3WU6A

Oxidized e.coli lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
185
structure length
185
Chain Sequence
NENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 185
sequence length 185
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu6A01
4JI3I 4DV7E 1N32I 2ZBKB 4JI7I 1EI1A 4PU9A 1HNWI 1HNXI 4DUYI 4X64E 4LFCE 2GS8A 4HY1A 5LMNI 4USMA 5GMEA 4LFAE 1Z5AA 3PYGA 5A2QC 2A2CA 4YY3I 4UTGA 4DV1E 1ZXNA 1IBME 4KHPE 1N33I 1I94I 3ZZTA 3LTOA 4DPUA 2VQEI 2AJ4A 4X65I 4DV3E 5IWAE 4X64I 2XEXA 1U2RA 1Z59A 3HULA 4LF5E 4FWHA 2Q2EB 1PVGA 3PYDA 2V2VA 3T1HI 1KTVA 5LMUI 4DR5I 1FJGE 4LF5I 4LF6I 4X62E 4AQYE 4FWDA 4Z7YA 3OTOE 1N0UA 4NXNE 4JI4I 5BR8E 4B3SE 4WUCA 1B63A 4HYMA 3LPSA 4DR1E 1H74A 4JI0I 3ZM7A 3ZZ0A 1K47A 4B3SI 1IBKE 4JG4A 4DR1I 3WU5A 4RPFA 2HKJA 2UUCI 4EMDA 5FLXC 2E5LE 3B8HA 1Z0VA 4XTJA 2CZ9A 1HR0E 2UUBI 2HFSA 1MG7A 2X36A 1Z5BA 4B3ME 4JI3E 1B62A 2HK2A 3V2UC 1XMQI 4JI7E 1XNRI 4DU7A 3GONA 3QT5A 4JI5I 1HNWE 4DUYE 2UXDE 3B82A 1PIEA 1Z0EA 5IT9C 4USKA 5LMNE 1N0VC 4X66I 4YY3E 2X7IA 1N33E 1H73A 1I94E 1N36I 2VQEE 4X65E 2UU9E 4PRXA 2UXDI 4DV0I 1KVKA 1NHHA 4DUZI 1XMOI 1RREA 3CWVA 4DV6I 1NZ0A 5A2QQ 2ZM6I 2F4VE 3PYEA 4JI1I 4URLA 2WW4A 2UU9I 3K17A 3T1HE 1NHJA 4WUBA 5LMUE 4DR5E 4LF9E 2HKEA 4LF6E 3QT8A 2DEJA 2F4VI 3PYFA 4K0KI 1XHKA 3ZKDA 1XNQI 4GKKE 1QZRA 1MU5A 4JI4E 1ZM2A 4LF9I 4P7AA 4ED4A 4B3TE 3WU3A 2OI2A 4YHHI 4FWGA 4JI0E 3ZKBA 1Z0BA 4OX9I 4GKKI 2VQFI 2UXCI 1Z0TA 3JAMQ 1ZXMA 1A6FA 2V2QA 1ELOA 4B3TI 2E1RA 1OJ4A 4DR7E 4UT4A 2UUCE 2BM0A 1ZM3A 3J7AM 4B3RI 1IBLI 4JI6I 2UUBE 3D4JA 2A2DA 4DR2I 4DR7I 4JV5I 1Z0GA 1XMQE 1XNRE 4DXLA 4FN5A 3K1JA 4JI5E 4LF7I 1UEKA 4DU8A 4DPTA 4DV2I 4JI2I 4LF8I 4DR3I 3J80C 1NHIA 4X66E 4JYAE 1Z0WA 1HNZI 4GKJE 2BV3A 1H7SA 1EA6A 1N36E 4WUDA 4R1FA 2HHHI 4NXMI 4DV0E 4PRVA 4DV4I 4DUZE 1XMOE 4DV6E 1RR9A 4JYAI 2ZM6E 2R3VA 4GKJI 4JI1E 3M6AA 4LFBI 1N34I 3J7AG 3J81C 2J7KA 4P52A 2NPFA 4DPXA 4HXZA 3QT6A 2R42A 3QT7A 1J5EI 2UXBI 5L3JA 4K0KE 2ZITA 1XNQE 1KIJA 3T1YE 3V5RA 4KQVA 4MYTA 4M1KA 4DV7I 4YHHE 4JI8E 4OX9E 4DPYA 2VQFE 4DR4E 2UXCE 3T1YI 1H72C 1DARA 4DPWA 2UUAE 1D6TA 1S16A 1Z5CA 4LFCI 1ZM4A 4DV5E 4LFAI 4JI8I 1VISA 4HACB 4DR4I 4DV1I 1FWLA 2BM1A 2EFGA 5GMDA 1IBMI 2UUAI 4KHPI 2DEIA 2HK3A 4B3RE 4DV3I 5IWAI 1IBLE 4JI6E 1S4EA 1FWKA 4ZVIA 2VF3A 1MX0A 4DR2E 4DV5I 4JV5E 1KKHA 3WU4A 4HACA 1FI4A 4Z7CA 4LF7E 4FW9A 4I3HA 3JAMC 4DV2E 4JI2E 1FJGI 3H4LA 4LF8E 4DR3E 3F0NA 4X62I 2HFUA 3Q1QA 5FLXQ 3B78A 1HNZE 1BKNA 4AQYI 2LJPA 3OTOI 2HHHE 4NXNI 4NXME 5BR8I 4DV4E 3J80Q 3WU6A 4DR6E 1Z0CA 4MYUA 4LFBE 1ZM9A 1N34E 2V8PA 1IBKI 5IT9Q 1FNMA 4LF4E 4DR6I 3ZZUA 1J5EE 2V2ZA 1PKPA 2UXBE 5LL6R 1N32E 3J81Q 2E5LI 3LNUA 1FKAE 1WUUA 1H7UA 1HNXE 2V34A 1HR0I 4LF4I 4B3MI
chains in the Genus database with same CATH superfamily
