3WU6A

Oxidized e.coli lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
185
structure length
185
Chain Sequence
NENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 61
structure length 185
sequence length 185
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu6A01
4DUZI 1Z59A 4DR2E 5A2QQ 1HNXE 2R42A 1FI4A 4DV6I 1FNMA 2UU9I 1HNZE 4P52A 1MX0A 4AQYI 4B3TE 4DUYE 4DV5E 4LFBI 4B3RE 4FWDA 3M6AA 1HR0E 1EI1A 4DR7E 4Z7CA 3WU3A 5IT9C 3JAMC 3QT6A 4X65E 4DXLA 1J5EE 4I3HA 2EFGA 4MYTA 4R1FA 1ZM3A 1IBLE 3V5RA 1ELOA 3ZZUA 4JI8I 4DV1I 3CWVA 4LFAE 4LF9I 2UUBI 1H73A 4USMA 1Z0BA 1Z0GA 4Z7YA 4DR4I 2DEJA 5LMNE 1DARA 1IBKI 4HXZA 4URLA 4LF4I 4NXNI 4DV6E 4LF7I 2HFSA 2UU9E 2V2QA 4WUDA 3J81C 3B78A 1N32E 2UUCI 2BV3A 4AQYE 1PKPA 2E1RA 4JYAI 4JI1E 4JI7E 4LFBE 3D4JA 4B3SI 3WU4A 1Z0WA 1KKHA 4JV5I 4DR7I 1Z0TA 3JAMQ 3LTOA 2HK2A 4JI8E 4DV1E 1IBLI 4XTJA 4ZVIA 2UUBE 1UEKA 4FN5A 4DPYA 4YY3I 4DR4E 4JI4I 4DV4I 2CZ9A 1KIJA 1IBKE 1H7SA 3T1HI 2HKJA 1FWKA 3QT5A 4LF4E 4NXNE 1Z5AA 4P7AA 4LF7E 1HNWI 1PIEA 2ZITA 3K17A 3HULA 2UXBI 1N36E 2UXDI 2UUCE 1B62A 4FWGA 2HKEA 4K0KI 3J81Q 2UUAE 4JYAE 1N32I 4JI5I 4FWHA 4UTGA 1KTVA 2E5LE 4WUCA 4JI1I 4B3SE 2X7IA 1B63A 4JI7I 2AJ4A 1XNQE 4HACB 4JV5E 3V2UC 2VQEI 3J7AG 2F4VE 4DR1I 3ZKDA 4DV7E 2BM1A 2LJPA 4UT4A 2HFUA 1Z0CA 3LNUA 2WW4A 1ZM4A 4JI2I 3Q1QA 1MG7A 4DPTA 2ZM6I 4YY3E 4DR5I 1XMOI 4DR3I 4DV4E 4JI4E 4MYUA 1NZ0A 3J80Q 1NHJA 3T1HE 2VQFE 4PRVA 1HNWE 2UXBE 4GKJI 2UXDE 4JG4A 1Z5CA 4DV3E 4K0KE 1N36I 4GKKE 4FW9A 4JI5E 2UUAI 5A2QC 2VF3A 2HK3A 2HHHI 2E5LI 1NHIA 1RR9A 2VQEE 4DR1E 3WU5A 2DEIA 2V2VA 1XNQI 1VISA 2F4VI 5IT9Q 5LMUI 4NXMI 3QT7A 1Z0EA 4WUBA 4DV7I 2R3VA 1H7UA 4X64I 4DV2I 4JI2E 1N33E 1BKNA 4DR6I 2V2ZA 3QT8A 2V8PA 1ZM9A 4RPFA 2ZM6E 1FKAE 4DR5E 1XMOE 4DR3E 3PYDA 4B3ME 5FLXC 1A6FA 3GONA 5BR8I 1Z0VA 4JI3I 1S4EA 2VQFI 4YHHI 1I94I 4DU7A 1XNRI 2A2DA 4HYMA 2UXCI 4OX9I 4GKJE 4KHPI 1KVKA 4X66I 2V34A 3ZM7A 2Q2EB 3OTOI 4DV3I 4DU8A 4GKKI 1S16A 3ZZ0A 2X36A 2BM0A 2HHHE 4DV0I 1EA6A 4DPUA 3LPSA 1N34I 1FJGI 1WUUA 4X62I 3B8HA 5LMUE 4JI6E 4NXME 4USKA 4DPWA 4X64E 4DV2E 4DR6E 1D6TA 2A2CA 1XMQI 3T1YI 1N33I 5GMDA 3ZKBA 4LF5I 4HACA 3F0NA 1QZRA 5BR8E 2OI2A 4JI3E 4M1KA 4B3MI 5FLXQ 5LL6R 4YHHE 1FWLA 3H4LA 1I94E 1XNRE 2UXCE 4OX9E 1PVGA 4LF6E 4ED4A 4KHPE 1ZXNA 4X66E 3OTOE 5IWAE 4LF8I 3PYFA 1IBMI 4KQVA 4HY1A 4DUZE 4JI0I 5GMEA 4LFCI 1ZXMA 1N0VC 4DV0E 2J7KA 2ZBKB 1K47A 4DR2I 1N34E 1H72C 3ZZTA 1HNXI 1FJGE 3B82A 4X62E 1NHHA 4DPXA 1XHKA 3WU6A 4JI6I 1XMQE 1HNZI 3T1YE 4PU9A 1N0UA 4PRXA 3K1JA 3PYEA 5L3JA 4LF5E 4B3TI 4DUYI 4DV5I 4B3RI 1HR0I 1U2RA 4EMDA 4X65I 1J5EI 1Z5BA 2GS8A 1H74A 4LF6I 2XEXA 1RREA 4LF9E 1ZM2A 3PYGA 4LF8E 3J7AM 1OJ4A 1IBME 4LFAI 3J80C 5IWAI 1MU5A 4JI0E 4LFCE 2NPFA 5LMNI
chains in the Genus database with same CATH superfamily
