4DV2I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2I00
2UXBI 4JI5I 1KTVA 1Z0VA 4OX9E 1H7UA 1XNRI 4GKJI 3PYGA 1B62A 3M6AA 2OI2A 1N34I 1XMOI 3WU6A 4JI6E 4LF5I 4GKJE 4EMDA 2UUAI 3J81C 4PRXA 2LJPA 5LL6R 4DR5E 4DV3I 4LFAI 4LFBI 3WU4A 4JI1I 3ZKBA 2V2ZA 1XNQE 2BM0A 3WU3A 1J5EE 5A2QQ 4DV3E 1HR0E 3F0NA 1HNXI 3JAMC 4LF7E 3QT6A 4URLA 2BV3A 4UT4A 4YHHI 1Z5BA 5IT9Q 3QT8A 5LMNI 2HHHE 4FWGA 1OJ4A 2XEXA 4Z7CA 2HK3A 2F4VI 4B3SI 1NZ0A 4NXNI 3OTOE 4DR4E 4DUYI 4DXLA 4DR6I 4NXMI 3JAMQ 4HY1A 3J80Q 2V34A 2HKJA 5A2QC 4DV4I 4DV6E 4KHPI 4ED4A 5LMUI 1Z0TA 2UXDE 4DR6E 1UEKA 2ZM6E 4B3TI 4B3TE 4P7AA 4FW9A 5FLXC 4LF8E 1N32E 5GMDA 1Z0EA 4AQYI 4KQVA 1S16A 4X62E 4JI7E 4DUYE 3LPSA 4DR4I 2E1RA 3QT5A 3ZM7A 2UXCE 2A2DA 4DR7I 5GMEA 1RREA 4DV0I 4JI7I 4DV5E 5FLXQ 4LF8I 1EI1A 2UXDI 1KVKA 4X66I 3PYFA 1ZXMA 4P52A 3K1JA 1DARA 4LFAE 4LF7I 4JG4A 1MG7A 4DPUA 3J80C 1HR0I 4JI2E 4DV2I 1XMOE 1N0UA 4GKKI 4DR5I 3K17A 2F4VE 3V5RA 4DU8A 2EFGA 3ZZTA 2NPFA 4JV5E 4DR1E 4DR1I 3B8HA 4JYAE 1PVGA 4DPTA 5BR8I 5BR8E 2ZITA 2V2QA 5LMNE 1H72C 1Z0CA 4HXZA 2UXCI 4DU7A 1A6FA 2DEIA 1FNMA 4WUDA 2UUBE 4OX9I 1IBKE 3T1HE 4DPXA 4XTJA 2UUAE 3ZZUA 4KHPE 4DR3I 1IBME 1FJGI 2X7IA 4Z7YA 1KIJA 1N36E 4DUZI 2R42A 1D6TA 2VQEI 2Q2EB 4ZVIA 2UU9I 3T1YE 3ZZ0A 4PRVA 4M1KA 4HYMA 4MYTA 3J7AG 4HACB 1N32I 2AJ4A 1FWKA 4RPFA 3T1YI 3B82A 2VQEE 2HHHI 1Z5CA 2UU9E 4LFCI 4X65I 2ZM6I 4JI2I 2VQFI 4YHHE 4I3HA 4DPYA 1FWLA 1Z0WA 3T1HI 1I94E 4LF9E 4DR3E 1IBMI 2HFSA 4DV1I 4JI0I 1N33E 3LTOA 2UUBI 5LMUE 4JI3I 4LF6I 1XHKA 3V2UC 1NHHA 4LF4E 4DV4E 4B3SE 4HACA 4USKA 2UUCE 3J81Q 4DR7E 1BKNA 1K47A 4WUBA 1HNZI 1RR9A 5L3JA 4UTGA 3QT7A 1ZM2A 1Z0GA 3CWVA 4X64I 4DR2E 4JYAI 1N36I 3D4JA 1HNWE 2CZ9A 4B3RE 4FN5A 4DUZE 1J5EI 1HNXE 4JI8E 1ELOA 4JI1E 1MU5A 4USMA 4DV6I 2J7KA 4JI5E 1H7SA 1MX0A 1IBLE 1Z0BA 4JI4E 4MYUA 3Q1QA 4JI6I 4X64E 4NXNE 4X65E 4B3RI 1KKHA 4JI8I 4K0KI 4DR2I 3HULA 1N34E 2ZBKB 2VF3A 2GS8A 1ZM3A 2V8PA 2HFUA 2BM1A 2V2VA 1PIEA 4JI3E 4LF6E 1FKAE 4JI4I 3J7AM 1IBLI 5IWAE 1PKPA 4DPWA 1S4EA 2HK2A 2UUCI 4DV2E 2UXBE 4PU9A 3WU5A 4FWDA 4X66E 1XNQI 4AQYE 1N33I 1WUUA 1Z5AA 4DV1E 1NHIA 3GONA 4LFBE 4DV7I 4DV7E 4JI0E 1H74A 4FWHA 4B3MI 1XMQE 3LNUA 3ZKDA 1XMQI 4B3ME 1Z59A 4YY3E 1B63A 1U2RA 5IT9C 4DV5I 1HNWI 4LF5E 4R1FA 2R3VA 4NXME 4LFCE 4DV0E 1H73A 5IWAI 2X36A 2E5LI 3PYEA 3B78A 1NHJA 1ZM4A 1FI4A 4WUCA 3OTOI 4X62I 1HNZE 2A2CA 1XNRE 2HKEA 4K0KE 1EA6A 4LF4I 1QZRA 4JV5I 1N0VC 1FJGE 1ZM9A 2E5LE 1IBKI 1I94I 4LF9I 2DEJA 3H4LA 4GKKE 2VQFE 1VISA 1ZXNA 2WW4A 3PYDA 4YY3I
chains in the Genus database with same CATH superfamily
