1RREA

Crystal structure of e.coli lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent protease La
publication title The catalytic domain of Escherichia coli Lon protease has a unique fold and a Ser-Lys dyad in the active site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 53
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2003-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1rreA01
3V5RA 4DV4I 1S16A 4DXLA 4DV3E 2ZITA 3J7AM 3WU4A 3V2UC 4B3TE 1N33E 2V8PA 2VQEE 2ZM6E 1XMQE 4X65I 4LFBE 4DPTA 1Z0EA 4DR1I 1ZM3A 2HFSA 3PYGA 4WUBA 2NPFA 1HNWE 1IBLI 3D4JA 4XTJA 1BKNA 3ZM7A 4NXME 4DPWA 1PIEA 3T1HI 4B3ME 2J7KA 3B82A 4JI0E 1XNRE 2A2CA 4HACA 3WU3A 2X36A 1WUUA 2UXCE 4AQYE 4X66E 4JI4E 1N36I 4YY3I 2V2VA 1XMOE 1IBKE 4DPXA 2V2ZA 3LPSA 5IT9Q 4PRXA 1H7SA 5IWAE 4KHPI 4FWHA 5GMDA 2BV3A 4DV0E 2ZBKB 4DV6I 1ELOA 1ZM4A 3WU5A 1B63A 5LMNE 2UU9E 1FJGE 1DARA 3J81Q 1FWKA 3ZZ0A 1HNXI 1HR0E 3B78A 2HKJA 2UUAI 1QZRA 3ZKBA 4LFAI 2E5LE 2HK2A 4ED4A 5IT9C 1MX0A 1MG7A 1N34I 4JI2I 2V2QA 4JI5I 4LF8I 1J5EE 4JI3I 2GS8A 4FWGA 4DR7E 4R1FA 2OI2A 4DV1I 5FLXQ 4LF5E 4DUZI 4DV3I 1XHKA 1N33I 4B3TI 4YHHE 2VQEI 2ZM6I 1XMQI 3JAMQ 4P52A 1Z0CA 4LFBI 4URLA 4LF9E 3QT6A 3J7AG 4X64E 4DR3E 4DUYE 4FWDA 1HNWI 2UXDE 1RREA 2F4VE 4OX9E 1FNMA 4NXMI 3JAMC 2VQFE 4B3MI 5BR8E 4JI0I 1XNRI 1NHHA 4M1KA 1PKPA 1N32E 1ZXMA 4Z7CA 2UXCI 4AQYI 4X66I 4JI4I 1XMOI 1IBKI 1Z0BA 3PYEA 3F0NA 4DR5E 5IWAI 3WU6A 4JG4A 1XNQE 4JV5E 4JI8E 1Z5CA 4DV0I 1ZM2A 4LF7E 1KTVA 2UU9I 5LMNI 1N0VC 1FJGI 1Z0GA 1Z0VA 4MYUA 1HR0I 1NHJA 2EFGA 2UXBE 2HHHE 2E5LI 4UT4A 3QT7A 4WUDA 4DR2E 5LMUE 4PRVA 5A2QQ 4JI1I 4DV5E 1A6FA 4DU8A 2AJ4A 4UTGA 1NHIA 1J5EI 2UUCE 1KIJA 4DR7I 2HFUA 4LF5I 1H72C 4LF4E 1Z0WA 1EI1A 2HK3A 4K0KE 3K1JA 4YHHI 5A2QC 1OJ4A 4LF6E 4JI1E 2A2DA 2BM0A 2WW4A 4FN5A 4HY1A 3J81C 4LF9I 1HNZE 3CWVA 1D6TA 1Z0TA 4LFCE 4GKKE 4X64I 4DR3I 4DUYI 4EMDA 1PVGA 4JYAE 3QT8A 2UXDI 2F4VI 4OX9I 3ZZUA 3T1YE 3M6AA 2CZ9A 2VQFI 4I3HA 5BR8I 1N32I 2E1RA 3GONA 4WUCA 5GMEA 1IBME 4USKA 5FLXC 1S4EA 4DR5I 4JI6E 2R42A 4GKJE 3HULA 5L3JA 1XNQI 4JV5I 4JI8I 4B3SE 4LF7I 4HXZA 4NXNE 4DV7E 4P7AA 1Z5AA 2V34A 1FWLA 4B3RE 1FKAE 2UUBE 1I94E 2UXBI 4DV2E 3OTOE 2HHHI 4X62E 4USMA 1ZXNA 2HKEA 4DR2I 5LMUI 3H4LA 4DR4I 4JI7E 4Z7YA 1EA6A 4DV5I 4PU9A 4DU7A 4DR6E 2UUCI 2R3VA 3ZZTA 4DR4E 4LF4I 4DV4E 2DEJA 5LL6R 4DPYA 4K0KI 1KVKA 1VISA 1B62A 4LF6I 4RPFA 4X65E 3LNUA 1UEKA 1HNZI 1Z5BA 4MYTA 3ZKDA 4DR1E 4LFCI 4GKKI 4KQVA 3QT5A 1FI4A 4JYAI 3B8HA 1IBLE 3T1YI 2XEXA 3T1HE 4HACB 3K17A 1K47A 1KKHA 1NZ0A 1ZM9A 1N36E 1IBMI 2BM1A 3LTOA 4YY3E 1Z59A 2LJPA 1H74A 2X7IA 4JI6I 4GKJI 4KHPE 4DPUA 4DV6E 4B3SI 4NXNI 4DV7I 2VF3A 3J80Q 1N0UA 1MU5A 1H73A 1HNXE 2DEIA 4B3RI 4ZVIA 1RR9A 2UUBI 2UUAE 4LFAE 1I94I 4DV2I 3OTOI 4X62I 3PYDA 3Q1QA 4JI7I 3PYFA 2Q2EB 4FW9A 1N34E 4JI2E 3J80C 1U2RA 4JI5E 4LF8E 4JI3E 4DR6I 4HYMA 4DV1E 1H7UA 4DUZE
