3T1HE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3t1hE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1hE02
5LMNE 4WYQB 1A6FA 4GKKE 2CPNA 1T4LB 2LTSA 4JI7I 4OX9I 4DR5I 4X66E 2DIXA 2E5LE 4DV4I 1NHIA 4X62E 3J81Q 4DPTA 4LFAI 1XMQI 4P52A 4K0KI 3WU4A 4YHHI 1ZM9A 4DR6I 1OJ4A 4JYAI 4JI4E 3JAMC 5BR8E 4KHPE 1VISA 2UXBE 2N3GA 1IBLE 2ZITA 1FI4A 2LJHA 1FKAE 3ZKDA 2RTXA 2BM0A 2JY9A 3ZM7A 3ZZUA 5IT9C 4LF9E 3GONA 1XHKA 3J7AG 1Z0VA 2NUEA 1O0WA 1IBKE 4X64I 5A2QQ 1ZM3A 3V5RA 3ADIA 1ZBTA 1IBME 4DPUA 2UUCE 2F4VE 2UXCE 2L3CA 3B8HA 4JI0I 1FWKA 4JI3I 3T1HE 4FW9A 4DUYE 1HNZE 2L2NA 4DR1I 5IWAE 1EI1A 4DR2E 2A2CA 1WHNA 4DU7A 2NA2A 4EMDA 4Z7CA 1WHQA 4JI2I 4LFBE 1N33E 4X8WA 2V8PA 4LFCI 4X65E 2HFUA 3C4BA 1N36I 1J5EI 2ZM6E 4FWDA 2EZ6A 1H7SA 2B7VA 2WW4A 2L33A 1HR0I 4JI1I 1U2RA 4JI6I 1S16A 4DV3I 3VYYA 1Z59A 4DV2E 4LF5E 3D4JA 1HNWI 4DV5E 2V34A 4GKJE 4USKA 1RR9A 2UXDE 4DV6E 4HACB 4FWGA 2L2MA 2NUFA 4DV1I 4AQYE 1KTVA 2VQEE 4DR3E 4DR7I 3J80Q 4OOGC 4NXMI 1UILA 1Z0TA 2HK2A 5FLXC 4JI7E 4OX9E 4DR5E 4LF4I 4JV5I 2X36A 4DV4E 2RS6A 1KIJA 2A2DA 4LFAE 1T4OA 1Z0BA 2RSMA 1YYWA 4K0KE 2KHXA 4LF8E 2UUAI 4YHHE 4LF6E 4DR6E 4PRVA 4JYAE 3J81C 1HNXI 2ZBKB 3K17A 2VQFI 2NUGA 4LF7I 3C4TA 2L3JA 4P7AA 3WU5A 1D6TA 1GQEA 3M6AA 4X62I 4DPXA 2UU9I 4DPWA 2HFSA 2AJ4A 2EFGA 3ADJA 1FWLA 1B62A 3P1XA 4URLA 4X64E 1RC7A 1Z0CA 1XNQI 4DV7I 5LMUE 1IBLI 4HY1A 4B3RI 1ELOA 3LLHA 2CZ9A 4KQVA 4DV0I 5A2QC 1DARA 5GMDA 3CWVA 1NHJA 4JI3E 3QT6A 4WUCA 4B3SI 4B3TI 4USMA 4DR1E 1ZXMA 1S4EA 1N32I 1PKPA 4JG4A 3H4LA 1XNRI 4DUZI 4JI2E 4M30A 4LFCE 3V2UC 4B3MI 2Q2EB 1J5EE 1FNMA 2GS8A 4YY3I 1ZXNA 3ADGA 2B7TA 1BKNA 3OTOI 1NHHA 1Z0WA 3ADLA 1HR0E 1Z5AA 4JI1E 4NXNI 4JI6E 4DV3E 2V2QA 4DR2I 1HNWE 1H74A 3WU6A 1EKZA 1N0VC 4LFBI 4X65I 1FJGI 4HXZA 4JI8I 2DB2A 1PVGA 4DV1E 2LUQA 4MYUA 3PYDA 2HHHI 4JI5I 2BM1A 4DR7E 3T1YI 4DPYA 4FWHA 4DR4I 1N34E 2UUBI 4NXME 4PRXA 3PYFA 4DV2I 4DV5I 1I94I 4JV5E 1Z5BA 2XEXA 4LF4E 2HKEA 1PIEA 3J80C 1B63A 1Z5CA 4UT4A 2N3HA 2J7KA 2IHR1 2LRSA 1XMQE 3LNUA 2VQEI 2UUAE 3K1JA 1KKHA 1XMOI 2L2KB 5L3JA 1HNXE 5LMNI 2VQFE 1J26A 4GKKI 4LF7E 4WUDA 1YYOA 4X66I 2E5LI 2HK3A 4I3HA 2UU9E 3JAMQ 4RPFA 4LF8I 2YT4A 1WUUA 3VYXA 1H7UA 4LF6I 2LBSB 3QT5A 1K47A 4XTJA 4JI4I 3B82A 5LL6R 5BR8I 1XNQE 3PYEA 1H73A 4DV7E 4KHPI 2UXBI 4B3RE 5IT9Q 4UTGA 1ZM2A 2R3VA 3Q1QA 2LTRA 2VF3A 4DV0E 4JI0E 1MG7A 3ZZ0A 3QT7A 1DI2A 1X49A 3ZKBA 4LF9I 4B3SE 3PYGA 3HTXA 4HYMA 4B3TE 1IBKI 1N32E 1MX0A 5LMUI 4ED4A 1IBMI 1XNRE 1UEKA 1RQ0A 3HULA 4DUZE 4MYTA 3WU3A 2UUCI 1YZ9A 2F4VI 2RS7A 2MDRA 4B3ME 2V2VA 2UXCI 2NPFA 4DXLA 1N36E 3LPSA 4YY3E 2V2ZA 3OTOE 2LJPA 3T1HI 4DUYI 1HNZI 4Z7YA 4WFTA 2OI2A 3B78A 4M2ZA 4NXNE 2DEJA 4R1FA 4FN5A 3ZZTA 2HKJA 4HACA 5IWAI 4WUBA 2E1RA 1EA6A 5GMEA 1N33I 1FJGE 2DMYA 4JI8E 4ZVIA 3F0NA 2ZM6I 1KVKA 2LUPB 1RREA 2HHHE 4JI5E 1T4NA 5CFFE 1QU6A 2X7IA 2B3TB 1ZM4A 3T1YE 4M1KA 1Z0GA 4DR4E 2UUBE 1MU5A 3LTOA 1STUA 1I94E 4LF5I 4GKJI 1N0UA 2DEIA 2BV3A 1NZ0A 4PU9A 2UXDI 4DV6I 3QT8A 1Z0EA 3J7Yp 1YYKA 1X47A 5FLXQ 4AQYI 1UHZA 3J7AM 4DKKA 4DR3I 1XMOE 1X48A 4DU8A 1QZRA 2JVAA 1N34I 1H72C 2R42A
chains in the Genus database with same CATH superfamily
5LMNE 2RQLA 4WYQB 1A6FA 2ODRD 2C39A 4GKKE 3NZKA 5AE1A 2WBUA 2CPNA 2EL4A 4WXDA 1T4LB 2LTSA 4MLVA 4JI7I 4OX9I 4DR5I 4AM3A 4R2EA 4X66E 2DIXA 2DLKA 2E5LE 3TQMA 4DV4I 2GO4A 4IS9A 1NHIA 4X62E 2C38B 3J81Q 2O1UA 2JPAA 1X6HA 4DPTA 3DF6A 4F9CB 4LFAI 1R6LA 3DJWA 4KWYA 1XMQI 1RHYA 4P52A 2EMXA 4K0KI 1YHCA 2EN7A 5KL2A 5K36E 4Q35B 3THOB 1UBDC 3WU4A 4YHHI 2EMCA 2ELYA 4WX9A 1ZM9A 2KONA 4DR6I 4IZJD 1OJ4A 3KZYA 1JK1A 4JYAI 2EMZA 1A1IA 2JEAA 3JAMC 4JI4E 4IFDF 5C0XF 2WZOA 5BR8E 2YPNA 4KHPE 1VISA 2PO0B 2UXBE 4FW5A 4LPFA 2N3GA 1IBLE 2EMGA 5EL9A 1BBOA 2B9DA 2ZITA 1FI4A 2PNMA 3EQ1A 2LJHA 3LMLA 1FKAE 1TF3A 3ZKDA 2EJ4A 4MU0A 2ENAA 1JK2A 2EPZA 2RTXA 1TF6A 2JY9A 2R76A 2BM0A 3ZM7A 4M0VA 3ZZUA 5JEAF 4I8OA 5IT9C 1IMUA 4LF9E 4IFDE 1GZ6A 3GONA 3PS3A 3MSWA 4NHRA 1XHKA 3J7AG 1Z0VA 2NUEA 1O0WA 4IZJB 1IBKE 2NN6E 4X64I 2EE8A 1ZM3A 5A2QQ 3V5RA 3M7NG 3ADIA 1ZBTA 4J3DA 4BA1A 3BF2A 1IBME 2L6MA 2L92A 4OO1F 2JT2A 3P3EA 2VF1A 4DPUA 2YTIA 2UUCE 4MDTA 2F4VE 1BB8A 4BHCA 2F1DA 2WNRB 2WCC3 4DMIA 2JEAB 2UXCE 3CDJA 2L3CA 1PDAA 1IQSA 2M1SA 3B8HA 2V88A 3Q6NA 2EOHA 4JI0I 1FWKA 3MHHC 4O5GA 2ENHA 2EQ0A 1YUIA 4JI3I 3T1HE 4FW9A 