PU9A 3LPSA 1RREA 5IWAE 5GMEA 4HACB 3K17A 2A2CA 4Z7YA 4DV6I 4HACA 4DV1I 1XMOI 4JI8E 3B78A 4JI6I 3J80Q 3HULA 1XMQE 2HHHE 3T1YI 3Q1QA 1N0VC 4NXNI 4JI5I 1NHJA 1VISA 2AJ4A 4HYMA 3PYFA 4DV0I 3ZZUA 4KHPI 4DV0E 3LTOA 4FWHA 4JYAE 4LF9I 4B3TI 4DR1I 4DR7I 4FN5A 3T1YE 4NXMI 3OTOE 3QT5A 4GKJE 4DUZE 2UXCE 3JAMC 1I94I 1XNQI 1PIEA 1ZM9A 4P52A 4DR5E 4DPWA 4DPXA 4DR3I 2V34A 4FWGA 2HFUA 4UT4A 4AQYI 4LFAI 3J80C 3ZM7A 3PYDA 3QT8A 4LF7E 2ZM6I 4DV5E 4DR5I 4EMDA 4RPFA 1B62A 4LFBI 2HFSA 4LFCI 5IT9C 4DPTA 5A2QQ 1K47A 1N32E 1Z0GA 4LF9E 2VQEI 2UUAE 2HKEA 3J81Q 3ZKBA 3ZKDA 4JI2E 4Z7CA 3J7AM 4UTGA 3QT6A 1FWLA 1EA6A 4JI5E 4JI4I 5LL6R 4LF7I 1J5EI 4DV6E 1Z5AA 4JI2I 4FWDA 4JI0E 4JI8I 3WU4A 2R42A 1OJ4A 4DPYA 1ZXMA 4YHHE 2F4VE 3B82A 4XTJA 4DV2E 1ZM3A 4JV5E 4USKA 4B3ME 3PYGA 1N36E 1UEKA 5IT9Q 3GONA 4GKKE 4KQVA 3T1HI 1NHHA 3B8HA 4JI3E 1N0UA 4DU7A 1PVGA 4HXZA 3V2UC 2HKJA 1EI1A 1Z0TA 3LNUA 1Z5BA 1IBKI 4FW9A 1KKHA 1ELOA 4DR1E 2CZ9A 3CWVA 2E1RA 1N36I 1HR0I 3T1HE 4DV7I 1H7UA 4PRXA 2LJPA 2E5LI 2BM1A 4DV2I 4LF6E 2V8PA 4PRVA 1KTVA 1XNRE 4X64I 4GKJI 3WU6A 1IBKE 4DUYE 1NZ0A 4X62I 1IBLI 1FWKA 2VQFE 5BR8I 3QT7A 4NXNE 4B3MI 1WUUA 1Z5CA 1RR9A 2VQEE 2UUAI 1XMQI 4DUYI 2UXBI 1BKNA 1XMOE 4DV1E 3F0NA 4JI6E 1XNRI 4LFBE 1HNZI 1D6TA 4LF8I 1QZRA 1HNXI 3V5RA 5A2QC 2J7KA 5IWAI 3ZZ0A 4B3SE 3D4JA 5GMDA 3J81C 2V2QA 2ZM6E 5LMNI 2UUCI 4DR4I 1N33E 4DR2I 5LMNE 4DR6I 4YY3E 4LF6I 2A2DA 2XEXA 4I3HA 4B3SI 4JI7E 2Q2EB 4P7AA 1HR0E 4DUZI 1FI4A 2UXCI 5LMUI 1IBME 1XNQE 4LF8E 4LF4I 4LF5E 3K1JA 2UU9E 1HNWI 4DV5I 4MYTA 4DR7E 4JI1E 1FJGI 4HY1A 4DR2E 2WW4A 4LFAE 1MU5A 2UUBI 4KHPE
chains in the Genus database with same CATH superfamily
1ZM2A 5DNXA 4ED4A 1Z59A 4YHHI 2HK3A 5EKWA 2WNRB 3U1KA 4B3RI 4JI0I 4X64E 3PYEA 2HHHI 4URLA 2DEIA 1Z0BA 2IOQA 2IOPA 3ZZTA 4JI4E 1NHIA 4IFDE 4USMA 4IFDD 2Z5BA 4IFDB 1FKAE 2V2VA 2VF3A 2X7IA 4LPFA 1H72C 5C0XC 3H1CA 5BR8E 2VQFI 2DEJA 1MX0A 1Z0EA 4WUDA 4FW4A 4DV4I 2NPFA 4LFCE 3M7NG 1PKPA 1N32I 4DV3I 4OO1B 4ZVIA 4OKGA 3PS1A 2NN6B 1KIJA 2V2ZA 4U3BA 5JEAA 1A6FA 2C38B 3M6AA 4BA1A 2Z5CB 1UDQA 4IZJB 2JEBA 1MG7A 2ZITA 2O3ZA 4LF5I 5EL9A 4B3RE 3P3EA 2UXDI 4GKKI 2HK2A 1Z0VA 3DD6A 4JV5I 4M1KA 1N34E 4MYUA 2UUBE 1H74A 4DPUA 2AE8A 1Y4UA 4JI1I 1FJGE 1OYPA 1YH8A 1J5EE 4DR4E 3GMEA 1XHKA 2Z5EA 2PO0A 4DV3E 4DV4E 2Z5CA 1ZXNA 4B3TE 4JYAI 4JI3I 1KVKA 4OZEA 4JI7I 1HNZE 2UXBE 4IZJD 3M85D 4NXME 1U2RA 1USVA 3WU5A 1UDNA 4J3DA 1XXEA 2F4VI 1E3PA 3Q6NA 5L3JA 2EFGA 4DR6E 4QNJA 1HNWE 4X66E 2BV3A 1VI7A 1IBLE 1Y60A 2PNZA 5LMUE 1IBMI 3H4LA 2OI2A 1H7SA 4X65I 4LCFA 4LCHA 4JG4A 4X65E 2R3VA 4WUCA 4AQYE 4AM3A 1DARA 5K36B 4X66I 2NN6D 5DROA 4DR3E 5JEAE 2UUCE 1RHYA 1S16A 1S4EA 2JEAA 2C38A 2E5LE 4LF4E 4R1FA 2IESA 