1RREA

Crystal structure of e.coli lon proteolytic domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The catalytic domain of Escherichia coli Lon protease has a unique fold and a Ser-Lys dyad in the active site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ATP-dependent protease La
total genus 53
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2003-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1rreA01
3V2UC 4YY3I 3ZKDA 1FNMA 5FLXC 5A2QQ 3PYGA 2UXDE 3Q1QA 4I3HA 4DV0I 3ZZUA 4LF6E 4JV5I 3T1HI 4DUZI 1Z0WA 4HY1A 2UXCI 3ZZ0A 3V5RA 2A2CA 4LF4I 1MG7A 4ZVIA 2X36A 2UXBI 4X64E 3OTOE 1N32I 1HNXE 4DPWA 1XMOI 3QT5A 2UXBE 5BR8E 2LJPA 4LFCE 3WU5A 4JV5E 4LF6I 4JI8E 1HNWE 2NPFA 1VISA 2HFSA 1NZ0A 4OX9I 4LF8I 3J7AM 4R1FA 4DR2I 4JI1E 1HNZE 5LMNI 2BM1A 1N36I 4LFBI 4JI0E 4LF5E 3T1YI 4LF7E 3T1HE 1ZM4A 4XTJA 1IBKE 5FLXQ 1XNRE 4YHHI 4DPTA 3QT6A 2HHHE 5IT9Q 4NXNE 4JI2E 3LTOA 4X62I 1H72C 3PYEA 1KTVA 4DV5I 2VQEE 1IBLE 1IBLI 4X65I 3WU4A 4FWDA 4DR3I 4PU9A 1D6TA 3WU6A 1FI4A 4JG4A 4ED4A 1EI1A 2UUAI 4DR7I 1IBKI 1H73A 1ZM3A 4GKJE 4DPXA 2XEXA 4LF7I 4JI4I 1N36E 4LFBE 4DR4I 4X66E 4X62E 3K17A 1J5EE 4GKJI 1HNZI 2GS8A 2EFGA 2VQFE 1B62A 4OX9E 5LMUI 1I94E 2E5LE 4JYAE 4P7AA 4DV4I 1HNWI 1XHKA 1ZM2A 1FJGE 3T1YE 1MU5A 1Z5CA 4B3ME 4JI6I 4DV2I 4FWGA 1N0VC 4KQVA 4LFAI 3JAMC 4JI5E 5LL6R 3PYDA 4DPUA 4DR6E 4YHHE 1NHJA 4LFAE 4RPFA 1Z0EA 4B3SE 4WUDA 1IBMI 2HK3A 3J7AG 2UUBE 1FWKA 1NHIA 4K0KI 2HFUA 4HYMA 4DUZE 4K0KE 1N0UA 4PRVA 5BR8I 3LNUA 4DR2E 3LPSA 3J81Q 4LF8E 4AQYE 4YY3E 2ZITA 1Z0VA 2F4VI 2ZM6E 1RREA 2UXCE 4B3MI 2UUBI 1XNQE 4LFCI 1FJGI 4KHPE 1IBME 1S4EA 2UUAE 4WUBA 2V8PA 3GONA 3ZM7A 1FKAE 2VF3A 1H7SA 4JYAI 2R42A 3JAMQ 4DPYA 1N32E 3OTOI 3CWVA 4DV2E 3PYFA 4JI6E 1Z0TA 2CZ9A 4JI4E 4GKKE 4DV5E 2HKJA 4URLA 1OJ4A 3J80C 4DV0E 2J7KA 5A2QC 1MX0A 5GMDA 2VQFI 1HR0E 5L3JA 4LF9E 1J5EI 1Z5AA 4X66I 2UUCI 4DXLA 4DV6E 5IWAI 4JI0I 4X65E 4LF5I 2BM0A 1ZXMA 1S16A 4DU8A 2VQEI 1N33E 1Z5BA 1ELOA 1RR9A 1Z59A 2A2DA 4JI2I 4LF9I 1ZXNA 4DUYE 2HHHI 2V2ZA 4B3TI 1XNRI 1WUUA 3B78A 3M6AA 1Z0BA 4JI7I 1H74A 4Z7CA 3J81C 4HACB 3HULA 2ZBKB 1B63A 2F4VE 1N34E 2V2VA 1HNXI 1U2RA 4DV7I 4NXMI 4LF4E 4KHPI 2V34A 3H4LA 4FWHA 5LMNE 4JI1I 4B3SI 1BKNA 2BV3A 2UXDI 2ZM6I 2HK2A 5IT9C 4DR6I 1Z0GA 4DU7A 2DEIA 3ZKBA 4NXME 1XMQE 4JI3E 1XMOE 1XMQI 4JI3I 4UT4A 2Q2EB 4AQYI 4JI5I 1N34I 4JI8I 1K47A 4DR5I 1QZRA 1UEKA 1KKHA 3D4JA 4DR5E 2HKEA 1I94I 2E5LI 5LMUE 1ZM9A 3F0NA 3B8HA 4X64I 4DUYI 3K1JA 2X7IA 4UTGA 4DV3I 1Z0CA 4DV1E 3WU3A 4HXZA 2UU9E 2E1RA 4EMDA 4B3RE 4FN5A 4WUCA 3ZZTA 4MYUA 4USMA 2UUCE 4M1KA 4Z7YA 4FW9A 3QT7A 1A6FA 4DV4E 1HR0I 3J80Q 4USKA 2WW4A 4DV7E 4DR3E 4DR1I 1NHHA 1H7UA 1N33I 2R3VA 4B3RI 2AJ4A 4DR4E 4MYTA 2UU9I 1PKPA 4JI7E 1FWLA 2OI2A 3B82A 4NXNI 4DR7E 1EA6A 4B3TE 1KIJA 1PIEA 1PVGA 3QT8A 2DEJA 4PRXA 1DARA 5GMEA 4GKKI 1XNQI 4P52A 5IWAE 4DV6I 2V2QA 4DV1I 1KVKA 4HACA 4DV3E 4DR1E