4DUYE 1OYRA 1HNZE 2JXPA 5AE2A 2L2NA 1N3GA 2YWQA 2EOJA 5F3WA 4DR1I 5IWAE 1EI1A 2PO1B 4DR2E 2MKDA 2A2CA 1WHNA 4DU7A 1YPNA 2NA2A 4GEQB 2V83A 3UHMA 4EMDA 4BBYA 4Z7CA 4R2DA 1WHQA 4JI2I 2CGEA 4FK5C 4LFBE 4X8WA 1N33E 2V8PA 2YTEA 5K36A 1SR9A 2N8XA 2E72A 4X65E 4LFCI 2HFUA 3C4BA 2VESA 5C0XE 1T39A 1N36I 4BC9A 2Z5EA 1J5EI 1X5WA 1X6FA 2ZM6E 1A1KA 1Y4SA 2LT7A 4FWDA 2EP3A 5IV8B 2E1MA 2EZ6A 2B7VA 3BBGA 1H7SA 2EQ1A 3FIGA 4QNJA 5K36D 2ENCA 2WW4A 1VI7A 3EPKA 2L33A 1DGCA 1YH8A 1HR0I 2R1FA 3PRYA 4LOMA 4JI1I 1Z1BA 2EMIA 3M99B 2EPCA 1S16A 1U2RA 4DV3I 5LLQA 4JI6I 2PO2B 5JEAE 5AASA 3VYYA 1EH8A 3L00A 4DV2E 2EM6A 2EM3A 2YTQA 2ADRA 1AAYA 4DV5E 4LF5E 2WBTA 4GKJE 2V34A 3D4JA 4USKA 2M9AA 3P06A 5DNLA 4LCFA 4Q28A 5FWKA 1RR9A 1WXRA 4F6MA 2UXDE 2GPIA 4DV6E 1YFHA 4HACB 4FWGA 2L2MA 3L7ZA 2YTGA 3KZZA 4R03A 1PJQA 1AH5A 4OO1E 2NUFA 2NN6A 4AQYE 4DV1I 1KTVA 3P3GA 2VQEE 5DRQA 4DR3E 2CT1A 4IZKA 4DR7I 3J80Q 2EM0A 2LJUA 3VHTB 4R2RA 1KJKA 3DD6A 2EPRA 2IOPA 4O24A 4OOGC 2EPUA 4NXMI 2EOEA 3BIDA 1UILA 2KOUA 2V8QB 1Z0TA 2GO3A 2HK2A 5A69A 2BBGA 2EM4A 5FLXC 2V85A 2Z5BA 4FW4A 4MU1A 4JI7E 4ZYGA 4DR5E 4OX9E 4LF4I 1UDNA 4JV5I 2PRTA 3H09A 2BR2A 2X36A 4DV4E 4GZNC 2RS6A 1IQOA 2IESA 1KIJA 2A2DA 5A6JA 3PS2A 2YZTA 4LFAE 1T4OA 1Z0BA 2EL6A 2RSMA 1YYWA 4K0KE 4IJDA 2KHXA 4LF8E 1UDSA 2UUAI 2EOXA 3M85G 4YHHE 1G2FC 3K6QA 4LF6E 4DR6E 1Z59A 2JEBB 4PRVA 4JYAE 1USUA 2WP8B 2IERA 2K4VA 3AV0A 3J81C 1HNXI 2ZBKB 2BA1G 2EMHA 2EN2A 2Q8UA 4M9VC 3K17A 4NBQA 3EPLA 5C0XA 1KYQA 2NUGA 3HKMA 2A25A 1E3PA 3GMEA 2YTJA 3K85A 4LF7I 3C4TA 2DMIA 2EOSA 2L3JA 2FTXB 4P7AA 3WU5A 4IFDD 5C0XD 1D6TA 4LTYA 1GQEA 3M6AA 3P3CA 2YU8A 4X62I 2C39B 4DPXA 2UU9I 2EMWA 4DPWA 2HFSA 1WRJA 2AJ4A 5JEAA 2C37A 2EFGA 5DROA 3ADJA 2CVEA 1FWLA 1B62A 1OYPA 2BA0G 3P1XA 2YTFA 4R2AA 1HK7A 5JEAD 2LO3A 4URLA 2JE6A 2EMFA 4X64E 1ZU1A 2V89A 2EN1A 1RC7A 2EPLX 1Z0CA 1XNQI 4RH8A 4DV7I 5LMUE 4MU4A 1IBLI 4HY1A 2EOYA 4OO1A 4B3RI 3EPHA 2ELZA 2F8BA 1ELOA 3KWRA 2JYAA 3LLHA 1E3HA 4ZYEA 1YSAC 2CZ9A 4KQVA 4OO1D 5A6AA 2YTNA 4DV0I 5A2QC 4OZEA 1DARA 5GMDA 2EOIA 1XXEA 3CWVA 1NHJA 1F2IG 4JI3E 3QT6A 4WUCA 2D9HA 3Q6MA 4R2PA 4B3SI 4KZSA 3H1CA 4TUIA 4BA2A 1LLMC 4B3TI 4USMA 4QNKA 2Z5CA 2LE2A 4DR1E 1ZXMA 1S4EA 1N32I 1PKPA 3EPJA 4JG4A 2M4IA 2EOFA 3H4LA 1XNRI 4DUZI 2EPAA 2BB8A 1G2DC 4JI2E 1Y60A 3M7ND 5K36C 1A1FA 4F54A 4R8OA 4M30A 4LFCE 3V2UC 4B3MI 5EKWA 2Q2EB 4BHBA 1J5EE 1FNMA 3ZOQB 4BA1B 2EQ3A 2GS8A 4YY3I 2YU5A 3ADGA 1ZXNA 2K7IA 2B7TA 3HPZA 1A1LA 2JP9A 4MQYA 3GCMA 1BKNA 3OTOI 2MC6A 1NHHA 3HXLA 1Z0WA 3ADLA 2WBSA 4J8ZA 1HR0E 2MKNA 1Z5AA 3RMPA 4JI1E 4NXNI 4JI6E 5KL3A 4DV3E 2EN3A 1PJSA 2V2QA 4DR2I 4R2CA 2EM7A 1HNWE 4LCGA 1GTKA 2EORA 1ZBQA 4BMJA 1L4SA 1X3CA 4NZVA 1H74A 3WU6A 1EKZA 2EM5A 1N0VC 4FW3A 4MLQA 4LFBI 4ZYDA 4X65I 1FJGI 4FW6A 3JTZA 4F6NA 2EM9A 2M7QA 2AE8A 4HXZA 4JI8I 1OYSA 3UK3C 2HC5A 2DB2A 2L8TA 1PVGA 2NN6C 4DV1E 1NCSA 2LUQA 2V87A 3AUZA 3PYDA 4MYUA 2HHHI 4JI5I 2BM1A 4DR7E 5K36B 2YTOA 5ELWA 3BGHA 3QG5C 3T1YI 4DPYA 4FWHA 2EPPA 2NN6D 4DR4I 1N34E 2UUBI 4NXME 4PRXA 2VQFI 1P47A 2GQ0A 1PJTA 3ECRA 2C38A 4IFDA 3PYFA 4O43A 4DV2I 1MEYC 4DV5I 4RHBB 4WXCA 4IS1C 1B69A 1I94I 4JV5E 1Z5BA 2XEXA 2EOMA 4LF4E 2HKEA 5T6JA 2I9IA 1PIEA 1TN9A 3J80C 1B63A 2CSHA 2DRPA 1Z5CA 4UT4A 2EMLA 2N3HA 2EM8A 4N4RB 2J7KA 2IHR1 3C6KA 2LRSA 1XMQE 4ISAA 1Y4UA 4X9JA 3LNUA 2VQEI 2UUAE 2PNZA 5KL4A 3K1JA 2PO0A 2LMZA 4O4KA 1KKHA 1XMOI 2L2KB 2CTDA 3L7ZB 1T38A 5L3JA 4IFDC 5C0XC 1HNXE 5LMNI 2VQFE 1J26A 2NN6B 3U1KA 4GKKI 3PS1A 5DRPA 1RMDA 4LF7E 4HEIA 4IZKB 4WUDA 2EOZA 1YYOA 4X66I 4MU3A 5AC4A 2E5LI 2HK3A 4I3HA 4P78A 2UU9E 2JWOA 2EPOA 1HNWI 3JAMQ 4BC7A 2Z5BB 2JR1A 5KL7A 5JEAC 4IZJA 4TUGA 2EN6A 2BR2B 2YTPA 2CG9A 1MGTA 2YT4A 4RPFA 4LF8I 3VK6A 2EN4A 2EPNA 1R6MA 1WUUA 2DSYA 3VYXA 1H7UA 4LF6I 2LBSB 1ZAAC 4N3OA 3M85D 2VE7C 2WNRA 3QT5A 1K47A 1UDOA 4XTJA 4JI4I 1YUJA 1DQ3A 5LL6R 3B82A 2PNZB 5ADZA 2YRHA 1XNQE 3PYEA 3HPSA 4BCAA 1H73A 4U3DA 4DV7E 2IOQA 4KHPI 4OO1C 2UXBI 4LU9A 2BA1D 5KL5A 4B3RE 2YSPA 2FGGA 5IT9Q 5BR8I 2JOBA 4UTGA 1ZM2A 4IFDB 2EMAA 2R3VA 5C0XB 2LTRA 2O1WA 2O1TA 3C6MA 2LVHA 4DV0E 2VF3A 4JI0E 1MG7A 1NEIA 5A6KA 3ZZ0A 2RSIA 2EPKX 3QT7A 1DI2A 1X49A 2PO1A 2LCEA 3ZKBA 1A1GA 4LF9I 4ZYHA 4B3SE 3PYGA 3HTXA 4U3BA 2MDGA 4HYMA 4B3TE 4GQUA 4F9BB 1IBKI 1N32E 1A1JA 2C37B 4L8NA 1MX0A 2BA0D 5DRRA 5JEAB 2EN8A 