2PNLA 4OO1B 4DUZI 1Z59A 2BR2B 4DR2E 5A2QQ 5ELWA 1HNXE 2R42A 2Z5CB 1FI4A 1RHYA 4DV6I 2J65A 1FNMA 2UU9I 1HNZE 4FW3A 3UHMA 4P52A 2IOPA 4J3DA 1MX0A 2CGEA 5FWKA 4AQYI 4B3TE 4DUYE 4DV5E 4LFBI 4B3RE 4FWDA 3M6AA 3K85A 4MQYA 1HR0E 1EI1A 4DR7E 4Z7CA 4QNJA 3WU3A 5IT9C 4IZJD 3JAMC 3QT6A 4X65E 4DXLA 1J5EE 2O3ZA 4I3HA 2EFGA 5DROA 4MYTA 2VESA 2AE8A 5C0XE 4R1FA 1ZM3A 1IBLE 3V5RA 1UDNA 1ELOA 3ZZUA 4IFDE 4JI8I 4DV1I 3CWVA 4LFAE 4LF9I 2UUBI 1H73A 4USMA 4IFDC 1Z0BA 1Z0GA 4Z7YA 4DR4I 2DEJA 5LMNE 1DARA 2O1WA 2NN6F 2BA0D 1E3HA 5C0XD 1IBKI 3M85G 4HXZA 4URLA 4LF4I 1UDSA 1R6LA 2JEAA 4NXNI 4IFDD 4DV6E 1HK7A 4LOMA 2NN6B 3GLLA 4LF7I 2HFSA 4BA1B 2UU9E 2V2QA 4WUDA 3J81C 3CDJA 3B78A 1N32E 2UUCI 2BV3A 3P3EA 4AQYE 1PKPA 2E1RA 4JYAI 5C0XA 4JI1E 2C37A 4JI7E 4LFBE 3D4JA 4IFDA 4B3SI 2PO0A 3WU4A 3L7ZA 1Z0WA 1KKHA 4JV5I 4DR7I 4AM3A 2GO4A 1Z0TA 2C39B 3JAMQ 3LTOA 5K36C 4LCGA 3GCMA 2HK2A 4IS9A 4JI8E 4DV1E 1IBLI 4OO1C 4XTJA 4ZVIA 3U1YA 2JEBB 3CDIA 5JEAE 3PRYA 2UUBE 1UEKA 3U1KA 4FN5A 5K36D 4DPYA 4YY3I 4DR4E 2WP8B 4JI4I 4DV4I 2O1UA 2CZ9A 1KIJA 2GQ0A 1IBKE 1H7SA 3T1HI 1R6MA 2HKJA 1FWKA 2PNZA 3QT5A 4LF4E 4NXNE 1Z5AA 4P7AA 5EKWA 4LF7E 1HNWI 1PIEA 2ZITA 3K17A 3HULA 2UXBI 2PNMA 5JEAD 1N36E 2UXDI 5K36A 2UUCE 1UDQA 1B62A 4FWGA 2HKEA 4K0KI 3J81Q 2UUAE 4JYAE 1N32I 4JI5I 4FWHA 2PO2A 4UTGA 1KTVA 4FW6A 2E5LE 4WUCA 4JI1I 1YH8A 2Z5BA 4B3SE 2X7IA 1B63A 4JI7I 2AJ4A 3Q6MA 2GO3A 1XNQE 4HACB 4JV5E 3V2UC 2VQEI 5JEAA 3J7AG 2F4VE 4FW5A 4DR1I 4BA2B 3ZKDA 4DV7E 2BM1A 2LJPA 4LPFA 4UT4A 1Y5YA 2HFUA 1Z0CA 3LNUA 2WW4A 1ZM4A 4JI2I 3Q1QA 3M7NG 2BA1G 1MG7A 3P3GA 4DPTA 2ZM6I 4YY3E 4DR5I 1Y6ZA 1XMOI 2NN6C 4DR3I 4DV4E 4IZJA 4MYUA 4JI4E 2PO1B 1NZ0A 3J80Q 4AIMA 1NHJA 1Y4UA 3T1HE 2VQFE 2C38A 4PRVA 2IESA 1HNWE 2UXBE 4GKJI 2UXDE 2JEAB 4JG4A 1Z5CA 4DV3E 1XXEA 5C0XF 4K0KE 4QNKA 1N36I 4GKKE 4FW9A 4JI5E 2Z5EA 2UUAI 5A2QC 2VF3A 1USVA 2HK3A 5C0XB 2C37B 2HHHI 2E5LI 1NHIA 1RR9A 2VQEE 5K36E 4IFDB 4DR1E 3WU5A 2DEIA 2PO0B 2V2VA 1VI7A 3L7ZB 1XNQI 1P42A 1VISA 4OO1E 2F4VI 2WNRA 3PS1A 5IT9Q 4OKGA 5LMUI 2JE6A 5DNXA 4LCFA 3PS3A 4NXMI 3QT7A 1Z0EA 4WUBA 4DV7I 2R3VA 1H7UA 1UDOA 3PS2A 4X64I 4DV2I 1OYPA 4ISAA 1BKNA 4JI2E 4DR6I 1N33E 2V2ZA 3QT8A 2V8PA 2IOQA 1ZM9A 1OYSA 3H1CA 4RPFA 2ZM6E 1FKAE 4DR5E 1XMOE 4DR3E 3PYDA 1OYRA 4B3ME 4IZKA 5FLXC 1A6FA 3GONA 5BR8I 1Z0VA 4OO1D 4JI3I 2O1VA 3M85D 1S4EA 2VQFI 4YHHI 4MDTA 1I94I 4DU7A 5DRRA 2A2DA 4HYMA 1XNRI 4OX9I 2UXCI 2PNZB 5DNLA 4GKJE 4KHPI 1KVKA 4AIDA 4X66I 2V34A 3ZM7A 2Q2EB 2WP8A 3GMEA 3OTOI 4DV3I 5K36B 4MU3A 4DU8A 4GKKI 4OO1A 1S16A 2BR2A 3ZZ0A 2X36A 3B4TA 2BM0A 2BA0G 2PO2B 5JEAF 2HHHE 2Z5CA 4DV0I 1EA6A 4DPUA 2Z5BB 3LPSA 4FW4A 1N34I 1FJGI 1WUUA 4X62I 3B8HA 5LMUE 5JEAB 4FW7A 4JI6E 4NXME 4USKA 4DPWA 4X64E 4DV2E 4DR6E 4U3BA 1D6TA 2A2CA 1XMQI 3T1YI 2NN6E 1N33I 5GMDA 3KRNA 3ZKBA 4LF5I 4HACA 3F0NA 4BA2A 1QZRA 5BR8E 2OI2A 4U3DA 2IERA 4JI3E 4IZJB 