3J80C

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j80C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j80C02
4DR6E 1DARA 4JI4I 1XNQE 1XNRE 5LL6R 4DR3E 4PRVA 1PKPA 4JI7E 4I3HA 3QT8A 2CZ9A 1HNZE 1H74A 1Z0WA 4HACA 4JI2E 4DR6I 4ED4A 1HR0I 4X64I 4UT4A 3B78A 4JI8E 4JV5I 4FWGA 4B3RE 4GKKE 1Z5BA 4DPXA 3OTOI 1Z59A 2ZBKB 4X66E 1Z0CA 3Q1QA 4B3SE 3LPSA 1N33E 5IT9C 3J7AM 2UUAE 4LF4I 3QT5A 4DR5E 3ZM7A 1IBLI 1I94E 3J80Q 4USMA 5L3JA 3J81Q 4DPYA 4PU9A 3JAMC 2XEXA 2V34A 1MG7A 4Z7CA 4LF5E 2A2CA 5A2QC 2A2DA 1BKNA 1HNWE 1NHIA 4X62E 1A6FA 2V8PA 4DR4I 5IT9Q 4M1KA 1KKHA 2HHHE 1IBKE 4WUBA 1D6TA 2UUCI 5IWAE 1ZXNA 2UU9E 1VISA 4DV5I 4JYAI 1N0VC 1HNXE 4UTGA 4DR5I 3T1YE 4KQVA 2HK3A 1KVKA 4FW9A 4DU8A 4DR3I 4HXZA 1N32I 2VQEI 5LMUI 1MX0A 5LMNI 4HYMA 5IWAI 4JI6I 2NPFA 4DV7I 4DV0I 5FLXC 2ZITA 1IBME 4HACB 2V2QA 2UUBE 3WU6A 5A2QQ 1IBMI 4HY1A 4LFCI 1FJGI 3ZKBA 1EI1A 1N0UA 5GMDA 2HFUA 3V2UC 3T1HI 3PYGA 1FNMA 1XMQE 4X65I 4JI1I 1N36E 4LF7I 4JYAE 2WW4A 4DV1E 2UUAI 4Z7YA 4K0KE 3QT7A 4DXLA 3ZZTA 4B3ME 1S4EA 4X66I 2E5LE 4K0KI 1Z0GA 3ZZUA 4GKJE 1XMOE 4MYUA 2UXDI 4LF5I 1KIJA 3PYDA 4AQYE 4DUZI 2R3VA 4GKKI 4FN5A 4DV0E 1Z5AA 4URLA 3PYEA 2F4VE 4USKA 1ZM9A 3WU5A 1S16A 2HFSA 4YHHI 1IBLE 1KTVA 1H73A 4X65E 2VQFI 3ZZ0A 4X64E 1HR0E 1XMQI 2UUCE 1EA6A 2HHHI 3D4JA 2UXCI 1HNZI 1ELOA 4DR4E 4JI3I 4B3SI 4JI6E 4RPFA 4P7AA 2EFGA 4JV5E 1N32E 3J81C 1PVGA 2E5LI 4OX9I 4JG4A 2Q2EB 5BR8I 3J80C 3QT6A 4DPUA 3ZKDA 2VQEE 1RREA 1XHKA 3PYFA 4DR2E 2BV3A 4WUDA 2UXBI 4FWHA 3K17A 3JAMQ 1HNXI 4YHHE 4P52A 4JI5E 1FJGE 4LFBI 4LFCE 4NXNE 1HNWI 1IBKI 4AQYI 2ZM6I 2X7IA 1XNRI 1XNQI 4B3RI 1Z0TA 2R42A 2J7KA 4R1FA 3CWVA 2DEIA 2V2VA 1ZM2A 2BM1A 4B3MI 4KHPE 3T1YI 1QZRA 2UXCE 4JI8I 1OJ4A 1I94I 3B82A 1N36I 4DV5E 4LF7E 4LF8E 1FI4A 4LFAE 2HKJA 4LF4E 1RR9A 2ZM6E 4YY3E 4JI0I 4LFBE 2X36A 4DR2I 2VF3A 1J5EE 4DV2E 4B3TE 4WUCA 2AJ4A 2UU9I 4YY3I 2UXBE 2BM0A 3WU3A 2HK2A 2LJPA 4X62I 2DEJA 1K47A 3K1JA 1NZ0A 4LF6I 5LMNE 5BR8E 4DV1I 4ZVIA 4NXME 1U2RA 1WUUA 1ZM4A 1Z0VA 1N34E 3M6AA 