4DV2I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2I00
2HK3A 3WU5A 4JI6E 2HHHI 4DR6E 1XMQI 4DR7I 1HNWI 1IBLE 1FJGE 4JI3E 5IWAI 2ZM6E 2UXBI 1ELOA 4DR2E 4USKA 4KQVA 3ZKDA 4DV4E 4DPUA 2VQFE 2UU9I 1FWKA 1N36I 1ZM4A 3F0NA 2V2ZA 2V2VA 3T1HI 1OJ4A 4Z7CA 3B82A 4KHPI 2V8PA 4YHHE 3OTOE 2J7KA 3ZM7A 4LF7I 3JAMC 1ZXMA 4RPFA 3QT7A 3ZZTA 5BR8I 5LMUI 4DPWA 1XMOE 2UUBI 2OI2A 1B62A 2UUAI 4P52A 1RREA 4B3RI 4JI2E 1XNQI 1NHIA 2VQEE 1Z0GA 1S16A 4WUBA 3ZKBA 4JYAI 1H72C 4X65E 4NXNI 1I94E 4K0KI 4DV5E 1Z0BA 4YY3I 1S4EA 4DUYE 4DR3E 4EMDA 4LFAI 1Z0EA 1Z0VA 4HYMA 1DARA 4DR5I 1FKAE 4M1KA 5L3JA 4AQYI 5LL6R 4JI5E 3J80Q 4X64E 2UXCI 4DV3E 1B63A 1IBKE 1Z59A 3WU4A 4DR1E 4B3TE 3PYFA 3J81Q 4JI8I 4LFCI 4DR4E 4MYTA 1HNXI 1N33E 2XEXA 4DV0I 2R3VA 2F4VI 4X66I 4GKJE 1FWLA 3QT8A 4JI7E 1N32I 3Q1QA 1XHKA 1N34E 4X62E 4DV1E 4LF5E 2HFUA 4JI1I 2UXDE 4DR6I 4DV6I 2V34A 1H73A 2A2CA 2E5LI 4DPXA 1Z5AA 1Z0CA 5LMNE 2ZM6I 4LF6E 3H4LA 1HNZI 2HHHE 1XMQE 4DR7E 4USMA 3ZZUA 3J80C 1HNWE 2BM0A 1KKHA 2R42A 2VQFI 1KVKA 4NXME 2VF3A 4URLA 5IWAE 4JI0E 4DUZI 2Q2EB 4HACA 3ZZ0A 1MG7A 1N36E 1NHJA 1EI1A 5IT9Q 2HFSA 4FWDA 4KHPE 3QT6A 2E1RA 1PIEA 1MU5A 2NPFA 2GS8A 4LFBI 1N0UA 3B8HA 1J5EI 4LF7E 2AJ4A 1RR9A 5BR8E 2UUCI 5LMUE 1UEKA 4LF9E 2UUBE 2UUAE 1ZM9A 4HACB 2VQEI 1IBMI 5FLXQ 4B3RE 4GKKI 4DUYI 4FWHA 4JYAE 4B3SI 3K17A 1KTVA 4PRVA 4JI4I 4OX9I 1ZXNA 4K0KE 4JV5I 1K47A 1HR0I 4YY3E 4JI5I 4LFAE 4X64I 4LF8I 1Z5CA 3PYDA 3PYGA 4DR1I 1VISA 4DV2I 4LF4I 1ZM2A 4AQYE 3J7AM 3GONA 1XNRI 2UXCE 4DV7I 3HULA 3PYEA 2BV3A 1PKPA 1EA6A 5A2QQ 4JI8E 4B3MI 1HNXE 4FW9A 1MX0A 4JI6I 4WUDA 2BM1A 4Z7YA 1IBLI 2F4VE 4X66E 1FJGI 4JI3I 1FI4A 2HKJA 3JAMQ 3T1YE 4HXZA 1H7SA 3V5RA 4DR2I 4JI1E 4DV4I 4DV6E 4FWGA 2E5LE 3J81C 4R1FA 2UXBE 4NXMI 2X36A 1NZ0A 1HNZE 4JI0I 2UU9E 1Z0TA 4JG4A 3V2UC 1NHHA 4DU7A 4YHHI 3OTOI 1H74A 3WU6A 2DEJA 2HK2A 3T1HE 4WUCA 1N0VC 5A2QC 4DUZE 1Z0WA 1QZRA 4UTGA 3M6AA 1XMOI 4DPYA 2CZ9A 4DXLA 1ZM3A 4ZVIA 1Z5BA 4MYUA 2A2DA 3D4JA 4DU8A 4LFBE 1J5EE 4LF9I 4JI2I 1FNMA 3B78A 4PU9A 1D6TA 4I3HA 1BKNA 4X65I 2UUCE 1I94I 4DV5I 2HKEA 4DR3I 3J7AG 1XNQE 3QT5A 2ZBKB 4ED4A 5IT9C 3LTOA 4NXNE 3WU3A 1A6FA 2WW4A 1IBME 4GKKE 3K1JA 4DPTA 3LPSA 4DV3I 4XTJA 1IBKI 4B3TI 4DR5E 4HY1A 4B3SE 2ZITA 4JI4E 4OX9E 3LNUA 2X7IA 1HR0E 2EFGA 4JV5E 2DEIA 4DR4I 1N33I 4LF8E 4FN5A 4DV2E 4GKJI 3CWVA 4LF4E 1H7UA 4LFCE 2LJPA 4JI7I 5FLXC 1WUUA 1N34I 5GMEA 1XNRE 4DV0E 4X62I 4DV1I 4DV7E 5GMDA 4LF5I 1U2RA 2UXDI 2V2QA 4UT4A 1KIJA 4B3ME 4P7AA 1N32E 3T1YI 5LMNI 4PRXA 1PVGA 4LF6I
chains in the Genus database with same CATH superfamily