4M1KA 4B3MI 2JT2A 5FLXQ 5LL6R 4YHHE 1FWLA 3H4LA 1I94E 5EL9A 1XNRE 2UXCE 4OX9E 1E3PA 1PVGA 1Y4SA 4N3OA 4ED4A 4LF6E 4KHPE 1ZXNA 2C38B 2NN6D 5C0XC 4X66E 3OTOE 4MU4A 5IWAE 4LF8I 3HJCA 3PYFA 2PO1A 1IBMI 4KQVA 3DD6A 4HY1A 4IFDF 4DUZE 4JI0I 5GMEA 4LFCI 1ZXMA 1N0VC 3P3CA 4DV0E 2J7KA 2ZBKB 1K47A 4DR2I 2NN6A 1N34E 1H72C 3ZZTA 1HNXI 1FJGE 3B82A 4X62E 1NHHA 4BA1A 3HKMA 4OZEA 4DPXA 1XHKA 3P76A 4MU0A 3WU6A 2WNRB 4JI6I 1XMQE 2JE6B 4MU1A 3T1YE 1HNZI 4PU9A 3M7ND 1N0UA 4PRXA 3K1JA 1YHCA 3PYEA 2BA1D 5L3JA 4LF5E 4NBQA 4B3TI 4DUYI 4DV5I 2F1DA 2O1TA 4B3RI 1HR0I 2C39A 1U2RA 4EMDA 4IZKB 1USUA 4X65I 1J5EI 2CVEA 3NZKA 1Z5BA 5DRQA 1Y60A 4LCHA 5K36F 2GS8A 2JEBA 1H74A 4LF6I 2CG9A 1RREA 2XEXA 5DRPA 4LF9E 1ZM2A 3PYGA 4LF8E 4OO1F 3J7AM 1OJ4A 1IBME 4LFAI 3J80C 4GQUA 3P06A 5IWAI 1MU5A 3Q6NA 4JI0E 4LFCE 5JEAC 2NPFA 5LMNI
chains in the Genus database with same CATH topology
2PNLA 4DUZI 1Z59A 4DR2E 5A2QQ 1HNXE 2R42A 2Z5CB 1FI4A 4DV6I 1FNMA 2UU9I 1HNZE 4P52A 2IOPA 2CGEA 1MX0A 5FWKA 4AQYI 4B3TE 4DUYE 4DV5E 4LFBI 4B3RE 4FWDA 3M6AA 3K85A 1HR0E 1EI1A 4DR7E 4Z7CA 3WU3A 5IT9C 4IZJD 3JAMC 3QT6A 4X65E 4DXLA 1J5EE 4I3HA 2EFGA 4MYTA 4R1FA 1ZM3A 1IBLE 3V5RA 1ELOA 3ZZUA 4JI8I 4DV1I 3CWVA 4LFAE 4LF9I 2UUBI 1H73A 4USMA 1Z0BA 1Z0GA 4Z7YA 4DR4I 2DEJA 5LMNE 1DARA 2O1WA 1IBKI 4HXZA 4URLA 4LF4I 4NXNI 4DV6E 1HK7A 4LF7I 2HFSA 2UU9E 2V2QA 4WUDA 3J81C 3B78A 1N32E 2UUCI 2BV3A 4AQYE 1PKPA 2E1RA 4JYAI 4JI1E 4JI7E 4LFBE 3D4JA 4B3SI 3WU4A 1Z0WA 1KKHA 4JV5I 4DR7I 1Z0TA 3JAMQ 3LTOA 2HK2A 4JI8E 4DV1E 1IBLI 4XTJA 4ZVIA 3PRYA 2UUBE 1UEKA 4FN5A 4DPYA 4YY3I 4DR4E 4JI4I 4DV4I 2O1UA 2CZ9A 1KIJA 2GQ0A 1IBKE 1H7SA 3T1HI 2HKJA 1FWKA 3QT5A 4LF4E 4NXNE 1Z5AA 4P7AA 4LF7E 1HNWI 1PIEA 2ZITA 3K17A 3HULA 2UXBI 2PNMA 1N36E 2UXDI 2UUCE 1B62A 4FWGA 2HKEA 4K0KI 3J81Q 2UUAE 4JYAE 1N32I 4JI5I 4FWHA 4UTGA 1KTVA 2E5LE 4WUCA 4JI1I 2Z5BA 4B3SE 2X7IA 1B63A 4JI7I 2AJ4A 3Q6MA 1XNQE 4HACB 4JV5E 3V2UC 2VQEI 3J7AG 2F4VE 4DR1I 3ZKDA 4DV7E 2BM1A 2LJPA 4UT4A 2HFUA 1Z0CA 3LNUA 2WW4A 1ZM4A 4JI2I 3Q1QA 1MG7A 4DPTA 2ZM6I 4YY3E 4DR5I 1Y6ZA 1XMOI 4DR3I 4DV4E 4IZJA 4MYUA 4JI4E 1NZ0A 3J80Q 1NHJA 1Y4UA 3T1HE 2VQFE 4PRVA 1HNWE 2UXBE 4GKJI 2UXDE 4JG4A 1Z5CA 4DV3E 4K0KE 1N36I 4GKKE 4FW9A 4JI5E 2Z5EA 2UUAI 5A2QC 2VF3A 1USVA 2HK3A 2HHHI 2E5LI 1NHIA 1RR9A 2VQEE 4DR1E 3WU5A 2DEIA 2V2VA 1XNQI 1VISA 2F4VI 5IT9Q 5LMUI 4NXMI 3QT7A 1Z0EA 4WUBA 4DV7I 2R3VA 1H7UA 4X64I 4DV2I 4JI2E 1N33E 1BKNA 4DR6I 2V2ZA 3QT8A 2V8PA 2IOQA 1ZM9A 4RPFA 2ZM6E 1FKAE 4DR5E 1XMOE 4DR3E 3PYDA 4B3ME 4IZKA 5FLXC 1A6FA 3GONA 5BR8I 1Z0VA 4JI3I 2O1VA 1S4EA 2VQFI 4YHHI 1I94I 4DU7A 1XNRI 2A2DA 4HYMA 2UXCI 4OX9I 4GKJE 4KHPI 1KVKA 4X66I 2V34A 3ZM7A 2Q2EB 3OTOI 4DV3I 4DU8A 4GKKI 1S16A 3ZZ0A 2X36A 2BM0A 2HHHE 2Z5CA 4DV0I 1EA6A 4DPUA 2Z5BB 3LPSA 1N34I 1FJGI 1WUUA 4X62I 3B8HA 5LMUE 4JI6E 4NXME 4USKA 4DPWA 