4JI3I 4IZKA 4DV7E 1N32I 3H1CA 2ZBKB 4JI7I 1EI1A 4PU9A 1HNWI 2WP8B 1HNXI 1UDQA 4DUYI 4X64E 4LFCE 2IOPA 2GS8A 4HY1A 3M85D 3PS2A 5JEAA 5LMNI 2BA0G 4USMA 5GMEA 4LFAE 1Z5AA 3PYGA 5A2QC 2A2CA 4U3DA 3P3EA 4YY3I 4UTGA 4DV1E 1ZXNA 4U3BA 1IBME 4KHPE 1N33I 2O3ZA 1I94I 3ZZTA 3LTOA 4DPUA 4ISAA 2VQEI 2AJ4A 4X65I 3NZKA 2WP8A 4DV3E 5IWAE 4X64I 1Y4UA 2XEXA 1U2RA 1Z59A 3HULA 4LF5E 4OO1E 4FWHA 2Q2EB 1PVGA 2C37B 3PYDA 1XXEA 2V2VA 3GMEA 3T1HI 1KTVA 5LMUI 4DR5I 1FJGE 4FW5A 1HK7A 4LF5I 4LF6I 4X62E 3Q6MA 3DD6A 4AQYE 2C37A 5DROA 2GQ0A 4FW4A 4FWDA 2Z5EA 4Z7YA 3OTOE 1N0UA 4LCHA 4NXNE 4JI4I 5BR8E 4B3SE 4WUCA 1B63A 4HYMA 1R6MA 3LPSA 2IESA 2BA0D 2BR2B 4DR1E 4BA2B 1H74A 4JI0I 4FW7A 3ZM7A 3ZZ0A 1K47A 1OYRA 4OO1C 4IZJB 4B3SI 1IBKE 2CG9A 4JG4A 5EKWA 4OO1D 3M85G 4DR1I 3WU5A 4NBQA 2BR2A 4RPFA 4BA2A 1OYSA 2HKJA 4OZEA 4EMDA 2UUCI 5JEAF 5FLXC 2E5LE 3B8HA 1Z0VA 2JT2A 2CZ9A 4XTJA 2JE6A 4IZJA 1HR0E 2UUBI 2HFSA 1MG7A 2X36A 1Z5BA 4B3ME 4JI3E 1E3PA 5C0XB 3GLLA 1B62A 2Z5CA 2HK2A 3V2UC 5FWKA 1XMQI 4JI7E 1XNRI 4DU7A 2JEAB 3P3CA 5DRQA 3GONA 3QT5A 4JI5I 1HNWE 2IOQA 4DUYE 2UXDE 3L7ZB 3B82A 4OO1B 1PIEA 4IFDE 1Z0EA 5IT9C 4USKA 5LMNE 3PS1A 5C0XA 1N0VC 4X66I 3P06A 4YY3E 2JEAA 2X7IA 2JEBB 1N33E 1H73A 1I94E 1N36I 2VQEE 4X65E 1RHYA 2UU9E 4PRXA 2UXDI 1UDNA 1KVKA 1NHHA 2CVEA 4DV0I 2J65A 3L7ZA 4DUZI 4OO1A 1XMOI 1RREA 3CWVA 4DV6I 1NZ0A 3U1YA 3PS3A 5A2QQ 2ZM6I 4LPFA 5K36E 2F4VE 5C0XE 2IERA 3PYEA 4JI1I 4URLA 2WW4A 2JEBA 2UU9I 3K17A 3T1HE 2PO2B 1NHJA 4WUBA 5LMUE 4DR5E 4LF9E 2HKEA 2CGEA 4LF6E 4MU4A 2PO1B 3QT8A 2DEJA 3CDJA 3PYFA 2F4VI 4K0KI 1XHKA 4QNKA 3ZKDA 1XNQI 4GKKE 4IFDC 1QZRA 1MU5A 4IZJD 1Y4SA 4IFDD 1USUA 3M7ND 2PO2A 4JI4E 1ZM2A 3UHMA 4LF9I 2BA1D 4P7AA 4ED4A 4B3TE 2WNRB 4FW6A 1P42A 3WU3A 2OI2A 2PO1A 4FW3A 4YHHI 4FWGA 4JI0E 3ZKBA 1Z0BA 2O1VA 2C39B 4OX9I 4GKKI 2VQFI 2UXCI 1Z0TA 3CDIA 3JAMQ 1ZXMA 5K36C 5C0XC 1A6FA 2NN6A 2V2QA 1ELOA 4B3TI 1VI7A 2E1RA 2VESA 5K36D 4OKGA 5C0XD 1OJ4A 2WNRA 3HKMA 4DR7E 4UT4A 4AIDA 2UUCE 2BM0A 1ZM3A 2C39A 4GQUA 5C0XF 4MQYA 2JE6B 4IFDB 3J7AM 4B3RI 4BA1B 1IBLI 4JI6I 2UUBE 3D4JA 2A2DA 1YH8A 2NN6E 2Z5CB 4DR2I 4DR7I 4JV5I 1Z0GA 1XMQE 4MU0A 1XNRE 4OO1F 1UDSA 4DXLA 4FN5A 3K1JA 4JI5E 4LF7I 1UEKA 4DU8A 4DPTA 2Z5BB 4IFDA 4BA1A 4DV2I 4JI2I 4LF8I 5K36B 4DR3I 3J80C 1NHIA 4X66E 4JYAE 1Z0WA 2PNLA 1HNZI 4GKJE 2BV3A 1Y6ZA 1H7SA 1EA6A 2C38B 1N36E 4WUDA 3M7NG 4R1FA 2HHHI 4NXMI 2Z5BA 2BA1G 4DV0E 4PRVA 4DV4I 4DUZE 4J3DA 1XMOE 5K36A 4DV6E 1RR9A 4JYAI 2ZM6E 1YHCA 3K85A 2R3VA 4GKJI 4JI1E 3M6AA 4LFBI 2NN6C 1N34I 3J7AG 3J81C 2J7KA 2C38A 2NN6D 4P52A 2NPFA 1E3HA 4DPXA 2GO3A 4HXZA 3QT6A 2R42A 3QT7A 1J5EI 2UXBI 2NN6F 5L3JA 4K0KE 1OYPA 2ZITA 2O1TA 1XNQE 1KIJA 2GO4A 3T1YE 4QNJA 5EL9A 3V5RA 4KQVA 4MYTA 4M1KA 4DV7I 4LCFA 4YHHE 4MDTA 4JI8E 4OX9E 4DPYA 2VQFE 4DR4E 2UXCE 3T1YI 1H72C 1DARA 4DPWA 2UUAE 1D6TA 2NN6B 3B4TA 1S16A 1Z5CA 4LFCI 4LOMA 1ZM4A 4IFDF 4DV5E 4LFAI 