1RREA

Crystal structure of e.coli lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent protease La
publication title The catalytic domain of Escherichia coli Lon protease has a unique fold and a Ser-Lys dyad in the active site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 53
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2003-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1rreA01
4DR3E 2HHHE 2F4VE 4JI2E 1Z0CA 4DV0I 1H72C 3ZZTA 2E5LI 4MYUA 4FN5A 2E1RA 1ZM3A 3M6AA 1EA6A 1N36E 1N0UA 4JV5E 1XNQI 4X66I 4DPWA 2EFGA 3T1YE 1XMOI 2ZBKB 3OTOI 1XNRI 1IBLI 1N33E 1FKAE 1XHKA 4FWGA 4JI2I 2UUCE 4KHPI 2UXDI 2A2DA 4YHHE 4B3ME 4DV3E 4B3TE 1B62A 1ZM2A 2VF3A 1Z5BA 4B3RE 2VQEE 3B82A 4P52A 4YY3E 3J7AM 4LF4E 1Z0WA 4DR5E 4K0KE 4R1FA 1HNWI 4M1KA 2A2CA 3QT6A 4X65I 2UXCE 4LF8I 3GONA 4DPUA 5BR8E 2BM0A 1ELOA 1ZXMA 1HNZE 1FI4A 4DV7E 4Z7CA 3K1JA 4JI1I 4NXNI 3WU6A 3B78A 2HKEA 4AQYE 2HKJA 4RPFA 4LF9E 4DUYE 4JI0E 2BM1A 4USMA 1XMQI 4DR1I 4DR6I 4DV6E 5IWAE 1J5EI 1N34E 4GKKI 1FWLA 2R42A 3LTOA 2ZITA 1I94E 1H73A 4DV0E 1UEKA 2ZM6I 2E5LE 1Z0TA 3V5RA 4MYTA 1XNQE 1H74A 4X66E 1B63A 1Z5AA 1HR0I 4LFAI 4DV1I 4JYAI 1XMOE 3OTOE 4FWHA 1Z0EA 1XNRE 1A6FA 3ZZUA 5FLXQ 1IBLE 4UTGA 2NPFA 1K47A 1I94I 4KHPE 4LF7I 2UXDE 5IT9Q 2X7IA 1NHHA 4X64I 3K17A 4EMDA 2HK2A 5A2QC 4DPYA 3ZM7A 3JAMC 4DR4I 3ZZ0A 1HNWE 1KVKA 4DV4I 4DR2I 1WUUA 5LMNI 4LF6I 4FW9A 4OX9I 4X65E 1PKPA 4LF8E 4JI3E 5IT9C 4URLA 4FWDA 3WU4A 4Z7YA 4DV2I 4B3SI 4JI1E 4JG4A 4NXNE 4JI8I 4DUZI 1S16A 1XMQE 4DR1E 1NHIA 3V2UC 2DEIA 3F0NA 4DR6E 1H7SA 3J81Q 2BV3A 1J5EE 3J80Q 4JI3I 4GKKE 2UU9I 4DPTA 3B8HA 1EI1A 1FWKA 2X36A 2ZM6E 2UUAI 2OI2A 1RREA 3PYFA 5GMEA 1IBKI 4DV5I 4DPXA 2V8PA 1BKNA 1MU5A 3J81C 4LF5I 3QT5A 1HR0E 4LFAE 1Z5CA 1U2RA 4DV1E 3T1HI 4JYAE 3CWVA 4NXMI 2VQFI 4WUBA 4XTJA 4X62I 1ZM9A 4LF7E 1N0VC 1ZM4A 4P7AA 1MX0A 4JI6I 4X64E 1Z0BA 2UUBI 4DR4E 3PYGA 4DV4E 5GMDA 4ED4A 4DR2E 5LMNE 1N32I 2HK3A 4LF6E 4LFCI 4OX9E 4LFBI 2V2QA 1KTVA 3WU3A 4GKJI 4DV2E 1RR9A 4B3SE 4JI8E 4DUZE 5LMUI 3PYEA 2DEJA 4PRXA 1Z59A 2Q2EB 2XEXA 1FJGI 1PIEA 1HNXI 5FLXC 2UU9E 4PRVA 4JI7I 1Z0VA 4DR7I 2UUAE 1NZ0A 1FNMA 1IBKE 4DV5E 3LNUA 3HULA 3QT7A 4DR3I 2HHHI 2F4VI 4LF5E 3PYDA 4PU9A 4HACB 4DU7A 2V2VA 1QZRA 3T1HE 2HFSA 3ZKBA 3Q1QA 4NXME 2VQFE 1N36I 4X62E 3LPSA 4JV5I 4HACA 4KQVA 4JI5E 4JI6E 1H7UA 4DU8A 3T1YI 2GS8A 2UXBE 1N33I 4ZVIA 2UUCI 2UUBE 2LJPA 1MG7A 4UT4A 4YHHI 1KKHA 4B3MI 4HY1A 3J80C 1N32E 4DV3I 4B3TI 4B3RI 4LFCE 2VQEI 3J7AG 2J7KA 4LFBE 1NHJA 1DARA 3WU5A 4YY3I 4JI4E 1Z0GA 4HXZA 4JI5I 4LF4I 4GKJE 4HYMA 4DR5I 4K0KI 1VISA 2UXBI 5LMUE 3ZKDA 1IBME 4I3HA 1ZXNA 4DXLA 3D4JA 2UXCI 2R3VA 4WUDA 5L3JA 2CZ9A 3QT8A 5BR8I 1S4EA 1FJGE 1HNZI 1HNXE 4DV7I 2V2ZA 5LL6R 1D6TA 4AQYI 2V34A 4LF9I 4DUYI 3H4LA 4JI0I 4JI7E 1OJ4A 2HFUA 4JI4I 4USKA 1KIJA 5A2QQ 3JAMQ 4DR7E 4DV6I 1IBMI 1PVGA 5IWAI 4WUCA 1N34I 2WW4A 2AJ4A
