1RREA

Crystal structure of e.coli lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-dependent protease La
publication title The catalytic domain of Escherichia coli Lon protease has a unique fold and a Ser-Lys dyad in the active site
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2003-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1rreA01
3Q1QA 2XEXA 4JI6I 1Z5BA 1NZ0A 3J81Q 4I3HA 1NHHA 2J7KA 5GMDA 1IBME 4Z7CA 1HR0E 4B3ME 3J7AG 2UU9I 1HNXE 2V2ZA 2CZ9A 1NHIA 2X36A 4LF4E 1XNRI 4JI2E 3LNUA 2UXBI 3V5RA 4NXMI 4JI5I 4GKKE 2E5LI 2UXDI 2UU9E 3QT7A 4DR5E 2VQFI 1H7UA 4B3RI 4KHPI 4DR4I 4LFCE 1XNRE 4NXNI 2F4VE 2HHHI 3D4JA 2AJ4A 4YY3I 2UXBE 2HFUA 4NXME 4JI5E 3ZM7A 1HNZE 1Z5AA 3PYEA 4PU9A 4K0KE 2HFSA 2V8PA 1Z0TA 2VQFE 4KHPE 1S16A 3LPSA 3T1HI 1I94E 3J7AM 1PIEA 2HHHE 4YY3E 4DPYA 1B63A 1FNMA 3PYDA 1ZM2A 1D6TA 5FLXC 2DEJA 4JI8I 4DUZE 4AQYI 1WUUA 2VF3A 1Z0EA 5L3JA 3PYGA 2V2VA 4URLA 3T1HE 1Z0GA 1OJ4A 3QT5A 5LMNI 1IBLE 3WU5A 1XHKA 4GKJE 3ZZUA 4JI7E 1ZXNA 4LF7E 2Q2EB 4JI0E 2NPFA 1K47A 4JI8E 1MU5A 4FWDA 4UTGA 1N36I 2ZM6I 1KKHA 4JYAE 4FWHA 4HY1A 1QZRA 4LF9I 4HYMA 3K17A 2VQEI 4FWGA 3ZKBA 5IT9Q 3ZZ0A 4X62I 1N36E 1PKPA 5GMEA 4HACA 2V34A 1HNWE 3WU4A 1EI1A 4LF9E 4DR2I 4P7AA 4B3TI 4LFAI 4OX9I 4LFBE 3WU3A 3QT8A 2VQEE 4DR1I 1B62A 4XTJA 5IWAE 1PVGA 3B8HA 4DR7I 5LMUI 4B3SE 4DV3I 4X62E 1Z0BA 1ZM9A 4JI6E 4DR2E 5BR8I 4HXZA 2A2CA 4OX9E 3J81C 4DPTA 3JAMQ 1N0VC 4PRXA 5LMUE 1FWLA 4LF8I 4DUYI 3H4LA 1IBKI 2R42A 5BR8E 4DV4I 1EA6A 2WW4A 2E5LE 2UXDE 4USKA 1Z0WA 5A2QQ 4LF8E 4B3RE 3LTOA 4DV0I 4DUYE 3B78A 4DR4E 1IBKE 4NXNE 5LL6R 4JI1I 4WUBA 2DEIA 4DV1I 4DPXA 4LF6I 2UUBI 4KQVA 4DV0E 4ED4A 4EMDA 4DR3I 3WU6A 4JI1E 1H74A 2UXCI 1NHJA 1MX0A 4LF6E 1FWKA 1KTVA 1H73A 3ZKDA 4AQYE 1Z59A 1FKAE 3T1YI 1H72C 1ELOA 5LMNE 1XMQI 4DR3E 2BV3A 4HACB 4USMA 4DV2I 1H7SA 4RPFA 4JI4I 1XMOI 3F0NA 3J80Q 1RR9A 3V2UC 3T1YE 1J5EI 4JG4A 2ZM6E 4JV5I 4JI3I 4DV2E 4DU7A 2GS8A 4X65I 4WUDA 4MYUA 2X7IA 2ZITA 1HR0I 2V2QA 3J80C 3CWVA 1Z5CA 4FW9A 1HNXI 4DPUA 2ZBKB 4JV5E 4ZVIA 5IT9C 4JI3E 2UUAI 1XNQI 4LF4I 4R1FA 1VISA 4JI2I 4B3TE 4LFAE 4X64I 4X65E 4GKKI 4DR1E 3PYFA 4DR7E 4DV6I 4DV3E 4DR5I 1N0UA 2BM0A 2UUAE 1XNQE 4LFCI 3OTOI 2F4VI 4X64E 4UT4A 4DR6I 3B82A 1HNZI 1N33I 4DV6E 4K0KI 3JAMC 1N32I 2EFGA 1KVKA 2HK2A 3M6AA 1I94I 2OI2A 4DV5I 3OTOE 1Z0VA 4DV4E 1RREA 4DU8A 4DR6E 5FLXQ 1N33E 4FN5A 4YHHI 4LF5I 4DUZI 1N32E 4DXLA 5A2QC 1ZM4A 1N34I 3GONA 4DV5E 1IBLI 4GKJI 3ZZTA 4JI7I 4DV1E 1A6FA 1U2RA 2E1RA 4LF7I 4JI0I 1UEKA 4M1KA 4YHHE 2UUBE 4LF5E 1FJGI 3QT6A 4MYTA 1N34E 4DV7I 2HK3A 1KIJA 1S4EA 2UXCE 1BKNA 4JYAI 2LJPA 3HULA 1FI4A 2HKJA 1ZXMA 4X66I 4PRVA 3K1JA 4DPWA 1FJGE 2R3VA 1MG7A 2UUCI 1XMQE 4DV7E 4P52A 4WUCA 1HNWI 2HKEA 4X66E 2A2DA 4Z7YA 4JI4E 4LFBI 1XMOE 1IBMI 1ZM3A 4B3MI 5IWAI 1Z0CA 1J5EE 2BM1A 1DARA 2UUCE 4B3SI