chains in the Genus database with same CATH superfamily
2PNLA 3V5RA 4DV4I 1S16A 4DXLA 4DV3E 2ZITA 2WNRB 3J7AM 3WU4A 3V2UC 4B3TE 1N33E 3P3EA 2V8PA 2VQEE 2ZM6E 1XMQE 2CVEA 4X65I 1OYSA 4LFBE 4DPTA 1Z0EA 4MU0A 4DR1I 4GQUA 1ZM3A 2HFSA 3PYGA 1UDSA 4WUBA 1UDQA 3P3GA 2NPFA 1HNWE 1IBLI 3D4JA 4XTJA 4AIDA 1BKNA 3ZM7A 2BR2A 4NXME 4DPWA 1PIEA 3T1HI 4B3ME 2J7KA 3L7ZA 3B82A 4JI0E 1XNRE 2A2CA 2PO2A 4HACA 3WU3A 2X36A 1WUUA 2O1UA 2UXCE 4AQYE 4OO1F 4X66E 4JI4E 1N36I 5JEAB 4YY3I 3PS1A 2V2VA 3HJCA 1XMOE 1IBKE 4IZKA 4DPXA 4OO1E 2V2ZA 1RHYA 3LPSA 2C38A 5IT9Q 4PRXA 2Z5BA 5DNLA 1H7SA 5IWAE 4KHPI 4FWHA 5GMDA 2BV3A 3UHMA 4IFDF 4DV0E 2ZBKB 5K36F 4DV6I 1ELOA 1ZM4A 1YHCA 3WU5A 2NN6A 1B63A 3U1YA 5LMNE 2UU9E 2CG9A 1FJGE 1DARA 3J81Q 1FWKA 3ZZ0A 1HNXI 1HR0E 3B78A 1R6MA 2HKJA 1E3HA 2UUAI 4OZEA 1QZRA 3ZKBA 4LFAI 2E5LE 2IERA 4OO1A 2HK2A 4ED4A 5IT9C 2O1TA 1MX0A 1MG7A 4MQYA 2JT2A 1N34I 3P76A 4JI2I 2V2QA 4N3OA 4IFDA 4JI5I 3PS3A 1J5EE 4LF8I 4JI3I 5K36A 2GS8A 4FWGA 5C0XA 3M85G 4DR7E 4R1FA 2NN6C 2OI2A 4DV1I 4OO1D 5FLXQ 4LF5E 4DUZI 2JEAA 2BA0G 2PO0B 4DV3I 1XHKA 4MU3A 1N33I 4B3TI 4YHHE 3KRNA 2WNRA 2VQEI 2ZM6I 1XMQI 1E3PA 3JAMQ 5DRQA 4P52A 4IFDD 1Z0CA 5K36D 4LFBI 4URLA 4LF9E 3QT6A 3J7AG 5JEAF 2JE6B 2WP8B 4X64E 4ISAA 5DRPA 4DR3E 4DUYE 4FWDA 5JEAE 5DRRA 4QNJA 5K36C 1HNWI 2UXDE 1RREA 2F4VE 5C0XC 4OX9E 1FNMA 4NXMI 3JAMC 2VQFE 5FWKA 4B3MI 3Q6MA 5BR8E 2J65A 4JI0I 2O1VA 1XNRI 1NHHA 2PO1B 4M1KA 1PKPA 1N32E 1ZXMA 3M85D 4Z7CA 2UXCI 4AQYI 4X66I 4JI4I 5ELWA 2BA0D 1XMOI 1IBKI 1Z0BA 5JEAA 3PYEA 3F0NA 4DR5E 5IWAI 2GQ0A 3WU6A 4JG4A 1XNQE 4JV5E 1XXEA 4JI8E 1Z5CA 4DV0I 2GO3A 1ZM2A 4LF7E 1KTVA 4IZJB 2UU9I 5LMNI 1N0VC 1Y60A 1FJGI 4LPFA 1Z0GA 1Z0VA 4MYUA 1HR0I 1NHJA 5JEAD 2EFGA 2UXBE 2C39A 1Y4SA 2E5LI 2HHHE 4BA2A 4UT4A 3QT7A 4WUDA 4DR2E 5LMUE 4PRVA 5A2QQ 4JI1I 4DV5E 1A6FA 4DU8A 3M7NG 2AJ4A 4UTGA 1NHIA 1J5EI 2UUCE 3U1KA 1KIJA 4DR7I 1Y5YA 2HFUA 2PNZB 2C37A 3K85A 4LF5I 1H72C 4LF4E 1Z0WA 1R6LA 1EI1A 2HK3A 2Z5CB 2PO0A 4K0KE 3K1JA 2VESA 4YHHI 5A2QC 1OJ4A 1YH8A 4J3DA 4LF6E 3B4TA 4JI1E 3HKMA 2A2DA 2BM0A 2WW4A 4FN5A 3P06A 4HY1A 3J81C 4QNKA 4LF9I 1HNZE 3CWVA 3H1CA 1D6TA 1Z0TA 4LFCE 4GKKE 2JE6A 4X64I 4FW3A 4DR3I 4DUYI 4EMDA 1PVGA 4JYAE 3QT8A 2UXDI 2F4VI 4OX9I 3ZZUA 5EKWA 3T1YE 3M6AA 3M7ND 2CZ9A 2VQFI 4I3HA 5BR8I 4OO1C 1N32I 2E1RA 4FW6A 2PO1A 1HK7A 1P42A 3GONA 4WUCA 1Y4UA 5GMEA 3GLLA 3NZKA 1IBME 4USKA 5FLXC 4MDTA 4U3BA 1S4EA 4IFDC 3PS2A 4DR5I 4JI6E 2R42A 4GKJE 3HULA 5L3JA 1XNQI 4JV5I 4JI8I 4B3SE 4LF7I 1UDNA 4HXZA 4NXNE 4DV7E 4P7AA 1Z5AA 2V34A 1FWLA 4IZJA 2PNMA 4B3RE 1FKAE 2JEBB 2UUBE 1USVA 1I94E 2UXBI 4DV2E 3OTOE 2HHHI 4X62E 4USMA 1ZXNA 2HKEA 4DR2I 5LMUI 4NBQA 3H4LA 4DR4I 4JI7E 4Z7YA 1EA6A 4DV5I 4PU9A 3DD6A 4IZJD 4BA1B 4LCGA 5DROA 3GCMA 4DU7A 1UDOA 1OYRA 4DR6E 2UUCI 2R3VA 4LCFA 3PRYA 3ZZTA 4DR4E 2PNZA 4LF4I 2NN6F 