3WU6A

Oxidized e.coli lon proteolytic domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
185
structure length
185
Chain Sequence
NENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 61
structure length 185
sequence length 185
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu6A01
4DV0E 1OJ4A 4WUDA 1I94I 5FLXC 2LJPA 4NXME 4LFBI 1XMOI 3LPSA 4Z7CA 2DEIA 2Q2EB 4DUYE 2HKEA 4UTGA 1HNXI 5LMUE 4DV7E 3B78A 4URLA 1FKAE 2UXBE 4DV4E 1XNQE 3JAMC 5BR8I 1IBLI 4B3MI 2ZBKB 2XEXA 4DPYA 1HR0E 1ZXMA 1HNZI 1J5EI 4JI3I 4DV6I 1DARA 3QT5A 3J81C 4PRVA 2V2QA 1WUUA 1N36E 4LF5E 4PRXA 3WU3A 4NXNI 4DUZE 1EA6A 1Z5BA 5LL6R 1NZ0A 4JI4E 4DV0I 2F4VE 1ELOA 2BV3A 1FNMA 4NXMI 4WUCA 3J7AM 4GKJI 4DR6I 2HFSA 4USKA 4DV3E 4DUYI 4HACB 1N34E 1XMOE 1S16A 5LMUI 4DV7I 1FI4A 1XHKA 1HNXE 3F0NA 1B62A 4DV4I 2X7IA 4AQYE 2UXCE 1XNQI 3ZKDA 5LMNE 4LF7E 1RR9A 1KKHA 2HK3A 3K17A 2E5LE 3ZZTA 1H73A 2UUCE 4X66E 4JI8E 2BM1A 1U2RA 1H7UA 1N33I 4X62I 2UUAE 1N36I 4EMDA 4LF5I 2R42A 4JI2E 4HYMA 2VQFI 1PIEA 2HHHE 4JI4I 3T1YE 2F4VI 4FWDA 1ZM9A 2GS8A 4DV3I 1XNRI 4DR4E 3V5RA 1N34I 4GKJE 4DR6E 2BM0A 4JI0E 4AQYI 2UXCI 4B3RE 1UEKA 4DV5E 5LMNI 4LF7I 3B8HA 2HK2A 1NHHA 3HULA 1EI1A 2E5LI 4LF4E 1H7SA 4HY1A 2UU9E 3GONA 2UUCI 4X66I 4JI8I 5L3JA 1MX0A 2VQEE 1Z0TA 3WU5A 4LFCE 2UUAI 4DPUA 4OX9E 4WUBA 1VISA 4JI5E 4JI2I 2V2VA 1N33E 2EFGA 4X62E 2E1RA 3J7AG 2HHHI 3T1YI 3Q1QA 4KQVA 4LF8E 2VQFE 4DR3E 2UUBE 3LNUA 4FW9A 1IBKE 4JV5E 4FWGA 3QT8A 4DU8A 4LF9E 4DR4I 4DR7E 1XMQE 4FWHA 4JI0I 1XNRE 4I3HA 5A2QQ 1NHIA 4MYTA 1IBME 4KHPE 5IWAE 4B3RI 1Z0BA 4DV5I 4R1FA 4DPXA 1Z5CA 1FWKA 2J7KA 4LFAE 4LF4I 2ZITA 3OTOE 1HNWE 4JI7E 1D6TA 4UT4A 2UU9I 2OI2A 1Z0WA 4B3TE 3QT7A 2VQEI 1ZM2A 4LFCI 4MYUA 4JI1E 3K1JA 4OX9I 4JI5I 4LF6E 1QZRA 1S4EA 1A6FA 3ZZ0A 4LF8I 4DR3I 2UUBI 4DV2E 4XTJA 2ZM6E 3T1HE 3PYDA 1IBKI 4LF9I 4JV5I 5IT9C 4PU9A 4M1KA 4DR7I 2AJ4A 1FJGE 1XMQI 4FN5A 3J80C 4DPWA 2X36A 1IBMI 4KHPI 1N0UA 1N0VC 5IWAI 4HACA 4DR1I 5FLXQ 4USMA 1MG7A 1Z0EA 4DV1E 4LFAI 1HNWI 1PVGA 3OTOI 4K0KI 4JI7I 1NHJA 4DR5E 1KIJA 4ZVIA 3H4LA 4B3TI 1RREA 3LTOA 4JI1I 3JAMQ 2UXDE 4X64E 1H72C 2DEJA 4DU7A 3ZZUA 4HXZA 4B3SE 4LF6I 4GKKE 2R3VA 1ZM3A 4YY3E 3PYFA 5GMDA 2HKJA 4DV2I 2V8PA 4X65E 4JYAE 2ZM6I 3T1HI 1PKPA 1Z59A 1B63A 3J81Q 1FJGI 3PYGA 4YHHE 4DR2E 3QT6A 2V34A 1N32E 4JI6E 3D4JA 1KVKA 3ZKBA 4Z7YA 3WU4A 1Z0CA 2A2CA 2V2ZA 4DV1I 1Z0GA 4DR1E 5A2QC 4DR5I 4JG4A 2HFUA 1KTVA 1Z0VA 4K0KE 4ED4A 1ZXNA 1BKNA 4P52A 3PYEA 2UXDI 2WW4A 3M6AA 1I94E 4LFBE 4X64I 4B3SI 4GKKI 4YY3I 2UXBI 1FWLA 3CWVA 4X65I 4JYAI 4DPTA 1H74A 1ZM4A 1HR0I 5BR8E 1IBLE 3WU6A 4B3ME 3B82A 5GMEA 2VF3A 4YHHI 1MU5A 4P7AA 3ZM7A 4DR2I 2CZ9A 2A2DA 1HNZE 1N32I 1J5EE 4RPFA 2NPFA 4JI6I 4JI3E 5IT9Q 4DV6E 1Z5AA 4DXLA 4DUZI 3J80Q 3V2UC 4NXNE 1K47A
chains in the Genus database with same CATH superfamily
