4DV2I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2I00
4DUZE 1DARA 4HXZA 4DV2I 1ZM2A 4LF5I 1KVKA 4HACB 3QT7A 2X36A 3K17A 3JAMQ 2UU9I 1HNZE 4DV6E 1XMOI 1FKAE 2OI2A 4P52A 1PIEA 3QT8A 2DEJA 5LMNE 1Z0BA 5GMDA 1KKHA 3J81Q 4FWHA 1J5EI 1PKPA 3PYDA 1FNMA 4DV1E 4B3TI 4M1KA 3T1HE 4LFAI 1HR0E 4X65I 1IBMI 4YY3I 1IBKI 3K1JA 1HNXI 1I94E 4DR1E 4AQYI 4P7AA 2HKEA 4JI1E 1MU5A 4JV5E 1FJGE 4NXNE 1EA6A 4DR5I 1N36E 4JI6E 4DR4E 4YHHI 1XMQI 4JI8I 1NZ0A 4DR3I 1H74A 1B62A 4EMDA 4X64I 2DEIA 1XNRI 2UUCE 4LFBI 4X62I 2J7KA 3PYGA 2VQEE 2HKJA 4DV5I 2F4VI 3WU6A 1HNWE 1OJ4A 4NXME 1FWKA 3M6AA 1N0VC 3WU3A 3ZZ0A 4B3ME 5FLXQ 2LJPA 4DXLA 2UUBI 5BR8I 1ZXMA 2ZBKB 4LF6E 1A6FA 1S4EA 3ZM7A 2E5LE 1D6TA 2AJ4A 5L3JA 5LMUI 2HFSA 2HK2A 1H73A 2HFUA 3B82A 3T1YE 2HHHI 1ZM9A 1N32I 4DV2E 1XNQE 4DPUA 4LF5E 4K0KE 3J80C 3PYEA 3LTOA 4HY1A 4DV7I 1XMOE 2UXCE 4JI2E 4USMA 4JI4I 4B3RI 4DUZI 3D4JA 4DU7A 4JI0I 1N34E 4DPWA 1PVGA 3F0NA 2ZM6I 3B8HA 1Z5BA 4DV6I 1J5EE 1H7UA 4FN5A 4DPTA 3WU5A 1MG7A 4Z7CA 2UXDI 2V2ZA 2BM1A 1Z59A 4LFAE 1ZM3A 2BV3A 4X65E 4LF7I 1ELOA 1FWLA 1H72C 1IBME 4YY3E 1B63A 1HNXE 4AQYE 2A2DA 4JI3I 4USKA 1Z5AA 2WW4A 4DR6I 2R42A 2X7IA 3T1HI 5LL6R 1HR0I 4JI5E 5GMEA 1ZM4A 5A2QC 4YHHE 1S16A 1XMQE 4JV5I 3V2UC 4NXNI 4JI8E 4DR3E 4OX9I 4DV0E 1Z0CA 1QZRA 4LFCI 4R1FA 2BM0A 1IBLI 2VQFE 1XNRE 4DR7I 4LF8E 1VISA 4X62E 3J80Q 4DR2I 4DV5E 3Q1QA 2UUCI 2F4VE 4KQVA 3J81C 1BKNA 3OTOI 4JI7I 2EFGA 4Z7YA 4DPXA 4LF4I 4PU9A 4MYTA 4PRXA 4DUYE 5BR8E 4GKJE 1K47A 4LF9I 3V5RA 4ZVIA 2HK3A 4DU8A 3LNUA 4B3MI 4GKKI 4FW9A 4B3SI 1Z5CA 2HHHE 1Z0TA 4LF6I 4DV4E 1N33I 3GONA 3ZKDA 4JYAI 2Q2EB 4DV3I 3WU4A 2UUAI 4KHPI 4PRVA 4XTJA 3ZZUA 2UU9E 4HACA 5IWAI 2UXBI 1N0UA 4DV7E 5A2QQ 4X66I 4JI4E 4B3RE 2GS8A 4ED4A 1XNQI 4K0KI 2V2QA 4JI0E 1HNZI 2V34A 2ZM6E 5IT9C 2UXCI 4JI2I 2UXDE 4B3TE 5LMNI 3LPSA 5FLXC 1U2RA 1N34I 1Z0GA 1IBKE 1NHJA 4LF7E 3CWVA 4JI3E 2ZITA 4DV1I 3B78A 4DR5E 4DR6E 1KIJA 4UT4A 3QT6A 1H7SA 1I94I 2NPFA 4DR1I 4JI1I 1FJGI 2V8PA 2R3VA 4FWDA 3H4LA 3PYFA 4OX9E 3QT5A 1MX0A 4X64E 4WUCA 4JI5I 1N36I 3JAMC 2V2VA 1XHKA 4LFCE 1IBLE 4JI6I 4DR4I 4LFBE 2A2CA 4RPFA 3ZKBA 4DR7E 1Z0EA 1ZXNA 2E1RA 4DV0I 1NHIA 4HYMA 4MYUA 4FWGA 1Z0WA 2VQFI 4DR2E 3J7AG 1NHHA 2VF3A 3OTOE 4LF8I 4JI7E 1WUUA 2VQEI 2UUBE 1FI4A 4LF4E 5IT9Q 3HULA 1HNWI 4NXMI 4URLA 1EI1A 2XEXA 4LF9E 4JG4A 5LMUE 4GKKE 4DUYI 4B3SE 4GKJI 3ZZTA 4DPYA 4UTGA 4I3HA 1N32E 1N33E 3J7AM 1RREA 4JYAE 2E5LI 4DV3E 1Z0VA 4WUDA 2UUAE 1UEKA 4KHPE 2CZ9A 1RR9A 5IWAE 3T1YI 2UXBE 1KTVA 4WUBA 4X66E 4DV4I
chains in the Genus database with same CATH superfamily