4WUBA 1I94E 1Z0WA 4DXLA 2UU9I 4K0KI 3J7AG 2GS8A 3WU3A 2UXDE 4BA2B 4IS9A 4NBQA 5C0XE 2ZBKB 1B63A 3OTOI 4OX9E 4ISAA 4DU8A 3L7ZA 4OX9I 1H73A 1ZM4A 5C0XA 5FLXQ 1Z0CA 1N33I 2BM0A 2CVEA 1E3HA 4YY3I 4K0KE 1OYRA 5FLXC 1FNMA 3HJCA 3JAMQ 1N34I 3PRYA 4X62E 1UDOA 2X36A 1HNXE 4DV7E 4PU9A 3LPSA 1RREA 5IWAE 5GMEA 4HACB 3K17A 2A2CA 4Z7YA 4DV6I 4HACA 4DV1I 1XMOI 4JI8E 3B78A 5JEAF 4JI6I 3J80Q 2BA1D 3HULA 1XMQE 2HHHE 5FWKA 2BA1G 3T1YI 3Q1QA 1N0VC 1R6MA 4NXNI 4JI5I 1NHJA 1VISA 2AJ4A 4HYMA 2CGEA 3PYFA 4DV0I 3ZZUA 2IERA 4KHPI 4DV0E 3LTOA 4FWHA 4JYAE 3K85A 4LF9I 4B3TI 4DR1I 2JEAB 4DR7I 4FN5A 3T1YE 4NXMI 3GLLA 3P3CA 2O1UA 3OTOE 3QT5A 4GKJE 4OO1F 4DUZE 3B4TA 3JAMC 2UXCE 5JEAB 1I94I 1XNQI 5JEAC 1PIEA 2JT2A 4IFDC 3P76A 1ZM9A 4P52A 2JE6A 4DR5E 5K36C 5K36E 4DPWA 4MQYA 4DPXA 4DR3I 2C37A 4MU3A 2V34A 4FWGA 2HFUA 3PS3A 4UT4A 4AQYI 4LFAI 3J80C 3ZM7A 2CG9A 3PYDA 3QT8A 4LF7E 2ZM6I 4DV5E 4OO1C 5C0XF 2WNRA 4EMDA 4DR5I 2PNMA 4RPFA 1B62A 3PS2A 4LFBI 2HFSA 4LFCI 1R6LA 2BR2A 5IT9C 4DPTA 5A2QQ 1K47A 5DNLA 1N32E 1Z0GA 3U1YA 4LF9E 1P42A 2VQEI 2UUAE 2HKEA 3J81Q 4N3OA 3ZKBA 2O1VA 4IZKA 3ZKDA 4JI2E 2BA0G 4U3DA 1Y4SA 4Z7CA 4FW7A 3J7AM 2BA0D 4UTGA 4IFDF 3QT6A 1FWLA 1EA6A 4JI5E 4FW6A 2JEBB 4JI4I 5LL6R 4LF7I 1J5EI 4AIDA 3CDJA 2NN6A 4DV6E 1Z5AA 4JI2I 4FWDA 4JI0E 4JI8I 3WU4A 2R42A 1OJ4A 4DPYA 1ZXMA 2O1TA 2PO1B 4YHHE 2F4VE 3B82A 4XTJA 4DV2E 1ZM3A 2JE6B 2NN6E 4USKA 5DRQA 4JV5E 4OO1E 4MU1A 4OO1D 4B3ME 3PYGA 1N36E 1UEKA 5IT9Q 3GONA 4GKKE 4KQVA 3P3GA 3T1HI 2VESA 1NHHA 3B8HA 4JI3E 1N0UA 2PO2B 3HKMA 5ELWA 4FW5A 4DU7A 1PVGA 4HXZA 3V2UC 1USUA 2HKJA 1EI1A 1Z0TA 3LNUA 1Z5BA 1IBKI 4FW9A 1KKHA 5C0XD 3L7ZB 1ELOA 4DR1E 5K36D 2CZ9A 2O1WA 3CWVA 3GCMA 2E1RA 1N36I 1HR0I 5JEAD 2WP8A 1YHCA 3T1HE 4DV7I 1H7UA 4AIMA 1HK7A 4PRXA 2LJPA 4FW3A 2E5LI 2BM1A 4DV2I 2NN6F 4LF6E 1OYSA 2V8PA 4PRVA 2C37B 2C39B 1KTVA 4QNKA 1XNRE 4X64I 4GKJI 2C39A 5DRPA 4IFDA 3UHMA 3WU6A 1IBKE 4GQUA 4DUYE 1NZ0A 4X62I 1IBLI 2GO4A 1FWKA 2VQFE 5BR8I 4LOMA 4MU0A 3QT7A 4NXNE 4B3MI 1WUUA 1Z5CA 1RR9A 4BA1B 3M7ND 2VQEE 2UUAI 1XMQI 4DUYI 3P06A 2UXBI 1BKNA 1XMOE 4DV1E 2PNZB 2BR2B 1Y5YA 3F0NA 4JI6E 1XNRI 4LFBE 2PO2A 3NZKA 1HNZI 4LF8I 1D6TA 1QZRA 1HNXI 3V5RA 5A2QC 2J7KA 5IWAI 3ZZ0A 4B3SE 3D4JA 5GMDA 2PO0B 3J81C 3Q6MA 5DRRA 2V2QA 2ZM6E 5LMNI 2UUCI 2F1DA 4DR4I 1N33E 4DR2I 5LMNE 4DR6I 4YY3E 5C0XB 3CDIA 4MDTA 4LF6I 2A2DA 2XEXA 1Y6ZA 5K36F 4I3HA 2PO1A 4B3SI 3KRNA 4OO1A 4JI7E 2Q2EB 4P7AA 2WP8B 4BA2A 1HR0E 4MU4A 4DUZI 1FI4A 2UXCI 2Z5BB 5LMUI 1IBME 4LCGA 1XNQE 4LF8E 4IZJA 2NN6C 4LF4I 4LF5E 3K1JA 1UDSA 2UU9E 4IZKB 2J65A 2GO3A 1HNWI 4DV5I 3M85G 4MYTA 4DR7E 4JI1E 1FJGI 4HY1A 4DR2E 2PNLA 2WW4A 4LFAE 5K36A 1MU5A 2GQ0A 2UUBI 4KHPE