4JI4E 4DV2I 4LF9E 1Z5CA 1N33I 4NXMI 1FWLA 4DUZE 4EMDA 2UXDE 2UUBI 1N34I 1XMOI 3OTOE 2F4VI 3GONA 4FWDA 1ZM3A 5LMUE 4DV3I 4DR7I 4DPTA 2HKEA 4DV6E 4DV3E 1H7SA 4LF6E 2E1RA 3WU4A 1B63A 4JI2I 1Z0BA 4JI3E 4NXNI 1UEKA 4XTJA 3F0NA 3V5RA 4JI1E 3B8HA 4DV4I 2VQFE 3T1HE 3J7AG 4LF8I 1J5EI 3HULA 4MYTA 4PRXA 4JI0E 1H72C 4DR7E 4DR1I 4DUYI 2GS8A 4DUYE 4DV6I 2V2ZA 1PIEA 1ZXMA 4DPWA 3LTOA 4KHPI 4DU7A 4DV7E 3H4LA 2OI2A 4LF9I 1NHJA 4JI5I 4B3TI 4DV4E 4JI7I 5GMEA 4LFAI 1FKAE 1FWKA 5FLXQ 1Z0EA 1NHHA 3LNUA 4DR1E 1B62A 4OX9E 1MU5A 4GKJI 1H7UA
chains in the Genus database with same CATH superfamily
4DR6E 2EN4A 1DARA 3EQ1A 4NHRA 1A1KA 2R1FA 3OMLA 4O5GA 4QNJA 1XNQE 1XNRE 3U1KA 4JI4I 4TUIA 4MU0A 3H09A 4Q28A 5LL6R 4DR3E 2WNRA 2YTNA 3PRYA 2EJ4A 4PRVA 2YTPA 1PKPA 2NN6D 2V88A 4JI7E 3RMPA 1WJPA 4I3HA 1QNTA 3QT8A 1YYKA 2CZ9A 1P47A 2BR2B 1HNZE 2NUEA 4I8OA 5K36F 1H74A 1Z0WA 2GPIA 3ZOQB 2EMBA 4HACA 2DB2A 5EKWA 2YTEA 2M7QA 4JI2E 3AUZA 3IWBA 4OKGA 4ED4A 1HR0I 4DR6I 1T4LB 5AC5A 2EOJA 5JEAF 4X64I 3HPSA 2YTOA 1BBGA 3FIGA 1JK2A 4UT4A 1WRJA 3B78A 3ADJA 5JEAB 2EN6A 1T4OA 2EPNA 2KHXA 5DRRA 5A6AA 4JI8E 2YWQA 1USVA 2EM5A 2FV4B 1YH8A 4JV5I 1RMDA 4B3RE 4FWGA 1AAYA 2LCEA 1UDQA 4WFTA 1GZ6A 2EN3A 2ENCA 1EH6A 2EOQA 1A1HA 2BR2A 1A1FA 2BBGA 3BF2A 4GKKE 1Z5BA 1A1LA 4LCFA 4DPXA 3OTOI 4RH8A 2EOOA 1UBDC 1KYQA 1Z59A 2ZBKB 2JYAA 4AM3A 2LRSA 2YTDA 2EMKA 4X66E 5AE1A 1Z0CA 3HKMA 3UHMA 4IFDE 2HJJA 2EOHA 3Q1QA 4B3SE 3GLLA 3IWCA 3LPSA 1N33E 5IT9C 3J7AM 2DRPA 2DLQA 2LTSA 2VF1A 4WXCA 3DD6A 4IZJA 4FW4A 2UUAE 5C0XA 2PRTA 2JOXA 4LF4I 3QT5A 4DR5E 1UILA 5IXMB 3ZM7A 1IBLI 1I94E 2GHFA 2JY9A 3J80Q 2EPLX 2LT7A 4USMA 3ADGA 4AIMA 4U3BA 2EMFA 5L3JA 1HK7A 3J81Q 4DKKA 1X49A 4DPYA 4PU9A 3JAMC 2MDGA 2XEXA 2V34A 3Q6MA 1PDAA 4AIDA 1R6MA 1MG7A 4Z7CA 1G2DC 4MLVA 4LF5E 5AC4A 2A2CA 5A2QC 3VYXA 4F9AB 3C6KA 2A2DA 1MEYC 1BKNA 1Z1BA 2RQLA 1HNWE 3L00A 2YTIA 1NHIA 5LLQA 2V83A 4X62E 1A6FA 2V8PA 4DR4I 2LVHA 4O24A 3M85G 2JVAA 2M1SA 5IT9Q 4M1KA 1KKHA 2HHHE 2I13A 2ODRC 2RS6A 1IBKE 2O1TA 