4DUZE 1DARA 4HXZA 2JE6A 4DV2I 1Y4UA 5C0XF 1ZM2A 4ISAA 2BA1D 3KRNA 4LF5I 1KVKA 1YHCA 4HACB 3QT7A 2X36A 3K17A 3JAMQ 2UU9I 1HNZE 4DV6E 1XMOI 5K36D 1FKAE 2OI2A 4P52A 1PIEA 1YH8A 3QT8A 2PNZA 2DEJA 5LMNE 1Z0BA 3P76A 5GMDA 1KKHA 3J81Q 4FWHA 1J5EI 1PKPA 3PYDA 5JEAF 1FNMA 4MU0A 4IFDB 2C38A 4IFDC 1OYPA 3PS1A 4DV1E 4B3TI 4M1KA 3T1HE 4LFAI 1HR0E 4X65I 2JT2A 3U1KA 2IESA 1IBMI 4YY3I 1IBKI 3K1JA 1HNXI 1I94E 4DR1E 4AQYI 4P7AA 2HKEA 4JI1E 4BA2A 1MU5A 4JV5E 1FJGE 2NN6B 4NXNE 5K36E 1EA6A 2NN6C 4DR5I 2IOPA 5EL9A 1N36E 2PO1B 1Y60A 4IFDD 5DNXA 4JI6E 5DNLA 2JEAA 4DR4E 2PO2A 3K85A 4YHHI 1XMQI 1HK7A 4JI8I 1NZ0A 4DR3I 1H74A 1B62A 4EMDA 4X64I 2DEIA 2NN6D 2UUCE 1XNRI 4OO1A 4LFBI 1OYRA 4FW3A 4X62I 2C37B 2JEBB 4U3BA 2GQ0A 2J7KA 2CVEA 3PYGA 2WNRA 2VQEE 2HKJA 4DV5I 2F4VI 3WU6A 4OO1C 1UDSA 1HNWE 1OJ4A 4NXME 1FWKA 3M6AA 1USVA 1N0VC 2Z5CA 3PS2A 4IFDE 3WU3A 3ZZ0A 4B3ME 5FLXQ 2WP8B 2LJPA 2C39A 4LCFA 4DXLA 4IZJA 2UUBI 5BR8I 4BA1A 1ZXMA 2ZBKB 1P42A 3U1YA 5C0XB 4LF6E 5C0XC 2Z5BA 4IS9A 1A6FA 2NN6E 3NZKA 1S4EA 3ZM7A 1RHYA 2E5LE 1D6TA 2BR2A 2GO4A 2AJ4A 3B4TA 5L3JA 5LMUI 4OO1D 2AE8A 4QNJA 4FW7A 2HFSA 4MU1A 4U3DA 2CGEA 2HK2A 1H73A 5JEAA 2HFUA 3B82A 3T1YE 2HHHI 1ZM9A 1N32I 4MU3A 4DV2E 1XNQE 4DPUA 4LF5E 4K0KE 5C0XD 3J80C 3PYEA 5JEAC 3LTOA 4HY1A 4DV7I 1XMOE 2O1TA 2UXCE 4JI2E 5DRPA 4LOMA 2JE6B 4USMA 4JI4I 4B3RI 4DUZI 3D4JA 4DU7A 4JI0I 1N34E 4DPWA 1PVGA 2O1WA 3F0NA 2ZM6I 3B8HA 1Z5BA 4DV6I 1J5EE 1H7UA 4FN5A 4DPTA 3GCMA 3WU5A 1MG7A 4Z7CA 2PNZB 2UXDI 2V2ZA 2BM1A 5JEAD 4J3DA 3M7NG 1Z59A 4LFAE 1ZM3A 2BV3A 4X65E 1Y6ZA 3GMEA 4LF7I 1ELOA 1FWLA 1H72C 1IBME 4YY3E 1B63A 3L7ZA 5C0XE 1HNXE 4IZKA 4AQYE 2A2DA 2IOQA 2C38B 4JI3I 4USKA 1Z5AA 2WW4A 4DR6I 2R42A 1UDNA 2O1VA 2X7IA 3T1HI 5LL6R 1HR0I 4JI5E 1Y4SA 1USUA 4MDTA 5GMEA 1ZM4A 3CDIA 4BA2B 5A2QC 3CDJA 4YHHE 1S16A 5EKWA 1XMQE 4JV5I 3V2UC 4NXNI 3P3CA 4JI8E 4DR3E 5DROA 4AM3A 3PRYA 4OX9I 4LPFA 4DV0E 1Z0CA 1QZRA 1E3HA 4LFCI 4R1FA 2BM0A 1IBLI 4AIDA 2VQFE 2JEAB 2PO2B 1XNRE 3HJCA 4DR7I 4LF8E 1VISA 4X62E 3M7ND 3J80Q 4OO1B 4DR2I 4DV5E 3Q1QA 3P3GA 2UUCI 4KQVA 3J81C 1BKNA 2F4VE 5ELWA 3OTOI 4JI7I 2EFGA 5DRRA 4Z7YA 4DPXA 2WNRB 4LF4I 4PU9A 4MYTA 2PNMA 4PRXA 4DUYE 5BR8E 4GKJE 1K47A 2Z5CB 1Y5YA 4LF9I 3V5RA 1UDQA 4ZVIA 2HK3A 4DU8A 3LNUA 4B3MI 2C39B 3PS3A 1R6LA 5K36A 4IZJB 4GKKI 4FW9A 2O3ZA 4BA1B 1VI7A 4B3SI 1Z5CA 2Z5BB 4OZEA 2HHHE 1Z0TA 2PO0A 3HKMA 4DV4E 4LF6I 3GONA 1N33I 3ZKDA 4JYAI 2Q2EB 3UHMA 2BR2B 4DV3I 1UDOA 3WU4A 2UUAI 2O1UA 4KHPI 4PRVA 4XTJA 3ZZUA 5JEAB 2UU9E 4HACA 5IWAI 2UXBI 3DD6A 1N0UA 2BA0D 4DV7E 5A2QQ 4X66I 2VESA 4IZJD 4JI4E 4B3RE 2GS8A 4ED4A 1XNQI 4K0KI 2V2QA 4JI0E 5K36F 1HNZI 4OO1E 2V34A 2ZM6E 5IT9C 3M85G 2UXCI 4JI2I 4FW6A 2UXDE 4B3TE 5LMNI 2IERA 4IFDA 3LPSA 5FLXC 1U2RA 1N34I 1OYSA 5DRQA 3Q6NA 1Z0GA 1NHJA 1IBKE 4LF7E 3CWVA 4JI3E 2ZITA 4FW4A 4DV1I 3B78A 4DR5E 2NN6A 4DR6E 2J65A 1KIJA 4UT4A 1E3PA 3L7ZB 3QT6A 1H7SA 4IZKB 2NPFA 4DR1I 1I94I 2PO1A 2CG9A 4JI1I 2Z5EA 1FJGI 4LCHA 2V8PA 2R3VA 4FWDA 3H4LA 3PYFA 4OX9E 3QT5A 5JEAE 1MX0A 4IFDF 4X64E 4WUCA 4JI5I 1N36I 