5LMUI 5AC5A 2HJJA 3IWBA 4ED4A 1IBMI 5AE3A 1XNRE 1UEKA 1RQ0A 2EMYA 4DUZE 3HULA 4MYTA 5DNXA 3WU3A 2UUCI 1YZ9A 4F9AB 2F4VI 2JE6B 2RS7A 2MDRA 2EPXA 4B3ME 2V2VA 4WSGA 2UXCI 2NPFA 4DXLA 2EM2A 1N36E 3LPSA 4AIMA 2EOQA 4LCHA 4YY3E 4FW7A 2PO2A 4OO1B 2EOOA 4BS9A 2V2ZA 5IXMB 1EH6A 2EWLA 3OTOE 2LJPA 2RPCA 3T1HI 3CDIA 4DUYI 1HNZI 4Z7YA 4R2QA 4WFTA 2OI2A 3B78A 4M2ZA 4NXNE 4HTGA 2DEJA 3B4TA 1A1HA 4FN5A 2YRKA 4P7DA 4R1FA 3ZZTA 2EL5A 3MHSC 2DGCA 2YTDA 2HGHA 2HKJA 4HACA 3F6HA 5IWAI 2GLIA 2G7HA 2J65A 2YRMA 3OMLA 3IWDA 3HJCA 4WUBA 4WPYA 1EA6A 2JOXA 2E1RA 1P42A 5GMEA 4BA2B 1N33I 5K36F 1BBGA 1FJGE 2DMYA 2J7JA 2Z5CB 5A6BA 2PNLA 4JI8E 3THNA 4ZVIA 3F0NA 1SFEA 2ZM6I 1KVKA 2GHFA 2LUPB 4OKGA 5A6BD 1RREA 4WSPA 2HHHE 3U1YA 4JI5E 1UN6B 3Q1QA 2VRDA 1Y5YA 1T4NA 5CFFE 1QU6A 2X7IA 2B3TB 1ZM4A 1X6EA 3T1YE 3IWCA 2FV4B 1Z0GA 4M1KA 4DR4E 2O3ZA 2UUBE 1MU5A 3LTOA 2NABA 1STUA 2I13A 1USVA 4F2JC 1EH7A 2EMKA 1I94E 4LF5I 3GLLA 1Y6ZA 4GKJI 2EMBA 2V86A 3HQ1A 2YSOA 1N0UA 2BV3A 2DEIA 3P76A 2DLQA 1NZ0A 4PU9A 3F6GA 5DNYA 2UXDI 4DV6I 3QT8A 1Z0EA 2LV2A 2MC5A 2JEBA 3J7Yp 1YYKA 2WP8A 5TSEA 5KL6A 1QNTA 1X47A 4L5NC 2NN6F 5FLXQ 4AQYI 1UHZA 2ODRC 1UDQA 3J7AM 4DKKA 4R2SA 1WJPA 2H36X 4AIDA 4DR3I 2EPMX 1XMOE 1X48A 3KRNA 4DU8A 1QZRA 1ZR9A 2JVAA 3JU0A 2O1VA 1N34I 1H72C 2R42A
chains in the Genus database with same CATH topology
5LMNE 4WYQB 1A6FA 2ODRD 4GKKE 5AE1A 2CPNA 1T4LB 2LTSA 4JI7I 4OX9I 4DR5I 4X66E 2DIXA 2E5LE 4DV4I 1NHIA 4X62E 3J81Q 2O1UA 4DPTA 3DF6A 4F9CB 4LFAI 3DJWA 1XMQI 4P52A 4K0KI 3WU4A 4YHHI 1ZM9A 2KONA 4DR6I 4IZJD 1OJ4A 4JYAI 3JAMC 4JI4E 2WZOA 5BR8E 4KHPE 1VISA 2UXBE 2N3GA 1IBLE 2B9DA 2ZITA 1FI4A 2PNMA 2LJHA 3LMLA 1FKAE 3ZKDA 2RTXA 2BM0A 2JY9A 3ZM7A 4M0VA 3ZZUA 4I8OA 5IT9C 4LF9E 1GZ6A 3GONA 3MSWA 1XHKA 3J7AG 1Z0VA 2NUEA 1O0WA 4IZJB 1IBKE 4X64I 5A2QQ 1ZM3A 3V5RA 3ADIA 1ZBTA 1IBME 2L6MA 2L92A 2VF1A 4DPUA 2UUCE 2F4VE 4DMIA 2UXCE 2L3CA 3B8HA 2M1SA 2V88A 3Q6NA 4JI0I 1FWKA 4JI3I 3T1HE 4FW9A 4DUYE 1HNZE 5AE2A 2L2NA 5F3WA 4DR1I 5IWAE 1EI1A 4DR2E 2A2CA 1WHNA 4DU7A 2NA2A 4GEQB 2V83A 4EMDA 4Z7CA 4BBYA 1WHQA 4JI2I 2CGEA 4LFBE 1N33E 4X8WA 2V8PA 1SR9A 4LFCI 4X65E 2HFUA 3C4BA 1N36I 4BC9A 2Z5EA 1J5EI 2ZM6E 1Y4SA 4FWDA 2E1MA 2EZ6A 2B7VA 1H7SA 3FIGA 2WW4A 2L33A 1HR0I 3PRYA 4JI1I 1U2RA 4JI6I 1S16A 4DV3I 5AASA 3VYYA 1Z59A 4DV2E 4LF5E 3D4JA 1HNWI 4DV5E 2V34A 4GKJE 4USKA 3P06A 4Q28A 5FWKA 1RR9A 1WXRA 2UXDE 4DV6E 4HACB 4FWGA 2L2MA 4R03A 2NUFA 4DV1I 4AQYE 1KTVA 2VQEE 4DR3E 4DR7I 4IZKA 3J80Q 2IOPA 4OOGC 4NXMI 1UILA 2KOUA 2V8QB 1Z0TA 2HK2A 5FLXC 2V85A 2Z5BA 4JI7E 4OX9E 4DR5E 4LF4I 4JV5I 3H09A 2X36A 4DV4E 2RS6A 1KIJA 2A2DA 2YZTA 4LFAE 1T4OA 1Z0BA 2RSMA 1YYWA 4K0KE 2KHXA 4LF8E 2UUAI 4YHHE 3K6QA 4LF6E 4DR6E 4PRVA 4JYAE 1USUA 2K4VA 3AV0A 3J81C 1HNXI 2ZBKB 3K17A 2VQFI 2NUGA 3K85A 4LF7I 3C4TA 2L3JA 2FTXB 4P7AA 3WU5A 1D6TA 4LTYA 1GQEA 3M6AA 4X62I 4DPXA 2UU9I 4DPWA 2HFSA 2AJ4A 2EFGA 3ADJA 1FWLA 1B62A 3P1XA 1HK7A 4URLA 4X64E 2V89A 1RC7A 1Z0CA 1XNQI 4DV7I 5LMUE 1IBLI 4HY1A 4B3RI 2F8BA 1ELOA 3KWRA 3LLHA 2CZ9A 4KQVA 4DV0I 5A2QC 1DARA 5GMDA 3CWVA 1NHJA 4JI3E 3QT6A 4WUCA 3Q6MA 4B3SI 4KZSA 4TUIA 4B3TI 4USMA 2Z5CA 2LE2A 4DR1E 1ZXMA 1S4EA 1N32I 1PKPA 4JG4A 2M4IA 3H4LA 1XNRI 4DUZI 4JI2E 4F54A 4R8OA 4M30A 4LFCE 3V2UC 4B3MI 2Q2EB 1J5EE 1FNMA 3ZOQB 2GS8A 4YY3I 1ZXNA 3ADGA 2B7TA 3HPZA 1BKNA 3OTOI 2MC6A 1NHHA 3HXLA 1Z0WA 3ADLA 4J8ZA 1HR0E 1Z5AA 3RMPA 4JI1E 4NXNI 4JI6E 4DV3E 2V2QA 4DR2I 1HNWE 4BMJA 1ZBQA 1H74A 3WU6A 1EKZA 1N0VC 4LFBI 4X65I 1FJGI 3JTZA 2M7QA 4HXZA 4JI8I 2DB2A 2L8TA 1PVGA 4DV1E 2LUQA 2V87A 3AUZA 3PYDA 4MYUA 2HHHI 4JI5I 2BM1A 4DR7E 3T1YI 4DPYA 4FWHA 4DR4I 1N34E 2UUBI 4NXME 4PRXA 2GQ0A 3PYFA 4DV2I 4DV5I 1I94I 4JV5E 1Z5BA 2XEXA 4LF4E 2HKEA 5T6JA 1PIEA 3J80C 1B63A 1Z5CA 4UT4A 2N3HA 2J7KA 2IHR1 2LRSA 1XMQE 1Y4UA 3LNUA 2VQEI 2UUAE 3K1JA 2LMZA 1KKHA 1XMOI 2L2KB 5L3JA 1HNXE 5LMNI 2VQFE 1J26A 4GKKI 4LF7E 4IZKB 4WUDA 1YYOA 4X66I 2E5LI 2HK3A 4I3HA 4P78A 2UU9E 2JWOA 3JAMQ 4BC7A 2Z5BB 2JR1A 4IZJA 4TUGA 4RPFA 4LF8I 2CG9A 2YT4A 3VK6A 1WUUA 2DSYA 3VYXA 1H7UA 4LF6I 2LBSB 4N3OA 2VE7C 3QT5A 1K47A 4XTJA 4JI4I 1DQ3A 5LL6R 3B82A 5BR8I 5ADZA 1XNQE 3PYEA 3HPSA 4BCAA 1H73A 4DV7E 2IOQA 4KHPI 2UXBI 4LU9A 4B3RE 5IT9Q 2FGGA 2JOBA 4UTGA 1ZM2A 2R3VA 3Q1QA 2LTRA 2O1WA 2O1TA 2VF3A 4DV0E 4JI0E 1MG7A 3ZZ0A 3QT7A 