2UXBI 4JI5I 1KTVA 4QNJA 1Z0VA 4IFDB 2O1TA 4MU4A 5DRQA 5FWKA 4OX9E 1H7UA 3B4TA 1XNRI 2WP8A 4GKJI 4IZJD 2NN6E 3PYGA 3K85A 4FW7A 3NZKA 1Y5YA 1Y4UA 1B62A 3M6AA 2OI2A 4U3BA 1N34I 1XMOI 3WU6A 4JI6E 4LF5I 4GKJE 4EMDA 2UUAI 3J81C 4PRXA 4IFDA 2LJPA 5LL6R 4DR5E 4DV3I 4LFAI 4LFBI 3WU4A 4JI1I 4NBQA 3ZKBA 4OO1C 2V2ZA 1XNQE 2J65A 2NN6A 2BM0A 3WU3A 2BR2A 1J5EE 5A2QQ 4DV3E 4FW3A 1HR0E 3F0NA 1HNXI 1R6MA 5C0XF 3JAMC 4LF7E 3QT6A 4URLA 2BV3A 4UT4A 4YHHI 1Z5BA 3CDJA 5IT9Q 3QT8A 2PNZB 5DNXA 5LMNI 2HHHE 4FWGA 1OJ4A 2XEXA 4Z7CA 2HK3A 2F4VI 2IERA 2Z5EA 2NN6B 4B3SI 1NZ0A 2NN6C 2C38A 4NXNI 3OTOE 3P3CA 3Q6MA 4DR4E 4IZJB 4DUYI 4DXLA 4DR6I 2PO0A 4NXMI 3JAMQ 4LOMA 1UDOA 4HY1A 3J80Q 1UDNA 3GMEA 2V34A 2HKJA 5A2QC 4DV4I 3M85D 4DV6E 4KHPI 4ED4A 5LMUI 1Z0TA 2UXDE 4DR6E 1UEKA 4MU1A 2O1VA 2ZM6E 4B3TI 4B3TE 4P7AA 4IZKB 2JEAA 4GQUA 4BA2B 4FW9A 5FLXC 4LF8E 3U1YA 1N32E 5GMDA 1Z0EA 4AQYI 2WP8B 4KQVA 1S16A 4X62E 4JI7E 4DUYE 3LPSA 4OKGA 4DR4I 2E1RA 4IZJA 3QT5A 3ZM7A 2UXCE 5C0XE 3PS3A 5C0XD 5EKWA 3HJCA 4AM3A 2A2DA 4DR7I 4QNKA 2AE8A 5GMEA 1RREA 5C0XB 1USVA 5JEAD 4DV0I 4DV5E 4JI7I 1XXEA 3P3EA 5FLXQ 4LF8I 4IFDD 1EI1A 1P42A 2BA0D 2UXDI 1KVKA 4X66I 5K36A 3PYFA 5K36B 1ZXMA 4P52A 2IOQA 3K1JA 1DARA 4LFAE 4LF7I 4JG4A 1MG7A 4DPUA 3J80C 1HR0I 5K36E 4JI2E 2Z5CA 4DV2I 1XMOE 1N0UA 4GKKI 4DR5I 3K17A 2PO2A 2PO2B 3UHMA 3V5RA 2F4VE 4DU8A 4LCHA 2EFGA 2IOPA 3ZZTA 1UDQA 2NPFA 4JV5E 3P06A 4ISAA 4DR1E 4DR1I 3B8HA 4JYAE 1PVGA 4DPTA 5BR8E 5BR8I 2ZITA 2PO1B 2V2QA 5LMNE 3M7ND 1H72C 1USUA 2JEBB 1Y6ZA 2Z5BB 1Z0CA 4HXZA 2UXCI 4DU7A 4MDTA 1A6FA 3PRYA 2DEIA 5DROA 1FNMA 1UDSA 2IESA 4WUDA 2UUBE 4OX9I 1OYRA 5JEAB 4J3DA 4OO1F 4FW4A 2C37A 1IBKE 4DPXA 3T1HE 4XTJA 2UUAE 3ZZUA 4KHPE 4DR3I 1IBME 1FJGI 2X7IA 4Z7YA 1KIJA 1N36E 4DUZI 2R42A 1D6TA 1Y60A 3L7ZA 2VQEI 4AIDA 2Q2EB 4ZVIA 3H1CA 2UU9I 3T1YE 3ZZ0A 4PRVA 4M1KA 5C0XA 4HYMA 4IFDF 1VI7A 4MYTA 5JEAA 3J7AG 4HACB 1N32I 2NN6F 2AJ4A 1FWKA 5ELWA 5JEAF 4RPFA 3T1YI 3B82A 2VQEE 2HHHI 1YH8A 1Z5CA 2UU9E 4LFCI 4X65I 3GLLA 4MU0A 5C0XC 5DRRA 2ZM6I 2VESA 4JI2I 2VQFI 4YHHE 4IS9A 5K36D 1E3HA 4I3HA 4DPYA 1FWLA 1Z0WA 3T1HI 1I94E 4LF9E 4DR3E 1IBMI 2HFSA 4DV1I 4JI0I 1N33E 2GO3A 2O1WA 3LTOA 2UUBI 5LMUE 4JI3I 3GCMA 4LF6I 1XHKA 4BA2A 3V2UC 1NHHA 2O3ZA 4LCGA 4DV4E 4LF4E 4B3SE 4HACA 4USKA 2UUCE 3J81Q 4DR7E 1BKNA 1K47A 2F1DA 4WUBA 1HNZI 2BA1G 1RR9A 5L3JA 4MQYA 4UTGA 3QT7A 1ZM2A 3HKMA 2PNMA 2Z5BA 4N3OA 1Z0GA 2Z5CB 2JT2A 3CWVA 4X64I 4DR2E 4JYAI 5EL9A 4OO1A 1N36I 3D4JA 1HNWE 2CZ9A 2GQ0A 4B3RE 4FN5A 4DUZE 4IZKA 3CDIA 1J5EI 1HNXE 4JI8E 1ELOA 4FW6A 4IFDE 2CGEA 3M7NG 4JI1E 1MU5A 4USMA 4BA1B 4BA1A 5JEAE 2J7KA 4DV6I 4JI5E 4FW5A 2C38B 5JEAC 2WNRB 2PNLA 1H7SA 1MX0A 1IBLE 1Z0BA 4JI4E 4MYUA 3Q1QA 4OO1B 4JI6I 2BA1D 4X64E 3L7ZB 4NXNE 4X65E 2PNZA 2BA0G 4B3RI 1KKHA 4JI8I 4K0KI 3KRNA 2PO1A 4DR2I 3HULA 1N34E 2ZBKB 2VF3A 2GS8A 1ZM3A 2V8PA 2JEBA 2WNRA 1OYPA 2HFUA 2BM1A 2BR2B 2V2VA 1PIEA 4JI3E 4LF6E 1FKAE 4JI4I 3J7AM 5K36C 1HK7A 1IBLI 5IWAE 1PKPA 4DPWA 1S4EA 2HK2A 5K36F 2UUCI 2PO0B 4DV2E 2UXBE 4PU9A 3WU5A 4FWDA 4X66E 