2HK3A 3WU5A 4JI6E 2NN6C 2HHHI 2WP8A 4DR6E 1XMQI 4DR7I 2PNZB 1HNWI 1IBLE 5K36D 1FJGE 4JI3E 1R6MA 4OO1A 5IWAI 2ZM6E 3P06A 2UXBI 1ELOA 4DR2E 4USKA 4KQVA 3ZKDA 4DV4E 4DPUA 2VQFE 2WNRA 2C37B 2PO2B 2UU9I 1FWKA 1N36I 1ZM4A 3F0NA 2JEBB 2V2ZA 2BA0G 5C0XC 2V2VA 2C39B 3T1HI 2PNLA 4MU4A 1OJ4A 2IERA 2Z5CB 4Z7CA 3B82A 4KHPI 2V8PA 4ISAA 4LOMA 4YHHE 3OTOE 2J7KA 1E3PA 4OKGA 3ZM7A 4LF7I 3JAMC 5K36E 2WP8B 1ZXMA 4RPFA 3QT7A 3ZZTA 2O1TA 5BR8I 1XXEA 5LMUI 2NN6D 1VI7A 4DPWA 2PO0A 1Y4UA 4OO1B 1Y5YA 1XMOE 2UUBI 2OI2A 4OO1F 1B62A 3Q6NA 2UUAI 2WNRB 1RHYA 2JE6A 4OO1C 3U1YA 4P52A 1RREA 4B3RI 4JI2E 4IFDD 1YH8A 4IZJA 1XNQI 1NHIA 2VQEE 5C0XD 1Z0GA 1S16A 4WUBA 3ZKBA 4JYAI 1H72C 1E3HA 4X65E 4NXNI 4NBQA 1I94E 4K0KI 4DV5E 1Z0BA 4FW4A 4YY3I 1S4EA 4DUYE 4DR3E 2NN6E 3P3EA 4EMDA 4LFAI 1Z0EA 1Z0VA 2JT2A 4HYMA 1DARA 4DR5I 2PO0B 1FKAE 4M1KA 5L3JA 4AQYI 5LL6R 4JI5E 3J80Q 4X64E 2UXCI 4DV3E 1B63A 2O1WA 1Z59A 3WU4A 2O1UA 1IBKE 4DR1E 2JE6B 4FW7A 4B3TE 5ELWA 1HK7A 3PYFA 3J81Q 4QNJA 4FW5A 3U1KA 4QNKA 3HJCA 1OYPA 4JI8I 2PO1A 2JEBA 4LFCI 4DR4E 4IZJB 4MYTA 1HNXI 4MU1A 1N33E 4LCFA 2XEXA 4DV0I 2Z5CA 2R3VA 2F4VI 4X66I 4GKJE 1FWLA 2IOPA 3QT8A 4JI7E 1N32I 1OYSA 3Q1QA 1XHKA 1N34E 4X62E 4DV1E 4LF5E 2HFUA 2BA1G 4JI1I 1Y4SA 2UXDE 4DR6I 4DV6I 2V34A 1H73A 5EL9A 2A2CA 2E5LI 4DPXA 1Z5AA 1Z0CA 3M7NG 5LMNE 1UDOA 2BR2A 2ZM6I 4LF6E 3H4LA 5DROA 1HNZI 4OO1E 2HHHE 1XMQE 4DR7E 4USMA 3ZZUA 3J80C 1HNWE 1YHCA 2BM0A 1P42A 1KKHA 2R42A 2VQFI 2PO1B 3NZKA 1KVKA 3CDJA 4NXME 2VF3A 4URLA 5IWAE 4JI0E 4DUZI 2Q2EB 4HACA 3PS3A 3ZZ0A 1MG7A 1N36E 1NHJA 4IZJD 1EI1A 5IT9Q 2HFSA 4FWDA 4KHPE 3QT6A 2E1RA 1PIEA 1MU5A 2NPFA 5DNXA 2GS8A 4LFBI 2BR2B 1N0UA 3B8HA 1J5EI 2C38A 4LF7E 3GMEA 3PS1A 2AJ4A 5DRPA 5FWKA 4FW3A 1RR9A 3P76A 5BR8E 2UUCI 3M85D 5LMUE 5JEAB 1UEKA 3Q6MA 4LF9E 5JEAF 2UUBE 2UUAE 1ZM9A 4HACB 2VQEI 2O1VA 4BA2A 1IBMI 5FLXQ 4B3RE 4GKKI 4BA1A 1R6LA 4DUYI 4FWHA 4JYAE 4B3SI 3K17A 3PRYA 1KTVA 4PRVA 4JI4I 2C38B 1ZXNA 4OX9I 4JV5I 1K47A 1HR0I 4K0KE 4YY3E 2BA0D 2GO3A 4JI5I 4LFAE 5DRRA 4X64I 4LF8I 1Z5CA 3PYDA 3GLLA 3PYGA 4DR1I 1VISA 4DV2I 4N3OA 4OO1D 4LF4I 1ZM2A 3DD6A 4AQYE 3J7AM 3GONA 3B4TA 1XNRI 2UXCE 2PNMA 4DV7I 4U3BA 4IFDA 3HULA 4BA2B 3PYEA 2BV3A 4LCHA 4LCGA 1PKPA 1EA6A 5A2QQ 4JI8E 4B3MI 4BA1B 3H1CA 1HNXE 4FW9A 1MX0A 4JI6I 4WUDA 2BM1A 2O3ZA 4Z7YA 5DRQA 1IBLI 2F4VE 4X66E 1FJGI 4JI3I 1FI4A 2HKJA 3JAMQ 3T1YE 4HXZA 2IESA 1H7SA 3V5RA 4DR2I 3UHMA 4JI1E 4DV4I 4DV6E 5JEAA 4FW6A 4FWGA 2E5LE 3J81C 4R1FA 2UXBE 3HKMA 4LPFA 1UDNA 4NXMI 2VESA 2X36A 1NZ0A 5JEAE 4IFDB 1HNZE 4JI0I 4MU0A 2UU9E 1Z0TA 5C0XB 4IFDF 4JG4A 3V2UC 1NHHA 4DU7A 4YHHI 4IZKA 5C0XF 3OTOI 1H74A 4MU3A 3WU6A 2DEJA 4IFDC 2HK2A 3T1HE 4WUCA 1N0VC 2J65A 4GQUA 5A2QC 4DUZE 3L7ZA 1Z0WA 1QZRA 1Y6ZA 4UTGA 5K36A 1UDSA 3M6AA 1XMOI 3P3GA 4DPYA 2CZ9A 1UDQA 3K85A 2JEAB 4DXLA 2GQ0A 2Z5EA 1ZM3A 4ZVIA 1Z5BA 4AIMA 4MYUA 2A2DA 2AE8A 2IOQA 3D4JA 4DU8A 4LFBE 1J5EE 1OYRA 4LF9I 4JI2I 1FNMA 3B78A 4PU9A 1D6TA 5JEAC 4I3HA 2BA1D 1BKNA 4X65I 2UUCE 1I94I 1USUA 3CDIA 4U3DA 4IZKB 2Z5BA 2CGEA 3M7ND 4DV5I 2HKEA 