1DI2A 1X49A 3ZKBA 4LF9I 4B3SE 3PYGA 3HTXA 4HYMA 4B3TE 4F9BB 1IBKI 1N32E 4L8NA 1MX0A 5LMUI 3IWBA 4ED4A 1IBMI 5AE3A 1XNRE 1UEKA 1RQ0A 3HULA 4DUZE 4MYTA 3WU3A 2UUCI 1YZ9A 4F9AB 2F4VI 2RS7A 2MDRA 4B3ME 2V2VA 2UXCI 2NPFA 4DXLA 1N36E 3LPSA 4YY3E 4BS9A 2V2ZA 2EWLA 3OTOE 2LJPA 3T1HI 4DUYI 1HNZI 4Z7YA 4WFTA 2OI2A 3B78A 4M2ZA 4NXNE 2DEJA 4R1FA 4FN5A 3ZZTA 4P7DA 2HKJA 4HACA 3F6HA 5IWAI 2G7HA 3OMLA 3IWDA 3HJCA 4WUBA 4WPYA 1EA6A 2JOXA 2E1RA 5GMEA 1N33I 2Z5CB 1FJGE 2DMYA 2PNLA 4JI8E 4ZVIA 3F0NA 2ZM6I 1KVKA 2LUPB 1RREA 4WSPA 2HHHE 4JI5E 1T4NA 5CFFE 1QU6A 2X7IA 2B3TB 1ZM4A 3T1YE 3IWCA 2FV4B 1Z0GA 4M1KA 4DR4E 2UUBE 1MU5A 3LTOA 1STUA 1USVA 1I94E 4LF5I 1Y6ZA 4GKJI 2V86A 3HQ1A 1N0UA 2BV3A 2DEIA 1NZ0A 4PU9A 3F6GA 5DNYA 2UXDI 4DV6I 3QT8A 1Z0EA 2MC5A 3J7Yp 1YYKA 1X47A 4L5NC 5FLXQ 4AQYI 1UHZA 2ODRC 3J7AM 4DKKA 2H36X 4DR3I 1XMOE 1X48A 4DU8A 1QZRA 2JVAA 3JU0A 2O1VA 1N34I 1H72C 2R42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN E;  4WYQ B;  1A6F A;  4GKK E;  2CPN A;  1T4L B;  2LTS A;  4JI7 I;  4OX9 I;  4DR5 I;  4X66 E;  2DIX A;  2E5L E;  4DV4 I;  1NHI A;  4X62 E;  3J81 Q;  4DPT A;  4LFA I;  1XMQ I;  4P52 A;  4K0K I;  3WU4 A;  4YHH I;  1ZM9 A;  4DR6 I;  1OJ4 A;  4JYA I;  4JI4 E;  3JAM C;  5BR8 E;  4KHP E;  1VIS A;  2UXB E;  2N3G A;  1IBL E;  2ZIT A;  1FI4 A;  2LJH A;  1FKA E;  3ZKD A;  2RTX A;  2BM0 A;  2JY9 A;  3ZM7 A;  3ZZU A;  5IT9 C;  4LF9 E;  3GON A;  1XHK A;  3J7A G;  1Z0V A;  2NUE A;  1O0W A;  1IBK E;  4X64 I;  5A2Q Q;  1ZM3 A;  3V5R A;  3ADI A;  1ZBT A;  1IBM E;  4DPU A;  2UUC E;  2F4V E;  2UXC E;  2L3C A;  3B8H A;  4JI0 I;  1FWK A;  4JI3 I;  3T1H E;  4FW9 A;  4DUY E;  1HNZ E;  2L2N A;  4DR1 I;  5IWA E;  1EI1 A;  4DR2 E;  2A2C A;  1WHN A;  4DU7 A;  2NA2 A;  4EMD A;  4Z7C A;  1WHQ A;  4JI2 I;  4LFB E;  1N33 E;  4X8W A;  2V8P A;  4LFC I;  4X65 E;  2HFU A;  3C4B A;  1N36 I;  1J5E I;  2ZM6 E;  4FWD A;  2EZ6 A;  1H7S A;  2B7V A;  2WW4 A;  2L33 A;  1HR0 I;  4JI1 I;  1U2R A;  4JI6 I;  1S16 A;  4DV3 I;  3VYY A;  1Z59 A;  4DV2 E;  4LF5 E;  3D4J A;  1HNW I;  4DV5 E;  2V34 A;  4GKJ E;  4USK A;  1RR9 A;  2UXD E;  4DV6 E;  4HAC B;  4FWG A;  2L2M A;  2NUF A;  4DV1 I;  4AQY E;  1KTV A;  2VQE E;  4DR3 E;  4DR7 I;  3J80 Q;  4OOG C;  4NXM I;  1UIL A;  1Z0T A;  2HK2 A;  5FLX C;  4JI7 E;  4OX9 E;  4DR5 E;  4LF4 I;  4JV5 I;  2X36 A;  4DV4 E;  2RS6 A;  1KIJ A;  2A2D A;  4LFA E;  1T4O A;  1Z0B A;  2RSM A;  1YYW A;  4K0K E;  2KHX A;  4LF8 E;  2UUA I;  4YHH E;  4LF6 E;  4DR6 E;  4PRV A;  4JYA E;  3J81 C;  1HNX I;  2ZBK B;  3K17 A;  2VQF I;  2NUG A;  4LF7 I;  3C4T A;  2L3J A;  4P7A A;  3WU5 A;  1D6T A;  1GQE A;  3M6A A;  4X62 I;  4DPX A;  2UU9 I;  4DPW A;  2HFS A;  2AJ4 A;  2EFG A;  3ADJ A;  1FWL A;  1B62 A;  3P1X A;  4URL A;  4X64 E;  1RC7 A;  1Z0C A;  1XNQ I;  4DV7 I;  5LMU E;  1IBL I;  4HY1 A;  4B3R I;  1ELO A;  3LLH A;  2CZ9 A;  4KQV A;  4DV0 I;  5A2Q C;  1DAR A;  5GMD A;  3CWV A;  1NHJ A;  4JI3 E;  3QT6 A;  4WUC A;  4B3S I;  4B3T I;  4USM A;  4DR1 E;  1ZXM A;  1S4E A;  1N32 I;  1PKP A;  4JG4 A;  3H4L A;  1XNR I;  4DUZ I;  4JI2 E;  4M30 A;  4LFC E;  3V2U C;  4B3M I;  2Q2E B;  1J5E E;  1FNM A;  2GS8 A;  4YY3 I;  1ZXN A;  3ADG A;  2B7T A;  1BKN A;  3OTO I;  1NHH A;  1Z0W A;  3ADL A;  1HR0 E;  1Z5A A;  4JI1 E;  4NXN I;  4JI6 E;  4DV3 E;  2V2Q A;  4DR2 I;  1HNW E;  1H74 A;  3WU6 A;  1EKZ A;  1N0V C;  4LFB I;  4X65 I;  1FJG I;  4HXZ A;  4JI8 I;  2DB2 A;  1PVG A;  4DV1 E;  2LUQ A;  4MYU A;  3PYD A;  2HHH I;  4JI5 I;  2BM1 A;  4DR7 E;  3T1Y I;  4DPY A;  4FWH A;  4DR4 I;  1N34 E;  2UUB I;  4NXM E;  4PRX A;  3PYF A;  4DV2 I;  4DV5 I;  1I94 I;  4JV5 E;  1Z5B A;  2XEX A;  4LF4 E;  2HKE A;  1PIE A;  3J80 C;  1B63 A;  1Z5C A;  4UT4 A;  2N3H A;  2J7K A;  2IHR 1;  2LRS A;  1XMQ E;  3LNU A;  2VQE I;  2UUA E;  3K1J A;  1KKH A;  1XMO I;  2L2K B;  5L3J A;  1HNX E;  5LMN I;  2VQF E;  1J26 A;  4GKK I;  4LF7 E;  4WUD A;  1YYO A;  4X66 I;  2E5L I;  2HK3 A;  4I3H A;  2UU9 E;  3JAM Q;  4RPF A;  4LF8 I;  2YT4 A;  1WUU A;  3VYX A;  1H7U A;  4LF6 I;  2LBS B;  3QT5 A;  1K47 A;  4XTJ A;  4JI4 I;  3B82 A;  5LL6 R;  5BR8 I;  1XNQ E;  3PYE A;  1H73 A;  4DV7 E;  4KHP I;  2UXB I;  4B3R E;  5IT9 Q;  4UTG A;  1ZM2 A;  2R3V A;  3Q1Q A;  2LTR A;  2VF3 A;  4DV0 E;  