1XNQI 2JE6B 4AQYE 1N33I 1WUUA 1Z5AA 4DV1E 1NHIA 3GONA 4LFBE 2NN6D 2C37B 4DV7E 4DV7I 1H74A 4JI0E 2JEAB 4FWHA 1XMQI 1YHCA 3LNUA 3ZKDA 1XMQE 4B3ME 1Z59A 4YY3E 4B3MI 1B63A 3PS2A 1U2RA 2CG9A 3DD6A 5IT9C 4DV5I 1HNWI 4LF5E 3P76A 4R1FA 4OZEA 2R3VA 4NXME 1E3PA 4LFCE 4DV0E 4AIMA 1H73A 5IWAI 1OYSA 3U1KA 1RHYA 2X36A 2E5LI 4U3DA 3PYEA 3B78A 3PS1A 2CVEA 1NHJA 2JE6A 1ZM4A 1FI4A 3P3GA 4WUCA 3OTOI 4X62I 1HNZE 5DRPA 2A2CA 1XNRE 2HKEA 4K0KE 4OO1D 1EA6A 2O1UA 4LF4I 1QZRA 4IFDC 4LCFA 1R6LA 4JV5I 1N0VC 1FJGE 1ZM9A 4OO1E 2E5LE 1IBKI 1I94I 4MU3A 4LF9I 2DEJA 3H4LA 3Q6NA 4GKKE 3M85G 2C39B 2C39A 5DNLA 2VQFE 1VISA 2GO4A 1ZXNA 4LPFA 2WW4A 1Y4SA 3PYDA 4YY3I
chains in the Genus database with same CATH topology
2UXBI 4JI5I 1KTVA 1Z0VA 2O1TA 5FWKA 4OX9E 1H7UA 1XNRI 4GKJI 4IZJD 3PYGA 3K85A 1Y4UA 1B62A 3M6AA 2OI2A 1N34I 1XMOI 3WU6A 4JI6E 4LF5I 4GKJE 4EMDA 2UUAI 3J81C 4PRXA 2LJPA 5LL6R 4DR5E 4DV3I 4LFAI 4LFBI 3WU4A 4JI1I 3ZKBA 2V2ZA 1XNQE 2BM0A 3WU3A 1J5EE 5A2QQ 4DV3E 1HR0E 3F0NA 1HNXI 3JAMC 4LF7E 3QT6A 4URLA 2BV3A 4UT4A 4YHHI 1Z5BA 5IT9Q 3QT8A 5LMNI 2HHHE 4FWGA 1OJ4A 2XEXA 4Z7CA 2HK3A 2F4VI 2Z5EA 4B3SI 1NZ0A 4NXNI 3OTOE 3Q6MA 4DR4E 4IZJB 4DUYI 4DXLA 4DR6I 4NXMI 3JAMQ 4HY1A 3J80Q 2V34A 2HKJA 5A2QC 4DV4I 4DV6E 4KHPI 4ED4A 5LMUI 1Z0TA 2UXDE 4DR6E 1UEKA 2O1VA 2ZM6E 4B3TI 4B3TE 4P7AA 4IZKB 4FW9A 5FLXC 4LF8E 1N32E 5GMDA 1Z0EA 4AQYI 4KQVA 1S16A 4X62E 4JI7E 4DUYE 3LPSA 4DR4I 2E1RA 4IZJA 3QT5A 3ZM7A 2UXCE 3HJCA 2A2DA 4DR7I 5GMEA 1RREA 4DV0I 1USVA 4DV5E 4JI7I 5FLXQ 4LF8I 1EI1A 2UXDI 1KVKA 4X66I 3PYFA 1ZXMA 4P52A 2IOQA 3K1JA 1DARA 4LFAE 4LF7I 4JG4A 1MG7A 4DPUA 3J80C 1HR0I 4JI2E 2Z5CA 4DV2I 1XMOE 1N0UA 4GKKI 4DR5I 3K17A 2F4VE 3V5RA 4DU8A 2EFGA 2IOPA 3ZZTA 2NPFA 4JV5E 3P06A 4DR1E 4DR1I 3B8HA 4JYAE 1PVGA 4DPTA 5BR8I 5BR8E 2ZITA 2V2QA 5LMNE 1H72C 1USUA 1Y6ZA 2Z5BB 1Z0CA 4HXZA 2UXCI 4DU7A 1A6FA 3PRYA 2DEIA 1FNMA 4WUDA 2UUBE 4OX9I 1IBKE 3T1HE 4DPXA 4XTJA 2UUAE 3ZZUA 4KHPE 4DR3I 1IBME 1FJGI 2X7IA 4Z7YA 1KIJA 1N36E 4DUZI 2R42A 1D6TA 2VQEI 2Q2EB 4ZVIA 2UU9I 3T1YE 3ZZ0A 4PRVA 4M1KA 4HYMA 4MYTA 3J7AG 4HACB 1N32I 2AJ4A 1FWKA 4RPFA 3T1YI 3B82A 2VQEE 2HHHI 1Z5CA 2UU9E 4LFCI 4X65I 2ZM6I 4JI2I 2VQFI 4YHHE 4I3HA 4DPYA 1FWLA 1Z0WA 3T1HI 1I94E 4LF9E 4DR3E 1IBMI 2HFSA 4DV1I 4JI0I 1N33E 2O1WA 3LTOA 2UUBI 5LMUE 4JI3I 4LF6I 1XHKA 3V2UC 1NHHA 4LF4E 4DV4E 4B3SE 4HACA 4USKA 2UUCE 3J81Q 4DR7E 1BKNA 1K47A 4WUBA 1HNZI 1RR9A 5L3JA 4UTGA 3QT7A 1ZM2A 2PNMA 2Z5BA 4N3OA 1Z0GA 2Z5CB 3CWVA 4X64I 4DR2E 4JYAI 1N36I 3D4JA 1HNWE 2CZ9A 2GQ0A 4B3RE 4FN5A 4DUZE 4IZKA 1J5EI 1HNXE 4JI8E 1ELOA 2CGEA 4JI1E 1MU5A 4USMA 4DV6I 2J7KA 4JI5E 2PNLA 1H7SA 1MX0A 1IBLE 1Z0BA 4JI4E 4MYUA 3Q1QA 4JI6I 4X64E 4NXNE 4X65E 4B3RI 1KKHA 4JI8I 4K0KI 4DR2I 3HULA 1N34E 2ZBKB 2VF3A 2GS8A 1ZM3A 2V8PA 2HFUA 2BM1A 2V2VA 1PIEA 4JI3E 