chains in the Genus database with same CATH superfamily
3V2UC 5C0XE 4YY3I 5JEAC 2NN6A 3ZKDA 4BA1A 1FNMA 5FLXC 5A2QQ 3PYGA 5DRQA 2UXDE 3Q1QA 1R6MA 4IFDE 2C37A 4OO1F 3M7NG 4I3HA 4DV0I 2JT2A 3ZZUA 4LF6E 4JV5I 3T1HI 4BA1B 4DUZI 2NN6B 1Z0WA 2PO2A 4HY1A 4OO1D 2UXCI 5JEAE 3ZZ0A 3V5RA 5DRPA 2Z5BB 2A2CA 4LF4I 1MG7A 4ZVIA 4IFDC 2X36A 2UXBI 4FW4A 4X64E 3OTOE 2NN6D 1N32I 4AM3A 1HNXE 4BA2A 4DPWA 1XMOI 3QT5A 2UXBE 4MDTA 5BR8E 2LJPA 3HJCA 5JEAB 4LFCE 3WU5A 4JV5E 4LF6I 3Q6NA 4IS9A 2C39A 5K36A 2JEAA 4JI8E 5K36F 1HNWE 2NPFA 1VISA 3HKMA 3GCMA 1OYPA 2JEBB 2HFSA 1NZ0A 2GQ0A 2PNMA 4FW5A 5FWKA 2J65A 4OX9I 4LF8I 1P42A 3J7AM 4R1FA 4IZJD 4DR2I 4JI1E 1HNZE 2Z5CA 5LMNI 2BM1A 1N36I 4LFBI 4JI0E 4LF5E 3T1YI 2PNZA 4LF7E 3T1HE 1ZM4A 4XTJA 1IBKE 5FLXQ 1XNRE 4YHHI 4DPTA 3P3CA 3QT6A 5DNXA 2HHHE 4OO1B 2BA1G 5IT9Q 4NXNE 3KRNA 4JI2E 3LTOA 4X62I 1H72C 4FW6A 3PYEA 1KTVA 4DV5I 1HK7A 2VQEE 1IBLE 1IBLI 1OYRA 4X65I 3WU4A 4MQYA 4FW7A 4FWDA 2C37B 2C38B 4DR3I 4PU9A 1RHYA 1D6TA 3WU6A 1E3HA 1FI4A 4JG4A 4ED4A 1EI1A 2UUAI 2O1TA 4DR7I 1IBKI 1H73A 1ZM3A 4GKJE 2Z5EA 4DPXA 1Y6ZA 2XEXA 2Z5CB 2PO0B 4LF7I 4U3BA 4JI4I 3P3EA 1N36E 4LFBE 4DR4I 4X66E 4X62E 3K17A 1J5EE 4MU4A 1HNZI 4GKJI 3PS1A 2GS8A 2EFGA 1UDOA 1B62A 4FW3A 4IZJB 2VQFE 1USVA 3UHMA 2NN6C 4OX9E 5LMUI 1I94E 2E5LE 2VESA 4IFDD 3H1CA 4JYAE 4P7AA 2JEAB 4DV4I 2WP8B 2C39B 2O3ZA 1HNWI 4IZKA 1XHKA 1ZM2A 4U3DA 1FJGE 3T1YE 4MU3A 1MU5A 1XXEA 1Z5CA 4B3ME 5C0XF 5EL9A 4JI6I 4DV2I 4FWGA 1N0VC 4KQVA 4LFAI 5JEAD 3JAMC 4JI5E 5LL6R 3PYDA 3GMEA 2IOPA 4DPUA 1R6LA 1Y5YA 4DR6E 4YHHE 1NHJA 3CDIA 4LFAE 3DD6A 4RPFA 1Z0EA 4B3SE 2BR2A 4ISAA 4WUDA 1IBMI 1UDQA 2HK3A 2GO4A 2UUBE 3J7AG 3B4TA 1FWKA 1NHIA 4K0KI 2HFUA 4HYMA 4DUZE 4K0KE 1N0UA 2JE6B 4PRVA 5BR8I 3L7ZA 3LNUA 4AIMA 4DR2E 3LPSA 3J81Q 4LF8E 2NN6E 4AQYE 1USUA 4YY3E 4OZEA 2ZITA 4IFDF 1Z0VA 2F4VI 2ZM6E 1RREA 5K36D 2BA1D 2UXCE 4B3MI 4OO1A 2IESA 2UUBI 1XNQE 4LFCI 1FJGI 4KHPE 1IBME 1S4EA 2UUAE 4WUBA 2V8PA 3GONA 3ZM7A 1FKAE 2VF3A 1H7SA 4JYAI 2R42A 3JAMQ 1YH8A 4DPYA 1N32E 3OTOI 3CWVA 1Y4UA 4DV2E 3PYFA 4JI6E 4OO1E 1Z0TA 2BA0G 2CZ9A 2O1WA 4N3OA 3P06A 4JI4E 3P76A 4GKKE 4DV5E 2HKJA 3P3GA 4URLA 2IOQA 1OJ4A 3J80C 1OYSA 4DV0E 2J7KA 3U1KA 5A2QC 4IZKB 1UDSA 4GQUA 1MX0A 4NBQA 5GMDA 4J3DA 2VQFI 1HR0E 5L3JA 4LF9E 1J5EI 1Z5AA 3PS3A 4X66I 2UUCI 4DXLA 4DV6E 5IWAI 4JI0I 4X65E 4LF5I 2PO1A 2BM0A 1ZXMA 4BA2B 3CDJA 1S16A 4DU8A 2VQEI 1N33E 2CVEA 1Z5BA 1ELOA 1RR9A 1Z59A 2A2DA 5ELWA 4JI2I 4LF9I 1ZXNA 4IFDB 4DUYE 2Z5BA 2HHHI 2V2ZA 4B3TI 1XNRI 2JE6A 1WUUA 3B78A 3M6AA 4OO1C 4QNKA 1Z0BA 4JI7I 2GO3A 1H74A 4Z7CA 3J81C 4HACB 3HULA 1UDNA 2PO1B 4OKGA 2ZBKB 1B63A 2F4VE 4LCHA 5C0XB 1N34E 2V2VA 1HNXI 1U2RA 2WNRA 1Y4SA 4DV7I 4LOMA 3M85D 4NXMI 5C0XD 2BA0D 4LF4E 2NN6F 2PNLA 2CG9A 3K85A 4MU1A 4LCGA 4KHPI 5K36C 2V34A 3H4LA 4FWHA 5LMNE 2PNZB 