4JI0 E;  1MG7 A;  3ZZ0 A;  3QT7 A;  1DI2 A;  1X49 A;  3ZKB A;  4LF9 I;  4B3S E;  3PYG A;  3HTX A;  4HYM A;  4B3T E;  1IBK I;  1N32 E;  1MX0 A;  5LMU I;  4ED4 A;  1IBM I;  1XNR E;  1UEK A;  1RQ0 A;  3HUL A;  4DUZ E;  4MYT A;  3WU3 A;  2UUC I;  1YZ9 A;  2F4V I;  2RS7 A;  2MDR A;  4B3M E;  2V2V A;  2UXC I;  2NPF A;  4DXL A;  1N36 E;  3LPS A;  4YY3 E;  2V2Z A;  3OTO E;  2LJP A;  3T1H I;  4DUY I;  1HNZ I;  4Z7Y A;  4WFT A;  2OI2 A;  3B78 A;  4M2Z A;  4NXN E;  2DEJ A;  4R1F A;  4FN5 A;  3ZZT A;  2HKJ A;  4HAC A;  5IWA I;  4WUB A;  2E1R A;  1EA6 A;  5GME A;  1N33 I;  1FJG E;  2DMY A;  4JI8 E;  4ZVI A;  3F0N A;  2ZM6 I;  1KVK A;  2LUP B;  1RRE A;  2HHH E;  4JI5 E;  1T4N A;  5CFF E;  1QU6 A;  2X7I A;  2B3T B;  1ZM4 A;  3T1Y E;  4M1K A;  1Z0G A;  4DR4 E;  2UUB E;  1MU5 A;  3LTO A;  1STU A;  1I94 E;  4LF5 I;  4GKJ I;  1N0U A;  2DEI A;  2BV3 A;  1NZ0 A;  4PU9 A;  2UXD I;  4DV6 I;  3QT8 A;  1Z0E A;  3J7Y p;  1YYK A;  1X47 A;  5FLX Q;  4AQY I;  1UHZ A;  3J7A M;  4DKK A;  4DR3 I;  1XMO E;  1X48 A;  4DU8 A;  1QZR A;  2JVA A;  1N34 I;  1H72 C;  2R42 A; 
#chains in the Genus database with same CATH topology
 5LMN E;  2RQL A;  4WYQ B;  1A6F A;  2ODR D;  2C39 A;  4GKK E;  3NZK A;  5AE1 A;  2WBU A;  2CPN A;  2EL4 A;  4WXD A;  1T4L B;  2LTS A;  4MLV A;  4JI7 I;  4OX9 I;  4DR5 I;  4AM3 A;  4R2E A;  4X66 E;  2DIX A;  2DLK A;  2E5L E;  3TQM A;  4DV4 I;  2GO4 A;  4IS9 A;  1NHI A;  4X62 E;  2C38 B;  3J81 Q;  2O1U A;  2JPA A;  1X6H A;  4DPT A;  3DF6 A;  4F9C B;  4LFA I;  1R6L A;  3DJW A;  4KWY A;  1XMQ I;  1RHY A;  4P52 A;  2EMX A;  4K0K I;  1YHC A;  2EN7 A;  5KL2 A;  5K36 E;  4Q35 B;  3THO B;  1UBD C;  3WU4 A;  4YHH I;  2EMC A;  2ELY A;  4WX9 A;  1ZM9 A;  2KON A;  4DR6 I;  4IZJ D;  1OJ4 A;  3KZY A;  1JK1 A;  4JYA I;  2EMZ A;  1A1I A;  2JEA A;  3JAM C;  4JI4 E;  4IFD F;  5C0X F;  2WZO A;  5BR8 E;  2YPN A;  4KHP E;  1VIS A;  2PO0 B;  2UXB E;  4FW5 A;  4LPF A;  2N3G A;  1IBL E;  2EMG A;  5EL9 A;  1BBO A;  2B9D A;  2ZIT A;  1FI4 A;  2PNM A;  3EQ1 A;  2LJH A;  3LML A;  1FKA E;  1TF3 A;  3ZKD A;  2EJ4 A;  4MU0 A;  2ENA A;  1JK2 A;  2EPZ A;  2RTX A;  1TF6 A;  2JY9 A;  2R76 A;  2BM0 A;  3ZM7 A;  4M0V A;  3ZZU A;  5JEA F;  4I8O A;  5IT9 C;  1IMU A;  4LF9 E;  4IFD E;  1GZ6 A;  3GON A;  3PS3 A;  3MSW A;  4NHR A;  1XHK A;  3J7A G;  1Z0V A;  2NUE A;  1O0W A;  4IZJ B;  1IBK E;  2NN6 E;  4X64 I;  2EE8 A;  1ZM3 A;  5A2Q Q;  3V5R A;  3M7N G;  3ADI A;  1ZBT A;  4J3D A;  4BA1 A;  3BF2 A;  1IBM E;  2L6M A;  2L92 A;  4OO1 F;  2JT2 A;  3P3E A;  2VF1 A;  4DPU A;  2YTI A;  2UUC E;  4MDT A;  2F4V E;  1BB8 A;  4BHC A;  2F1D A;  2WNR B;  2WCC 3;  4DMI A;  2JEA B;  2UXC E;  3CDJ A;  2L3C A;  1PDA A;  1IQS A;  2M1S A;  3B8H A;  2V88 A;  3Q6N A;  2EOH A;  4JI0 I;  1FWK A;  3MHH C;  4O5G A;  2ENH A;  2EQ0 A;  1YUI A;  4JI3 I;  3T1H E;  4FW9 A;  4DUY E;  1OYR A;  1HNZ E;  2JXP A;  5AE2 A;  2L2N A;  1N3G A;  2YWQ A;  2EOJ A;  5F3W A;  4DR1 I;  5IWA E;  1EI1 A;  2PO1 B;  4DR2 E;  2MKD A;  2A2C A;  1WHN A;  4DU7 A;  1YPN A;  2NA2 A;  4GEQ B;  2V83 A;  3UHM A;  4EMD A;  4BBY A;  4Z7C A;  4R2D A;  1WHQ A;  4JI2 I;  2CGE A;  4FK5 C;  4LFB E;  4X8W A;  1N33 E;  2V8P A;  2YTE A;  5K36 A;  1SR9 A;  2N8X A;  2E72 A;  4X65 E;  4LFC I;  2HFU A;  3C4B A;  2VES A;  5C0X E;  1T39 A;  1N36 I;  4BC9 A;  2Z5E A;  1J5E I;  1X5W A;  1X6F A;  2ZM6 E;  1A1K A;  1Y4S A;  2LT7 A;  4FWD A;  2EP3 A;  5IV8 B;  2E1M A;  2EZ6 A;  2B7V A;  3BBG A;  1H7S A;  2EQ1 A;  3FIG A;  4QNJ A;  5K36 D;  2ENC A;  2WW4 A;  1VI7 A;  3EPK A;  2L33 A;  1DGC A;  1YH8 A;  1HR0 I;  2R1F A;  3PRY A;  4LOM A;  4JI1 I;  1Z1B A;  2EMI A;  3M99 B;  2EPC A;  1S16 A;  1U2R A;  4DV3 I;  5LLQ A;  4JI6 I;  2PO2 B;  5JEA E;  5AAS A;  3VYY A;  1EH8 A;  3L00 A;  4DV2 E;  2EM6 A;  2EM3 A;  2YTQ A;  2ADR A;  1AAY A;  4DV5 E;  4LF5 E;  2WBT A;  4GKJ E;  2V34 A;  3D4J A;  4USK A;  2M9A A;  3P06 A;  5DNL A;  4LCF A;  4Q28 A;  5FWK A;  1RR9 A;  1WXR A;  4F6M A;  2UXD E;  2GPI A;  4DV6 E;  1YFH A;  4HAC B;  4FWG A;  2L2M A;  3L7Z A;  2YTG A;  3KZZ A;  4R03 A;  1PJQ A;  1AH5 A;  4OO1 E;  2NUF A;  2NN6 A;  4AQY E;  4DV1 I;  1KTV A;  3P3G A;  2VQE E;  5DRQ A;  4DR3 E;  2CT1 A;  4IZK A;  4DR7 I;  3J80 Q;  2EM0 A;  2LJU A;  