3J80C

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j80C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j80C02
1XNQI 4P52A 4P7AA 4JI0I 2HHHE 4DV3I 1QZRA 1D6TA 4DR5I 2LJPA 4OX9I 3PYGA 4YHHE 2VF3A 4PRVA 2X36A 4PRXA 3QT5A 4HYMA 2AJ4A 4KQVA 4Z7CA 1U2RA 1HNZE 5BR8I 2ZITA 1J5EI 4LF6I 2F4VI 5IWAE 4LF8I 4JI2E 4JI3I 4DPXA 1ZXMA 1HR0E 1Z5CA 4DR7E 3T1YI 1H74A 3OTOI 1KVKA 3F0NA 3QT7A 3J80C 1NZ0A 4MYUA 4LF7E 3QT8A 4WUBA 4DU8A 1HNXI 3J7AM 4AQYI 4DV7E 2UUCI 1XMQE 4DPTA 4DV1I 1FNMA 1IBKE 4DR2E 1WUUA 4JV5I 4KHPE 4NXMI 3LPSA 4B3RE 5IT9Q 4ED4A 2HKJA 4LF9E 2V34A 1OJ4A 4FWGA 4WUCA 2UXBI 2HK2A 1B62A 3J81Q 1H7SA 1FJGE 2X7IA 3B78A 4UT4A 1XNRI 1N36E 4DR4I 2VQEI 4JYAE 2UUBI 4DR3I 4RPFA 3T1HE 1N33I 4NXNE 4LF5E 1RR9A 4DV6I 2ZBKB 1MG7A 1XMOE 2E5LI 1I94I 1NHJA 4X62I 3GONA 4XTJA 3B82A 2ZM6E 2UXCE 2UU9I 1NHHA 3LNUA 1ZXNA 3ZKDA 3V5RA 2HHHI 1RREA 5GMDA 2BV3A 1A6FA 5IT9C 4YHHI 3PYFA 4PU9A 1FWKA 1HNZI 1XHKA 1Z0EA 2Q2EB 1N0VC 2V2ZA 4DV4E 4DR1E 1FWLA 3J81C 5IWAI 2R42A 4USKA 4JI2I 4LFBE 3B8HA 4JI7E 2GS8A 2V8PA 1HR0I 3Q1QA 4DR7I 4YY3E 1ZM2A 3ZKBA 3ZM7A 3J7AG 2A2DA 4FWDA 4LF7I 2A2CA 4DR6E 1Z0CA 4MYTA 3K1JA 4DV5E 4DPYA 4DV7I 1ZM9A 2UXDE 1XMQI 1UEKA 3ZZUA 1IBKI 4DR2I 3CWVA 2UUAE 4KHPI 4UTGA 2OI2A 4B3RI 1Z0VA 4LFCE 1Z0BA 4LF9I 4JI8E 1N32E 1PKPA 4DUZE 1ZM3A 4B3ME 4X66E 1Z0TA 2E1RA 4DPUA 1FJGI 4WUDA 2CZ9A 4B3SE 1S16A 5LMNE 2BM1A 1N36I 4JYAI 2VQFE 3H4LA 3T1HI 3D4JA 4NXNI 4JG4A 4LF5I 4HACB 1XMOI 1H73A 1MX0A 4GKKE 4GKJE 2ZM6I 2UXCI 5LMUE 4JI4E 1EA6A 1N34E 4LF4E 5GMEA 5A2QQ 4DUYE 3HULA 4B3TE 4K0KE 2V2VA 4DV0E 4JI1E 4DU7A 1KIJA 4X65E 2HKEA 3LTOA 2UUBE 4DV4I 4DR1I 1HNWE 1N0UA 4DV2E 1Z5AA 1KKHA 4LFBI 1IBLE 3WU5A 4X64E 4JI6E 4JI7I 4JI5E 3WU6A 4YY3I 1B63A 1IBME 5LL6R 4FW9A 1PIEA 1K47A 2EFGA 1FKAE 4LFAE 4DPWA 4USMA 1XNQE 4DR6I 5A2QC 4HACA 4JI0E 4DV3E 2HFUA 2HK3A 4DV5I 1BKNA 4DR5E 4OX9E 2UXDI 3PYDA 3WU4A 2UUAI 1PVGA 5BR8E 1J5EE 4LF6E 3ZZTA 2F4VE 4LFCI 4JI8I 1N32I 4LF8E 2DEJA 4DUZI 4JI3E 4B3MI 1ELOA 1EI1A 4X66I 4HXZA 3T1YE 1Z5BA 1H7UA 2NPFA 4B3SI 3OTOE 5LMNI 3JAMC 2VQFI 1NHIA 4Z7YA 3PYEA 4GKKI 4FN5A 4R1FA 4URLA 4GKJI 1HNXE 2BM0A 4AQYE 5FLXQ 4I3HA 2J7KA 5LMUI 4JI4I 1Z0GA 2UUCE 1FI4A 4DXLA 1N34I 4DV1E 2DEIA 4LF4I 2V2QA 4DUYI 1VISA 4JV5E 4B3TI 4NXME 1Z0WA 4K0KI 1DARA 3ZZ0A 1MU5A 5L3JA 4DV0I 4JI1I 3M6AA 1ZM4A 1Z59A 3K17A 3V2UC 4X65I 1S4EA 2HFSA 2UXBE 1HNWI 3WU3A 2WW4A 4DV2I 1XNRE 4DR4E 2VQEE 1IBLI 4DR3E 4ZVIA 4X64I 4JI6I 4JI5I 4M1KA 1N33E 1KTVA 4DV6E 1IBMI 1H72C 2E5LE 1I94E 4X62E 5FLXC 2UU9E 3QT6A 3J80Q 2R3VA 2XEXA 4FWHA 4EMDA 4LFAI 4HY1A 3JAMQ
chains in the Genus database with same CATH superfamily
1XNQI 4P52A 4P7AA 4JI0I 2HHHE 4DV3I 1QZRA 2JEAB 2L92A 2N8XA 4R2CA 1D6TA 4DR5I 1X49A 4KWYA 2LJPA 4OX9I 2YTOA 2CTDA 2EMFA 2K4VA 5TSEA 3PYGA 4YHHE 2VF3A 4PRVA 2X36A 5ELWA 2CT1A 4PRXA 3QT5A 1IMUA 2RSIA 2EOZA 2EOHA 2AJ4A 4HYMA 4LCHA 4LOMA 2LV2A 3BF2A 4IZJD 4KQVA 4Z7CA 3M85D 2GQ0A 1U2RA 5KL2A 4BA1A 5JEAB 1Y5YA 1HNZE 3AUZA 1BBGA 5BR8I 2ZITA 4BC9A 2VRDA 2JE6A 3B4TA 1J5EI 4LF6I 5EKWA 2F4VI 2PO0A 4MU3A 2EMHA 2LMZA 3H09A 3LLHA 5IWAE 4M2ZA 3DD6A 3HXLA 3BBGA 2Z5BA 1PJSA 2V88A 4LF8I 4JI2E 5AASA 4JI3I 4DPXA 2MC6A 4BA2B 1ZXMA 2BA1D 1HR0E 1Z5CA 2NUFA 2O1WA 2MDRA 4DR7E 4FW7A 3T1YI 2EP3A 3P3CA 2EM6A 1H74A 1X5WA 1DI2A 3OTOI 2WCC3 2EM7A 1KVKA 3F0NA 2DMYA 4WX9A 4BHCA 2EN6A 5LLQA 2E1MA 1ZBQA 1J26A 1R6LA 2EN8A 3QT7A 2YRMA 1TF6A 3EPKA 2EOFA 5C0XB 4DKKA 2LVHA 2B3TB 2JEBA 2PO1B 3J80C 2DLQA 2BA0G 1NZ0A 5K36A 3HQ1A 4LF7E 4MYUA 2EPOA 1PJQA 2EMGA 3QT8A 4WUBA 1UDOA 4DU8A 2EPLX 4FW6A 2WP8B 1HNXI 3J7AM 3GMEA 4AQYI 4MU0A 1KJKA 3THOB 4DV7E 2NABA 2L2KB 3M7NG 1NEIA 3EQ1A 2UUCI 1IQSA 1XMQE 3C6MA 2YPNA 4DPTA 4DV1I 3HJCA 2ELYA 1FNMA 1IBKE 4DR2E 1WUUA 1T38A 3EPJA 4JV5I 4Q28A 4KHPE 1Y6ZA 2YTNA 2FV4B 4BS9A 1STUA 3ADJA 4WSGA 2GLIA 3LPSA 4NXMI 4R2SA 2HGHA 4B3RE 2C39A 2NN6E 5IT9Q 2JEAA 4ED4A 2IOQA 4IFDB 2N3GA 4OO1E 2HKJA 1WJPA 2YSPA 1OYSA 1GQEA 3PS1A 2MKNA 4R2EA 2JOBA 4LF9E 4DV0I 2EN3A 2V34A 1OJ4A 4QNJA 4FWGA 4WUCA 2UXBI 2JY9A 4R2AA 3BIDA 2HK2A 4FW4A 1B62A 2JP9A 2M9AA 4ZYEA 3J81Q 2I13A 1H7SA 1FJGE 1RHYA 2X7IA 3B78A 3GLLA 4RHBB 4LPFA 2LRSA 4UT4A 