chains in the Genus database with same CATH topology
1ZM2A 4ED4A 1Z59A 4YHHI 2HK3A 4B3RI 4JI0I 4X64E 3PYEA 2HHHI 4URLA 2DEIA 1Z0BA 2IOQA 2IOPA 3ZZTA 4JI4E 1NHIA 4USMA 2Z5BA 1FKAE 2V2VA 2VF3A 2X7IA 1H72C 5BR8E 2VQFI 2DEJA 1MX0A 1Z0EA 4WUDA 4DV4I 2NPFA 4LFCE 1PKPA 1N32I 4DV3I 4ZVIA 1KIJA 2V2ZA 1A6FA 3M6AA 2Z5CB 4IZJB 1MG7A 2ZITA 4LF5I 4B3RE 2UXDI 4GKKI 2HK2A 1Z0VA 4JV5I 4M1KA 1N34E 4MYUA 2UUBE 1H74A 4DPUA 1Y4UA 4JI1I 1FJGE 1J5EE 4DR4E 1XHKA 2Z5EA 4DV3E 4DV4E 2Z5CA 1ZXNA 4B3TE 4JYAI 4JI3I 1KVKA 4JI7I 1HNZE 2UXBE 4IZJD 4NXME 1U2RA 1USVA 3WU5A 2F4VI 3Q6NA 5L3JA 2EFGA 4DR6E 1HNWE 4X66E 2BV3A 1IBLE 1IBMI 5LMUE 3H4LA 2OI2A 1H7SA 4X65I 4JG4A 4X65E 2R3VA 4WUCA 4AQYE 1DARA 4X66I 4DR3E 2UUCE 1S16A 1S4EA 2E5LE 4LF4E 4R1FA 4WUBA 1I94E 1Z0WA 4DXLA 2UU9I 4K0KI 3J7AG 2GS8A 3WU3A 2UXDE 2ZBKB 1B63A 3OTOI 4OX9E 4DU8A 4OX9I 1H73A 1ZM4A 5FLXQ 1Z0CA 1N33I 2BM0A 4YY3I 4K0KE 5FLXC 1FNMA 3HJCA 3JAMQ 1N34I 3PRYA 4X62E 2X36A 1HNXE 4DV7E 4PU9A 3LPSA 1RREA 5IWAE 5GMEA 4HACB 3K17A 2A2CA 4Z7YA 4DV6I 4HACA 4DV1I 1XMOI 4JI8E 3B78A 4JI6I 3J80Q 3HULA 1XMQE 2HHHE 5FWKA 3T1YI 3Q1QA 1N0VC 4NXNI 4JI5I 1NHJA 1VISA 2AJ4A 4HYMA 2CGEA 3PYFA 4DV0I 3ZZUA 4KHPI 4DV0E 3LTOA 4FWHA 4JYAE 3K85A 4LF9I 4B3TI 4DR1I 4DR7I 4FN5A 3T1YE 4NXMI 3OTOE 2O1UA 3QT5A 4GKJE 4DUZE 2UXCE 3JAMC 1I94I 1XNQI 1PIEA 1ZM9A 4P52A 4DR5E 4DPWA 4DPXA 4DR3I 2V34A 4FWGA 2HFUA 4UT4A 4AQYI 4LFAI 3J80C 3ZM7A 2CG9A 3PYDA 3QT8A 4LF7E 2ZM6I 4DV5E 4DR5I 4EMDA 2PNMA 4RPFA 1B62A 4LFBI 2HFSA 4LFCI 5IT9C 4DPTA 5A2QQ 1K47A 1N32E 1Z0GA 4LF9E 2VQEI 2UUAE 2HKEA 3J81Q 4N3OA 2O1VA 4IZKA 3ZKBA 3ZKDA 4JI2E 1Y4SA 4Z7CA 3J7AM 4UTGA 3QT6A 1FWLA 1EA6A 4JI5E 4JI4I 5LL6R 4LF7I 1J5EI 4DV6E 1Z5AA 4JI2I 4FWDA 4JI0E 4JI8I 3WU4A 2R42A 1OJ4A 4DPYA 1ZXMA 2O1TA 4YHHE 2F4VE 3B82A 4XTJA 4DV2E 1ZM3A 4JV5E 4USKA 4B3ME 3PYGA 1N36E 1UEKA 5IT9Q 3GONA 4GKKE 4KQVA 3T1HI 1NHHA 3B8HA 4JI3E 1N0UA 4DU7A 1PVGA 4HXZA 3V2UC 1USUA 2HKJA 1EI1A 1Z0TA 3LNUA 1Z5BA 1IBKI 4FW9A 1KKHA 1ELOA 4DR1E 2CZ9A 2O1WA 3CWVA 2E1RA 1N36I 1HR0I 3T1HE 4DV7I 1H7UA 1HK7A 4PRXA 2LJPA 2E5LI 2BM1A 4DV2I 4LF6E 2V8PA 4PRVA 1KTVA 1XNRE 4X64I 4GKJI 3WU6A 1IBKE 4DUYE 1NZ0A 4X62I 1IBLI 1FWKA 2VQFE 5BR8I 3QT7A 4NXNE 4B3MI 1WUUA 1Z5CA 1RR9A 2VQEE 2UUAI 1XMQI 4DUYI 3P06A 2UXBI 1BKNA 1XMOE 4DV1E 3F0NA 4JI6E 1XNRI 4LFBE 1HNZI 1D6TA 4LF8I 1QZRA 1HNXI 3V5RA 5A2QC 2J7KA 5IWAI 3ZZ0A 4B3SE 3D4JA 5GMDA 3J81C 3Q6MA 2V2QA 2ZM6E 5LMNI 2UUCI 4DR4I 1N33E 4DR2I 5LMNE 4DR6I 4YY3E 4LF6I 2A2DA 2XEXA 1Y6ZA 4I3HA 4B3SI 4JI7E 2Q2EB 4P7AA 1HR0E 4DUZI 1FI4A 2UXCI 2Z5BB 5LMUI 1IBME 1XNQE 4LF8E 4IZJA 4LF4I 4LF5E 3K1JA 2UU9E 4IZKB 1HNWI 4DV5I 4MYTA 4DR7E 4JI1E 1FJGI 4HY1A 4DR2E 2PNLA 2WW4A 4LFAE 1MU5A 