3H1CA 4FW5A 4MQYA 2V2VA 1XHKA 3JAMC 4LFCE 1IBLE 4JI6I 4DR4I 4LFBE 3M85D 4OKGA 2A2CA 4RPFA 3ZKBA 4DR7E 1Z0EA 1ZXNA 3GLLA 1R6MA 4N3OA 2C37A 2E1RA 2JEBA 1XXEA 4DV0I 1NHIA 2NN6F 4HYMA 4MYUA 4FWGA 2BA0G 1Z0WA 2VQFI 4DR2E 3P3EA 2PNLA 3J7AG 1NHHA 2VF3A 3OTOE 4LF8I 4MU4A 2BA1G 4JI7E 1WUUA 4QNKA 2WP8A 4AIMA 2VQEI 2UUBE 1FI4A 4LF4E 5IT9Q 3HULA 2F1DA 1HNWI 5FWKA 4NXMI 4URLA 1EI1A 4GQUA 3Q6MA 2XEXA 5C0XA 4LF9E 4JG4A 5LMUE 4GKKE 2GO3A 4DUYI 4NBQA 4B3SE 4GKJI 3ZZTA 4DPYA 4UTGA 4I3HA 1N32E 1N33E 3J7AM 1RREA 4OO1F 4JYAE 2E5LI 5K36B 5K36C 4DV3E 1Z0VA 4WUDA 2UUAE 3P06A 1UEKA 4LCGA 4KHPE 2CZ9A 1RR9A 5IWAE 3T1YI 2UXBE 2PO0B 1KTVA 4WUBA 4X66E 4DV4I
chains in the Genus database with same CATH topology
4DUZE 1DARA 4HXZA 4DV2I 1Y4UA 1ZM2A 4LF5I 1KVKA 4HACB 3QT7A 2X36A 3K17A 3JAMQ 2UU9I 1HNZE 4DV6E 1XMOI 1FKAE 2OI2A 4P52A 1PIEA 3QT8A 2DEJA 5LMNE 1Z0BA 5GMDA 1KKHA 3J81Q 4FWHA 1J5EI 1PKPA 3PYDA 1FNMA 4DV1E 4B3TI 4M1KA 3T1HE 4LFAI 1HR0E 4X65I 1IBMI 4YY3I 1IBKI 3K1JA 1HNXI 1I94E 4DR1E 4AQYI 4P7AA 2HKEA 4JI1E 1MU5A 4JV5E 1FJGE 4NXNE 1EA6A 4DR5I 2IOPA 1N36E 4JI6E 4DR4E 3K85A 4YHHI 1XMQI 1HK7A 4JI8I 1NZ0A 4DR3I 1H74A 1B62A 4EMDA 4X64I 2DEIA 1XNRI 2UUCE 4LFBI 4X62I 2GQ0A 2J7KA 3PYGA 2VQEE 2HKJA 4DV5I 2F4VI 3WU6A 1HNWE 1OJ4A 4NXME 1FWKA 3M6AA 1USVA 1N0VC 2Z5CA 3WU3A 3ZZ0A 4B3ME 5FLXQ 2LJPA 4DXLA 4IZJA 2UUBI 5BR8I 1ZXMA 2ZBKB 4LF6E 2Z5BA 1A6FA 1S4EA 3ZM7A 2E5LE 1D6TA 2AJ4A 5L3JA 5LMUI 2HFSA 2CGEA 2HK2A 1H73A 2HFUA 3B82A 3T1YE 2HHHI 1ZM9A 1N32I 4DV2E 1XNQE 4DPUA 4LF5E 4K0KE 3J80C 3PYEA 3LTOA 4HY1A 4DV7I 1XMOE 2O1TA 2UXCE 4JI2E 4USMA 4JI4I 4B3RI 4DUZI 3D4JA 4DU7A 4JI0I 1N34E 4DPWA 1PVGA 2O1WA 3F0NA 2ZM6I 3B8HA 1Z5BA 4DV6I 1J5EE 1H7UA 4FN5A 4DPTA 3WU5A 1MG7A 4Z7CA 2UXDI 2V2ZA 2BM1A 1Z59A 4LFAE 1ZM3A 2BV3A 4X65E 1Y6ZA 4LF7I 1ELOA 1FWLA 1H72C 1IBME 4YY3E 1B63A 1HNXE 4IZKA 4AQYE 2A2DA 2IOQA 4JI3I 4USKA 1Z5AA 2WW4A 4DR6I 2R42A 2O1VA 2X7IA 3T1HI 5LL6R 1HR0I 4JI5E 1Y4SA 1USUA 5GMEA 1ZM4A 5A2QC 4YHHE 1S16A 1XMQE 4JV5I 3V2UC 4NXNI 4JI8E 4DR3E 3PRYA 4OX9I 4DV0E 1Z0CA 1QZRA 4LFCI 4R1FA 2BM0A 1IBLI 2VQFE 1XNRE 3HJCA 4DR7I 4LF8E 1VISA 4X62E 3J80Q 4DR2I 4DV5E 3Q1QA 2UUCI 2F4VE 4KQVA 3J81C 1BKNA 3OTOI 4JI7I 2EFGA 4Z7YA 4DPXA 4LF4I 4PU9A 4MYTA 2PNMA 4PRXA 4DUYE 5BR8E 4GKJE 1K47A 2Z5CB 4LF9I 3V5RA 4ZVIA 2HK3A 4DU8A 3LNUA 4B3MI 4IZJB 4GKKI 4FW9A 4B3SI 1Z5CA 2Z5BB 2HHHE 1Z0TA 4LF6I 4DV4E 1N33I 3GONA 3ZKDA 4JYAI 2Q2EB 4DV3I 3WU4A 2UUAI 2O1UA 4KHPI 4PRVA 4XTJA 3ZZUA 2UU9E 4HACA 5IWAI 2UXBI 1N0UA 4DV7E 5A2QQ 4X66I 4IZJD 4JI4E 4B3RE 2GS8A 4ED4A 1XNQI 4K0KI 2V2QA 4JI0E 1HNZI 2V34A 2ZM6E 5IT9C 2UXCI 4JI2I 2UXDE 4B3TE 5LMNI 3LPSA 5FLXC 1U2RA 1N34I 3Q6NA 1Z0GA 1NHJA 1IBKE 4LF7E 3CWVA 4JI3E 2ZITA 4DV1I 3B78A 4DR5E 4DR6E 1KIJA 4UT4A 3QT6A 1H7SA 4IZKB 2NPFA 4DR1I 1I94I 2CG9A 4JI1I 