4JI8I 5JEAE 3HJCA 1VISA 4HACB 4DR4I 4DV1I 1FWLA 2BM1A 1USVA 3GCMA 2EFGA 5GMDA 1IBMI 2UUAI 4KHPI 2DEIA 2PNZB 2HK3A 4B3RE 4DV3I 5IWAI 1IBLE 4JI6E 1S4EA 1FWKA 5DRRA 2O1UA 4ZVIA 2PO0B 2VF3A 1MX0A 4DR2E 4DV5I 4JV5E 4AM3A 1KKHA 3WU4A 5K36F 4HACA 1FI4A 4Z7CA 4LF7E 4MU1A 4FW9A 4I3HA 2PNZA 3JAMC 5ELWA 4DV2E 4JI2E 1FJGI 3H4LA 4LF8E 4DR3E 3F0NA 5DNXA 4X62I 2PO0A 2HFUA 3Q1QA 5FLXQ 3B78A 1HNZE 1BKNA 4AQYI 1UDOA 4LCGA 5JEAC 2LJPA 3OTOI 2HHHE 4NXNI 4NXME 5BR8I 3Q6NA 4DV4E 2PNMA 5JEAD 3J80Q 3WU6A 4DR6E 1Z0CA 2F1DA 1Y60A 4N3OA 4MYUA 1Y5YA 3KRNA 3PRYA 4LFBE 4AIMA 5DRPA 1ZM9A 1N34E 4MU3A 4IS9A 3P76A 2V8PA 1R6LA 3U1KA 1IBKI 5IT9Q 1FNMA 2O1WA 4LF4E 4IZKB 4DR6I 3ZZUA 1J5EE 2V2ZA 1PKPA 2UXBE 5LL6R 1N32E 3P3GA 3J81Q 2E5LI 3LNUA 1FKAE 1WUUA 1H7UA 1HNXE 2V34A 1HR0I 5DNLA 4LF4I 2AE8A 4B3MI 5JEAB
chains in the Genus database with same CATH topology
4JI3I 4IZKA 4DV7E 1N32I 2ZBKB 4JI7I 1EI1A 4PU9A 1HNWI 1HNXI 4DUYI 4X64E 4LFCE 2IOPA 2GS8A 4HY1A 5LMNI 4USMA 5GMEA 4LFAE 1Z5AA 3PYGA 5A2QC 2A2CA 4YY3I 4UTGA 4DV1E 1ZXNA 1IBME 4KHPE 1N33I 1I94I 3ZZTA 3LTOA 4DPUA 2VQEI 2AJ4A 4X65I 4DV3E 5IWAE 4X64I 1Y4UA 2XEXA 1U2RA 1Z59A 3HULA 4LF5E 4FWHA 2Q2EB 1PVGA 3PYDA 2V2VA 3T1HI 1KTVA 5LMUI 4DR5I 1FJGE 1HK7A 4LF5I 4LF6I 4X62E 3Q6MA 4AQYE 2GQ0A 4FWDA 2Z5EA 4Z7YA 3OTOE 1N0UA 4NXNE 4JI4I 5BR8E 4B3SE 4WUCA 1B63A 4HYMA 3LPSA 4DR1E 1H74A 4JI0I 3ZM7A 3ZZ0A 1K47A 4IZJB 4B3SI 1IBKE 2CG9A 4JG4A 4DR1I 3WU5A 4RPFA 2HKJA 2UUCI 4EMDA 5FLXC 2E5LE 3B8HA 1Z0VA 4XTJA 2CZ9A 4IZJA 1HR0E 2UUBI 2HFSA 1MG7A 2X36A 1Z5BA 4B3ME 4JI3E 1B62A 2Z5CA 2HK2A 3V2UC 5FWKA 1XMQI 4JI7E 1XNRI 4DU7A 3GONA 3QT5A 4JI5I 1HNWE 2IOQA 4DUYE 2UXDE 3B82A 1PIEA 1Z0EA 5IT9C 4USKA 5LMNE 1N0VC 4X66I 3P06A 4YY3E 2X7IA 1N33E 1H73A 1I94E 1N36I 2VQEE 4X65E 2UU9E 4PRXA 2UXDI 4DV0I 1KVKA 1NHHA 4DUZI 1XMOI 1RREA 3CWVA 4DV6I 1NZ0A 5A2QQ 2ZM6I 2F4VE 3PYEA 4JI1I 4URLA 2WW4A 2UU9I 3K17A 3T1HE 1NHJA 4WUBA 5LMUE 4DR5E 4LF9E 2HKEA 2CGEA 4LF6E 3QT8A 2DEJA 2F4VI 3PYFA 4K0KI 1XHKA 3ZKDA 1XNQI 4GKKE 1QZRA 1MU5A 4IZJD 1Y4SA 1USUA 4JI4E 1ZM2A 4LF9I 4P7AA 4ED4A 4B3TE 3WU3A 2OI2A 4YHHI 4FWGA 4JI0E 3ZKBA 1Z0BA 2O1VA 4OX9I 4GKKI 2VQFI 2UXCI 1Z0TA 3JAMQ 1ZXMA 1A6FA 2V2QA 1ELOA 4B3TI 2E1RA 1OJ4A 4DR7E 4UT4A 2UUCE 2BM0A 1ZM3A 3J7AM 4B3RI 1IBLI 4JI6I 2UUBE 3D4JA 2A2DA 2Z5CB 4DR2I 4DR7I 4JV5I 1Z0GA 1XMQE 1XNRE 4DXLA 4FN5A 3K1JA 4JI5E 4LF7I 1UEKA 4DU8A 4DPTA 2Z5BB 4DV2I 4JI2I 4LF8I 4DR3I 3J80C 1NHIA 4X66E 4JYAE 1Z0WA 2PNLA 1HNZI 4GKJE 2BV3A 1Y6ZA 1H7SA 1EA6A 1N36E 4WUDA 4R1FA 2HHHI 4NXMI 2Z5BA 4DV0E 4PRVA 4DV4I 4DUZE 1XMOE 4DV6E 1RR9A 4JYAI 2ZM6E 3K85A 2R3VA 4GKJI 4JI1E 3M6AA 4LFBI 1N34I 3J7AG 3J81C 2J7KA 4P52A 2NPFA 4DPXA 4HXZA 3QT6A 2R42A 3QT7A 1J5EI 2UXBI 5L3JA 4K0KE 2ZITA 2O1TA 1XNQE 1KIJA 3T1YE 3V5RA 4KQVA 4MYTA 4M1KA 4DV7I 4YHHE 4JI8E 4OX9E 4DPYA 2VQFE 4DR4E 