5DNXA 4DV0E 1OJ4A 3PS2A 4WUDA 4OO1A 1I94I 5FLXC 2LJPA 4NXME 4LFBI 1XMOI 3LPSA 2F1DA 4Z7CA 3PS3A 2DEIA 2Q2EB 1P42A 2HKEA 4UTGA 4DUYE 2WNRA 1HNXI 3M7ND 2JEBB 5LMUE 4DV7E 3B78A 2JT2A 4URLA 1FKAE 2UXBE 4DV4E 2CGEA 1XNQE 2WP8B 3JAMC 5BR8I 1IBLI 4FW4A 4B3MI 2ZBKB 5K36E 2XEXA 4DPYA 1HR0E 1ZXMA 2CVEA 1HNZI 1J5EI 4JI3I 4DV6I 3P76A 1DARA 3K85A 3QT5A 3U1YA 3M85G 3J81C 4PRVA 2V2QA 3CDJA 4LCFA 1WUUA 1N36E 4LF5E 4PRXA 4FW5A 5C0XC 3WU3A 4NXNI 4DUZE 1EA6A 1Z5BA 2PO2B 2NN6B 5LL6R 1HK7A 1NZ0A 2Z5CB 4JI4E 2PNZB 4DV0I 5K36F 2F4VE 1ELOA 4IZJB 2C38B 2BV3A 4BA2B 1FNMA 4NXMI 4WUCA 5ELWA 3J7AM 4GKJI 4DR6I 2HFSA 4USKA 4IZJD 4DV3E 4DUYI 4BA1A 4HACB 1N34E 1XMOE 1S16A 5LMUI 4DV7I 1FI4A 1XHKA 2C39A 1HNXE 1UDQA 2Z5EA 3F0NA 1B62A 4DV4I 2X7IA 4AQYE 2UXCE 2C37A 4IFDC 1XNQI 5EL9A 3ZKDA 5LMNE 4LF7E 1RR9A 4OO1B 1KKHA 2HK3A 2PO0A 1XXEA 3K17A 1Y60A 2E5LE 3ZZTA 1H73A 2UUCE 4X66E 5C0XA 4JI8E 2BM1A 1U2RA 1H7UA 3HJCA 1OYSA 1OYPA 4MQYA 5C0XE 4AIDA 1N33I 4X62I 3B4TA 2UUAE 4IS9A 1N36I 4EMDA 4LF5I 2CG9A 2R42A 4N3OA 4JI2E 4HYMA 2VQFI 1PIEA 2HHHE 4JI4I 3T1YE 2F4VI 4FWDA 1ZM9A 2GS8A 4DV3I 3KRNA 1XNRI 4IFDA 2J65A 4DR4E 3V5RA 2IOPA 1N34I 5C0XF 2BA0G 4GKJE 4DR6E 4IFDE 2BM0A 4JI0E 2O1WA 4AQYI 2UXCI 3P3EA 2JE6A 4B3RE 1UEKA 4DV5E 1YH8A 5LMNI 4LF7I 5DNLA 3B8HA 5EKWA 2HK2A 1NHHA 3HULA 4LOMA 1EI1A 2IERA 5K36A 2E5LI 4LF4E 1H7SA 4HY1A 3L7ZB 2UU9E 3GONA 2UUCI 4X66I 4U3BA 4JI8I 1VI7A 5L3JA 1MX0A 2O1UA 4IFDF 1Y4UA 2VQEE 1Z0TA 2C37B 3WU5A 5JEAB 4LFCE 2UUAI 3H1CA 4DPUA 4OX9E 4WUBA 1VISA 4JI5E 4JI2I 2V2VA 1N33E 5JEAD 2EFGA 4X62E 2E1RA 3J7AG 2O3ZA 2HHHI 3T1YI 4IZKA 3Q6MA 3Q1QA 4KQVA 4LF8E 2VQFE 4DR3E 2UUBE 1USVA 3LNUA 4FW9A 1IBKE 4JV5E 4FWGA 3QT8A 4DU8A 4LF9E 4DR4I 4FW3A 4DR7E 3P3CA 2NN6D 1XMQE 4FWHA 4OKGA 1UDSA 4JI0I 1XNRE 4I3HA 5A2QQ 1NHIA 5FWKA 4MYTA 1IBME 4KHPE 5IWAE 2NN6C 1Y6ZA 3PS1A 4B3RI 1R6MA 1Z0BA 2IESA 4R1FA 4DV5I 2JEBA 1UDOA 4DPXA 1Z5CA 1FWKA 3P06A 2O1TA 2J7KA 4LFAE 4LF4I 2ZITA 3OTOE 1HNWE 4JI7E 1Y4SA 2JEAA 1D6TA 4UT4A 2UU9I 2WP8A 2OI2A 4NBQA 4MU3A 1Z0WA 4QNJA 2WNRB 4OO1D 2PO1A 1USUA 4B3TE 3QT7A 2VQEI 3GCMA 1ZM2A 1Y5YA 3NZKA 4LFCI 4MYUA 4JI1E 3K1JA 4OX9I 4JI5I 4OO1C 4LF6E 4ISAA 1QZRA 2AE8A 5K36B 5JEAE 4FW6A 1S4EA 1A6FA 3PRYA 3ZZ0A 2Z5BA 4LF8I 4DR3I 2UUBI 4DV2E 5K36D 4XTJA 2BA1G 2ZM6E 2BR2A 5DRRA 3T1HE 3PYDA 1IBKI 4LF9I 4JV5I 5IT9C 4PU9A 3GMEA 2Z5CA 4M1KA 4LCHA 4DR7I 2PNZA 2AJ4A 4MU0A 1FJGE 1XMQI 4IZJA 2NN6E 2PNMA 4FN5A 3J80C 2C38A 2BA0D 4BA2A 4DPWA 1OYRA 2X36A 1IBMI 4KHPI 1N0UA 1N0VC 5IWAI 4MU1A 1UDNA 4IZKB 4HACA 4DR1I 5FLXQ 4USMA 1MG7A 1Z0EA 4DV1E 4LFAI 1HNWI 1PVGA 3OTOI 4K0KI 4JI7I 1NHJA 1YHCA 3HKMA 5DRQA 4AIMA 4DR5E 3U1KA 3UHMA 4BA1B 1KIJA 2NN6F 4ZVIA 3H4LA 4B3TI 1RREA 4OO1E 3LTOA 4JI1I 3JAMQ 2UXDE 2C39B 4X64E 1H72C 2DEJA 4DU7A 3ZZUA 3M7NG 4HXZA 4B3SE 4LF6I 4GKKE 2R3VA 1ZM3A 4YY3E 3PYFA 3M85D 4MDTA 2JEAB 5GMDA 2HKJA 