3T1HE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3t1hE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1hE02
5A2QC 4YHHE 1HNXE 1NHIA 4FN5A 1MG7A 1H7UA 3QT7A 1XMOI 4LF8I 4XTJA 1J5EE 1Z59A 2UUBE 1BKNA 4DU8A 2HFSA 1Z5CA 2X36A 4DV3I 3QT8A 1S16A 3ZKBA 4LF5E 2ZBKB 4DR7E 2UXCE 1YYWA 1FJGE 4NXNI 4M30A 2N3GA 2V2VA 2WW4A 3T1YI 4JI3I 2EZ6A 1QU6A 4LF4E 3J7Yp 4DXLA 4B3TE 3ADIA 1PKPA 1QZRA 1Z0CA 1FWKA 1B62A 4DPYA 4JI1I 1K47A 2J7KA 2LTRA 4LFBI 4HACB 1T4LB 1HNZI 2V2QA 4GKKE 3ZZUA 2DIXA 3ZZTA 2OI2A 4DPXA 3ADLA 1ZBTA 5LMNI 4GKJI 1N33E 4DV0I 2DMYA 1WUUA 3JAMC 2V34A 5GMDA 4JV5I 4DKKA 4ED4A 1KTVA 4UT4A 1STUA 4YY3E 5LL6R 1IBLI 3WU5A 2UXDI 2LUQA 2L33A 4JI7I 2R42A 3C4BA 1RREA 1Z0EA 1J26A 4JI3E 1EKZA 4DR3I 2L3CA 4LF6I 1EA6A 4DR4E 4ZVIA 4LF7I 2HFUA 2HK2A 4DV2I 4WUBA 1HNWE 3J81C 5LMUI 2UU9I 4PRXA 1UHZA 4OX9I 5IT9Q 4X66E 4JI2I 4DR1E 1DI2A 3J80C 4PRVA 4JI6E 2LBSB 4X65I 2V2ZA 3V5RA 2ZM6E 4X62I 4LFCI 1H72C 3QT6A 1IBME 2GS8A 1NHHA 1PVGA 1ZM3A 1N34I 1ZM4A 4DR5I 1UILA 1FKAE 2CZ9A 1N36E 2CPNA 4X64I 1X48A 1ZXMA 4JI4I 1I94I 2VQFE 4I3HA 2L2KB 1XNQE 1N32I 4KHPI 2UXDE 3V2UC 3PYDA 4X8WA 1Z5AA 4JYAI 4MYUA 1RC7A 5IWAE 1FI4A 2UUCE 2RS6A 1XNRI 1ZM9A 4WUCA 4LF7E 2HK3A 1Z0BA 1RR9A 1EI1A 4DR6I 4B3RE 4DV4E 4DV7E 2LTSA 4URLA 4LF9I 1YYKA 4RPFA 4OOGC 5FLXQ 4JI0E 4JI2E 3T1HE 3K1JA 4M2ZA 1U2RA 4X65E 5A2QQ 1HR0I 4WFTA 1T4NA 3ADJA 4B3SE 4WUDA 4DPWA 4B3MI 4JI5I 3VYYA 3HTXA 2F4VE 1H74A 3B78A 5BR8E 4FWDA 4P52A 4DV5I 1RQ0A 3J7AM 2HKJA 4DV1I 3ZZ0A 3LPSA 4DU7A 2B7TA 2E5LI 1IBKI 1XMOE 4LF8E 4AQYI 1NZ0A 2RTXA 2BM1A 1Z0TA 2UXBI 3M6AA 2NUFA 4WYQB 4DV3E 4DR6E 2AJ4A 3QT5A 3PYFA 2VQEI 2A2CA 3WU4A 1X49A 4JI8I 4NXNE 4DR2I 5CFFE 2LUPB 5IT9C 3T1YE 3VYXA 4KQVA 4LFAI 1FNMA 4FWHA 4K0KI 3H4LA 1Z0VA 4FW9A 1O0WA 2HHHI 4YHHI 1HNXI 4P7AA 1YZ9A 2V8PA 2A2DA 3B8HA 4USKA 3D4JA 1Z0WA 1KKHA 2UUAI 4JI1E 1J5EI 1D6TA 3F0NA 2LRSA 3JAMQ 4LFBE 1DARA 2LJPA 1ELOA 2IHR1 1HNZE 4EMDA 2E5LE 3P1XA 2N3HA 2DEIA 4DUYI 2VF3A 4MYTA 5LMNE 4GKJE 4DV0E 4LF5I 4NXMI 2UXBE 4DR7I 1GQEA 3PYEA 1FJGI 4JV5E 2X7IA 3OTOI 1OJ4A 2E1RA 3J7AG 1PIEA 3C4TA 2JY9A 2VQEE 1N0VC 4HY1A 1IBLE 4JI7E 2L3JA 3J81Q 4USMA 1KIJA 4DR3E 1ZXNA 2KHXA 4R1FA 2Q2EB 4LF6E 2BM0A 1A6FA 1XMQI 2HHHE 3J80Q 4DV2E 3LTOA 4FWGA 5LMUE 2UU9E 4GKKI 4OX9E 2UUAE 1N33I 1YYOA 4X62E 4LFCE 3B82A 1B63A 2XEXA 4JG4A 1Z0GA 1N34E 2ZITA 4DUYE 4YY3I 4NXME 4DR5E 3OTOE 4X64E 2BV3A 4UTGA 2RSMA 4JI4E 1I94E 2EFGA 1N32E 4KHPE 4DR4I 2RS7A 2DB2A 4JYAE 3ZM7A 4DPTA 2YT4A 1HNWI 4HXZA 1XNRE 3K17A 1WHQA 3GONA 1WHNA 2NA2A 1XMQE 4X66I 2L2MA 2B7VA 2LJHA 3ADGA 3WU6A 4DR1I 4JI6I 4DUZI 2ZM6I 1MX0A 2B3TB 4LF9E 2L2NA 1H73A 1IBMI 3Q1QA 1VISA 1Z5BA 1X47A 4DV6I 2NUEA 3WU3A 1HR0E 1N36I 2JVAA 4PU9A 4B3ME 3HULA 2MDRA 1H7SA 2VQFI 4JI5E 1XNQI 5L3JA 1FWLA 3LNUA 3LLHA 4DV5E 3CWVA 5IWAI 2UUCI 4DV1E 2NUGA 4M1KA 2UUBI 1XHKA 1NHJA 2HKEA 2NPFA 4HACA 4Z7CA 5GMEA 1IBKE 1S4EA 4AQYE 4B3RI 4DV4I 4DV7I 2UXCI 1ZM2A 4JI0I 1KVKA 3T1HI 4HYMA 4Z7YA 4LF4I 1N0UA 1MU5A 4DUZE 2DEJA 1UEKA 4B3SI 4JI8E 4DR2E 1T4OA 3PYGA 4B3TI 5FLXC 3ZKDA 2F4VI 4LFAE 4DV6E 4K0KE 2R3VA 5BR8I 4DPUA
chains in the Genus database with same CATH superfamily
5A2QC 5KL6A 4YHHE 5ADZA 1HNXE 2KONA 1NHIA 2O1WA 1XXEA 2EMAA 5KL3A 4FN5A 2EQ0A 1EH8A 1UDSA 3P06A 1MG7A 1H7UA 3QT7A 5KL2A 4J3DA 1XMOI 4LF8I 4XTJA 1J5EE 2JE6B 2WP8A 1MGTA 4R2SA 2YTQA 1Z59A 5JEAB 2V8QB 4IFDC 3TQMA 1UDQA 2UUBE 4U3BA 1ZAAC 1BKNA 2EMFA 2EQ1A 2EMHA 2EN7A 2EPKX 4BS9A 4DU8A 2C37B 2HFSA 1Z5CA 2O1UA 2X36A 5AC5A 4IFDE 4I8OA 4DV3I 4NZVA 3QT8A 4FW3A 5DNYA 2EOOA 2YTIA 1S16A 3BF2A 2ELYA 2CVEA 4LF5E 2ZBKB 2V88A 5AE1A 3H1CA 3ZKBA 4O24A 4DR7E 4O5GA 2UXCE 1YYWA 2EJ4A 2JOXA 1R6MA 3HQ1A 1FJGE 2Z5CA 2IESA 4M30A 4NXNI 2EPLX 2N3GA 1DGCA 3M85D 2V2VA 2WW4A 2WCC3 2JYAA 2EZ6A 3M85G 3T1YI 4JI3I 2HC5A 1QU6A 4LF4E 1SFEA 2O3ZA 4WXDA 2EN3A 4TUGA 1X3CA 4ZYHA 2YWQA 1X5WA 5AASA 3J7Yp 1T39A 3L7ZA 2YSPA 4N3OA 4DXLA 4B3TE 3ADIA 4OO1F 5JEAC 1PKPA 1QZRA 1Z0CA 2PO0A 1RMDA 4QNJA 2VESA 4LTYA 1FWKA 1B62A 4DPYA 4NHRA 2YZTA 4R8OA 1K47A 4JI1I 4BA1A 5JEAE 2J7KA 3PS1A 2ENAA 2LTRA 4LFBI 2M7QA 4HACB 4IJDA 5DRQA 1T4LB 3F6HA 1HNZI 2V2QA 3U1KA 3AV0A 3HPZA 2YTDA 4FK5C 2EM0A 1X6FA 2EOMA 4GKKE 5DROA 3ZZUA 3ZOQB 1TF6A 2DIXA 2EMBA 3ZZTA 5DRPA 2OI2A 4DPXA 3ADLA 1ZBTA 5LMNI 4GKJI 1N33E 4DV0I 2DMYA 1Z1BA 2YTOA 4U3DA 