4X64E 4DV2E 4DR6E 1D6TA 2A2CA 1XMQI 3T1YI 1N33I 5GMDA 3ZKBA 4LF5I 4HACA 3F0NA 1QZRA 5BR8E 2OI2A 4JI3E 4IZJB 4M1KA 4B3MI 5FLXQ 5LL6R 4YHHE 1FWLA 3H4LA 1I94E 1XNRE 2UXCE 4OX9E 1PVGA 1Y4SA 4N3OA 4ED4A 4LF6E 4KHPE 1ZXNA 4X66E 3OTOE 5IWAE 4LF8I 3HJCA 3PYFA 1IBMI 4KQVA 4HY1A 4DUZE 4JI0I 5GMEA 4LFCI 1ZXMA 1N0VC 4DV0E 2J7KA 2ZBKB 1K47A 4DR2I 1N34E 1H72C 3ZZTA 1HNXI 1FJGE 3B82A 4X62E 1NHHA 4DPXA 1XHKA 3WU6A 4JI6I 1XMQE 1HNZI 3T1YE 4PU9A 1N0UA 4PRXA 3K1JA 3PYEA 5L3JA 4LF5E 4B3TI 4DUYI 4DV5I 2O1TA 4B3RI 1HR0I 1U2RA 4EMDA 4IZKB 1USUA 4X65I 1J5EI 1Z5BA 2GS8A 1H74A 4LF6I 2CG9A 1RREA 2XEXA 4LF9E 1ZM2A 3PYGA 4LF8E 3J7AM 1OJ4A 1IBME 4LFAI 3J80C 3P06A 5IWAI 1MU5A 3Q6NA 4JI0E 4LFCE 2NPFA 5LMNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ I;  1Z59 A;  4DR2 E;  5A2Q Q;  1HNX E;  2R42 A;  1FI4 A;  4DV6 I;  1FNM A;  2UU9 I;  1HNZ E;  4P52 A;  1MX0 A;  4AQY I;  4B3T E;  4DUY E;  4DV5 E;  4LFB I;  4B3R E;  4FWD A;  3M6A A;  1HR0 E;  1EI1 A;  4DR7 E;  4Z7C A;  3WU3 A;  5IT9 C;  3JAM C;  3QT6 A;  4X65 E;  4DXL A;  1J5E E;  4I3H A;  2EFG A;  4MYT A;  4R1F A;  1ZM3 A;  1IBL E;  3V5R A;  1ELO A;  3ZZU A;  4JI8 I;  4DV1 I;  3CWV A;  4LFA E;  4LF9 I;  2UUB I;  1H73 A;  4USM A;  1Z0B A;  1Z0G A;  4Z7Y A;  4DR4 I;  2DEJ A;  5LMN E;  1DAR A;  1IBK I;  4HXZ A;  4URL A;  4LF4 I;  4NXN I;  4DV6 E;  4LF7 I;  2HFS A;  2UU9 E;  2V2Q A;  4WUD A;  3J81 C;  3B78 A;  1N32 E;  2UUC I;  2BV3 A;  4AQY E;  1PKP A;  2E1R A;  4JYA I;  4JI1 E;  4JI7 E;  4LFB E;  3D4J A;  4B3S I;  3WU4 A;  1Z0W A;  1KKH A;  4JV5 I;  4DR7 I;  1Z0T A;  3JAM Q;  3LTO A;  2HK2 A;  4JI8 E;  4DV1 E;  1IBL I;  4XTJ A;  4ZVI A;  2UUB E;  1UEK A;  4FN5 A;  4DPY A;  4YY3 I;  4DR4 E;  4JI4 I;  4DV4 I;  2CZ9 A;  1KIJ A;  1IBK E;  1H7S A;  3T1H I;  2HKJ A;  1FWK A;  3QT5 A;  4LF4 E;  4NXN E;  1Z5A A;  4P7A A;  4LF7 E;  1HNW I;  1PIE A;  2ZIT A;  3K17 A;  3HUL A;  2UXB I;  1N36 E;  2UXD I;  2UUC E;  1B62 A;  4FWG A;  2HKE A;  4K0K I;  3J81 Q;  2UUA E;  4JYA E;  1N32 I;  4JI5 I;  4FWH A;  4UTG A;  1KTV A;  2E5L E;  4WUC A;  4JI1 I;  4B3S E;  2X7I A;  1B63 A;  4JI7 I;  2AJ4 A;  1XNQ E;  4HAC B;  4JV5 E;  3V2U C;  2VQE I;  3J7A G;  2F4V E;  4DR1 I;  3ZKD A;  4DV7 E;  2BM1 A;  2LJP A;  4UT4 A;  2HFU A;  1Z0C A;  3LNU A;  2WW4 A;  1ZM4 A;  4JI2 I;  3Q1Q A;  1MG7 A;  4DPT A;  2ZM6 I;  4YY3 E;  4DR5 I;  1XMO I;  4DR3 I;  4DV4 E;  4JI4 E;  4MYU A;  1NZ0 A;  3J80 Q;  1NHJ A;  3T1H E;  2VQF E;  4PRV A;  1HNW E;  2UXB E;  4GKJ I;  2UXD E;  4JG4 A;  1Z5C A;  4DV3 E;  4K0K E;  1N36 I;  4GKK E;  4FW9 A;  4JI5 E;  2UUA I;  5A2Q C;  2VF3 A;  2HK3 A;  2HHH I;  2E5L I;  1NHI A;  1RR9 A;  2VQE E;  4DR1 E;  3WU5 A;  2DEI A;  2V2V A;  1XNQ I;  1VIS A;  2F4V I;  5IT9 Q;  5LMU I;  4NXM I;  3QT7 A;  1Z0E A;  4WUB A;  4DV7 I;  2R3V A;  