4IS9A 4DV4E 2DEJA 5LL6R 4DPYA 2O1WA 4K0KI 1KVKA 1VISA 4AIMA 3CDJA 4FW5A 2NN6E 1B62A 2Z5CA 4MU1A 2GO4A 5JEAC 4LF6I 4RPFA 4X65E 3LNUA 1UEKA 4U3DA 2Z5EA 1HNZI 1Z5BA 4MYTA 3ZKDA 4DR1E 4LFCI 4GKKI 2AE8A 2F1DA 5EL9A 4KQVA 3QT5A 1FI4A 4JYAI 3B8HA 2BR2B 4LCHA 1IBLE 3T1YI 2O3ZA 2XEXA 3L7ZB 3P3CA 3T1HE 2PO2B 4HACB 5C0XF 3K17A 4IFDE 1VI7A 5K36E 4OKGA 5C0XE 1K47A 1KKHA 1NZ0A 2IOPA 1ZM9A 1N36E 2C39B 4IZKB 1IBMI 2BM1A 3LTOA 4YY3E 1Z59A 4BA2B 2WP8A 4MU4A 2LJPA 4FW7A 2C38B 2Z5BB 2BA1G 1H74A 2X7IA 4JI6I 1Y6ZA 4GKJI 4KHPE 2NN6D 2NN6B 4DPUA 4DV6E 4B3SI 4NXNI 4DV7I 2IESA 2VF3A 3J80Q 1N0UA 1MU5A 1H73A 2C37B 1HNXE 2DEIA 4B3RI 4ZVIA 4OO1B 1RR9A 2UUBI 2UUAE 4LFAE 1I94I 2IOQA 4DV2I 2JEBA 3OTOI 4X62I 3PYDA 1USUA 3Q1QA 4JI7I 4AM3A 3CDIA 3PYFA 2CGEA 2Q2EB 3GMEA 4FW9A 1N34E 4IFDB 4JI2E 5C0XD 3J80C 5K36B 5DNXA 1U2RA 5C0XB 4BA1A 4JI5E 4LF8E 4LOMA 4JI3E 4DR6I 1OYPA 4FW4A 3Q6NA 4HYMA 2JEAB 4DV1E 1H7UA 2BA1D 4DUZE
chains in the Genus database with same CATH topology
2PNLA 3V5RA 4DV4I 1S16A 4DXLA 4DV3E 2ZITA 3J7AM 3WU4A 3V2UC 4B3TE 1N33E 2V8PA 2VQEE 2ZM6E 1XMQE 4X65I 4LFBE 4DPTA 1Z0EA 4DR1I 1ZM3A 2HFSA 3PYGA 4WUBA 2NPFA 1HNWE 1IBLI 3D4JA 4XTJA 1BKNA 3ZM7A 4NXME 4DPWA 1PIEA 3T1HI 4B3ME 2J7KA 3B82A 4JI0E 1XNRE 2A2CA 4HACA 3WU3A 2X36A 1WUUA 2O1UA 2UXCE 4AQYE 4X66E 4JI4E 1N36I 4YY3I 2V2VA 3HJCA 1XMOE 1IBKE 4IZKA 4DPXA 2V2ZA 3LPSA 5IT9Q 4PRXA 2Z5BA 1H7SA 5IWAE 4KHPI 4FWHA 5GMDA 2BV3A 4DV0E 2ZBKB 4DV6I 1ELOA 1ZM4A 3WU5A 1B63A 5LMNE 2UU9E 2CG9A 1FJGE 1DARA 3J81Q 1FWKA 3ZZ0A 1HNXI 1HR0E 3B78A 2HKJA 2UUAI 1QZRA 3ZKBA 4LFAI 2E5LE 2HK2A 4ED4A 5IT9C 2O1TA 1MX0A 1MG7A 1N34I 4JI2I 2V2QA 4N3OA 4JI5I 4LF8I 1J5EE 4JI3I 2GS8A 4FWGA 4DR7E 4R1FA 2OI2A 4DV1I 5FLXQ 4LF5E 4DUZI 4DV3I 1XHKA 1N33I 4B3TI 4YHHE 2VQEI 2ZM6I 1XMQI 3JAMQ 4P52A 1Z0CA 4LFBI 4URLA 4LF9E 3QT6A 3J7AG 4X64E 4DR3E 4DUYE 4FWDA 1HNWI 2UXDE 1RREA 2F4VE 4OX9E 1FNMA 4NXMI 3JAMC 2VQFE 5FWKA 4B3MI 3Q6MA 5BR8E 4JI0I 2O1VA 1XNRI 1NHHA 4M1KA 1PKPA 1N32E 1ZXMA 4Z7CA 2UXCI 4AQYI 4X66I 4JI4I 1XMOI 1IBKI 1Z0BA 3PYEA 3F0NA 4DR5E 5IWAI 2GQ0A 3WU6A 4JG4A 1XNQE 4JV5E 4JI8E 1Z5CA 4DV0I 1ZM2A 4LF7E 1KTVA 4IZJB 2UU9I 5LMNI 1N0VC 1FJGI 1Z0GA 1Z0VA 4MYUA 1HR0I 1NHJA 2EFGA 2UXBE 1Y4SA 2E5LI 2HHHE 4UT4A 3QT7A 4WUDA 4DR2E 5LMUE 4PRVA 5A2QQ 4DV5E 4JI1I 1A6FA 4DU8A 2AJ4A 4UTGA 1NHIA 1J5EI 2UUCE 1KIJA 4DR7I 2HFUA 3K85A 4LF5I 1H72C 4LF4E 1Z0WA 1EI1A 2HK3A 2Z5CB 4K0KE 3K1JA 4YHHI 5A2QC 1OJ4A 4LF6E 4JI1E 2A2DA 2BM0A 2WW4A 4FN5A 3P06A 4HY1A 3J81C 4LF9I 1HNZE 3CWVA 1D6TA 1Z0TA 4LFCE 4GKKE 4X64I 4DR3I 4DUYI 4EMDA 1PVGA 4JYAE 3QT8A 2UXDI 2F4VI 4OX9I 3ZZUA 3T1YE 3M6AA 2CZ9A 2VQFI 4I3HA 5BR8I 1N32I 2E1RA 1HK7A 3GONA 4WUCA 1Y4UA 5GMEA 1IBME 4USKA 5FLXC 1S4EA 4DR5I 4JI6E 2R42A 4GKJE 3HULA 5L3JA 1XNQI 4JV5I 4JI8I 4B3SE 4LF7I 4HXZA 4NXNE 4DV7E 4P7AA 1Z5AA 2V34A 1FWLA 4IZJA 2PNMA 4B3RE 