2Z5EA 1FJGI 2V8PA 2R3VA 4FWDA 3H4LA 3PYFA 4OX9E 3QT5A 1MX0A 4X64E 4WUCA 4JI5I 1N36I 3JAMC 2V2VA 1XHKA 4LFCE 1IBLE 4JI6I 4DR4I 4LFBE 2A2CA 4RPFA 3ZKBA 4DR7E 1Z0EA 1ZXNA 4N3OA 2E1RA 4DV0I 1NHIA 4HYMA 4MYUA 4FWGA 1Z0WA 2VQFI 4DR2E 2PNLA 3J7AG 1NHHA 2VF3A 3OTOE 4LF8I 4JI7E 1WUUA 2VQEI 2UUBE 1FI4A 4LF4E 5IT9Q 3HULA 1HNWI 5FWKA 4NXMI 4URLA 1EI1A 3Q6MA 2XEXA 4LF9E 4JG4A 5LMUE 4GKKE 4DUYI 4B3SE 4GKJI 3ZZTA 4DPYA 4UTGA 4I3HA 1N32E 1N33E 3J7AM 1RREA 4JYAE 2E5LI 4DV3E 1Z0VA 4WUDA 2UUAE 3P06A 1UEKA 4KHPE 2CZ9A 1RR9A 3T1YI 5IWAE 2UXBE 1KTVA 4WUBA 4X66E 4DV4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ E;  1DAR A;  4HXZ A;  4DV2 I;  1ZM2 A;  4LF5 I;  1KVK A;  4HAC B;  3QT7 A;  2X36 A;  3K17 A;  3JAM Q;  2UU9 I;  1HNZ E;  4DV6 E;  1XMO I;  1FKA E;  2OI2 A;  4P52 A;  1PIE A;  3QT8 A;  2DEJ A;  5LMN E;  1Z0B A;  5GMD A;  1KKH A;  3J81 Q;  4FWH A;  1J5E I;  1PKP A;  3PYD A;  1FNM A;  4DV1 E;  4B3T I;  4M1K A;  3T1H E;  4LFA I;  1HR0 E;  4X65 I;  1IBM I;  4YY3 I;  1IBK I;  3K1J A;  1HNX I;  1I94 E;  4DR1 E;  4AQY I;  4P7A A;  2HKE A;  4JI1 E;  1MU5 A;  4JV5 E;  1FJG E;  4NXN E;  1EA6 A;  4DR5 I;  1N36 E;  4JI6 E;  4DR4 E;  4YHH I;  1XMQ I;  4JI8 I;  1NZ0 A;  4DR3 I;  1H74 A;  1B62 A;  4EMD A;  4X64 I;  2DEI A;  1XNR I;  2UUC E;  4LFB I;  4X62 I;  2J7K A;  3PYG A;  2VQE E;  2HKJ A;  4DV5 I;  2F4V I;  3WU6 A;  1HNW E;  1OJ4 A;  4NXM E;  1FWK A;  3M6A A;  1N0V C;  3WU3 A;  3ZZ0 A;  4B3M E;  5FLX Q;  2LJP A;  4DXL A;  2UUB I;  5BR8 I;  1ZXM A;  2ZBK B;  4LF6 E;  1A6F A;  1S4E A;  3ZM7 A;  2E5L E;  1D6T A;  2AJ4 A;  5L3J A;  5LMU I;  2HFS A;  2HK2 A;  1H73 A;  2HFU A;  3B82 A;  3T1Y E;  2HHH I;  1ZM9 A;  1N32 I;  4DV2 E;  1XNQ E;  4DPU A;  4LF5 E;  4K0K E;  3J80 C;  3PYE A;  3LTO A;  4HY1 A;  4DV7 I;  1XMO E;  2UXC E;  4JI2 E;  4USM A;  4JI4 I;  4B3R I;  4DUZ I;  3D4J A;  4DU7 A;  4JI0 I;  1N34 E;  4DPW A;  1PVG A;  3F0N A;  2ZM6 I;  3B8H A;  1Z5B A;  4DV6 I;  1J5E E;  1H7U A;  4FN5 A;  4DPT A;  3WU5 A;  1MG7 A;  4Z7C A;  2UXD I;  2V2Z A;  2BM1 A;  1Z59 A;  4LFA E;  1ZM3 A;  2BV3 A;  4X65 E;  4LF7 I;  1ELO A;  1FWL A;  1H72 C;  1IBM E;  4YY3 E;  1B63 A;  1HNX E;  4AQY E;  2A2D A;  4JI3 I;  4USK A;  1Z5A A;  2WW4 A;  4DR6 I;  2R42 A;  2X7I A;  3T1H I;  5LL6 R;  1HR0 I;  4JI5 E;  5GME A;  1ZM4 A;  5A2Q C;  4YHH E;  1S16 A;  1XMQ E;  4JV5 I;  3V2U C;  4NXN I;  4JI8 E;  4DR3 E;  4OX9 I;  4DV0 E;  1Z0C A;  1QZR A;  4LFC I;  4R1F A;  2BM0 A;  1IBL I;  2VQF E;  1XNR E;  4DR7 I;  4LF8 E;  1VIS A;  4X62 E;  3J80 Q;  4DR2 I;  4DV5 E;  3Q1Q A;  2UUC I;  2F4V E;  4KQV A;  3J81 C;  1BKN A;  3OTO I;  4JI7 I;  2EFG A;  4Z7Y A;  4DPX A;  4LF4 I;  4PU9 A;  4MYT A;  4PRX A;  4DUY E;  5BR8 E;  4GKJ E;  1K47 A;  4LF9 I;  3V5R A;  4ZVI A;  2HK3 A;  