2V87A 4WUBA 3EPLA 1D6TA 1SFEA 5IWAE 2UUCI 2EN1A 1ZXNA 2EMXA 2YTFA 4IFDF 4U3DA 2UU9E 2EN2A 2VESA 2EQ1A 5K36D 2JXPA 1EH8A 2EZ6A 1VISA 4DV5I 4JYAI 1N0VC 1HNXE 1IMUA 2N8XA 4O4KA 1YYWA 4UTGA 4DR5I 1RQ0A 2JR1A 2PO0B 3T1YE 2CGEA 2V86A 4KQVA 2PNZB 2EP3A 2HK3A 2ENAA 4BCAA 1KVKA 4NBQA 4FW9A 5DROA 2L33A 4DU8A 4DR3I 2KONA 4HXZA 1N32I 1DGCA 2VQEI 2J65A 1MX0A 5LMUI 5LMNI 2GO3A 4HYMA 5IWAI 4KWYA 4JI6I 2NPFA 2ENHA 2EQ0A 4DV0I 4DV7I 1X5WA 3P06A 5FLXC 4GZNC 2ZITA 2EPPA 1IBME 4HACB 4GQUA 4WPYA 1E3HA 2UUBE 2V2QA 2PO1B 4F2JC 2YU5A 2DMYA 3WU6A 3P3GA 2EM6A 5ELWA 2YU8A 5A2QQ 1IBMI 4HY1A 2C37B 2E72A 3LMLA 4LFCI 2B7VA 2EN7A 2C38B 1FJGI 3ZKBA 4OO1A 1EI1A 3Q6NA 2M4IA 1N0UA 3MHSC 1OYSA 2NA2A 2HFUA 3CDIA 5GMDA 2EMHA 2WZOA 4GEQB 3V2UC 4M2ZA 3T1HI 3PYGA 1XMQE 4X8WA 2YRHA 5TSEA 1FNMA 2M9AA 2L3JA 2RS7A 1T4NA 5AE2A 4X65I 4F54A 4JI1I 4RHBB 4X9JA 1N36E 4LF7I 1YUIA 4JYAE 4FK5C 2LMZA 2WW4A 2RTXA 4DV1E 2UUAI 4Z7YA 4K0KE 2D9HA 4HEIA 3QT7A 2E1MA 4DXLA 3ZZTA 4B3ME 2N3GA 4IS9A 2EPKX 1S4EA 2K7IA 2ODRD 1LLMC 4X66I 2LUQA 2E5LE 3VK6A 2L92A 4K0KI 1Z0GA 4BC7A 4GKJE 1XMOE 2Z5EA 2EM9A 4MYUA 3ZZUA 2UXDI 2WBUA 4LF5I 3VYYA 1KIJA 5JEAE 3GMEA 3PYDA 3UK3C 4ISAA 4FW3A 4AQYE 2EOXA 2R3VA 4DUZI 2EMWA 4GKKI 1YUJA 5K36C 2CTDA 2EQ3A 4DV0E 4FN5A 3EPKA 4IZKB 2EOSA 4ZYEA 1Z5AA 4R2AA 4URLA 3PYEA 3HJCA 1DQ3A 2F4VE 4FW5A 4USKA 1ZM9A 3WU5A 2LBSB 1S16A 2HFSA 4YHHI 3DF6A 1IBLE 2PNMA 1KTVA 1H73A 4LOMA 4X65E 4BA1B 1AH5A 4IZJB 2CPNA 2VQFI 3ZZ0A 4X64E 5C0XB 2JEBB 1HR0E 1XMQI 2UUCE 2BB8A 2O1WA 1YSAC 1EA6A 1KJKA 4LCGA 4WX9A 2HGHA 3D4JA 2RSIA 1ZR9A 2HHHI 4IFDC 2UXCI 1X6EA 2LJHA 2RPCA 1YZ9A 2Z5CA 1RC7A 3KRNA 5FWKA 1HNZI 1ELOA 4DR4E 3ECRA 3BIDA 4P78A 3K85A 2DLKA 4JI3I 4NZVA 4B3SI 2MC6A 2CG9A 2EPAA 4JI6E 4OOGC 4RPFA 1QU6A 1NEIA 2Q8UA 2EFGA 4MU4A 4P7AA 5KL5A 2LUPB 2EPRA 4JV5E 1N32E 2VRDA 2KOUA 3J81C 1PVGA 2V85A 2E5LI 4OX9I 4JG4A 2L3CA 2EM4A 5AE3A 2Q2EB 4Q35B 1SR9A 5BR8I 1Y4UA 1BBOA 3J80C 1TN9A 3L7ZB 3QT6A 4DPUA 1PJSA 3ZKDA 2EMCA 2VQEE 1RREA 4IJDA 2WCC3 3MSWA 1TF3A 1P42A 