2GQ0A 2UUBI 4KHPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM2 A;  4ED4 A;  1Z59 A;  4YHH I;  2HK3 A;  4B3R I;  4JI0 I;  4X64 E;  3PYE A;  2HHH I;  4URL A;  2DEI A;  1Z0B A;  3ZZT A;  4JI4 E;  1NHI A;  4USM A;  1FKA E;  2V2V A;  2VF3 A;  2X7I A;  1H72 C;  5BR8 E;  2VQF I;  2DEJ A;  1MX0 A;  1Z0E A;  4WUD A;  4DV4 I;  2NPF A;  4LFC E;  1PKP A;  1N32 I;  4DV3 I;  4ZVI A;  1KIJ A;  2V2Z A;  1A6F A;  3M6A A;  1MG7 A;  2ZIT A;  4LF5 I;  4B3R E;  2UXD I;  4GKK I;  2HK2 A;  1Z0V A;  4JV5 I;  4M1K A;  1N34 E;  4MYU A;  2UUB E;  1H74 A;  4DPU A;  4JI1 I;  1FJG E;  1J5E E;  4DR4 E;  1XHK A;  4DV3 E;  4DV4 E;  1ZXN A;  4B3T E;  4JYA I;  4JI3 I;  1KVK A;  4JI7 I;  1HNZ E;  2UXB E;  4NXM E;  1U2R A;  3WU5 A;  2F4V I;  5L3J A;  2EFG A;  4DR6 E;  1HNW E;  4X66 E;  2BV3 A;  1IBL E;  1IBM I;  5LMU E;  3H4L A;  2OI2 A;  1H7S A;  4X65 I;  4JG4 A;  4X65 E;  2R3V A;  4WUC A;  4AQY E;  1DAR A;  4X66 I;  4DR3 E;  2UUC E;  1S16 A;  1S4E A;  2E5L E;  4LF4 E;  4R1F A;  4WUB A;  1I94 E;  1Z0W A;  4DXL A;  2UU9 I;  4K0K I;  3J7A G;  2GS8 A;  3WU3 A;  2UXD E;  2ZBK B;  1B63 A;  3OTO I;  4OX9 E;  4DU8 A;  4OX9 I;  1H73 A;  1ZM4 A;  5FLX Q;  1Z0C A;  1N33 I;  2BM0 A;  4YY3 I;  4K0K E;  5FLX C;  1FNM A;  3JAM Q;  1N34 I;  4X62 E;  2X36 A;  1HNX E;  4DV7 E;  4PU9 A;  3LPS A;  1RRE A;  5IWA E;  5GME A;  4HAC B;  3K17 A;  2A2C A;  4Z7Y A;  4DV6 I;  4HAC A;  4DV1 I;  1XMO I;  4JI8 E;  3B78 A;  4JI6 I;  3J80 Q;  3HUL A;  1XMQ E;  2HHH E;  3T1Y I;  3Q1Q A;  1N0V C;  4NXN I;  4JI5 I;  1NHJ A;  1VIS A;  2AJ4 A;  4HYM A;  3PYF A;  4DV0 I;  3ZZU A;  4KHP I;  4DV0 E;  3LTO A;  4FWH A;  4JYA E;  4LF9 I;  4B3T I;  4DR1 I;  4DR7 I;  4FN5 A;  3T1Y E;  4NXM I;  3OTO E;  3QT5 A;  4GKJ E;  4DUZ E;  2UXC E;  3JAM C;  1I94 I;  1XNQ I;  1PIE A;  1ZM9 A;  4P52 A;  4DR5 E;  4DPW A;  4DPX A;  4DR3 I;  2V34 A;  4FWG A;  2HFU A;  4UT4 A;  4AQY I;  4LFA I;  3J80 C;  3ZM7 A;  3PYD A;  3QT8 A;  4LF7 E;  2ZM6 I;  4DV5 E;  4DR5 I;  4EMD A;  4RPF A;  1B62 A;  4LFB I;  2HFS A;  4LFC I;  5IT9 C;  4DPT A;  5A2Q Q;  1K47 A;  1N32 E;  1Z0G A;  4LF9 E;  2VQE I;  2UUA E;  2HKE A;  3J81 Q;  3ZKB A;  3ZKD A;  4JI2 E;  4Z7C A;  3J7A M;  4UTG A;  3QT6 A;  1FWL A;  1EA6 A;  4JI5 E;  4JI4 I;  5LL6 R;  4LF7 I;  1J5E I;  4DV6 E;  1Z5A A;  4JI2 I;  4FWD A;  4JI0 E;  4JI8 I;  3WU4 A;  2R42 A;  1OJ4 A;  4DPY A;  1ZXM A;  4YHH E;  2F4V E;  3B82 A;  4XTJ A;  4DV2 E;  1ZM3 A;  4JV5 E;  4USK A;  4B3M E;  3PYG A;  1N36 E;  1UEK A;  5IT9 Q;  3GON A;  4GKK E;  4KQV A;  3T1H I;  1NHH A;  3B8H A;  4JI3 E;  1N0U A;  4DU7 A;  1PVG A;  4HXZ A;  3V2U C;  2HKJ A;  1EI1 A;  1Z0T A;  3LNU A;  1Z5B A;  1IBK I;  4FW9 A;  1KKH A;  1ELO A;  4DR1 E;  2CZ9 A;  3CWV A;  2E1R A;  1N36 I;  1HR0 I;  3T1H E;  4DV7 I;  1H7U A;  4PRX A;  2LJP A;  2E5L I;  2BM1 A;  4DV2 I;  4LF6 E;  2V8P A;  4PRV A;  1KTV A;  1XNR E;  4X64 I;  4GKJ I;  3WU6 A;  1IBK E;  4DUY E;  1NZ0 A;  4X62 I;  1IBL I;  1FWK A;  2VQF E;  5BR8 I;  3QT7 A;  4NXN E;  4B3M I;  1WUU A;  1Z5C A;  1RR9 A;  2VQE E;  2UUA I;  1XMQ I;  4DUY I;  2UXB I;  1BKN A;  1XMO E;  4DV1 E;  3F0N A;  4JI6 E;  1XNR I;  4LFB E;  1HNZ I;  1D6T A;  4LF8 I;  1QZR A;  1HNX I;  3V5R A;  5A2Q C;  2J7K A;  5IWA I;  3ZZ0 A;  4B3S E;  3D4J A;  5GMD A;  3J81 C;  2V2Q A;  2ZM6 E;  5LMN I;  2UUC I;  4DR4 I;  1N33 E;  4DR2 I;  5LMN E;  4DR6 I;  4YY3 E;  4LF6 I;  2A2D A;  2XEX A;  4I3H A;  4B3S I;  4JI7 E;  2Q2E B;  4P7A A;  1HR0 E;  4DUZ I;  1FI4 A;  2UXC I;  5LMU I;  1IBM E;  1XNQ E;  4LF8 E;  4LF4 I;  4LF5 E;  3K1J A;  2UU9 E;  1HNW I;  4DV5 I;  4MYT A;  4DR7 E;  4JI1 E;  1FJG I;  4HY1 A;  4DR2 E;  2WW4 A;  4LFA E;  1MU5 A;  2UUB I;  4KHP E; 
#chains in the Genus database with same CATH topology
 1ZM2 A;  5DNX A;  4ED4 A;  1Z59 A;  4YHH I;  2HK3 A;  5EKW A;  2WNR B;  3U1K A;  4B3R I;  4JI0 I;  4X64 E;  3PYE A;  2HHH I;  4URL A;  2DEI A;  1Z0B A;  2IOQ A;  2IOP A;  3ZZT A;  4JI4 E;  1NHI A;  4IFD E;  4USM A;  4IFD D;  2Z5B A;  4IFD B;  1FKA E;  2V2V A;  2VF3 A;  2X7I A;  4LPF A;  1H72 C;  5C0X C;  3H1C A;  5BR8 E;  2VQF I;  2DEJ A;  1MX0 A;  1Z0E A;  4WUD A;  4FW4 A;  4DV4 I;  2NPF A;  4LFC E;  3M7N G;  1PKP A;  1N32 I;  4DV3 I;  4OO1 B;  4ZVI A;  4OKG A;  3PS1 A;  2NN6 B;  1KIJ A;  2V2Z A;  4U3B A;  5JEA A;  1A6F A;  2C38 B;  3M6A A;  4BA1 A;  2Z5C B;  1UDQ A;  4IZJ B;  2JEB A;  1MG7 A;  2ZIT A;  2O3Z A;  4LF5 I;  5EL9 A;  4B3R E;  3P3E A;  2UXD I;  4GKK I;  2HK2 A;  1Z0V A;  3DD6 A;  4JV5 I;  4M1K A;  1N34 E;  4MYU A;  2UUB E;  1H74 A;  4DPU A;  2AE8 A;  1Y4U A;  4JI1 I;  1FJG E;  1OYP A;  1YH8 A;  1J5E E;  4DR4 E;  3GME A;  1XHK A;  2Z5E A;  2PO0 A;  4DV3 E;  4DV4 E;  2Z5C A;  1ZXN A;  4B3T E;  4JYA I;  4JI3 I;  1KVK A;  4OZE A;  4JI7 I;  1HNZ E;  2UXB E;  4IZJ D;  3M85 D;  4NXM E;  1U2R A;  1USV A;  3WU5 A;  1UDN A;  4J3D A;  1XXE A;  2F4V I;  1E3P A;  3Q6N A;  5L3J A;  2EFG A;  4DR6 E;  4QNJ A;  1HNW E;  4X66 E;  2BV3 A;  1VI7 A;  1IBL E;  1Y60 A;  2PNZ A;  5LMU E;  1IBM I;  3H4L A;  2OI2 A;  1H7S A;  4X65 I;  4LCF A;  4LCH A;  4JG4 A;  4X65 E;  2R3V A;  4WUC A;  4AQY E;  4AM3 A;  1DAR A;  5K36 B;  4X66 I;  2NN6 D;  5DRO A;  4DR3 E;  5JEA E;  2UUC E;  1RHY A;  1S16 A;  1S4E A;  2JEA A;  2C38 A;  2E5L E;  4LF4 E;  4R1F A;  2IES A;  4WUB A;  1I94 E;  1Z0W A;  4DXL A;  2UU9 I;  