4QNKA 2PO0B 4DV2I 5DRPA 2V8PA 4X65E 4JYAE 2PO1B 2ZM6I 3T1HI 1PKPA 1Z59A 3DD6A 4AM3A 5C0XB 1B63A 5JEAC 3J81Q 1FJGI 4OO1F 2GO3A 2VESA 2IOQA 3P3GA 3PYGA 4YHHE 5C0XD 4DR2E 3QT6A 2V34A 1N32E 2GO4A 4JI6E 2Z5BB 5DROA 4FW7A 3D4JA 1KVKA 3ZKBA 4MU4A 4Z7YA 3GLLA 3WU4A 1Z0CA 2BR2B 2A2CA 2V2ZA 4DV1I 1Z0GA 4DR1E 5A2QC 4J3DA 3CDIA 4JG4A 4DR5I 2HFUA 1KTVA 4IFDB 1Z0VA 4GQUA 4K0KE 4ED4A 1ZXNA 1BKNA 4P52A 3Q6NA 3PYEA 4IFDD 2UXDI 2WW4A 3M6AA 1I94E 3L7ZA 4LFBE 4X64I 1E3PA 4B3SI 1RHYA 2JE6B 4GKKI 1R6LA 4YY3I 2UXBI 1FWLA 4U3DA 5JEAA 3CWVA 4X65I 4JYAI 4DPTA 4OZEA 1H74A 1ZM4A 1HR0I 5BR8E 1IBLE 2BA1D 3WU6A 4B3ME 3B82A 2PNLA 5GMEA 1E3HA 2O1VA 2VF3A 4YHHI 1MU5A 2NN6A 2PO2A 4LPFA 4P7AA 3ZM7A 4DR2I 2CZ9A 2A2DA 1HNZE 1N32I 5K36C 1J5EE 4RPFA 2NPFA 4JI6I 4JI3E 2GQ0A 5IT9Q 4DV6E 1Z5AA 4DXLA 4LCGA 4DUZI 3J80Q 3V2UC 5JEAF 4NXNE 1K47A
chains in the Genus database with same CATH topology
4DV0E 1OJ4A 4WUDA 1I94I 5FLXC 2LJPA 4NXME 4LFBI 1XMOI 3LPSA 4Z7CA 2DEIA 2Q2EB 4DUYE 2HKEA 4UTGA 1HNXI 5LMUE 4DV7E 3B78A 4URLA 1FKAE 2UXBE 4DV4E 2CGEA 1XNQE 3JAMC 5BR8I 1IBLI 4B3MI 2ZBKB 2XEXA 4DPYA 1HR0E 1ZXMA 1HNZI 1J5EI 4JI3I 4DV6I 1DARA 3K85A 3QT5A 3J81C 4PRVA 2V2QA 1WUUA 1N36E 4LF5E 4PRXA 3WU3A 4NXNI 4DUZE 1EA6A 1Z5BA 5LL6R 1HK7A 1NZ0A 2Z5CB 4JI4E 4DV0I 2F4VE 1ELOA 4IZJB 2BV3A 1FNMA 4NXMI 4WUCA 3J7AM 4GKJI 4DR6I 2HFSA 4USKA 4IZJD 4DV3E 4DUYI 4HACB 1N34E 1XMOE 1S16A 5LMUI 4DV7I 1FI4A 1XHKA 1HNXE 2Z5EA 3F0NA 1B62A 4DV4I 2X7IA 4AQYE 2UXCE 1XNQI 3ZKDA 5LMNE 4LF7E 1RR9A 1KKHA 2HK3A 3K17A 2E5LE 3ZZTA 1H73A 2UUCE 4X66E 4JI8E 2BM1A 1U2RA 1H7UA 3HJCA 1N33I 4X62I 2UUAE 1N36I 4EMDA 4LF5I 2CG9A 2R42A 4N3OA 4JI2E 4HYMA 2VQFI 1PIEA 2HHHE 4JI4I 3T1YE 2F4VI 4FWDA 1ZM9A 2GS8A 4DV3I 1XNRI 4DR4E 3V5RA 2IOPA 1N34I 4GKJE 4DR6E 2BM0A 4JI0E 2O1WA 4AQYI 2UXCI 4B3RE 1UEKA 4DV5E 5LMNI 4LF7I 3B8HA 2HK2A 1NHHA 3HULA 1EI1A 2E5LI 4LF4E 1H7SA 4HY1A 2UU9E 3GONA 2UUCI 4X66I 4JI8I 5L3JA 1MX0A 2O1UA 1Y4UA 2VQEE 1Z0TA 3WU5A 4LFCE 2UUAI 4DPUA 4OX9E 4WUBA 1VISA 4JI5E 4JI2I 2V2VA 1N33E 2EFGA 4X62E 2E1RA 3J7AG 2HHHI 3T1YI 4IZKA 3Q6MA 3Q1QA 4KQVA 4LF8E 2VQFE 4DR3E 2UUBE 1USVA 3LNUA 4FW9A 1IBKE 4JV5E 4FWGA 3QT8A 4DU8A 4LF9E 4DR4I 4DR7E 1XMQE 4FWHA 4JI0I 1XNRE 4I3HA 5A2QQ 1NHIA 5FWKA 4MYTA 1IBME 4KHPE 5IWAE 1Y6ZA 4B3RI 1Z0BA 4DV5I 4R1FA 4DPXA 1Z5CA 1FWKA 3P06A 2O1TA 2J7KA 4LFAE 4LF4I 2ZITA 3OTOE 1HNWE 4JI7E 1Y4SA 1D6TA 4UT4A 2UU9I 2OI2A 1Z0WA 1USUA 4B3TE 3QT7A 2VQEI 1ZM2A 4LFCI 4MYUA 4JI1E 3K1JA 4OX9I 4JI5I 4LF6E 1QZRA 1S4EA 1A6FA 3PRYA 3ZZ0A 2Z5BA 4LF8I 4DR3I 2UUBI 4DV2E 4XTJA 2ZM6E 3T1HE 3PYDA 1IBKI 4LF9I 4JV5I 5IT9C 4PU9A 2Z5CA 4M1KA 4DR7I 2AJ4A 1FJGE 1XMQI 4IZJA 2PNMA 4FN5A 3J80C 4DPWA 2X36A 1IBMI 4KHPI 1N0UA 1N0VC 5IWAI 4IZKB 4HACA 4DR1I 5FLXQ 4USMA 1MG7A 1Z0EA 4DV1E 4LFAI 1HNWI 1PVGA 3OTOI 4K0KI 4JI7I 1NHJA 4DR5E 1KIJA 4ZVIA 3H4LA 