chains in the Genus database with same CATH superfamily
2F1DA 3Q1QA 2NN6C 2BR2A 4MU4A 4IFDF 4OZEA 2XEXA 4JI6I 1Z5BA 2JE6B 1NZ0A 3J81Q 5K36A 4I3HA 1NHHA 4IZJA 2J7KA 5GMDA 1IBME 5K36D 4Z7CA 1HR0E 4IZJD 4B3ME 3J7AG 2UU9I 5JEAC 1HNXE 2V2ZA 2IERA 2IESA 2CZ9A 1NHIA 4FW5A 2X36A 4LF4E 1OYPA 1XNRI 2C38B 4JI2E 2JE6A 4BA1B 4BA2B 3LNUA 2UXBI 5JEAA 3V5RA 4AIMA 4NXMI 4JI5I 4GKKE 5JEAD 2E5LI 2UXDI 2UU9E 3P76A 3QT7A 4DR5E 2VQFI 1H7UA 4B3RI 4KHPI 4DR4I 4LFCE 1XNRE 4NXNI 2F4VE 4BA1A 2HHHI 3D4JA 2AJ4A 4YY3I 2UXBE 2HFUA 4NXME 4JI5E 5C0XF 3ZM7A 1HNZE 1Z5AA 1XXEA 2IOQA 3PYEA 4PU9A 5DNXA 4K0KE 2HFSA 2V8PA 1Z0TA 2VQFE 4LCHA 4KHPE 1S16A 1UDNA 3M7ND 3LPSA 3U1KA 3T1HI 1I94E 3J7AM 1PIEA 2HHHE 4N3OA 4OO1E 4YY3E 5ELWA 4DPYA 4OO1B 1B63A 1Y4UA 1FNMA 3PYDA 3CDJA 1ZM2A 1D6TA 5FLXC 2DEJA 4JI8I 4DUZE 4AQYI 1WUUA 1UDOA 2VF3A 1Z0EA 2JEBB 3PYGA 2V2VA 4URLA 5L3JA 3T1HE 1Z0GA 1OJ4A 3QT5A 5LMNI 1IBLE 3WU5A 1XHKA 4GKJE 1RHYA 4NBQA 3ZZUA 4JI7E 2CVEA 1ZXNA 4LF7E 1OYSA 2Q2EB 4IFDC 4JI0E 4IZKA 2NPFA 2O1VA 1K47A 2Z5EA 4JI8E 3M85G 1MU5A 4FWDA 2JEBA 4UTGA 1N36I 2ZM6I 4QNJA 1Y4SA 2PNZA 1KKHA 4JYAE 1Y60A 4FWHA 3GCMA 4HY1A 3CDIA 5K36E 1QZRA 4LF9I 4HYMA 2NN6E 5K36B 4IZJB 3K85A 3K17A 2VQEI 2NN6B 1R6MA 3P06A 5DNLA 4FWGA 3ZKBA 5IT9Q 3ZZ0A 4X62I 1N36E 3GMEA 1PKPA 5GMEA 4HACA 2V34A 1HNWE 5JEAE 3WU4A 1EI1A 4LF9E 4ISAA 4DR2I 1USUA 4P7AA 4B3TI 4LFAI 4OX9I 4J3DA 3U1YA 5JEAB 4LFBE 3WU3A 3QT8A 2NN6A 2VQEE 4DR1I 1B62A 4XTJA 5IWAE 1PVGA 3B8HA 2NN6D 4DR7I 5LMUI 4B3SE 2GO3A 5C0XC 4DV3I 4X62E 1Z0BA 1ZM9A 4JI6E 1YHCA 4DR2E 5BR8I 1UDQA 4MQYA 4HXZA 2A2CA 4OX9E 2IOPA 5C0XA 4U3DA 3J81C 3KRNA 4DPTA 3Q6MA 5C0XD 2PO0A 3JAMQ 4AM3A 1N0VC 4PRXA 5LMUE 2PO2B 1FWLA 4LF8I 3UHMA 4DUYI 1VI7A 3H4LA 1IBKI 2R42A 5BR8E 4FW7A 4FW6A 4DV4I 1EA6A 2WW4A 2E5LE 2UXDE 4USKA 1P42A 2PO2A 1Z0WA 5A2QQ 4LF8E 4B3RE 1Y5YA 3LTOA 4DV0I 1R6LA 4OKGA 4DUYE 3B78A 4DR4E 2WNRB 1IBKE 4NXNE 5LL6R 2O1UA 4JI1I 4WUBA 2DEIA 4DV1I 3PS3A 2BA1G 4DPXA 2C37A 4LF6I 4IZKB 2PNMA 3DD6A 5DRPA 2UUBI 4KQVA 2BA0G 4DV0E 2JEAB 2WNRA 4ED4A 4EMDA 4DR3I 3WU6A 4JI1E 4IFDB 1H74A 2UXCI 2PNZB 1NHJA 1MX0A 4MU3A 2J65A 4LF6E 1FWKA 4IS9A 1KTVA 1H73A 3ZKDA 4AQYE 1Z59A 1FKAE 2VESA 2JEAA 3T1YI 1H72C 1ELOA 5LMNE 1XMQI 4DR3E 4IFDA 2Z5BA 2BV3A 4HACB 4USMA 4IFDD 4DV2I 5DRQA 1H7SA 4RPFA 4JI4I 2PO1A 3Q6NA 1XMOI 2O1TA 3F0NA 3J80Q 1RR9A 3V2UC 3T1YE 4LCGA 3L7ZB 1J5EI 4JG4A 5FWKA 2ZM6E 4JV5I 4JI3I 1UDSA 2Z5CB 1HK7A 4QNKA 4DV2E 2BA1D 4DU7A 5C0XE 4OO1F 2GS8A 4X65I 4WUDA 5C0XB 2CGEA 4MYUA 2BA0D 2X7IA 2ZITA 1HR0I 2O3ZA 5EL9A 3L7ZA 2PO0B 2V2QA 3J80C 3CWVA 1Z5CA 4FW3A 4FW9A 1HNXI 4DPUA 2ZBKB 3PS2A 4JV5E 2GO4A 4ZVIA 5IT9C 4JI3E 2UUAI 2Z5CA 1XNQI 1OYRA 3M7NG 4LF4I 4R1FA 1VISA 4JI2I 4B3TE 4LFAE 4X64I 4X65E 3P3EA 4GKKI 3M85D 4DR1E 3PYFA 2CG9A 2JT2A 4DR7E 4DV6I 4DV3E 5DRRA 4DR5I 1N0UA 2BM0A 2UUAE 1XNQE 4LFCI 3OTOI 2F4VI 3PS1A 4U3BA 4X64E 