chains in the Genus database with same CATH superfamily
3GMEA 4DR3E 2HHHE 2F4VE 4JI2E 1UDNA 4IFDE 1Z0CA 4DV0I 3U1KA 1H72C 4N3OA 2Z5BA 3ZZTA 2E5LI 4MYUA 4FN5A 4FW3A 2E1RA 1ZM3A 3M6AA 3PS2A 1EA6A 1N36E 2O1UA 2PO2B 1N0UA 4MQYA 2J65A 1XNQI 4JV5E 4X66I 4DPWA 1E3HA 2EFGA 4LPFA 4OKGA 3P3GA 3T1YE 1XMOI 2ZBKB 3OTOI 1XNRI 1IBLI 1N33E 1FKAE 2PO2A 5C0XF 1XHKA 4FWGA 4BA2B 4JI2I 2UUCE 4KHPI 2NN6F 2UXDI 2A2DA 4YHHE 4B3ME 4DV3E 4B3TE 2O1WA 1B62A 1ZM2A 2VF3A 1Z5BA 4B3RE 2VQEE 4AIMA 3B82A 4OO1B 4AM3A 1Y6ZA 5FWKA 4BA1B 4P52A 4YY3E 3J7AM 4LF4E 1Z0WA 4DR5E 4K0KE 4R1FA 1HNWI 4M1KA 2A2CA 3QT6A 4OO1A 4X65I 2UXCE 4LF8I 3GONA 4DPUA 4IZJB 5BR8E 2BM0A 1ELOA 5ELWA 1ZXMA 1HNZE 1FI4A 5K36D 4IFDF 4DV7E 4Z7CA 3K1JA 4JI1I 4NXNI 3WU6A 3B78A 2HKEA 4AQYE 2HKJA 4RPFA 4LF9E 4DUYE 1Y4SA 4JI0E 2BM1A 4USMA 3GLLA 4IZJA 1XMQI 4DR1I 3K85A 5C0XC 4DR6I 5EL9A 4DV6E 5IWAE 5JEAB 1VI7A 1OYRA 1J5EI 2C39B 2JEAB 1N34E 2IOPA 4GKKI 1FWLA 2R42A 3LTOA 2ZITA 1I94E 1H73A 4DV0E 1UEKA 5EKWA 2ZM6I 2PNMA 3M85D 2E5LE 5JEAA 3GCMA 1UDQA 2C39A 2JEAA 4OO1E 1Z0TA 3V5RA 4MYTA 2Z5EA 4FW5A 1XNQE 1H74A 4X66E 1B63A 1Z5AA 1HR0I 4LFAI 3CDIA 4MU1A 4DV1I 2BA0D 4JYAI 1XMOE 3OTOE 4FWHA 1Z0EA 1XNRE 1A6FA 1OYPA 3ZZUA 5FLXQ 1IBLE 4UTGA 4IFDC 2NPFA 5K36F 1K47A 1I94I 4KHPE 1XXEA 4LF7I 2UXDE 5IT9Q 2X7IA 4U3BA 1R6LA 1Y4UA 1NHHA 4IZJD 4X64I 4QNKA 3K17A 4EMDA 3PS1A 4QNJA 4IFDD 2HK2A 5A2QC 2GO3A 4DPYA 3ZM7A 3JAMC 4DR4I 3M7ND 1USUA 3ZZ0A 5DROA 4IZKB 1HNWE 1KVKA 4DV4I 5JEAE 4MU0A 4DR2I 1WUUA 5LMNI 4LF6I 4FW9A 4OX9I 4ISAA 4X65E 1PKPA 4LF8E 4JI3E 5IT9C 4URLA 4FWDA 4IZKA 3WU4A 4Z7YA 4DV2I 4B3SI 4JI1E 4JG4A 2O1VA 4NXNE 4JI8I 3P3EA 1YHCA 4DUZI 3P06A 1S16A 4FW4A 2C37B 4OO1F 3Q6NA 1XMQE 4DR1E 1NHIA 3V2UC 2DEIA 5K36C 2NN6B 3F0NA 4DR6E 1H7SA 3J81Q 2BV3A 2CVEA 3KRNA 1J5EE 2C37A 3J80Q 4JI3I 4GKKE 2UU9I 3P3CA 5DNLA 4DPTA 3B8HA 1EI1A 3PS3A 2NN6A 3UHMA 1FWKA 2X36A 2ZM6E 3H1CA 2UUAI 2OI2A 1RREA 3PYFA 5GMEA 1IBKI 4DV5I 4DPXA 2V8PA 1BKNA 2WNRA 3Q6MA 1MU5A 3J81C 4LF5I 3QT5A 1HR0E 4LFAE 2WP8B 1Z5CA 1U2RA 4DV1E 3T1HI 4JYAE 4LCHA 2BR2B 3CWVA 2GO4A 4NXMI 2VQFI 4WUBA 4XTJA 4X62I 1ZM9A 4LF7E 2CGEA 2WP8A 1N0VC 1ZM4A 4LCGA 4P7AA 3P76A 4OO1C 1MX0A 2IESA 1UDSA 4JI6I 2BR2A 1OYSA 2C38B 4X64E 1Z0BA 1P42A 1YH8A 2CG9A 5DNXA 2NN6E 1Y60A 2UUBI 3PYGA 4DR4E 2PNLA 4OO1D 2C38A 4DV4E 5GMDA 4ED4A 4DR2E 5LMNE 1N32I 2HK3A 4LF6E 4LFCI 4OX9E 2PO0B 4LFBI 2V2QA 1KTVA 3WU3A 4GKJI 4DV2E 1RR9A 4B3SE 4JI8E 4DUZE 5LMUI 3PYEA 2DEJA 2PO0A 4PRXA 1HK7A 5K36B 1Z59A 5JEAC 4U3DA 2Q2EB 3HKMA 4NBQA 2XEXA 1FJGI 2JE6B 4OZEA 1PIEA 1HNXI 3NZKA 5FLXC 1Y5YA 5K36A 2GQ0A 2UU9E 4PRVA 5DRQA 5JEAD 4JI7I 3HJCA 2JE6A 1Z0VA 4DR7I 2UUAE 1E3PA 1NZ0A 1FNMA 2O3ZA 1IBKE 4DV5E 3LNUA 3HULA 3QT7A 1R6MA 5C0XB 4DR3I 2HHHI 2IOQA 2F4VI 4LF5E 3PYDA 4PU9A 4HACB 4IS9A 4DU7A 2V2VA 1QZRA 3T1HE 2HFSA 3ZKBA 2BA1G 2JT2A 