4JI1I 4B3SI 1VI7A 1BKNA 2BV3A 4IZJA 2UXDI 2ZM6I 2HK2A 5IT9C 4DR6I 1Z0GA 4DU7A 2DEIA 3ZKBA 4NXME 1XMQE 4JI3E 1XMOE 1XMQI 4JI3I 4UT4A 2Q2EB 4AQYI 4JI5I 5JEAF 3PS2A 1N34I 4JI8I 1K47A 4QNJA 2PO0A 4DR5I 1QZRA 1UEKA 1KKHA 3D4JA 4DR5E 5DNLA 1E3PA 4AIDA 2C38A 2HKEA 1I94I 2E5LI 4IFDA 5LMUE 1ZM9A 3F0NA 3B8HA 2O1VA 3M7ND 4X64I 5EKWA 4DUYI 3K1JA 2X7IA 4UTGA 4DV3I 1Z0CA 3Q6MA 4DV1E 5K36E 3WU3A 4HXZA 4MU0A 2UU9E 3L7ZB 2E1RA 4EMDA 4B3RE 4FN5A 4WUCA 3ZZTA 4MYUA 2PO2B 4LPFA 4USMA 2UUCE 4M1KA 4Z7YA 4FW9A 3QT7A 1A6FA 4DV4E 1HR0I 3J80Q 2BR2B 4USKA 2WW4A 4DV7E 4DR3E 4DR1I 1NHHA 1H7UA 1N33I 2R3VA 3M85G 3GLLA 2AJ4A 4B3RI 4DR4E 4MYTA 5DROA 2UU9I 1PKPA 4JI7E 1FWLA 2OI2A 3B82A 2O1UA 4NXNI 4DR7E 1EA6A 2JEBA 1Y60A 4B3TE 1KIJA 5K36B 3U1YA 1PIEA 2WP8A 2AE8A 4LCFA 5JEAA 1PVGA 3QT8A 2DEJA 4PRXA 1DARA 2WNRB 5GMEA 2IERA 4GKKI 1XNQI 1YHCA 4P52A 5C0XC 3NZKA 5IWAE 4DV6I 2V2QA 3PRYA 2F1DA 4DV1I 1KVKA 5C0XA 4HACA 5DRRA 4DV3E 4DR1E 2CGEA
chains in the Genus database with same CATH topology
3V2UC 4YY3I 3ZKDA 1FNMA 5FLXC 5A2QQ 3PYGA 2UXDE 3Q1QA 4I3HA 4DV0I 3ZZUA 4LF6E 4JV5I 3T1HI 4DUZI 1Z0WA 4HY1A 2UXCI 3ZZ0A 3V5RA 2Z5BB 2A2CA 4LF4I 1MG7A 4ZVIA 2X36A 2UXBI 4X64E 3OTOE 1N32I 1HNXE 4DPWA 1XMOI 3QT5A 2UXBE 5BR8E 2LJPA 3HJCA 4LFCE 3WU5A 4JV5E 4LF6I 3Q6NA 4JI8E 1HNWE 2NPFA 1VISA 2HFSA 1NZ0A 2GQ0A 2PNMA 5FWKA 4OX9I 4LF8I 3J7AM 4R1FA 4IZJD 4DR2I 4JI1E 1HNZE 2Z5CA 5LMNI 2BM1A 1N36I 4LFBI 4JI0E 4LF5E 3T1YI 4LF7E 3T1HE 1ZM4A 4XTJA 1IBKE 5FLXQ 1XNRE 4YHHI 4DPTA 3QT6A 2HHHE 5IT9Q 4NXNE 4JI2E 4X62I 3LTOA 1H72C 3PYEA 1KTVA 4DV5I 1HK7A 2VQEE 1IBLE 1IBLI 4X65I 3WU4A 4FWDA 4DR3I 4PU9A 1D6TA 3WU6A 1FI4A 4JG4A 4ED4A 1EI1A 2UUAI 2O1TA 4DR7I 1IBKI 1H73A 1ZM3A 4GKJE 2Z5EA 4DPXA 1Y6ZA 2XEXA 2Z5CB 4LF7I 4JI4I 1N36E 4LFBE 4DR4I 4X66E 4X62E 3K17A 1J5EE 4GKJI 1HNZI 2GS8A 2EFGA 2VQFE 1B62A 4IZJB 1USVA 4OX9E 5LMUI 1I94E 2E5LE 4JYAE 4P7AA 4DV4I 1HNWI 4IZKA 1XHKA 1ZM2A 1FJGE 3T1YE 1MU5A 1Z5CA 4B3ME 4JI6I 4DV2I 4FWGA 1N0VC 4KQVA 4LFAI 3JAMC 4JI5E 5LL6R 3PYDA 2IOPA 4DPUA 4DR6E 4YHHE 1NHJA 4LFAE 4RPFA 1Z0EA 4B3SE 4WUDA 1IBMI 2HK3A 3J7AG 2UUBE 1FWKA 1NHIA 4K0KI 2HFUA 4HYMA 4DUZE 4K0KE 1N0UA 4PRVA 5BR8I 3LNUA 4DR2E 3LPSA 3J81Q 4LF8E 4AQYE 1USUA 4YY3E 2ZITA 1Z0VA 2F4VI 2ZM6E 1RREA 2UXCE 4B3MI 2UUBI 1XNQE 4LFCI 1FJGI 4KHPE 1IBME 1S4EA 2UUAE 4WUBA 2V8PA 3GONA 3ZM7A 1FKAE 2VF3A 1H7SA 4JYAI 2R42A 3JAMQ 4DPYA 1N32E 3OTOI 3CWVA 1Y4UA 4DV2E 3PYFA 4JI6E 1Z0TA 2CZ9A 2O1WA 4N3OA 3P06A 4JI4E 4GKKE 4DV5E 2HKJA 4URLA 2IOQA 1OJ4A 3J80C 4DV0E 2J7KA 5A2QC 4IZKB 1MX0A 5GMDA 2VQFI 1HR0E 5L3JA 4LF9E 1J5EI 1Z5AA 4X66I 2UUCI 4DXLA 4DV6E 5IWAI 4JI0I 4X65E 4LF5I 2BM0A 1ZXMA 1S16A 4DU8A 2VQEI 1N33E 1Z5BA 1ELOA 1RR9A 1Z59A 2A2DA 4JI2I 4LF9I 1ZXNA 4DUYE 2Z5BA 2HHHI 2V2ZA 4B3TI 1XNRI 1WUUA 3B78A 3M6AA 1Z0BA 4JI7I 1H74A 4Z7CA 3J81C 4HACB 3HULA 2ZBKB 1B63A 2F4VE 1N34E 