4UT4A 4DR6I 5K36F 3B4TA 2C37B 3B82A 1HNZI 3PRYA 1N33I 2NN6F 4DV6E 4K0KI 3JAMC 1N32I 2EFGA 1KVKA 2HK2A 3M6AA 1I94I 2C38A 2OI2A 4DV5I 3OTOE 1Z0VA 4BA2A 4LCFA 4DV4E 1RREA 4DU8A 4AIDA 4DR6E 2O1WA 5JEAF 5FLXQ 2AE8A 3P3GA 2C39B 1N33E 4FN5A 4YHHI 2WP8B 4LF5I 4DUZI 4LPFA 1N32E 4DXLA 1Y6ZA 4IFDE 5A2QC 3HKMA 1ZM4A 1N34I 3GONA 4DV5E 1IBLI 4GKJI 2Z5BB 3ZZTA 4JI7I 4LOMA 4DV1E 1A6FA 1E3PA 1U2RA 4GQUA 1USVA 2E1RA 3GLLA 4LF7I 4JI0I 2C39A 1YH8A 1UEKA 4M1KA 4YHHE 3H1CA 2UUBE 2PO1B 2WP8A 4LF5E 4OO1C 1E3HA 1FJGI 3QT6A 4MYTA 1N34E 4DV7I 2HK3A 1KIJA 1S4EA 2UXCE 1BKNA 4JYAI 2LJPA 3HULA 1FI4A 2HKJA 1ZXMA 4OO1A 4X66I 4FW4A 4OO1D 4PRVA 3K1JA 2GQ0A 4MDTA 3P3CA 4DPWA 1FJGE 2R3VA 1MG7A 2UUCI 1XMQE 4MU0A 3NZKA 4DV7E 2BR2B 2PNLA 4P52A 4WUCA 1HNWI 2HKEA 3HJCA 4X66E 2A2DA 4Z7YA 4JI4E 4LFBI 1XMOE 1IBMI 1ZM3A 5DROA 4B3MI 4MU1A 1Z0CA 5IWAI 1J5EE 2BM1A 1DARA 5K36C 2UUCE 5EKWA 4B3SI
chains in the Genus database with same CATH topology
3Q1QA 2XEXA 4JI6I 1Z5BA 1NZ0A 3J81Q 4I3HA 1NHHA 4IZJA 2J7KA 5GMDA 1IBME 4Z7CA 1HR0E 4IZJD 4B3ME 3J7AG 2UU9I 1HNXE 2V2ZA 2CZ9A 1NHIA 2X36A 4LF4E 1XNRI 4JI2E 3LNUA 2UXBI 3V5RA 4NXMI 4JI5I 4GKKE 2E5LI 2UXDI 2UU9E 3QT7A 4DR5E 2VQFI 1H7UA 4B3RI 4KHPI 4DR4I 4LFCE 1XNRE 4NXNI 2F4VE 2HHHI 3D4JA 2AJ4A 4YY3I 2UXBE 2HFUA 4NXME 4JI5E 3ZM7A 1HNZE 1Z5AA 2IOQA 3PYEA 4PU9A 4K0KE 2HFSA 2V8PA 1Z0TA 2VQFE 4KHPE 1S16A 3LPSA 3T1HI 1I94E 3J7AM 1PIEA 2HHHE 4N3OA 4YY3E 4DPYA 1B63A 1Y4UA 1FNMA 3PYDA 1ZM2A 1D6TA 5FLXC 2DEJA 4JI8I 4DUZE 4AQYI 1WUUA 2VF3A 1Z0EA 5L3JA 3PYGA 2V2VA 4URLA 3T1HE 1Z0GA 1OJ4A 3QT5A 5LMNI 1IBLE 3WU5A 1XHKA 4GKJE 3ZZUA 4JI7E 1ZXNA 4LF7E 2Q2EB 4JI0E 4IZKA 2NPFA 2O1VA 1K47A 2Z5EA 4JI8E 1MU5A 4FWDA 4UTGA 1N36I 2ZM6I 1Y4SA 1KKHA 4JYAE 4FWHA 4HY1A 1QZRA 4LF9I 4HYMA 4IZJB 3K85A 3K17A 2VQEI 3P06A 4FWGA 3ZKBA 5IT9Q 3ZZ0A 4X62I 1N36E 1PKPA 5GMEA 4HACA 2V34A 1HNWE 3WU4A 1EI1A 4LF9E 4DR2I 1USUA 4P7AA 4B3TI 4LFAI 4OX9I 4LFBE 3WU3A 3QT8A 2VQEE 4DR1I 1B62A 4XTJA 5IWAE 1PVGA 3B8HA 4DR7I 5LMUI 4B3SE 4DV3I 4X62E 1Z0BA 1ZM9A 4JI6E 4DR2E 5BR8I 4HXZA 2A2CA 4OX9E 2IOPA 3J81C 4DPTA 3Q6MA 3JAMQ 1N0VC 4PRXA 5LMUE 1FWLA 4LF8I 4DUYI 3H4LA 1IBKI 2R42A 5BR8E 4DV4I 1EA6A 2WW4A 2E5LE 2UXDE 4USKA 1Z0WA 5A2QQ 4LF8E 4B3RE 3LTOA 4DV0I 4DUYE 3B78A 4DR4E 1IBKE 4NXNE 5LL6R 2O1UA 4JI1I 4WUBA 2DEIA 4DV1I 4DPXA 4LF6I 4IZKB 2PNMA 2UUBI 4KQVA 4DV0E 4ED4A 4EMDA 4DR3I 3WU6A 4JI1E 1H74A 2UXCI 1NHJA 1MX0A 4LF6E 1FWKA 1KTVA 1H73A 3ZKDA 4AQYE 1Z59A 1FKAE 3T1YI 1H72C 1ELOA 5LMNE 1XMQI 4DR3E 2Z5BA 2BV3A 4HACB 4USMA 4DV2I 1H7SA 4RPFA 4JI4I 3Q6NA 1XMOI 2O1TA 3F0NA 3J80Q 1RR9A 3V2UC 3T1YE 1J5EI 4JG4A 5FWKA 2ZM6E 4JV5I 4JI3I 2Z5CB 1HK7A 4DV2E 4DU7A 2GS8A 4X65I 4WUDA 2CGEA 4MYUA 2X7IA 2ZITA 1HR0I 2V2QA 3J80C 3CWVA 1Z5CA 4FW9A 1HNXI 4DPUA 2ZBKB 4JV5E 4ZVIA 5IT9C 4JI3E 2UUAI 2Z5CA 1XNQI 4LF4I 4R1FA 1VISA 4JI2I 4B3TE 