3B4TA 5C0XA 3Q1QA 2AE8A 3M85G 4NXME 4J3DA 4BA2A 1USVA 3CDJA 2VQFE 1N36I 4X62E 2WNRB 3LPSA 4JV5I 4MU4A 5DRPA 4HACA 4FW6A 4KQVA 4JI5E 4JI6E 1H7UA 4DU8A 3T1YI 2VESA 2GS8A 2UXBE 1N33I 2BA0G 5K36E 4ZVIA 4BA1A 2UUCI 2UUBE 2LJPA 2PO1B 4IFDB 1MG7A 4UT4A 4YHHI 4AIDA 1KKHA 4B3MI 4HY1A 3J80C 2JEBB 4MU3A 5JEAF 4DV3I 1N32E 4B3TI 4B3RI 4LFCE 2VQEI 3J7AG 2J7KA 4LFBE 1UDOA 1NHJA 1DARA 2PO1A 4GQUA 4IFDA 3WU5A 4YY3I 4JI4E 1Z0GA 2Z5CB 4HXZA 4JI5I 4LF4I 4GKJE 2JEBA 4HYMA 4DR5I 4K0KI 1VISA 3M7NG 2UXBI 5LMUE 3ZKDA 1IBME 4I3HA 5C0XE 2NN6C 5DRRA 1ZXNA 4DXLA 3D4JA 2IERA 2UXCI 4WUDA 2R3VA 5L3JA 2CZ9A 3QT8A 5BR8I 2Z5CA 1S4EA 1FJGE 2BA1D 2PNZB 1HNZI 1HNXE 5C0XD 4DV7I 2V2ZA 2F1DA 5LL6R 1D6TA 4LCFA 4AQYI 2NN6D 2V34A 4LF9I 4DUYI 3L7ZB 3H4LA 4JI0I 2O1TA 4JI7E 4MDTA 3DD6A 1OJ4A 2PNZA 2HFUA 4JI4I 4USKA 1KIJA 5A2QQ 3JAMQ 4DR7E 4DV6I 1IBMI 1PVGA 2Z5BB 4LOMA 5IWAI 3PRYA 4FW7A 4WUCA 3L7ZA 3U1YA 1RHYA 1N34I 2WW4A 2AJ4A
chains in the Genus database with same CATH topology
4DR3E 2HHHE 2F4VE 4JI2E 1Z0CA 4DV0I 1H72C 4N3OA 2Z5BA 3ZZTA 2E5LI 4MYUA 4FN5A 2E1RA 1ZM3A 3M6AA 1EA6A 1N36E 2O1UA 1N0UA 4JV5E 1XNQI 4X66I 4DPWA 2EFGA 3T1YE 1XMOI 2ZBKB 3OTOI 1XNRI 1IBLI 1N33E 1FKAE 1XHKA 4FWGA 4JI2I 2UUCE 4KHPI 2UXDI 2A2DA 4YHHE 4B3ME 4DV3E 4B3TE 2O1WA 1B62A 1ZM2A 2VF3A 1Z5BA 4B3RE 2VQEE 3B82A 1Y6ZA 5FWKA 4P52A 4YY3E 3J7AM 4LF4E 1Z0WA 4DR5E 4K0KE 4R1FA 1HNWI 4M1KA 2A2CA 3QT6A 4X65I 2UXCE 4LF8I 3GONA 4DPUA 4IZJB 5BR8E 2BM0A 1ELOA 1ZXMA 1HNZE 1FI4A 4DV7E 4Z7CA 3K1JA 4JI1I 4NXNI 3WU6A 3B78A 2HKEA 4AQYE 2HKJA 4RPFA 4LF9E 4DUYE 1Y4SA 4JI0E 2BM1A 4USMA 4IZJA 1XMQI 4DR1I 3K85A 4DR6I 4DV6E 5IWAE 1J5EI 1N34E 2IOPA 4GKKI 1FWLA 2R42A 3LTOA 2ZITA 1I94E 1H73A 4DV0E 1UEKA 2ZM6I 2PNMA 2E5LE 1Z0TA 3V5RA 4MYTA 2Z5EA 1XNQE 1H74A 4X66E 1B63A 1Z5AA 1HR0I 4LFAI 4DV1I 4JYAI 1XMOE 3OTOE 4FWHA 1Z0EA 1XNRE 1A6FA 3ZZUA 5FLXQ 1IBLE 4UTGA 2NPFA 1K47A 1I94I 4KHPE 4LF7I 2UXDE 5IT9Q 2X7IA 1Y4UA 1NHHA 4IZJD 4X64I 3K17A 4EMDA 2HK2A 5A2QC 4DPYA 3ZM7A 3JAMC 4DR4I 1USUA 3ZZ0A 4IZKB 1HNWE 1KVKA 4DV4I 4DR2I 1WUUA 5LMNI 4LF6I 4FW9A 4OX9I 4X65E 1PKPA 4LF8E 4JI3E 5IT9C 4URLA 4FWDA 4IZKA 3WU4A 4Z7YA 4DV2I 4B3SI 4JI1E 4JG4A 2O1VA 4NXNE 4JI8I 4DUZI 3P06A 1S16A 3Q6NA 1XMQE 4DR1E 1NHIA 3V2UC 2DEIA 3F0NA 4DR6E 1H7SA 3J81Q 2BV3A 1J5EE 3J80Q 4JI3I 4GKKE 2UU9I 4DPTA 3B8HA 1EI1A 1FWKA 2X36A 2ZM6E 2UUAI 2OI2A 1RREA 3PYFA 5GMEA 1IBKI 4DV5I 4DPXA 2V8PA 1BKNA 3Q6MA 1MU5A 3J81C 4LF5I 3QT5A 1HR0E 4LFAE 1Z5CA 1U2RA 4DV1E 3T1HI 4JYAE 3CWVA 4NXMI 2VQFI 4WUBA 4XTJA 4X62I 1ZM9A 4LF7E 2CGEA 1N0VC 1ZM4A 4P7AA 1MX0A 4JI6I 4X64E 1Z0BA 2CG9A 2UUBI 4DR4E 3PYGA 2PNLA 4DV4E 5GMDA 4ED4A 4DR2E 5LMNE 1N32I 2HK3A 4LF6E 4LFCI 4OX9E 4LFBI 2V2QA 1KTVA 3WU3A 4GKJI 4DV2E 1RR9A 4B3SE 4JI8E 4DUZE 5LMUI 3PYEA 2DEJA 4PRXA 1HK7A 1Z59A 2Q2EB 2XEXA 1FJGI 1PIEA 1HNXI 5FLXC 2GQ0A 2UU9E 4PRVA 4JI7I 