3VYXA 2EWLA 1N36E 1XNRI 4DR4I 2VQEI 4OO1B 5K36E 4JYAE 1YYKA 1P47A 2UUBI 2YU8A 3P1XA 4DR3I 2ODRD 4RPFA 3T1HE 2NN6C 1N33I 3DJWA 5DROA 2O3ZA 4NZVA 2E72A 4NXNE 4BMJA 4LF5E 1NCSA 1RR9A 2O1VA 4DV6I 2ZBKB 1MG7A 2EPMX 2LUPB 1XMOE 2C37B 1AH5A 4ZYHA 1YUIA 1XXEA 4MQYA 2E5LI 1I94I 1NHJA 4X62I 3GONA 4XTJA 2B7VA 2RQLA 2ZM6E 2UXCE 4N4RB 3B82A 3UK3C 2EMIA 5KL6A 4FW5A 5FWKA 2UU9I 1NHHA 3LNUA 4FK5C 1A1HA 2DGCA 1PDAA 4LU9A 5AE3A 3RMPA 1ZXNA 4LCFA 1A1LA 1ZU1A 3ZKDA 2YTIA 5DNLA 1X6EA 5K36C 4J3DA 3FIGA 4QNKA 1ZR9A 3V5RA 2LO3A 2HHHI 2HJJA 1RREA 5GMDA 5IV8B 2BV3A 2DB2A 2EM4A 1A6FA 4NBQA 2WBSA 2KOUA 4X9JA 5ADZA 5K36D 5IXMB 5IT9C 4YHHI 2WNRA 2JT2A 5JEAE 3PYFA 2Z5EA 4PU9A 2CVEA 2DRPA 1FWKA 2Z5CB 1HNZI 1XHKA 4P78A 2EOOA 1Z0EA 2J7JA 2Q2EB 1N0VC 2V2ZA 3HPZA 2VF1A 4DV4E 1VI7A 4DR1E 1OYRA 1FWLA 4Q35B 3J81C 4M30A 5CFFE 5IWAI 2EN7A 2R42A 3U1KA 3U1YA 4USKA 3IWDA 4X8WA 4IZJB 1L4SA 2EM3A 4LFBE 4JI2I 2YU5A 3B8HA 2EMYA 4JI7E 2GS8A 1AAYA 2V8PA 2LT7A 1HR0I 4O4KA 3Q1QA 4HTGA 4DR7I 4YY3E 5JEAC 3L7ZB 1MGTA 4RH8A 2EQ0A 2GO4A 2GHFA 1ZM2A 3ZKBA 3C4TA 3ZM7A 3J7AG 1X6HA 2M7QA 2EZ6A 1Y60A 2NN6A 5C0XE 2M1SA 4OO1A 4TUGA 2PNMA 3MHSC 2A2DA 4L5NC 1X47A 4LCGA 2JOXA 2EMXA 3HPSA 4FWDA 3Q6NA 1T4NA 4LF7I 2EORA 3C6KA 2A2CA 2RSMA 2MKDA 5AE1A 4R2RA 1YZ9A 1WRJA 4DR6E 5DRQA 1Z0CA 4MYTA 4DV5E 3K1JA 1PJTA 3P06A 4DPYA 2YTJA 4DV7I 1ZM9A 2UXDE 4ZYGA 1XMQI 2CGEA 4ZYDA 1O0WA 1UEKA 1ZBTA 2C38B 3ZZUA 5C0XC 4DR2I 1IBKI 3CWVA 2L6MA 5AC4A 2UUAE 4IZKB 4KHPI 2EL4A 4M0VA 2EL6A 4UTGA 2OI2A 2JYAA 1GZ6A 1YFHA 4IFDE 1X3CA 1T39A 3P3GA 2D9HA 2EN2A 3C4BA 2ENHA 4F54A 2RPCA 4F2JC 1UDSA 1Z0VA 4LFCE 1Z0BA 2KHXA 2GPIA 2IHR1 3JU0A 2L2MA 4F6NA 2WBUA 4LF9I 2V85A 2KONA 4AIDA 2EPZA 4JI8E 1N32E 1E3PA 4F9BB 3P3EA 1PKPA 2YTDA 4DUZE 1ZM3A 1B69A 4B3ME 2EM2A 4X66E 1Z0TA 2E1RA 1EH8A 4DPUA 4N3OA 1FJGI 3F6GA 1TN9A 4OKGA 4WUDA 2EPPA 1Y4UA 2CZ9A 4B3SE 2AE8A 1S16A 5LMNE 2BM1A 1N36I 4U3BA 4JYAI 4IFDC 2VQFE 1SR9A 1JK2A 3H4LA 1YPNA 5JEAA 3D4JA 3T1HI 3HTXA 2EMCA 3M99B 5KL5A 4NXNI 1G2FC 3OMLA 2M4IA 4JG4A 4LF5I 4HACB 2BBGA 2RS6A 2LUQA 1XMOI 1H73A 3AV0A 4GKKE 1MX0A 1QNTA 5DRPA 4BA1B 2DIXA 2DLKA 2EQ1A 4GKJE 3NZKA 3MSWA 2PNZB 3J7Yp 2ZM6I 2UXCI 2VE7C 2NN6F 1RQ0A 3M7ND 4OO1C 5LMUE 4JI4E 4BBYA 2L3JA 2PO0B 4BA2A 4OZEA 4OO1F 1BBOA 1EA6A 2Z5BB 1N34E 4LF4E 1YHCA 2NN6D 2O1TA 5GMEA 5A2QQ 2EPCA 4DUYE 3HULA 2YTPA 3K85A 1IQOA 2VESA 4OO1D 4R2PA 1UBDC 3ECRA 4R2DA 4B3TE 4K0KE 2K7IA 2EMAA 2V2VA 5C0XA 2ELZA 2RTXA 1A1KA 1Y4SA 4P7DA 3ADGA 3THNA 4DV0E 2IESA 4KZSA 4JI1E 3ADLA 3EPHA 1KYQA 2PO1A 5K36F 1GTKA 4TUIA 2FTXB 4X65E 1KIJA 4DU7A 3M85G 2HKEA 2C38A 4J8ZA 3LTOA 2WP8A 2LJUA 4F9CB 4IS9A 2UUBE 2N3HA 2EPXA 4L8NA 2EL5A 4I8OA 2JEBB 1HK7A 3HKMA 5A6BA 2EPNA 1EKZA 1HNWE 4IZKA 3K6QA 4DV4I 4DR1I 2YWQA 1N0UA 4MLVA 4DV2E 1A1JA 2YTFA 1Z5AA 1KKHA 2WZOA 1RMDA 4WFTA 4LFBI 2LE2A 1IBLE 3WU5A 4X64E 4JI6E 2PNLA 4JI5E 4JI7I 4MLQA 2EMBA 1LLMC 1E3HA 2BA1G 2EOSA 3WU6A 4AM3A 2EM9A 1B63A 4YY3I 2G7HA 2YRHA 4IFDA 2MC5A 2R1FA 1DQ3A 2JWOA 2WBTA 4O43A 1IBME 1YUJA 2NUEA 3PRYA 5LL6R 1UDQA 4FW9A 1ZAAC 4R8OA 2ENCA 1PIEA 1K47A 2C39B 4LTYA 2YZTA 2EPAA 1UN6B 2EFGA 1FKAE 2EN1A 5JEAF 2CPNA 1T4LB 2DSYA 4WSPA 2JVAA 2EMKA 4F6MA 3KZZA 4LFAE 4DPWA 5A69A 1XNQE 4USMA 5A6AA 4DR6I 5A2QC 4R03A 1RC7A 4JI0E 4HACA 2EPRA 4DV3E 1G2DC 2HFUA 1WHQA 1UILA 2HK3A 4BHBA 1DGCA 2PO2B 5JEAD 2IERA 4F9AB 1BKNA 4DV5I 1P42A 1EH7A 4DR5E 2EN4A 2JXPA 4IJDA 4O5GA 1EH6A 4OX9E 2UXDI 2PNZA 4B3RI 3P76A 3PYDA 2O1UA 3WU4A 2L2NA 2EM5A 2GO3A 3IWCA 5DRRA 4GQUA 3QG5C 2C37A 3PS2A 4MU4A 1A1IA 1MEYC 2UUAI 1PVGA 3CDIA 2I9IA 5A6KA 2EOIA 5F3WA 1A1FA 1OYPA 4MDTA 2EPUA 5BR8E 5A6JA 4GZNC 2F1DA 4OOGC 3ZOQB 2V8QB 5KL4A 1J5EE 4LF6E 1TF3A 2F4VE 5KL7A 4LFCI 3CDJA 3ZZTA 3VK6A 1UHZA 2V89A 5C0XF 4M9VC 2JPAA 3F6HA 1YSAC 5AE2A 4JI8I 1N32I 3VHTB 4LF8E 2DEJA 2R76A 2H36X 1Z1BA 4DUZI 4JI3E 5T6JA 5C0XD 4B3MI 2EQ3A 1EI1A 1ELOA 4X66I 2LJHA 1T4OA 4WYQB 5DNXA 4HXZA 3T1YE 4O24A 1Z5BA 1H7UA 1YYOA 2NPFA 4B3SI 3OTOE 3L00A 5LMNI 3KZYA 2EOQA 3JAMC 2EOEA 4MU1A 2EOXA 2JR1A 2A25A 2VQFI 2BR2B 2EJ4A 3IWBA 1NHIA 2Z5CA 1JK1A 1BB8A 4Z7YA 5A6BD 3PYEA 1QU6A 2L3CA 2LBSB 2MDGA 2WNRB 2DMIA 5EL9A 2NUGA 