2CVEA 4AM3A 2F1DA 4DR3I 1XNQE 3J7AG 2CG9A 4MQYA 3L7ZB 3QT5A 2ZBKB 4ED4A 5IT9C 3LTOA 4NXNE 3WU3A 5K36B 3KRNA 1Y60A 1A6FA 2NN6A 2WW4A 1IBME 5K36F 4GKKE 3K1JA 4DPTA 3LPSA 4DV3I 4XTJA 1IBKI 5K36C 4B3TI 2GO4A 4DR5E 4HY1A 4B3SE 2PNZA 4IS9A 2ZITA 4OZEA 4JI4E 4J3DA 4OX9E 3LNUA 2X7IA 3P3CA 2EFGA 1HR0E 4JV5E 2DEIA 4DR4I 1N33I 4AIDA 3GCMA 4LF8E 5C0XA 5JEAD 4FN5A 2Z5BB 4MDTA 4DV2E 4GKJI 3CWVA 2C37A 2PO2A 4IFDE 4LF4E 1H7UA 4LFCE 2LJPA 4JI7I 5C0XE 5FLXC 1WUUA 1N34I 5GMEA 1XNRE 4DV0E 4X62I 4DV1I 4DV7E 5GMDA 4LF5I 1U2RA 2C39A 1USVA 2UXDI 2V2QA 2NN6B 5EKWA 3M85G 4UT4A 1KIJA 3PS2A 2NN6F 4B3ME 4P7AA 1N32E 5DNLA 5LMNI 4PRXA 3T1YI 2JEAA 1PVGA 4LF6I
chains in the Genus database with same CATH topology
2HK3A 3WU5A 4JI6E 2HHHI 4DR6E 1XMQI 4DR7I 1HNWI 1IBLE 1FJGE 4JI3E 5IWAI 2ZM6E 3P06A 2UXBI 1ELOA 4DR2E 4USKA 4KQVA 3ZKDA 4DV4E 4DPUA 2VQFE 2UU9I 1FWKA 1N36I 1ZM4A 3F0NA 2V2ZA 2V2VA 3T1HI 2PNLA 1OJ4A 2Z5CB 4Z7CA 3B82A 4KHPI 2V8PA 4YHHE 3OTOE 2J7KA 3ZM7A 4LF7I 3JAMC 1ZXMA 4RPFA 3QT7A 3ZZTA 2O1TA 5BR8I 5LMUI 4DPWA 1Y4UA 1XMOE 2UUBI 2OI2A 1B62A 3Q6NA 2UUAI 4P52A 1RREA 4B3RI 4JI2E 4IZJA 1XNQI 1NHIA 2VQEE 1Z0GA 1S16A 4WUBA 3ZKBA 4JYAI 1H72C 4X65E 4NXNI 1I94E 4K0KI 4DV5E 1Z0BA 4YY3I 1S4EA 4DUYE 4DR3E 4EMDA 4LFAI 1Z0EA 1Z0VA 4HYMA 1DARA 4DR5I 1FKAE 4M1KA 5L3JA 4AQYI 5LL6R 4JI5E 3J80Q 4X64E 2UXCI 4DV3E 1B63A 2O1WA 1Z59A 3WU4A 2O1UA 1IBKE 4DR1E 4B3TE 1HK7A 3PYFA 3J81Q 3HJCA 4JI8I 4LFCI 4DR4E 4IZJB 4MYTA 1HNXI 1N33E 2XEXA 4DV0I 2Z5CA 2R3VA 2F4VI 4X66I 4GKJE 1FWLA 2IOPA 3QT8A 4JI7E 1N32I 3Q1QA 1XHKA 1N34E 4X62E 4DV1E 4LF5E 2HFUA 4JI1I 1Y4SA 2UXDE 4DR6I 4DV6I 2V34A 1H73A 2A2CA 2E5LI 4DPXA 1Z5AA 1Z0CA 5LMNE 2ZM6I 4LF6E 3H4LA 1HNZI 2HHHE 1XMQE 4DR7E 4USMA 3ZZUA 3J80C 1HNWE 2BM0A 1KKHA 2VQFI 2R42A 1KVKA 4NXME 2VF3A 4URLA 5IWAE 4JI0E 4DUZI 2Q2EB 4HACA 3ZZ0A 1MG7A 1N36E 1NHJA 4IZJD 1EI1A 5IT9Q 2HFSA 4FWDA 4KHPE 3QT6A 2E1RA 1PIEA 1MU5A 2NPFA 2GS8A 4LFBI 1N0UA 3B8HA 1J5EI 4LF7E 2AJ4A 5FWKA 1RR9A 5BR8E 2UUCI 5LMUE 1UEKA 3Q6MA 4LF9E 2UUBE 2UUAE 1ZM9A 4HACB 2VQEI 2O1VA 1IBMI 5FLXQ 4B3RE 4GKKI 4DUYI 4FWHA 4JYAE 4B3SI 3K17A 3PRYA 1KTVA 4PRVA 4JI4I 4OX9I 1ZXNA 4K0KE 4JV5I 1K47A 1HR0I 4YY3E 4JI5I 4LFAE 4X64I 4LF8I 1Z5CA 3PYDA 3PYGA 4DR1I 1VISA 4DV2I 4N3OA 4LF4I 1ZM2A 4AQYE 3J7AM 3GONA 1XNRI 2UXCE 2PNMA 4DV7I 3HULA 3PYEA 2BV3A 1PKPA 1EA6A 5A2QQ 4JI8E 4B3MI 1HNXE 4FW9A 1MX0A 4JI6I 4WUDA 2BM1A 4Z7YA 1IBLI 2F4VE 4X66E 1FJGI 4JI3I 1FI4A 2HKJA 3JAMQ 3T1YE 4HXZA 1H7SA 3V5RA 4DR2I 4JI1E 4DV4I 4DV6E 4FWGA 2E5LE 3J81C 4R1FA 2UXBE 4NXMI 2X36A 1NZ0A 1HNZE 4JI0I 2UU9E 1Z0TA 4JG4A 3V2UC 1NHHA 4DU7A 4YHHI 4IZKA 3OTOI 1H74A 3WU6A 2DEJA 2HK2A 3T1HE 4WUCA 1N0VC 5A2QC 4DUZE 1Z0WA 1QZRA 1Y6ZA 4UTGA 3M6AA 1XMOI 4DPYA 2CZ9A 3K85A 4DXLA 2GQ0A 2Z5EA 1ZM3A 4ZVIA 1Z5BA 4MYUA 2A2DA 2IOQA 3D4JA 