3VHT B;  4R2R A;  1KJK A;  3DD6 A;  2EPR A;  2IOP A;  4O24 A;  4OOG C;  2EPU A;  4NXM I;  2EOE A;  3BID A;  1UIL A;  2KOU A;  2V8Q B;  1Z0T A;  2GO3 A;  2HK2 A;  5A69 A;  2BBG A;  2EM4 A;  5FLX C;  2V85 A;  2Z5B A;  4FW4 A;  4MU1 A;  4JI7 E;  4ZYG A;  4DR5 E;  4OX9 E;  4LF4 I;  1UDN A;  4JV5 I;  2PRT A;  3H09 A;  2BR2 A;  2X36 A;  4DV4 E;  4GZN C;  2RS6 A;  1IQO A;  2IES A;  1KIJ A;  2A2D A;  5A6J A;  3PS2 A;  2YZT A;  4LFA E;  1T4O A;  1Z0B A;  2EL6 A;  2RSM A;  1YYW A;  4K0K E;  4IJD A;  2KHX A;  4LF8 E;  1UDS A;  2UUA I;  2EOX A;  3M85 G;  4YHH E;  1G2F C;  3K6Q A;  4LF6 E;  4DR6 E;  1Z59 A;  2JEB B;  4PRV A;  4JYA E;  1USU A;  2WP8 B;  2IER A;  2K4V A;  3AV0 A;  3J81 C;  1HNX I;  2ZBK B;  2BA1 G;  2EMH A;  2EN2 A;  2Q8U A;  4M9V C;  3K17 A;  4NBQ A;  3EPL A;  5C0X A;  1KYQ A;  2NUG A;  3HKM A;  2A25 A;  1E3P A;  3GME A;  2YTJ A;  3K85 A;  4LF7 I;  3C4T A;  2DMI A;  2EOS A;  2L3J A;  2FTX B;  4P7A A;  3WU5 A;  4IFD D;  5C0X D;  1D6T A;  4LTY A;  1GQE A;  3M6A A;  3P3C A;  2YU8 A;  4X62 I;  2C39 B;  4DPX A;  2UU9 I;  2EMW A;  4DPW A;  2HFS A;  1WRJ A;  2AJ4 A;  5JEA A;  2C37 A;  2EFG A;  5DRO A;  3ADJ A;  2CVE A;  1FWL A;  1B62 A;  1OYP A;  2BA0 G;  3P1X A;  2YTF A;  4R2A A;  1HK7 A;  5JEA D;  2LO3 A;  4URL A;  2JE6 A;  2EMF A;  4X64 E;  1ZU1 A;  2V89 A;  2EN1 A;  1RC7 A;  2EPL X;  1Z0C A;  1XNQ I;  4RH8 A;  4DV7 I;  5LMU E;  4MU4 A;  1IBL I;  4HY1 A;  2EOY A;  4OO1 A;  4B3R I;  3EPH A;  2ELZ A;  2F8B A;  1ELO A;  3KWR A;  2JYA A;  3LLH A;  1E3H A;  4ZYE A;  1YSA C;  2CZ9 A;  4KQV A;  4OO1 D;  5A6A A;  2YTN A;  4DV0 I;  5A2Q C;  4OZE A;  1DAR A;  5GMD A;  2EOI A;  1XXE A;  3CWV A;  1NHJ A;  1F2I G;  4JI3 E;  3QT6 A;  4WUC A;  2D9H A;  3Q6M A;  4R2P A;  4B3S I;  4KZS A;  3H1C A;  4TUI A;  4BA2 A;  1LLM C;  4B3T I;  4USM A;  4QNK A;  2Z5C A;  2LE2 A;  4DR1 E;  1ZXM A;  1S4E A;  1N32 I;  1PKP A;  3EPJ A;  4JG4 A;  2M4I A;  2EOF A;  3H4L A;  1XNR I;  4DUZ I;  2EPA A;  2BB8 A;  1G2D C;  4JI2 E;  1Y60 A;  3M7N D;  5K36 C;  1A1F A;  4F54 A;  4R8O A;  4M30 A;  4LFC E;  3V2U C;  4B3M I;  5EKW A;  2Q2E B;  4BHB A;  1J5E E;  1FNM A;  3ZOQ B;  4BA1 B;  2EQ3 A;  2GS8 A;  4YY3 I;  2YU5 A;  3ADG A;  1ZXN A;  2K7I A;  2B7T A;  3HPZ A;  1A1L A;  2JP9 A;  4MQY A;  3GCM A;  1BKN A;  3OTO I;  2MC6 A;  1NHH A;  3HXL A;  1Z0W A;  3ADL A;  2WBS A;  4J8Z A;  1HR0 E;  2MKN A;  1Z5A A;  3RMP A;  4JI1 E;  4NXN I;  4JI6 E;  5KL3 A;  4DV3 E;  2EN3 A;  1PJS A;  2V2Q A;  4DR2 I;  4R2C A;  2EM7 A;  1HNW E;  4LCG A;  1GTK A;  2EOR A;  1ZBQ A;  4BMJ A;  1L4S A;  1X3C A;  4NZV A;  1H74 A;  3WU6 A;  1EKZ A;  2EM5 A;  1N0V C;  4FW3 A;  4MLQ A;  4LFB I;  4ZYD A;  4X65 I;  1FJG I;  4FW6 A;  3JTZ A;  4F6N A;  2EM9 A;  2M7Q A;  2AE8 A;  4HXZ A;  4JI8 I;  1OYS A;  3UK3 C;  2HC5 A;  2DB2 A;  2L8T A;  1PVG A;  2NN6 C;  4DV1 E;  1NCS A;  2LUQ A;  2V87 A;  3AUZ A;  3PYD A;  4MYU A;  2HHH I;  4JI5 I;  2BM1 A;  4DR7 E;  5K36 B;  2YTO A;  5ELW A;  3BGH A;  3QG5 C;  3T1Y I;  4DPY A;  4FWH A;  2EPP A;  2NN6 D;  4DR4 I;  1N34 E;  2UUB I;  4NXM E;  4PRX A;  2VQF I;  1P47 A;  2GQ0 A;  1PJT A;  3ECR A;  2C38 A;  4IFD A;  3PYF A;  4O43 A;  4DV2 I;  1MEY C;  4DV5 I;  4RHB B;  4WXC A;  4IS1 C;  1B69 A;  1I94 I;  4JV5 E;  1Z5B A;  2XEX A;  2EOM A;  4LF4 E;  2HKE A;  5T6J A;  2I9I A;  1PIE A;  1TN9 A;  3J80 C;  1B63 A;  2CSH A;  2DRP A;  1Z5C A;  4UT4 A;  2EML A;  2N3H A;  2EM8 A;  4N4R B;  2J7K A;  2IHR 1;  3C6K A;  2LRS A;  1XMQ E;  4ISA A;  1Y4U A;  4X9J A;  3LNU A;  2VQE I;  2UUA E;  2PNZ A;  5KL4 A;  3K1J A;  2PO0 A;  2LMZ A;  4O4K A;  1KKH A;  1XMO I;  2L2K B;  2CTD A;  3L7Z B;  1T38 A;  5L3J A;  4IFD C;  5C0X C;  1HNX E;  5LMN I;  2VQF E;  1J26 A;  2NN6 B;  3U1K A;  4GKK I;  3PS1 A;  5DRP A;  1RMD A;  4LF7 E;  4HEI A;  4IZK B;  4WUD A;  2EOZ A;  1YYO A;  4X66 I;  4MU3 A;  5AC4 A;  2E5L I;  2HK3 A;  4I3H A;  4P78 A;  2UU9 E;  2JWO A;  2EPO A;  1HNW I;  3JAM Q;  4BC7 A;  2Z5B B;  2JR1 A;  5KL7 A;  5JEA C;  4IZJ A;  4TUG A;  2EN6 A;  2BR2 B;  2YTP A;  2CG9 A;  1MGT A;  2YT4 A;  4RPF A;  4LF8 I;  3VK6 A;  2EN4 A;  2EPN A;  1R6M A;  1WUU A;  2DSY A;  3VYX A;  1H7U A;  4LF6 I;  2LBS B;  1ZAA C;  4N3O A;  3M85 D;  2VE7 C;  2WNR A;  3QT5 A;  1K47 A;  