4GKKI 4FN5A 4R1FA 2YTEA 4URLA 2BB8A 2YTQA 1N3GA 4GKJI 4IFDF 2NA2A 2CSHA 2FGGA 3KRNA 1HNXE 2BM0A 4IZJA 3MHHC 4BC7A 4AQYE 5FLXQ 4ISAA 3Q6MA 4I3HA 2J7KA 3KWRA 2BA0D 5LMUI 4GEQB 4JI4I 1USUA 2EPKX 2L33A 5AC5A 4R2QA 1Z0GA 4IFDD 2UUCE 1FI4A 1A1GA 4DXLA 4DV1E 3L7ZA 2EOMA 3JTZA 2DEIA 1N34I 4LF4I 2V2QA 4DUYI 1VISA 2B9DA 4JV5E 2JE6B 4B3TI 4NXME 3VYYA 1Z0WA 4K0KI 1DARA 2B7TA 2LTSA 2PO2A 3ZZ0A 4FW3A 1SFEA 2ENAA 1MU5A 5L3JA 2YRKA 1USVA 2EMZA 2HC5A 5DNYA 4JI1I 2EE8A 2ODRC 2PRTA 3M6AA 1F2IG 4NHRA 4AIMA 2V87A 2NN6B 4WXCA 1ZM4A 1Z59A 3K17A 3V2UC 4X65I 2RS7A 4WPYA 1S4EA 4IS1C 1YYWA 2UXBE 2HFSA 1YH8A 3GCMA 1X6FA 1HNWI 3BGHA 3WU3A 3TQMA 2L8TA 2WW4A 2LCEA 4DV2I 3DF6A 3ADIA 2LTRA 2YTGA 1XNRE 4DR4E 2V83A 2VQEE 2J65A 5KL3A 1IBLI 4DR3E 4U3DA 4ZVIA 4X64I 2EOYA 4BCAA 4JI5I 2EM8A 4M1KA 4JI6I 5K36B 2EMLA 3EPLA 1N33E 3PS3A 2EM0A 1WXRA 3UHMA 1KTVA 2EOJA 4DV6E 4WXDA 2IOPA 1IBMI 1WHNA 1X48A 3LMLA 1H72C 2E5LE 1I94E 3H1CA 2YSOA 4X62E 5FLXC 1R6MA 1UDNA 4DMIA 2CG9A 2UU9E 3QT6A 2BR2A 3J80Q 2R3VA 2V86A 2XEXA 4FWHA 2EMWA 4EMDA 2ADRA 4HY1A 3JAMQ 2Q8UA 4LFAI 2F8BA 4HEIA 2YT4A
chains in the Genus database with same CATH topology
1XNQI 4P52A 4P7AA 4JI0I 2HHHE 4DV3I 1QZRA 2L92A 1D6TA 4DR5I 1X49A 2LJPA 4OX9I 2K4VA 3PYGA 4YHHE 2VF3A 4PRVA 2X36A 4PRXA 3QT5A 4HYMA 2AJ4A 4IZJD 4KQVA 4Z7CA 2GQ0A 1U2RA 1HNZE 3AUZA 5BR8I 2ZITA 4BC9A 1J5EI 4LF6I 2F4VI 2LMZA 3H09A 3LLHA 5IWAE 4M2ZA 3HXLA 2Z5BA 2V88A 4LF8I 4JI2E 5AASA 4JI3I 4DPXA 2MC6A 1ZXMA 1HR0E 1Z5CA 2NUFA 2O1WA 2MDRA 4DR7E 3T1YI 1H74A 1DI2A 3OTOI 1KVKA 3F0NA 2DMYA 2E1MA 1ZBQA 1J26A 3QT7A 4DKKA 2B3TB 3J80C 1NZ0A 3HQ1A 4LF7E 4MYUA 3QT8A 4WUBA 4DU8A 1HNXI 3J7AM 4AQYI 4DV7E 2L2KB 2UUCI 1XMQE 4DPTA 4DV1I 3HJCA 1FNMA 1IBKE 4DR2E 1WUUA 4JV5I 4Q28A 4KHPE 1Y6ZA 4BS9A 2FV4B 1STUA 3ADJA 3LPSA 4NXMI 4B3RE 5IT9Q 4ED4A 2IOQA 2N3GA 2HKJA 1GQEA 2JOBA 4LF9E 2V34A 1OJ4A 4FWGA 4WUCA 2UXBI 2JY9A 2HK2A 1B62A 3J81Q 1H7SA 1FJGE 2X7IA 3B78A 2LRSA 4UT4A 3VYXA 2EWLA 1N36E 1XNRI 4DR4I 2VQEI 4JYAE 1YYKA 2UUBI 3P1XA 4DR3I 2ODRD 4RPFA 3T1HE 1N33I 3DJWA 4NXNE 4BMJA 4LF5E 1RR9A 2O1VA 4DV6I 2ZBKB 1MG7A 2LUPB 1XMOE 2E5LI 1I94I 1NHJA 4X62I 3GONA 4XTJA 2B7VA 2ZM6E 2UXCE 3B82A 5FWKA 2UU9I 1NHHA 3LNUA 1ZXNA 4LU9A 5AE3A 3RMPA 3ZKDA 3FIGA 3V5RA 2HHHI 1RREA 5GMDA 2BV3A 2DB2A 1A6FA 2KOUA 5ADZA 5IT9C 4YHHI 3PYFA 2Z5EA 4PU9A 1FWKA 2Z5CB 1HNZI 1XHKA 4P78A 1Z0EA 2Q2EB 1N0VC 2V2ZA 3HPZA 2VF1A 4DV4E 4DR1E 1FWLA 3J81C 4M30A 5CFFE 5IWAI 2R42A 4USKA 3IWDA 4X8WA 4IZJB 4LFBE 4JI2I 3B8HA 4JI7E 2GS8A 2V8PA 1HR0I 3Q1QA 4DR7I 4YY3E 1ZM2A 3ZKBA 3ZM7A 3C4TA 3J7AG 2EZ6A 2M7QA 2M1SA 4TUGA 2PNMA 2A2DA 4L5NC 1X47A 2JOXA 3HPSA 4FWDA 3Q6NA 1T4NA 4LF7I 2A2CA 2RSMA 5AE1A 1YZ9A 4DR6E 1Z0CA 4MYTA 4DV5E 3K1JA 3P06A 4DPYA 4DV7I 1ZM9A 2UXDE 1XMQI 2CGEA 1O0WA 1UEKA 1ZBTA 3ZZUA 1IBKI 4DR2I 3CWVA 2L6MA 2UUAE 4IZKB 4KHPI 4M0VA 4UTGA 2OI2A 1GZ6A 4B3RI 4F54A 3C4BA 1Z0VA 4LFCE 1Z0BA 2KHXA 2IHR1 3JU0A 2L2MA 4LF9I 2V85A 2KONA 4JI8E 1N32E 4F9BB 1PKPA 4DUZE 1ZM3A 4B3ME 4X66E 1Z0TA 2E1RA 4DPUA 4N3OA 1FJGI 3F6GA 4WUDA 1Y4UA 2CZ9A 4B3SE 1S16A 5LMNE 2BM1A 1N36I 4JYAI 2VQFE 1SR9A 3H4LA 3T1HI 3D4JA 3HTXA 4NXNI 4JG4A 3OMLA 2M4IA 4LF5I 4HACB 2RS6A 2LUQA 1XMOI 1H73A 3AV0A 4GKKE 1MX0A 2DIXA 4GKJE 3MSWA 3J7Yp 2ZM6I 2UXCI 2VE7C 1RQ0A 5LMUE 4JI4E 4BBYA 2L3JA 1EA6A 2Z5BB 1N34E 4LF4E 2O1TA 5GMEA 5A2QQ 4DUYE 3HULA 3K85A 4B3TE 4K0KE 2V2VA 2RTXA 1Y4SA 4P7DA 3ADGA 4DV0E 4KZSA 4JI1E 3ADLA 4TUIA 2FTXB 4X65E 1KIJA 4DU7A 2HKEA 4J8ZA 3LTOA 4F9CB 2UUBE 2N3HA 4L8NA 4I8OA 4IZKA 1HK7A 4DV4I 1EKZA 1HNWE 4DR1I 3K6QA 1N0UA 4DV2E 1Z5AA 1KKHA 2WZOA 4WFTA 4LFBI 2LE2A 1IBLE 3WU5A 4X64E 4JI6E 2PNLA 4JI5E 4JI7I 3WU6A 4YY3I 1B63A 2G7HA 2MC5A 1DQ3A 2JWOA 1IBME 3PRYA 2NUEA 5LL6R 4FW9A 4R8OA 1PIEA 1K47A 4LTYA 2YZTA 2EFGA 1FKAE 2CPNA 1T4LB 2DSYA 4WSPA 2JVAA 4LFAE 4DPWA 1XNQE 4USMA 4DR6I 5A2QC 4R03A 1RC7A 4JI0E 4HACA 4DV3E 2HFUA 1WHQA 1UILA 2HK3A 4DV5I 4F9AB 1BKNA 4DR5E 4OX9E 2UXDI 3PYDA 2O1UA 3WU4A 2L2NA 3IWCA 2UUAI 1PVGA 5F3WA 5BR8E 4OOGC 3ZOQB 2V8QB 1J5EE 4LF6E 2F4VE 3ZZTA 4LFCI 3VK6A 1UHZA 2V89A 3F6HA 5AE2A 4JI8I 1N32I 4LF8E 2DEJA 4DUZI 2H36X 4JI3E 5T6JA 4B3MI 1ELOA 