4LFAE 4X64I 4X65E 4GKKI 4DR1E 3PYFA 2CG9A 4DR7E 4DV6I 4DV3E 4DR5I 1N0UA 2BM0A 2UUAE 1XNQE 4LFCI 3OTOI 2F4VI 4X64E 4UT4A 4DR6I 3B82A 1HNZI 3PRYA 1N33I 4DV6E 4K0KI 3JAMC 1N32I 2EFGA 1KVKA 2HK2A 3M6AA 1I94I 2OI2A 4DV5I 3OTOE 1Z0VA 4DV4E 1RREA 4DU8A 4DR6E 2O1WA 5FLXQ 1N33E 4FN5A 4YHHI 4LF5I 4DUZI 1N32E 4DXLA 1Y6ZA 5A2QC 1ZM4A 1N34I 3GONA 4DV5E 1IBLI 4GKJI 2Z5BB 3ZZTA 4JI7I 4DV1E 1A6FA 1U2RA 1USVA 2E1RA 4LF7I 4JI0I 1UEKA 4M1KA 4YHHE 2UUBE 4LF5E 1FJGI 3QT6A 4MYTA 1N34E 4DV7I 2HK3A 1KIJA 1S4EA 2UXCE 1BKNA 4JYAI 2LJPA 3HULA 1FI4A 2HKJA 1ZXMA 4X66I 4PRVA 3K1JA 2GQ0A 4DPWA 1FJGE 2R3VA 1MG7A 2UUCI 1XMQE 4DV7E 2PNLA 4P52A 4WUCA 1HNWI 2HKEA 3HJCA 4X66E 2A2DA 4Z7YA 4JI4E 4LFBI 1XMOE 1IBMI 1ZM3A 4B3MI 5IWAI 1Z0CA 1J5EE 2BM1A 1DARA 2UUCE 4B3SI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1Q A;  2XEX A;  4JI6 I;  1Z5B A;  1NZ0 A;  3J81 Q;  4I3H A;  1NHH A;  2J7K A;  5GMD A;  1IBM E;  4Z7C A;  1HR0 E;  4B3M E;  3J7A G;  2UU9 I;  1HNX E;  2V2Z A;  2CZ9 A;  1NHI A;  2X36 A;  4LF4 E;  1XNR I;  4JI2 E;  3LNU A;  2UXB I;  3V5R A;  4NXM I;  4JI5 I;  4GKK E;  2E5L I;  2UXD I;  2UU9 E;  3QT7 A;  4DR5 E;  2VQF I;  1H7U A;  4B3R I;  4KHP I;  4DR4 I;  4LFC E;  1XNR E;  4NXN I;  2F4V E;  2HHH I;  3D4J A;  2AJ4 A;  4YY3 I;  2UXB E;  2HFU A;  4NXM E;  4JI5 E;  3ZM7 A;  1HNZ E;  1Z5A A;  3PYE A;  4PU9 A;  4K0K E;  2HFS A;  2V8P A;  1Z0T A;  2VQF E;  4KHP E;  1S16 A;  3LPS A;  3T1H I;  1I94 E;  3J7A M;  1PIE A;  2HHH E;  4YY3 E;  4DPY A;  1B63 A;  1FNM A;  3PYD A;  1ZM2 A;  1D6T A;  5FLX C;  2DEJ A;  4JI8 I;  4DUZ E;  4AQY I;  1WUU A;  2VF3 A;  1Z0E A;  5L3J A;  3PYG A;  2V2V A;  4URL A;  3T1H E;  1Z0G A;  1OJ4 A;  3QT5 A;  5LMN I;  1IBL E;  3WU5 A;  1XHK A;  4GKJ E;  3ZZU A;  4JI7 E;  1ZXN A;  4LF7 E;  2Q2E B;  4JI0 E;  2NPF A;  1K47 A;  4JI8 E;  1MU5 A;  4FWD A;  4UTG A;  1N36 I;  2ZM6 I;  1KKH A;  4JYA E;  4FWH A;  4HY1 A;  1QZR A;  4LF9 I;  4HYM A;  3K17 A;  2VQE I;  4FWG A;  3ZKB A;  5IT9 Q;  3ZZ0 A;  4X62 I;  1N36 E;  1PKP A;  5GME A;  4HAC A;  2V34 A;  1HNW E;  3WU4 A;  1EI1 A;  4LF9 E;  4DR2 I;  4P7A A;  4B3T I;  4LFA I;  4OX9 I;  4LFB E;  3WU3 A;  3QT8 A;  2VQE E;  4DR1 I;  1B62 A;  4XTJ A;  5IWA E;  1PVG A;  3B8H A;  4DR7 I;  5LMU I;  4B3S E;  4DV3 I;  4X62 E;  1Z0B A;  1ZM9 A;  4JI6 E;  4DR2 E;  5BR8 I;  4HXZ A;  2A2C A;  4OX9 E;  3J81 C;  4DPT A;  3JAM Q;  1N0V C;  4PRX A;  5LMU E;  1FWL A;  4LF8 I;  4DUY I;  3H4L A;  1IBK I;  2R42 A;  5BR8 E;  4DV4 I;  1EA6 A;  2WW4 A;  2E5L E;  2UXD E;  4USK A;  1Z0W A;  5A2Q Q;  4LF8 E;  4B3R E;  3LTO A;  4DV0 I;  4DUY E;  3B78 A;  4DR4 E;  1IBK E;  4NXN E;  5LL6 R;  4JI1 I;  4WUB A;  2DEI A;  4DV1 I;  4DPX A;  4LF6 I;  2UUB I;  4KQV A;  4DV0 E;  4ED4 A;  4EMD A;  4DR3 I;  3WU6 A;  4JI1 E;  1H74 A;  2UXC I;  1NHJ A;  1MX0 A;  4LF6 