4DU8A 4LFBE 1J5EE 4LF9I 4JI2I 1FNMA 3B78A 4PU9A 1D6TA 4I3HA 1BKNA 4X65I 2UUCE 1I94I 1USUA 4IZKB 2Z5BA 2CGEA 4DV5I 2HKEA 4DR3I 3J7AG 1XNQE 2CG9A 3QT5A 2ZBKB 4ED4A 5IT9C 3LTOA 4NXNE 3WU3A 1A6FA 2WW4A 1IBME 4GKKE 3K1JA 4DPTA 3LPSA 4DV3I 4XTJA 1IBKI 4B3TI 4DR5E 4HY1A 4B3SE 2ZITA 4JI4E 4OX9E 3LNUA 2X7IA 1HR0E 2EFGA 4JV5E 2DEIA 4DR4I 1N33I 4LF8E 4FN5A 2Z5BB 4DV2E 4GKJI 3CWVA 4LF4E 1H7UA 4LFCE 2LJPA 4JI7I 5FLXC 1WUUA 1N34I 5GMEA 1XNRE 4DV0E 4X62I 4DV1I 4DV7E 5GMDA 4LF5I 1U2RA 1USVA 2UXDI 2V2QA 4UT4A 1KIJA 4B3ME 4P7AA 1N32E 3T1YI 5LMNI 4PRXA 1PVGA 4LF6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  3WU5 A;  4JI6 E;  2HHH I;  4DR6 E;  1XMQ I;  4DR7 I;  1HNW I;  1IBL E;  1FJG E;  4JI3 E;  5IWA I;  2ZM6 E;  2UXB I;  1ELO A;  4DR2 E;  4USK A;  4KQV A;  3ZKD A;  4DV4 E;  4DPU A;  2VQF E;  2UU9 I;  1FWK A;  1N36 I;  1ZM4 A;  3F0N A;  2V2Z A;  2V2V A;  3T1H I;  1OJ4 A;  4Z7C A;  3B82 A;  4KHP I;  2V8P A;  4YHH E;  3OTO E;  2J7K A;  3ZM7 A;  4LF7 I;  3JAM C;  1ZXM A;  4RPF A;  3QT7 A;  3ZZT A;  5BR8 I;  5LMU I;  4DPW A;  1XMO E;  2UUB I;  2OI2 A;  1B62 A;  2UUA I;  4P52 A;  1RRE A;  4B3R I;  4JI2 E;  1XNQ I;  1NHI A;  2VQE E;  1Z0G A;  1S16 A;  4WUB A;  3ZKB A;  4JYA I;  1H72 C;  4X65 E;  4NXN I;  1I94 E;  4K0K I;  4DV5 E;  1Z0B A;  4YY3 I;  1S4E A;  4DUY E;  4DR3 E;  4EMD A;  4LFA I;  1Z0E A;  1Z0V A;  4HYM A;  1DAR A;  4DR5 I;  1FKA E;  4M1K A;  5L3J A;  4AQY I;  5LL6 R;  4JI5 E;  3J80 Q;  4X64 E;  2UXC I;  4DV3 E;  1B63 A;  1IBK E;  1Z59 A;  3WU4 A;  4DR1 E;  4B3T E;  3PYF A;  3J81 Q;  4JI8 I;  4LFC I;  4DR4 E;  4MYT A;  1HNX I;  1N33 E;  2XEX A;  4DV0 I;  2R3V A;  2F4V I;  4X66 I;  4GKJ E;  1FWL A;  3QT8 A;  4JI7 E;  1N32 I;  3Q1Q A;  1XHK A;  1N34 E;  4X62 E;  4DV1 E;  4LF5 E;  2HFU A;  4JI1 I;  2UXD E;  4DR6 I;  4DV6 I;  2V34 A;  1H73 A;  2A2C A;  2E5L I;  4DPX A;  1Z5A A;  1Z0C A;  5LMN E;  2ZM6 I;  4LF6 E;  3H4L A;  1HNZ I;  2HHH E;  1XMQ E;  4DR7 E;  4USM A;  3ZZU A;  3J80 C;  1HNW E;  2BM0 A;  1KKH A;  2R42 A;  2VQF I;  1KVK A;  4NXM E;  2VF3 A;  4URL A;  5IWA E;  4JI0 E;  4DUZ I;  2Q2E B;  4HAC A;  3ZZ0 A;  1MG7 A;  1N36 E;  1NHJ A;  1EI1 A;  5IT9 Q;  2HFS A;  4FWD A;  4KHP E;  3QT6 A;  2E1R A;  1PIE A;  1MU5 A;  2NPF A;  2GS8 A;  4LFB I;  1N0U A;  3B8H A;  1J5E I;  4LF7 E;  2AJ4 A;  1RR9 A;  5BR8 E;  2UUC I;  5LMU E;  1UEK A;  4LF9 E;  2UUB E;  2UUA E;  1ZM9 A;  4HAC B;  2VQE I;  1IBM I;  5FLX Q;  4B3R E;  4GKK I;  4DUY I;  4FWH A;  4JYA E;  4B3S I;  3K17 A;  1KTV A;  4PRV A;  4JI4 I;  4OX9 I;  1ZXN A;  4K0K E;  4JV5 I;  1K47 A;  1HR0 I;  4YY3 E;  4JI5 I;  4LFA E;  4X64 I;  4LF8 I;  1Z5C A;  3PYD A;  3PYG A;  4DR1 I;  1VIS A;  4DV2 I;  4LF4 I;  1ZM2 A;  4AQY E;  3J7A M;  3GON A;  1XNR I;  2UXC E;  4DV7 I;  