1EI1A 4X66I 2LJHA 1T4OA 4WYQB 4HXZA 3T1YE 1Z5BA 1H7UA 1YYOA 2NPFA 4B3SI 3OTOE 5LMNI 3JAMC 2JR1A 2VQFI 1NHIA 3IWBA 2Z5CA 4Z7YA 3PYEA 1QU6A 2L3CA 2LBSB 2NUGA 4GKKI 4FN5A 4R1FA 4URLA 4GKJI 2NA2A 2FGGA 4IZJA 1HNXE 2BM0A 4BC7A 4AQYE 5FLXQ 4I3HA 3Q6MA 2J7KA 3KWRA 5LMUI 4JI4I 4GEQB 1USUA 2L33A 1Z0GA 2UUCE 1FI4A 4DXLA 4DV1E 1N34I 3JTZA 2DEIA 4LF4I 2V2QA 4DUYI 1VISA 2B9DA 4JV5E 4B3TI 4NXME 3VYYA 1Z0WA 4K0KI 1DARA 2B7TA 2LTSA 3ZZ0A 1MU5A 5L3JA 1USVA 4DV0I 5DNYA 4JI1I 2ODRC 3M6AA 2V87A 1ZM4A 1Z59A 3K17A 3V2UC 4X65I 2RS7A 4WPYA 1S4EA 1YYWA 2UXBE 2HFSA 1HNWI 3WU3A 2L8TA 2WW4A 4DV2I 3DF6A 3ADIA 2LTRA 1XNRE 4DR4E 2V83A 2VQEE 1IBLI 4DR3E 4ZVIA 4X64I 4BCAA 4JI6I 4JI5I 4M1KA 1N33E 1WXRA 1KTVA 4DV6E 2IOPA 1IBMI 1WHNA 1X48A 3LMLA 1H72C 2E5LE 1I94E 4X62E 5FLXC 4DMIA 2CG9A 2UU9E 3QT6A 3J80Q 2R3VA 2V86A 2XEXA 4FWHA 4EMDA 4LFAI 4HY1A 3JAMQ 2F8BA 2YT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ I;  4P52 A;  4P7A A;  4JI0 I;  2HHH E;  4DV3 I;  1QZR A;  1D6T A;  4DR5 I;  2LJP A;  4OX9 I;  3PYG A;  4YHH E;  2VF3 A;  4PRV A;  2X36 A;  4PRX A;  3QT5 A;  4HYM A;  2AJ4 A;  4KQV A;  4Z7C A;  1U2R A;  1HNZ E;  5BR8 I;  2ZIT A;  1J5E I;  4LF6 I;  2F4V I;  5IWA E;  4LF8 I;  4JI2 E;  4JI3 I;  4DPX A;  1ZXM A;  1HR0 E;  1Z5C A;  4DR7 E;  3T1Y I;  1H74 A;  3OTO I;  1KVK A;  3F0N A;  3QT7 A;  3J80 C;  1NZ0 A;  4MYU A;  4LF7 E;  3QT8 A;  4WUB A;  4DU8 A;  1HNX I;  3J7A M;  4AQY I;  4DV7 E;  2UUC I;  1XMQ E;  4DPT A;  4DV1 I;  1FNM A;  1IBK E;  4DR2 E;  1WUU A;  4JV5 I;  4KHP E;  4NXM I;  3LPS A;  4B3R E;  5IT9 Q;  4ED4 A;  2HKJ A;  4LF9 E;  2V34 A;  1OJ4 A;  4FWG A;  4WUC A;  2UXB I;  2HK2 A;  1B62 A;  3J81 Q;  1H7S A;  1FJG E;  2X7I A;  3B78 A;  4UT4 A;  1XNR I;  1N36 E;  4DR4 I;  2VQE I;  4JYA E;  2UUB I;  4DR3 I;  4RPF A;  3T1H E;  1N33 I;  4NXN E;  4LF5 E;  1RR9 A;  4DV6 I;  2ZBK B;  1MG7 A;  1XMO E;  2E5L I;  1I94 I;  1NHJ A;  4X62 I;  3GON A;  4XTJ A;  3B82 A;  2ZM6 E;  2UXC E;  2UU9 I;  1NHH A;  3LNU A;  1ZXN A;  3ZKD A;  3V5R A;  2HHH I;  1RRE A;  5GMD A;  2BV3 A;  1A6F A;  5IT9 C;  4YHH I;  3PYF A;  4PU9 A;  1FWK A;  1HNZ I;  1XHK A;  1Z0E A;  2Q2E B;  1N0V C;  2V2Z A;  4DV4 E;  4DR1 E;  1FWL A;  3J81 C;  5IWA I;  2R42 A;  4USK A;  4JI2 I;  4LFB E;  3B8H A;  4JI7 E;  2GS8 A;  2V8P A;  1HR0 I;  3Q1Q A;  4DR7 I;  4YY3 E;  1ZM2 A;  3ZKB A;  3ZM7 A;  3J7A G;  2A2D A;  4FWD A;  4LF7 I;  2A2C A;  4DR6 E;  1Z0C A;  4MYT A;  3K1J A;  4DV5 E;  4DPY A;  4DV7 I;  1ZM9 A;  2UXD E;  1XMQ I;  1UEK A;  3ZZU A;  1IBK I;  4DR2 I;  3CWV A;  2UUA E;  4KHP I;  4UTG A;  2OI2 A;  4B3R I;  1Z0V A;  4LFC E;  1Z0B A;  4LF9 I;  4JI8 E;  1N32 E;  1PKP A;  4DUZ E;  1ZM3 A;  4B3M E;  4X66 E;  1Z0T A;  2E1R A;  4DPU A;  1FJG I;  4WUD A;  2CZ9 A;  4B3S E;  1S16 A;  5LMN E;  2BM1 A;  1N36 I;  4JYA I;  2VQF E;  3H4L A;  3T1H I;  3D4J A;  4NXN I;  4JG4 A;  4LF5 I;  4HAC B;  1XMO I;  1H73 A;  1MX0 A;  4GKK E;  4GKJ E;  2ZM6 I;  2UXC I;  5LMU E;  4JI4 E;  1EA6 A;  1N34 E;  4LF4 E;  5GME A;  5A2Q Q;  4DUY E;  3HUL A;  4B3T E;  4K0K E;  2V2V A;  4DV0 E;  4JI1 E;  4DU7 A;  1KIJ A;  4X65 E;  2HKE A;  3LTO A;  2UUB E;  4DV4 I;  4DR1 I;  1HNW E;  1N0U A;  4DV2 E;  1Z5A A;  1KKH A;  4LFB I;  1IBL E;  3WU5 A;  4X64 E;  4JI6 E;  4JI7 I;  4JI5 E;  3WU6 A;  4YY3 I;  1B63 A;  1IBM E;  5LL6 R;  4FW9 A;  1PIE A;  1K47 A;  2EFG A;  1FKA E;  4LFA E;  4DPW A;  4USM A;  1XNQ E;  4DR6 I;  5A2Q C;  4HAC A;  4JI0 E;  4DV3 E;  2HFU A;  2HK3 A;  4DV5 I;  1BKN A;  4DR5 E;  4OX9 E;  2UXD I;  3PYD A;  3WU4 A;  2UUA I;  1PVG A;  5BR8 E;  1J5E E;  4LF6 E;  3ZZT A;  2F4V E;  4LFC I;  4JI8 I;  1N32 I;  4LF8 E;  2DEJ A;  4DUZ I;  4JI3 E;  4B3M I;  1ELO A;  1EI1 A;  4X66 I;  4HXZ A;  3T1Y E;  1Z5B A;  1H7U A;  2NPF A;  4B3S I;  3OTO E;  5LMN I;  3JAM C;  2VQF I;  1NHI A;  4Z7Y A;  3PYE A;  4GKK I;  4FN5 A;  4R1F A;  4URL A;  4GKJ I;  1HNX E;  2BM0 A;  4AQY E;  5FLX Q;  4I3H A;  2J7K A;  5LMU I;  4JI4 I;  1Z0G A;  2UUC E;  1FI4 A;  4DXL A;  1N34 I;  4DV1 E;  2DEI A;  4LF4 I;  2V2Q A;  4DUY I;  1VIS A;  4JV5 E;  4B3T I;  4NXM E;  1Z0W A;  4K0K I;  1DAR A;  3ZZ0 A;  1MU5 A;  5L3J A;  4DV0 I;  4JI1 I;  3M6A A;  1ZM4 A;  1Z59 A;  3K17 A;  3V2U C;  4X65 I;  1S4E A;  2HFS A;  2UXB E;  1HNW I;  3WU3 A;  2WW4 A;  4DV2 I;  1XNR E;  4DR4 E;  2VQE E;  1IBL I;  4DR3 E;  4ZVI A;  4X64 I;  4JI6 I;  4JI5 I;  4M1K A;  1N33 E;  1KTV A;  4DV6 E;  1IBM I;  1H72 C;  2E5L E;  1I94 E;  4X62 E;  5FLX C;  2UU9 E;  3QT6 A;  3J80 Q;  2R3V A;  2XEX A;  4FWH A;  4EMD A;  4LFA I;  4HY1 A;  3JAM Q; 