2V85A 3JAMC 1IMUA 4Q28A 1WUUA 2EMXA 2V34A 5GMDA 4JV5I 2EP3A 2ENCA 4WPYA 4DKKA 5DRRA 4ED4A 1KTVA 1PJTA 4UT4A 1STUA 5ELWA 1AH5A 4YY3E 4R2PA 5LL6R 1IBLI 2EPCA 1A1FA 2R1FA 3WU5A 3EQ1A 2BR2B 2GO4A 2UXDI 2LUQA 2L33A 4JI7I 5F3WA 3KWRA 2PNZA 4TUIA 2R42A 2JWOA 3C4BA 1A1JA 2I13A 1RREA 1Z0EA 2JEAB 2CG9A 3C6KA 2C39A 4IS1C 1J26A 3B4TA 4JI3E 2EMWA 1EKZA 4DR3I 5DNXA 2F1DA 1B69A 2M9AA 2NN6E 5AC4A 2EOZA 2L3CA 4F6NA 1KJKA 2WNRA 4LF6I 1WRJA 4DR4E 1EA6A 4ZVIA 1YUIA 2N8XA 4LF7I 3U1YA 2HFUA 5K36E 2HK2A 4M0VA 4DV2I 2BA1D 2EOIA 4WUBA 1HNWE 3J81C 1Y5YA 5LMUI 2UU9I 4PRXA 1A1KA 2BA1G 2EE8A 2EM8A 1RHYA 1UHZA 4OX9I 3BIDA 2WP8B 5IT9Q 4WSGA 4X66E 4JI2I 2J7JA 1GZ6A 1LLMC 4DR1E 1DI2A 2Z5BA 3J80C 4PRVA 3OMLA 3L00A 4JI6E 3JTZA 2BB8A 2LBSB 4X65I 2V2ZA 3V5RA 2ZM6E 4X62I 4LFCI 3GLLA 2EM5A 5EKWA 1H72C 3HXLA 3QT6A 1IBME 2GS8A 1NHHA 4MLQA 3THOB 1OYRA 1PVGA 1ZM3A 1N34I 1ZM4A 2DRPA 2YTEA 2G7HA 2EN8A 4DR5I 2EM6A 1UILA 1FKAE 2CZ9A 4BCAA 1N36E 1A1GA 2B9DA 2CPNA 4R2CA 4X64I 1X48A 4IZKA 2LV2A 3EPJA 1ZXMA 4JI4I 4GEQB 2DLKA 1I94I 2VQFE 4I3HA 2L2KB 1XNQE 1N32I 3KZYA 4KHPI 2EWLA 2UXDE 2K4VA 5LLQA 3V2UC 2PNMA 3PYDA 4X8WA 1Z5AA 5C0XF 4JYAI 4MYUA 1RC7A 2E1MA 5IWAE 1FI4A 2UUCE 1OYSA 1NEIA 2PO0B 2RS6A 4L5NC 3IWDA 1XNRI 1ZM9A 4WUCA 4BA1B 4LF7E 2HK3A 4MU0A 4MU4A 5KL5A 1Z0BA 1RR9A 1EI1A 4DR6I 4B3RE 4DV4E 3P3CA 4DV7E 2LTSA 3PS2A 1N3GA 2O1TA 4URLA 4N4RB 2BA0D 3PS3A 4KWYA 4IZJA 4LF9I 1YYKA 4RPFA 4OOGC 5FLXQ 2BA0G 2EM9A 5EL9A 4JI0E 4JI2E 2ENHA 3T1HE 3CDJA 3K1JA 4M2ZA 1U2RA 2JEBA 4OO1A 2GHFA 4X65E 1AAYA 1USUA 4FW4A 5A2QQ 4WFTA 1HR0I 1T4NA 3LMLA 3ADJA 4B3SE 4WUDA 1E3PA 4DPWA 4B3MI 2EMYA 1P42A 4AIDA 1GTKA 2R76A 2EMLA 3P3GA 4JI5I 3VYYA 3HTXA 2F4VE 2PNZB 2YSOA 4MU1A 1H74A 3B78A 5BR8E 1YHCA 4FWDA 4P52A 4OZEA 4DV5I 2PO1A 2IOPA 2NN6B 2GQ0A 1RQ0A 4IZJD 3J7AM 2I9IA 2HKJA 1EH7A 4DV1I 3ZZ0A 5K36B 2EOHA 4R2DA 1G2DC 2PO2A 3LPSA 1X6HA 4ZYDA 4DU7A 5KL7A 3MHSC 4OO1D 1HK7A 1IQOA 3GMEA 3EPKA 2EPMX 1BBOA 2B7TA 2E5LI 1IBKI 1XMOE 4LF8E 4F2JC 4AQYI 1WJPA 2VE7C 1NZ0A 2Q8UA 2H36X 2RTXA 2JR1A 2EOFA 2BM1A 1Z0TA 2UXBI 1E3HA 3M6AA 3Q6NA 2LE2A 2VRDA 1A1LA 2Z5BB 2NUFA 2YU5A 4WYQB 4DV3E 4DR6E 3NZKA 2AJ4A 3QT5A 2DLQA 3PYFA 1VI7A 2VQEI 3AUZA 5A6JA 4O43A 2DGCA 5A6BA 2A2CA 1ZR9A 3WU4A 1X49A 4JI8I 5C0XA 2NN6C 5FWKA 3K85A 4NXNE 4DR2I 5CFFE 2BBGA 3FIGA 3P3EA 3F6GA 1F2IG 3HJCA 4NBQA 5K36C 2LUPB 2LMZA 5IT9C 2EM3A 3T1YE 3VYXA 2AE8A 4KQVA 4LFAI 1FNMA 3HPSA 4FWHA 4MDTA 3H4LA 4K0KI 4FW5A 4IFDF 2EN6A 4WSPA 5KL4A 1O0WA 1Z0VA 4FW9A 4IZKB 2LVHA 2HHHI 2EPPA 2WBSA 2O1VA 4YHHI 1WXRA 1HNXI 1PJQA 1KYQA 4R03A 4P7AA 4BC9A 4M9VC 1YZ9A 2L6MA 2V8PA 2A2DA 1DQ3A 2FTXB 4HEIA 1PJSA 2ADRA 2EOJA 3B8HA 4USKA 3D4JA 1Z0WA 5A6BD 1KKHA 2EM4A 2EOEA 2UUAI 4JI1E 3DF6A 2YTPA 5C0XD 1J5EI 1D6TA 3F0NA 2LRSA 2EOXA 3JAMQ 4LFBE 1DARA 2LJPA 1ELOA 2IHR1 1HNZE 2MC6A 1A1IA 2CT1A 2EN4A 5IXMB 4EMDA 1TN9A 2E5LE 3P1XA 1ZU1A 2CSHA 2EOSA 2N3HA 2KOUA 2LT7A 3M7ND 2DEIA 4DUYI 2VF3A 4MYTA 3K6QA 5LMNE 2HJJA 4GKJE 1BBGA 4IZJB 4DV0E 2EL5A 4LF5I 4NXMI 2Z5CB 3M7NG 1YPNA 2UXBE 4DR7I 1GQEA 2V83A 5JEAF 3PYEA 1FJGI 4JV5E 4O4KA 2X7IA 3OTOI 4FW7A 1OJ4A 5A69A 2E1RA 5A6AA 2MKDA 2JPAA 4OO1B 2ODRD 3J7AG 3UK3C 1PIEA 3C4TA 2JY9A 5DNLA 4MLVA 2VQEE 1N0VC 4HY1A 1IBLE 3L7ZB 2EM2A 2IOQA 4JI7E 2EMIA 2L3JA 2NABA 4WX9A 2MKNA 3J81Q 1SR9A 2EN1A 4MU3A 2JXPA 2YTNA 3Q6MA 4USMA 2DSYA 3THNA 4DR3E 1KIJA 1ZXNA 2PO1B 2KHXA 4F54A 3KRNA 4J8ZA 4Q35B 2EPRA 4R1FA 3ECRA 1IQSA 2Q2EB 4LF6E 2BM0A 1A6FA 2C38A 2HHHE 1XMQI 2EOQA 3J80Q 4R2QA 4DV2E 3LTOA 3KZZA 4FWGA 2M1SA 4DMIA 4R2RA 5LMUE 2HGHA 2UU9E 1NCSA 3BBGA 3C6MA 2L8TA 2L92A 5T6JA 4GKKI 4OX9E 4RH8A 5AE3A 2V89A 2UUAE 2YRMA 4P7DA 1G2FC 2EPUA 2Z5EA 1TF3A 4OO1C 2EM7A 3MHHC 2NN6F 1N33I 2EPXA 2DMIA 2EOYA 5IV8B 4LPFA 4LCFA 4IFDA 4BHCA 1YYOA 3HKMA 5K36F 1EH6A 4X62E 4LFCE 3B82A 1B63A 3VK6A 1USVA 2XEXA 4JG4A 4OO1E 1Z0GA 1UN6B 4F9BB 1Y4SA 1N34E 1UBDC 2J65A 2ZITA 2CTDA 4DUYE 4YY3I 3EPLA 4RHBB 5C0XB 4NXME 2YPNA 4DR5E 1QNTA 2EMKA 1BB8A 3H09A 2CGEA 4P78A 2C39B 3OTOE 2V86A 2PRTA 2EL4A 4X64E 2BV3A 4BA2A 2MC5A 2YRKA 4UTGA 2RSMA 4JI4E 2WNRB 4BBYA 1I94E 2LCEA 2RQLA 2EFGA 1N32E 2EL6A 2EORA 4KHPE 1Y4UA 2EPZA 4QNKA 4DR4I 2RS7A 4IFDD 2WZOA 2DB2A 2ELZA 4BMJA 4JYAE 2IERA 3ZM7A 2YT4A 4DPTA 1HNWI 2K7IA 2MDGA 4ZYGA 4BHBA 2JE6A 4HXZA 5AE2A 4WXCA 4F9CB 1XNRE 3K17A 1WHQA 