2UXCE 3T1YI 1H72C 1DARA 4DPWA 2UUAE 1D6TA 1S16A 1Z5CA 4LFCI 1ZM4A 4DV5E 4LFAI 4JI8I 3HJCA 1VISA 4HACB 4DR4I 4DV1I 1FWLA 2BM1A 1USVA 2EFGA 5GMDA 1IBMI 2UUAI 4KHPI 2DEIA 2HK3A 4B3RE 4DV3I 5IWAI 1IBLE 4JI6E 1S4EA 1FWKA 2O1UA 4ZVIA 2VF3A 1MX0A 4DR2E 4DV5I 4JV5E 1KKHA 3WU4A 4HACA 1FI4A 4Z7CA 4LF7E 4FW9A 4I3HA 3JAMC 4DV2E 4JI2E 1FJGI 3H4LA 4LF8E 4DR3E 3F0NA 4X62I 2HFUA 3Q1QA 5FLXQ 3B78A 1HNZE 1BKNA 4AQYI 2LJPA 3OTOI 2HHHE 4NXNI 4NXME 5BR8I 3Q6NA 4DV4E 2PNMA 3J80Q 3WU6A 4DR6E 1Z0CA 4N3OA 4MYUA 3PRYA 4LFBE 1ZM9A 1N34E 2V8PA 1IBKI 5IT9Q 1FNMA 2O1WA 4LF4E 4IZKB 4DR6I 3ZZUA 1J5EE 2V2ZA 1PKPA 2UXBE 5LL6R 1N32E 3J81Q 2E5LI 3LNUA 1FKAE 1WUUA 1H7UA 1HNXE 2V34A 1HR0I 4LF4I 4B3MI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 I;  4DV7 E;  1N32 I;  2ZBK B;  4JI7 I;  1EI1 A;  4PU9 A;  1HNW I;  1HNX I;  4DUY I;  4X64 E;  4LFC E;  2GS8 A;  4HY1 A;  5LMN I;  4USM A;  5GME A;  4LFA E;  1Z5A A;  3PYG A;  5A2Q C;  2A2C A;  4YY3 I;  4UTG A;  4DV1 E;  1ZXN A;  1IBM E;  4KHP E;  1N33 I;  1I94 I;  3ZZT A;  3LTO A;  4DPU A;  2VQE I;  2AJ4 A;  4X65 I;  4DV3 E;  5IWA E;  4X64 I;  2XEX A;  1U2R A;  1Z59 A;  3HUL A;  4LF5 E;  4FWH A;  2Q2E B;  1PVG A;  3PYD A;  2V2V A;  3T1H I;  1KTV A;  5LMU I;  4DR5 I;  1FJG E;  4LF5 I;  4LF6 I;  4X62 E;  4AQY E;  4FWD A;  4Z7Y A;  3OTO E;  1N0U A;  4NXN E;  4JI4 I;  5BR8 E;  4B3S E;  4WUC A;  1B63 A;  4HYM A;  3LPS A;  4DR1 E;  1H74 A;  4JI0 I;  3ZM7 A;  3ZZ0 A;  1K47 A;  4B3S I;  1IBK E;  4JG4 A;  4DR1 I;  3WU5 A;  4RPF A;  2HKJ A;  2UUC I;  4EMD A;  5FLX C;  2E5L E;  3B8H A;  1Z0V A;  4XTJ A;  2CZ9 A;  1HR0 E;  2UUB I;  2HFS A;  1MG7 A;  2X36 A;  1Z5B A;  4B3M E;  4JI3 E;  1B62 A;  2HK2 A;  3V2U C;  1XMQ I;  4JI7 E;  1XNR I;  4DU7 A;  3GON A;  3QT5 A;  4JI5 I;  1HNW E;  4DUY E;  2UXD E;  3B82 A;  1PIE A;  1Z0E A;  5IT9 C;  4USK A;  5LMN E;  1N0V C;  4X66 I;  4YY3 E;  2X7I A;  1N33 E;  1H73 A;  1I94 E;  1N36 I;  2VQE E;  4X65 E;  2UU9 E;  4PRX A;  2UXD I;  4DV0 I;  1KVK A;  1NHH A;  4DUZ I;  1XMO I;  1RRE A;  3CWV A;  4DV6 I;  1NZ0 A;  5A2Q Q;  2ZM6 I;  2F4V E;  3PYE A;  4JI1 I;  4URL A;  2WW4 A;  2UU9 I;  3K17 A;  3T1H E;  1NHJ A;  4WUB A;  5LMU E;  4DR5 E;  4LF9 E;  2HKE A;  4LF6 E;  3QT8 A;  2DEJ A;  2F4V I;  3PYF A;  4K0K I;  1XHK A;  3ZKD A;  1XNQ I;  4GKK E;  1QZR A;  1MU5 A;  4JI4 E;  1ZM2 A;  4LF9 I;  4P7A A;  4ED4 A;  4B3T E;  3WU3 A;  2OI2 A;  4YHH I;  4FWG A;  4JI0 E;  3ZKB A;  1Z0B A;  4OX9 I;  4GKK I;  2VQF I;  2UXC I;  1Z0T A;  3JAM Q;  1ZXM A;  1A6F A;  2V2Q A;  1ELO A;  4B3T I;  2E1R A;  1OJ4 A;  4DR7 E;  4UT4 A;  2UUC E;  2BM0 A;  1ZM3 A;  3J7A M;  4B3R I;  1IBL I;  4JI6 I;  2UUB E;  3D4J A;  2A2D A;  4DR2 I;  4DR7 I;  4JV5 I;  1Z0G A;  1XMQ E;  1XNR E;  4DXL A;  4FN5 A;  3K1J A;  4JI5 E;  4LF7 I;  1UEK A;  4DU8 