#chains in the Genus database with same CATH topology
 1XNQ I;  4P52 A;  4P7A A;  4JI0 I;  2HHH E;  4DV3 I;  1QZR A;  2JEA B;  2L92 A;  2N8X A;  4R2C A;  1D6T A;  4DR5 I;  1X49 A;  4KWY A;  2LJP A;  4OX9 I;  2YTO A;  2CTD A;  2EMF A;  2K4V A;  5TSE A;  3PYG A;  4YHH E;  2VF3 A;  4PRV A;  2X36 A;  5ELW A;  2CT1 A;  4PRX A;  3QT5 A;  1IMU A;  2RSI A;  2EOZ A;  2EOH A;  2AJ4 A;  4HYM A;  4LCH A;  4LOM A;  2LV2 A;  3BF2 A;  4IZJ D;  4KQV A;  4Z7C A;  3M85 D;  2GQ0 A;  1U2R A;  5KL2 A;  4BA1 A;  5JEA B;  1Y5Y A;  1HNZ E;  3AUZ A;  1BBG A;  5BR8 I;  2ZIT A;  4BC9 A;  2VRD A;  2JE6 A;  3B4T A;  1J5E I;  4LF6 I;  5EKW A;  2F4V I;  2PO0 A;  4MU3 A;  2EMH A;  2LMZ A;  3H09 A;  3LLH A;  5IWA E;  4M2Z A;  3DD6 A;  3HXL A;  3BBG A;  2Z5B A;  1PJS A;  2V88 A;  4LF8 I;  4JI2 E;  5AAS A;  4JI3 I;  4DPX A;  2MC6 A;  4BA2 B;  1ZXM A;  2BA1 D;  1HR0 E;  1Z5C A;  2NUF A;  2O1W A;  2MDR A;  4DR7 E;  4FW7 A;  3T1Y I;  2EP3 A;  3P3C A;  2EM6 A;  1H74 A;  1X5W A;  1DI2 A;  3OTO I;  2WCC 3;  2EM7 A;  1KVK A;  3F0N A;  2DMY A;  4WX9 A;  4BHC A;  2EN6 A;  5LLQ A;  2E1M A;  1ZBQ A;  1J26 A;  1R6L A;  2EN8 A;  3QT7 A;  2YRM A;  1TF6 A;  3EPK A;  2EOF A;  5C0X B;  4DKK A;  2LVH A;  2B3T B;  2JEB A;  2PO1 B;  3J80 C;  2DLQ A;  2BA0 G;  1NZ0 A;  5K36 A;  3HQ1 A;  4LF7 E;  4MYU A;  2EPO A;  1PJQ A;  2EMG A;  3QT8 A;  4WUB A;  1UDO A;  4DU8 A;  2EPL X;  4FW6 A;  2WP8 B;  1HNX I;  3J7A M;  3GME A;  4AQY I;  4MU0 A;  1KJK A;  3THO B;  4DV7 E;  2NAB A;  2L2K B;  3M7N G;  1NEI A;  3EQ1 A;  2UUC I;  1IQS A;  1XMQ E;  3C6M A;  2YPN A;  4DPT A;  4DV1 I;  3HJC A;  2ELY A;  1FNM A;  1IBK E;  4DR2 E;  1WUU A;  1T38 A;  3EPJ A;  4JV5 I;  4Q28 A;  4KHP E;  1Y6Z A;  2YTN A;  2FV4 B;  4BS9 A;  1STU A;  3ADJ A;  4WSG A;  2GLI A;  3LPS A;  4NXM I;  4R2S A;  2HGH A;  4B3R E;  2C39 A;  2NN6 E;  5IT9 Q;  2JEA A;  4ED4 A;  2IOQ A;  4IFD B;  2N3G A;  4OO1 E;  2HKJ A;  1WJP A;  2YSP A;  1OYS A;  1GQE A;  3PS1 A;  2MKN A;  4R2E A;  2JOB A;  4LF9 E;  4DV0 I;  2EN3 A;  2V34 A;  1OJ4 A;  4QNJ A;  4FWG A;  4WUC A;  2UXB I;  2JY9 A;  4R2A A;  3BID A;  2HK2 A;  4FW4 A;  1B62 A;  2JP9 A;  2M9A A;  4ZYE A;  3J81 Q;  2I13 A;  1H7S A;  1FJG E;  1RHY A;  2X7I A;  3B78 A;  3GLL A;  4RHB B;  4LPF A;  2LRS A;  4UT4 A;  3VYX A;  2EWL A;  1N36 E;  1XNR I;  4DR4 I;  2VQE I;  4OO1 B;  5K36 E;  4JYA E;  1YYK A;  1P47 A;  2UUB I;  2YU8 A;  3P1X A;  4DR3 I;  2ODR D;  4RPF A;  3T1H E;  2NN6 C;  1N33 I;  3DJW A;  5DRO A;  2O3Z A;  4NZV A;  2E72 A;  4NXN E;  4BMJ A;  4LF5 E;  1NCS A;  1RR9 A;  2O1V A;  4DV6 I;  2ZBK B;  1MG7 A;  2EPM X;  2LUP B;  1XMO E;  2C37 B;  1AH5 A;  4ZYH A;  1YUI A;  1XXE A;  4MQY A;  2E5L I;  1I94 I;  1NHJ A;  4X62 I;  3GON A;  4XTJ A;  2B7V A;  2RQL A;  2ZM6 E;  2UXC E;  4N4R B;  3B82 A;  3UK3 C;  2EMI A;  5KL6 A;  4FW5 A;  5FWK A;  2UU9 I;  1NHH A;  3LNU A;  4FK5 C;  1A1H A;  2DGC A;  1PDA A;  4LU9 A;  5AE3 A;  3RMP A;  1ZXN A;  4LCF A;  1A1L A;  1ZU1 A;  3ZKD A;  2YTI A;  5DNL A;  1X6E A;  5K36 C;  4J3D A;  3FIG A;  4QNK A;  1ZR9 A;  3V5R A;  2LO3 A;  2HHH I;  2HJJ A;  1RRE A;  5GMD A;  5IV8 B;  2BV3 A;  2DB2 A;  2EM4 A;  1A6F A;  4NBQ A;  2WBS A;  2KOU A;  4X9J A;  5ADZ A;  5K36 D;  5IXM B;  5IT9 C;  4YHH I;  2WNR A;  2JT2 A;  5JEA E;  3PYF A;  2Z5E A;  4PU9 A;  2CVE A;  2DRP A;  1FWK A;  2Z5C B;  1HNZ I;  1XHK A;  4P78 A;  2EOO A;  1Z0E A;  2J7J A;  2Q2E B;  1N0V C;  2V2Z A;  3HPZ A;  2VF1 A;  4DV4 E;  1VI7 A;  4DR1 E;  1OYR A;  1FWL A;  4Q35 B;  3J81 C;  4M30 A;  5CFF E;  5IWA I;  2EN7 A;  2R42 A;  3U1K A;  3U1Y A;  4USK A;  3IWD A;  4X8W A;  4IZJ B;  1L4S