2V2VA 1HNXI 1U2RA 1Y4SA 4DV7I 4NXMI 4LF4E 2PNLA 2CG9A 3K85A 4KHPI 2V34A 3H4LA 4FWHA 5LMNE 4JI1I 4B3SI 1BKNA 2BV3A 4IZJA 2UXDI 2ZM6I 2HK2A 5IT9C 4DR6I 1Z0GA 4DU7A 2DEIA 3ZKBA 4NXME 1XMQE 4JI3E 1XMOE 1XMQI 4JI3I 4UT4A 2Q2EB 4AQYI 4JI5I 1N34I 4JI8I 1K47A 4DR5I 1QZRA 1UEKA 1KKHA 3D4JA 4DR5E 2HKEA 1I94I 2E5LI 5LMUE 1ZM9A 3F0NA 3B8HA 2O1VA 4X64I 4DUYI 3K1JA 2X7IA 4UTGA 4DV3I 1Z0CA 3Q6MA 4DV1E 3WU3A 4HXZA 2UU9E 2E1RA 4EMDA 4B3RE 4FN5A 4WUCA 3ZZTA 4MYUA 4USMA 2UUCE 4M1KA 4Z7YA 4FW9A 3QT7A 1A6FA 4DV4E 1HR0I 3J80Q 4USKA 2WW4A 4DV7E 4DR3E 4DR1I 1NHHA 1H7UA 1N33I 2R3VA 4B3RI 2AJ4A 4DR4E 4MYTA 2UU9I 1PKPA 4JI7E 1FWLA 2OI2A 3B82A 2O1UA 4NXNI 4DR7E 1EA6A 4B3TE 1KIJA 1PIEA 1PVGA 3QT8A 2DEJA 4PRXA 1DARA 5GMEA 4GKKI 1XNQI 4P52A 5IWAE 4DV6I 2V2QA 3PRYA 4DV1I 1KVKA 4HACA 4DV3E 4DR1E 2CGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2U C;  4YY3 I;  3ZKD A;  1FNM A;  5FLX C;  5A2Q Q;  3PYG A;  2UXD E;  3Q1Q A;  4I3H A;  4DV0 I;  3ZZU A;  4LF6 E;  4JV5 I;  3T1H I;  4DUZ I;  1Z0W A;  4HY1 A;  2UXC I;  3ZZ0 A;  3V5R A;  2A2C A;  4LF4 I;  1MG7 A;  4ZVI A;  2X36 A;  2UXB I;  4X64 E;  3OTO E;  1N32 I;  1HNX E;  4DPW A;  1XMO I;  3QT5 A;  2UXB E;  5BR8 E;  2LJP A;  4LFC E;  3WU5 A;  4JV5 E;  4LF6 I;  4JI8 E;  1HNW E;  2NPF A;  1VIS A;  2HFS A;  1NZ0 A;  4OX9 I;  4LF8 I;  3J7A M;  4R1F A;  4DR2 I;  4JI1 E;  1HNZ E;  5LMN I;  2BM1 A;  1N36 I;  4LFB I;  4JI0 E;  4LF5 E;  3T1Y I;  4LF7 E;  3T1H E;  1ZM4 A;  4XTJ A;  1IBK E;  5FLX Q;  1XNR E;  4YHH I;  4DPT A;  3QT6 A;  2HHH E;  5IT9 Q;  4NXN E;  4JI2 E;  3LTO A;  4X62 I;  1H72 C;  3PYE A;  1KTV A;  4DV5 I;  2VQE E;  1IBL E;  1IBL I;  4X65 I;  3WU4 A;  4FWD A;  4DR3 I;  4PU9 A;  1D6T A;  3WU6 A;  1FI4 A;  4JG4 A;  4ED4 A;  1EI1 A;  2UUA I;  4DR7 I;  1IBK I;  1H73 A;  1ZM3 A;  4GKJ E;  4DPX A;  2XEX A;  4LF7 I;  4JI4 I;  1N36 E;  4LFB E;  4DR4 I;  4X66 E;  4X62 E;  3K17 A;  1J5E E;  4GKJ I;  1HNZ I;  2GS8 A;  2EFG A;  2VQF E;  1B62 A;  4OX9 E;  5LMU I;  1I94 E;  2E5L E;  4JYA E;  4P7A A;  4DV4 I;  1HNW I;  1XHK A;  1ZM2 A;  1FJG E;  3T1Y E;  1MU5 A;  1Z5C A;  4B3M E;  4JI6 I;  4DV2 I;  4FWG A;  1N0V C;  4KQV A;  4LFA I;  3JAM C;  4JI5 E;  5LL6 R;  3PYD A;  4DPU A;  4DR6 E;  4YHH E;  1NHJ A;  4LFA E;  4RPF A;  1Z0E A;  4B3S E;  4WUD A;  1IBM I;  2HK3 A;  3J7A G;  2UUB E;  1FWK A;  1NHI A;  4K0K I;  2HFU A;  4HYM A;  4DUZ E;  4K0K E;  1N0U A;  4PRV A;  5BR8 I;  3LNU A;  4DR2 E;  3LPS A;  3J81 Q;  4LF8 E;  4AQY E;  4YY3 E;  2ZIT A;  1Z0V A;  2F4V I;  2ZM6 E;  1RRE A;  2UXC E;  4B3M I;  2UUB I;  1XNQ E;  4LFC I;  1FJG I;  4KHP E;  1IBM E;  1S4E A;  2UUA E;  4WUB A;  2V8P A;  3GON A;  3ZM7 A;  1FKA E;  2VF3 A;  1H7S A;  4JYA I;  2R42 A;  3JAM Q;  4DPY A;  1N32 E;  3OTO I;  3CWV A;  4DV2 E;  3PYF A;  4JI6 E;  1Z0T A;  2CZ9 A;  4JI4 E;  4GKK