4DU8 A;  3LNU A;  4B3M I;  4GKK I;  4FW9 A;  4B3S I;  1Z5C A;  2HHH E;  1Z0T A;  4LF6 I;  4DV4 E;  1N33 I;  3GON A;  3ZKD A;  4JYA I;  2Q2E B;  4DV3 I;  3WU4 A;  2UUA I;  4KHP I;  4PRV A;  4XTJ A;  3ZZU A;  2UU9 E;  4HAC A;  5IWA I;  2UXB I;  1N0U A;  4DV7 E;  5A2Q Q;  4X66 I;  4JI4 E;  4B3R E;  2GS8 A;  4ED4 A;  1XNQ I;  4K0K I;  2V2Q A;  4JI0 E;  1HNZ I;  2V34 A;  2ZM6 E;  5IT9 C;  2UXC I;  4JI2 I;  2UXD E;  4B3T E;  5LMN I;  3LPS A;  5FLX C;  1U2R A;  1N34 I;  1Z0G A;  1IBK E;  1NHJ A;  4LF7 E;  3CWV A;  4JI3 E;  2ZIT A;  4DV1 I;  3B78 A;  4DR5 E;  4DR6 E;  1KIJ A;  4UT4 A;  3QT6 A;  1H7S A;  1I94 I;  2NPF A;  4DR1 I;  4JI1 I;  1FJG I;  2V8P A;  2R3V A;  4FWD A;  3H4L A;  3PYF A;  4OX9 E;  3QT5 A;  1MX0 A;  4X64 E;  4WUC A;  4JI5 I;  1N36 I;  3JAM C;  2V2V A;  1XHK A;  4LFC E;  1IBL E;  4JI6 I;  4DR4 I;  4LFB E;  2A2C A;  4RPF A;  3ZKB A;  4DR7 E;  1Z0E A;  1ZXN A;  2E1R A;  4DV0 I;  1NHI A;  4HYM A;  4MYU A;  4FWG A;  1Z0W A;  2VQF I;  4DR2 E;  3J7A G;  1NHH A;  2VF3 A;  3OTO E;  4LF8 I;  4JI7 E;  1WUU A;  2VQE I;  2UUB E;  1FI4 A;  4LF4 E;  5IT9 Q;  3HUL A;  1HNW I;  4NXM I;  4URL A;  1EI1 A;  2XEX A;  4LF9 E;  4JG4 A;  5LMU E;  4GKK E;  4DUY I;  4B3S E;  4GKJ I;  3ZZT A;  4DPY A;  4UTG A;  4I3H A;  1N32 E;  1N33 E;  3J7A M;  1RRE A;  4JYA E;  2E5L I;  4DV3 E;  1Z0V A;  4WUD A;  2UUA E;  1UEK A;  4KHP E;  2CZ9 A;  1RR9 A;  5IWA E;  3T1Y I;  2UXB E;  1KTV A;  4WUB A;  4X66 E;  4DV4 I; 
#chains in the Genus database with same CATH topology
 4DUZ E;  1DAR A;  4HXZ A;  2JE6 A;  4DV2 I;  1Y4U A;  5C0X F;  1ZM2 A;  4ISA A;  2BA1 D;  3KRN A;  4LF5 I;  1KVK A;  1YHC A;  4HAC B;  3QT7 A;  2X36 A;  3K17 A;  3JAM Q;  2UU9 I;  1HNZ E;  4DV6 E;  1XMO I;  5K36 D;  1FKA E;  2OI2 A;  4P52 A;  1PIE A;  1YH8 A;  3QT8 A;  2PNZ A;  2DEJ A;  5LMN E;  1Z0B A;  3P76 A;  5GMD A;  1KKH A;  3J81 Q;  4FWH A;  1J5E I;  1PKP A;  3PYD A;  5JEA F;  1FNM A;  4MU0 A;  4IFD B;  2C38 A;  4IFD C;  1OYP A;  3PS1 A;  4DV1 E;  4B3T I;  4M1K A;  3T1H E;  4LFA I;  1HR0 E;  4X65 I;  2JT2 A;  3U1K A;  2IES A;  1IBM I;  4YY3 I;  1IBK I;  3K1J A;  1HNX I;  1I94 E;  4DR1 E;  4AQY I;  4P7A A;  2HKE A;  4JI1 E;  4BA2 A;  1MU5 A;  4JV5 E;  1FJG E;  2NN6 B;  4NXN E;  5K36 E;  1EA6 A;  2NN6 C;  4DR5 I;  2IOP A;  5EL9 A;  1N36 E;  2PO1 B;  1Y60 A;  4IFD D;  5DNX A;  4JI6 E;  5DNL A;  2JEA A;  4DR4 E;  2PO2 A;  3K85 A;  4YHH I;  1XMQ I;  1HK7 A;  4JI8 I;  1NZ0 A;  4DR3 I;  1H74 A;  1B62 A;  4EMD A;  4X64 I;  2DEI A;  2NN6 D;  2UUC E;  1XNR I;  4OO1 A;  4LFB I;  1OYR A;  4FW3 A;  4X62 I;  2C37 B;  2JEB B;  4U3B A;  2GQ0 A;  2J7K A;  2CVE A;  3PYG A;  2WNR A;  2VQE E;  2HKJ A;  4DV5 I;  2F4V I;  3WU6 A;  4OO1 C;  1UDS A;  1HNW E;  1OJ4 A;  4NXM E;  1FWK A;  3M6A