2A25A 5JEAA 4LCGA 3GONA 2JT2A 1WHNA 4KZSA 5TSEA 2NA2A 1XMQE 1MEYC 1YUJA 4X66I 2L2MA 2B7VA 3RMPA 2LJHA 3ADGA 2C37A 3WU6A 4DR1I 3DD6A 2V87A 1Y60A 4JI6I 3EPHA 1YH8A 5C0XC 4X9JA 4DUZI 2ZM6I 2FGGA 1MX0A 2B3TB 4LF9E 2M4IA 2L2NA 3GCMA 2WBTA 1H73A 1L4SA 2EPAA 1IBMI 3Q1QA 1VISA 1Z5BA 3IWBA 5C0XE 1X47A 3DJWA 2RSIA 4MQYA 4DV6I 3JU0A 2EMGA 2NUEA 3WU3A 1YSAC 1ZBQA 3MSWA 2LO3A 4BC7A 1HR0E 2JP9A 1N36I 2JVAA 5JEAD 4HTGA 2YTJA 1PDAA 2PNLA 4PU9A 4B3ME 4AM3A 3HULA 2EPOA 2GO3A 4R2EA 2MDRA 4OKGA 5A6KA 3P76A 2F8BA 1H7SA 4FW6A 2VQFI 4JI5E 1XNQI 2GPIA 5L3JA 1P47A 1X6EA 4GZNC 2ODRC 1FWLA 3LNUA 3LLHA 1UDNA 4DV5E 4ISAA 4R2AA 2VF1A 2E72A 2EMCA 1OYPA 3CWVA 4IS9A 5IWAI 4F6MA 4DV1E 2NN6A 2UUCI 2NUGA 3PRYA 4LOMA 4M1KA 3VHTB 3BGHA 5K36A 2UUBI 1XHKA 3M99B 1YFHA 1NHJA 2C38B 2HKEA 2NPFA 3UHMA 4HACA 4L8NA 2EPNA 4Z7CA 2FV4B 2LJUA 4F9AB 4ZYEA 5GMEA 4GQUA 1IBKE 1S4EA 1Y6ZA 4AQYE 4B3RI 4DV4I 2GLIA 4DV7I 2RPCA 2YU8A 2EN2A 1T38A 3CDIA 2UXCI 3QG5C 2EQ3A 1ZM2A 1JK2A 4JI0I 2YTFA 2YTGA 1KVKA 2JEBB 4IFDB 3T1HI 2NN6D 4LU9A 4HYMA 4Z7YA 4LF4I 2YRHA 4BA2B 2JOBA 2D9HA 1N0UA 1MU5A 4DUZE 5K36D 2DEJA 1UEKA 1R6LA 4B3SI 4JI8E 4LCHA 2WBUA 2BR2A 4DR2E 1T4OA 3PYGA 4B3TI 2EMZA 1JK1A 5FLXC 4AIMA 2JEAA 3ZKDA 2F4VI 4LFAE 4DV6E 1UDOA 4K0KE 2R3VA 5BR8I 4DPUA 1A1HA 2PO2B 3IWCA
chains in the Genus database with same CATH topology
5A2QC 4YHHE 5ADZA 1HNXE 2KONA 1NHIA 2O1WA 4FN5A 3P06A 1MG7A 1H7UA 3QT7A 1XMOI 4LF8I 4XTJA 1J5EE 1Z59A 2V8QB 2UUBE 1BKNA 4BS9A 4DU8A 2HFSA 1Z5CA 2O1UA 2X36A 4I8OA 4DV3I 3QT8A 5DNYA 1S16A 3ZKBA 4LF5E 2ZBKB 2V88A 5AE1A 4DR7E 2UXCE 1YYWA 2JOXA 2Z5CA 3HQ1A 1FJGE 4NXNI 4M30A 2N3GA 2V2VA 2WW4A 3T1YI 4JI3I 2EZ6A 1QU6A 4LF4E 4TUGA 5AASA 3J7Yp 4N3OA 4DXLA 4B3TE 3ADIA 1PKPA 1QZRA 1Z0CA 4LTYA 1FWKA 1B62A 4DPYA 2YZTA 4R8OA 1K47A 4JI1I 2J7KA 2LTRA 4LFBI 2M7QA 4HACB 1T4LB 3F6HA 1HNZI 2V2QA 3AV0A 3HPZA 4GKKE 3ZZUA 3ZOQB 2DIXA 3ZZTA 2OI2A 4DPXA 3ADLA 1ZBTA 5LMNI 4GKJI 1N33E 4DV0I 2DMYA 2V85A 3JAMC 1WUUA 4Q28A 2V34A 5GMDA 4JV5I 4DKKA 4WPYA 4ED4A 1KTVA 4UT4A 1STUA 4YY3E 5LL6R 1IBLI 3WU5A 2UXDI 2LUQA 2L33A 4JI7I 5F3WA 3KWRA 4TUIA 2R42A 2JWOA 3C4BA 1RREA 1Z0EA 2CG9A 1J26A 4JI3E 1EKZA 4DR3I 2L3CA 4LF6I 1EA6A 4DR4E 4ZVIA 4LF7I 2HFUA 2HK2A 4M0VA 4DV2I 4WUBA 1HNWE 3J81C 5LMUI 2UU9I 4PRXA 1UHZA 4OX9I 5IT9Q 4X66E 4JI2I 1GZ6A 4DR1E 1DI2A 2Z5BA 3J80C 4PRVA 3OMLA 4JI6E 3JTZA 2LBSB 4X65I 2V2ZA 3V5RA 2ZM6E 4X62I 4LFCI 1H72C 3HXLA 3QT6A 1IBME 2GS8A 1NHHA 1PVGA 1ZM3A 1N34I 1ZM4A 2G7HA 4DR5I 1UILA 1FKAE 2CZ9A 4BCAA 1N36E 2B9DA 2CPNA 4X64I 1X48A 4IZKA 1ZXMA 4JI4I 4GEQB 1I94I 2VQFE 4I3HA 2L2KB 1XNQE 1N32I 4KHPI 2EWLA 2UXDE 2K4VA 3V2UC 2PNMA 3PYDA 4X8WA 1Z5AA 4JYAI 4MYUA 1RC7A 2E1MA 5IWAE 1FI4A 2UUCE 2RS6A 4L5NC 3IWDA 1XNRI 1ZM9A 4WUCA 4LF7E 2HK3A 1Z0BA 1RR9A 1EI1A 4DR6I 4B3RE 4DV4E 4DV7E 2LTSA 2O1TA 4URLA 4IZJA 4LF9I 1YYKA 4RPFA 4OOGC 5FLXQ 4JI0E 4JI2E 3T1HE 3K1JA 4M2ZA 1U2RA 4X65E 5A2QQ 1USUA 1HR0I 4WFTA 1T4NA 3LMLA 3ADJA 4B3SE 4WUDA 4DPWA 4B3MI 4JI5I 3VYYA 3HTXA 2F4VE 1H74A 3B78A 5BR8E 4FWDA 4P52A 4DV5I 2IOPA 2GQ0A 1RQ0A 4IZJD 3J7AM 2HKJA 4DV1I 3ZZ0A 3LPSA 4DU7A 1HK7A 2B7TA 2E5LI 1IBKI 1XMOE 4LF8E 4AQYI 2VE7C 1NZ0A 2H36X 2RTXA 2JR1A 2BM1A 1Z0TA 2UXBI 3M6AA 3Q6NA 2LE2A 2Z5BB 2NUFA 4WYQB 4DV3E 4DR6E 2AJ4A 3QT5A 3PYFA 2VQEI 3AUZA 2A2CA 3WU4A 1X49A 4JI8I 5FWKA 3K85A 4NXNE 4DR2I 5CFFE 3FIGA 3F6GA 3HJCA 2LUPB 2LMZA 5IT9C 3T1YE 3VYXA 4KQVA 4LFAI 1FNMA 3HPSA 4FWHA 4K0KI 3H4LA 1Z0VA 4WSPA 4FW9A 1O0WA 2HHHI 4IZKB 2O1VA 4YHHI 1WXRA 1HNXI 4R03A 4P7AA 4BC9A 1YZ9A 2V8PA 2L6MA 2A2DA 1DQ3A 2FTXB 3B8HA 4USKA 3D4JA 1Z0WA 1KKHA 2UUAI 4JI1E 3DF6A 1J5EI 1D6TA 3F0NA 2LRSA 3JAMQ 4LFBE 1DARA 2LJPA 1ELOA 2IHR1 1HNZE 2MC6A 4EMDA 2E5LE 3P1XA 2N3HA 2KOUA 2DEIA 4DUYI 2VF3A 4MYTA 3K6QA 5LMNE 4GKJE 4IZJB 4DV0E 4LF5I 4NXMI 2Z5CB 2UXBE 4DR7I 1GQEA 2V83A 3PYEA 1FJGI 4JV5E 2X7IA 3OTOI 1OJ4A 2E1RA 2ODRD 3J7AG 1PIEA 3C4TA 2JY9A 2VQEE 1N0VC 4HY1A 1IBLE 2IOQA 4JI7E 2L3JA 3J81Q 1SR9A 3Q6MA 4USMA 2DSYA 1KIJA 4DR3E 1ZXNA 2KHXA 4F54A 4R1FA 4J8ZA 2Q2EB 4LF6E 2BM0A 1A6FA 1XMQI 2HHHE 3J80Q 4DV2E 3LTOA 4FWGA 2M1SA 4DMIA 5LMUE 2UU9E 2L8TA 2L92A 5T6JA 4GKKI 4OX9E 5AE3A 2V89A 2UUAE 4P7DA 2Z5EA 1N33I 1YYOA 4X62E 4LFCE 3B82A 1B63A 3VK6A 1USVA 2XEXA 4JG4A 1Z0GA 4F9BB 1Y4SA 1N34E 2ZITA 4DUYE 4YY3I 4NXME 4DR5E 3H09A 2CGEA 