3HJCA 1Z0VA 4DR7I 2UUAE 1NZ0A 1FNMA 1IBKE 4DV5E 3LNUA 3HULA 3QT7A 4DR3I 2HHHI 2IOQA 2F4VI 4LF5E 3PYDA 4PU9A 4HACB 4DU7A 2V2VA 1QZRA 3T1HE 2HFSA 3ZKBA 3Q1QA 4NXME 1USVA 2VQFE 1N36I 4X62E 3LPSA 4JV5I 4HACA 4KQVA 4JI5E 4JI6E 1H7UA 4DU8A 3T1YI 2GS8A 2UXBE 1N33I 4ZVIA 2UUCI 2UUBE 2LJPA 1MG7A 4UT4A 4YHHI 1KKHA 4B3MI 4HY1A 3J80C 1N32E 4DV3I 4B3TI 4B3RI 4LFCE 2VQEI 3J7AG 2J7KA 4LFBE 1NHJA 1DARA 3WU5A 4YY3I 4JI4E 1Z0GA 2Z5CB 4HXZA 4JI5I 4LF4I 4GKJE 4HYMA 4DR5I 4K0KI 1VISA 2UXBI 5LMUE 3ZKDA 1IBME 4I3HA 1ZXNA 4DXLA 3D4JA 2UXCI 2R3VA 4WUDA 5L3JA 2CZ9A 3QT8A 5BR8I 2Z5CA 1S4EA 1FJGE 1HNZI 1HNXE 4DV7I 2V2ZA 5LL6R 1D6TA 4AQYI 2V34A 4LF9I 4DUYI 3H4LA 4JI0I 2O1TA 4JI7E 1OJ4A 2HFUA 4JI4I 4USKA 1KIJA 5A2QQ 3JAMQ 4DR7E 4DV6I 1IBMI 1PVGA 2Z5BB 5IWAI 3PRYA 4WUCA 1N34I 2WW4A 2AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 E;  2HHH E;  2F4V E;  4JI2 E;  1Z0C A;  4DV0 I;  1H72 C;  3ZZT A;  2E5L I;  4MYU A;  4FN5 A;  2E1R A;  1ZM3 A;  3M6A A;  1EA6 A;  1N36 E;  1N0U A;  4JV5 E;  1XNQ I;  4X66 I;  4DPW A;  2EFG A;  3T1Y E;  1XMO I;  2ZBK B;  3OTO I;  1XNR I;  1IBL I;  1N33 E;  1FKA E;  1XHK A;  4FWG A;  4JI2 I;  2UUC E;  4KHP I;  2UXD I;  2A2D A;  4YHH E;  4B3M E;  4DV3 E;  4B3T E;  1B62 A;  1ZM2 A;  2VF3 A;  1Z5B A;  4B3R E;  2VQE E;  3B82 A;  4P52 A;  4YY3 E;  3J7A M;  4LF4 E;  1Z0W A;  4DR5 E;  4K0K E;  4R1F A;  1HNW I;  4M1K A;  2A2C A;  3QT6 A;  4X65 I;  2UXC E;  4LF8 I;  3GON A;  4DPU A;  5BR8 E;  2BM0 A;  1ELO A;  1ZXM A;  1HNZ E;  1FI4 A;  4DV7 E;  4Z7C A;  3K1J A;  4JI1 I;  4NXN I;  3WU6 A;  3B78 A;  2HKE A;  4AQY E;  2HKJ A;  4RPF A;  4LF9 E;  4DUY E;  4JI0 E;  2BM1 A;  4USM A;  1XMQ I;  4DR1 I;  4DR6 I;  4DV6 E;  5IWA E;  1J5E I;  1N34 E;  4GKK I;  1FWL A;  2R42 A;  3LTO A;  2ZIT A;  1I94 E;  1H73 A;  4DV0 E;  1UEK A;  2ZM6 I;  2E5L E;  1Z0T A;  3V5R A;  4MYT A;  1XNQ E;  1H74 A;  4X66 E;  1B63 A;  1Z5A A;  1HR0 I;  4LFA I;  4DV1 I;  4JYA I;  1XMO E;  3OTO E;  4FWH A;  1Z0E A;  1XNR E;  1A6F A;  3ZZU A;  5FLX Q;  1IBL E;  4UTG A;  2NPF A;  1K47 A;  1I94 I;  4KHP E;  4LF7 I;  2UXD E;  5IT9 Q;  2X7I A;  1NHH A;  4X64 I;  3K17 A;  4EMD A;  2HK2 A;  5A2Q C;  4DPY A;  3ZM7 A;  3JAM C;  4DR4 I;  3ZZ0 A;  1HNW E;  1KVK A;  4DV4 I;  4DR2 I;  1WUU A;  5LMN I;  4LF6 I;  4FW9 A;  4OX9 I;  4X65 E;  1PKP A;  4LF8 E;  4JI3 E;  5IT9 C;  4URL A;  4FWD A;  3WU4 A;  4Z7Y A;  4DV2 I;  4B3S I;  4JI1 E;  4JG4 A;  4NXN E;  4JI8 I;  4DUZ I;  1S16 A;  1XMQ E;  4DR1 E;  1NHI A;  3V2U C;  2DEI A;  3F0N A;  4DR6 E;  1H7S A;  3J81 Q;  2BV3 A;  1J5E E;  3J80 Q;  4JI3 I;  4GKK E;  2UU9 I;  4DPT A;  3B8H A;  1EI1 A;  1FWK A;  2X36 A;  2ZM6 E;  2UUA I;  2OI2 A;  1RRE A;  3PYF A;  5GME A;  1IBK I;  4DV5 I;  4DPX A;  2V8P A;  1BKN A;  1MU5 A;  3J81 C;  4LF5 I;  3QT5 A;  1HR0 E;  4LFA E;  1Z5C A;  