1FKAE 2UUBE 1USVA 1I94E 2UXBI 4DV2E 3OTOE 2HHHI 4X62E 4USMA 1ZXNA 2HKEA 4DR2I 5LMUI 3H4LA 4DR4I 4JI7E 4Z7YA 1EA6A 4DV5I 4PU9A 4IZJD 4DU7A 4DR6E 2UUCI 2R3VA 3PRYA 3ZZTA 4DR4E 4LF4I 4DV4E 2DEJA 5LL6R 4DPYA 2O1WA 4K0KI 1KVKA 1VISA 1B62A 2Z5CA 4LF6I 4RPFA 4X65E 3LNUA 1UEKA 2Z5EA 1HNZI 1Z5BA 4MYTA 3ZKDA 4DR1E 4LFCI 4GKKI 4KQVA 3QT5A 1FI4A 4JYAI 3B8HA 1IBLE 3T1YI 2XEXA 3T1HE 4HACB 3K17A 1K47A 1KKHA 1NZ0A 2IOPA 1ZM9A 1N36E 4IZKB 1IBMI 2BM1A 3LTOA 4YY3E 1Z59A 2LJPA 2Z5BB 1H74A 2X7IA 4JI6I 1Y6ZA 4GKJI 4KHPE 4DPUA 4DV6E 4B3SI 4NXNI 4DV7I 2VF3A 3J80Q 1N0UA 1MU5A 1H73A 1HNXE 2DEIA 4B3RI 4ZVIA 1RR9A 2UUBI 2UUAE 4LFAE 1I94I 2IOQA 4DV2I 3OTOI 4X62I 3PYDA 1USUA 3Q1QA 4JI7I 3PYFA 2CGEA 2Q2EB 4FW9A 1N34E 4JI2E 3J80C 1U2RA 4JI5E 4LF8E 4JI3E 4DR6I 3Q6NA 4HYMA 4DV1E 1H7UA 4DUZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5R A;  4DV4 I;  1S16 A;  4DXL A;  4DV3 E;  2ZIT A;  3J7A M;  3WU4 A;  3V2U C;  4B3T E;  1N33 E;  2V8P A;  2VQE E;  2ZM6 E;  1XMQ E;  4X65 I;  4LFB E;  4DPT A;  1Z0E A;  4DR1 I;  1ZM3 A;  2HFS A;  3PYG A;  4WUB A;  2NPF A;  1HNW E;  1IBL I;  3D4J A;  4XTJ A;  1BKN A;  3ZM7 A;  4NXM E;  4DPW A;  1PIE A;  3T1H I;  4B3M E;  2J7K A;  3B82 A;  4JI0 E;  1XNR E;  2A2C A;  4HAC A;  3WU3 A;  2X36 A;  1WUU A;  2UXC E;  4AQY E;  4X66 E;  4JI4 E;  1N36 I;  4YY3 I;  2V2V A;  1XMO E;  1IBK E;  4DPX A;  2V2Z A;  3LPS A;  5IT9 Q;  4PRX A;  1H7S A;  5IWA E;  4KHP I;  4FWH A;  5GMD A;  2BV3 A;  4DV0 E;  2ZBK B;  4DV6 I;  1ELO A;  1ZM4 A;  3WU5 A;  1B63 A;  5LMN E;  2UU9 E;  1FJG E;  1DAR A;  3J81 Q;  1FWK A;  3ZZ0 A;  1HNX I;  1HR0 E;  3B78 A;  2HKJ A;  2UUA I;  1QZR A;  3ZKB A;  4LFA I;  2E5L E;  2HK2 A;  4ED4 A;  5IT9 C;  1MX0 A;  1MG7 A;  1N34 I;  4JI2 I;  2V2Q A;  4JI5 I;  4LF8 I;  1J5E E;  4JI3 I;  2GS8 A;  4FWG A;  4DR7 E;  4R1F A;  2OI2 A;  4DV1 I;  5FLX Q;  4LF5 E;  4DUZ I;  4DV3 I;  1XHK A;  1N33 I;  4B3T I;  4YHH E;  2VQE I;  2ZM6 I;  1XMQ I;  3JAM Q;  4P52 A;  1Z0C A;  4LFB I;  4URL A;  4LF9 E;  3QT6 A;  3J7A G;  4X64 E;  4DR3 E;  4DUY E;  4FWD A;  1HNW I;  2UXD E;  1RRE A;  2F4V E;  4OX9 E;  1FNM A;  4NXM I;  3JAM C;  2VQF E;  4B3M I;  5BR8 E;  4JI0 I;  1XNR I;  1NHH A;  4M1K A;  1PKP A;  1N32 E;  1ZXM A;  4Z7C A;  2UXC I;  4AQY I;  4X66 I;  4JI4 I;  1XMO I;  1IBK I;  1Z0B A;  3PYE A;  3F0N A;  4DR5 E;  5IWA I;  3WU6 A;  4JG4 A;  1XNQ E;  4JV5 E;  4JI8 E;  1Z5C A;  4DV0 I;  1ZM2 A;  4LF7 E;  1KTV A;  2UU9 I;  5LMN I;  1N0V C;  1FJG I;  1Z0G A;  1Z0V A;  4MYU A;  1HR0 I;  1NHJ A;  2EFG A;  2UXB E;  2HHH E;  2E5L I;  4UT4 A;  3QT7 A;  4WUD A;  4DR2 E;  5LMU E;  4PRV A;  5A2Q Q;  4JI1 I;  4DV5 E;  1A6F A;  4DU8 A;  2AJ4 A;  4UTG A;  1NHI A;  1J5E I;  2UUC E;  1KIJ A;  4DR7 I;  2HFU A;  4LF5 I;  1H72 C;  4LF4 E;  1Z0W A;  1EI1 A;  2HK3 A;  4K0K E;  3K1J A;  4YHH I;  