3HUL A;  3PYE A;  2BV3 A;  1PKP A;  1EA6 A;  5A2Q Q;  4JI8 E;  4B3M I;  1HNX E;  4FW9 A;  1MX0 A;  4JI6 I;  4WUD A;  2BM1 A;  4Z7Y A;  1IBL I;  2F4V E;  4X66 E;  1FJG I;  4JI3 I;  1FI4 A;  2HKJ A;  3JAM Q;  3T1Y E;  4HXZ A;  1H7S A;  3V5R A;  4DR2 I;  4JI1 E;  4DV4 I;  4DV6 E;  4FWG A;  2E5L E;  3J81 C;  4R1F A;  2UXB E;  4NXM I;  2X36 A;  1NZ0 A;  1HNZ E;  4JI0 I;  2UU9 E;  1Z0T A;  4JG4 A;  3V2U C;  1NHH A;  4DU7 A;  4YHH I;  3OTO I;  1H74 A;  3WU6 A;  2DEJ A;  2HK2 A;  3T1H E;  4WUC A;  1N0V C;  5A2Q C;  4DUZ E;  1Z0W A;  1QZR A;  4UTG A;  3M6A A;  1XMO I;  4DPY A;  2CZ9 A;  4DXL A;  1ZM3 A;  4ZVI A;  1Z5B A;  4MYU A;  2A2D A;  3D4J A;  4DU8 A;  4LFB E;  1J5E E;  4LF9 I;  4JI2 I;  1FNM A;  3B78 A;  4PU9 A;  1D6T A;  4I3H A;  1BKN A;  4X65 I;  2UUC E;  1I94 I;  4DV5 I;  2HKE A;  4DR3 I;  3J7A G;  1XNQ E;  3QT5 A;  2ZBK B;  4ED4 A;  5IT9 C;  3LTO A;  4NXN E;  3WU3 A;  1A6F A;  2WW4 A;  1IBM E;  4GKK E;  3K1J A;  4DPT A;  3LPS A;  4DV3 I;  4XTJ A;  1IBK I;  4B3T I;  4DR5 E;  4HY1 A;  4B3S E;  2ZIT A;  4JI4 E;  4OX9 E;  3LNU A;  2X7I A;  1HR0 E;  2EFG A;  4JV5 E;  2DEI A;  4DR4 I;  1N33 I;  4LF8 E;  4FN5 A;  4DV2 E;  4GKJ I;  3CWV A;  4LF4 E;  1H7U A;  4LFC E;  2LJP A;  4JI7 I;  5FLX C;  1WUU A;  1N34 I;  5GME A;  1XNR E;  4DV0 E;  4X62 I;  4DV1 I;  4DV7 E;  5GMD A;  4LF5 I;  1U2R A;  2UXD I;  2V2Q A;  4UT4 A;  1KIJ A;  4B3M E;  4P7A A;  1N32 E;  3T1Y I;  5LMN I;  4PRX A;  1PVG A;  4LF6 I; 
#chains in the Genus database with same CATH topology
 2HK3 A;  3WU5 A;  4JI6 E;  2NN6 C;  2HHH I;  2WP8 A;  4DR6 E;  1XMQ I;  4DR7 I;  2PNZ B;  1HNW I;  1IBL E;  5K36 D;  1FJG E;  4JI3 E;  1R6M A;  4OO1 A;  5IWA I;  2ZM6 E;  3P06 A;  2UXB I;  1ELO A;  4DR2 E;  4USK A;  4KQV A;  3ZKD A;  4DV4 E;  4DPU A;  2VQF E;  2WNR A;  2C37 B;  2PO2 B;  2UU9 I;  1FWK A;  1N36 I;  1ZM4 A;  3F0N A;  2JEB B;  2V2Z A;  2BA0 G;  5C0X C;  2V2V A;  2C39 B;  3T1H I;  2PNL A;  4MU4 A;  1OJ4 A;  2IER A;  2Z5C B;  4Z7C A;  3B82 A;  4KHP I;  2V8P A;  4ISA A;  4LOM A;  4YHH E;  3OTO E;  2J7K A;  1E3P A;  4OKG A;  3ZM7 A;  4LF7 I;  3JAM C;  5K36 E;  2WP8 B;  1ZXM A;  4RPF A;  3QT7 A;  3ZZT A;  2O1T A;  5BR8 I;  1XXE A;  5LMU I;  2NN6 D;  1VI7 A;  4DPW A;  2PO0 A;  1Y4U A;  4OO1 B;  1Y5Y A;  1XMO E;  2UUB I;  2OI2 A;  4OO1 F;  1B62 A;  3Q6N A;  2UUA I;  2WNR B;  1RHY A;  2JE6 A;  4OO1 C;  3U1Y A;  4P52 A;  1RRE A;  4B3R I;  4JI2 E;  4IFD D;  1YH8 A;  4IZJ A;  1XNQ I;  1NHI A;  2VQE E;  5C0X D;  1Z0G A;  1S16 A;  4WUB A;  3ZKB A;  4JYA I;  1H72 C;  1E3H A;  4X65 E;  4NXN I;  4NBQ A;  1I94 E;  4K0K I;  4DV5 E;  1Z0B A;  4FW4 A;  4YY3 I;  1S4E A;  4DUY E;  4DR3 E;  2NN6 E;  3P3E A;  4EMD A;  4LFA I;  1Z0E A;  1Z0V A;  2JT2 A;  4HYM A;  1DAR A;  4DR5 I;  2PO0 B;  