4LF6E 1FKAE 4JI4I 3J7AM 1HK7A 1IBLI 5IWAE 1PKPA 4DPWA 1S4EA 2HK2A 2UUCI 4DV2E 2UXBE 4PU9A 3WU5A 4FWDA 4X66E 1XNQI 4AQYE 1N33I 1WUUA 1Z5AA 4DV1E 1NHIA 3GONA 4LFBE 4DV7I 4DV7E 4JI0E 1H74A 4FWHA 4B3MI 1XMQE 3LNUA 3ZKDA 1XMQI 4B3ME 1Z59A 4YY3E 1B63A 1U2RA 2CG9A 5IT9C 4DV5I 1HNWI 4LF5E 4R1FA 2R3VA 4NXME 4LFCE 4DV0E 1H73A 5IWAI 2X36A 2E5LI 3PYEA 3B78A 1NHJA 1ZM4A 1FI4A 4WUCA 3OTOI 4X62I 1HNZE 2A2CA 1XNRE 2HKEA 4K0KE 1EA6A 2O1UA 4LF4I 1QZRA 4JV5I 1N0VC 1FJGE 1ZM9A 2E5LE 1IBKI 1I94I 4LF9I 2DEJA 3H4LA 3Q6NA 4GKKE 2VQFE 1VISA 1ZXNA 2WW4A 1Y4SA 3PYDA 4YY3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB I;  4JI5 I;  1KTV A;  1Z0V A;  4OX9 E;  1H7U A;  1XNR I;  4GKJ I;  3PYG A;  1B62 A;  3M6A A;  2OI2 A;  1N34 I;  1XMO I;  3WU6 A;  4JI6 E;  4LF5 I;  4GKJ E;  4EMD A;  2UUA I;  3J81 C;  4PRX A;  2LJP A;  5LL6 R;  4DR5 E;  4DV3 I;  4LFA I;  4LFB I;  3WU4 A;  4JI1 I;  3ZKB A;  2V2Z A;  1XNQ E;  2BM0 A;  3WU3 A;  1J5E E;  5A2Q Q;  4DV3 E;  1HR0 E;  3F0N A;  1HNX I;  3JAM C;  4LF7 E;  3QT6 A;  4URL A;  2BV3 A;  4UT4 A;  4YHH I;  1Z5B A;  5IT9 Q;  3QT8 A;  5LMN I;  2HHH E;  4FWG A;  1OJ4 A;  2XEX A;  4Z7C A;  2HK3 A;  2F4V I;  4B3S I;  1NZ0 A;  4NXN I;  3OTO E;  4DR4 E;  4DUY I;  4DXL A;  4DR6 I;  4NXM I;  3JAM Q;  4HY1 A;  3J80 Q;  2V34 A;  2HKJ A;  5A2Q C;  4DV4 I;  4DV6 E;  4KHP I;  4ED4 A;  5LMU I;  1Z0T A;  2UXD E;  4DR6 E;  1UEK A;  2ZM6 E;  4B3T I;  4B3T E;  4P7A A;  4FW9 A;  5FLX C;  4LF8 E;  1N32 E;  5GMD A;  1Z0E A;  4AQY I;  4KQV A;  1S16 A;  4X62 E;  4JI7 E;  4DUY E;  3LPS A;  4DR4 I;  2E1R A;  3QT5 A;  3ZM7 A;  2UXC E;  2A2D A;  4DR7 I;  5GME A;  1RRE A;  4DV0 I;  4JI7 I;  4DV5 E;  5FLX Q;  4LF8 I;  1EI1 A;  2UXD I;  1KVK A;  4X66 I;  3PYF A;  1ZXM A;  4P52 A;  3K1J A;  1DAR A;  4LFA E;  4LF7 I;  4JG4 A;  1MG7 A;  4DPU A;  3J80 C;  1HR0 I;  4JI2 E;  4DV2 I;  1XMO E;  1N0U A;  4GKK I;  4DR5 I;  3K17 A;  2F4V E;  3V5R A;  4DU8 A;  2EFG A;  3ZZT A;  2NPF A;  4JV5 E;  4DR1 E;  4DR1 I;  3B8H A;  4JYA E;  1PVG A;  4DPT A;  5BR8 I;  5BR8 E;  2ZIT A;  2V2Q A;  5LMN E;  1H72 C;  1Z0C A;  4HXZ A;  2UXC I;  4DU7 A;  1A6F A;  2DEI A;  1FNM A;  4WUD A;  2UUB E;  4OX9 I;  1IBK E;  3T1H E;  4DPX A;  4XTJ A;  2UUA E;  3ZZU A;  4KHP E;  4DR3 I;  1IBM E;  1FJG I;  2X7I A;  4Z7Y A;  1KIJ A;  1N36 E;  4DUZ I;  2R42 A;  1D6T A;  2VQE I;  2Q2E B;  4ZVI A;  2UU9 I;  3T1Y E;  3ZZ0 A;  4PRV A;  4M1K A;  4HYM A;  4MYT A;  3J7A G;  4HAC B;  1N32 I;  2AJ4 A;  1FWK A;  4RPF A;  3T1Y I;  3B82 A;  2VQE E;  2HHH I;  1Z5C A;  2UU9 E;  4LFC I;  4X65 I;  2ZM6 I;  4JI2 I;  2VQF I;  4YHH E;  4I3H A;  4DPY A;  1FWL A;  1Z0W A;  3T1H I;  1I94 E;  4LF9 E;  4DR3 E;  1IBM I;  2HFS A;  4DV1 I;  4JI0 I;  1N33 E;  3LTO A;  2UUB I;  5LMU E;  4JI3 I;  4LF6 I;  