4B3TI 1RREA 3LTOA 4JI1I 3JAMQ 2UXDE 4X64E 1H72C 2DEJA 4DU7A 3ZZUA 4HXZA 4B3SE 4LF6I 4GKKE 2R3VA 1ZM3A 4YY3E 3PYFA 5GMDA 2HKJA 4DV2I 2V8PA 4X65E 4JYAE 2ZM6I 3T1HI 1PKPA 1Z59A 1B63A 3J81Q 1FJGI 2IOQA 3PYGA 4YHHE 4DR2E 3QT6A 2V34A 1N32E 4JI6E 2Z5BB 3D4JA 1KVKA 3ZKBA 4Z7YA 3WU4A 1Z0CA 2A2CA 2V2ZA 4DV1I 1Z0GA 4DR1E 5A2QC 4DR5I 4JG4A 2HFUA 1KTVA 1Z0VA 4K0KE 4ED4A 1ZXNA 1BKNA 4P52A 3Q6NA 3PYEA 2UXDI 2WW4A 3M6AA 1I94E 4LFBE 4X64I 4B3SI 4GKKI 4YY3I 2UXBI 1FWLA 3CWVA 4X65I 4JYAI 4DPTA 1H74A 1ZM4A 1HR0I 5BR8E 1IBLE 3WU6A 4B3ME 3B82A 2PNLA 5GMEA 2VF3A 2O1VA 4YHHI 1MU5A 4P7AA 3ZM7A 4DR2I 2CZ9A 2A2DA 1HNZE 1N32I 1J5EE 4RPFA 2NPFA 4JI6I 4JI3E 2GQ0A 5IT9Q 4DV6E 1Z5AA 4DXLA 4DUZI 3J80Q 3V2UC 4NXNE 1K47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 E;  1OJ4 A;  4WUD A;  1I94 I;  5FLX C;  2LJP A;  4NXM E;  4LFB I;  1XMO I;  3LPS A;  4Z7C A;  2DEI A;  2Q2E B;  4DUY E;  2HKE A;  4UTG A;  1HNX I;  5LMU E;  4DV7 E;  3B78 A;  4URL A;  1FKA E;  2UXB E;  4DV4 E;  1XNQ E;  3JAM C;  5BR8 I;  1IBL I;  4B3M I;  2ZBK B;  2XEX A;  4DPY A;  1HR0 E;  1ZXM A;  1HNZ I;  1J5E I;  4JI3 I;  4DV6 I;  1DAR A;  3QT5 A;  3J81 C;  4PRV A;  2V2Q A;  1WUU A;  1N36 E;  4LF5 E;  4PRX A;  3WU3 A;  4NXN I;  4DUZ E;  1EA6 A;  1Z5B A;  5LL6 R;  1NZ0 A;  4JI4 E;  4DV0 I;  2F4V E;  1ELO A;  2BV3 A;  1FNM A;  4NXM I;  4WUC A;  3J7A M;  4GKJ I;  4DR6 I;  2HFS A;  4USK A;  4DV3 E;  4DUY I;  4HAC B;  1N34 E;  1XMO E;  1S16 A;  5LMU I;  4DV7 I;  1FI4 A;  1XHK A;  1HNX E;  3F0N A;  1B62 A;  4DV4 I;  2X7I A;  4AQY E;  2UXC E;  1XNQ I;  3ZKD A;  5LMN E;  4LF7 E;  1RR9 A;  1KKH A;  2HK3 A;  3K17 A;  2E5L E;  3ZZT A;  1H73 A;  2UUC E;  4X66 E;  4JI8 E;  2BM1 A;  1U2R A;  1H7U A;  1N33 I;  4X62 I;  2UUA E;  1N36 I;  4EMD A;  4LF5 I;  2R42 A;  4JI2 E;  4HYM A;  2VQF I;  1PIE A;  2HHH E;  4JI4 I;  3T1Y E;  2F4V I;  4FWD A;  1ZM9 A;  2GS8 A;  4DV3 I;  1XNR I;  4DR4 E;  3V5R A;  1N34 I;  4GKJ E;  4DR6 E;  2BM0 A;  4JI0 E;  4AQY I;  2UXC I;  4B3R E;  1UEK A;  4DV5 E;  5LMN I;  4LF7 I;  3B8H A;  2HK2 A;  1NHH A;  3HUL A;  1EI1 A;  2E5L I;  4LF4 E;  1H7S A;  4HY1 A;  2UU9 E;  3GON A;  2UUC I;  4X66 I;  4JI8 I;  5L3J A;  1MX0 A;  2VQE E;  1Z0T A;  3WU5 A;  4LFC E;  2UUA I;  4DPU A;  4OX9 E;  4WUB A;  1VIS A;  4JI5 E;  4JI2 I;  2V2V A;  1N33 E;  2EFG A;  4X62 E;  2E1R A;  3J7A G;  2HHH I;  3T1Y I;  3Q1Q A;  4KQV A;  4LF8 E;  2VQF E;  4DR3 E;  2UUB E;  3LNU A;  4FW9 A;  1IBK E;  4JV5 E;  4FWG A;  3QT8 A;  4DU8 A;  4LF9 E;  4DR4 I;  4DR7 E;  1XMQ E;  4FWH A;  4JI0 I;  1XNR E;  4I3H A;  5A2Q Q;  1NHI A;  4MYT A;  1IBM E;  4KHP E;  5IWA E;  4B3R I;  1Z0B A;  4DV5 I;  4R1F A;  4DPX A;  1Z5C A;  1FWK A;  2J7K A;  4LFA E;  4LF4 I;  2ZIT A;  3OTO E;  1HNW E;  4JI7 E;  1D6T A;  4UT4 A;  2UU9 I;  2OI2 A;  1Z0W A;  