1U2R A;  4DV1 E;  3T1H I;  4JYA E;  3CWV A;  4NXM I;  2VQF I;  4WUB A;  4XTJ A;  4X62 I;  1ZM9 A;  4LF7 E;  1N0V C;  1ZM4 A;  4P7A A;  1MX0 A;  4JI6 I;  4X64 E;  1Z0B A;  2UUB I;  4DR4 E;  3PYG A;  4DV4 E;  5GMD A;  4ED4 A;  4DR2 E;  5LMN E;  1N32 I;  2HK3 A;  4LF6 E;  4LFC I;  4OX9 E;  4LFB I;  2V2Q A;  1KTV A;  3WU3 A;  4GKJ I;  4DV2 E;  1RR9 A;  4B3S E;  4JI8 E;  4DUZ E;  5LMU I;  3PYE A;  2DEJ A;  4PRX A;  1Z59 A;  2Q2E B;  2XEX A;  1FJG I;  1PIE A;  1HNX I;  5FLX C;  2UU9 E;  4PRV A;  4JI7 I;  1Z0V A;  4DR7 I;  2UUA E;  1NZ0 A;  1FNM A;  1IBK E;  4DV5 E;  3LNU A;  3HUL A;  3QT7 A;  4DR3 I;  2HHH I;  2F4V I;  4LF5 E;  3PYD A;  4PU9 A;  4HAC B;  4DU7 A;  2V2V A;  1QZR A;  3T1H E;  2HFS A;  3ZKB A;  3Q1Q A;  4NXM E;  2VQF E;  1N36 I;  4X62 E;  3LPS A;  4JV5 I;  4HAC A;  4KQV A;  4JI5 E;  4JI6 E;  1H7U A;  4DU8 A;  3T1Y I;  2GS8 A;  2UXB E;  1N33 I;  4ZVI A;  2UUC I;  2UUB E;  2LJP A;  1MG7 A;  4UT4 A;  4YHH I;  1KKH A;  4B3M I;  4HY1 A;  3J80 C;  1N32 E;  4DV3 I;  4B3T I;  4B3R I;  4LFC E;  2VQE I;  3J7A G;  2J7K A;  4LFB E;  1NHJ A;  1DAR A;  3WU5 A;  4YY3 I;  4JI4 E;  1Z0G A;  4HXZ A;  4JI5 I;  4LF4 I;  4GKJ E;  4HYM A;  4DR5 I;  4K0K I;  1VIS A;  2UXB I;  5LMU E;  3ZKD A;  1IBM E;  4I3H A;  1ZXN A;  4DXL A;  3D4J A;  2UXC I;  2R3V A;  4WUD A;  5L3J A;  2CZ9 A;  3QT8 A;  5BR8 I;  1S4E A;  1FJG E;  1HNZ I;  1HNX E;  4DV7 I;  2V2Z A;  5LL6 R;  1D6T A;  4AQY I;  2V34 A;  4LF9 I;  4DUY I;  3H4L A;  4JI0 I;  4JI7 E;  1OJ4 A;  2HFU A;  4JI4 I;  4USK A;  1KIJ A;  5A2Q Q;  3JAM Q;  4DR7 E;  4DV6 I;  1IBM I;  1PVG A;  5IWA I;  4WUC A;  1N34 I;  2WW4 A;  2AJ4 A; 
#chains in the Genus database with same CATH topology
 3GME A;  4DR3 E;  2HHH E;  2F4V E;  4JI2 E;  1UDN A;  4IFD E;  1Z0C A;  4DV0 I;  3U1K A;  1H72 C;  4N3O A;  2Z5B A;  3ZZT A;  2E5L I;  4MYU A;  4FN5 A;  4FW3 A;  2E1R A;  1ZM3 A;  3M6A A;  3PS2 A;  1EA6 A;  1N36 E;  2O1U A;  2PO2 B;  1N0U A;  4MQY A;  2J65 A;  1XNQ I;  4JV5 E;  4X66 I;  4DPW A;  1E3H A;  2EFG A;  4LPF A;  4OKG A;  3P3G A;  3T1Y E;  1XMO I;  2ZBK B;  3OTO I;  1XNR I;  1IBL I;  1N33 E;  1FKA E;  2PO2 A;  5C0X F;  1XHK A;  4FWG A;  4BA2 B;  4JI2 I;  2UUC E;  4KHP I;  2NN6 F;  2UXD I;  2A2D A;  4YHH E;  4B3M E;  4DV3 E;  4B3T E;  2O1W A;  1B62 A;  1ZM2 A;  2VF3 A;  1Z5B A;  4B3R E;  2VQE E;  4AIM A;  3B82 A;  4OO1 B;  4AM3 A;  1Y6Z A;  5FWK A;  4BA1 B;  4P52 A;  4YY3 E;  3J7A M;  4LF4 E;  1Z0W A;  4DR5 E;  4K0K E;  4R1F A;  1HNW I;  4M1K A;  2A2C A;  3QT6 A;  4OO1 A;  4X65 I;  2UXC E;  4LF8 I;  3GON A;  4DPU A;  4IZJ B;  5BR8 E;  2BM0 A;  1ELO A;  5ELW A;  1ZXM A;  1HNZ E;  1FI4 A;  5K36 D;  4IFD F;  4DV7 E;  4Z7C A;  3K1J A;  4JI1 I;  4NXN I;  3WU6 A;  3B78 A;  2HKE A;  4AQY E;  2HKJ A;  4RPF A;  4LF9 E;  4DUY E;  1Y4S A;  4JI0 E;  