1FKA E;  4M1K A;  5L3J A;  4AQY I;  5LL6 R;  4JI5 E;  3J80 Q;  4X64 E;  2UXC I;  4DV3 E;  1B63 A;  2O1W A;  1Z59 A;  3WU4 A;  2O1U A;  1IBK E;  4DR1 E;  2JE6 B;  4FW7 A;  4B3T E;  5ELW A;  1HK7 A;  3PYF A;  3J81 Q;  4QNJ A;  4FW5 A;  3U1K A;  4QNK A;  3HJC A;  1OYP A;  4JI8 I;  2PO1 A;  2JEB A;  4LFC I;  4DR4 E;  4IZJ B;  4MYT A;  1HNX I;  4MU1 A;  1N33 E;  4LCF A;  2XEX A;  4DV0 I;  2Z5C A;  2R3V A;  2F4V I;  4X66 I;  4GKJ E;  1FWL A;  2IOP A;  3QT8 A;  4JI7 E;  1N32 I;  1OYS A;  3Q1Q A;  1XHK A;  1N34 E;  4X62 E;  4DV1 E;  4LF5 E;  2HFU A;  2BA1 G;  4JI1 I;  1Y4S A;  2UXD E;  4DR6 I;  4DV6 I;  2V34 A;  1H73 A;  5EL9 A;  2A2C A;  2E5L I;  4DPX A;  1Z5A A;  1Z0C A;  3M7N G;  5LMN E;  1UDO A;  2BR2 A;  2ZM6 I;  4LF6 E;  3H4L A;  5DRO A;  1HNZ I;  4OO1 E;  2HHH E;  1XMQ E;  4DR7 E;  4USM A;  3ZZU A;  3J80 C;  1HNW E;  1YHC A;  2BM0 A;  1P42 A;  1KKH A;  2R42 A;  2VQF I;  2PO1 B;  3NZK A;  1KVK A;  3CDJ A;  4NXM E;  2VF3 A;  4URL A;  5IWA E;  4JI0 E;  4DUZ I;  2Q2E B;  4HAC A;  3PS3 A;  3ZZ0 A;  1MG7 A;  1N36 E;  1NHJ A;  4IZJ D;  1EI1 A;  5IT9 Q;  2HFS A;  4FWD A;  4KHP E;  3QT6 A;  2E1R A;  1PIE A;  1MU5 A;  2NPF A;  5DNX A;  2GS8 A;  4LFB I;  2BR2 B;  1N0U A;  3B8H A;  1J5E I;  2C38 A;  4LF7 E;  3GME A;  3PS1 A;  2AJ4 A;  5DRP A;  5FWK A;  4FW3 A;  1RR9 A;  3P76 A;  5BR8 E;  2UUC I;  3M85 D;  5LMU E;  5JEA B;  1UEK A;  3Q6M A;  4LF9 E;  5JEA F;  2UUB E;  2UUA E;  1ZM9 A;  4HAC B;  2VQE I;  2O1V A;  4BA2 A;  1IBM I;  5FLX Q;  4B3R E;  4GKK I;  4BA1 A;  1R6L A;  4DUY I;  4FWH A;  4JYA E;  4B3S I;  3K17 A;  3PRY A;  1KTV A;  4PRV A;  4JI4 I;  2C38 B;  1ZXN A;  4OX9 I;  4JV5 I;  1K47 A;  1HR0 I;  4K0K E;  4YY3 E;  2BA0 D;  2GO3 A;  4JI5 I;  4LFA E;  5DRR A;  4X64 I;  4LF8 I;  1Z5C A;  3PYD A;  3GLL A;  3PYG A;  4DR1 I;  1VIS A;  4DV2 I;  4N3O A;  4OO1 D;  4LF4 I;  1ZM2 A;  3DD6 A;  4AQY E;  3J7A M;  3GON A;  3B4T A;  1XNR I;  2UXC E;  2PNM A;  4DV7 I;  4U3B A;  4IFD A;  3HUL A;  4BA2 B;  3PYE A;  2BV3 A;  4LCH A;  4LCG A;  1PKP A;  1EA6 A;  5A2Q Q;  4JI8 E;  4B3M I;  4BA1 B;  3H1C A;  1HNX E;  4FW9 A;  1MX0 A;  4JI6 I;  4WUD A;  2BM1 A;  2O3Z A;  4Z7Y A;  5DRQ A;  1IBL I;  2F4V E;  4X66 E;  1FJG I;  4JI3 I;  1FI4 A;  2HKJ A;  3JAM Q;  3T1Y E;  4HXZ A;  2IES A;  1H7S A;  3V5R A;  4DR2 I;  3UHM A;  4JI1 E;  4DV4 I;  4DV6 E;  5JEA A;  4FW6 A;  4FWG A;  2E5L E;  3J81 C;  4R1F A;  2UXB E;  3HKM A;  4LPF A;  1UDN A;  4NXM I;  2VES A;  2X36 A;  1NZ0 A;  5JEA E;  4IFD B;  1HNZ E;  4JI0 I;  4MU0 A;  2UU9 E;  1Z0T A;  5C0X B;  4IFD F;  4JG4 A;  3V2U C;  1NHH A;  4DU7 A;  4YHH I;  4IZK A;  5C0X F;  3OTO I;  1H74 A;  4MU3 A;  3WU6 A;  2DEJ A;  4IFD C;  2HK2 A;  3T1H E;  4WUC A;  1N0V C;  2J65 A;  4GQU A;  5A2Q C;  4DUZ E;  3L7Z