1XHK A;  3V2U C;  1NHH A;  4LF4 E;  4DV4 E;  4B3S E;  4HAC A;  4USK A;  2UUC E;  3J81 Q;  4DR7 E;  1BKN A;  1K47 A;  4WUB A;  1HNZ I;  1RR9 A;  5L3J A;  4UTG A;  3QT7 A;  1ZM2 A;  1Z0G A;  3CWV A;  4X64 I;  4DR2 E;  4JYA I;  1N36 I;  3D4J A;  1HNW E;  2CZ9 A;  4B3R E;  4FN5 A;  4DUZ E;  1J5E I;  1HNX E;  4JI8 E;  1ELO A;  4JI1 E;  1MU5 A;  4USM A;  4DV6 I;  2J7K A;  4JI5 E;  1H7S A;  1MX0 A;  1IBL E;  1Z0B A;  4JI4 E;  4MYU A;  3Q1Q A;  4JI6 I;  4X64 E;  4NXN E;  4X65 E;  4B3R I;  1KKH A;  4JI8 I;  4K0K I;  4DR2 I;  3HUL A;  1N34 E;  2ZBK B;  2VF3 A;  2GS8 A;  1ZM3 A;  2V8P A;  2HFU A;  2BM1 A;  2V2V A;  1PIE A;  4JI3 E;  4LF6 E;  1FKA E;  4JI4 I;  3J7A M;  1IBL I;  5IWA E;  1PKP A;  4DPW A;  1S4E A;  2HK2 A;  2UUC I;  4DV2 E;  2UXB E;  4PU9 A;  3WU5 A;  4FWD A;  4X66 E;  1XNQ I;  4AQY E;  1N33 I;  1WUU A;  1Z5A A;  4DV1 E;  1NHI A;  3GON A;  4LFB E;  4DV7 I;  4DV7 E;  4JI0 E;  1H74 A;  4FWH A;  4B3M I;  1XMQ E;  3LNU A;  3ZKD A;  1XMQ I;  4B3M E;  1Z59 A;  4YY3 E;  1B63 A;  1U2R A;  5IT9 C;  4DV5 I;  1HNW I;  4LF5 E;  4R1F A;  2R3V A;  4NXM E;  4LFC E;  4DV0 E;  1H73 A;  5IWA I;  2X36 A;  2E5L I;  3PYE A;  3B78 A;  1NHJ A;  1ZM4 A;  1FI4 A;  4WUC A;  3OTO I;  4X62 I;  1HNZ E;  2A2C A;  1XNR E;  2HKE A;  4K0K E;  1EA6 A;  4LF4 I;  1QZR A;  4JV5 I;  1N0V C;  1FJG E;  1ZM9 A;  2E5L E;  1IBK I;  1I94 I;  4LF9 I;  2DEJ A;  3H4L A;  4GKK E;  2VQF E;  1VIS A;  1ZXN A;  2WW4 A;  3PYD A;  4YY3 I; 
#chains in the Genus database with same CATH topology
 2UXB I;  4JI5 I;  1KTV A;  4QNJ A;  1Z0V A;  4IFD B;  2O1T A;  4MU4 A;  5DRQ A;  5FWK A;  4OX9 E;  1H7U A;  3B4T A;  1XNR I;  2WP8 A;  4GKJ I;  4IZJ D;  2NN6 E;  3PYG A;  3K85 A;  4FW7 A;  3NZK A;  1Y5Y A;  1Y4U A;  1B62 A;  3M6A A;  2OI2 A;  4U3B A;  1N34 I;  1XMO I;  3WU6 A;  4JI6 E;  4LF5 I;  4GKJ E;  4EMD A;  2UUA I;  3J81 C;  4PRX A;  4IFD A;  2LJP A;  5LL6 R;  4DR5 E;  4DV3 I;  4LFA I;  4LFB I;  3WU4 A;  4JI1 I;  4NBQ A;  3ZKB A;  4OO1 C;  2V2Z A;  1XNQ E;  2J65 A;  2NN6 A;  2BM0 A;  3WU3 A;  2BR2 A;  1J5E E;  5A2Q Q;  4DV3 E;  4FW3 A;  1HR0 E;  3F0N A;  1HNX I;  1R6M A;  5C0X F;  3JAM C;  4LF7 E;  3QT6 A;  4URL A;  2BV3 A;  4UT4 A;  4YHH I;  1Z5B A;  3CDJ A;  5IT9 Q;  3QT8 A;  2PNZ B;  5DNX A;  5LMN I;  2HHH E;  4FWG A;  1OJ4 A;  2XEX A;  4Z7C A;  2HK3 A;  2F4V I;  2IER A;  2Z5E A;  2NN6 B;  4B3S I;  1NZ0 A;  2NN6 C;  2C38 A;  4NXN I;  3OTO E;  3P3C A;  3Q6M A;  4DR4 E;  4IZJ B;  4DUY I;  4DXL A;  4DR6 I;  2PO0 A;  4NXM I;  3JAM Q;  4LOM A;  1UDO A;  4HY1 A;  3J80 Q;  1UDN A;  3GME A;  2V34 A;  2HKJ A;  5A2Q C;  4DV4 I;  3M85 D;  4DV6 E;  4KHP I;  4ED4 A;  5LMU I;  1Z0T A;  2UXD E;  4DR6 E;  1UEK A;  4MU1 A;  2O1V A;  2ZM6 E;  4B3T I;  4B3T E;  4P7A A;  4IZK B;  2JEA