4P78A 3OTOE 2V86A 4X64E 2BV3A 2MC5A 4UTGA 2RSMA 4JI4E 4BBYA 1I94E 2EFGA 1N32E 4KHPE 1Y4UA 4DR4I 2RS7A 2WZOA 2DB2A 4BMJA 4JYAE 3ZM7A 4DPTA 2YT4A 1HNWI 4HXZA 5AE2A 4F9CB 1XNRE 3K17A 1WHQA 3GONA 1WHNA 4KZSA 2NA2A 1XMQE 4X66I 2L2MA 2B7VA 3RMPA 2LJHA 3ADGA 3WU6A 4DR1I 2V87A 4JI6I 4DUZI 2ZM6I 2FGGA 1MX0A 2B3TB 4LF9E 2M4IA 2L2NA 1H73A 1IBMI 3Q1QA 1VISA 1Z5BA 3IWBA 1X47A 3DJWA 4DV6I 3JU0A 2NUEA 3WU3A 1ZBQA 3MSWA 1HR0E 4BC7A 1N36I 2JVAA 2PNLA 4PU9A 4B3ME 3HULA 2MDRA 2F8BA 1H7SA 2VQFI 4JI5E 1XNQI 5L3JA 1FWLA 2ODRC 3LNUA 3LLHA 4DV5E 2VF1A 3CWVA 5IWAI 2UUCI 4DV1E 2NUGA 3PRYA 4M1KA 2UUBI 1XHKA 1NHJA 2HKEA 2NPFA 4HACA 4L8NA 4Z7CA 2FV4B 4F9AB 5GMEA 1IBKE 1S4EA 1Y6ZA 4AQYE 4B3RI 4DV4I 4DV7I 2UXCI 1ZM2A 4JI0I 1KVKA 3T1HI 4HYMA 4LU9A 4Z7YA 4LF4I 2JOBA 1N0UA 1MU5A 4DUZE 2DEJA 1UEKA 4B3SI 4JI8E 4DR2E 1T4OA 3PYGA 4B3TI 5FLXC 3ZKDA 2F4VI 4LFAE 4DV6E 4K0KE 2R3VA 5BR8I 4DPUA 3IWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q C;  4YHH E;  1HNX E;  1NHI A;  4FN5 A;  1MG7 A;  1H7U A;  3QT7 A;  1XMO I;  4LF8 I;  4XTJ A;  1J5E E;  1Z59 A;  2UUB E;  1BKN A;  4DU8 A;  2HFS A;  1Z5C A;  2X36 A;  4DV3 I;  3QT8 A;  1S16 A;  3ZKB A;  4LF5 E;  2ZBK B;  4DR7 E;  2UXC E;  1YYW A;  1FJG E;  4NXN I;  4M30 A;  2N3G A;  2V2V A;  2WW4 A;  3T1Y I;  4JI3 I;  2EZ6 A;  1QU6 A;  4LF4 E;  3J7Y p;  4DXL A;  4B3T E;  3ADI A;  1PKP A;  1QZR A;  1Z0C A;  1FWK A;  1B62 A;  4DPY A;  4JI1 I;  1K47 A;  2J7K A;  2LTR A;  4LFB I;  4HAC B;  1T4L B;  1HNZ I;  2V2Q A;  4GKK E;  3ZZU A;  2DIX A;  3ZZT A;  2OI2 A;  4DPX A;  3ADL A;  1ZBT A;  5LMN I;  4GKJ I;  1N33 E;  4DV0 I;  2DMY A;  1WUU A;  3JAM C;  2V34 A;  5GMD A;  4JV5 I;  4DKK A;  4ED4 A;  1KTV A;  4UT4 A;  1STU A;  4YY3 E;  5LL6 R;  1IBL I;  3WU5 A;  2UXD I;  2LUQ A;  2L33 A;  4JI7 I;  2R42 A;  3C4B A;  1RRE A;  1Z0E A;  1J26 A;  4JI3 E;  1EKZ A;  4DR3 I;  2L3C A;  4LF6 I;  1EA6 A;  4DR4 E;  4ZVI A;  4LF7 I;  2HFU A;  2HK2 A;  4DV2 I;  4WUB A;  1HNW E;  3J81 C;  5LMU I;  2UU9 I;  4PRX A;  1UHZ A;  4OX9 I;  5IT9 Q;  4X66 E;  4JI2 I;  4DR1 E;  1DI2 A;  3J80 C;  4PRV A;  4JI6 E;  2LBS B;  4X65 I;  2V2Z A;  3V5R A;  2ZM6 E;  4X62 I;  4LFC I;  1H72 C;  3QT6 A;  1IBM E;  2GS8 A;  1NHH A;  1PVG A;  1ZM3 A;  1N34 I;  1ZM4 A;  4DR5 I;  1UIL A;  1FKA E;  2CZ9 A;  1N36 E;  2CPN A;  4X64 I;  1X48 A;  1ZXM A;  4JI4 I;  1I94 I;  2VQF E;  4I3H A;  2L2K B;  1XNQ E;  1N32 I;  4KHP I;  2UXD E;  3V2U C;  3PYD A;  4X8W A;  1Z5A A;  4JYA I;  4MYU A;  1RC7 A;  5IWA E;  1FI4 A;  2UUC E;  2RS6 A;  1XNR I;  1ZM9 A;  4WUC A;  4LF7 E;  2HK3 A;  1Z0B A;  1RR9 A;  1EI1 A;  4DR6 I;  4B3R E;  4DV4 E;  4DV7 E;  2LTS A;  4URL A;  4LF9 I;  1YYK A;  4RPF A;  4OOG C;  5FLX Q;  4JI0 E;  4JI2 E;  3T1H E;  3K1J A;  4M2Z A;  1U2R A;  4X65 E;  5A2Q Q;  1HR0 I;  4WFT A;  1T4N A;  3ADJ A;  4B3S E;  4WUD A;  4DPW A;  4B3M I;  4JI5 I;  3VYY A;  3HTX A;  2F4V E;  1H74 A;  3B78 A;  5BR8 E;  4FWD A;  4P52 A;  4DV5 I;  1RQ0 A;  3J7A M;  2HKJ A;  4DV1 I;  3ZZ0 A;  3LPS A;  4DU7 A;  2B7T A;  2E5L I;  1IBK I;  1XMO E;  4LF8 E;  4AQY I;  1NZ0 A;  2RTX A;  2BM1 A;  1Z0T A;  2UXB I;  3M6A A;  2NUF A;  4WYQ B;  4DV3 E;  4DR6 E;  2AJ4 A;  3QT5 A;  3PYF A;  2VQE I;  2A2C A;  3WU4 A;  1X49 A;  4JI8 I;  4NXN E;  4DR2 I;  5CFF E;  2LUP B;  5IT9 C;  3T1Y E;  3VYX A;  4KQV A;  4LFA I;  1FNM A;  4FWH A;  4K0K I;  3H4L A;  1Z0V A;  4FW9 A;  1O0W A;  2HHH I;  4YHH I;  1HNX I;  4P7A A;  1YZ9 A;  2V8P A;  2A2D A;  3B8H A;  4USK A;  3D4J A;  1Z0W A;  1KKH A;  2UUA I;  4JI1 E;  1J5E I;  1D6T A;  3F0N A;  2LRS A;  3JAM Q;  4LFB E;  1DAR A;  2LJP A;  1ELO A;  2IHR 1;  1HNZ E;  4EMD A;  2E5L E;  3P1X A;  2N3H A;  2DEI A;  4DUY I;  2VF3 A;  4MYT A;  5LMN E;  4GKJ E;  4DV0 E;  4LF5 I;  4NXM I;  2UXB E;  4DR7 I;  1GQE A;  3PYE A;  1FJG I;  4JV5 E;  2X7I A;  3OTO I;  1OJ4 A;  2E1R A;  3J7A G;  1PIE A;  3C4T A;  2JY9 A;  2VQE E;  1N0V C;  4HY1 A;  1IBL E;  4JI7 E;  2L3J A;  3J81 Q;  4USM A;  1KIJ A;  4DR3 E;  1ZXN A;  2KHX A;  4R1F A;  2Q2E B;  4LF6 E;  2BM0 A;  1A6F A;  1XMQ I;  2HHH E;  3J80 Q;  4DV2 E;  3LTO A;  4FWG A;  5LMU E;  2UU9 E;  4GKK I;  4OX9 E;  2UUA E;  1N33 I;  1YYO A;  4X62 E;  4LFC E;  3B82 A;  1B63 A;  2XEX A;  4JG4 A;  1Z0G A;  1N34 E;  2ZIT A;  