A;  1Z0W A;  1QZR A;  1Y6Z A;  4UTG A;  5K36 A;  1UDS A;  3M6A A;  1XMO I;  3P3G A;  4DPY A;  2CZ9 A;  1UDQ A;  3K85 A;  2JEA B;  4DXL A;  2GQ0 A;  2Z5E A;  1ZM3 A;  4ZVI A;  1Z5B A;  4AIM A;  4MYU A;  2A2D A;  2AE8 A;  2IOQ A;  3D4J A;  4DU8 A;  4LFB E;  1J5E E;  1OYR A;  4LF9 I;  4JI2 I;  1FNM A;  3B78 A;  4PU9 A;  1D6T A;  5JEA C;  4I3H A;  2BA1 D;  1BKN A;  4X65 I;  2UUC E;  1I94 I;  1USU A;  3CDI A;  4U3D A;  4IZK B;  2Z5B A;  2CGE A;  3M7N D;  4DV5 I;  2HKE A;  2CVE A;  4AM3 A;  2F1D A;  4DR3 I;  1XNQ E;  3J7A G;  2CG9 A;  4MQY A;  3L7Z B;  3QT5 A;  2ZBK B;  4ED4 A;  5IT9 C;  3LTO A;  4NXN E;  3WU3 A;  5K36 B;  3KRN A;  1Y60 A;  1A6F A;  2NN6 A;  2WW4 A;  1IBM E;  5K36 F;  4GKK E;  3K1J A;  4DPT A;  3LPS A;  4DV3 I;  4XTJ A;  1IBK I;  5K36 C;  4B3T I;  2GO4 A;  4DR5 E;  4HY1 A;  4B3S E;  2PNZ A;  4IS9 A;  2ZIT A;  4OZE A;  4JI4 E;  4J3D A;  4OX9 E;  3LNU A;  2X7I A;  3P3C A;  2EFG A;  1HR0 E;  4JV5 E;  2DEI A;  4DR4 I;  1N33 I;  4AID A;  3GCM A;  4LF8 E;  5C0X A;  5JEA D;  4FN5 A;  2Z5B B;  4MDT A;  4DV2 E;  4GKJ I;  3CWV A;  2C37 A;  2PO2 A;  4IFD E;  4LF4 E;  1H7U A;  4LFC E;  2LJP A;  4JI7 I;  5C0X E;  5FLX C;  1WUU A;  1N34 I;  5GME A;  1XNR E;  4DV0 E;  4X62 I;  4DV1 I;  4DV7 E;  5GMD A;  4LF5 I;  1U2R A;  2C39 A;  1USV A;  2UXD I;  2V2Q A;  2NN6 B;  5EKW A;  3M85 G;  4UT4 A;  1KIJ A;  3PS2 A;  2NN6 F;  4B3M E;  4P7A A;  1N32 E;  5DNL A;  5LMN I;  4PRX A;  3T1Y I;  2JEA A;  1PVG A;  4LF6 I; 
#chains in the Genus database with same CATH homology
 2HK3 A;  3WU5 A;  4JI6 E;  2HHH I;  4DR6 E;  1XMQ I;  4DR7 I;  1HNW I;  1IBL E;  1FJG E;  4JI3 E;  5IWA I;  2ZM6 E;  3P06 A;  2UXB I;  1ELO A;  4DR2 E;  4USK A;  4KQV A;  3ZKD A;  4DV4 E;  4DPU A;  2VQF E;  2UU9 I;  1FWK A;  1N36 I;  1ZM4 A;  3F0N A;  2V2Z A;  2V2V A;  3T1H I;  2PNL A;  1OJ4 A;  2Z5C B;  4Z7C A;  3B82 A;  4KHP I;  2V8P A;  4YHH E;  3OTO E;  2J7K A;  3ZM7 A;  4LF7 I;  3JAM C;  1ZXM A;  4RPF A;  3QT7 A;  3ZZT A;  2O1T A;  5BR8 I;  5LMU I;  4DPW A;  1Y4U A;  1XMO E;  2UUB I;  2OI2 A;  1B62 A;  3Q6N A;  2UUA I;  4P52 A;  1RRE A;  4B3R I;  4JI2 E;  4IZJ A;  1XNQ I;  1NHI A;  2VQE E;  1Z0G A;  1S16 A;  4WUB A;  3ZKB A;  4JYA I;  1H72 C;  4X65 E;  4NXN I;  1I94 E;  4K0K I;  4DV5 E;  1Z0B A;  4YY3 I;  1S4E A;  4DUY E;  4DR3 E;  4EMD A;  4LFA I;  1Z0E A;  1Z0V A;  4HYM A;  1DAR A;  4DR5 I;  1FKA E;  4M1K A;  5L3J A;  4AQY I;  5LL6 R;  4JI5 E;  3J80 Q;  4X64 E;  2UXC I;  4DV3 E;  1B63 A;  2O1W A;  1Z59 A;  3WU4 A;  2O1U A;  1IBK E;  4DR1 E;  4B3T E;  1HK7 A;  3PYF A;  3J81 Q;  3HJC A;  4JI8 I;  4LFC I;  4DR4 E;  4IZJ B;  4MYT A;  1HNX I;  1N33 E;  2XEX A;  4DV0 I;  2Z5C A;  2R3V A;  2F4V I;  4X66 I;  4GKJ E;  1FWL A;  2IOP A;  3QT8 A;  4JI7 E;  1N32 I;  