E;  4DV5 E;  2HKJ A;  4URL A;  1OJ4 A;  3J80 C;  4DV0 E;  2J7K A;  5A2Q C;  1MX0 A;  5GMD A;  2VQF I;  1HR0 E;  5L3J A;  4LF9 E;  1J5E I;  1Z5A A;  4X66 I;  2UUC I;  4DXL A;  4DV6 E;  5IWA I;  4JI0 I;  4X65 E;  4LF5 I;  2BM0 A;  1ZXM A;  1S16 A;  4DU8 A;  2VQE I;  1N33 E;  1Z5B A;  1ELO A;  1RR9 A;  1Z59 A;  2A2D A;  4JI2 I;  4LF9 I;  1ZXN A;  4DUY E;  2HHH I;  2V2Z A;  4B3T I;  1XNR I;  1WUU A;  3B78 A;  3M6A A;  1Z0B A;  4JI7 I;  1H74 A;  4Z7C A;  3J81 C;  4HAC B;  3HUL A;  2ZBK B;  1B63 A;  2F4V E;  1N34 E;  2V2V A;  1HNX I;  1U2R A;  4DV7 I;  4NXM I;  4LF4 E;  4KHP I;  2V34 A;  3H4L A;  4FWH A;  5LMN E;  4JI1 I;  4B3S I;  1BKN A;  2BV3 A;  2UXD I;  2ZM6 I;  2HK2 A;  5IT9 C;  4DR6 I;  1Z0G A;  4DU7 A;  2DEI A;  3ZKB A;  4NXM E;  1XMQ E;  4JI3 E;  1XMO E;  1XMQ I;  4JI3 I;  4UT4 A;  2Q2E B;  4AQY I;  4JI5 I;  1N34 I;  4JI8 I;  1K47 A;  4DR5 I;  1QZR A;  1UEK A;  1KKH A;  3D4J A;  4DR5 E;  2HKE A;  1I94 I;  2E5L I;  5LMU E;  1ZM9 A;  3F0N A;  3B8H A;  4X64 I;  4DUY I;  3K1J A;  2X7I A;  4UTG A;  4DV3 I;  1Z0C A;  4DV1 E;  3WU3 A;  4HXZ A;  2UU9 E;  2E1R A;  4EMD A;  4B3R E;  4FN5 A;  4WUC A;  3ZZT A;  4MYU A;  4USM A;  2UUC E;  4M1K A;  4Z7Y A;  4FW9 A;  3QT7 A;  1A6F A;  4DV4 E;  1HR0 I;  3J80 Q;  4USK A;  2WW4 A;  4DV7 E;  4DR3 E;  4DR1 I;  1NHH A;  1H7U A;  1N33 I;  2R3V A;  4B3R I;  2AJ4 A;  4DR4 E;  4MYT A;  2UU9 I;  1PKP A;  4JI7 E;  1FWL A;  2OI2 A;  3B82 A;  4NXN I;  4DR7 E;  1EA6 A;  4B3T E;  1KIJ A;  1PIE A;  1PVG A;  3QT8 A;  2DEJ A;  4PRX A;  1DAR A;  5GME A;  4GKK I;  1XNQ I;  4P52 A;  5IWA E;  4DV6 I;  2V2Q A;  4DV1 I;  1KVK A;  4HAC A;  4DV3 E;  4DR1 E; 
#chains in the Genus database with same CATH topology
 3V2U C;  5C0X E;  4YY3 I;  5JEA C;  2NN6 A;  3ZKD A;  4BA1 A;  1FNM A;  5FLX C;  5A2Q Q;  3PYG A;  5DRQ A;  2UXD E;  3Q1Q A;  1R6M A;  4IFD E;  2C37 A;  4OO1 F;  3M7N G;  4I3H A;  4DV0 I;  2JT2 A;  3ZZU A;  4LF6 E;  4JV5 I;  3T1H I;  4BA1 B;  4DUZ I;  2NN6 B;  1Z0W A;  2PO2 A;  4HY1 A;  4OO1 D;  2UXC I;  5JEA E;  3ZZ0 A;  3V5R A;  5DRP A;  2Z5B B;  2A2C A;  4LF4 I;  1MG7 A;  4ZVI A;  4IFD C;  2X36 A;  2UXB I;  4FW4 A;  4X64 E;  3OTO E;  2NN6 D;  1N32 I;  4AM3 A;  1HNX E;  4BA2 A;  4DPW A;  1XMO I;  3QT5 A;  2UXB E;  4MDT A;  5BR8 E;  2LJP A;  3HJC A;  5JEA B;  4LFC E;  3WU5 A;  4JV5 E;  4LF6 I;  3Q6N A;  4IS9 A;  2C39 A;  5K36 A;  2JEA A;  4JI8 E;  5K36 F;  1HNW E;  2NPF A;  1VIS A;  3HKM A;  3GCM A;  1OYP A;  2JEB B;  2HFS A;  1NZ0 A;  2GQ0 A;  2PNM A;  4FW5 A;  5FWK A;  2J65 A;  4OX9 I;  4LF8 I;  1P42 A;  3J7A M;  4R1F A;  4IZJ D;  4DR2 I;  4JI1 E;  1HNZ E;  2Z5C A;  5LMN I;  2BM1 A;  1N36 I;  4LFB I;  4JI0 E;  4LF5 E;  3T1Y I;  2PNZ A;  4LF7 E;  3T1H E;  1ZM4 A;  4XTJ A;  1IBK E;  5FLX Q;  1XNR E;  4YHH I;  4DPT A;  3P3C A;  3QT6 A;  5DNX