4K0K I;  3J7A G;  2GS8 A;  3WU3 A;  2UXD E;  4BA2 B;  4IS9 A;  4NBQ A;  5C0X E;  2ZBK B;  1B63 A;  3OTO I;  4OX9 E;  4ISA A;  4DU8 A;  3L7Z A;  4OX9 I;  1H73 A;  1ZM4 A;  5C0X A;  5FLX Q;  1Z0C A;  1N33 I;  2BM0 A;  2CVE A;  1E3H A;  4YY3 I;  4K0K E;  1OYR A;  5FLX C;  1FNM A;  3HJC A;  3JAM Q;  1N34 I;  3PRY A;  4X62 E;  1UDO A;  2X36 A;  1HNX E;  4DV7 E;  4PU9 A;  3LPS A;  1RRE A;  5IWA E;  5GME A;  4HAC B;  3K17 A;  2A2C A;  4Z7Y A;  4DV6 I;  4HAC A;  4DV1 I;  1XMO I;  4JI8 E;  3B78 A;  5JEA F;  4JI6 I;  3J80 Q;  2BA1 D;  3HUL A;  1XMQ E;  2HHH E;  5FWK A;  2BA1 G;  3T1Y I;  3Q1Q A;  1N0V C;  1R6M A;  4NXN I;  4JI5 I;  1NHJ A;  1VIS A;  2AJ4 A;  4HYM A;  2CGE A;  3PYF A;  4DV0 I;  3ZZU A;  2IER A;  4KHP I;  4DV0 E;  3LTO A;  4FWH A;  4JYA E;  3K85 A;  4LF9 I;  4B3T I;  4DR1 I;  2JEA B;  4DR7 I;  4FN5 A;  3T1Y E;  4NXM I;  3GLL A;  3P3C A;  2O1U A;  3OTO E;  3QT5 A;  4GKJ E;  4OO1 F;  4DUZ E;  3B4T A;  3JAM C;  2UXC E;  5JEA B;  1I94 I;  1XNQ I;  5JEA C;  1PIE A;  2JT2 A;  4IFD C;  3P76 A;  1ZM9 A;  4P52 A;  2JE6 A;  4DR5 E;  5K36 C;  5K36 E;  4DPW A;  4MQY A;  4DPX A;  4DR3 I;  2C37 A;  4MU3 A;  2V34 A;  4FWG A;  2HFU A;  3PS3 A;  4UT4 A;  4AQY I;  4LFA I;  3J80 C;  3ZM7 A;  2CG9 A;  3PYD A;  3QT8 A;  4LF7 E;  2ZM6 I;  4DV5 E;  4OO1 C;  5C0X F;  2WNR A;  4EMD A;  4DR5 I;  2PNM A;  4RPF A;  1B62 A;  3PS2 A;  4LFB I;  2HFS A;  4LFC I;  1R6L A;  2BR2 A;  5IT9 C;  4DPT A;  5A2Q Q;  1K47 A;  5DNL A;  1N32 E;  1Z0G A;  3U1Y A;  4LF9 E;  1P42 A;  2VQE I;  2UUA E;  2HKE A;  3J81 Q;  4N3O A;  3ZKB A;  2O1V A;  4IZK A;  3ZKD A;  4JI2 E;  2BA0 G;  4U3D A;  1Y4S A;  4Z7C A;  4FW7 A;  3J7A M;  2BA0 D;  4UTG A;  4IFD F;  3QT6 A;  1FWL A;  1EA6 A;  4JI5 E;  4FW6 A;  2JEB B;  4JI4 I;  5LL6 R;  4LF7 I;  1J5E I;  4AID A;  3CDJ A;  2NN6 A;  4DV6 E;  1Z5A A;  4JI2 I;  4FWD A;  4JI0 E;  4JI8 I;  3WU4 A;  2R42 A;  1OJ4 A;  4DPY A;  1ZXM A;  2O1T A;  2PO1 B;  4YHH E;  2F4V E;  3B82 A;  4XTJ A;  4DV2 E;  1ZM3 A;  2JE6 B;  2NN6 E;  4USK A;  5DRQ A;  4JV5 E;  4OO1 E;  4MU1 A;  4OO1 D;  4B3M E;  3PYG A;  1N36 E;  1UEK A;  5IT9 Q;  3GON A;  4GKK E;  4KQV A;  3P3G A;  3T1H I;  2VES A;  1NHH A;  3B8H A;  4JI3 E;  1N0U A;  2PO2 B;  3HKM A;  5ELW A;  4FW5 A;  4DU7 A;  1PVG A;  4HXZ A;  3V2U C;  1USU A;  2HKJ A;  1EI1 A;  1Z0T A;  3LNU A;  1Z5B A;  1IBK I;  4FW9 A;  1KKH A;  5C0X D;  3L7Z B;  1ELO A;  4DR1 E;  5K36 D;  2CZ9 A;  2O1W A;  3CWV A;  3GCM A;  2E1R A;  1N36 I;  1HR0 I;  5JEA D;  2WP8 A;  1YHC A;  3T1H E;  4DV7 I;  1H7U A;  4AIM A;  1HK7 A;  4PRX A;  2LJP A;  4FW3 A;  2E5L I;  2BM1 A;  4DV2 I;  2NN6 F;  4LF6 E;  1OYS A;  2V8P A;  