4B3T E;  3QT7 A;  2VQE I;  1ZM2 A;  4LFC I;  4MYU A;  4JI1 E;  3K1J A;  4OX9 I;  4JI5 I;  4LF6 E;  1QZR A;  1S4E A;  1A6F A;  3ZZ0 A;  4LF8 I;  4DR3 I;  2UUB I;  4DV2 E;  4XTJ A;  2ZM6 E;  3T1H E;  3PYD A;  1IBK I;  4LF9 I;  4JV5 I;  5IT9 C;  4PU9 A;  4M1K A;  4DR7 I;  2AJ4 A;  1FJG E;  1XMQ I;  4FN5 A;  3J80 C;  4DPW A;  2X36 A;  1IBM I;  4KHP I;  1N0U A;  1N0V C;  5IWA I;  4HAC A;  4DR1 I;  5FLX Q;  4USM A;  1MG7 A;  1Z0E A;  4DV1 E;  4LFA I;  1HNW I;  1PVG A;  3OTO I;  4K0K I;  4JI7 I;  1NHJ A;  4DR5 E;  1KIJ A;  4ZVI A;  3H4L A;  4B3T I;  1RRE A;  3LTO A;  4JI1 I;  3JAM Q;  2UXD E;  4X64 E;  1H72 C;  2DEJ A;  4DU7 A;  3ZZU A;  4HXZ A;  4B3S E;  4LF6 I;  4GKK E;  2R3V A;  1ZM3 A;  4YY3 E;  3PYF A;  5GMD A;  2HKJ A;  4DV2 I;  2V8P A;  4X65 E;  4JYA E;  2ZM6 I;  3T1H I;  1PKP A;  1Z59 A;  1B63 A;  3J81 Q;  1FJG I;  3PYG A;  4YHH E;  4DR2 E;  3QT6 A;  2V34 A;  1N32 E;  4JI6 E;  3D4J A;  1KVK A;  3ZKB A;  4Z7Y A;  3WU4 A;  1Z0C A;  2A2C A;  2V2Z A;  4DV1 I;  1Z0G A;  4DR1 E;  5A2Q C;  4DR5 I;  4JG4 A;  2HFU A;  1KTV A;  1Z0V A;  4K0K E;  4ED4 A;  1ZXN A;  1BKN A;  4P52 A;  3PYE A;  2UXD I;  2WW4 A;  3M6A A;  1I94 E;  4LFB E;  4X64 I;  4B3S I;  4GKK I;  4YY3 I;  2UXB I;  1FWL A;  3CWV A;  4X65 I;  4JYA I;  4DPT A;  1H74 A;  1ZM4 A;  1HR0 I;  5BR8 E;  1IBL E;  3WU6 A;  4B3M E;  3B82 A;  5GME A;  2VF3 A;  4YHH I;  1MU5 A;  4P7A A;  3ZM7 A;  4DR2 I;  2CZ9 A;  2A2D A;  1HNZ E;  1N32 I;  1J5E E;  4RPF A;  2NPF A;  4JI6 I;  4JI3 E;  5IT9 Q;  4DV6 E;  1Z5A A;  4DXL A;  4DUZ I;  3J80 Q;  3V2U C;  4NXN E;  1K47 A; 
#chains in the Genus database with same CATH topology
 5DNX A;  4DV0 E;  1OJ4 A;  3PS2 A;  4WUD A;  4OO1 A;  1I94 I;  5FLX C;  2LJP A;  4NXM E;  4LFB I;  1XMO I;  3LPS A;  2F1D A;  4Z7C A;  3PS3 A;  2DEI A;  2Q2E B;  1P42 A;  2HKE A;  4UTG A;  4DUY E;  2WNR A;  1HNX I;  3M7N D;  2JEB B;  5LMU E;  4DV7 E;  3B78 A;  2JT2 A;  4URL A;  1FKA E;  2UXB E;  4DV4 E;  2CGE A;  1XNQ E;  2WP8 B;  3JAM C;  5BR8 I;  1IBL I;  4FW4 A;  4B3M I;  2ZBK B;  5K36 E;  2XEX A;  4DPY A;  1HR0 E;  1ZXM A;  2CVE A;  1HNZ I;  1J5E I;  4JI3 I;  4DV6 I;  3P76 A;  1DAR A;  3K85 A;  3QT5 A;  3U1Y A;  3M85 G;  3J81 C;  4PRV A;  2V2Q A;  3CDJ A;  4LCF A;  1WUU A;  1N36 E;  4LF5 E;  4PRX A;  4FW5 A;  5C0X C;  3WU3 A;  4NXN I;  4DUZ E;  1EA6 A;  1Z5B A;  2PO2 B;  2NN6 B;  5LL6 R;  1HK7 A;  1NZ0 A;  2Z5C B;  4JI4 E;  2PNZ B;  4DV0 I;  5K36 F;  2F4V E;  1ELO A;  4IZJ B;  2C38 B;  2BV3 A;  4BA2 B;  1FNM A;  4NXM I;  4WUC A;  5ELW A;  3J7A M;  4GKJ I;  4DR6 I;  2HFS A;  4USK A;  4IZJ D;  4DV3 E;  4DUY I;  4BA1 A;  4HAC B;  1N34 E;  1XMO E;  1S16 A;  5LMU I;  4DV7 I;  1FI4 A;  1XHK A;  2C39 A;  1HNX E;  1UDQ A;  2Z5E A;  3F0N A;  1B62 A;  4DV4 I;  2X7I A;  4AQY E;  2UXC E;  2C37 A;  