A;  2EM3 A;  4LFB E;  4JI2 I;  2YU5 A;  3B8H A;  2EMY A;  4JI7 E;  2GS8 A;  1AAY A;  2V8P A;  2LT7 A;  1HR0 I;  4O4K A;  3Q1Q A;  4HTG A;  4DR7 I;  4YY3 E;  5JEA C;  3L7Z B;  1MGT A;  4RH8 A;  2EQ0 A;  2GO4 A;  2GHF A;  1ZM2 A;  3ZKB A;  3C4T A;  3ZM7 A;  3J7A G;  1X6H A;  2M7Q A;  2EZ6 A;  1Y60 A;  2NN6 A;  5C0X E;  2M1S A;  4OO1 A;  4TUG A;  2PNM A;  3MHS C;  2A2D A;  4L5N C;  1X47 A;  4LCG A;  2JOX A;  2EMX A;  3HPS A;  4FWD A;  3Q6N A;  1T4N A;  4LF7 I;  2EOR A;  3C6K A;  2A2C A;  2RSM A;  2MKD A;  5AE1 A;  4R2R A;  1YZ9 A;  1WRJ A;  4DR6 E;  5DRQ A;  1Z0C A;  4MYT A;  4DV5 E;  3K1J A;  1PJT A;  3P06 A;  4DPY A;  2YTJ A;  4DV7 I;  1ZM9 A;  2UXD E;  4ZYG A;  1XMQ I;  2CGE A;  4ZYD A;  1O0W A;  1UEK A;  1ZBT A;  2C38 B;  3ZZU A;  5C0X C;  4DR2 I;  1IBK I;  3CWV A;  2L6M A;  5AC4 A;  2UUA E;  4IZK B;  4KHP I;  2EL4 A;  4M0V A;  2EL6 A;  4UTG A;  2OI2 A;  2JYA A;  1GZ6 A;  1YFH A;  4IFD E;  1X3C A;  1T39 A;  3P3G A;  2D9H A;  2EN2 A;  3C4B A;  2ENH A;  4F54 A;  2RPC A;  4F2J C;  1UDS A;  1Z0V A;  4LFC E;  1Z0B A;  2KHX A;  2GPI A;  2IHR 1;  3JU0 A;  2L2M A;  4F6N A;  2WBU A;  4LF9 I;  2V85 A;  2KON A;  4AID A;  2EPZ A;  4JI8 E;  1N32 E;  1E3P A;  4F9B B;  3P3E A;  1PKP A;  2YTD A;  4DUZ E;  1ZM3 A;  1B69 A;  4B3M E;  2EM2 A;  4X66 E;  1Z0T A;  2E1R A;  1EH8 A;  4DPU A;  4N3O A;  1FJG I;  3F6G A;  1TN9 A;  4OKG A;  4WUD A;  2EPP A;  1Y4U A;  2CZ9 A;  4B3S E;  2AE8 A;  1S16 A;  5LMN E;  2BM1 A;  1N36 I;  4U3B A;  4JYA I;  4IFD C;  2VQF E;  1SR9 A;  1JK2 A;  3H4L A;  1YPN A;  5JEA A;  3D4J A;  3T1H I;  3HTX A;  2EMC A;  3M99 B;  5KL5 A;  4NXN I;  1G2F C;  3OML A;  2M4I A;  4JG4 A;  4LF5 I;  4HAC B;  2BBG A;  2RS6 A;  2LUQ A;  1XMO I;  1H73 A;  3AV0 A;  4GKK E;  1MX0 A;  1QNT A;  5DRP A;  4BA1 B;  2DIX A;  2DLK A;  2EQ1 A;  4GKJ E;  3NZK A;  3MSW A;  2PNZ B;  3J7Y p;  2ZM6 I;  2UXC I;  2VE7 C;  2NN6 F;  1RQ0 A;  3M7N D;  4OO1 C;  5LMU E;  4JI4 E;  4BBY A;  2L3J A;  2PO0 B;  4BA2 A;  4OZE A;  4OO1 F;  1BBO A;  1EA6 A;  2Z5B B;  1N34 E;  4LF4 E;  1YHC A;  2NN6 D;  2O1T A;  5GME A;  5A2Q Q;  2EPC A;  4DUY E;  3HUL A;  2YTP A;  3K85 A;  1IQO A;  2VES A;  4OO1 D;  4R2P A;  1UBD C;  3ECR A;  4R2D A;  4B3T E;  4K0K E;  2K7I A;  2EMA A;  2V2V A;  5C0X A;  2ELZ A;  2RTX A;  1A1K A;  1Y4S A;  4P7D A;  3ADG A;  3THN A;  4DV0 E;  2IES A;  4KZS A;  4JI1 E;  3ADL A;  3EPH A;  1KYQ A;  2PO1 A;  5K36 F;  1GTK A;  4TUI A;  2FTX B;  4X65 E;  1KIJ A;  4DU7 A;  3M85 G;  2HKE A;  2C38 A;  4J8Z A;  3LTO A;  2WP8 A;  2LJU A;  4F9C B;  4IS9 A;  2UUB E;  2N3H A;  2EPX A;  4L8N A;  2EL5 A;  4I8O A;  2JEB B;  1HK7 A;  3HKM A;  5A6B A;  2EPN A;  1EKZ A;  1HNW E;  4IZK A;  3K6Q A;  4DV4 I;  4DR1 I;  2YWQ A;  1N0U A;  4MLV A;  4DV2 E;  1A1J A;  2YTF A;  1Z5A A;  1KKH A;  2WZO A;  1RMD A;  4WFT A;  4LFB I;  2LE2 A;  1IBL E;  3WU5 A;  4X64 E;  4JI6 E;  2PNL A;  4JI5 E;  4JI7 I;  4MLQ A;  2EMB A;  1LLM C;  1E3H A;  2BA1 G;  2EOS A;  3WU6 A;  4AM3 A;  2EM9 A;  1B63 A;  4YY3 I;  2G7H A;  2YRH A;  4IFD A;  2MC5 A;  2R1F A;  1DQ3 A;  2JWO A;  2WBT A;  4O43 A;  1IBM E;  1YUJ A;  2NUE A;  3PRY A;  5LL6 R;  1UDQ A;  4FW9 A;  1ZAA C;  4R8O A;  2ENC A;  1PIE A;  1K47 A;  2C39 B;  4LTY A;  2YZT A;  2EPA A;  1UN6 B;  2EFG A;  1FKA E;  2EN1 A;  5JEA F;  2CPN A;  1T4L B;  2DSY A;  4WSP A;  2JVA A;  2EMK A;  4F6M A;  3KZZ A;  4LFA E;  4DPW A;  5A69 A;  1XNQ E;  4USM A;  5A6A A;  4DR6 I;  5A2Q C;  4R03 A;  1RC7 A;  4JI0 E;  4HAC A;  2EPR A;  4DV3 E;  1G2D C;  2HFU A;  1WHQ A;  1UIL A;  2HK3 A;  4BHB A;  1DGC A;  2PO2 B;  5JEA D;  2IER A;  4F9A B;  1BKN A;  4DV5 I;  1P42 A;  1EH7 A;  4DR5 E;  2EN4 A;  2JXP A;  4IJD A;  4O5G A;  1EH6 A;  4OX9 E;  2UXD I;  2PNZ A;  4B3R I;  3P76 A;  3PYD A;  2O1U A;  3WU4 A;  2L2N A;  2EM5 A;  2GO3 A;  3IWC A;  5DRR A;  4GQU A;  3QG5 C;  2C37 A;  3PS2 A;  4MU4 A;  1A1I A;  1MEY C;  2UUA I;  1PVG A;  3CDI A;  2I9I A;  5A6K A;  2EOI A;  5F3W A;  1A1F A;  1OYP A;  4MDT A;  2EPU A;  5BR8 E;  5A6J A;  4GZN C;  2F1D A;  4OOG C;  3ZOQ B;  2V8Q B;  5KL4 A;  1J5E E;  4LF6 