4PRV A;  2C37 B;  2C39 B;  1KTV A;  4QNK A;  1XNR E;  4X64 I;  4GKJ I;  2C39 A;  5DRP A;  4IFD A;  3UHM A;  3WU6 A;  1IBK E;  4GQU A;  4DUY E;  1NZ0 A;  4X62 I;  1IBL I;  2GO4 A;  1FWK A;  2VQF E;  5BR8 I;  4LOM A;  4MU0 A;  3QT7 A;  4NXN E;  4B3M I;  1WUU A;  1Z5C A;  1RR9 A;  4BA1 B;  3M7N D;  2VQE E;  2UUA I;  1XMQ I;  4DUY I;  3P06 A;  2UXB I;  1BKN A;  1XMO E;  4DV1 E;  2PNZ B;  2BR2 B;  1Y5Y A;  3F0N A;  4JI6 E;  1XNR I;  4LFB E;  2PO2 A;  3NZK A;  1HNZ I;  4LF8 I;  1D6T A;  1QZR A;  1HNX I;  3V5R A;  5A2Q C;  2J7K A;  5IWA I;  3ZZ0 A;  4B3S E;  3D4J A;  5GMD A;  2PO0 B;  3J81 C;  3Q6M A;  5DRR A;  2V2Q A;  2ZM6 E;  5LMN I;  2UUC I;  2F1D A;  4DR4 I;  1N33 E;  4DR2 I;  5LMN E;  4DR6 I;  4YY3 E;  5C0X B;  3CDI A;  4MDT A;  4LF6 I;  2A2D A;  2XEX A;  1Y6Z A;  5K36 F;  4I3H A;  2PO1 A;  4B3S I;  3KRN A;  4OO1 A;  4JI7 E;  2Q2E B;  4P7A A;  2WP8 B;  4BA2 A;  1HR0 E;  4MU4 A;  4DUZ I;  1FI4 A;  2UXC I;  2Z5B B;  5LMU I;  1IBM E;  4LCG A;  1XNQ E;  4LF8 E;  4IZJ A;  2NN6 C;  4LF4 I;  4LF5 E;  3K1J A;  1UDS A;  2UU9 E;  4IZK B;  2J65 A;  2GO3 A;  1HNW I;  4DV5 I;  3M85 G;  4MYT A;  4DR7 E;  4JI1 E;  1FJG I;  4HY1 A;  4DR2 E;  2PNL A;  2WW4 A;  4LFA E;  5K36 A;  1MU5 A;  2GQ0 A;  2UUB I;  4KHP E; 
#chains in the Genus database with same CATH homology
 1ZM2 A;  4ED4 A;  1Z59 A;  4YHH I;  2HK3 A;  4B3R I;  4JI0 I;  4X64 E;  3PYE A;  2HHH I;  4URL A;  2DEI A;  1Z0B A;  2IOQ A;  2IOP A;  3ZZT A;  4JI4 E;  1NHI A;  4USM A;  2Z5B A;  1FKA E;  2V2V A;  2VF3 A;  2X7I A;  1H72 C;  5BR8 E;  2VQF I;  2DEJ A;  1MX0 A;  1Z0E A;  4WUD A;  4DV4 I;  2NPF A;  4LFC E;  1PKP A;  1N32 I;  4DV3 I;  4ZVI A;  1KIJ A;  2V2Z A;  1A6F A;  3M6A A;  2Z5C B;  4IZJ B;  1MG7 A;  2ZIT A;  4LF5 I;  4B3R E;  2UXD I;  4GKK I;  2HK2 A;  1Z0V A;  4JV5 I;  4M1K A;  1N34 E;  4MYU A;  2UUB E;  1H74 A;  4DPU A;  1Y4U A;  4JI1 I;  1FJG E;  1J5E E;  4DR4 E;  1XHK A;  2Z5E A;  4DV3 E;  4DV4 E;  2Z5C A;  1ZXN A;  4B3T E;  4JYA I;  4JI3 I;  1KVK A;  4JI7 I;  1HNZ E;  2UXB E;  4IZJ D;  4NXM E;  1U2R A;  1USV A;  3WU5 A;  2F4V I;  3Q6N A;  5L3J A;  2EFG A;  4DR6 E;  1HNW E;  4X66 E;  2BV3 A;  1IBL E;  1IBM I;  5LMU E;  3H4L A;  2OI2 A;  1H7S A;  4X65 I;  4JG4 A;  4X65 E;  2R3V A;  4WUC A;  4AQY E;  1DAR A;  4X66 I;  4DR3 E;  2UUC E;  1S16 A;  1S4E A;  2E5L E;  4LF4 E;  4R1F A;  4WUB A;  1I94 E;  1Z0W A;  4DXL A;  2UU9 I;  4K0K I;  3J7A G;  2GS8 A;  3WU3 A;  2UXD E;  2ZBK B;  1B63 A;  3OTO I;  4OX9 E;  4DU8 A;  4OX9 I;  1H73 A;  1ZM4 A;  5FLX Q;  1Z0C A;  1N33 I;  2BM0 A;  4YY3 I;  4K0K E;  5FLX C;  1FNM A;  3HJC A;  3JAM Q;  1N34 I;  3PRY A;  4X62 E;  2X36 A;  