1UDO A;  4XTJ A;  4JI4 I;  1YUJ A;  1DQ3 A;  5LL6 R;  3B82 A;  2PNZ B;  5ADZ A;  2YRH A;  1XNQ E;  3PYE A;  3HPS A;  4BCA A;  1H73 A;  4U3D A;  4DV7 E;  2IOQ A;  4KHP I;  4OO1 C;  2UXB I;  4LU9 A;  2BA1 D;  5KL5 A;  4B3R E;  2YSP A;  2FGG A;  5IT9 Q;  5BR8 I;  2JOB A;  4UTG A;  1ZM2 A;  4IFD B;  2EMA A;  2R3V A;  5C0X B;  2LTR A;  2O1W A;  2O1T A;  3C6M A;  2LVH A;  4DV0 E;  2VF3 A;  4JI0 E;  1MG7 A;  1NEI A;  5A6K A;  3ZZ0 A;  2RSI A;  2EPK X;  3QT7 A;  1DI2 A;  1X49 A;  2PO1 A;  2LCE A;  3ZKB A;  1A1G A;  4LF9 I;  4ZYH A;  4B3S E;  3PYG A;  3HTX A;  4U3B A;  2MDG A;  4HYM A;  4B3T E;  4GQU A;  4F9B B;  1IBK I;  1N32 E;  1A1J A;  2C37 B;  4L8N A;  1MX0 A;  2BA0 D;  5DRR A;  5JEA B;  2EN8 A;  5LMU I;  5AC5 A;  2HJJ A;  3IWB A;  4ED4 A;  1IBM I;  5AE3 A;  1XNR E;  1UEK A;  1RQ0 A;  2EMY A;  4DUZ E;  3HUL A;  4MYT A;  5DNX A;  3WU3 A;  2UUC I;  1YZ9 A;  4F9A B;  2F4V I;  2JE6 B;  2RS7 A;  2MDR A;  2EPX A;  4B3M E;  2V2V A;  4WSG A;  2UXC I;  2NPF A;  4DXL A;  2EM2 A;  1N36 E;  3LPS A;  4AIM A;  2EOQ A;  4LCH A;  4YY3 E;  4FW7 A;  2PO2 A;  4OO1 B;  2EOO A;  4BS9 A;  2V2Z A;  5IXM B;  1EH6 A;  2EWL A;  3OTO E;  2LJP A;  2RPC A;  3T1H I;  3CDI A;  4DUY I;  1HNZ I;  4Z7Y A;  4R2Q A;  4WFT A;  2OI2 A;  3B78 A;  4M2Z A;  4NXN E;  4HTG A;  2DEJ A;  3B4T A;  1A1H A;  4FN5 A;  2YRK A;  4P7D A;  4R1F A;  3ZZT A;  2EL5 A;  3MHS C;  2DGC A;  2YTD A;  2HGH A;  2HKJ A;  4HAC A;  3F6H A;  5IWA I;  2GLI A;  2G7H A;  2J65 A;  2YRM A;  3OML A;  3IWD A;  3HJC A;  4WUB A;  4WPY A;  1EA6 A;  2JOX A;  2E1R A;  1P42 A;  5GME A;  4BA2 B;  1N33 I;  5K36 F;  1BBG A;  1FJG E;  2DMY A;  2J7J A;  2Z5C B;  5A6B A;  2PNL A;  4JI8 E;  3THN A;  4ZVI A;  3F0N A;  1SFE A;  2ZM6 I;  1KVK A;  2GHF A;  2LUP B;  4OKG A;  5A6B D;  1RRE A;  4WSP A;  2HHH E;  3U1Y A;  4JI5 E;  1UN6 B;  3Q1Q A;  2VRD A;  1Y5Y A;  1T4N A;  5CFF E;  1QU6 A;  2X7I A;  2B3T B;  1ZM4 A;  1X6E A;  3T1Y E;  3IWC A;  2FV4 B;  1Z0G A;  4M1K A;  4DR4 E;  2O3Z A;  2UUB E;  1MU5 A;  3LTO A;  2NAB A;  1STU A;  2I13 A;  1USV A;  4F2J C;  1EH7 A;  2EMK A;  1I94 E;  4LF5 I;  3GLL A;  1Y6Z A;  4GKJ I;  2EMB A;  2V86 A;  3HQ1 A;  2YSO A;  1N0U A;  2BV3 A;  2DEI A;  3P76 A;  2DLQ A;  1NZ0 A;  4PU9 A;  3F6G A;  5DNY A;  2UXD I;  4DV6 I;  3QT8 A;  1Z0E A;  2LV2 A;  2MC5 A;  2JEB A;  3J7Y p;  1YYK A;  2WP8 A;  5TSE A;  5KL6 A;  1QNT A;  1X47 A;  4L5N C;  2NN6 F;  5FLX Q;  4AQY I;  1UHZ A;  2ODR C;  1UDQ A;  3J7A M;  4DKK A;  4R2S A;  1WJP A;  2H36 X;  4AID A;  4DR3 I;  2EPM X;  1XMO E;  1X48 A;  3KRN A;  4DU8 A;  1QZR A;  1ZR9 A;  2JVA A;  3JU0 A;  2O1V A;  1N34 I;  1H72 C;  2R42 A; 
#chains in the Genus database with same CATH homology
 5LMN E;  4WYQ B;  1A6F A;  2ODR D;  4GKK E;  5AE1 A;  2CPN A;  1T4L B;  2LTS A;  4JI7 I;  4OX9 I;  4DR5 I;  4X66 E;  2DIX A;  2E5L E;  4DV4 I;  1NHI A;  4X62 E;  3J81 Q;  2O1U A;  4DPT A;  3DF6 A;  4F9C B;  4LFA I;  3DJW A;  1XMQ I;  4P52 A;  4K0K I;  3WU4 A;  4YHH I;  1ZM9 A;  2KON A;  4DR6 I;  4IZJ D;  1OJ4 A;  4JYA I;  3JAM C;  4JI4 E;  2WZO A;  5BR8 E;  4KHP E;  1VIS A;  2UXB E;  2N3G A;  1IBL E;  2B9D A;  2ZIT A;  1FI4 A;  2PNM A;  2LJH A;  3LML A;  1FKA E;  3ZKD A;  2RTX A;  2BM0 A;  2JY9 A;  3ZM7 A;  4M0V A;  3ZZU A;  4I8O A;  5IT9 C;  4LF9 E;  1GZ6 A;  3GON A;  3MSW A;  1XHK A;  3J7A G;  1Z0V A;  2NUE A;  1O0W A;  4IZJ B;  1IBK E;  4X64 I;  5A2Q Q;  1ZM3 A;  3V5R A;  3ADI A;  1ZBT A;  1IBM E;  2L6M A;  2L92 A;  2VF1 A;  4DPU A;  2UUC E;  2F4V E;  4DMI A;  2UXC E;  2L3C A;  3B8H A;  2M1S A;  2V88 A;  3Q6N A;  4JI0 I;  1FWK A;  4JI3 I;  3T1H E;  4FW9 A;  4DUY E;  1HNZ E;  5AE2 A;  2L2N A;  5F3W A;  4DR1 I;  5IWA E;  1EI1 A;  4DR2 E;  2A2C A;  1WHN A;  4DU7 A;  2NA2 A;  4GEQ B;  2V83 A;  4EMD A;  4Z7C A;  4BBY A;  1WHQ A;  4JI2 I;  2CGE A;  4LFB E;  1N33 E;  4X8W A;  2V8P A;  1SR9 A;  4LFC I;  4X65 E;  2HFU A;  3C4B A;  1N36 I;  4BC9 A;  2Z5E A;  1J5E I;  2ZM6 E;  1Y4S A;  4FWD A;  2E1M A;  2EZ6 A;  2B7V A;  1H7S A;  3FIG A;  2WW4 A;  2L33 A;  1HR0 I;  3PRY A;  4JI1 I;  1U2R A;  4JI6 I;  1S16 A;  4DV3 I;  5AAS A;  3VYY A;  1Z59 A;  4DV2 E;  4LF5 E;  3D4J A;  1HNW I;  4DV5 E;  2V34 A;  4GKJ E;  4USK A;  3P06 A;  4Q28 A;  5FWK A;  1RR9 