A;  4GQU A;  4BA2 B;  4FW9 A;  5FLX C;  4LF8 E;  3U1Y A;  1N32 E;  5GMD A;  1Z0E A;  4AQY I;  2WP8 B;  4KQV A;  1S16 A;  4X62 E;  4JI7 E;  4DUY E;  3LPS A;  4OKG A;  4DR4 I;  2E1R A;  4IZJ A;  3QT5 A;  3ZM7 A;  2UXC E;  5C0X E;  3PS3 A;  5C0X D;  5EKW A;  3HJC A;  4AM3 A;  2A2D A;  4DR7 I;  4QNK A;  2AE8 A;  5GME A;  1RRE A;  5C0X B;  1USV A;  5JEA D;  4DV0 I;  4DV5 E;  4JI7 I;  1XXE A;  3P3E A;  5FLX Q;  4LF8 I;  4IFD D;  1EI1 A;  1P42 A;  2BA0 D;  2UXD I;  1KVK A;  4X66 I;  5K36 A;  3PYF A;  5K36 B;  1ZXM A;  4P52 A;  2IOQ A;  3K1J A;  1DAR A;  4LFA E;  4LF7 I;  4JG4 A;  1MG7 A;  4DPU A;  3J80 C;  1HR0 I;  5K36 E;  4JI2 E;  2Z5C A;  4DV2 I;  1XMO E;  1N0U A;  4GKK I;  4DR5 I;  3K17 A;  2PO2 A;  2PO2 B;  3UHM A;  3V5R A;  2F4V E;  4DU8 A;  4LCH A;  2EFG A;  2IOP A;  3ZZT A;  1UDQ A;  2NPF A;  4JV5 E;  3P06 A;  4ISA A;  4DR1 E;  4DR1 I;  3B8H A;  4JYA E;  1PVG A;  4DPT A;  5BR8 E;  5BR8 I;  2ZIT A;  2PO1 B;  2V2Q A;  5LMN E;  3M7N D;  1H72 C;  1USU A;  2JEB B;  1Y6Z A;  2Z5B B;  1Z0C A;  4HXZ A;  2UXC I;  4DU7 A;  4MDT A;  1A6F A;  3PRY A;  2DEI A;  5DRO A;  1FNM A;  1UDS A;  2IES A;  4WUD A;  2UUB E;  4OX9 I;  1OYR A;  5JEA B;  4J3D A;  4OO1 F;  4FW4 A;  2C37 A;  1IBK E;  4DPX A;  3T1H E;  4XTJ A;  2UUA E;  3ZZU A;  4KHP E;  4DR3 I;  1IBM E;  1FJG I;  2X7I A;  4Z7Y A;  1KIJ A;  1N36 E;  4DUZ I;  2R42 A;  1D6T A;  1Y60 A;  3L7Z A;  2VQE I;  4AID A;  2Q2E B;  4ZVI A;  3H1C A;  2UU9 I;  3T1Y E;  3ZZ0 A;  4PRV A;  4M1K A;  5C0X A;  4HYM A;  4IFD F;  1VI7 A;  4MYT A;  5JEA A;  3J7A G;  4HAC B;  1N32 I;  2NN6 F;  2AJ4 A;  1FWK A;  5ELW A;  5JEA F;  4RPF A;  3T1Y I;  3B82 A;  2VQE E;  2HHH I;  1YH8 A;  1Z5C A;  2UU9 E;  4LFC I;  4X65 I;  3GLL A;  4MU0 A;  5C0X C;  5DRR A;  2ZM6 I;  2VES A;  4JI2 I;  2VQF I;  4YHH E;  4IS9 A;  5K36 D;  1E3H A;  4I3H A;  4DPY A;  1FWL A;  1Z0W A;  3T1H I;  1I94 E;  4LF9 E;  4DR3 E;  1IBM I;  2HFS A;  4DV1 I;  4JI0 I;  1N33 E;  2GO3 A;  2O1W A;  3LTO A;  2UUB I;  5LMU E;  4JI3 I;  3GCM A;  4LF6 I;  1XHK A;  4BA2 A;  3V2U C;  1NHH A;  2O3Z A;  4LCG A;  4DV4 E;  4LF4 E;  4B3S E;  4HAC A;  4USK A;  2UUC E;  3J81 Q;  4DR7 E;  1BKN A;  1K47 A;  2F1D A;  4WUB A;  1HNZ I;  2BA1 G;  1RR9 A;  5L3J A;  4MQY A;  4UTG A;  3QT7 A;  1ZM2 A;  3HKM A;  2PNM A;  2Z5B A;  4N3O A;  1Z0G A;  2Z5C B;  2JT2 A;  3CWV A;  4X64 I;  4DR2 E;  4JYA I;  5EL9 A;  4OO1 A;  1N36 I;  3D4J A;  1HNW E;  2CZ9 A;  2GQ0 A;  4B3R E;  4FN5 A;  4DUZ E;  4IZK A;  3CDI A;  1J5E I;  1HNX E;  4JI8 E;  1ELO A;  4FW6 A;  4IFD E;  2CGE A;  3M7N G;  4JI1 E;  1MU5 A;  4USM A;  4BA1 B;  4BA1 A;  5JEA E;  2J7K A;  4DV6 I;  4JI5 E;  4FW5 A;  2C38 B;  5JEA C;  2WNR B;  2PNL A;  1H7S A;  1MX0 A;  1IBL E;  1Z0B A;  4JI4 E;  4MYU A;  3Q1Q A;  4OO1 