E;  1TF3 A;  2F4V E;  5KL7 A;  4LFC I;  3CDJ A;  3ZZT A;  3VK6 A;  1UHZ A;  2V89 A;  5C0X F;  4M9V C;  2JPA A;  3F6H A;  1YSA C;  5AE2 A;  4JI8 I;  1N32 I;  3VHT B;  4LF8 E;  2DEJ A;  2R76 A;  2H36 X;  1Z1B A;  4DUZ I;  4JI3 E;  5T6J A;  5C0X D;  4B3M I;  2EQ3 A;  1EI1 A;  1ELO A;  4X66 I;  2LJH A;  1T4O A;  4WYQ B;  5DNX A;  4HXZ A;  3T1Y E;  4O24 A;  1Z5B A;  1H7U A;  1YYO A;  2NPF A;  4B3S I;  3OTO E;  3L00 A;  5LMN I;  3KZY A;  2EOQ A;  3JAM C;  2EOE A;  4MU1 A;  2EOX A;  2JR1 A;  2A25 A;  2VQF I;  2BR2 B;  2EJ4 A;  3IWB A;  1NHI A;  2Z5C A;  1JK1 A;  1BB8 A;  4Z7Y A;  5A6B D;  3PYE A;  1QU6 A;  2L3C A;  2LBS B;  2MDG A;  2WNR B;  2DMI A;  5EL9 A;  2NUG A;  4GKK I;  4FN5 A;  4R1F A;  2YTE A;  4URL A;  2BB8 A;  2YTQ A;  1N3G A;  4GKJ I;  4IFD F;  2NA2 A;  2CSH A;  2FGG A;  3KRN A;  1HNX E;  2BM0 A;  4IZJ A;  3MHH C;  4BC7 A;  4AQY E;  5FLX Q;  4ISA A;  3Q6M A;  4I3H A;  2J7K A;  3KWR A;  2BA0 D;  5LMU I;  4GEQ B;  4JI4 I;  1USU A;  2EPK X;  2L33 A;  5AC5 A;  4R2Q A;  1Z0G A;  4IFD D;  2UUC E;  1FI4 A;  1A1G A;  4DXL A;  4DV1 E;  3L7Z A;  2EOM A;  3JTZ A;  2DEI A;  1N34 I;  4LF4 I;  2V2Q A;  4DUY I;  1VIS A;  2B9D A;  4JV5 E;  2JE6 B;  4B3T I;  4NXM E;  3VYY A;  1Z0W A;  4K0K I;  1DAR A;  2B7T A;  2LTS A;  2PO2 A;  3ZZ0 A;  4FW3 A;  1SFE A;  2ENA A;  1MU5 A;  5L3J A;  2YRK A;  1USV A;  2EMZ A;  2HC5 A;  5DNY A;  4JI1 I;  2EE8 A;  2ODR C;  2PRT A;  3M6A A;  1F2I G;  4NHR A;  4AIM A;  2V87 A;  2NN6 B;  4WXC A;  1ZM4 A;  1Z59 A;  3K17 A;  3V2U C;  4X65 I;  2RS7 A;  4WPY A;  1S4E A;  4IS1 C;  1YYW A;  2UXB E;  2HFS A;  1YH8 A;  3GCM A;  1X6F A;  1HNW I;  3BGH A;  3WU3 A;  3TQM A;  2L8T A;  2WW4 A;  2LCE A;  4DV2 I;  3DF6 A;  3ADI A;  2LTR A;  2YTG A;  1XNR E;  4DR4 E;  2V83 A;  2VQE E;  2J65 A;  5KL3 A;  1IBL I;  4DR3 E;  4U3D A;  4ZVI A;  4X64 I;  2EOY A;  4BCA A;  4JI5 I;  2EM8 A;  4M1K A;  4JI6 I;  5K36 B;  2EML A;  3EPL A;  1N33 E;  3PS3 A;  2EM0 A;  1WXR A;  3UHM A;  1KTV A;  2EOJ A;  4DV6 E;  4WXD A;  2IOP A;  1IBM I;  1WHN A;  1X48 A;  3LML A;  1H72 C;  2E5L E;  1I94 E;  3H1C A;  2YSO A;  4X62 E;  5FLX C;  1R6M A;  1UDN A;  4DMI A;  2CG9 A;  2UU9 E;  3QT6 A;  2BR2 A;  3J80 Q;  2R3V A;  2V86 A;  2XEX A;  4FWH A;  2EMW A;  4EMD A;  2ADR A;  4HY1 A;  3JAM Q;  2Q8U A;  4LFA I;  2F8B A;  4HEI A;  2YT4 A; 
#chains in the Genus database with same CATH homology
 1XNQ I;  4P52 A;  4P7A A;  4JI0 I;  2HHH E;  4DV3 I;  1QZR A;  2L92 A;  1D6T A;  4DR5 I;  1X49 A;  2LJP A;  4OX9 I;  2K4V A;  3PYG A;  4YHH E;  2VF3 A;  4PRV A;  2X36 A;  4PRX A;  3QT5 A;  4HYM A;  2AJ4 A;  4IZJ D;  4KQV A;  4Z7C A;  2GQ0 A;  1U2R A;  1HNZ E;  3AUZ A;  5BR8 I;  2ZIT A;  4BC9 A;  1J5E I;  4LF6 I;  2F4V I;  2LMZ A;  3H09 A;  3LLH A;  5IWA E;  4M2Z A;  3HXL A;  2Z5B A;  2V88 A;  4LF8 I;  4JI2 E;  5AAS A;  4JI3 I;  4DPX A;  2MC6 A;  1ZXM A;  1HR0 E;  1Z5C A;  2NUF A;  2O1W A;  2MDR A;  4DR7 E;  3T1Y I;  1H74 A;  1DI2 A;  3OTO I;  1KVK A;  3F0N A;  2DMY A;  2E1M A;  1ZBQ A;  1J26 A;  3QT7 A;  4DKK A;  2B3T B;  3J80 C;  1NZ0 A;  3HQ1 A;  4LF7 E;  4MYU A;  3QT8 A;  4WUB A;  4DU8 A;  1HNX I;  3J7A M;  4AQY I;  4DV7 E;  2L2K B;  2UUC I;  1XMQ E;  4DPT A;  4DV1 I;  3HJC A;  1FNM A;  1IBK E;  4DR2 E;  1WUU A;  4JV5 I;  4Q28 A;  4KHP E;  1Y6Z A;  4BS9 A;  2FV4 B;  1STU A;  3ADJ A;  3LPS A;  4NXM I;  4B3R E;  5IT9 Q;  4ED4 A;  2IOQ A;  2N3G A;  2HKJ A;  1GQE A;  2JOB A;  4LF9 E;  2V34 A;  1OJ4 A;  4FWG A;  4WUC A;  2UXB I;  2JY9 A;  2HK2 A;  1B62 A;  3J81 Q;  1H7S A;  1FJG E;  2X7I A;  3B78 A;  2LRS A;  4UT4 A;  3VYX A;  2EWL A;  1N36 E;  1XNR I;  4DR4 I;  2VQE I;  4JYA E;  1YYK A;  2UUB I;  3P1X A;  4DR3 I;  2ODR D;  4RPF A;  3T1H E;  1N33 I;  3DJW A;  4NXN E;  4BMJ A;  4LF5 E;  1RR9 A;  2O1V A;  4DV6 I;  2ZBK B;  1MG7 A;  2LUP B;  1XMO E;  2E5L I;  1I94 I;  1NHJ A;  4X62 I;  3GON A;  4XTJ A;  2B7V A;  2ZM6 E;  2UXC E;  3B82 A;  5FWK A;  2UU9 I;  1NHH A;  3LNU A;  1ZXN A;  4LU9 A;  5AE3 A;  3RMP A;  3ZKD A;  3FIG A;  3V5R A;  2HHH I;  1RRE A;  5GMD A;  2BV3 A;  2DB2 A;  1A6F A;  2KOU