E;  1FWK A;  1KTV A;  1H73 A;  3ZKD A;  4AQY E;  1Z59 A;  1FKA E;  3T1Y I;  1H72 C;  1ELO A;  5LMN E;  1XMQ I;  4DR3 E;  2BV3 A;  4HAC B;  4USM A;  4DV2 I;  1H7S A;  4RPF A;  4JI4 I;  1XMO I;  3F0N A;  3J80 Q;  1RR9 A;  3V2U C;  3T1Y E;  1J5E I;  4JG4 A;  2ZM6 E;  4JV5 I;  4JI3 I;  4DV2 E;  4DU7 A;  2GS8 A;  4X65 I;  4WUD A;  4MYU A;  2X7I A;  2ZIT A;  1HR0 I;  2V2Q A;  3J80 C;  3CWV A;  1Z5C A;  4FW9 A;  1HNX I;  4DPU A;  2ZBK B;  4JV5 E;  4ZVI A;  5IT9 C;  4JI3 E;  2UUA I;  1XNQ I;  4LF4 I;  4R1F A;  1VIS A;  4JI2 I;  4B3T E;  4LFA E;  4X64 I;  4X65 E;  4GKK I;  4DR1 E;  3PYF A;  4DR7 E;  4DV6 I;  4DV3 E;  4DR5 I;  1N0U A;  2BM0 A;  2UUA E;  1XNQ E;  4LFC I;  3OTO I;  2F4V I;  4X64 E;  4UT4 A;  4DR6 I;  3B82 A;  1HNZ I;  1N33 I;  4DV6 E;  4K0K I;  3JAM C;  1N32 I;  2EFG A;  1KVK A;  2HK2 A;  3M6A A;  1I94 I;  2OI2 A;  4DV5 I;  3OTO E;  1Z0V A;  4DV4 E;  1RRE A;  4DU8 A;  4DR6 E;  5FLX Q;  1N33 E;  4FN5 A;  4YHH I;  4LF5 I;  4DUZ I;  1N32 E;  4DXL A;  5A2Q C;  1ZM4 A;  1N34 I;  3GON A;  4DV5 E;  1IBL I;  4GKJ I;  3ZZT A;  4JI7 I;  4DV1 E;  1A6F A;  1U2R A;  2E1R A;  4LF7 I;  4JI0 I;  1UEK A;  4M1K A;  4YHH E;  2UUB E;  4LF5 E;  1FJG I;  3QT6 A;  4MYT A;  1N34 E;  4DV7 I;  2HK3 A;  1KIJ A;  1S4E A;  2UXC E;  1BKN A;  4JYA I;  2LJP A;  3HUL A;  1FI4 A;  2HKJ A;  1ZXM A;  4X66 I;  4PRV A;  3K1J A;  4DPW A;  1FJG E;  2R3V A;  1MG7 A;  2UUC I;  1XMQ E;  4DV7 E;  4P52 A;  4WUC A;  1HNW I;  2HKE A;  4X66 E;  2A2D A;  4Z7Y A;  4JI4 E;  4LFB I;  1XMO E;  1IBM I;  1ZM3 A;  4B3M I;  5IWA I;  1Z0C A;  1J5E E;  2BM1 A;  1DAR A;  2UUC E;  4B3S I; 
#chains in the Genus database with same CATH topology
 2F1D A;  3Q1Q A;  2NN6 C;  2BR2 A;  4MU4 A;  4IFD F;  4OZE A;  2XEX A;  4JI6 I;  1Z5B A;  2JE6 B;  1NZ0 A;  3J81 Q;  5K36 A;  4I3H A;  1NHH A;  4IZJ A;  2J7K A;  5GMD A;  1IBM E;  5K36 D;  4Z7C A;  1HR0 E;  4IZJ D;  4B3M E;  3J7A G;  2UU9 I;  5JEA C;  1HNX E;  2V2Z A;  2IER A;  2IES A;  2CZ9 A;  1NHI A;  4FW5 A;  2X36 A;  4LF4 E;  1OYP A;  1XNR I;  2C38 B;  4JI2 E;  2JE6 A;  4BA1 B;  4BA2 B;  3LNU A;  2UXB I;  5JEA A;  3V5R A;  4AIM A;  4NXM I;  4JI5 I;  4GKK E;  5JEA D;  2E5L I;  2UXD I;  2UU9 E;  3P76 A;  3QT7 A;  4DR5 E;  2VQF I;  1H7U A;  4B3R I;  4KHP I;  4DR4 I;  4LFC E;  1XNR E;  4NXN I;  2F4V E;  4BA1 A;  2HHH I;  3D4J A;  2AJ4 A;  4YY3 I;  2UXB E;  2HFU A;  4NXM E;  4JI5 E;  5C0X F;  3ZM7 A;  1HNZ E;  1Z5A A;  1XXE A;  2IOQ A;  3PYE A;  4PU9 A;  5DNX A;  4K0K E;  2HFS A;  2V8P A;  1Z0T A;  2VQF E;  4LCH A;  4KHP E;  1S16 A;  1UDN A;  3M7N D;  3LPS A;  3U1K A;  3T1H I;  1I94 E;  3J7A M;  1PIE A;  2HHH E;  4N3O A;  4OO1 E;  4YY3 E;  5ELW A;  4DPY A;  4OO1 B;  1B63 A;  1Y4U A;  1FNM A;  3PYD A;  3CDJ A;  1ZM2 A;  1D6T A;  5FLX C;  2DEJ A;  4JI8 I;  4DUZ E;  4AQY