4DUY E;  4YY3 I;  4NXM E;  4DR5 E;  3OTO E;  4X64 E;  2BV3 A;  4UTG A;  2RSM A;  4JI4 E;  1I94 E;  2EFG A;  1N32 E;  4KHP E;  4DR4 I;  2RS7 A;  2DB2 A;  4JYA E;  3ZM7 A;  4DPT A;  2YT4 A;  1HNW I;  4HXZ A;  1XNR E;  3K17 A;  1WHQ A;  3GON A;  1WHN A;  2NA2 A;  1XMQ E;  4X66 I;  2L2M A;  2B7V A;  2LJH A;  3ADG A;  3WU6 A;  4DR1 I;  4JI6 I;  4DUZ I;  2ZM6 I;  1MX0 A;  2B3T B;  4LF9 E;  2L2N A;  1H73 A;  1IBM I;  3Q1Q A;  1VIS A;  1Z5B A;  1X47 A;  4DV6 I;  2NUE A;  3WU3 A;  1HR0 E;  1N36 I;  2JVA A;  4PU9 A;  4B3M E;  3HUL A;  2MDR A;  1H7S A;  2VQF I;  4JI5 E;  1XNQ I;  5L3J A;  1FWL A;  3LNU A;  3LLH A;  4DV5 E;  3CWV A;  5IWA I;  2UUC I;  4DV1 E;  2NUG A;  4M1K A;  2UUB I;  1XHK A;  1NHJ A;  2HKE A;  2NPF A;  4HAC A;  4Z7C A;  5GME A;  1IBK E;  1S4E A;  4AQY E;  4B3R I;  4DV4 I;  4DV7 I;  2UXC I;  1ZM2 A;  4JI0 I;  1KVK A;  3T1H I;  4HYM A;  4Z7Y A;  4LF4 I;  1N0U A;  1MU5 A;  4DUZ E;  2DEJ A;  1UEK A;  4B3S I;  4JI8 E;  4DR2 E;  1T4O A;  3PYG A;  4B3T I;  5FLX C;  3ZKD A;  2F4V I;  4LFA E;  4DV6 E;  4K0K E;  2R3V A;  5BR8 I;  4DPU A; 
#chains in the Genus database with same CATH topology
 5A2Q C;  5KL6 A;  4YHH E;  5ADZ A;  1HNX E;  2KON A;  1NHI A;  2O1W A;  1XXE A;  2EMA A;  5KL3 A;  4FN5 A;  2EQ0 A;  1EH8 A;  1UDS A;  3P06 A;  1MG7 A;  1H7U A;  3QT7 A;  5KL2 A;  4J3D A;  1XMO I;  4LF8 I;  4XTJ A;  1J5E E;  2JE6 B;  2WP8 A;  1MGT A;  4R2S A;  2YTQ A;  1Z59 A;  5JEA B;  2V8Q B;  4IFD C;  3TQM A;  1UDQ A;  2UUB E;  4U3B A;  1ZAA C;  1BKN A;  2EMF A;  2EQ1 A;  2EMH A;  2EN7 A;  2EPK X;  4BS9 A;  4DU8 A;  2C37 B;  2HFS A;  1Z5C A;  2O1U A;  2X36 A;  5AC5 A;  4IFD E;  4I8O A;  4DV3 I;  4NZV A;  3QT8 A;  4FW3 A;  5DNY A;  2EOO A;  2YTI A;  1S16 A;  3BF2 A;  2ELY A;  2CVE A;  4LF5 E;  2ZBK B;  2V88 A;  5AE1 A;  3H1C A;  3ZKB A;  4O24 A;  4DR7 E;  4O5G A;  2UXC E;  1YYW A;  2EJ4 A;  2JOX A;  1R6M A;  3HQ1 A;  1FJG E;  2Z5C A;  2IES A;  4M30 A;  4NXN I;  2EPL X;  2N3G A;  1DGC A;  3M85 D;  2V2V A;  2WW4 A;  2WCC 3;  2JYA A;  2EZ6 A;  3M85 G;  3T1Y I;  4JI3 I;  2HC5 A;  1QU6 A;  4LF4 E;  1SFE A;  2O3Z A;  4WXD A;  2EN3 A;  4TUG A;  1X3C A;  4ZYH A;  2YWQ A;  1X5W A;  5AAS A;  3J7Y p;  1T39 A;  3L7Z A;  2YSP A;  4N3O A;  4DXL A;  4B3T E;  3ADI A;  4OO1 F;  5JEA C;  1PKP A;  1QZR A;  1Z0C A;  2PO0 A;  1RMD A;  4QNJ A;  2VES A;  4LTY A;  1FWK A;  1B62 A;  4DPY A;  4NHR A;  2YZT A;  4R8O A;  1K47 A;  4JI1 I;  4BA1 A;  5JEA E;  2J7K A;  3PS1 A;  2ENA A;  2LTR A;  4LFB I;  2M7Q A;  4HAC B;  4IJD A;  5DRQ A;  1T4L B;  3F6H A;  1HNZ I;  2V2Q A;  3U1K A;  3AV0 A;  3HPZ A;  2YTD A;  4FK5 C;  2EM0 A;  1X6F A;  2EOM A;  4GKK E;  5DRO A;  3ZZU A;  3ZOQ B;  1TF6 A;  2DIX A;  2EMB A;  3ZZT A;  5DRP A;  2OI2 A;  4DPX A;  3ADL A;  1ZBT A;  5LMN I;  4GKJ I;  1N33 E;  4DV0 I;  2DMY A;  1Z1B A;  2YTO A;  4U3D A;  2V85 A;  3JAM C;  1IMU A;  4Q28 A;  1WUU A;  2EMX A;  2V34 A;  5GMD A;  4JV5 I;  2EP3 A;  2ENC A;  4WPY A;  4DKK A;  5DRR A;  4ED4 A;  1KTV A;  1PJT A;  4UT4 A;  1STU A;  5ELW A;  1AH5 A;  4YY3 E;  4R2P A;  5LL6 R;  1IBL I;  2EPC A;  1A1F A;  2R1F A;  3WU5 A;  3EQ1 A;  2BR2 B;  2GO4 A;  2UXD I;  2LUQ A;  2L33 A;  4JI7 I;  5F3W A;  3KWR A;  2PNZ A;  4TUI A;  2R42 A;  2JWO A;  3C4B A;  1A1J A;  2I13 A;  1RRE A;  1Z0E A;  2JEA B;  2CG9 A;  3C6K A;  2C39 A;  4IS1 C;  1J26 A;  3B4T A;  4JI3 E;  2EMW A;  1EKZ A;  4DR3 I;  5DNX A;  2F1D A;  1B69 A;  2M9A A;  2NN6 E;  5AC4 A;  2EOZ A;  2L3C A;  4F6N A;  1KJK A;  2WNR A;  4LF6 I;  1WRJ A;  4DR4 E;  1EA6 A;  4ZVI A;  1YUI A;  2N8X A;  4LF7 I;  3U1Y A;  2HFU A;  5K36 E;  2HK2 A;  4M0V A;  4DV2 I;  2BA1 D;  2EOI A;  4WUB A;  1HNW E;  3J81 C;  1Y5Y A;  5LMU I;  2UU9 I;  4PRX A;  1A1K A;  2BA1 G;  2EE8 A;  2EM8 A;  1RHY A;  1UHZ A;  4OX9 I;  3BID A;  2WP8 B;  5IT9 Q;  4WSG A;  4X66 E;  4JI2 I;  2J7J A;  1GZ6 A;  1LLM C;  4DR1 E;  1DI2 A;  2Z5B A;  3J80 C;  4PRV A;  3OML A;  3L00 A;  4JI6 E;  3JTZ A;  2BB8 A;  2LBS B;  4X65 I;  2V2Z A;  3V5R A;  2ZM6 E;  4X62 I;  4LFC I;  3GLL A;  2EM5 A;  5EKW A;  1H72 C;  3HXL A;  3QT6 A;  1IBM E;  2GS8 A;  1NHH A;  4MLQ A;  3THO B;  1OYR A;  1PVG A;  1ZM3 A;  1N34 I;  1ZM4 A;  2DRP A;  2YTE A;  2G7H A;  2EN8 A;  4DR5 I;  2EM6 A;  1UIL A;  