A;  5ADZ A;  5IT9 C;  4YHH I;  3PYF A;  2Z5E A;  4PU9 A;  1FWK A;  2Z5C B;  1HNZ I;  1XHK A;  4P78 A;  1Z0E A;  2Q2E B;  1N0V C;  2V2Z A;  3HPZ A;  2VF1 A;  4DV4 E;  4DR1 E;  1FWL A;  3J81 C;  4M30 A;  5CFF E;  5IWA I;  2R42 A;  4USK A;  3IWD A;  4X8W A;  4IZJ B;  4LFB E;  4JI2 I;  3B8H A;  4JI7 E;  2GS8 A;  2V8P A;  1HR0 I;  3Q1Q A;  4DR7 I;  4YY3 E;  1ZM2 A;  3ZKB A;  3ZM7 A;  3C4T A;  3J7A G;  2EZ6 A;  2M7Q A;  2M1S A;  4TUG A;  2PNM A;  2A2D A;  4L5N C;  1X47 A;  2JOX A;  3HPS A;  4FWD A;  3Q6N A;  1T4N A;  4LF7 I;  2A2C A;  2RSM A;  5AE1 A;  1YZ9 A;  4DR6 E;  1Z0C A;  4MYT A;  4DV5 E;  3K1J A;  3P06 A;  4DPY A;  4DV7 I;  1ZM9 A;  2UXD E;  1XMQ I;  2CGE A;  1O0W A;  1UEK A;  1ZBT A;  3ZZU A;  1IBK I;  4DR2 I;  3CWV A;  2L6M A;  2UUA E;  4IZK B;  4KHP I;  4M0V A;  4UTG A;  2OI2 A;  1GZ6 A;  4B3R I;  4F54 A;  3C4B A;  1Z0V A;  4LFC E;  1Z0B A;  2KHX A;  2IHR 1;  3JU0 A;  2L2M A;  4LF9 I;  2V85 A;  2KON A;  4JI8 E;  1N32 E;  4F9B B;  1PKP A;  4DUZ E;  1ZM3 A;  4B3M E;  4X66 E;  1Z0T A;  2E1R A;  4DPU A;  4N3O A;  1FJG I;  3F6G A;  4WUD A;  1Y4U A;  2CZ9 A;  4B3S E;  1S16 A;  5LMN E;  2BM1 A;  1N36 I;  4JYA I;  2VQF E;  1SR9 A;  3H4L A;  3T1H I;  3D4J A;  3HTX A;  4NXN I;  4JG4 A;  3OML A;  2M4I A;  4LF5 I;  4HAC B;  2RS6 A;  2LUQ A;  1XMO I;  1H73 A;  3AV0 A;  4GKK E;  1MX0 A;  2DIX A;  4GKJ E;  3MSW A;  3J7Y p;  2ZM6 I;  2UXC I;  2VE7 C;  1RQ0 A;  5LMU E;  4JI4 E;  4BBY A;  2L3J A;  1EA6 A;  2Z5B B;  1N34 E;  4LF4 E;  2O1T A;  5GME A;  5A2Q Q;  4DUY E;  3HUL A;  3K85 A;  4B3T E;  4K0K E;  2V2V A;  2RTX A;  1Y4S A;  4P7D A;  3ADG A;  4DV0 E;  4KZS A;  4JI1 E;  3ADL A;  4TUI A;  2FTX B;  4X65 E;  1KIJ A;  4DU7 A;  2HKE A;  4J8Z A;  3LTO A;  4F9C B;  2UUB E;  2N3H A;  4L8N A;  4I8O A;  4IZK A;  1HK7 A;  4DV4 I;  1EKZ A;  1HNW E;  4DR1 I;  3K6Q A;  1N0U A;  4DV2 E;  1Z5A A;  1KKH A;  2WZO A;  4WFT A;  4LFB I;  2LE2 A;  1IBL E;  3WU5 A;  4X64 E;  4JI6 E;  2PNL A;  4JI5 E;  4JI7 I;  3WU6 A;  4YY3 I;  1B63 A;  2G7H A;  2MC5 A;  1DQ3 A;  2JWO A;  1IBM E;  3PRY A;  2NUE A;  5LL6 R;  4FW9 A;  4R8O A;  1PIE A;  1K47 A;  4LTY A;  2YZT A;  2EFG A;  1FKA E;  2CPN A;  1T4L B;  2DSY A;  4WSP A;  2JVA A;  4LFA E;  4DPW A;  1XNQ E;  4USM A;  4DR6 I;  5A2Q C;  4R03 A;  1RC7 A;  4JI0 E;  4HAC A;  4DV3 E;  2HFU A;  1WHQ A;  1UIL A;  2HK3 A;  4DV5 I;  4F9A B;  1BKN A;  4DR5 E;  4OX9 E;  2UXD I;  3PYD A;  2O1U A;  3WU4 A;  2L2N A;  3IWC A;  2UUA I;  1PVG A;  5F3W A;  5BR8 E;  4OOG C;  3ZOQ B;  2V8Q B;  1J5E E;  4LF6 E;  2F4V E;  3ZZT A;  4LFC I;  3VK6 A;  1UHZ A;  2V89 A;  3F6H A;  5AE2 A;  4JI8 I;  1N32 I;  4LF8 E;  2DEJ A;  4DUZ I;  2H36 X;  4JI3 E;  5T6J A;  4B3M I;  1ELO A;  1EI1 A;  4X66 I;  2LJH A;  1T4O A;  4WYQ B;  4HXZ A;  3T1Y E;  1Z5B A;  1H7U A;  1YYO A;  2NPF A;  4B3S I;  3OTO E;  5LMN I;  3JAM C;  2JR1 A;  2VQF I;  1NHI A;  3IWB A;  2Z5C A;  4Z7Y A;  3PYE A;  1QU6 A;  2L3C A;  2LBS B;  2NUG A;  4GKK I;  4FN5 A;  4R1F A;  4URL A;  4GKJ I;  2NA2 A;  2FGG A;  4IZJ A;  1HNX E;  2BM0 A;  4BC7 A;  4AQY E;  5FLX Q;  4I3H A;  3Q6M A;  2J7K A;  3KWR A;  5LMU I;  4JI4 I;  4GEQ B;  1USU A;  2L33 A;  1Z0G A;  2UUC E;  1FI4 A;  4DXL A;  4DV1 E;  1N34 I;  3JTZ A;  2DEI A;  4LF4 I;  2V2Q A;  4DUY I;  1VIS A;  2B9D A;  4JV5 E;  4B3T I;  4NXM E;  3VYY A;  1Z0W A;  4K0K I;  1DAR A;  2B7T A;  2LTS A;  3ZZ0 A;  1MU5 A;  5L3J A;  1USV A;  4DV0 I;  5DNY A;  4JI1 I;  2ODR C;  3M6A A;  2V87 A;  1ZM4 A;  1Z59 A;  3K17 A;  3V2U C;  4X65 I;  2RS7 A;  4WPY A;  1S4E A;  1YYW A;  2UXB E;  2HFS A;  1HNW I;  3WU3 A;  2L8T A;  2WW4 A;  4DV2 I;  3DF6 A;  3ADI A;  2LTR A;  1XNR E;  4DR4 E;  2V83 A;  2VQE E;  1IBL I;  4DR3 E;  4ZVI A;  4X64 I;  4BCA A;  4JI6 I;  4JI5 I;  4M1K A;  1N33 E;  1WXR A;  1KTV A;  4DV6 E;  2IOP A;  1IBM I;  1WHN A;  1X48 A;  3LML A;  1H72 C;  2E5L E;  1I94 E;  4X62 E;  5FLX C;  4DMI A;  2CG9 A;  2UU9 E;  3QT6 A;  3J80 Q;  2R3V A;  2V86 A;  2XEX A;  4FWH A;  4EMD A;  4LFA I;  4HY1 A;  3JAM Q;  2F8B A;  2YT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...