A;  4DPT A;  4DV2 I;  4JI2 I;  4LF8 I;  4DR3 I;  3J80 C;  1NHI A;  4X66 E;  4JYA E;  1Z0W A;  1HNZ I;  4GKJ E;  2BV3 A;  1H7S A;  1EA6 A;  1N36 E;  4WUD A;  4R1F A;  2HHH I;  4NXM I;  4DV0 E;  4PRV A;  4DV4 I;  4DUZ E;  1XMO E;  4DV6 E;  1RR9 A;  4JYA I;  2ZM6 E;  2R3V A;  4GKJ I;  4JI1 E;  3M6A A;  4LFB I;  1N34 I;  3J7A G;  3J81 C;  2J7K A;  4P52 A;  2NPF A;  4DPX A;  4HXZ A;  3QT6 A;  2R42 A;  3QT7 A;  1J5E I;  2UXB I;  5L3J A;  4K0K E;  2ZIT A;  1XNQ E;  1KIJ A;  3T1Y E;  3V5R A;  4KQV A;  4MYT A;  4M1K A;  4DV7 I;  4YHH E;  4JI8 E;  4OX9 E;  4DPY A;  2VQF E;  4DR4 E;  2UXC E;  3T1Y I;  1H72 C;  1DAR A;  4DPW A;  2UUA E;  1D6T A;  1S16 A;  1Z5C A;  4LFC I;  1ZM4 A;  4DV5 E;  4LFA I;  4JI8 I;  1VIS A;  4HAC B;  4DR4 I;  4DV1 I;  1FWL A;  2BM1 A;  2EFG A;  5GMD A;  1IBM I;  2UUA I;  4KHP I;  2DEI A;  2HK3 A;  4B3R E;  4DV3 I;  5IWA I;  1IBL E;  4JI6 E;  1S4E A;  1FWK A;  4ZVI A;  2VF3 A;  1MX0 A;  4DR2 E;  4DV5 I;  4JV5 E;  1KKH A;  3WU4 A;  4HAC A;  1FI4 A;  4Z7C A;  4LF7 E;  4FW9 A;  4I3H A;  3JAM C;  4DV2 E;  4JI2 E;  1FJG I;  3H4L A;  4LF8 E;  4DR3 E;  3F0N A;  4X62 I;  2HFU A;  3Q1Q A;  5FLX Q;  3B78 A;  1HNZ E;  1BKN A;  4AQY I;  2LJP A;  3OTO I;  2HHH E;  4NXN I;  4NXM E;  5BR8 I;  4DV4 E;  3J80 Q;  3WU6 A;  4DR6 E;  1Z0C A;  4MYU A;  4LFB E;  1ZM9 A;  1N34 E;  2V8P A;  1IBK I;  5IT9 Q;  1FNM A;  4LF4 E;  4DR6 I;  3ZZU A;  1J5E E;  2V2Z A;  1PKP A;  2UXB E;  5LL6 R;  1N32 E;  3J81 Q;  2E5L I;  3LNU A;  1FKA E;  1WUU A;  1H7U A;  1HNX E;  2V34 A;  1HR0 I;  4LF4 I;  4B3M I; 
#chains in the Genus database with same CATH topology
 4JI3 I;  4IZK A;  4DV7 E;  1N32 I;  3H1C A;  2ZBK B;  4JI7 I;  1EI1 A;  4PU9 A;  1HNW I;  2WP8 B;  1HNX I;  1UDQ A;  4DUY I;  4X64 E;  4LFC E;  2IOP A;  2GS8 A;  4HY1 A;  3M85 D;  3PS2 A;  5JEA A;  5LMN I;  2BA0 G;  4USM A;  5GME A;  4LFA E;  1Z5A A;  3PYG A;  5A2Q C;  2A2C A;  4U3D A;  3P3E A;  4YY3 I;  4UTG A;  4DV1 E;  1ZXN A;  4U3B A;  1IBM E;  4KHP E;  1N33 I;  2O3Z A;  1I94 I;  3ZZT A;  3LTO A;  4DPU A;  4ISA A;  2VQE I;  2AJ4 A;  4X65 I;  3NZK A;  2WP8 A;  4DV3 E;  5IWA E;  4X64 I;  1Y4U A;  2XEX A;  1U2R A;  1Z59 A;  3HUL A;  4LF5 E;  4OO1 E;  4FWH A;  2Q2E B;  1PVG A;  2C37 B;  3PYD A;  1XXE A;  2V2V A;  3GME A;  3T1H I;  1KTV A;  5LMU I;  4DR5 I;  1FJG E;  4FW5 A;  1HK7 A;  4LF5 I;  4LF6 I;  4X62 E;  3Q6M A;  3DD6 A;  4AQY E;  2C37 A;  5DRO A;  2GQ0 A;  4FW4 A;  4FWD A;  2Z5E A;  4Z7Y A;  3OTO E;  1N0U A;  4LCH A;  4NXN E;  4JI4 I;  5BR8 E;  4B3S E;  4WUC A;  1B63 A;  4HYM A;  1R6M A;  3LPS A;  2IES A;  2BA0 D;  2BR2 B;  4DR1 E;  4BA2 B;  1H74 A;  4JI0 I;  4FW7 A;  3ZM7 A;  3ZZ0 A;  1K47 A;  1OYR A;  4OO1 C;  4IZJ B;  4B3S I;  1IBK E;  2CG9 A;  4JG4 A;  5EKW A;  4OO1 D;  3M85 G;  4DR1 I;  3WU5 