1H7U A;  4X64 I;  4DV2 I;  4JI2 E;  1N33 E;  1BKN A;  4DR6 I;  2V2Z A;  3QT8 A;  2V8P A;  1ZM9 A;  4RPF A;  2ZM6 E;  1FKA E;  4DR5 E;  1XMO E;  4DR3 E;  3PYD A;  4B3M E;  5FLX C;  1A6F A;  3GON A;  5BR8 I;  1Z0V A;  4JI3 I;  1S4E A;  2VQF I;  4YHH I;  1I94 I;  4DU7 A;  1XNR I;  2A2D A;  4HYM A;  2UXC I;  4OX9 I;  4GKJ E;  4KHP I;  1KVK A;  4X66 I;  2V34 A;  3ZM7 A;  2Q2E B;  3OTO I;  4DV3 I;  4DU8 A;  4GKK I;  1S16 A;  3ZZ0 A;  2X36 A;  2BM0 A;  2HHH E;  4DV0 I;  1EA6 A;  4DPU A;  3LPS A;  1N34 I;  1FJG I;  1WUU A;  4X62 I;  3B8H A;  5LMU E;  4JI6 E;  4NXM E;  4USK A;  4DPW A;  4X64 E;  4DV2 E;  4DR6 E;  1D6T A;  2A2C A;  1XMQ I;  3T1Y I;  1N33 I;  5GMD A;  3ZKB A;  4LF5 I;  4HAC A;  3F0N A;  1QZR A;  5BR8 E;  2OI2 A;  4JI3 E;  4M1K A;  4B3M I;  5FLX Q;  5LL6 R;  4YHH E;  1FWL A;  3H4L A;  1I94 E;  1XNR E;  2UXC E;  4OX9 E;  1PVG A;  4LF6 E;  4ED4 A;  4KHP E;  1ZXN A;  4X66 E;  3OTO E;  5IWA E;  4LF8 I;  3PYF A;  1IBM I;  4KQV A;  4HY1 A;  4DUZ E;  4JI0 I;  5GME A;  4LFC I;  1ZXM A;  1N0V C;  4DV0 E;  2J7K A;  2ZBK B;  1K47 A;  4DR2 I;  1N34 E;  1H72 C;  3ZZT A;  1HNX I;  1FJG E;  3B82 A;  4X62 E;  1NHH A;  4DPX A;  1XHK A;  3WU6 A;  4JI6 I;  1XMQ E;  1HNZ I;  3T1Y E;  4PU9 A;  1N0U A;  4PRX A;  3K1J A;  3PYE A;  5L3J A;  4LF5 E;  4B3T I;  4DUY I;  4DV5 I;  4B3R I;  1HR0 I;  1U2R A;  4EMD A;  4X65 I;  1J5E I;  1Z5B A;  2GS8 A;  1H74 A;  4LF6 I;  2XEX A;  1RRE A;  4LF9 E;  1ZM2 A;  3PYG A;  4LF8 E;  3J7A M;  1OJ4 A;  1IBM E;  4LFA I;  3J80 C;  5IWA I;  1MU5 A;  4JI0 E;  4LFC E;  2NPF A;  5LMN I; 
#chains in the Genus database with same CATH topology
 2PNL A;  4OO1 B;  4DUZ I;  1Z59 A;  2BR2 B;  4DR2 E;  5A2Q Q;  5ELW A;  1HNX E;  2R42 A;  2Z5C B;  1FI4 A;  1RHY A;  4DV6 I;  2J65 A;  1FNM A;  2UU9 I;  1HNZ E;  4FW3 A;  3UHM A;  4P52 A;  2IOP A;  4J3D A;  1MX0 A;  2CGE A;  5FWK A;  4AQY I;  4B3T E;  4DUY E;  4DV5 E;  4LFB I;  4B3R E;  4FWD A;  3M6A A;  3K85 A;  4MQY A;  1HR0 E;  1EI1 A;  4DR7 E;  4Z7C A;  4QNJ A;  3WU3 A;  5IT9 C;  4IZJ D;  3JAM C;  3QT6 A;  4X65 E;  4DXL A;  1J5E E;  2O3Z A;  4I3H A;  2EFG A;  5DRO A;  4MYT A;  2VES A;  2AE8 A;  5C0X E;  4R1F A;  1ZM3 A;  1IBL E;  3V5R A;  1UDN A;  1ELO A;  3ZZU A;  4IFD E;  4JI8 I;  4DV1 I;  3CWV A;  4LFA E;  4LF9 I;  2UUB I;  1H73 A;  4USM A;  4IFD C;  1Z0B A;  1Z0G A;  4Z7Y A;  4DR4 I;  2DEJ A;  5LMN E;  1DAR A;  2O1W A;  2NN6 F;  2BA0 D;  1E3H A;  5C0X D;  1IBK I;  3M85 G;  4HXZ A;  4URL A;  4LF4 I;  1UDS A;  1R6L A;  2JEA A;  4NXN I;  4IFD D;  4DV6 E;  1HK7 A;  4LOM A;  2NN6 B;  3GLL A;  4LF7 I;  2HFS A;  4BA1 B;  2UU9 E;  2V2Q A;  4WUD A;  3J81 C;  3CDJ A;  3B78 A;  1N32 E;  2UUC I;  2BV3 A;  3P3E A;  4AQY E;  1PKP A;  2E1R A;  4JYA I;  5C0X A;  4JI1 E;  2C37 A;  4JI7 E;  4LFB E;  3D4J