B;  4JI6 I;  2BA1 D;  4X64 E;  3L7Z B;  4NXN E;  4X65 E;  2PNZ A;  2BA0 G;  4B3R I;  1KKH A;  4JI8 I;  4K0K I;  3KRN A;  2PO1 A;  4DR2 I;  3HUL A;  1N34 E;  2ZBK B;  2VF3 A;  2GS8 A;  1ZM3 A;  2V8P A;  2JEB A;  2WNR A;  1OYP A;  2HFU A;  2BM1 A;  2BR2 B;  2V2V A;  1PIE A;  4JI3 E;  4LF6 E;  1FKA E;  4JI4 I;  3J7A M;  5K36 C;  1HK7 A;  1IBL I;  5IWA E;  1PKP A;  4DPW A;  1S4E A;  2HK2 A;  5K36 F;  2UUC I;  2PO0 B;  4DV2 E;  2UXB E;  4PU9 A;  3WU5 A;  4FWD A;  4X66 E;  1XNQ I;  2JE6 B;  4AQY E;  1N33 I;  1WUU A;  1Z5A A;  4DV1 E;  1NHI A;  3GON A;  4LFB E;  2NN6 D;  2C37 B;  4DV7 E;  4DV7 I;  1H74 A;  4JI0 E;  2JEA B;  4FWH A;  1XMQ I;  1YHC A;  3LNU A;  3ZKD A;  1XMQ E;  4B3M E;  1Z59 A;  4YY3 E;  4B3M I;  1B63 A;  3PS2 A;  1U2R A;  2CG9 A;  3DD6 A;  5IT9 C;  4DV5 I;  1HNW I;  4LF5 E;  3P76 A;  4R1F A;  4OZE A;  2R3V A;  4NXM E;  1E3P A;  4LFC E;  4DV0 E;  4AIM A;  1H73 A;  5IWA I;  1OYS A;  3U1K A;  1RHY A;  2X36 A;  2E5L I;  4U3D A;  3PYE A;  3B78 A;  3PS1 A;  2CVE A;  1NHJ A;  2JE6 A;  1ZM4 A;  1FI4 A;  3P3G A;  4WUC A;  3OTO I;  4X62 I;  1HNZ E;  5DRP A;  2A2C A;  1XNR E;  2HKE A;  4K0K E;  4OO1 D;  1EA6 A;  2O1U A;  4LF4 I;  1QZR A;  4IFD C;  4LCF A;  1R6L A;  4JV5 I;  1N0V C;  1FJG E;  1ZM9 A;  4OO1 E;  2E5L E;  1IBK I;  1I94 I;  4MU3 A;  4LF9 I;  2DEJ A;  3H4L A;  3Q6N A;  4GKK E;  3M85 G;  2C39 B;  2C39 A;  5DNL A;  2VQF E;  1VIS A;  2GO4 A;  1ZXN A;  4LPF A;  2WW4 A;  1Y4S A;  3PYD A;  4YY3 I; 
#chains in the Genus database with same CATH homology
 2UXB I;  4JI5 I;  1KTV A;  1Z0V A;  2O1T A;  5FWK A;  4OX9 E;  1H7U A;  1XNR I;  4GKJ I;  4IZJ D;  3PYG A;  3K85 A;  1Y4U A;  1B62 A;  3M6A A;  2OI2 A;  1N34 I;  1XMO I;  3WU6 A;  4JI6 E;  4LF5 I;  4GKJ E;  4EMD A;  2UUA I;  3J81 C;  4PRX A;  2LJP A;  5LL6 R;  4DR5 E;  4DV3 I;  4LFA I;  4LFB I;  3WU4 A;  4JI1 I;  3ZKB A;  2V2Z A;  1XNQ E;  2BM0 A;  3WU3 A;  1J5E E;  5A2Q Q;  4DV3 E;  1HR0 E;  3F0N A;  1HNX I;  3JAM C;  4LF7 E;  3QT6 A;  4URL A;  2BV3 A;  4UT4 A;  4YHH I;  1Z5B A;  5IT9 Q;  3QT8 A;  5LMN I;  2HHH E;  4FWG A;  1OJ4 A;  2XEX A;  4Z7C A;  2HK3 A;  2F4V I;  2Z5E A;  4B3S I;  1NZ0 A;  4NXN I;  3OTO E;  3Q6M A;  4DR4 E;  4IZJ B;  4DUY I;  4DXL A;  4DR6 I;  4NXM I;  3JAM Q;  4HY1 A;  3J80 Q;  2V34 A;  2HKJ A;  5A2Q C;  4DV4 I;  4DV6 E;  4KHP I;  4ED4 A;  5LMU I;  1Z0T A;  2UXD E;  4DR6 E;  1UEK A;  2O1V A;  2ZM6 E;  4B3T I;  4B3T E;  4P7A A;  4IZK B;  4FW9 A;  5FLX C;  4LF8 E;  1N32 E;  5GMD A;  1Z0E A;  4AQY I;  4KQV A;  1S16 A;  4X62 E;  4JI7 E;  4DUY E;  3LPS A;  4DR4 I;  2E1R A;  4IZJ A;  3QT5 A;  3ZM7 A;  2UXC E;  3HJC A;  2A2D A;  4DR7 I;  5GME A;  1RRE A;  4DV0 I;  1USV A;  4DV5 E;  4JI7 I;  5FLX Q;  4LF8 I;  1EI1 A;  2UXD I;  1KVK A;  4X66 I;  