4IFD C;  1XNQ I;  5EL9 A;  3ZKD A;  5LMN E;  4LF7 E;  1RR9 A;  4OO1 B;  1KKH A;  2HK3 A;  2PO0 A;  1XXE A;  3K17 A;  1Y60 A;  2E5L E;  3ZZT A;  1H73 A;  2UUC E;  4X66 E;  5C0X A;  4JI8 E;  2BM1 A;  1U2R A;  1H7U A;  3HJC A;  1OYS A;  1OYP A;  4MQY A;  5C0X E;  4AID A;  1N33 I;  4X62 I;  3B4T A;  2UUA E;  4IS9 A;  1N36 I;  4EMD A;  4LF5 I;  2CG9 A;  2R42 A;  4N3O A;  4JI2 E;  4HYM A;  2VQF I;  1PIE A;  2HHH E;  4JI4 I;  3T1Y E;  2F4V I;  4FWD A;  1ZM9 A;  2GS8 A;  4DV3 I;  3KRN A;  1XNR I;  4IFD A;  2J65 A;  4DR4 E;  3V5R A;  2IOP A;  1N34 I;  5C0X F;  2BA0 G;  4GKJ E;  4DR6 E;  4IFD E;  2BM0 A;  4JI0 E;  2O1W A;  4AQY I;  2UXC I;  3P3E A;  2JE6 A;  4B3R E;  1UEK A;  4DV5 E;  1YH8 A;  5LMN I;  4LF7 I;  5DNL A;  3B8H A;  5EKW A;  2HK2 A;  1NHH A;  3HUL A;  4LOM A;  1EI1 A;  2IER A;  5K36 A;  2E5L I;  4LF4 E;  1H7S A;  4HY1 A;  3L7Z B;  2UU9 E;  3GON A;  2UUC I;  4X66 I;  4U3B A;  4JI8 I;  1VI7 A;  5L3J A;  1MX0 A;  2O1U A;  4IFD F;  1Y4U A;  2VQE E;  1Z0T A;  2C37 B;  3WU5 A;  5JEA B;  4LFC E;  2UUA I;  3H1C A;  4DPU A;  4OX9 E;  4WUB A;  1VIS A;  4JI5 E;  4JI2 I;  2V2V A;  1N33 E;  5JEA D;  2EFG A;  4X62 E;  2E1R A;  3J7A G;  2O3Z A;  2HHH I;  3T1Y I;  4IZK A;  3Q6M A;  3Q1Q A;  4KQV A;  4LF8 E;  2VQF E;  4DR3 E;  2UUB E;  1USV A;  3LNU A;  4FW9 A;  1IBK E;  4JV5 E;  4FWG A;  3QT8 A;  4DU8 A;  4LF9 E;  4DR4 I;  4FW3 A;  4DR7 E;  3P3C A;  2NN6 D;  1XMQ E;  4FWH A;  4OKG A;  1UDS A;  4JI0 I;  1XNR E;  4I3H A;  5A2Q Q;  1NHI A;  5FWK A;  4MYT A;  1IBM E;  4KHP E;  5IWA E;  2NN6 C;  1Y6Z A;  3PS1 A;  4B3R I;  1R6M A;  1Z0B A;  2IES A;  4R1F A;  4DV5 I;  2JEB A;  1UDO A;  4DPX A;  1Z5C A;  1FWK A;  3P06 A;  2O1T A;  2J7K A;  4LFA E;  4LF4 I;  2ZIT A;  3OTO E;  1HNW E;  4JI7 E;  1Y4S A;  2JEA A;  1D6T A;  4UT4 A;  2UU9 I;  2WP8 A;  2OI2 A;  4NBQ A;  4MU3 A;  1Z0W A;  4QNJ A;  2WNR B;  4OO1 D;  2PO1 A;  1USU A;  4B3T E;  3QT7 A;  2VQE I;  3GCM A;  1ZM2 A;  1Y5Y A;  3NZK A;  4LFC I;  4MYU A;  4JI1 E;  3K1J A;  4OX9 I;  4JI5 I;  4OO1 C;  4LF6 E;  4ISA A;  1QZR A;  2AE8 A;  5K36 B;  5JEA E;  4FW6 A;  1S4E A;  1A6F A;  3PRY A;  3ZZ0 A;  2Z5B A;  4LF8 I;  4DR3 I;  2UUB I;  4DV2 E;  5K36 D;  4XTJ A;  2BA1 G;  2ZM6 E;  2BR2 A;  5DRR A;  3T1H E;  3PYD A;  1IBK I;  4LF9 I;  4JV5 I;  5IT9 C;  4PU9 A;  3GME A;  2Z5C A;  4M1K A;  4LCH A;  4DR7 I;  2PNZ A;  2AJ4 A;  4MU0 A;  1FJG E;  1XMQ I;  4IZJ A;  2NN6 E;  2PNM A;  4FN5 A;  3J80 C;  2C38 A;  2BA0 D;  4BA2 A;  4DPW A;  1OYR A;  2X36 A;  1IBM I;  4KHP I;  1N0U A;  1N0V C;  5IWA I;  4MU1 A;  1UDN A;  4IZK B;  4HAC A;  4DR1 I;  5FLX Q;  4USM A;  1MG7 A;  1Z0E A;  4DV1 E;  4LFA I;  1HNW I;  1PVG A;  3OTO I;  4K0K I;  4JI7 I;  1NHJ A;  1YHC A;  3HKM A;  5DRQ A;  4AIM A;  4DR5 E;  3U1K A;  3UHM A;  4BA1 B;  1KIJ A;  