3Q1Q A;  1XHK A;  1N34 E;  4X62 E;  4DV1 E;  4LF5 E;  2HFU A;  4JI1 I;  1Y4S A;  2UXD E;  4DR6 I;  4DV6 I;  2V34 A;  1H73 A;  2A2C A;  2E5L I;  4DPX A;  1Z5A A;  1Z0C A;  5LMN E;  2ZM6 I;  4LF6 E;  3H4L A;  1HNZ I;  2HHH E;  1XMQ E;  4DR7 E;  4USM A;  3ZZU A;  3J80 C;  1HNW E;  2BM0 A;  1KKH A;  2VQF I;  2R42 A;  1KVK A;  4NXM E;  2VF3 A;  4URL A;  5IWA E;  4JI0 E;  4DUZ I;  2Q2E B;  4HAC A;  3ZZ0 A;  1MG7 A;  1N36 E;  1NHJ A;  4IZJ D;  1EI1 A;  5IT9 Q;  2HFS A;  4FWD A;  4KHP E;  3QT6 A;  2E1R A;  1PIE A;  1MU5 A;  2NPF A;  2GS8 A;  4LFB I;  1N0U A;  3B8H A;  1J5E I;  4LF7 E;  2AJ4 A;  5FWK A;  1RR9 A;  5BR8 E;  2UUC I;  5LMU E;  1UEK A;  3Q6M A;  4LF9 E;  2UUB E;  2UUA E;  1ZM9 A;  4HAC B;  2VQE I;  2O1V A;  1IBM I;  5FLX Q;  4B3R E;  4GKK I;  4DUY I;  4FWH A;  4JYA E;  4B3S I;  3K17 A;  3PRY A;  1KTV A;  4PRV A;  4JI4 I;  4OX9 I;  1ZXN A;  4K0K E;  4JV5 I;  1K47 A;  1HR0 I;  4YY3 E;  4JI5 I;  4LFA E;  4X64 I;  4LF8 I;  1Z5C A;  3PYD A;  3PYG A;  4DR1 I;  1VIS A;  4DV2 I;  4N3O A;  4LF4 I;  1ZM2 A;  4AQY E;  3J7A M;  3GON A;  1XNR I;  2UXC E;  2PNM A;  4DV7 I;  3HUL A;  3PYE A;  2BV3 A;  1PKP A;  1EA6 A;  5A2Q Q;  4JI8 E;  4B3M I;  1HNX E;  4FW9 A;  1MX0 A;  4JI6 I;  4WUD A;  2BM1 A;  4Z7Y A;  1IBL I;  2F4V E;  4X66 E;  1FJG I;  4JI3 I;  1FI4 A;  2HKJ A;  3JAM Q;  3T1Y E;  4HXZ A;  1H7S A;  3V5R A;  4DR2 I;  4JI1 E;  4DV4 I;  4DV6 E;  4FWG A;  2E5L E;  3J81 C;  4R1F A;  2UXB E;  4NXM I;  2X36 A;  1NZ0 A;  1HNZ E;  4JI0 I;  2UU9 E;  1Z0T A;  4JG4 A;  3V2U C;  1NHH A;  4DU7 A;  4YHH I;  4IZK A;  3OTO I;  1H74 A;  3WU6 A;  2DEJ A;  2HK2 A;  3T1H E;  4WUC A;  1N0V C;  5A2Q C;  4DUZ E;  1Z0W A;  1QZR A;  1Y6Z A;  4UTG A;  3M6A A;  1XMO I;  4DPY A;  2CZ9 A;  3K85 A;  4DXL A;  2GQ0 A;  2Z5E A;  1ZM3 A;  4ZVI A;  1Z5B A;  4MYU A;  2A2D A;  2IOQ A;  3D4J A;  4DU8 A;  4LFB E;  1J5E E;  4LF9 I;  4JI2 I;  1FNM A;  3B78 A;  4PU9 A;  1D6T A;  4I3H A;  1BKN A;  4X65 I;  2UUC E;  1I94 I;  1USU A;  4IZK B;  2Z5B A;  2CGE A;  4DV5 I;  2HKE A;  4DR3 I;  3J7A G;  1XNQ E;  2CG9 A;  3QT5 A;  2ZBK B;  4ED4 A;  5IT9 C;  3LTO A;  4NXN E;  3WU3 A;  1A6F A;  2WW4 A;  1IBM E;  4GKK E;  3K1J A;  4DPT A;  3LPS A;  4DV3 I;  4XTJ A;  1IBK I;  4B3T I;  4DR5 E;  4HY1 A;  4B3S E;  2ZIT A;  4JI4 E;  4OX9 E;  3LNU A;  2X7I A;  1HR0 E;  2EFG A;  4JV5 E;  2DEI A;  4DR4 I;  1N33 I;  4LF8 E;  4FN5 A;  2Z5B B;  4DV2 E;  4GKJ I;  3CWV A;  4LF4 E;  1H7U A;  4LFC E;  2LJP A;  4JI7 I;  5FLX C;  1WUU A;  1N34 I;  5GME A;  1XNR E;  4DV0 E;  4X62 I;  4DV1 I;  4DV7 E;  5GMD A;  4LF5 I;  1U2R A;  1USV A;  2UXD I;  2V2Q A;  4UT4 A;  1KIJ A;  4B3M E;  4P7A A;  1N32 E;  3T1Y I;  5LMN I;  4PRX A;  1PVG A;  4LF6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...