5A2Q C;  1OJ4 A;  4LF6 E;  4JI1 E;  2A2D A;  2BM0 A;  2WW4 A;  4FN5 A;  4HY1 A;  3J81 C;  4LF9 I;  1HNZ E;  3CWV A;  1D6T A;  1Z0T A;  4LFC E;  4GKK E;  4X64 I;  4DR3 I;  4DUY I;  4EMD A;  1PVG A;  4JYA E;  3QT8 A;  2UXD I;  2F4V I;  4OX9 I;  3ZZU A;  3T1Y E;  3M6A A;  2CZ9 A;  2VQF I;  4I3H A;  5BR8 I;  1N32 I;  2E1R A;  3GON A;  4WUC A;  5GME A;  1IBM E;  4USK A;  5FLX C;  1S4E A;  4DR5 I;  4JI6 E;  2R42 A;  4GKJ E;  3HUL A;  5L3J A;  1XNQ I;  4JV5 I;  4JI8 I;  4B3S E;  4LF7 I;  4HXZ A;  4NXN E;  4DV7 E;  4P7A A;  1Z5A A;  2V34 A;  1FWL A;  4B3R E;  1FKA E;  2UUB E;  1I94 E;  2UXB I;  4DV2 E;  3OTO E;  2HHH I;  4X62 E;  4USM A;  1ZXN A;  2HKE A;  4DR2 I;  5LMU I;  3H4L A;  4DR4 I;  4JI7 E;  4Z7Y A;  1EA6 A;  4DV5 I;  4PU9 A;  4DU7 A;  4DR6 E;  2UUC I;  2R3V A;  3ZZT A;  4DR4 E;  4LF4 I;  4DV4 E;  2DEJ A;  5LL6 R;  4DPY A;  4K0K I;  1KVK A;  1VIS A;  1B62 A;  4LF6 I;  4RPF A;  4X65 E;  3LNU A;  1UEK A;  1HNZ I;  1Z5B A;  4MYT A;  3ZKD A;  4DR1 E;  4LFC I;  4GKK I;  4KQV A;  3QT5 A;  1FI4 A;  4JYA I;  3B8H A;  1IBL E;  3T1Y I;  2XEX A;  3T1H E;  4HAC B;  3K17 A;  1K47 A;  1KKH A;  1NZ0 A;  1ZM9 A;  1N36 E;  1IBM I;  2BM1 A;  3LTO A;  4YY3 E;  1Z59 A;  2LJP A;  1H74 A;  2X7I A;  4JI6 I;  4GKJ I;  4KHP E;  4DPU A;  4DV6 E;  4B3S I;  4NXN I;  4DV7 I;  2VF3 A;  3J80 Q;  1N0U A;  1MU5 A;  1H73 A;  1HNX E;  2DEI A;  4B3R I;  4ZVI A;  1RR9 A;  2UUB I;  2UUA E;  4LFA E;  1I94 I;  4DV2 I;  3OTO I;  4X62 I;  3PYD A;  3Q1Q A;  4JI7 I;  3PYF A;  2Q2E B;  4FW9 A;  1N34 E;  4JI2 E;  3J80 C;  1U2R A;  4JI5 E;  4LF8 E;  4JI3 E;  4DR6 I;  4HYM A;  4DV1 E;  1H7U A;  4DUZ E; 
#chains in the Genus database with same CATH topology
 2PNL A;  3V5R A;  4DV4 I;  1S16 A;  4DXL A;  4DV3 E;  2ZIT A;  2WNR B;  3J7A M;  3WU4 A;  3V2U C;  4B3T E;  1N33 E;  3P3E A;  2V8P A;  2VQE E;  2ZM6 E;  1XMQ E;  2CVE A;  4X65 I;  1OYS A;  4LFB E;  4DPT A;  1Z0E A;  4MU0 A;  4DR1 I;  4GQU A;  1ZM3 A;  2HFS A;  3PYG A;  1UDS A;  4WUB A;  1UDQ A;  3P3G A;  2NPF A;  1HNW E;  1IBL I;  3D4J A;  4XTJ A;  4AID A;  1BKN A;  3ZM7 A;  2BR2 A;  4NXM E;  4DPW A;  1PIE A;  3T1H I;  4B3M E;  2J7K A;  3L7Z A;  3B82 A;  4JI0 E;  1XNR E;  2A2C A;  2PO2 A;  4HAC A;  3WU3 A;  2X36 A;  1WUU A;  2O1U A;  2UXC E;  4AQY E;  4OO1 F;  4X66 E;  4JI4 E;  1N36 I;  5JEA B;  4YY3 I;  3PS1 A;  2V2V A;  3HJC A;  1XMO E;  1IBK E;  4IZK A;  4DPX A;  4OO1 E;  2V2Z A;  1RHY A;  3LPS A;  2C38 A;  5IT9 Q;  4PRX A;  2Z5B A;  5DNL A;  1H7S A;  5IWA E;  4KHP I;  4FWH A;  5GMD A;  2BV3 A;  3UHM A;  4IFD F;  4DV0 E;  2ZBK B;  5K36 F;  4DV6 I;  1ELO A;  1ZM4 A;  1YHC A;  3WU5 A;  2NN6 A;  1B63 A;  3U1Y A;  5LMN E;  2UU9 E;  2CG9 A;  1FJG E;  1DAR A;  3J81 Q;  1FWK A;  3ZZ0 A;  1HNX I;  1HR0 E;  3B78 A;  1R6M A;  2HKJ A;  1E3H A;  2UUA I;  