2NN6 F;  4ZVI A;  3H4L A;  4B3T I;  1RRE A;  4OO1 E;  3LTO A;  4JI1 I;  3JAM Q;  2UXD E;  2C39 B;  4X64 E;  1H72 C;  2DEJ A;  4DU7 A;  3ZZU A;  3M7N G;  4HXZ A;  4B3S E;  4LF6 I;  4GKK E;  2R3V A;  1ZM3 A;  4YY3 E;  3PYF A;  3M85 D;  4MDT A;  2JEA B;  5GMD A;  2HKJ A;  4QNK A;  2PO0 B;  4DV2 I;  5DRP A;  2V8P A;  4X65 E;  4JYA E;  2PO1 B;  2ZM6 I;  3T1H I;  1PKP A;  1Z59 A;  3DD6 A;  4AM3 A;  5C0X B;  1B63 A;  5JEA C;  3J81 Q;  1FJG I;  4OO1 F;  2GO3 A;  2VES A;  2IOQ A;  3P3G A;  3PYG A;  4YHH E;  5C0X D;  4DR2 E;  3QT6 A;  2V34 A;  1N32 E;  2GO4 A;  4JI6 E;  2Z5B B;  5DRO A;  4FW7 A;  3D4J A;  1KVK A;  3ZKB A;  4MU4 A;  4Z7Y A;  3GLL A;  3WU4 A;  1Z0C A;  2BR2 B;  2A2C A;  2V2Z A;  4DV1 I;  1Z0G A;  4DR1 E;  5A2Q C;  4J3D A;  3CDI A;  4JG4 A;  4DR5 I;  2HFU A;  1KTV A;  4IFD B;  1Z0V A;  4GQU A;  4K0K E;  4ED4 A;  1ZXN A;  1BKN A;  4P52 A;  3Q6N A;  3PYE A;  4IFD D;  2UXD I;  2WW4 A;  3M6A A;  1I94 E;  3L7Z A;  4LFB E;  4X64 I;  1E3P A;  4B3S I;  1RHY A;  2JE6 B;  4GKK I;  1R6L A;  4YY3 I;  2UXB I;  1FWL A;  4U3D A;  5JEA A;  3CWV A;  4X65 I;  4JYA I;  4DPT A;  4OZE A;  1H74 A;  1ZM4 A;  1HR0 I;  5BR8 E;  1IBL E;  2BA1 D;  3WU6 A;  4B3M E;  3B82 A;  2PNL A;  5GME A;  1E3H A;  2O1V A;  2VF3 A;  4YHH I;  1MU5 A;  2NN6 A;  2PO2 A;  4LPF A;  4P7A A;  3ZM7 A;  4DR2 I;  2CZ9 A;  2A2D A;  1HNZ E;  1N32 I;  5K36 C;  1J5E E;  4RPF A;  2NPF A;  4JI6 I;  4JI3 E;  2GQ0 A;  5IT9 Q;  4DV6 E;  1Z5A A;  4DXL A;  4LCG A;  4DUZ I;  3J80 Q;  3V2U C;  5JEA F;  4NXN E;  1K47 A; 
#chains in the Genus database with same CATH homology
 4DV0 E;  1OJ4 A;  4WUD A;  1I94 I;  5FLX C;  2LJP A;  4NXM E;  4LFB I;  1XMO I;  3LPS A;  4Z7C A;  2DEI A;  2Q2E B;  4DUY E;  2HKE A;  4UTG A;  1HNX I;  5LMU E;  4DV7 E;  3B78 A;  4URL A;  1FKA E;  2UXB E;  4DV4 E;  2CGE A;  1XNQ E;  3JAM C;  5BR8 I;  1IBL I;  4B3M I;  2ZBK B;  2XEX A;  4DPY A;  1HR0 E;  1ZXM A;  1HNZ I;  1J5E I;  4JI3 I;  4DV6 I;  1DAR A;  3K85 A;  3QT5 A;  3J81 C;  4PRV A;  2V2Q A;  1WUU A;  1N36 E;  4LF5 E;  4PRX A;  3WU3 A;  4NXN I;  4DUZ E;  1EA6 A;  1Z5B A;  5LL6 R;  1HK7 A;  1NZ0 A;  2Z5C B;  4JI4 E;  4DV0 I;  2F4V E;  1ELO A;  4IZJ B;  2BV3 A;  1FNM A;  4NXM I;  4WUC A;  3J7A M;  4GKJ I;  4DR6 I;  2HFS A;  4USK A;  4IZJ D;  4DV3 E;  4DUY I;  4HAC B;  1N34 E;  1XMO E;  1S16 A;  5LMU I;  4DV7 I;  1FI4 A;  1XHK A;  1HNX E;  2Z5E A;  3F0N A;  1B62 A;  4DV4 I;  2X7I A;  4AQY E;  2UXC E;  1XNQ I;  3ZKD A;  5LMN E;  4LF7 E;  1RR9 A;  1KKH A;  2HK3 A;  3K17 A;  2E5L E;  3ZZT A;  1H73 A;  2UUC E;  4X66 E;  4JI8 E;  2BM1 A;  1U2R A;  1H7U A;  3HJC A;  1N33 I;  4X62 I;  2UUA E;  1N36 I;  4EMD A;  4LF5 I;  2CG9 A;  2R42 A;  4N3O A;  4JI2 E;  4HYM A;  2VQF I;  1PIE A;  2HHH E;  4JI4 I;  3T1Y E;  2F4V I;  4FWD A;  1ZM9 