A;  4IFD A;  4B3S I;  2PO0 A;  3WU4 A;  3L7Z A;  1Z0W A;  1KKH A;  4JV5 I;  4DR7 I;  4AM3 A;  2GO4 A;  1Z0T A;  2C39 B;  3JAM Q;  3LTO A;  5K36 C;  4LCG A;  3GCM A;  2HK2 A;  4IS9 A;  4JI8 E;  4DV1 E;  1IBL I;  4OO1 C;  4XTJ A;  4ZVI A;  3U1Y A;  2JEB B;  3CDI A;  5JEA E;  3PRY A;  2UUB E;  1UEK A;  3U1K A;  4FN5 A;  5K36 D;  4DPY A;  4YY3 I;  4DR4 E;  2WP8 B;  4JI4 I;  4DV4 I;  2O1U A;  2CZ9 A;  1KIJ A;  2GQ0 A;  1IBK E;  1H7S A;  3T1H I;  1R6M A;  2HKJ A;  1FWK A;  2PNZ A;  3QT5 A;  4LF4 E;  4NXN E;  1Z5A A;  4P7A A;  5EKW A;  4LF7 E;  1HNW I;  1PIE A;  2ZIT A;  3K17 A;  3HUL A;  2UXB I;  2PNM A;  5JEA D;  1N36 E;  2UXD I;  5K36 A;  2UUC E;  1UDQ A;  1B62 A;  4FWG A;  2HKE A;  4K0K I;  3J81 Q;  2UUA E;  4JYA E;  1N32 I;  4JI5 I;  4FWH A;  2PO2 A;  4UTG A;  1KTV A;  4FW6 A;  2E5L E;  4WUC A;  4JI1 I;  1YH8 A;  2Z5B A;  4B3S E;  2X7I A;  1B63 A;  4JI7 I;  2AJ4 A;  3Q6M A;  2GO3 A;  1XNQ E;  4HAC B;  4JV5 E;  3V2U C;  2VQE I;  5JEA A;  3J7A G;  2F4V E;  4FW5 A;  4DR1 I;  4BA2 B;  3ZKD A;  4DV7 E;  2BM1 A;  2LJP A;  4LPF A;  4UT4 A;  1Y5Y A;  2HFU A;  1Z0C A;  3LNU A;  2WW4 A;  1ZM4 A;  4JI2 I;  3Q1Q A;  3M7N G;  2BA1 G;  1MG7 A;  3P3G A;  4DPT A;  2ZM6 I;  4YY3 E;  4DR5 I;  1Y6Z A;  1XMO I;  2NN6 C;  4DR3 I;  4DV4 E;  4IZJ A;  4MYU A;  4JI4 E;  2PO1 B;  1NZ0 A;  3J80 Q;  4AIM A;  1NHJ A;  1Y4U A;  3T1H E;  2VQF E;  2C38 A;  4PRV A;  2IES A;  1HNW E;  2UXB E;  4GKJ I;  2UXD E;  2JEA B;  4JG4 A;  1Z5C A;  4DV3 E;  1XXE A;  5C0X F;  4K0K E;  4QNK A;  1N36 I;  4GKK E;  4FW9 A;  4JI5 E;  2Z5E A;  2UUA I;  5A2Q C;  2VF3 A;  1USV A;  2HK3 A;  5C0X B;  2C37 B;  2HHH I;  2E5L I;  1NHI A;  1RR9 A;  2VQE E;  5K36 E;  4IFD B;  4DR1 E;  3WU5 A;  2DEI A;  2PO0 B;  2V2V A;  1VI7 A;  3L7Z B;  1XNQ I;  1P42 A;  1VIS A;  4OO1 E;  2F4V I;  2WNR A;  3PS1 A;  5IT9 Q;  4OKG A;  5LMU I;  2JE6 A;  5DNX A;  4LCF A;  3PS3 A;  4NXM I;  3QT7 A;  1Z0E A;  4WUB A;  4DV7 I;  2R3V A;  1H7U A;  1UDO A;  3PS2 A;  4X64 I;  4DV2 I;  1OYP A;  4ISA A;  1BKN A;  4JI2 E;  4DR6 I;  1N33 E;  2V2Z A;  3QT8 A;  2V8P A;  2IOQ A;  1ZM9 A;  1OYS A;  3H1C A;  4RPF A;  2ZM6 E;  1FKA E;  4DR5 E;  1XMO E;  4DR3 E;  3PYD A;  1OYR A;  4B3M E;  4IZK A;  5FLX C;  1A6F A;  3GON A;  5BR8 I;  1Z0V A;  4OO1 D;  4JI3 I;  2O1V A;  3M85 D;  1S4E A;  2VQF I;  4YHH I;  4MDT A;  1I94 I;  4DU7 A;  5DRR A;  2A2D A;  4HYM A;  1XNR I;  4OX9 I;  2UXC I;  2PNZ B;  5DNL A;  4GKJ E;  4KHP I;  1KVK A;  4AID A;  4X66 I;  2V34 A;  3ZM7 A;  2Q2E B;  2WP8 A;  3GME A;  3OTO I;  4DV3 I;  5K36 B;  4MU3 A;  4DU8 A;  4GKK I;  4OO1 A;  1S16 A;  2BR2 A;  3ZZ0 A;  2X36 A;  3B4T A;  2BM0 A;  2BA0 G;  2PO2 B;  5JEA F;  2HHH E;  2Z5C A;  4DV0 I;  1EA6 A;  4DPU A;  2Z5B B;  3LPS A;  4FW4 A;  1N34 I;  1FJG I;  1WUU A;  4X62 I;  3B8H