A;  4NBQ A;  2BR2 A;  4RPF A;  4BA2 A;  1OYS A;  2HKJ A;  4OZE A;  4EMD A;  2UUC I;  5JEA F;  5FLX C;  2E5L E;  3B8H A;  1Z0V A;  2JT2 A;  2CZ9 A;  4XTJ A;  2JE6 A;  4IZJ A;  1HR0 E;  2UUB I;  2HFS A;  1MG7 A;  2X36 A;  1Z5B A;  4B3M E;  4JI3 E;  1E3P A;  5C0X B;  3GLL A;  1B62 A;  2Z5C A;  2HK2 A;  3V2U C;  5FWK A;  1XMQ I;  4JI7 E;  1XNR I;  4DU7 A;  2JEA B;  3P3C A;  5DRQ A;  3GON A;  3QT5 A;  4JI5 I;  1HNW E;  2IOQ A;  4DUY E;  2UXD E;  3L7Z B;  3B82 A;  4OO1 B;  1PIE A;  4IFD E;  1Z0E A;  5IT9 C;  4USK A;  5LMN E;  3PS1 A;  5C0X A;  1N0V C;  4X66 I;  3P06 A;  4YY3 E;  2JEA A;  2X7I A;  2JEB B;  1N33 E;  1H73 A;  1I94 E;  1N36 I;  2VQE E;  4X65 E;  1RHY A;  2UU9 E;  4PRX A;  2UXD I;  1UDN A;  1KVK A;  1NHH A;  2CVE A;  4DV0 I;  2J65 A;  3L7Z A;  4DUZ I;  4OO1 A;  1XMO I;  1RRE A;  3CWV A;  4DV6 I;  1NZ0 A;  3U1Y A;  3PS3 A;  5A2Q Q;  2ZM6 I;  4LPF A;  5K36 E;  2F4V E;  5C0X E;  2IER A;  3PYE A;  4JI1 I;  4URL A;  2WW4 A;  2JEB A;  2UU9 I;  3K17 A;  3T1H E;  2PO2 B;  1NHJ A;  4WUB A;  5LMU E;  4DR5 E;  4LF9 E;  2HKE A;  2CGE A;  4LF6 E;  4MU4 A;  2PO1 B;  3QT8 A;  2DEJ A;  3CDJ A;  3PYF A;  2F4V I;  4K0K I;  1XHK A;  4QNK A;  3ZKD A;  1XNQ I;  4GKK E;  4IFD C;  1QZR A;  1MU5 A;  4IZJ D;  1Y4S A;  4IFD D;  1USU A;  3M7N D;  2PO2 A;  4JI4 E;  1ZM2 A;  3UHM A;  4LF9 I;  2BA1 D;  4P7A A;  4ED4 A;  4B3T E;  2WNR B;  4FW6 A;  1P42 A;  3WU3 A;  2OI2 A;  2PO1 A;  4FW3 A;  4YHH I;  4FWG A;  4JI0 E;  3ZKB A;  1Z0B A;  2O1V A;  2C39 B;  4OX9 I;  4GKK I;  2VQF I;  2UXC I;  1Z0T A;  3CDI A;  3JAM Q;  1ZXM A;  5K36 C;  5C0X C;  1A6F A;  2NN6 A;  2V2Q A;  1ELO A;  4B3T I;  1VI7 A;  2E1R A;  2VES A;  5K36 D;  4OKG A;  5C0X D;  1OJ4 A;  2WNR A;  3HKM A;  4DR7 E;  4UT4 A;  4AID A;  2UUC E;  2BM0 A;  1ZM3 A;  2C39 A;  4GQU A;  5C0X F;  4MQY A;  2JE6 B;  4IFD B;  3J7A M;  4B3R I;  4BA1 B;  1IBL I;  4JI6 I;  2UUB E;  3D4J A;  2A2D A;  1YH8 A;  2NN6 E;  2Z5C B;  4DR2 I;  4DR7 I;  4JV5 I;  1Z0G A;  1XMQ E;  4MU0 A;  1XNR E;  4OO1 F;  1UDS A;  4DXL A;  4FN5 A;  3K1J A;  4JI5 E;  4LF7 I;  1UEK A;  4DU8 A;  4DPT A;  2Z5B B;  4IFD A;  4BA1 A;  4DV2 I;  4JI2 I;  4LF8 I;  5K36 B;  4DR3 I;  3J80 C;  1NHI A;  4X66 E;  4JYA E;  1Z0W A;  2PNL A;  1HNZ I;  4GKJ E;  2BV3 A;  1Y6Z A;  1H7S A;  1EA6 A;  2C38 B;  1N36 E;  4WUD A;  3M7N G;  4R1F A;  2HHH I;  4NXM I;  2Z5B A;  2BA1 G;  4DV0 E;  4PRV A;  4DV4 I;  4DUZ E;  4J3D A;  1XMO E;  5K36 A;  4DV6 E;  1RR9 A;  4JYA I;  2ZM6 E;  1YHC A;  3K85 A;  2R3V A;  4GKJ I;  4JI1 E;  3M6A A;  4LFB I;  2NN6 C;  1N34 I;  3J7A G;  3J81 C;  2J7K A;  2C38 A;  2NN6 D;  4P52 A;  2NPF A;  1E3H A;  4DPX A;  2GO3 A;  4HXZ A;  3QT6 A;  2R42 A;  3QT7 A;  1J5E I;  2UXB I;  2NN6 F;  5L3J A;  4K0K E;  1OYP A;  2ZIT A;  2O1T A;  1XNQ E;  1KIJ A;  