1FKA E;  2CZ9 A;  4BCA A;  1N36 E;  1A1G A;  2B9D A;  2CPN A;  4R2C A;  4X64 I;  1X48 A;  4IZK A;  2LV2 A;  3EPJ A;  1ZXM A;  4JI4 I;  4GEQ B;  2DLK A;  1I94 I;  2VQF E;  4I3H A;  2L2K B;  1XNQ E;  1N32 I;  3KZY A;  4KHP I;  2EWL A;  2UXD E;  2K4V A;  5LLQ A;  3V2U C;  2PNM A;  3PYD A;  4X8W A;  1Z5A A;  5C0X F;  4JYA I;  4MYU A;  1RC7 A;  2E1M A;  5IWA E;  1FI4 A;  2UUC E;  1OYS A;  1NEI A;  2PO0 B;  2RS6 A;  4L5N C;  3IWD A;  1XNR I;  1ZM9 A;  4WUC A;  4BA1 B;  4LF7 E;  2HK3 A;  4MU0 A;  4MU4 A;  5KL5 A;  1Z0B A;  1RR9 A;  1EI1 A;  4DR6 I;  4B3R E;  4DV4 E;  3P3C A;  4DV7 E;  2LTS A;  3PS2 A;  1N3G A;  2O1T A;  4URL A;  4N4R B;  2BA0 D;  3PS3 A;  4KWY A;  4IZJ A;  4LF9 I;  1YYK A;  4RPF A;  4OOG C;  5FLX Q;  2BA0 G;  2EM9 A;  5EL9 A;  4JI0 E;  4JI2 E;  2ENH A;  3T1H E;  3CDJ A;  3K1J A;  4M2Z A;  1U2R A;  2JEB A;  4OO1 A;  2GHF A;  4X65 E;  1AAY A;  1USU A;  4FW4 A;  5A2Q Q;  4WFT A;  1HR0 I;  1T4N A;  3LML A;  3ADJ A;  4B3S E;  4WUD A;  1E3P A;  4DPW A;  4B3M I;  2EMY A;  1P42 A;  4AID A;  1GTK A;  2R76 A;  2EML A;  3P3G A;  4JI5 I;  3VYY A;  3HTX A;  2F4V E;  2PNZ B;  2YSO A;  4MU1 A;  1H74 A;  3B78 A;  5BR8 E;  1YHC A;  4FWD A;  4P52 A;  4OZE A;  4DV5 I;  2PO1 A;  2IOP A;  2NN6 B;  2GQ0 A;  1RQ0 A;  4IZJ D;  3J7A M;  2I9I A;  2HKJ A;  1EH7 A;  4DV1 I;  3ZZ0 A;  5K36 B;  2EOH A;  4R2D A;  1G2D C;  2PO2 A;  3LPS A;  1X6H A;  4ZYD A;  4DU7 A;  5KL7 A;  3MHS C;  4OO1 D;  1HK7 A;  1IQO A;  3GME A;  3EPK A;  2EPM X;  1BBO A;  2B7T A;  2E5L I;  1IBK I;  1XMO E;  4LF8 E;  4F2J C;  4AQY I;  1WJP A;  2VE7 C;  1NZ0 A;  2Q8U A;  2H36 X;  2RTX A;  2JR1 A;  2EOF A;  2BM1 A;  1Z0T A;  2UXB I;  1E3H A;  3M6A A;  3Q6N A;  2LE2 A;  2VRD A;  1A1L A;  2Z5B B;  2NUF A;  2YU5 A;  4WYQ B;  4DV3 E;  4DR6 E;  3NZK A;  2AJ4 A;  3QT5 A;  2DLQ A;  3PYF A;  1VI7 A;  2VQE I;  3AUZ A;  5A6J A;  4O43 A;  2DGC A;  5A6B A;  2A2C A;  1ZR9 A;  3WU4 A;  1X49 A;  4JI8 I;  5C0X A;  2NN6 C;  5FWK A;  3K85 A;  4NXN E;  4DR2 I;  5CFF E;  2BBG A;  3FIG A;  3P3E A;  3F6G A;  1F2I G;  3HJC A;  4NBQ A;  5K36 C;  2LUP B;  2LMZ A;  5IT9 C;  2EM3 A;  3T1Y E;  3VYX A;  2AE8 A;  4KQV A;  4LFA I;  1FNM A;  3HPS A;  4FWH A;  4MDT A;  3H4L A;  4K0K I;  4FW5 A;  4IFD F;  2EN6 A;  4WSP A;  5KL4 A;  1O0W A;  1Z0V A;  4FW9 A;  4IZK B;  2LVH A;  2HHH I;  2EPP A;  2WBS A;  2O1V A;  4YHH I;  1WXR A;  1HNX I;  1PJQ A;  1KYQ A;  4R03 A;  4P7A A;  4BC9 A;  4M9V C;  1YZ9 A;  2L6M A;  2V8P A;  2A2D A;  1DQ3 A;  2FTX B;  4HEI A;  1PJS A;  2ADR A;  2EOJ A;  3B8H A;  4USK A;  3D4J A;  1Z0W A;  5A6B D;  1KKH A;  2EM4 A;  2EOE A;  2UUA I;  4JI1 E;  3DF6 A;  2YTP A;  5C0X D;  1J5E I;  1D6T A;  3F0N A;  2LRS A;  2EOX A;  3JAM Q;  4LFB E;  1DAR A;  2LJP A;  1ELO A;  2IHR 1;  1HNZ E;  2MC6 A;  1A1I A;  2CT1 A;  2EN4 A;  5IXM B;  4EMD A;  1TN9 A;  2E5L E;  3P1X A;  1ZU1 A;  2CSH A;  2EOS A;  2N3H A;  2KOU A;  2LT7 A;  3M7N D;  2DEI A;  4DUY I;  2VF3 A;  4MYT A;  3K6Q A;  5LMN E;  2HJJ A;  4GKJ E;  1BBG A;  4IZJ B;  4DV0 E;  2EL5 A;  4LF5 I;  4NXM I;  2Z5C B;  3M7N G;  1YPN A;  2UXB E;  4DR7 I;  1GQE A;  2V83 A;  5JEA F;  3PYE A;  1FJG I;  4JV5 E;  4O4K A;  2X7I A;  3OTO I;  4FW7 A;  1OJ4 A;  5A69 A;  2E1R A;  5A6A A;  2MKD A;  2JPA A;  4OO1 B;  2ODR D;  3J7A G;  3UK3 C;  1PIE A;  3C4T A;  2JY9 A;  5DNL A;  4MLV A;  2VQE E;  1N0V C;  4HY1 A;  1IBL E;  3L7Z B;  2EM2 A;  2IOQ A;  4JI7 E;  2EMI A;  2L3J A;  2NAB A;  4WX9 A;  2MKN A;  3J81 Q;  1SR9 A;  2EN1 A;  4MU3 A;  2JXP A;  2YTN A;  3Q6M A;  4USM A;  2DSY A;  3THN A;  4DR3 E;  1KIJ A;  1ZXN A;  2PO1 B;  2KHX A;  4F54 A;  3KRN A;  4J8Z A;  4Q35 B;  2EPR A;  4R1F A;  3ECR A;  1IQS A;  2Q2E B;  4LF6 E;  2BM0 A;  1A6F A;  2C38 A;  2HHH E;  1XMQ I;  2EOQ A;  3J80 Q;  4R2Q A;  4DV2 E;  3LTO A;  3KZZ A;  4FWG A;  2M1S A;  4DMI A;  4R2R A;  5LMU E;  2HGH A;  2UU9 E;  1NCS A;  3BBG A;  3C6M A;  2L8T A;  2L92 A;  5T6J A;  4GKK I;  4OX9 E;  4RH8 A;  5AE3 A;  2V89 A;  2UUA E;  2YRM A;  4P7D A;  1G2F C;  2EPU A;  2Z5E A;  1TF3 A;  4OO1 C;  2EM7 A;  3MHH C;  2NN6 F;  1N33 I;  2EPX A;  2DMI A;  2EOY A;  5IV8 B;  4LPF A;  4LCF A;  4IFD A;  4BHC A;  1YYO A;  3HKM A;  5K36 F;  1EH6 A;  4X62 E;  4LFC E;  3B82 A;  1B63 A;  3VK6 A;  