A;  5LMU E;  5JEA B;  4FW7 A;  4JI6 E;  4NXM E;  4USK A;  4DPW A;  4X64 E;  4DV2 E;  4DR6 E;  4U3B A;  1D6T A;  2A2C A;  1XMQ I;  3T1Y I;  2NN6 E;  1N33 I;  5GMD A;  3KRN A;  3ZKB A;  4LF5 I;  4HAC A;  3F0N A;  4BA2 A;  1QZR A;  5BR8 E;  2OI2 A;  4U3D A;  2IER A;  4JI3 E;  4IZJ B;  4M1K A;  4B3M I;  2JT2 A;  5FLX Q;  5LL6 R;  4YHH E;  1FWL A;  3H4L A;  1I94 E;  5EL9 A;  1XNR E;  2UXC E;  4OX9 E;  1E3P A;  1PVG A;  1Y4S A;  4N3O A;  4ED4 A;  4LF6 E;  4KHP E;  1ZXN A;  2C38 B;  2NN6 D;  5C0X C;  4X66 E;  3OTO E;  4MU4 A;  5IWA E;  4LF8 I;  3HJC A;  3PYF A;  2PO1 A;  1IBM I;  4KQV A;  3DD6 A;  4HY1 A;  4IFD F;  4DUZ E;  4JI0 I;  5GME A;  4LFC I;  1ZXM A;  1N0V C;  3P3C A;  4DV0 E;  2J7K A;  2ZBK B;  1K47 A;  4DR2 I;  2NN6 A;  1N34 E;  1H72 C;  3ZZT A;  1HNX I;  1FJG E;  3B82 A;  4X62 E;  1NHH A;  4BA1 A;  3HKM A;  4OZE A;  4DPX A;  1XHK A;  3P76 A;  4MU0 A;  3WU6 A;  2WNR B;  4JI6 I;  1XMQ E;  2JE6 B;  4MU1 A;  3T1Y E;  1HNZ I;  4PU9 A;  3M7N D;  1N0U A;  4PRX A;  3K1J A;  1YHC A;  3PYE A;  2BA1 D;  5L3J A;  4LF5 E;  4NBQ A;  4B3T I;  4DUY I;  4DV5 I;  2F1D A;  2O1T A;  4B3R I;  1HR0 I;  2C39 A;  1U2R A;  4EMD A;  4IZK B;  1USU A;  4X65 I;  1J5E I;  2CVE A;  3NZK A;  1Z5B A;  5DRQ A;  1Y60 A;  4LCH A;  5K36 F;  2GS8 A;  2JEB A;  1H74 A;  4LF6 I;  2CG9 A;  1RRE A;  2XEX A;  5DRP A;  4LF9 E;  1ZM2 A;  3PYG A;  4LF8 E;  4OO1 F;  3J7A M;  1OJ4 A;  1IBM E;  4LFA I;  3J80 C;  4GQU A;  3P06 A;  5IWA I;  1MU5 A;  3Q6N A;  4JI0 E;  4LFC E;  5JEA C;  2NPF A;  5LMN I; 
#chains in the Genus database with same CATH homology
 2PNL A;  4DUZ I;  1Z59 A;  4DR2 E;  5A2Q Q;  1HNX E;  2R42 A;  2Z5C B;  1FI4 A;  4DV6 I;  1FNM A;  2UU9 I;  1HNZ E;  4P52 A;  2IOP A;  2CGE A;  1MX0 A;  5FWK A;  4AQY I;  4B3T E;  4DUY E;  4DV5 E;  4LFB I;  4B3R E;  4FWD A;  3M6A A;  3K85 A;  1HR0 E;  1EI1 A;  4DR7 E;  4Z7C A;  3WU3 A;  5IT9 C;  4IZJ D;  3JAM C;  3QT6 A;  4X65 E;  4DXL A;  1J5E E;  4I3H A;  2EFG A;  4MYT A;  4R1F A;  1ZM3 A;  1IBL E;  3V5R A;  1ELO A;  3ZZU A;  4JI8 I;  4DV1 I;  3CWV A;  4LFA E;  4LF9 I;  2UUB I;  1H73 A;  4USM A;  1Z0B A;  1Z0G A;  4Z7Y A;  4DR4 I;  2DEJ A;  5LMN E;  1DAR A;  2O1W A;  1IBK I;  4HXZ A;  4URL A;  4LF4 I;  4NXN I;  4DV6 E;  1HK7 A;  4LF7 I;  2HFS A;  2UU9 E;  2V2Q A;  4WUD A;  3J81 C;  3B78 A;  1N32 E;  2UUC I;  2BV3 A;  4AQY E;  1PKP A;  2E1R A;  4JYA I;  4JI1 E;  4JI7 E;  4LFB E;  3D4J A;  4B3S I;  3WU4 A;  1Z0W A;  1KKH A;  4JV5 I;  4DR7 I;  1Z0T A;  3JAM Q;  3LTO A;  2HK2 A;  4JI8 E;  4DV1 E;  1IBL I;  4XTJ A;  4ZVI A;  3PRY A;  2UUB E;  1UEK A;  4FN5 A;  4DPY A;  4YY3 I;  4DR4 E;  4JI4 I;  4DV4 I;  2O1U A;  2CZ9 A;  1KIJ A;  2GQ0 A;  1IBK E;  1H7S A;  3T1H I;  2HKJ A;  1FWK A;  3QT5 A;  4LF4 E;  4NXN E;  1Z5A A;  4P7A A;  4LF7 E;  