2GO4 A;  3T1Y E;  4QNJ A;  5EL9 A;  3V5R A;  4KQV A;  4MYT A;  4M1K A;  4DV7 I;  4LCF A;  4YHH E;  4MDT A;  4JI8 E;  4OX9 E;  4DPY A;  2VQF E;  4DR4 E;  2UXC E;  3T1Y I;  1H72 C;  1DAR A;  4DPW A;  2UUA E;  1D6T A;  2NN6 B;  3B4T A;  1S16 A;  1Z5C A;  4LFC I;  4LOM A;  1ZM4 A;  4IFD F;  4DV5 E;  4LFA I;  4JI8 I;  5JEA E;  3HJC A;  1VIS A;  4HAC B;  4DR4 I;  4DV1 I;  1FWL A;  2BM1 A;  1USV A;  3GCM A;  2EFG A;  5GMD A;  1IBM I;  2UUA I;  4KHP I;  2DEI A;  2PNZ B;  2HK3 A;  4B3R E;  4DV3 I;  5IWA I;  1IBL E;  4JI6 E;  1S4E A;  1FWK A;  5DRR A;  2O1U A;  4ZVI A;  2PO0 B;  2VF3 A;  1MX0 A;  4DR2 E;  4DV5 I;  4JV5 E;  4AM3 A;  1KKH A;  3WU4 A;  5K36 F;  4HAC A;  1FI4 A;  4Z7C A;  4LF7 E;  4MU1 A;  4FW9 A;  4I3H A;  2PNZ A;  3JAM C;  5ELW A;  4DV2 E;  4JI2 E;  1FJG I;  3H4L A;  4LF8 E;  4DR3 E;  3F0N A;  5DNX A;  4X62 I;  2PO0 A;  2HFU A;  3Q1Q A;  5FLX Q;  3B78 A;  1HNZ E;  1BKN A;  4AQY I;  1UDO A;  4LCG A;  5JEA C;  2LJP A;  3OTO I;  2HHH E;  4NXN I;  4NXM E;  5BR8 I;  3Q6N A;  4DV4 E;  2PNM A;  5JEA D;  3J80 Q;  3WU6 A;  4DR6 E;  1Z0C A;  2F1D A;  1Y60 A;  4N3O A;  4MYU A;  1Y5Y A;  3KRN A;  3PRY A;  4LFB E;  4AIM A;  5DRP A;  1ZM9 A;  1N34 E;  4MU3 A;  4IS9 A;  3P76 A;  2V8P A;  1R6L A;  3U1K A;  1IBK I;  5IT9 Q;  1FNM A;  2O1W A;  4LF4 E;  4IZK B;  4DR6 I;  3ZZU A;  1J5E E;  2V2Z A;  1PKP A;  2UXB E;  5LL6 R;  1N32 E;  3P3G A;  3J81 Q;  2E5L I;  3LNU A;  1FKA E;  1WUU A;  1H7U A;  1HNX E;  2V34 A;  1HR0 I;  5DNL A;  4LF4 I;  2AE8 A;  4B3M I;  5JEA B; 
#chains in the Genus database with same CATH homology
 4JI3 I;  4IZK A;  4DV7 E;  1N32 I;  2ZBK B;  4JI7 I;  1EI1 A;  4PU9 A;  1HNW I;  1HNX I;  4DUY I;  4X64 E;  4LFC E;  2IOP A;  2GS8 A;  4HY1 A;  5LMN I;  4USM A;  5GME A;  4LFA E;  1Z5A A;  3PYG A;  5A2Q C;  2A2C A;  4YY3 I;  4UTG A;  4DV1 E;  1ZXN A;  1IBM E;  4KHP E;  1N33 I;  1I94 I;  3ZZT A;  3LTO A;  4DPU A;  2VQE I;  2AJ4 A;  4X65 I;  4DV3 E;  5IWA E;  4X64 I;  1Y4U A;  2XEX A;  1U2R A;  1Z59 A;  3HUL A;  4LF5 E;  4FWH A;  2Q2E B;  1PVG A;  3PYD A;  2V2V A;  3T1H I;  1KTV A;  5LMU I;  4DR5 I;  1FJG E;  1HK7 A;  4LF5 I;  4LF6 I;  4X62 E;  3Q6M A;  4AQY E;  2GQ0 A;  4FWD A;  2Z5E A;  4Z7Y A;  3OTO E;  1N0U A;  4NXN E;  4JI4 I;  5BR8 E;  4B3S E;  4WUC A;  1B63 A;  4HYM A;  3LPS A;  4DR1 E;  1H74 A;  4JI0 I;  3ZM7 A;  3ZZ0 A;  1K47 A;  4IZJ B;  4B3S I;  1IBK E;  2CG9 A;  4JG4 A;  4DR1 I;  3WU5 A;  4RPF A;  2HKJ A;  2UUC I;  4EMD A;  5FLX C;  2E5L E;  3B8H A;  1Z0V A;  4XTJ A;  2CZ9 A;  4IZJ A;  1HR0 E;  2UUB I;  2HFS A;  1MG7 A;  2X36 A;  1Z5B A;  4B3M E;  4JI3 E;  1B62 A;  2Z5C A;  2HK2 A;  3V2U C;  5FWK A;  1XMQ I;  4JI7 E;  1XNR I;  4DU7 A;  3GON A;  3QT5 A;  4JI5 I;  1HNW E;  2IOQ A;  4DUY E;  2UXD E;  3B82 A;  1PIE A;  1Z0E A;  5IT9 