4OZE A;  1QZR A;  3ZKB A;  4LFA I;  2E5L E;  2IER A;  4OO1 A;  2HK2 A;  4ED4 A;  5IT9 C;  2O1T A;  1MX0 A;  1MG7 A;  4MQY A;  2JT2 A;  1N34 I;  3P76 A;  4JI2 I;  2V2Q A;  4N3O A;  4IFD A;  4JI5 I;  3PS3 A;  1J5E E;  4LF8 I;  4JI3 I;  5K36 A;  2GS8 A;  4FWG A;  5C0X A;  3M85 G;  4DR7 E;  4R1F A;  2NN6 C;  2OI2 A;  4DV1 I;  4OO1 D;  5FLX Q;  4LF5 E;  4DUZ I;  2JEA A;  2BA0 G;  2PO0 B;  4DV3 I;  1XHK A;  4MU3 A;  1N33 I;  4B3T I;  4YHH E;  3KRN A;  2WNR A;  2VQE I;  2ZM6 I;  1XMQ I;  1E3P A;  3JAM Q;  5DRQ A;  4P52 A;  4IFD D;  1Z0C A;  5K36 D;  4LFB I;  4URL A;  4LF9 E;  3QT6 A;  3J7A G;  5JEA F;  2JE6 B;  2WP8 B;  4X64 E;  4ISA A;  5DRP A;  4DR3 E;  4DUY E;  4FWD A;  5JEA E;  5DRR A;  4QNJ A;  5K36 C;  1HNW I;  2UXD E;  1RRE A;  2F4V E;  5C0X C;  4OX9 E;  1FNM A;  4NXM I;  3JAM C;  2VQF E;  5FWK A;  4B3M I;  3Q6M A;  5BR8 E;  2J65 A;  4JI0 I;  2O1V A;  1XNR I;  1NHH A;  2PO1 B;  4M1K A;  1PKP A;  1N32 E;  1ZXM A;  3M85 D;  4Z7C A;  2UXC I;  4AQY I;  4X66 I;  4JI4 I;  5ELW A;  2BA0 D;  1XMO I;  1IBK I;  1Z0B A;  5JEA A;  3PYE A;  3F0N A;  4DR5 E;  5IWA I;  2GQ0 A;  3WU6 A;  4JG4 A;  1XNQ E;  4JV5 E;  1XXE A;  4JI8 E;  1Z5C A;  4DV0 I;  2GO3 A;  1ZM2 A;  4LF7 E;  1KTV A;  4IZJ B;  2UU9 I;  5LMN I;  1N0V C;  1Y60 A;  1FJG I;  4LPF A;  1Z0G A;  1Z0V A;  4MYU A;  1HR0 I;  1NHJ A;  5JEA D;  2EFG A;  2UXB E;  2C39 A;  1Y4S A;  2E5L I;  2HHH E;  4BA2 A;  4UT4 A;  3QT7 A;  4WUD A;  4DR2 E;  5LMU E;  4PRV A;  5A2Q Q;  4JI1 I;  4DV5 E;  1A6F A;  4DU8 A;  3M7N G;  2AJ4 A;  4UTG A;  1NHI A;  1J5E I;  2UUC E;  3U1K A;  1KIJ A;  4DR7 I;  1Y5Y A;  2HFU A;  2PNZ B;  2C37 A;  3K85 A;  4LF5 I;  1H72 C;  4LF4 E;  1Z0W A;  1R6L A;  1EI1 A;  2HK3 A;  2Z5C B;  2PO0 A;  4K0K E;  3K1J A;  2VES A;  4YHH I;  5A2Q C;  1OJ4 A;  1YH8 A;  4J3D A;  4LF6 E;  3B4T A;  4JI1 E;  3HKM A;  2A2D A;  2BM0 A;  2WW4 A;  4FN5 A;  3P06 A;  4HY1 A;  3J81 C;  4QNK A;  4LF9 I;  1HNZ E;  3CWV A;  3H1C A;  1D6T A;  1Z0T A;  4LFC E;  4GKK E;  2JE6 A;  4X64 I;  4FW3 A;  4DR3 I;  4DUY I;  4EMD A;  1PVG A;  4JYA E;  3QT8 A;  2UXD I;  2F4V I;  4OX9 I;  3ZZU A;  5EKW A;  3T1Y E;  3M6A A;  3M7N D;  2CZ9 A;  2VQF I;  4I3H A;  5BR8 I;  4OO1 C;  1N32 I;  2E1R A;  4FW6 A;  2PO1 A;  1HK7 A;  1P42 A;  3GON A;  4WUC A;  1Y4U A;  5GME A;  3GLL A;  3NZK A;  1IBM E;  4USK A;  5FLX C;  4MDT A;  4U3B A;  1S4E A;  4IFD C;  3PS2 A;  4DR5 I;  4JI6 E;  2R42 A;  4GKJ E;  3HUL A;  5L3J A;  1XNQ I;  4JV5 I;  4JI8 I;  4B3S E;  4LF7 I;  1UDN A;  4HXZ A;  4NXN E;  4DV7 E;  4P7A A;  1Z5A A;  2V34 A;  1FWL A;  4IZJ A;  2PNM A;  4B3R E;  1FKA E;  2JEB B;  2UUB E;  1USV A;  1I94 E;  2UXB I;  4DV2 E;  3OTO E;  2HHH I;  4X62 E;  4USM A;  1ZXN A;  2HKE A;  4DR2 I;  5LMU I;  4NBQ A;  3H4L A;  4DR4 I;  4JI7 E;  4Z7Y A;  1EA6 A;  4DV5 I;  4PU9 