1HNW I;  1PIE A;  2ZIT A;  3K17 A;  3HUL A;  2UXB I;  2PNM A;  1N36 E;  2UXD I;  2UUC E;  1B62 A;  4FWG A;  2HKE A;  4K0K I;  3J81 Q;  2UUA E;  4JYA E;  1N32 I;  4JI5 I;  4FWH A;  4UTG A;  1KTV A;  2E5L E;  4WUC A;  4JI1 I;  2Z5B A;  4B3S E;  2X7I A;  1B63 A;  4JI7 I;  2AJ4 A;  3Q6M A;  1XNQ E;  4HAC B;  4JV5 E;  3V2U C;  2VQE I;  3J7A G;  2F4V E;  4DR1 I;  3ZKD A;  4DV7 E;  2BM1 A;  2LJP A;  4UT4 A;  2HFU A;  1Z0C A;  3LNU A;  2WW4 A;  1ZM4 A;  4JI2 I;  3Q1Q A;  1MG7 A;  4DPT A;  2ZM6 I;  4YY3 E;  4DR5 I;  1Y6Z A;  1XMO I;  4DR3 I;  4DV4 E;  4IZJ A;  4MYU A;  4JI4 E;  1NZ0 A;  3J80 Q;  1NHJ A;  1Y4U A;  3T1H E;  2VQF E;  4PRV A;  1HNW E;  2UXB E;  4GKJ I;  2UXD E;  4JG4 A;  1Z5C A;  4DV3 E;  4K0K E;  1N36 I;  4GKK E;  4FW9 A;  4JI5 E;  2Z5E A;  2UUA I;  5A2Q C;  2VF3 A;  1USV A;  2HK3 A;  2HHH I;  2E5L I;  1NHI A;  1RR9 A;  2VQE E;  4DR1 E;  3WU5 A;  2DEI A;  2V2V A;  1XNQ I;  1VIS A;  2F4V I;  5IT9 Q;  5LMU I;  4NXM I;  3QT7 A;  1Z0E A;  4WUB A;  4DV7 I;  2R3V A;  1H7U A;  4X64 I;  4DV2 I;  4JI2 E;  1N33 E;  1BKN A;  4DR6 I;  2V2Z A;  3QT8 A;  2V8P A;  2IOQ A;  1ZM9 A;  4RPF A;  2ZM6 E;  1FKA E;  4DR5 E;  1XMO E;  4DR3 E;  3PYD A;  4B3M E;  4IZK A;  5FLX C;  1A6F A;  3GON A;  5BR8 I;  1Z0V A;  4JI3 I;  2O1V A;  1S4E A;  2VQF I;  4YHH I;  1I94 I;  4DU7 A;  1XNR I;  2A2D A;  4HYM A;  2UXC I;  4OX9 I;  4GKJ E;  4KHP I;  1KVK A;  4X66 I;  2V34 A;  3ZM7 A;  2Q2E B;  3OTO I;  4DV3 I;  4DU8 A;  4GKK I;  1S16 A;  3ZZ0 A;  2X36 A;  2BM0 A;  2HHH E;  2Z5C A;  4DV0 I;  1EA6 A;  4DPU A;  2Z5B B;  3LPS A;  1N34 I;  1FJG I;  1WUU A;  4X62 I;  3B8H A;  5LMU E;  4JI6 E;  4NXM E;  4USK A;  4DPW A;  4X64 E;  4DV2 E;  4DR6 E;  1D6T A;  2A2C A;  1XMQ I;  3T1Y I;  1N33 I;  5GMD A;  3ZKB A;  4LF5 I;  4HAC A;  3F0N A;  1QZR A;  5BR8 E;  2OI2 A;  4JI3 E;  4IZJ B;  4M1K A;  4B3M I;  5FLX Q;  5LL6 R;  4YHH E;  1FWL A;  3H4L A;  1I94 E;  1XNR E;  2UXC E;  4OX9 E;  1PVG A;  1Y4S A;  4N3O A;  4ED4 A;  4LF6 E;  4KHP E;  1ZXN A;  4X66 E;  3OTO E;  5IWA E;  4LF8 I;  3HJC A;  3PYF A;  1IBM I;  4KQV A;  4HY1 A;  4DUZ E;  4JI0 I;  5GME A;  4LFC I;  1ZXM A;  1N0V C;  4DV0 E;  2J7K A;  2ZBK B;  1K47 A;  4DR2 I;  1N34 E;  1H72 C;  3ZZT A;  1HNX I;  1FJG E;  3B82 A;  4X62 E;  1NHH A;  4DPX A;  1XHK A;  3WU6 A;  4JI6 I;  1XMQ E;  1HNZ I;  3T1Y E;  4PU9 A;  1N0U A;  4PRX A;  3K1J A;  3PYE A;  5L3J A;  4LF5 E;  4B3T I;  4DUY I;  4DV5 I;  2O1T A;  4B3R I;  1HR0 I;  1U2R A;  4EMD A;  4IZK B;  1USU A;  4X65 I;  1J5E I;  1Z5B A;  2GS8 A;  1H74 A;  4LF6 I;  2CG9 A;  1RRE A;  2XEX A;  4LF9 E;  1ZM2 A;  3PYG A;  4LF8 E;  3J7A M;  1OJ4 A;  1IBM E;  4LFA I;  3J80 C;  3P06 A;  5IWA I;  1MU5 A;  3Q6N A;  4JI0 E;  4LFC E;  2NPF A;  5LMN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...