2BM1 A;  4USM A;  3GLL A;  4IZJ A;  1XMQ I;  4DR1 I;  3K85 A;  5C0X C;  4DR6 I;  5EL9 A;  4DV6 E;  5IWA E;  5JEA B;  1VI7 A;  1OYR A;  1J5E I;  2C39 B;  2JEA B;  1N34 E;  2IOP A;  4GKK I;  1FWL A;  2R42 A;  3LTO A;  2ZIT A;  1I94 E;  1H73 A;  4DV0 E;  1UEK A;  5EKW A;  2ZM6 I;  2PNM A;  3M85 D;  2E5L E;  5JEA A;  3GCM A;  1UDQ A;  2C39 A;  2JEA A;  4OO1 E;  1Z0T A;  3V5R A;  4MYT A;  2Z5E A;  4FW5 A;  1XNQ E;  1H74 A;  4X66 E;  1B63 A;  1Z5A A;  1HR0 I;  4LFA I;  3CDI A;  4MU1 A;  4DV1 I;  2BA0 D;  4JYA I;  1XMO E;  3OTO E;  4FWH A;  1Z0E A;  1XNR E;  1A6F A;  1OYP A;  3ZZU A;  5FLX Q;  1IBL E;  4UTG A;  4IFD C;  2NPF A;  5K36 F;  1K47 A;  1I94 I;  4KHP E;  1XXE A;  4LF7 I;  2UXD E;  5IT9 Q;  2X7I A;  4U3B A;  1R6L A;  1Y4U A;  1NHH A;  4IZJ D;  4X64 I;  4QNK A;  3K17 A;  4EMD A;  3PS1 A;  4QNJ A;  4IFD D;  2HK2 A;  5A2Q C;  2GO3 A;  4DPY A;  3ZM7 A;  3JAM C;  4DR4 I;  3M7N D;  1USU A;  3ZZ0 A;  5DRO A;  4IZK B;  1HNW E;  1KVK A;  4DV4 I;  5JEA E;  4MU0 A;  4DR2 I;  1WUU A;  5LMN I;  4LF6 I;  4FW9 A;  4OX9 I;  4ISA A;  4X65 E;  1PKP A;  4LF8 E;  4JI3 E;  5IT9 C;  4URL A;  4FWD A;  4IZK A;  3WU4 A;  4Z7Y A;  4DV2 I;  4B3S I;  4JI1 E;  4JG4 A;  2O1V A;  4NXN E;  4JI8 I;  3P3E A;  1YHC A;  4DUZ I;  3P06 A;  1S16 A;  4FW4 A;  2C37 B;  4OO1 F;  3Q6N A;  1XMQ E;  4DR1 E;  1NHI A;  3V2U C;  2DEI A;  5K36 C;  2NN6 B;  3F0N A;  4DR6 E;  1H7S A;  3J81 Q;  2BV3 A;  2CVE A;  3KRN A;  1J5E E;  2C37 A;  3J80 Q;  4JI3 I;  4GKK E;  2UU9 I;  3P3C A;  5DNL A;  4DPT A;  3B8H A;  1EI1 A;  3PS3 A;  2NN6 A;  3UHM A;  1FWK A;  2X36 A;  2ZM6 E;  3H1C A;  2UUA I;  2OI2 A;  1RRE A;  3PYF A;  5GME A;  1IBK I;  4DV5 I;  4DPX A;  2V8P A;  1BKN A;  2WNR A;  3Q6M A;  1MU5 A;  3J81 C;  4LF5 I;  3QT5 A;  1HR0 E;  4LFA E;  2WP8 B;  1Z5C A;  1U2R A;  4DV1 E;  3T1H I;  4JYA E;  4LCH A;  2BR2 B;  3CWV A;  2GO4 A;  4NXM I;  2VQF I;  4WUB A;  4XTJ A;  4X62 I;  1ZM9 A;  4LF7 E;  2CGE A;  2WP8 A;  1N0V C;  1ZM4 A;  4LCG A;  4P7A A;  3P76 A;  4OO1 C;  1MX0 A;  2IES A;  1UDS A;  4JI6 I;  2BR2 A;  1OYS A;  2C38 B;  4X64 E;  1Z0B A;  1P42 A;  1YH8 A;  2CG9 A;  5DNX A;  2NN6 E;  1Y60 A;  2UUB I;  3PYG A;  4DR4 E;  2PNL A;  4OO1 D;  2C38 A;  4DV4 E;  5GMD A;  4ED4 A;  4DR2 E;  5LMN E;  1N32 I;  2HK3 A;  4LF6 E;  4LFC I;  4OX9 E;  2PO0 B;  4LFB I;  2V2Q A;  1KTV A;  3WU3 A;  4GKJ I;  4DV2 E;  1RR9 A;  4B3S E;  4JI8 E;  4DUZ E;  5LMU I;  3PYE A;  2DEJ A;  2PO0 A;  4PRX A;  1HK7 A;  5K36 B;  1Z59 A;  5JEA C;  4U3D A;  2Q2E B;  3HKM A;  4NBQ A;  2XEX A;  1FJG I;  2JE6 B;  4OZE A;  1PIE A;  1HNX I;  3NZK A;  5FLX C;  1Y5Y A;  5K36 A;  2GQ0 A;  2UU9 E;  4PRV A;  5DRQ A;  5JEA D;  4JI7 I;  3HJC A;  2JE6 A;  1Z0V A;  4DR7 I;  2UUA E;  1E3P A;  1NZ0 A;  1FNM A;  2O3Z A;  1IBK E;  4DV5 E;  3LNU A;  3HUL A;  3QT7 