I;  1WUU A;  1UDO A;  2VF3 A;  1Z0E A;  2JEB B;  3PYG A;  2V2V A;  4URL A;  5L3J A;  3T1H E;  1Z0G A;  1OJ4 A;  3QT5 A;  5LMN I;  1IBL E;  3WU5 A;  1XHK A;  4GKJ E;  1RHY A;  4NBQ A;  3ZZU A;  4JI7 E;  2CVE A;  1ZXN A;  4LF7 E;  1OYS A;  2Q2E B;  4IFD C;  4JI0 E;  4IZK A;  2NPF A;  2O1V A;  1K47 A;  2Z5E A;  4JI8 E;  3M85 G;  1MU5 A;  4FWD A;  2JEB A;  4UTG A;  1N36 I;  2ZM6 I;  4QNJ A;  1Y4S A;  2PNZ A;  1KKH A;  4JYA E;  1Y60 A;  4FWH A;  3GCM A;  4HY1 A;  3CDI A;  5K36 E;  1QZR A;  4LF9 I;  4HYM A;  2NN6 E;  5K36 B;  4IZJ B;  3K85 A;  3K17 A;  2VQE I;  2NN6 B;  1R6M A;  3P06 A;  5DNL A;  4FWG A;  3ZKB A;  5IT9 Q;  3ZZ0 A;  4X62 I;  1N36 E;  3GME A;  1PKP A;  5GME A;  4HAC A;  2V34 A;  1HNW E;  5JEA E;  3WU4 A;  1EI1 A;  4LF9 E;  4ISA A;  4DR2 I;  1USU A;  4P7A A;  4B3T I;  4LFA I;  4OX9 I;  4J3D A;  3U1Y A;  5JEA B;  4LFB E;  3WU3 A;  3QT8 A;  2NN6 A;  2VQE E;  4DR1 I;  1B62 A;  4XTJ A;  5IWA E;  1PVG A;  3B8H A;  2NN6 D;  4DR7 I;  5LMU I;  4B3S E;  2GO3 A;  5C0X C;  4DV3 I;  4X62 E;  1Z0B A;  1ZM9 A;  4JI6 E;  1YHC A;  4DR2 E;  5BR8 I;  1UDQ A;  4MQY A;  4HXZ A;  2A2C A;  4OX9 E;  2IOP A;  5C0X A;  4U3D A;  3J81 C;  3KRN A;  4DPT A;  3Q6M A;  5C0X D;  2PO0 A;  3JAM Q;  4AM3 A;  1N0V C;  4PRX A;  5LMU E;  2PO2 B;  1FWL A;  4LF8 I;  3UHM A;  4DUY I;  1VI7 A;  3H4L A;  1IBK I;  2R42 A;  5BR8 E;  4FW7 A;  4FW6 A;  4DV4 I;  1EA6 A;  2WW4 A;  2E5L E;  2UXD E;  4USK A;  1P42 A;  2PO2 A;  1Z0W A;  5A2Q Q;  4LF8 E;  4B3R E;  1Y5Y A;  3LTO A;  4DV0 I;  1R6L A;  4OKG A;  4DUY E;  3B78 A;  4DR4 E;  2WNR B;  1IBK E;  4NXN E;  5LL6 R;  2O1U A;  4JI1 I;  4WUB A;  2DEI A;  4DV1 I;  3PS3 A;  2BA1 G;  4DPX A;  2C37 A;  4LF6 I;  4IZK B;  2PNM A;  3DD6 A;  5DRP A;  2UUB I;  4KQV A;  2BA0 G;  4DV0 E;  2JEA B;  2WNR A;  4ED4 A;  4EMD A;  4DR3 I;  3WU6 A;  4JI1 E;  4IFD B;  1H74 A;  2UXC I;  2PNZ B;  1NHJ A;  1MX0 A;  4MU3 A;  2J65 A;  4LF6 E;  1FWK A;  4IS9 A;  1KTV A;  1H73 A;  3ZKD A;  4AQY E;  1Z59 A;  1FKA E;  2VES A;  2JEA A;  3T1Y I;  1H72 C;  1ELO A;  5LMN E;  1XMQ I;  4DR3 E;  4IFD A;  2Z5B A;  2BV3 A;  4HAC B;  4USM A;  4IFD D;  4DV2 I;  5DRQ A;  1H7S A;  4RPF A;  4JI4 I;  2PO1 A;  3Q6N A;  1XMO I;  2O1T A;  3F0N A;  3J80 Q;  1RR9 A;  3V2U C;  3T1Y E;  4LCG A;  3L7Z B;  1J5E I;  4JG4 A;  5FWK A;  2ZM6 E;  4JV5 I;  4JI3 I;  1UDS A;  2Z5C B;  1HK7 A;  4QNK A;  4DV2 E;  2BA1 D;  4DU7 A;  5C0X E;  4OO1 F;  2GS8 A;  4X65 I;  4WUD A;  5C0X B;  2CGE A;  4MYU A;  2BA0 D;  2X7I A;  2ZIT A;  1HR0 I;  2O3Z A;  5EL9 A;  3L7Z A;  2PO0 B;  2V2Q A;  3J80 C;  3CWV A;  1Z5C A;  4FW3 A;  4FW9 A;  1HNX I;  4DPU A;  2ZBK B;  3PS2 A;  4JV5 E;  2GO4 A;  4ZVI A;  5IT9 C;  4JI3 E;  2UUA I;  2Z5C A;  1XNQ I;  1OYR A;  3M7N G;  4LF4 I;  4R1F A;  1VIS A;  4JI2 I;  4B3T E;  4LFA E;  