1USV A;  2XEX A;  4JG4 A;  4OO1 E;  1Z0G A;  1UN6 B;  4F9B B;  1Y4S A;  1N34 E;  1UBD C;  2J65 A;  2ZIT A;  2CTD A;  4DUY E;  4YY3 I;  3EPL A;  4RHB B;  5C0X B;  4NXM E;  2YPN A;  4DR5 E;  1QNT A;  2EMK A;  1BB8 A;  3H09 A;  2CGE A;  4P78 A;  2C39 B;  3OTO E;  2V86 A;  2PRT A;  2EL4 A;  4X64 E;  2BV3 A;  4BA2 A;  2MC5 A;  2YRK A;  4UTG A;  2RSM A;  4JI4 E;  2WNR B;  4BBY A;  1I94 E;  2LCE A;  2RQL A;  2EFG A;  1N32 E;  2EL6 A;  2EOR A;  4KHP E;  1Y4U A;  2EPZ A;  4QNK A;  4DR4 I;  2RS7 A;  4IFD D;  2WZO A;  2DB2 A;  2ELZ A;  4BMJ A;  4JYA E;  2IER A;  3ZM7 A;  2YT4 A;  4DPT A;  1HNW I;  2K7I A;  2MDG A;  4ZYG A;  4BHB A;  2JE6 A;  4HXZ A;  5AE2 A;  4WXC A;  4F9C B;  1XNR E;  3K17 A;  1WHQ A;  2A25 A;  5JEA A;  4LCG A;  3GON A;  2JT2 A;  1WHN A;  4KZS A;  5TSE A;  2NA2 A;  1XMQ E;  1MEY C;  1YUJ A;  4X66 I;  2L2M A;  2B7V A;  3RMP A;  2LJH A;  3ADG A;  2C37 A;  3WU6 A;  4DR1 I;  3DD6 A;  2V87 A;  1Y60 A;  4JI6 I;  3EPH A;  1YH8 A;  5C0X C;  4X9J A;  4DUZ I;  2ZM6 I;  2FGG A;  1MX0 A;  2B3T B;  4LF9 E;  2M4I A;  2L2N A;  3GCM A;  2WBT A;  1H73 A;  1L4S A;  2EPA A;  1IBM I;  3Q1Q A;  1VIS A;  1Z5B A;  3IWB A;  5C0X E;  1X47 A;  3DJW A;  2RSI A;  4MQY A;  4DV6 I;  3JU0 A;  2EMG A;  2NUE A;  3WU3 A;  1YSA C;  1ZBQ A;  3MSW A;  2LO3 A;  4BC7 A;  1HR0 E;  2JP9 A;  1N36 I;  2JVA A;  5JEA D;  4HTG A;  2YTJ A;  1PDA A;  2PNL A;  4PU9 A;  4B3M E;  4AM3 A;  3HUL A;  2EPO A;  2GO3 A;  4R2E A;  2MDR A;  4OKG A;  5A6K A;  3P76 A;  2F8B A;  1H7S A;  4FW6 A;  2VQF I;  4JI5 E;  1XNQ I;  2GPI A;  5L3J A;  1P47 A;  1X6E A;  4GZN C;  2ODR C;  1FWL A;  3LNU A;  3LLH A;  1UDN A;  4DV5 E;  4ISA A;  4R2A A;  2VF1 A;  2E72 A;  2EMC A;  1OYP A;  3CWV A;  4IS9 A;  5IWA I;  4F6M A;  4DV1 E;  2NN6 A;  2UUC I;  2NUG A;  3PRY A;  4LOM A;  4M1K A;  3VHT B;  3BGH A;  5K36 A;  2UUB I;  1XHK A;  3M99 B;  1YFH A;  1NHJ A;  2C38 B;  2HKE A;  2NPF A;  3UHM A;  4HAC A;  4L8N A;  2EPN A;  4Z7C A;  2FV4 B;  2LJU A;  4F9A B;  4ZYE A;  5GME A;  4GQU A;  1IBK E;  1S4E A;  1Y6Z A;  4AQY E;  4B3R I;  4DV4 I;  2GLI A;  4DV7 I;  2RPC A;  2YU8 A;  2EN2 A;  1T38 A;  3CDI A;  2UXC I;  3QG5 C;  2EQ3 A;  1ZM2 A;  1JK2 A;  4JI0 I;  2YTF A;  2YTG A;  1KVK A;  2JEB B;  4IFD B;  3T1H I;  2NN6 D;  4LU9 A;  4HYM A;  4Z7Y A;  4LF4 I;  2YRH A;  4BA2 B;  2JOB A;  2D9H A;  1N0U A;  1MU5 A;  4DUZ E;  5K36 D;  2DEJ A;  1UEK A;  1R6L A;  4B3S I;  4JI8 E;  4LCH A;  2WBU A;  2BR2 A;  4DR2 E;  1T4O A;  3PYG A;  4B3T I;  2EMZ A;  1JK1 A;  5FLX C;  4AIM A;  2JEA A;  3ZKD A;  2F4V I;  4LFA E;  4DV6 E;  1UDO A;  4K0K E;  2R3V A;  5BR8 I;  4DPU A;  1A1H A;  2PO2 B;  3IWC A; 
#chains in the Genus database with same CATH homology
 5A2Q C;  4YHH E;  5ADZ A;  1HNX E;  2KON A;  1NHI A;  2O1W A;  4FN5 A;  3P06 A;  1MG7 A;  1H7U A;  3QT7 A;  1XMO I;  4LF8 I;  4XTJ A;  1J5E E;  1Z59 A;  2V8Q B;  2UUB E;  1BKN A;  4BS9 A;  4DU8 A;  2HFS A;  1Z5C A;  2O1U A;  2X36 A;  4I8O A;  4DV3 I;  3QT8 A;  5DNY A;  1S16 A;  3ZKB A;  4LF5 E;  2ZBK B;  2V88 A;  5AE1 A;  4DR7 E;  2UXC E;  1YYW A;  2JOX A;  2Z5C A;  3HQ1 A;  1FJG E;  4NXN I;  4M30 A;  2N3G A;  2V2V A;  2WW4 A;  3T1Y I;  4JI3 I;  2EZ6 A;  1QU6 A;  4LF4 E;  4TUG A;  5AAS A;  3J7Y p;  4N3O A;  4DXL A;  4B3T E;  3ADI A;  1PKP A;  1QZR A;  1Z0C A;  4LTY A;  1FWK A;  1B62 A;  4DPY A;  2YZT A;  4R8O A;  1K47 A;  4JI1 I;  2J7K A;  2LTR A;  4LFB I;  2M7Q A;  4HAC B;  1T4L B;  3F6H A;  1HNZ I;  2V2Q A;  3AV0 A;  3HPZ A;  4GKK E;  3ZZU A;  3ZOQ B;  2DIX A;  3ZZT A;  2OI2 A;  4DPX A;  3ADL A;  1ZBT A;  5LMN I;  4GKJ I;  1N33 E;  4DV0 I;  2DMY A;  2V85 A;  3JAM C;  1WUU A;  4Q28 A;  2V34 A;  5GMD A;  4JV5 I;  4DKK A;  4WPY A;  4ED4 A;  1KTV A;  4UT4 A;  1STU A;  4YY3 E;  5LL6 R;  1IBL I;  3WU5 A;  2UXD I;  2LUQ A;  2L33 A;  4JI7 I;  5F3W A;  3KWR A;  4TUI A;  2R42 A;  2JWO A;  3C4B A;  1RRE A;  1Z0E A;  2CG9 A;  1J26 A;  4JI3 E;  1EKZ A;  4DR3 I;  2L3C A;  4LF6 I;  1EA6 A;  4DR4 E;  4ZVI A;  4LF7 I;  2HFU A;  2HK2 A;  4M0V A;  4DV2 I;  4WUB A;  1HNW E;  3J81 C;  5LMU I;  2UU9 I;  4PRX A;  1UHZ A;  4OX9 I;  5IT9 Q;  4X66 E;  4JI2 I;  1GZ6 A;  4DR1 E;  1DI2 A;  2Z5B A;  3J80 C;  4PRV A;  3OML A;  4JI6 E;  3JTZ A;  2LBS B;  4X65 I;  2V2Z