A;  1USV A;  1N0V C;  2Z5C A;  3PS2 A;  4IFD E;  3WU3 A;  3ZZ0 A;  4B3M E;  5FLX Q;  2WP8 B;  2LJP A;  2C39 A;  4LCF A;  4DXL A;  4IZJ A;  2UUB I;  5BR8 I;  4BA1 A;  1ZXM A;  2ZBK B;  1P42 A;  3U1Y A;  5C0X B;  4LF6 E;  5C0X C;  2Z5B A;  4IS9 A;  1A6F A;  2NN6 E;  3NZK A;  1S4E A;  3ZM7 A;  1RHY A;  2E5L E;  1D6T A;  2BR2 A;  2GO4 A;  2AJ4 A;  3B4T A;  5L3J A;  5LMU I;  4OO1 D;  2AE8 A;  4QNJ A;  4FW7 A;  2HFS A;  4MU1 A;  4U3D A;  2CGE A;  2HK2 A;  1H73 A;  5JEA A;  2HFU A;  3B82 A;  3T1Y E;  2HHH I;  1ZM9 A;  1N32 I;  4MU3 A;  4DV2 E;  1XNQ E;  4DPU A;  4LF5 E;  4K0K E;  5C0X D;  3J80 C;  3PYE A;  5JEA C;  3LTO A;  4HY1 A;  4DV7 I;  1XMO E;  2O1T A;  2UXC E;  4JI2 E;  5DRP A;  4LOM A;  2JE6 B;  4USM A;  4JI4 I;  4B3R I;  4DUZ I;  3D4J A;  4DU7 A;  4JI0 I;  1N34 E;  4DPW A;  1PVG A;  2O1W A;  3F0N A;  2ZM6 I;  3B8H A;  1Z5B A;  4DV6 I;  1J5E E;  1H7U A;  4FN5 A;  4DPT A;  3GCM A;  3WU5 A;  1MG7 A;  4Z7C A;  2PNZ B;  2UXD I;  2V2Z A;  2BM1 A;  5JEA D;  4J3D A;  3M7N G;  1Z59 A;  4LFA E;  1ZM3 A;  2BV3 A;  4X65 E;  1Y6Z A;  3GME A;  4LF7 I;  1ELO A;  1FWL A;  1H72 C;  1IBM E;  4YY3 E;  1B63 A;  3L7Z A;  5C0X E;  1HNX E;  4IZK A;  4AQY E;  2A2D A;  2IOQ A;  2C38 B;  4JI3 I;  4USK A;  1Z5A A;  2WW4 A;  4DR6 I;  2R42 A;  1UDN A;  2O1V A;  2X7I A;  3T1H I;  5LL6 R;  1HR0 I;  4JI5 E;  1Y4S A;  1USU A;  4MDT A;  5GME A;  1ZM4 A;  3CDI A;  4BA2 B;  5A2Q C;  3CDJ A;  4YHH E;  1S16 A;  5EKW A;  1XMQ E;  4JV5 I;  3V2U C;  4NXN I;  3P3C A;  4JI8 E;  4DR3 E;  5DRO A;  4AM3 A;  3PRY A;  4OX9 I;  4LPF A;  4DV0 E;  1Z0C A;  1QZR A;  1E3H A;  4LFC I;  4R1F A;  2BM0 A;  1IBL I;  4AID A;  2VQF E;  2JEA B;  2PO2 B;  1XNR E;  3HJC A;  4DR7 I;  4LF8 E;  1VIS A;  4X62 E;  3M7N D;  3J80 Q;  4OO1 B;  4DR2 I;  4DV5 E;  3Q1Q A;  3P3G A;  2UUC I;  4KQV A;  3J81 C;  1BKN A;  2F4V E;  5ELW A;  3OTO I;  4JI7 I;  2EFG A;  5DRR A;  4Z7Y A;  4DPX A;  2WNR B;  4LF4 I;  4PU9 A;  4MYT A;  2PNM A;  4PRX A;  4DUY E;  5BR8 E;  4GKJ E;  1K47 A;  2Z5C B;  1Y5Y A;  4LF9 I;  3V5R A;  1UDQ A;  4ZVI A;  2HK3 A;  4DU8 A;  3LNU A;  4B3M I;  2C39 B;  3PS3 A;  1R6L A;  5K36 A;  4IZJ B;  4GKK I;  4FW9 A;  2O3Z A;  4BA1 B;  1VI7 A;  4B3S I;  1Z5C A;  2Z5B B;  4OZE A;  2HHH E;  1Z0T A;  2PO0 A;  3HKM A;  4DV4 E;  4LF6 I;  3GON A;  1N33 I;  3ZKD A;  4JYA I;  2Q2E B;  3UHM A;  2BR2 B;  4DV3 I;  1UDO A;  3WU4 A;  2UUA I;  2O1U A;  4KHP I;  4PRV A;  4XTJ A;  3ZZU A;  5JEA B;  2UU9 E;  4HAC A;  5IWA I;  2UXB I;  3DD6 A;  1N0U A;  2BA0 D;  4DV7 E;  5A2Q Q;  4X66 I;  2VES A;  4IZJ D;  4JI4 E;  4B3R E;  2GS8 A;  4ED4 A;  1XNQ I;  4K0K I;  2V2Q A;  4JI0 E;  5K36 F;  1HNZ I;  4OO1 E;  2V34 A;  2ZM6 E;  5IT9 C;  3M85 G;  2UXC I;  4JI2 I;  4FW6 A;  2UXD E;  4B3T E;  5LMN I;  2IER