A;  3DD6 A;  4IZJ D;  4BA1 B;  4LCG A;  5DRO A;  3GCM A;  4DU7 A;  1UDO A;  1OYR A;  4DR6 E;  2UUC I;  2R3V A;  4LCF A;  3PRY A;  3ZZT A;  4DR4 E;  2PNZ A;  4LF4 I;  2NN6 F;  4IS9 A;  4DV4 E;  2DEJ A;  5LL6 R;  4DPY A;  2O1W A;  4K0K I;  1KVK A;  1VIS A;  4AIM A;  3CDJ A;  4FW5 A;  2NN6 E;  1B62 A;  2Z5C A;  4MU1 A;  2GO4 A;  5JEA C;  4LF6 I;  4RPF A;  4X65 E;  3LNU A;  1UEK A;  4U3D A;  2Z5E A;  1HNZ I;  1Z5B A;  4MYT A;  3ZKD A;  4DR1 E;  4LFC I;  4GKK I;  2AE8 A;  2F1D A;  5EL9 A;  4KQV A;  3QT5 A;  1FI4 A;  4JYA I;  3B8H A;  2BR2 B;  4LCH A;  1IBL E;  3T1Y I;  2O3Z A;  2XEX A;  3L7Z B;  3P3C A;  3T1H E;  2PO2 B;  4HAC B;  5C0X F;  3K17 A;  4IFD E;  1VI7 A;  5K36 E;  4OKG A;  5C0X E;  1K47 A;  1KKH A;  1NZ0 A;  2IOP A;  1ZM9 A;  1N36 E;  2C39 B;  4IZK B;  1IBM I;  2BM1 A;  3LTO A;  4YY3 E;  1Z59 A;  4BA2 B;  2WP8 A;  4MU4 A;  2LJP A;  4FW7 A;  2C38 B;  2Z5B B;  2BA1 G;  1H74 A;  2X7I A;  4JI6 I;  1Y6Z A;  4GKJ I;  4KHP E;  2NN6 D;  2NN6 B;  4DPU A;  4DV6 E;  4B3S I;  4NXN I;  4DV7 I;  2IES A;  2VF3 A;  3J80 Q;  1N0U A;  1MU5 A;  1H73 A;  2C37 B;  1HNX E;  2DEI A;  4B3R I;  4ZVI A;  4OO1 B;  1RR9 A;  2UUB I;  2UUA E;  4LFA E;  1I94 I;  2IOQ A;  4DV2 I;  2JEB A;  3OTO I;  4X62 I;  3PYD A;  1USU A;  3Q1Q A;  4JI7 I;  4AM3 A;  3CDI A;  3PYF A;  2CGE A;  2Q2E B;  3GME A;  4FW9 A;  1N34 E;  4IFD B;  4JI2 E;  5C0X D;  3J80 C;  5K36 B;  5DNX A;  1U2R A;  5C0X B;  4BA1 A;  4JI5 E;  4LF8 E;  4LOM A;  4JI3 E;  4DR6 I;  1OYP A;  4FW4 A;  3Q6N A;  4HYM A;  2JEA B;  4DV1 E;  1H7U A;  2BA1 D;  4DUZ E; 
#chains in the Genus database with same CATH homology
 2PNL A;  3V5R A;  4DV4 I;  1S16 A;  4DXL A;  4DV3 E;  2ZIT A;  3J7A M;  3WU4 A;  3V2U C;  4B3T E;  1N33 E;  2V8P A;  2VQE E;  2ZM6 E;  1XMQ E;  4X65 I;  4LFB E;  4DPT A;  1Z0E A;  4DR1 I;  1ZM3 A;  2HFS A;  3PYG A;  4WUB A;  2NPF A;  1HNW E;  1IBL I;  3D4J A;  4XTJ A;  1BKN A;  3ZM7 A;  4NXM E;  4DPW A;  1PIE A;  3T1H I;  4B3M E;  2J7K A;  3B82 A;  4JI0 E;  1XNR E;  2A2C A;  4HAC A;  3WU3 A;  2X36 A;  1WUU A;  2O1U A;  2UXC E;  4AQY E;  4X66 E;  4JI4 E;  1N36 I;  4YY3 I;  2V2V A;  3HJC A;  1XMO E;  1IBK E;  4IZK A;  4DPX A;  2V2Z A;  3LPS A;  5IT9 Q;  4PRX A;  2Z5B A;  1H7S A;  5IWA E;  4KHP I;  4FWH A;  5GMD A;  2BV3 A;  4DV0 E;  2ZBK B;  4DV6 I;  1ELO A;  1ZM4 A;  3WU5 A;  1B63 A;  5LMN E;  2UU9 E;  2CG9 A;  1FJG E;  1DAR A;  3J81 Q;  1FWK A;  3ZZ0 A;  1HNX I;  1HR0 E;  3B78 A;  2HKJ A;  2UUA I;  1QZR A;  3ZKB A;  4LFA I;  2E5L E;  2HK2 A;  4ED4 A;  5IT9 C;  2O1T A;  1MX0 A;  1MG7 A;  1N34 I;  4JI2 I;  2V2Q A;  4N3O A;  4JI5 I;  4LF8 I;  1J5E E;  4JI3 I;  2GS8 A;  4FWG A;  4DR7 E;  4R1F A;  2OI2 A;  4DV1 I;  5FLX Q;  4LF5 E;  4DUZ I;  4DV3 I;  1XHK A;  1N33 I;  4B3T I;  4YHH E;  2VQE I;  2ZM6 I;  1XMQ I;  3JAM Q;  