A;  3V5R A;  2ZM6 E;  4X62 I;  4LFC I;  1H72 C;  3HXL A;  3QT6 A;  1IBM E;  2GS8 A;  1NHH A;  1PVG A;  1ZM3 A;  1N34 I;  1ZM4 A;  2G7H A;  4DR5 I;  1UIL A;  1FKA E;  2CZ9 A;  4BCA A;  1N36 E;  2B9D A;  2CPN A;  4X64 I;  1X48 A;  4IZK A;  1ZXM A;  4JI4 I;  4GEQ B;  1I94 I;  2VQF E;  4I3H A;  2L2K B;  1XNQ E;  1N32 I;  4KHP I;  2EWL A;  2UXD E;  2K4V A;  3V2U C;  2PNM A;  3PYD A;  4X8W A;  1Z5A A;  4JYA I;  4MYU A;  1RC7 A;  2E1M A;  5IWA E;  1FI4 A;  2UUC E;  2RS6 A;  4L5N C;  3IWD A;  1XNR I;  1ZM9 A;  4WUC A;  4LF7 E;  2HK3 A;  1Z0B A;  1RR9 A;  1EI1 A;  4DR6 I;  4B3R E;  4DV4 E;  4DV7 E;  2LTS A;  2O1T A;  4URL A;  4IZJ A;  4LF9 I;  1YYK A;  4RPF A;  4OOG C;  5FLX Q;  4JI0 E;  4JI2 E;  3T1H E;  3K1J A;  4M2Z A;  1U2R A;  4X65 E;  5A2Q Q;  1USU A;  1HR0 I;  4WFT A;  1T4N A;  3LML A;  3ADJ A;  4B3S E;  4WUD A;  4DPW A;  4B3M I;  4JI5 I;  3VYY A;  3HTX A;  2F4V E;  1H74 A;  3B78 A;  5BR8 E;  4FWD A;  4P52 A;  4DV5 I;  2IOP A;  2GQ0 A;  1RQ0 A;  4IZJ D;  3J7A M;  2HKJ A;  4DV1 I;  3ZZ0 A;  3LPS A;  4DU7 A;  1HK7 A;  2B7T A;  2E5L I;  1IBK I;  1XMO E;  4LF8 E;  4AQY I;  2VE7 C;  1NZ0 A;  2H36 X;  2RTX A;  2JR1 A;  2BM1 A;  1Z0T A;  2UXB I;  3M6A A;  3Q6N A;  2LE2 A;  2Z5B B;  2NUF A;  4WYQ B;  4DV3 E;  4DR6 E;  2AJ4 A;  3QT5 A;  3PYF A;  2VQE I;  3AUZ A;  2A2C A;  3WU4 A;  1X49 A;  4JI8 I;  5FWK A;  3K85 A;  4NXN E;  4DR2 I;  5CFF E;  3FIG A;  3F6G A;  3HJC A;  2LUP B;  2LMZ A;  5IT9 C;  3T1Y E;  3VYX A;  4KQV A;  4LFA I;  1FNM A;  3HPS A;  4FWH A;  4K0K I;  3H4L A;  1Z0V A;  4WSP A;  4FW9 A;  1O0W A;  2HHH I;  4IZK B;  2O1V A;  4YHH I;  1WXR A;  1HNX I;  4R03 A;  4P7A A;  4BC9 A;  1YZ9 A;  2V8P A;  2L6M A;  2A2D A;  1DQ3 A;  2FTX B;  3B8H A;  4USK A;  3D4J A;  1Z0W A;  1KKH A;  2UUA I;  4JI1 E;  3DF6 A;  1J5E I;  1D6T A;  3F0N A;  2LRS A;  3JAM Q;  4LFB E;  1DAR A;  2LJP A;  1ELO A;  2IHR 1;  1HNZ E;  2MC6 A;  4EMD A;  2E5L E;  3P1X A;  2N3H A;  2KOU A;  2DEI A;  4DUY I;  2VF3 A;  4MYT A;  3K6Q A;  5LMN E;  4GKJ E;  4IZJ B;  4DV0 E;  4LF5 I;  4NXM I;  2Z5C B;  2UXB E;  4DR7 I;  1GQE A;  2V83 A;  3PYE A;  1FJG I;  4JV5 E;  2X7I A;  3OTO I;  1OJ4 A;  2E1R A;  2ODR D;  3J7A G;  1PIE A;  3C4T A;  2JY9 A;  2VQE E;  1N0V C;  4HY1 A;  1IBL E;  2IOQ A;  4JI7 E;  2L3J A;  3J81 Q;  1SR9 A;  3Q6M A;  4USM A;  2DSY A;  1KIJ A;  4DR3 E;  1ZXN A;  2KHX A;  4F54 A;  4R1F A;  4J8Z A;  2Q2E B;  4LF6 E;  2BM0 A;  1A6F A;  1XMQ I;  2HHH E;  3J80 Q;  4DV2 E;  3LTO A;  4FWG A;  2M1S A;  4DMI A;  5LMU E;  2UU9 E;  2L8T A;  2L92 A;  5T6J A;  4GKK I;  4OX9 E;  5AE3 A;  2V89 A;  2UUA E;  4P7D A;  2Z5E A;  1N33 I;  1YYO A;  4X62 E;  4LFC E;  3B82 A;  1B63 A;  3VK6 A;  1USV A;  2XEX A;  4JG4 A;  1Z0G A;  4F9B B;  1Y4S A;  1N34 E;  2ZIT A;  4DUY E;  4YY3 I;  4NXM E;  4DR5 E;  3H09 A;  2CGE A;  4P78 A;  3OTO E;  2V86 A;  4X64 E;  2BV3 A;  2MC5 A;  4UTG A;  2RSM A;  4JI4 E;  4BBY A;  1I94 E;  2EFG A;  1N32 E;  4KHP E;  1Y4U A;  4DR4 I;  2RS7 A;  2WZO A;  2DB2 A;  4BMJ A;  4JYA E;  3ZM7 A;  4DPT A;  2YT4 A;  1HNW I;  4HXZ A;  5AE2 A;  4F9C B;  1XNR E;  3K17 A;  1WHQ A;  3GON A;  1WHN A;  4KZS A;  2NA2 A;  1XMQ E;  4X66 I;  2L2M A;  2B7V A;  3RMP A;  2LJH A;  3ADG A;  3WU6 A;  4DR1 I;  2V87 A;  4JI6 I;  4DUZ I;  2ZM6 I;  2FGG A;  1MX0 A;  2B3T B;  4LF9 E;  2M4I A;  2L2N A;  1H73 A;  1IBM I;  3Q1Q A;  1VIS A;  1Z5B A;  3IWB A;  1X47 A;  3DJW A;  4DV6 I;  3JU0 A;  2NUE A;  3WU3 A;  1ZBQ A;  3MSW A;  1HR0 E;  4BC7 A;  1N36 I;  2JVA A;  2PNL A;  4PU9 A;  4B3M E;  3HUL A;  2MDR A;  2F8B A;  1H7S A;  2VQF I;  4JI5 E;  1XNQ I;  5L3J A;  1FWL A;  2ODR C;  3LNU A;  3LLH A;  4DV5 E;  2VF1 A;  3CWV A;  5IWA I;  2UUC I;  4DV1 E;  2NUG A;  3PRY A;  4M1K A;  2UUB I;  1XHK A;  1NHJ A;  2HKE A;  2NPF A;  4HAC A;  4L8N A;  4Z7C A;  2FV4 B;  4F9A B;  5GME A;  1IBK E;  1S4E A;  1Y6Z A;  4AQY E;  4B3R I;  4DV4 I;  4DV7 I;  2UXC I;  1ZM2 A;  4JI0 I;  1KVK A;  3T1H I;  4HYM A;  4LU9 A;  4Z7Y A;  4LF4 I;  2JOB A;  1N0U A;  1MU5 A;  4DUZ E;  2DEJ A;  1UEK A;  4B3S I;  4JI8 E;  4DR2 E;  1T4O A;  3PYG A;  4B3T I;  5FLX C;  3ZKD A;  2F4V I;  4LFA E;  4DV6 E;  4K0K E;  2R3V A;  5BR8 I;  4DPU A;  3IWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...