3PYF A;  1ZXM A;  4P52 A;  2IOQ A;  3K1J A;  1DAR A;  4LFA E;  4LF7 I;  4JG4 A;  1MG7 A;  4DPU A;  3J80 C;  1HR0 I;  4JI2 E;  2Z5C A;  4DV2 I;  1XMO E;  1N0U A;  4GKK I;  4DR5 I;  3K17 A;  2F4V E;  3V5R A;  4DU8 A;  2EFG A;  2IOP A;  3ZZT A;  2NPF A;  4JV5 E;  3P06 A;  4DR1 E;  4DR1 I;  3B8H A;  4JYA E;  1PVG A;  4DPT A;  5BR8 I;  5BR8 E;  2ZIT A;  2V2Q A;  5LMN E;  1H72 C;  1USU A;  1Y6Z A;  2Z5B B;  1Z0C A;  4HXZ A;  2UXC I;  4DU7 A;  1A6F A;  3PRY A;  2DEI A;  1FNM A;  4WUD A;  2UUB E;  4OX9 I;  1IBK E;  3T1H E;  4DPX A;  4XTJ A;  2UUA E;  3ZZU A;  4KHP E;  4DR3 I;  1IBM E;  1FJG I;  2X7I A;  4Z7Y A;  1KIJ A;  1N36 E;  4DUZ I;  2R42 A;  1D6T A;  2VQE I;  2Q2E B;  4ZVI A;  2UU9 I;  3T1Y E;  3ZZ0 A;  4PRV A;  4M1K A;  4HYM A;  4MYT A;  3J7A G;  4HAC B;  1N32 I;  2AJ4 A;  1FWK A;  4RPF A;  3T1Y I;  3B82 A;  2VQE E;  2HHH I;  1Z5C A;  2UU9 E;  4LFC I;  4X65 I;  2ZM6 I;  4JI2 I;  2VQF I;  4YHH E;  4I3H A;  4DPY A;  1FWL A;  1Z0W A;  3T1H I;  1I94 E;  4LF9 E;  4DR3 E;  1IBM I;  2HFS A;  4DV1 I;  4JI0 I;  1N33 E;  2O1W A;  3LTO A;  2UUB I;  5LMU E;  4JI3 I;  4LF6 I;  1XHK A;  3V2U C;  1NHH A;  4LF4 E;  4DV4 E;  4B3S E;  4HAC A;  4USK A;  2UUC E;  3J81 Q;  4DR7 E;  1BKN A;  1K47 A;  4WUB A;  1HNZ I;  1RR9 A;  5L3J A;  4UTG A;  3QT7 A;  1ZM2 A;  2PNM A;  2Z5B A;  4N3O A;  1Z0G A;  2Z5C B;  3CWV A;  4X64 I;  4DR2 E;  4JYA I;  1N36 I;  3D4J A;  1HNW E;  2CZ9 A;  2GQ0 A;  4B3R E;  4FN5 A;  4DUZ E;  4IZK A;  1J5E I;  1HNX E;  4JI8 E;  1ELO A;  2CGE A;  4JI1 E;  1MU5 A;  4USM A;  4DV6 I;  2J7K A;  4JI5 E;  2PNL A;  1H7S A;  1MX0 A;  1IBL E;  1Z0B A;  4JI4 E;  4MYU A;  3Q1Q A;  4JI6 I;  4X64 E;  4NXN E;  4X65 E;  4B3R I;  1KKH A;  4JI8 I;  4K0K I;  4DR2 I;  3HUL A;  1N34 E;  2ZBK B;  2VF3 A;  2GS8 A;  1ZM3 A;  2V8P A;  2HFU A;  2BM1 A;  2V2V A;  1PIE A;  4JI3 E;  4LF6 E;  1FKA E;  4JI4 I;  3J7A M;  1HK7 A;  1IBL I;  5IWA E;  1PKP A;  4DPW A;  1S4E A;  2HK2 A;  2UUC I;  4DV2 E;  2UXB E;  4PU9 A;  3WU5 A;  4FWD A;  4X66 E;  1XNQ I;  4AQY E;  1N33 I;  1WUU A;  1Z5A A;  4DV1 E;  1NHI A;  3GON A;  4LFB E;  4DV7 I;  4DV7 E;  4JI0 E;  1H74 A;  4FWH A;  4B3M I;  1XMQ E;  3LNU A;  3ZKD A;  1XMQ I;  4B3M E;  1Z59 A;  4YY3 E;  1B63 A;  1U2R A;  2CG9 A;  5IT9 C;  4DV5 I;  1HNW I;  4LF5 E;  4R1F A;  2R3V A;  4NXM E;  4LFC E;  4DV0 E;  1H73 A;  5IWA I;  2X36 A;  2E5L I;  3PYE A;  3B78 A;  1NHJ A;  1ZM4 A;  1FI4 A;  4WUC A;  3OTO I;  4X62 I;  1HNZ E;  2A2C A;  1XNR E;  2HKE A;  4K0K E;  1EA6 A;  2O1U A;  4LF4 I;  1QZR A;  4JV5 I;  1N0V C;  1FJG E;  1ZM9 A;  2E5L E;  1IBK I;  1I94 I;  4LF9 I;  2DEJ A;  3H4L A;  3Q6N A;  4GKK E;  2VQF E;  1VIS A;  1ZXN A;  2WW4 A;  1Y4S A;  3PYD A;  4YY3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...