A;  1WXR A;  2UXD E;  4DV6 E;  4HAC B;  4FWG A;  2L2M A;  4R03 A;  2NUF A;  4DV1 I;  4AQY E;  1KTV A;  2VQE E;  4DR3 E;  4DR7 I;  4IZK A;  3J80 Q;  2IOP A;  4OOG C;  4NXM I;  1UIL A;  2KOU A;  2V8Q B;  1Z0T A;  2HK2 A;  5FLX C;  2V85 A;  2Z5B A;  4JI7 E;  4OX9 E;  4DR5 E;  4LF4 I;  4JV5 I;  3H09 A;  2X36 A;  4DV4 E;  2RS6 A;  1KIJ A;  2A2D A;  2YZT A;  4LFA E;  1T4O A;  1Z0B A;  2RSM A;  1YYW A;  4K0K E;  2KHX A;  4LF8 E;  2UUA I;  4YHH E;  3K6Q A;  4LF6 E;  4DR6 E;  4PRV A;  4JYA E;  1USU A;  2K4V A;  3AV0 A;  3J81 C;  1HNX I;  2ZBK B;  3K17 A;  2VQF I;  2NUG A;  3K85 A;  4LF7 I;  3C4T A;  2L3J A;  2FTX B;  4P7A A;  3WU5 A;  1D6T A;  4LTY A;  1GQE A;  3M6A A;  4X62 I;  4DPX A;  2UU9 I;  4DPW A;  2HFS A;  2AJ4 A;  2EFG A;  3ADJ A;  1FWL A;  1B62 A;  3P1X A;  1HK7 A;  4URL A;  4X64 E;  2V89 A;  1RC7 A;  1Z0C A;  1XNQ I;  4DV7 I;  5LMU E;  1IBL I;  4HY1 A;  4B3R I;  2F8B A;  1ELO A;  3KWR A;  3LLH A;  2CZ9 A;  4KQV A;  4DV0 I;  5A2Q C;  1DAR A;  5GMD A;  3CWV A;  1NHJ A;  4JI3 E;  3QT6 A;  4WUC A;  3Q6M A;  4B3S I;  4KZS A;  4TUI A;  4B3T I;  4USM A;  2Z5C A;  2LE2 A;  4DR1 E;  1ZXM A;  1S4E A;  1N32 I;  1PKP A;  4JG4 A;  2M4I A;  3H4L A;  1XNR I;  4DUZ I;  4JI2 E;  4F54 A;  4R8O A;  4M30 A;  4LFC E;  3V2U C;  4B3M I;  2Q2E B;  1J5E E;  1FNM A;  3ZOQ B;  2GS8 A;  4YY3 I;  1ZXN A;  3ADG A;  2B7T A;  3HPZ A;  1BKN A;  3OTO I;  2MC6 A;  1NHH A;  3HXL A;  1Z0W A;  3ADL A;  4J8Z A;  1HR0 E;  1Z5A A;  3RMP A;  4JI1 E;  4NXN I;  4JI6 E;  4DV3 E;  2V2Q A;  4DR2 I;  1HNW E;  4BMJ A;  1ZBQ A;  1H74 A;  3WU6 A;  1EKZ A;  1N0V C;  4LFB I;  4X65 I;  1FJG I;  3JTZ A;  2M7Q A;  4HXZ A;  4JI8 I;  2DB2 A;  2L8T A;  1PVG A;  4DV1 E;  2LUQ A;  2V87 A;  3AUZ A;  3PYD A;  4MYU A;  2HHH I;  4JI5 I;  2BM1 A;  4DR7 E;  3T1Y I;  4DPY A;  4FWH A;  4DR4 I;  1N34 E;  2UUB I;  4NXM E;  4PRX A;  2GQ0 A;  3PYF A;  4DV2 I;  4DV5 I;  1I94 I;  4JV5 E;  1Z5B A;  2XEX A;  4LF4 E;  2HKE A;  5T6J A;  1PIE A;  3J80 C;  1B63 A;  1Z5C A;  4UT4 A;  2N3H A;  2J7K A;  2IHR 1;  2LRS A;  1XMQ E;  1Y4U A;  3LNU A;  2VQE I;  2UUA E;  3K1J A;  2LMZ A;  1KKH A;  1XMO I;  2L2K B;  5L3J A;  1HNX E;  5LMN I;  2VQF E;  1J26 A;  4GKK I;  4LF7 E;  4IZK B;  4WUD A;  1YYO A;  4X66 I;  2E5L I;  2HK3 A;  4I3H A;  4P78 A;  2UU9 E;  2JWO A;  3JAM Q;  4BC7 A;  2Z5B B;  2JR1 A;  4IZJ A;  4TUG A;  4RPF A;  4LF8 I;  2CG9 A;  2YT4 A;  3VK6 A;  1WUU A;  2DSY A;  3VYX A;  1H7U A;  4LF6 I;  2LBS B;  4N3O A;  2VE7 C;  3QT5 A;  1K47 A;  4XTJ A;  4JI4 I;  1DQ3 A;  5LL6 R;  3B82 A;  5BR8 I;  5ADZ A;  1XNQ E;  3PYE A;  3HPS A;  4BCA A;  1H73 A;  4DV7 E;  2IOQ A;  4KHP I;  2UXB I;  4LU9 A;  4B3R E;  5IT9 Q;  2FGG A;  2JOB A;  4UTG A;  1ZM2 A;  2R3V A;  3Q1Q A;  2LTR A;  2O1W A;  2O1T A;  2VF3 A;  4DV0 E;  4JI0 E;  1MG7 A;  3ZZ0 A;  3QT7 A;  1DI2 A;  1X49 A;  3ZKB A;  4LF9 I;  4B3S E;  3PYG A;  3HTX A;  4HYM A;  4B3T E;  4F9B B;  1IBK I;  1N32 E;  4L8N A;  1MX0 A;  5LMU I;  3IWB A;  4ED4 A;  1IBM I;  5AE3 A;  1XNR E;  1UEK A;  1RQ0 A;  3HUL A;  4DUZ E;  4MYT A;  3WU3 A;  2UUC I;  1YZ9 A;  4F9A B;  2F4V I;  2RS7 A;  2MDR A;  4B3M E;  2V2V A;  2UXC I;  2NPF A;  4DXL A;  1N36 E;  3LPS A;  4YY3 E;  4BS9 A;  2V2Z A;  2EWL A;  3OTO E;  2LJP A;  3T1H I;  4DUY I;  1HNZ I;  4Z7Y A;  4WFT A;  2OI2 A;  3B78 A;  4M2Z A;  4NXN E;  2DEJ A;  4R1F A;  4FN5 A;  3ZZT A;  4P7D A;  2HKJ A;  4HAC A;  3F6H A;  5IWA I;  2G7H A;  3OML A;  3IWD A;  3HJC A;  4WUB A;  4WPY A;  1EA6 A;  2JOX A;  2E1R A;  5GME A;  1N33 I;  2Z5C B;  1FJG E;  2DMY A;  2PNL A;  4JI8 E;  4ZVI A;  3F0N A;  2ZM6 I;  1KVK A;  2LUP B;  1RRE A;  4WSP A;  2HHH E;  4JI5 E;  1T4N A;  5CFF E;  1QU6 A;  2X7I A;  2B3T B;  1ZM4 A;  3T1Y E;  3IWC A;  2FV4 B;  1Z0G A;  4M1K A;  4DR4 E;  2UUB E;  1MU5 A;  3LTO A;  1STU A;  1USV A;  1I94 E;  4LF5 I;  1Y6Z A;  4GKJ I;  2V86 A;  3HQ1 A;  1N0U A;  2BV3 A;  2DEI A;  1NZ0 A;  4PU9 A;  3F6G A;  5DNY A;  2UXD I;  4DV6 I;  3QT8 A;  1Z0E A;  2MC5 A;  3J7Y p;  1YYK A;  1X47 A;  4L5N C;  5FLX Q;  4AQY I;  1UHZ A;  2ODR C;  3J7A M;  4DKK A;  2H36 X;  4DR3 I;  1XMO E;  1X48 A;  4DU8 A;  1QZR A;  2JVA A;  3JU0 A;  2O1V A;  1N34 I;  1H72 C;  2R42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...