1HNX E;  4DV7 E;  4PU9 A;  3LPS A;  1RRE A;  5IWA E;  5GME A;  4HAC B;  3K17 A;  2A2C A;  4Z7Y A;  4DV6 I;  4HAC A;  4DV1 I;  1XMO I;  4JI8 E;  3B78 A;  4JI6 I;  3J80 Q;  3HUL A;  1XMQ E;  2HHH E;  5FWK A;  3T1Y I;  3Q1Q A;  1N0V C;  4NXN I;  4JI5 I;  1NHJ A;  1VIS A;  2AJ4 A;  4HYM A;  2CGE A;  3PYF A;  4DV0 I;  3ZZU A;  4KHP I;  4DV0 E;  3LTO A;  4FWH A;  4JYA E;  3K85 A;  4LF9 I;  4B3T I;  4DR1 I;  4DR7 I;  4FN5 A;  3T1Y E;  4NXM I;  3OTO E;  2O1U A;  3QT5 A;  4GKJ E;  4DUZ E;  2UXC E;  3JAM C;  1I94 I;  1XNQ I;  1PIE A;  1ZM9 A;  4P52 A;  4DR5 E;  4DPW A;  4DPX A;  4DR3 I;  2V34 A;  4FWG A;  2HFU A;  4UT4 A;  4AQY I;  4LFA I;  3J80 C;  3ZM7 A;  2CG9 A;  3PYD A;  3QT8 A;  4LF7 E;  2ZM6 I;  4DV5 E;  4DR5 I;  4EMD A;  2PNM A;  4RPF A;  1B62 A;  4LFB I;  2HFS A;  4LFC I;  5IT9 C;  4DPT A;  5A2Q Q;  1K47 A;  1N32 E;  1Z0G A;  4LF9 E;  2VQE I;  2UUA E;  2HKE A;  3J81 Q;  4N3O A;  2O1V A;  4IZK A;  3ZKB A;  3ZKD A;  4JI2 E;  1Y4S A;  4Z7C A;  3J7A M;  4UTG A;  3QT6 A;  1FWL A;  1EA6 A;  4JI5 E;  4JI4 I;  5LL6 R;  4LF7 I;  1J5E I;  4DV6 E;  1Z5A A;  4JI2 I;  4FWD A;  4JI0 E;  4JI8 I;  3WU4 A;  2R42 A;  1OJ4 A;  4DPY A;  1ZXM A;  2O1T A;  4YHH E;  2F4V E;  3B82 A;  4XTJ A;  4DV2 E;  1ZM3 A;  4JV5 E;  4USK A;  4B3M E;  3PYG A;  1N36 E;  1UEK A;  5IT9 Q;  3GON A;  4GKK E;  4KQV A;  3T1H I;  1NHH A;  3B8H A;  4JI3 E;  1N0U A;  4DU7 A;  1PVG A;  4HXZ A;  3V2U C;  1USU A;  2HKJ A;  1EI1 A;  1Z0T A;  3LNU A;  1Z5B A;  1IBK I;  4FW9 A;  1KKH A;  1ELO A;  4DR1 E;  2CZ9 A;  2O1W A;  3CWV A;  2E1R A;  1N36 I;  1HR0 I;  3T1H E;  4DV7 I;  1H7U A;  1HK7 A;  4PRX A;  2LJP A;  2E5L I;  2BM1 A;  4DV2 I;  4LF6 E;  2V8P A;  4PRV A;  1KTV A;  1XNR E;  4X64 I;  4GKJ I;  3WU6 A;  1IBK E;  4DUY E;  1NZ0 A;  4X62 I;  1IBL I;  1FWK A;  2VQF E;  5BR8 I;  3QT7 A;  4NXN E;  4B3M I;  1WUU A;  1Z5C A;  1RR9 A;  2VQE E;  2UUA I;  1XMQ I;  4DUY I;  3P06 A;  2UXB I;  1BKN A;  1XMO E;  4DV1 E;  3F0N A;  4JI6 E;  1XNR I;  4LFB E;  1HNZ I;  1D6T A;  4LF8 I;  1QZR A;  1HNX I;  3V5R A;  5A2Q C;  2J7K A;  5IWA I;  3ZZ0 A;  4B3S E;  3D4J A;  5GMD A;  3J81 C;  3Q6M A;  2V2Q A;  2ZM6 E;  5LMN I;  2UUC I;  4DR4 I;  1N33 E;  4DR2 I;  5LMN E;  4DR6 I;  4YY3 E;  4LF6 I;  2A2D A;  2XEX A;  1Y6Z A;  4I3H A;  4B3S I;  4JI7 E;  2Q2E B;  4P7A A;  1HR0 E;  4DUZ I;  1FI4 A;  2UXC I;  2Z5B B;  5LMU I;  1IBM E;  1XNQ E;  4LF8 E;  4IZJ A;  4LF4 I;  4LF5 E;  3K1J A;  2UU9 E;  4IZK B;  1HNW I;  4DV5 I;  4MYT A;  4DR7 E;  4JI1 E;  1FJG I;  4HY1 A;  4DR2 E;  2PNL A;  2WW4 A;  4LFA E;  1MU5 A;  2GQ0 A;  2UUB I;  4KHP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...