A;  4IFD A;  3LPS A;  5FLX C;  1U2R A;  1N34 I;  1OYS A;  5DRQ A;  3Q6N A;  1Z0G A;  1NHJ A;  1IBK E;  4LF7 E;  3CWV A;  4JI3 E;  2ZIT A;  4FW4 A;  4DV1 I;  3B78 A;  4DR5 E;  2NN6 A;  4DR6 E;  2J65 A;  1KIJ A;  4UT4 A;  1E3P A;  3L7Z B;  3QT6 A;  1H7S A;  4IZK B;  2NPF A;  4DR1 I;  1I94 I;  2PO1 A;  2CG9 A;  4JI1 I;  2Z5E A;  1FJG I;  4LCH A;  2V8P A;  2R3V A;  4FWD A;  3H4L A;  3PYF A;  4OX9 E;  3QT5 A;  5JEA E;  1MX0 A;  4IFD F;  4X64 E;  4WUC A;  4JI5 I;  1N36 I;  3H1C A;  4FW5 A;  4MQY A;  2V2V A;  1XHK A;  3JAM C;  4LFC E;  1IBL E;  4JI6 I;  4DR4 I;  4LFB E;  3M85 D;  4OKG A;  2A2C A;  4RPF A;  3ZKB A;  4DR7 E;  1Z0E A;  1ZXN A;  3GLL A;  1R6M A;  4N3O A;  2C37 A;  2E1R A;  2JEB A;  1XXE A;  4DV0 I;  1NHI A;  2NN6 F;  4HYM A;  4MYU A;  4FWG A;  2BA0 G;  1Z0W A;  2VQF I;  4DR2 E;  3P3E A;  2PNL A;  3J7A G;  1NHH A;  2VF3 A;  3OTO E;  4LF8 I;  4MU4 A;  2BA1 G;  4JI7 E;  1WUU A;  4QNK A;  2WP8 A;  4AIM A;  2VQE I;  2UUB E;  1FI4 A;  4LF4 E;  5IT9 Q;  3HUL A;  2F1D A;  1HNW I;  5FWK A;  4NXM I;  4URL A;  1EI1 A;  4GQU A;  3Q6M A;  2XEX A;  5C0X A;  4LF9 E;  4JG4 A;  5LMU E;  4GKK E;  2GO3 A;  4DUY I;  4NBQ A;  4B3S E;  4GKJ I;  3ZZT A;  4DPY A;  4UTG A;  4I3H A;  1N32 E;  1N33 E;  3J7A M;  1RRE A;  4OO1 F;  4JYA E;  2E5L I;  5K36 B;  5K36 C;  4DV3 E;  1Z0V A;  4WUD A;  2UUA E;  3P06 A;  1UEK A;  4LCG A;  4KHP E;  2CZ9 A;  1RR9 A;  5IWA E;  3T1Y I;  2UXB E;  2PO0 B;  1KTV A;  4WUB A;  4X66 E;  4DV4 I; 
#chains in the Genus database with same CATH homology
 4DUZ E;  1DAR A;  4HXZ A;  4DV2 I;  1Y4U A;  1ZM2 A;  4LF5 I;  1KVK A;  4HAC B;  3QT7 A;  2X36 A;  3K17 A;  3JAM Q;  2UU9 I;  1HNZ E;  4DV6 E;  1XMO I;  1FKA E;  2OI2 A;  4P52 A;  1PIE A;  3QT8 A;  2DEJ A;  5LMN E;  1Z0B A;  5GMD A;  1KKH A;  3J81 Q;  4FWH A;  1J5E I;  1PKP A;  3PYD A;  1FNM A;  4DV1 E;  4B3T I;  4M1K A;  3T1H E;  4LFA I;  1HR0 E;  4X65 I;  1IBM I;  4YY3 I;  1IBK I;  3K1J A;  1HNX I;  1I94 E;  4DR1 E;  4AQY I;  4P7A A;  2HKE A;  4JI1 E;  1MU5 A;  4JV5 E;  1FJG E;  4NXN E;  1EA6 A;  4DR5 I;  2IOP A;  1N36 E;  4JI6 E;  4DR4 E;  3K85 A;  4YHH I;  1XMQ I;  1HK7 A;  4JI8 I;  1NZ0 A;  4DR3 I;  1H74 A;  1B62 A;  4EMD A;  4X64 I;  2DEI A;  1XNR I;  2UUC E;  4LFB I;  4X62 I;  2GQ0 A;  2J7K A;  3PYG A;  2VQE E;  2HKJ A;  4DV5 I;  2F4V I;  3WU6 A;  1HNW E;  1OJ4 A;  4NXM E;  1FWK A;  3M6A A;  1USV A;  1N0V C;  2Z5C A;  3WU3 A;  3ZZ0 A;  4B3M E;  5FLX Q;  2LJP A;  4DXL A;  4IZJ A;  2UUB I;  5BR8 I;  1ZXM A;  2ZBK B;  4LF6 E;  2Z5B A;  1A6F A;  1S4E A;  3ZM7 A;  2E5L E;  1D6T A;  2AJ4 A;  5L3J A;  5LMU I;  2HFS A;  2CGE A;  2HK2 A;  1H73 A;  2HFU A;  3B82 A;  3T1Y E;  2HHH I;  1ZM9 A;  1N32 I;  4DV2 E;  1XNQ E;  4DPU A;  4LF5 E;  4K0K E;  3J80 C;  3PYE A;  