A;  2HHH E;  4OO1 B;  2BA1 G;  5IT9 Q;  4NXN E;  3KRN A;  4JI2 E;  3LTO A;  4X62 I;  1H72 C;  4FW6 A;  3PYE A;  1KTV A;  4DV5 I;  1HK7 A;  2VQE E;  1IBL E;  1IBL I;  1OYR A;  4X65 I;  3WU4 A;  4MQY A;  4FW7 A;  4FWD A;  2C37 B;  2C38 B;  4DR3 I;  4PU9 A;  1RHY A;  1D6T A;  3WU6 A;  1E3H A;  1FI4 A;  4JG4 A;  4ED4 A;  1EI1 A;  2UUA I;  2O1T A;  4DR7 I;  1IBK I;  1H73 A;  1ZM3 A;  4GKJ E;  2Z5E A;  4DPX A;  1Y6Z A;  2XEX A;  2Z5C B;  2PO0 B;  4LF7 I;  4U3B A;  4JI4 I;  3P3E A;  1N36 E;  4LFB E;  4DR4 I;  4X66 E;  4X62 E;  3K17 A;  1J5E E;  4MU4 A;  1HNZ I;  4GKJ I;  3PS1 A;  2GS8 A;  2EFG A;  1UDO A;  1B62 A;  4FW3 A;  4IZJ B;  2VQF E;  1USV A;  3UHM A;  2NN6 C;  4OX9 E;  5LMU I;  1I94 E;  2E5L E;  2VES A;  4IFD D;  3H1C A;  4JYA E;  4P7A A;  2JEA B;  4DV4 I;  2WP8 B;  2C39 B;  2O3Z A;  1HNW I;  4IZK A;  1XHK A;  1ZM2 A;  4U3D A;  1FJG E;  3T1Y E;  4MU3 A;  1MU5 A;  1XXE A;  1Z5C A;  4B3M E;  5C0X F;  5EL9 A;  4JI6 I;  4DV2 I;  4FWG A;  1N0V C;  4KQV A;  4LFA I;  5JEA D;  3JAM C;  4JI5 E;  5LL6 R;  3PYD A;  3GME A;  2IOP A;  4DPU A;  1R6L A;  1Y5Y A;  4DR6 E;  4YHH E;  1NHJ A;  3CDI A;  4LFA E;  3DD6 A;  4RPF A;  1Z0E A;  4B3S E;  2BR2 A;  4ISA A;  4WUD A;  1IBM I;  1UDQ A;  2HK3 A;  2GO4 A;  2UUB E;  3J7A G;  3B4T A;  1FWK A;  1NHI A;  4K0K I;  2HFU A;  4HYM A;  4DUZ E;  4K0K E;  1N0U A;  2JE6 B;  4PRV A;  5BR8 I;  3L7Z A;  3LNU A;  4AIM A;  4DR2 E;  3LPS A;  3J81 Q;  4LF8 E;  2NN6 E;  4AQY E;  1USU A;  4YY3 E;  4OZE A;  2ZIT A;  4IFD F;  1Z0V A;  2F4V I;  2ZM6 E;  1RRE A;  5K36 D;  2BA1 D;  2UXC E;  4B3M I;  4OO1 A;  2IES A;  2UUB I;  1XNQ E;  4LFC I;  1FJG I;  4KHP E;  1IBM E;  1S4E A;  2UUA E;  4WUB A;  2V8P A;  3GON A;  3ZM7 A;  1FKA E;  2VF3 A;  1H7S A;  4JYA I;  2R42 A;  3JAM Q;  1YH8 A;  4DPY A;  1N32 E;  3OTO I;  3CWV A;  1Y4U A;  4DV2 E;  3PYF A;  4JI6 E;  4OO1 E;  1Z0T A;  2BA0 G;  2CZ9 A;  2O1W A;  4N3O A;  3P06 A;  4JI4 E;  3P76 A;  4GKK E;  4DV5 E;  2HKJ A;  3P3G A;  4URL A;  2IOQ A;  1OJ4 A;  3J80 C;  1OYS A;  4DV0 E;  2J7K A;  3U1K A;  5A2Q C;  4IZK B;  1UDS A;  4GQU A;  1MX0 A;  4NBQ A;  5GMD A;  4J3D A;  2VQF I;  1HR0 E;  5L3J A;  4LF9 E;  1J5E I;  1Z5A A;  3PS3 A;  4X66 I;  2UUC I;  4DXL A;  4DV6 E;  5IWA I;  4JI0 I;  4X65 E;  4LF5 I;  2PO1 A;  2BM0 A;  1ZXM A;  4BA2 B;  3CDJ A;  1S16 A;  4DU8 A;  2VQE I;  1N33 E;  2CVE A;  1Z5B A;  1ELO A;  1RR9 A;  1Z59 A;  2A2D A;  5ELW A;  4JI2 I;  4LF9 I;  1ZXN A;  4IFD B;  4DUY E;  2Z5B A;  2HHH I;  2V2Z A;  4B3T I;  1XNR I;  2JE6 A;  1WUU A;  3B78 A;  3M6A A;  4OO1 C;  4QNK A;  1Z0B A;  4JI7 I;  2GO3 A;  1H74 A;  4Z7C A;  3J81 C;  4HAC B;  3HUL A;  1UDN A;  2PO1 B;  4OKG A;  2ZBK B;  1B63 A;  2F4V E;  4LCH A;  5C0X B;  1N34 E;  2V2V A;  1HNX I;  1U2R A;  2WNR A;  1Y4S A;  4DV7 I;  4LOM A;  3M85 D;  