A;  1R6M A;  5C0X B;  4DR3 I;  2HHH I;  2IOQ A;  2F4V I;  4LF5 E;  3PYD A;  4PU9 A;  4HAC B;  4IS9 A;  4DU7 A;  2V2V A;  1QZR A;  3T1H E;  2HFS A;  3ZKB A;  2BA1 G;  2JT2 A;  3B4T A;  5C0X A;  3Q1Q A;  2AE8 A;  3M85 G;  4NXM E;  4J3D A;  4BA2 A;  1USV A;  3CDJ A;  2VQF E;  1N36 I;  4X62 E;  2WNR B;  3LPS A;  4JV5 I;  4MU4 A;  5DRP A;  4HAC A;  4FW6 A;  4KQV A;  4JI5 E;  4JI6 E;  1H7U A;  4DU8 A;  3T1Y I;  2VES A;  2GS8 A;  2UXB E;  1N33 I;  2BA0 G;  5K36 E;  4ZVI A;  4BA1 A;  2UUC I;  2UUB E;  2LJP A;  2PO1 B;  4IFD B;  1MG7 A;  4UT4 A;  4YHH I;  4AID A;  1KKH A;  4B3M I;  4HY1 A;  3J80 C;  2JEB B;  4MU3 A;  5JEA F;  4DV3 I;  1N32 E;  4B3T I;  4B3R I;  4LFC E;  2VQE I;  3J7A G;  2J7K A;  4LFB E;  1UDO A;  1NHJ A;  1DAR A;  2PO1 A;  4GQU A;  4IFD A;  3WU5 A;  4YY3 I;  4JI4 E;  1Z0G A;  2Z5C B;  4HXZ A;  4JI5 I;  4LF4 I;  4GKJ E;  2JEB A;  4HYM A;  4DR5 I;  4K0K I;  1VIS A;  3M7N G;  2UXB I;  5LMU E;  3ZKD A;  1IBM E;  4I3H A;  5C0X E;  2NN6 C;  5DRR A;  1ZXN A;  4DXL A;  3D4J A;  2IER A;  2UXC I;  4WUD A;  2R3V A;  5L3J A;  2CZ9 A;  3QT8 A;  5BR8 I;  2Z5C A;  1S4E A;  1FJG E;  2BA1 D;  2PNZ B;  1HNZ I;  1HNX E;  5C0X D;  4DV7 I;  2V2Z A;  2F1D A;  5LL6 R;  1D6T A;  4LCF A;  4AQY I;  2NN6 D;  2V34 A;  4LF9 I;  4DUY I;  3L7Z B;  3H4L A;  4JI0 I;  2O1T A;  4JI7 E;  4MDT A;  3DD6 A;  1OJ4 A;  2PNZ A;  2HFU A;  4JI4 I;  4USK A;  1KIJ A;  5A2Q Q;  3JAM Q;  4DR7 E;  4DV6 I;  1IBM I;  1PVG A;  2Z5B B;  4LOM A;  5IWA I;  3PRY A;  4FW7 A;  4WUC A;  3L7Z A;  3U1Y A;  1RHY A;  1N34 I;  2WW4 A;  2AJ4 A; 
#chains in the Genus database with same CATH homology
 4DR3 E;  2HHH E;  2F4V E;  4JI2 E;  1Z0C A;  4DV0 I;  1H72 C;  4N3O A;  2Z5B A;  3ZZT A;  2E5L I;  4MYU A;  4FN5 A;  2E1R A;  1ZM3 A;  3M6A A;  1EA6 A;  1N36 E;  2O1U A;  1N0U A;  4JV5 E;  1XNQ I;  4X66 I;  4DPW A;  2EFG A;  3T1Y E;  1XMO I;  2ZBK B;  3OTO I;  1XNR I;  1IBL I;  1N33 E;  1FKA E;  1XHK A;  4FWG A;  4JI2 I;  2UUC E;  4KHP I;  2UXD I;  2A2D A;  4YHH E;  4B3M E;  4DV3 E;  4B3T E;  2O1W A;  1B62 A;  1ZM2 A;  2VF3 A;  1Z5B A;  4B3R E;  2VQE E;  3B82 A;  1Y6Z A;  5FWK A;  4P52 A;  4YY3 E;  3J7A M;  4LF4 E;  1Z0W A;  4DR5 E;  4K0K E;  4R1F A;  1HNW I;  4M1K A;  2A2C A;  3QT6 A;  4X65 I;  2UXC E;  4LF8 I;  3GON A;  4DPU A;  4IZJ B;  5BR8 E;  2BM0 A;  1ELO A;  1ZXM A;  1HNZ E;  1FI4 A;  4DV7 E;  4Z7C A;  3K1J A;  4JI1 I;  4NXN I;  3WU6 A;  3B78 A;  2HKE A;  4AQY E;  2HKJ A;  4RPF A;  4LF9 E;  4DUY E;  1Y4S A;  4JI0 E;  2BM1 A;  4USM A;  4IZJ A;  1XMQ I;  4DR1 I;  3K85 A;  4DR6 I;  4DV6 E;  5IWA E;  1J5E I;  1N34 E;  2IOP A;  4GKK I;  1FWL A;  2R42 A;  3LTO A;  2ZIT A;  1I94 E;  1H73 A;  4DV0 E;  1UEK A;  2ZM6 I;  2PNM A;  2E5L E;  1Z0T A;  3V5R A;  4MYT A;  2Z5E A;  1XNQ E;  1H74 A;  4X66 E;  1B63 A;  1Z5A A;  