3LTO A;  4HY1 A;  4DV7 I;  1XMO E;  2O1T A;  2UXC E;  4JI2 E;  4USM A;  4JI4 I;  4B3R I;  4DUZ I;  3D4J A;  4DU7 A;  4JI0 I;  1N34 E;  4DPW A;  1PVG A;  2O1W A;  3F0N A;  2ZM6 I;  3B8H A;  1Z5B A;  4DV6 I;  1J5E E;  1H7U A;  4FN5 A;  4DPT A;  3WU5 A;  1MG7 A;  4Z7C A;  2UXD I;  2V2Z A;  2BM1 A;  1Z59 A;  4LFA E;  1ZM3 A;  2BV3 A;  4X65 E;  1Y6Z A;  4LF7 I;  1ELO A;  1FWL A;  1H72 C;  1IBM E;  4YY3 E;  1B63 A;  1HNX E;  4IZK A;  4AQY E;  2A2D A;  2IOQ A;  4JI3 I;  4USK A;  1Z5A A;  2WW4 A;  4DR6 I;  2R42 A;  2O1V A;  2X7I A;  3T1H I;  5LL6 R;  1HR0 I;  4JI5 E;  1Y4S A;  1USU A;  5GME A;  1ZM4 A;  5A2Q C;  4YHH E;  1S16 A;  1XMQ E;  4JV5 I;  3V2U C;  4NXN I;  4JI8 E;  4DR3 E;  3PRY A;  4OX9 I;  4DV0 E;  1Z0C A;  1QZR A;  4LFC I;  4R1F A;  2BM0 A;  1IBL I;  2VQF E;  1XNR E;  3HJC A;  4DR7 I;  4LF8 E;  1VIS A;  4X62 E;  3J80 Q;  4DR2 I;  4DV5 E;  3Q1Q A;  2UUC I;  2F4V E;  4KQV A;  3J81 C;  1BKN A;  3OTO I;  4JI7 I;  2EFG A;  4Z7Y A;  4DPX A;  4LF4 I;  4PU9 A;  4MYT A;  2PNM A;  4PRX A;  4DUY E;  5BR8 E;  4GKJ E;  1K47 A;  2Z5C B;  4LF9 I;  3V5R A;  4ZVI A;  2HK3 A;  4DU8 A;  3LNU A;  4B3M I;  4IZJ B;  4GKK I;  4FW9 A;  4B3S I;  1Z5C A;  2Z5B B;  2HHH E;  1Z0T A;  4LF6 I;  4DV4 E;  1N33 I;  3GON A;  3ZKD A;  4JYA I;  2Q2E B;  4DV3 I;  3WU4 A;  2UUA I;  2O1U A;  4KHP I;  4PRV A;  4XTJ A;  3ZZU A;  2UU9 E;  4HAC A;  5IWA I;  2UXB I;  1N0U A;  4DV7 E;  5A2Q Q;  4X66 I;  4IZJ D;  4JI4 E;  4B3R E;  2GS8 A;  4ED4 A;  1XNQ I;  4K0K I;  2V2Q A;  4JI0 E;  1HNZ I;  2V34 A;  2ZM6 E;  5IT9 C;  2UXC I;  4JI2 I;  2UXD E;  4B3T E;  5LMN I;  3LPS A;  5FLX C;  1U2R A;  1N34 I;  3Q6N A;  1Z0G A;  1NHJ A;  1IBK E;  4LF7 E;  3CWV A;  4JI3 E;  2ZIT A;  4DV1 I;  3B78 A;  4DR5 E;  4DR6 E;  1KIJ A;  4UT4 A;  3QT6 A;  1H7S A;  4IZK B;  2NPF A;  4DR1 I;  1I94 I;  2CG9 A;  4JI1 I;  2Z5E A;  1FJG I;  2V8P A;  2R3V A;  4FWD A;  3H4L A;  3PYF A;  4OX9 E;  3QT5 A;  1MX0 A;  4X64 E;  4WUC A;  4JI5 I;  1N36 I;  3JAM C;  2V2V A;  1XHK A;  4LFC E;  1IBL E;  4JI6 I;  4DR4 I;  4LFB E;  2A2C A;  4RPF A;  3ZKB A;  4DR7 E;  1Z0E A;  1ZXN A;  4N3O A;  2E1R A;  4DV0 I;  1NHI A;  4HYM A;  4MYU A;  4FWG A;  1Z0W A;  2VQF I;  4DR2 E;  2PNL A;  3J7A G;  1NHH A;  2VF3 A;  3OTO E;  4LF8 I;  4JI7 E;  1WUU A;  2VQE I;  2UUB E;  1FI4 A;  4LF4 E;  5IT9 Q;  3HUL A;  1HNW I;  5FWK A;  4NXM I;  4URL A;  1EI1 A;  3Q6M A;  2XEX A;  4LF9 E;  4JG4 A;  5LMU E;  4GKK E;  4DUY I;  4B3S E;  4GKJ I;  3ZZT A;  4DPY A;  4UTG A;  4I3H A;  1N32 E;  1N33 E;  3J7A M;  1RRE A;  4JYA E;  2E5L I;  4DV3 E;  1Z0V A;  4WUD A;  2UUA E;  3P06 A;  1UEK A;  4KHP E;  2CZ9 A;  1RR9 A;  3T1Y I;  5IWA E;  2UXB E;  1KTV A;  4WUB A;  4X66 E;  4DV4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...