4X64 I;  4X65 E;  3P3E A;  4GKK I;  3M85 D;  4DR1 E;  3PYF A;  2CG9 A;  2JT2 A;  4DR7 E;  4DV6 I;  4DV3 E;  5DRR A;  4DR5 I;  1N0U A;  2BM0 A;  2UUA E;  1XNQ E;  4LFC I;  3OTO I;  2F4V I;  3PS1 A;  4U3B A;  4X64 E;  4UT4 A;  4DR6 I;  5K36 F;  3B4T A;  2C37 B;  3B82 A;  1HNZ I;  3PRY A;  1N33 I;  2NN6 F;  4DV6 E;  4K0K I;  3JAM C;  1N32 I;  2EFG A;  1KVK A;  2HK2 A;  3M6A A;  1I94 I;  2C38 A;  2OI2 A;  4DV5 I;  3OTO E;  1Z0V A;  4BA2 A;  4LCF A;  4DV4 E;  1RRE A;  4DU8 A;  4AID A;  4DR6 E;  2O1W A;  5JEA F;  5FLX Q;  2AE8 A;  3P3G A;  2C39 B;  1N33 E;  4FN5 A;  4YHH I;  2WP8 B;  4LF5 I;  4DUZ I;  4LPF A;  1N32 E;  4DXL A;  1Y6Z A;  4IFD E;  5A2Q C;  3HKM A;  1ZM4 A;  1N34 I;  3GON A;  4DV5 E;  1IBL I;  4GKJ I;  2Z5B B;  3ZZT A;  4JI7 I;  4LOM A;  4DV1 E;  1A6F A;  1E3P A;  1U2R A;  4GQU A;  1USV A;  2E1R A;  3GLL A;  4LF7 I;  4JI0 I;  2C39 A;  1YH8 A;  1UEK A;  4M1K A;  4YHH E;  3H1C A;  2UUB E;  2PO1 B;  2WP8 A;  4LF5 E;  4OO1 C;  1E3H A;  1FJG I;  3QT6 A;  4MYT A;  1N34 E;  4DV7 I;  2HK3 A;  1KIJ A;  1S4E A;  2UXC E;  1BKN A;  4JYA I;  2LJP A;  3HUL A;  1FI4 A;  2HKJ A;  1ZXM A;  4OO1 A;  4X66 I;  4FW4 A;  4OO1 D;  4PRV A;  3K1J A;  2GQ0 A;  4MDT A;  3P3C A;  4DPW A;  1FJG E;  2R3V A;  1MG7 A;  2UUC I;  1XMQ E;  4MU0 A;  3NZK A;  4DV7 E;  2BR2 B;  2PNL A;  4P52 A;  4WUC A;  1HNW I;  2HKE A;  3HJC A;  4X66 E;  2A2D A;  4Z7Y A;  4JI4 E;  4LFB I;  1XMO E;  1IBM I;  1ZM3 A;  5DRO A;  4B3M I;  4MU1 A;  1Z0C A;  5IWA I;  1J5E E;  2BM1 A;  1DAR A;  5K36 C;  2UUC E;  5EKW A;  4B3S I; 
#chains in the Genus database with same CATH homology
 3Q1Q A;  2XEX A;  4JI6 I;  1Z5B A;  1NZ0 A;  3J81 Q;  4I3H A;  1NHH A;  4IZJ A;  2J7K A;  5GMD A;  1IBM E;  4Z7C A;  1HR0 E;  4IZJ D;  4B3M E;  3J7A G;  2UU9 I;  1HNX E;  2V2Z A;  2CZ9 A;  1NHI A;  2X36 A;  4LF4 E;  1XNR I;  4JI2 E;  3LNU A;  2UXB I;  3V5R A;  4NXM I;  4JI5 I;  4GKK E;  2E5L I;  2UXD I;  2UU9 E;  3QT7 A;  4DR5 E;  2VQF I;  1H7U A;  4B3R I;  4KHP I;  4DR4 I;  4LFC E;  1XNR E;  4NXN I;  2F4V E;  2HHH I;  3D4J A;  2AJ4 A;  4YY3 I;  2UXB E;  2HFU A;  4NXM E;  4JI5 E;  3ZM7 A;  1HNZ E;  1Z5A A;  2IOQ A;  3PYE A;  4PU9 A;  4K0K E;  2HFS A;  2V8P A;  1Z0T A;  2VQF E;  4KHP E;  1S16 A;  3LPS A;  3T1H I;  1I94 E;  3J7A M;  1PIE A;  2HHH E;  4N3O A;  4YY3 E;  4DPY A;  1B63 A;  1Y4U A;  1FNM A;  3PYD A;  1ZM2 A;  1D6T A;  5FLX C;  2DEJ A;  4JI8 I;  4DUZ E;  4AQY I;  1WUU A;  2VF3 A;  1Z0E A;  5L3J A;  3PYG A;  2V2V A;  4URL A;  3T1H E;  1Z0G A;  1OJ4 A;  3QT5 A;  5LMN I;  1IBL E;  3WU5 A;  1XHK A;  4GKJ E;  3ZZU A;  4JI7 E;  1ZXN A;  4LF7 E;  2Q2E B;  4JI0 E;  4IZK A;  2NPF A;  2O1V A;  1K47 A;  2Z5E A;  4JI8 E;  1MU5 A;  4FWD A;  4UTG A;  1N36 I;  2ZM6 I;  1Y4S A;  1KKH A;  4JYA E;  4FWH A;  4HY1 A;  1QZR A;  4LF9 I;  