A;  2GS8 A;  4DV3 I;  1XNR I;  4DR4 E;  3V5R A;  2IOP A;  1N34 I;  4GKJ E;  4DR6 E;  2BM0 A;  4JI0 E;  2O1W A;  4AQY I;  2UXC I;  4B3R E;  1UEK A;  4DV5 E;  5LMN I;  4LF7 I;  3B8H A;  2HK2 A;  1NHH A;  3HUL A;  1EI1 A;  2E5L I;  4LF4 E;  1H7S A;  4HY1 A;  2UU9 E;  3GON A;  2UUC I;  4X66 I;  4JI8 I;  5L3J A;  1MX0 A;  2O1U A;  1Y4U A;  2VQE E;  1Z0T A;  3WU5 A;  4LFC E;  2UUA I;  4DPU A;  4OX9 E;  4WUB A;  1VIS A;  4JI5 E;  4JI2 I;  2V2V A;  1N33 E;  2EFG A;  4X62 E;  2E1R A;  3J7A G;  2HHH I;  3T1Y I;  4IZK A;  3Q6M A;  3Q1Q A;  4KQV A;  4LF8 E;  2VQF E;  4DR3 E;  2UUB E;  1USV A;  3LNU A;  4FW9 A;  1IBK E;  4JV5 E;  4FWG A;  3QT8 A;  4DU8 A;  4LF9 E;  4DR4 I;  4DR7 E;  1XMQ E;  4FWH A;  4JI0 I;  1XNR E;  4I3H A;  5A2Q Q;  1NHI A;  5FWK A;  4MYT A;  1IBM E;  4KHP E;  5IWA E;  1Y6Z A;  4B3R I;  1Z0B A;  4DV5 I;  4R1F A;  4DPX A;  1Z5C A;  1FWK A;  3P06 A;  2O1T A;  2J7K A;  4LFA E;  4LF4 I;  2ZIT A;  3OTO E;  1HNW E;  4JI7 E;  1Y4S A;  1D6T A;  4UT4 A;  2UU9 I;  2OI2 A;  1Z0W A;  1USU A;  4B3T E;  3QT7 A;  2VQE I;  1ZM2 A;  4LFC I;  4MYU A;  4JI1 E;  3K1J A;  4OX9 I;  4JI5 I;  4LF6 E;  1QZR A;  1S4E A;  1A6F A;  3PRY A;  3ZZ0 A;  2Z5B A;  4LF8 I;  4DR3 I;  2UUB I;  4DV2 E;  4XTJ A;  2ZM6 E;  3T1H E;  3PYD A;  1IBK I;  4LF9 I;  4JV5 I;  5IT9 C;  4PU9 A;  2Z5C A;  4M1K A;  4DR7 I;  2AJ4 A;  1FJG E;  1XMQ I;  4IZJ A;  2PNM A;  4FN5 A;  3J80 C;  4DPW A;  2X36 A;  1IBM I;  4KHP I;  1N0U A;  1N0V C;  5IWA I;  4IZK B;  4HAC A;  4DR1 I;  5FLX Q;  4USM A;  1MG7 A;  1Z0E A;  4DV1 E;  4LFA I;  1HNW I;  1PVG A;  3OTO I;  4K0K I;  4JI7 I;  1NHJ A;  4DR5 E;  1KIJ A;  4ZVI A;  3H4L A;  4B3T I;  1RRE A;  3LTO A;  4JI1 I;  3JAM Q;  2UXD E;  4X64 E;  1H72 C;  2DEJ A;  4DU7 A;  3ZZU A;  4HXZ A;  4B3S E;  4LF6 I;  4GKK E;  2R3V A;  1ZM3 A;  4YY3 E;  3PYF A;  5GMD A;  2HKJ A;  4DV2 I;  2V8P A;  4X65 E;  4JYA E;  2ZM6 I;  3T1H I;  1PKP A;  1Z59 A;  1B63 A;  3J81 Q;  1FJG I;  2IOQ A;  3PYG A;  4YHH E;  4DR2 E;  3QT6 A;  2V34 A;  1N32 E;  4JI6 E;  2Z5B B;  3D4J A;  1KVK A;  3ZKB A;  4Z7Y A;  3WU4 A;  1Z0C A;  2A2C A;  2V2Z A;  4DV1 I;  1Z0G A;  4DR1 E;  5A2Q C;  4DR5 I;  4JG4 A;  2HFU A;  1KTV A;  1Z0V A;  4K0K E;  4ED4 A;  1ZXN A;  1BKN A;  4P52 A;  3Q6N A;  3PYE A;  2UXD I;  2WW4 A;  3M6A A;  1I94 E;  4LFB E;  4X64 I;  4B3S I;  4GKK I;  4YY3 I;  2UXB I;  1FWL A;  3CWV A;  4X65 I;  4JYA I;  4DPT A;  1H74 A;  1ZM4 A;  1HR0 I;  5BR8 E;  1IBL E;  3WU6 A;  4B3M E;  3B82 A;  2PNL A;  5GME A;  2VF3 A;  2O1V A;  4YHH I;  1MU5 A;  4P7A A;  3ZM7 A;  4DR2 I;  2CZ9 A;  2A2D A;  1HNZ E;  1N32 I;  1J5E E;  4RPF A;  2NPF A;  4JI6 I;  4JI3 E;  2GQ0 A;  5IT9 Q;  4DV6 E;  1Z5A A;  4DXL A;  4DUZ I;  3J80 Q;  3V2U C;  4NXN E;  1K47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...