1HR0 I;  4LFA I;  4DV1 I;  4JYA I;  1XMO E;  3OTO E;  4FWH A;  1Z0E A;  1XNR E;  1A6F A;  3ZZU A;  5FLX Q;  1IBL E;  4UTG A;  2NPF A;  1K47 A;  1I94 I;  4KHP E;  4LF7 I;  2UXD E;  5IT9 Q;  2X7I A;  1Y4U A;  1NHH A;  4IZJ D;  4X64 I;  3K17 A;  4EMD A;  2HK2 A;  5A2Q C;  4DPY A;  3ZM7 A;  3JAM C;  4DR4 I;  1USU A;  3ZZ0 A;  4IZK B;  1HNW E;  1KVK A;  4DV4 I;  4DR2 I;  1WUU A;  5LMN I;  4LF6 I;  4FW9 A;  4OX9 I;  4X65 E;  1PKP A;  4LF8 E;  4JI3 E;  5IT9 C;  4URL A;  4FWD A;  4IZK A;  3WU4 A;  4Z7Y A;  4DV2 I;  4B3S I;  4JI1 E;  4JG4 A;  2O1V A;  4NXN E;  4JI8 I;  4DUZ I;  3P06 A;  1S16 A;  3Q6N A;  1XMQ E;  4DR1 E;  1NHI A;  3V2U C;  2DEI A;  3F0N A;  4DR6 E;  1H7S A;  3J81 Q;  2BV3 A;  1J5E E;  3J80 Q;  4JI3 I;  4GKK E;  2UU9 I;  4DPT A;  3B8H A;  1EI1 A;  1FWK A;  2X36 A;  2ZM6 E;  2UUA I;  2OI2 A;  1RRE A;  3PYF A;  5GME A;  1IBK I;  4DV5 I;  4DPX A;  2V8P A;  1BKN A;  3Q6M A;  1MU5 A;  3J81 C;  4LF5 I;  3QT5 A;  1HR0 E;  4LFA E;  1Z5C A;  1U2R A;  4DV1 E;  3T1H I;  4JYA E;  3CWV A;  4NXM I;  2VQF I;  4WUB A;  4XTJ A;  4X62 I;  1ZM9 A;  4LF7 E;  2CGE A;  1N0V C;  1ZM4 A;  4P7A A;  1MX0 A;  4JI6 I;  4X64 E;  1Z0B A;  2CG9 A;  2UUB I;  4DR4 E;  3PYG A;  2PNL A;  4DV4 E;  5GMD A;  4ED4 A;  4DR2 E;  5LMN E;  1N32 I;  2HK3 A;  4LF6 E;  4LFC I;  4OX9 E;  4LFB I;  2V2Q A;  1KTV A;  3WU3 A;  4GKJ I;  4DV2 E;  1RR9 A;  4B3S E;  4JI8 E;  4DUZ E;  5LMU I;  3PYE A;  2DEJ A;  4PRX A;  1HK7 A;  1Z59 A;  2Q2E B;  2XEX A;  1FJG I;  1PIE A;  1HNX I;  5FLX C;  2GQ0 A;  2UU9 E;  4PRV A;  4JI7 I;  3HJC A;  1Z0V A;  4DR7 I;  2UUA E;  1NZ0 A;  1FNM A;  1IBK E;  4DV5 E;  3LNU A;  3HUL A;  3QT7 A;  4DR3 I;  2HHH I;  2IOQ A;  2F4V I;  4LF5 E;  3PYD A;  4PU9 A;  4HAC B;  4DU7 A;  2V2V A;  1QZR A;  3T1H E;  2HFS A;  3ZKB A;  3Q1Q A;  4NXM E;  1USV A;  2VQF E;  1N36 I;  4X62 E;  3LPS A;  4JV5 I;  4HAC A;  4KQV A;  4JI5 E;  4JI6 E;  1H7U A;  4DU8 A;  3T1Y I;  2GS8 A;  2UXB E;  1N33 I;  4ZVI A;  2UUC I;  2UUB E;  2LJP A;  1MG7 A;  4UT4 A;  4YHH I;  1KKH A;  4B3M I;  4HY1 A;  3J80 C;  1N32 E;  4DV3 I;  4B3T I;  4B3R I;  4LFC E;  2VQE I;  3J7A G;  2J7K A;  4LFB E;  1NHJ A;  1DAR A;  3WU5 A;  4YY3 I;  4JI4 E;  1Z0G A;  2Z5C B;  4HXZ A;  4JI5 I;  4LF4 I;  4GKJ E;  4HYM A;  4DR5 I;  4K0K I;  1VIS A;  2UXB I;  5LMU E;  3ZKD A;  1IBM E;  4I3H A;  1ZXN A;  4DXL A;  3D4J A;  2UXC I;  2R3V A;  4WUD A;  5L3J A;  2CZ9 A;  3QT8 A;  5BR8 I;  2Z5C A;  1S4E A;  1FJG E;  1HNZ I;  1HNX E;  4DV7 I;  2V2Z A;  5LL6 R;  1D6T A;  4AQY I;  2V34 A;  4LF9 I;  4DUY I;  3H4L A;  4JI0 I;  2O1T A;  4JI7 E;  1OJ4 A;  2HFU A;  4JI4 I;  4USK A;  1KIJ A;  5A2Q Q;  3JAM Q;  4DR7 E;  4DV6 I;  1IBM I;  1PVG A;  2Z5B B;  5IWA I;  3PRY A;  4WUC A;  1N34 I;  2WW4 A;  2AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...