4HYM A;  4IZJ B;  3K85 A;  3K17 A;  2VQE I;  3P06 A;  4FWG A;  3ZKB A;  5IT9 Q;  3ZZ0 A;  4X62 I;  1N36 E;  1PKP A;  5GME A;  4HAC A;  2V34 A;  1HNW E;  3WU4 A;  1EI1 A;  4LF9 E;  4DR2 I;  1USU A;  4P7A A;  4B3T I;  4LFA I;  4OX9 I;  4LFB E;  3WU3 A;  3QT8 A;  2VQE E;  4DR1 I;  1B62 A;  4XTJ A;  5IWA E;  1PVG A;  3B8H A;  4DR7 I;  5LMU I;  4B3S E;  4DV3 I;  4X62 E;  1Z0B A;  1ZM9 A;  4JI6 E;  4DR2 E;  5BR8 I;  4HXZ A;  2A2C A;  4OX9 E;  2IOP A;  3J81 C;  4DPT A;  3Q6M A;  3JAM Q;  1N0V C;  4PRX A;  5LMU E;  1FWL A;  4LF8 I;  4DUY I;  3H4L A;  1IBK I;  2R42 A;  5BR8 E;  4DV4 I;  1EA6 A;  2WW4 A;  2E5L E;  2UXD E;  4USK A;  1Z0W A;  5A2Q Q;  4LF8 E;  4B3R E;  3LTO A;  4DV0 I;  4DUY E;  3B78 A;  4DR4 E;  1IBK E;  4NXN E;  5LL6 R;  2O1U A;  4JI1 I;  4WUB A;  2DEI A;  4DV1 I;  4DPX A;  4LF6 I;  4IZK B;  2PNM A;  2UUB I;  4KQV A;  4DV0 E;  4ED4 A;  4EMD A;  4DR3 I;  3WU6 A;  4JI1 E;  1H74 A;  2UXC I;  1NHJ A;  1MX0 A;  4LF6 E;  1FWK A;  1KTV A;  1H73 A;  3ZKD A;  4AQY E;  1Z59 A;  1FKA E;  3T1Y I;  1H72 C;  1ELO A;  5LMN E;  1XMQ I;  4DR3 E;  2Z5B A;  2BV3 A;  4HAC B;  4USM A;  4DV2 I;  1H7S A;  4RPF A;  4JI4 I;  3Q6N A;  1XMO I;  2O1T A;  3F0N A;  3J80 Q;  1RR9 A;  3V2U C;  3T1Y E;  1J5E I;  4JG4 A;  5FWK A;  2ZM6 E;  4JV5 I;  4JI3 I;  2Z5C B;  1HK7 A;  4DV2 E;  4DU7 A;  2GS8 A;  4X65 I;  4WUD A;  2CGE A;  4MYU A;  2X7I A;  2ZIT A;  1HR0 I;  2V2Q A;  3J80 C;  3CWV A;  1Z5C A;  4FW9 A;  1HNX I;  4DPU A;  2ZBK B;  4JV5 E;  4ZVI A;  5IT9 C;  4JI3 E;  2UUA I;  2Z5C A;  1XNQ I;  4LF4 I;  4R1F A;  1VIS A;  4JI2 I;  4B3T E;  4LFA E;  4X64 I;  4X65 E;  4GKK I;  4DR1 E;  3PYF A;  2CG9 A;  4DR7 E;  4DV6 I;  4DV3 E;  4DR5 I;  1N0U A;  2BM0 A;  2UUA E;  1XNQ E;  4LFC I;  3OTO I;  2F4V I;  4X64 E;  4UT4 A;  4DR6 I;  3B82 A;  1HNZ I;  3PRY A;  1N33 I;  4DV6 E;  4K0K I;  3JAM C;  1N32 I;  2EFG A;  1KVK A;  2HK2 A;  3M6A A;  1I94 I;  2OI2 A;  4DV5 I;  3OTO E;  1Z0V A;  4DV4 E;  1RRE A;  4DU8 A;  4DR6 E;  2O1W A;  5FLX Q;  1N33 E;  4FN5 A;  4YHH I;  4LF5 I;  4DUZ I;  1N32 E;  4DXL A;  1Y6Z A;  5A2Q C;  1ZM4 A;  1N34 I;  3GON A;  4DV5 E;  1IBL I;  4GKJ I;  2Z5B B;  3ZZT A;  4JI7 I;  4DV1 E;  1A6F A;  1U2R A;  1USV A;  2E1R A;  4LF7 I;  4JI0 I;  1UEK A;  4M1K A;  4YHH E;  2UUB E;  4LF5 E;  1FJG I;  3QT6 A;  4MYT A;  1N34 E;  4DV7 I;  2HK3 A;  1KIJ A;  1S4E A;  2UXC E;  1BKN A;  4JYA I;  2LJP A;  3HUL A;  1FI4 A;  2HKJ A;  1ZXM A;  4X66 I;  4PRV A;  3K1J A;  2GQ0 A;  4DPW A;  1FJG E;  2R3V A;  1MG7 A;  2UUC I;  1XMQ E;  4DV7 E;  2PNL A;  4P52 A;  4WUC A;  1HNW I;  2HKE A;  3HJC A;  4X66 E;  2A2D A;  4Z7Y A;  4JI4 E;  4LFB I;  1XMO E;  1IBM I;  1ZM3 A;  4B3M I;  5IWA I;  1Z0C A;  1J5E E;  2BM1 A;  1DAR A;  2UUC E;  4B3S I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...