C;  4USK A;  5LMN E;  1N0V C;  4X66 I;  3P06 A;  4YY3 E;  2X7I A;  1N33 E;  1H73 A;  1I94 E;  1N36 I;  2VQE E;  4X65 E;  2UU9 E;  4PRX A;  2UXD I;  4DV0 I;  1KVK A;  1NHH A;  4DUZ I;  1XMO I;  1RRE A;  3CWV A;  4DV6 I;  1NZ0 A;  5A2Q Q;  2ZM6 I;  2F4V E;  3PYE A;  4JI1 I;  4URL A;  2WW4 A;  2UU9 I;  3K17 A;  3T1H E;  1NHJ A;  4WUB A;  5LMU E;  4DR5 E;  4LF9 E;  2HKE A;  2CGE A;  4LF6 E;  3QT8 A;  2DEJ A;  2F4V I;  3PYF A;  4K0K I;  1XHK A;  3ZKD A;  1XNQ I;  4GKK E;  1QZR A;  1MU5 A;  4IZJ D;  1Y4S A;  1USU A;  4JI4 E;  1ZM2 A;  4LF9 I;  4P7A A;  4ED4 A;  4B3T E;  3WU3 A;  2OI2 A;  4YHH I;  4FWG A;  4JI0 E;  3ZKB A;  1Z0B A;  2O1V A;  4OX9 I;  4GKK I;  2VQF I;  2UXC I;  1Z0T A;  3JAM Q;  1ZXM A;  1A6F A;  2V2Q A;  1ELO A;  4B3T I;  2E1R A;  1OJ4 A;  4DR7 E;  4UT4 A;  2UUC E;  2BM0 A;  1ZM3 A;  3J7A M;  4B3R I;  1IBL I;  4JI6 I;  2UUB E;  3D4J A;  2A2D A;  2Z5C B;  4DR2 I;  4DR7 I;  4JV5 I;  1Z0G A;  1XMQ E;  1XNR E;  4DXL A;  4FN5 A;  3K1J A;  4JI5 E;  4LF7 I;  1UEK A;  4DU8 A;  4DPT A;  2Z5B B;  4DV2 I;  4JI2 I;  4LF8 I;  4DR3 I;  3J80 C;  1NHI A;  4X66 E;  4JYA E;  1Z0W A;  2PNL A;  1HNZ I;  4GKJ E;  2BV3 A;  1Y6Z A;  1H7S A;  1EA6 A;  1N36 E;  4WUD A;  4R1F A;  2HHH I;  4NXM I;  2Z5B A;  4DV0 E;  4PRV A;  4DV4 I;  4DUZ E;  1XMO E;  4DV6 E;  1RR9 A;  4JYA I;  2ZM6 E;  3K85 A;  2R3V A;  4GKJ I;  4JI1 E;  3M6A A;  4LFB I;  1N34 I;  3J7A G;  3J81 C;  2J7K A;  4P52 A;  2NPF A;  4DPX A;  4HXZ A;  3QT6 A;  2R42 A;  3QT7 A;  1J5E I;  2UXB I;  5L3J A;  4K0K E;  2ZIT A;  2O1T A;  1XNQ E;  1KIJ A;  3T1Y E;  3V5R A;  4KQV A;  4MYT A;  4M1K A;  4DV7 I;  4YHH E;  4JI8 E;  4OX9 E;  4DPY A;  2VQF E;  4DR4 E;  2UXC E;  3T1Y I;  1H72 C;  1DAR A;  4DPW A;  2UUA E;  1D6T A;  1S16 A;  1Z5C A;  4LFC I;  1ZM4 A;  4DV5 E;  4LFA I;  4JI8 I;  3HJC A;  1VIS A;  4HAC B;  4DR4 I;  4DV1 I;  1FWL A;  2BM1 A;  1USV A;  2EFG A;  5GMD A;  1IBM I;  2UUA I;  4KHP I;  2DEI A;  2HK3 A;  4B3R E;  4DV3 I;  5IWA I;  1IBL E;  4JI6 E;  1S4E A;  1FWK A;  2O1U A;  4ZVI A;  2VF3 A;  1MX0 A;  4DR2 E;  4DV5 I;  4JV5 E;  1KKH A;  3WU4 A;  4HAC A;  1FI4 A;  4Z7C A;  4LF7 E;  4FW9 A;  4I3H A;  3JAM C;  4DV2 E;  4JI2 E;  1FJG I;  3H4L A;  4LF8 E;  4DR3 E;  3F0N A;  4X62 I;  2HFU A;  3Q1Q A;  5FLX Q;  3B78 A;  1HNZ E;  1BKN A;  4AQY I;  2LJP A;  3OTO I;  2HHH E;  4NXN I;  4NXM E;  5BR8 I;  3Q6N A;  4DV4 E;  2PNM A;  3J80 Q;  3WU6 A;  4DR6 E;  1Z0C A;  4N3O A;  4MYU A;  3PRY A;  4LFB E;  1ZM9 A;  1N34 E;  2V8P A;  1IBK I;  5IT9 Q;  1FNM A;  2O1W A;  4LF4 E;  4IZK B;  4DR6 I;  3ZZU A;  1J5E E;  2V2Z A;  1PKP A;  2UXB E;  5LL6 R;  1N32 E;  3J81 Q;  2E5L I;  3LNU A;  1FKA E;  1WUU A;  1H7U A;  1HNX E;  2V34 A;  1HR0 I;  4LF4 I;  4B3M I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...