4P52 A;  1Z0C A;  4LFB I;  4URL A;  4LF9 E;  3QT6 A;  3J7A G;  4X64 E;  4DR3 E;  4DUY E;  4FWD A;  1HNW I;  2UXD E;  1RRE A;  2F4V E;  4OX9 E;  1FNM A;  4NXM I;  3JAM C;  2VQF E;  5FWK A;  4B3M I;  3Q6M A;  5BR8 E;  4JI0 I;  2O1V A;  1XNR I;  1NHH A;  4M1K A;  1PKP A;  1N32 E;  1ZXM A;  4Z7C A;  2UXC I;  4AQY I;  4X66 I;  4JI4 I;  1XMO I;  1IBK I;  1Z0B A;  3PYE A;  3F0N A;  4DR5 E;  5IWA I;  2GQ0 A;  3WU6 A;  4JG4 A;  1XNQ E;  4JV5 E;  4JI8 E;  1Z5C A;  4DV0 I;  1ZM2 A;  4LF7 E;  1KTV A;  4IZJ B;  2UU9 I;  5LMN I;  1N0V C;  1FJG I;  1Z0G A;  1Z0V A;  4MYU A;  1HR0 I;  1NHJ A;  2EFG A;  2UXB E;  1Y4S A;  2E5L I;  2HHH E;  4UT4 A;  3QT7 A;  4WUD A;  4DR2 E;  5LMU E;  4PRV A;  5A2Q Q;  4DV5 E;  4JI1 I;  1A6F A;  4DU8 A;  2AJ4 A;  4UTG A;  1NHI A;  1J5E I;  2UUC E;  1KIJ A;  4DR7 I;  2HFU A;  3K85 A;  4LF5 I;  1H72 C;  4LF4 E;  1Z0W A;  1EI1 A;  2HK3 A;  2Z5C B;  4K0K E;  3K1J A;  4YHH I;  5A2Q C;  1OJ4 A;  4LF6 E;  4JI1 E;  2A2D A;  2BM0 A;  2WW4 A;  4FN5 A;  3P06 A;  4HY1 A;  3J81 C;  4LF9 I;  1HNZ E;  3CWV A;  1D6T A;  1Z0T A;  4LFC E;  4GKK E;  4X64 I;  4DR3 I;  4DUY I;  4EMD A;  1PVG A;  4JYA E;  3QT8 A;  2UXD I;  2F4V I;  4OX9 I;  3ZZU A;  3T1Y E;  3M6A A;  2CZ9 A;  2VQF I;  4I3H A;  5BR8 I;  1N32 I;  2E1R A;  1HK7 A;  3GON A;  4WUC A;  1Y4U A;  5GME A;  1IBM E;  4USK A;  5FLX C;  1S4E A;  4DR5 I;  4JI6 E;  2R42 A;  4GKJ E;  3HUL A;  5L3J A;  1XNQ I;  4JV5 I;  4JI8 I;  4B3S E;  4LF7 I;  4HXZ A;  4NXN E;  4DV7 E;  4P7A A;  1Z5A A;  2V34 A;  1FWL A;  4IZJ A;  2PNM A;  4B3R E;  1FKA E;  2UUB E;  1USV A;  1I94 E;  2UXB I;  4DV2 E;  3OTO E;  2HHH I;  4X62 E;  4USM A;  1ZXN A;  2HKE A;  4DR2 I;  5LMU I;  3H4L A;  4DR4 I;  4JI7 E;  4Z7Y A;  1EA6 A;  4DV5 I;  4PU9 A;  4IZJ D;  4DU7 A;  4DR6 E;  2UUC I;  2R3V A;  3PRY A;  3ZZT A;  4DR4 E;  4LF4 I;  4DV4 E;  2DEJ A;  5LL6 R;  4DPY A;  2O1W A;  4K0K I;  1KVK A;  1VIS A;  1B62 A;  2Z5C A;  4LF6 I;  4RPF A;  4X65 E;  3LNU A;  1UEK A;  2Z5E A;  1HNZ I;  1Z5B A;  4MYT A;  3ZKD A;  4DR1 E;  4LFC I;  4GKK I;  4KQV A;  3QT5 A;  1FI4 A;  4JYA I;  3B8H A;  1IBL E;  3T1Y I;  2XEX A;  3T1H E;  4HAC B;  3K17 A;  1K47 A;  1KKH A;  1NZ0 A;  2IOP A;  1ZM9 A;  1N36 E;  4IZK B;  1IBM I;  2BM1 A;  3LTO A;  4YY3 E;  1Z59 A;  2LJP A;  2Z5B B;  1H74 A;  2X7I A;  4JI6 I;  1Y6Z A;  4GKJ I;  4KHP E;  4DPU A;  4DV6 E;  4B3S I;  4NXN I;  4DV7 I;  2VF3 A;  3J80 Q;  1N0U A;  1MU5 A;  1H73 A;  1HNX E;  2DEI A;  4B3R I;  4ZVI A;  1RR9 A;  2UUB I;  2UUA E;  4LFA E;  1I94 I;  2IOQ A;  4DV2 I;  3OTO I;  4X62 I;  3PYD A;  1USU A;  3Q1Q A;  4JI7 I;  3PYF A;  2CGE A;  2Q2E B;  4FW9 A;  1N34 E;  4JI2 E;  3J80 C;  1U2R A;  4JI5 E;  4LF8 E;  4JI3 E;  4DR6 I;  3Q6N A;  4HYM A;  4DV1 E;  1H7U A;  4DUZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...