4NXM I;  5C0X D;  2BA0 D;  4LF4 E;  2NN6 F;  2PNL A;  2CG9 A;  3K85 A;  4MU1 A;  4LCG A;  4KHP I;  5K36 C;  2V34 A;  3H4L A;  4FWH A;  5LMN E;  2PNZ B;  4JI1 I;  4B3S I;  1VI7 A;  1BKN A;  2BV3 A;  4IZJ A;  2UXD I;  2ZM6 I;  2HK2 A;  5IT9 C;  4DR6 I;  1Z0G A;  4DU7 A;  2DEI A;  3ZKB A;  4NXM E;  1XMQ E;  4JI3 E;  1XMO E;  1XMQ I;  4JI3 I;  4UT4 A;  2Q2E B;  4AQY I;  4JI5 I;  5JEA F;  3PS2 A;  1N34 I;  4JI8 I;  1K47 A;  4QNJ A;  2PO0 A;  4DR5 I;  1QZR A;  1UEK A;  1KKH A;  3D4J A;  4DR5 E;  5DNL A;  1E3P A;  4AID A;  2C38 A;  2HKE A;  1I94 I;  2E5L I;  4IFD A;  5LMU E;  1ZM9 A;  3F0N A;  3B8H A;  2O1V A;  3M7N D;  4X64 I;  5EKW A;  4DUY I;  3K1J A;  2X7I A;  4UTG A;  4DV3 I;  1Z0C A;  3Q6M A;  4DV1 E;  5K36 E;  3WU3 A;  4HXZ A;  4MU0 A;  2UU9 E;  3L7Z B;  2E1R A;  4EMD A;  4B3R E;  4FN5 A;  4WUC A;  3ZZT A;  4MYU A;  2PO2 B;  4LPF A;  4USM A;  2UUC E;  4M1K A;  4Z7Y A;  4FW9 A;  3QT7 A;  1A6F A;  4DV4 E;  1HR0 I;  3J80 Q;  2BR2 B;  4USK A;  2WW4 A;  4DV7 E;  4DR3 E;  4DR1 I;  1NHH A;  1H7U A;  1N33 I;  2R3V A;  3M85 G;  3GLL A;  2AJ4 A;  4B3R I;  4DR4 E;  4MYT A;  5DRO A;  2UU9 I;  1PKP A;  4JI7 E;  1FWL A;  2OI2 A;  3B82 A;  2O1U A;  4NXN I;  4DR7 E;  1EA6 A;  2JEB A;  1Y60 A;  4B3T E;  1KIJ A;  5K36 B;  3U1Y A;  1PIE A;  2WP8 A;  2AE8 A;  4LCF A;  5JEA A;  1PVG A;  3QT8 A;  2DEJ A;  4PRX A;  1DAR A;  2WNR B;  5GME A;  2IER A;  4GKK I;  1XNQ I;  1YHC A;  4P52 A;  5C0X C;  3NZK A;  5IWA E;  4DV6 I;  2V2Q A;  3PRY A;  2F1D A;  4DV1 I;  1KVK A;  5C0X A;  4HAC A;  5DRR A;  4DV3 E;  4DR1 E;  2CGE A; 
#chains in the Genus database with same CATH homology
 3V2U C;  4YY3 I;  3ZKD A;  1FNM A;  5FLX C;  5A2Q Q;  3PYG A;  2UXD E;  3Q1Q A;  4I3H A;  4DV0 I;  3ZZU A;  4LF6 E;  4JV5 I;  3T1H I;  4DUZ I;  1Z0W A;  4HY1 A;  2UXC I;  3ZZ0 A;  3V5R A;  2Z5B B;  2A2C A;  4LF4 I;  1MG7 A;  4ZVI A;  2X36 A;  2UXB I;  4X64 E;  3OTO E;  1N32 I;  1HNX E;  4DPW A;  1XMO I;  3QT5 A;  2UXB E;  5BR8 E;  2LJP A;  3HJC A;  4LFC E;  3WU5 A;  4JV5 E;  4LF6 I;  3Q6N A;  4JI8 E;  1HNW E;  2NPF A;  1VIS A;  2HFS A;  1NZ0 A;  2GQ0 A;  2PNM A;  5FWK A;  4OX9 I;  4LF8 I;  3J7A M;  4R1F A;  4IZJ D;  4DR2 I;  4JI1 E;  1HNZ E;  2Z5C A;  5LMN I;  2BM1 A;  1N36 I;  4LFB I;  4JI0 E;  4LF5 E;  3T1Y I;  4LF7 E;  3T1H E;  1ZM4 A;  4XTJ A;  1IBK E;  5FLX Q;  1XNR E;  4YHH I;  4DPT A;  3QT6 A;  2HHH E;  5IT9 Q;  4NXN E;  4JI2 E;  4X62 I;  3LTO A;  1H72 C;  3PYE A;  1KTV A;  4DV5 I;  1HK7 A;  2VQE E;  1IBL E;  1IBL I;  4X65 I;  3WU4 A;  4FWD A;  4DR3 I;  4PU9 A;  1D6T A;  3WU6 A;  1FI4 A;  4JG4 A;  4ED4 A;  1EI1 A;  2UUA I;  2O1T A;  4DR7 I;  1IBK I;  1H73 A;  1ZM3 A;  4GKJ E;  2Z5E A;  4DPX A;  1Y6Z A;  2XEX A;  2Z5C B;  4LF7 I;  4JI4 I;  1N36 E;  4LFB E;  4DR4 I;  4X66 E;  4X62 E;  3K17 A;  1J5E E;  4GKJ I;  1HNZ I;  2GS8 A;  2EFG A;  2VQF E;  1B62 A;  4IZJ B;  1USV A;  4OX9 E;  5LMU I;  1I94 E;  2E5L E;  4JYA E;  4P7A A;  4DV4 I;  1HNW I;  4IZK A;  1XHK A;  1ZM2 A;  1FJG E;  3T1Y E;  1MU5 A;  1Z5C A;  4B3M E;  4JI6 I;  4DV2 I;  4FWG A;  1N0V C;  4KQV A;  4LFA I;  3JAM C;  4JI5 E;  5LL6 R;  3PYD A;  2IOP A;  4DPU A;  4DR6 E;  4YHH E;  1NHJ A;  4LFA E;  4RPF A;  1Z0E A;  4B3S E;  4WUD A;  1IBM I;  2HK3 A;  3J7A G;  2UUB E;  1FWK A;  1NHI A;  4K0K I;  2HFU A;  4HYM A;  4DUZ E;  4K0K E;  1N0U A;  4PRV A;  5BR8 I;  3LNU A;  4DR2 E;  3LPS A;  3J81 Q;  4LF8 E;  4AQY E;  1USU A;  4YY3 E;  2ZIT A;  1Z0V A;  2F4V I;  2ZM6 E;  1RRE A;  2UXC E;  4B3M I;  2UUB I;  1XNQ E;  4LFC I;  1FJG I;  4KHP E;  1IBM E;  1S4E A;  2UUA E;  4WUB A;  2V8P A;  3GON A;  3ZM7 A;  1FKA E;  2VF3 A;  1H7S A;  4JYA I;  2R42 A;  3JAM Q;  4DPY A;  1N32 E;  3OTO I;  3CWV A;  1Y4U A;  4DV2 E;  3PYF A;  4JI6 E;  1Z0T A;  2CZ9 A;  2O1W A;  4N3O A;  3P06 A;  4JI4 E;  4GKK E;  4DV5 E;  2HKJ A;  4URL A;  2IOQ A;  1OJ4 A;  3J80 C;  4DV0 E;  2J7K A;  5A2Q C;  4IZK B;  1MX0 A;  5GMD A;  2VQF I;  1HR0 E;  5L3J A;  4LF9 E;  1J5E I;  1Z5A A;  4X66 I;  2UUC I;  4DXL A;  4DV6 E;  5IWA I;  4JI0 I;  4X65 E;  4LF5 I;  2BM0 A;  1ZXM A;  1S16 A;  4DU8 A;  2VQE I;  1N33 E;  1Z5B A;  1ELO A;  1RR9 A;  1Z59 A;  2A2D A;  4JI2 I;  4LF9 I;  1ZXN A;  4DUY E;  2Z5B A;  2HHH I;  2V2Z A;  4B3T I;  1XNR I;  1WUU A;  3B78 A;  3M6A A;  1Z0B A;  4JI7 I;  1H74 A;  4Z7C A;  3J81 C;  4HAC B;  3HUL A;  2ZBK B;  1B63 A;  2F4V E;  1N34 E;  2V2V A;  1HNX I;  1U2R A;  1Y4S A;  4DV7 I;  4NXM I;  4LF4 E;  2PNL A;  2CG9 A;  3K85 A;  4KHP I;  2V34 A;  3H4L A;  4FWH A;  5LMN E;  4JI1 I;  4B3S I;  1BKN A;  2BV3 A;  4IZJ A;  2UXD I;  2ZM6 I;  2HK2 A;  5IT9 C;  4DR6 I;  1Z0G A;  4DU7 A;  2DEI A;  3ZKB A;  4NXM E;  1XMQ E;  4JI3 E;  1XMO E;  1XMQ I;  4JI3 I;  4UT4 A;  2Q2E B;  4AQY I;  4JI5 I;  1N34 I;  4JI8 I;  1K47 A;  4DR5 I;  1QZR A;  1UEK A;  1KKH A;  3D4J A;  4DR5 E;  2HKE A;  1I94 I;  2E5L I;  5LMU E;  1ZM9 A;  3F0N A;  3B8H A;  2O1V A;  4X64 I;  4DUY I;  3K1J A;  2X7I A;  4UTG A;  4DV3 I;  1Z0C A;  3Q6M A;  4DV1 E;  3WU3 A;  4HXZ A;  2UU9 E;  2E1R A;  4EMD A;  4B3R E;  4FN5 A;  4WUC A;  3ZZT A;  4MYU A;  4USM A;  2UUC E;  4M1K A;  4Z7Y A;  4FW9 A;  3QT7 A;  1A6F A;  4DV4 E;  1HR0 I;  3J80 Q;  4USK A;  2WW4 A;  4DV7 E;  4DR3 E;  4DR1 I;  1NHH A;  1H7U A;  1N33 I;  2R3V A;  4B3R I;  2AJ4 A;  4DR4 E;  4MYT A;  2UU9 I;  1PKP A;  4JI7 E;  1FWL A;  2OI2 A;  3B82 A;  2O1U A;  4NXN I;  4DR7 E;  1EA6 A;  4B3T E;  1KIJ A;  1PIE A;  1PVG A;  3QT8 A;  2DEJ A;  4PRX A;  1DAR A;  5GME A;  4GKK I;  1XNQ I;  4P52 A;  5IWA E;  4DV6 I;  2V2Q A;  3PRY A;  4DV1 I;  1KVK A;  4HAC A;  4DV3 E;  4DR1 E;  2CGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...