2Z5CB 1XHKA 3B4TA 3PYFA 4DR2E 2EMLA 4ZYDA 2BV3A 4WUDA 2L8TA 1YHCA 2EPMX 1O0WA 4IFDD 4MDTA 2F1DA 2UXBI 1GTKA 2JE6A 4FWHA 1USUA 2GO4A 2V8QB 1Y5YA 3K17A 3JAMQ 1HNXI 5AASA 1X6FA 4YHHE 4P52A 2FGGA 2IOPA 3PS3A 1GQEA 3DJWA 4JI5E 3THOB 3HPZA 1FJGE 4LFBI 4LFCE 2JP9A 4NXNE 4LU9A 2NUFA 1HNWI 1IBKI 4AQYI 2ZM6I 2EORA 2EMZA 2X7IA 1J26A 1XNRI 1XNQI 2CVEA 5DNXA 4B3RI 2IESA 4F6MA 4F6NA 1Z0TA 2R42A 1E3PA 2YTQA 3M7ND 2J7KA 4R1FA 4M30A 5CFFE 3CWVA 2DEIA 2V2VA 2HC5A 1ZM2A 2BM1A 4B3MI 2B7TA 2B9DA 3HTXA 4KHPE 3P76A 3PS2A 2Z5BA 2EM0A 3T1YI 1QZRA 4N3OA 2CSHA 1A1IA 4BA2B 2YSPA 4F9CB 4BMJA 2UXCE 2L2NA 2JT2A 1OJ4A 2MKDA 4JI8I 1I94I 2WBTA 3B82A 4LF7E 4DV5E 2EOFA 1N36I 4LF8E 3LLHA 4LFAE 1X47A 1FI4A 2HKJA 4LF4E 2YZTA 2GLIA 1RR9A 2BA1G 4MQYA 2ZM6E 3PS1A 2IOQA 3QG5C 4YY3E 4OO1B 3F6HA 1WHQA 2EM8A 4JI0I 3KWRA 2B3TB 1ZBQA 4L5NC 4LFBE 2YT4A 2O1VA 2EM3A 1T39A 4R2EA 1J5EE 4DV2E 2VF3A 2X36A 4DR2I 4B3TE 4WUCA 5KL7A 3EPJA 2AJ4A 4LCHA 2UU9I 3M99B 2FTXB 1YYOA 4OZEA 1EH7A 1Y60A 1F2IG 4YY3I 1EKZA 2NUGA 5KL4A 2UXBE 2BM0A 2EMIA 5KL3A 2PO2B 2YPNA 2BA0G 3WU3A 2EOEA 4BS9A 2YSOA 2HK2A 2LJPA 2G7HA 2WP8A 3JU0A 5DRPA 4X62I 2DEJA 1K47A 3K1JA 5K36E 4LPFA 4IS1C 2EOYA 1NZ0A 3M7NG 3ADIA 4LF6I 1VI7A 3M85D 5C0XE 2JWOA 5BR8E 5LMNE 4N4RB 1B69A 4DV1I 2N3HA 4HTGA 2YTGA 1A1GA 4OO1D 4ZVIA 2F8BA 2IERA 2EL6A 3MHHC 1X3CA 4R2RA 4R8OA 4NXME 2L2KB 2EL4A 2C39A 1U2RA 2NN6F 2LTRA 1UHZA 1WUUA 1ZM4A 4QNKA 3BBGA 3J7Yp 2WBSA 1Z0VA 4OO1E 2WP8B 2EPOA 1N34E 4WSPA 2DIXA 3M6AA 4BA1A 2IHR1 4JI4E 1Y6ZA 4WSGA 5KL6A 2GQ0A 4DV2I 5A6BD 3P1XA 2JEBA 2NN6A 3C6MA 2O3ZA 4LF9E 2DMIA 1Z5CA 1YPNA 4IFDA 1N33I 2EOMA 5A6JA 2AE8A 3C4BA 1PJQA 2EPCA 1BB8A 2PO0A 1FWLA 4NXMI 2L6MA 4DUZE 3IWDA 5DNYA 2J7JA 4EMDA 2R76A 3KZZA 5JEAD 2PNZA 1PJTA 2UXDE 4BC9A 2UUBI 1N34I 4R03A 2VE7C 5A69A 5JEAA 2EWLA 4WYQB 1XMOI 2EMYA 4BHCA 3OTOE 2F4VI 3GONA 1OYRA 3BGHA 5C0XF 1R6LA 4FWDA 1ZM3A 4MLQA 4OO1C 2WNRB 2EM7A 3AV0A 4R2CA 2LE2A 3VHTB 5A6BA 1IQSA 5K36B 5LMUE 4DV3I 4DR7I 2LO3A 1RHYA 2HKEA 4DPTA 2EPXA 1MGTA 2ADRA 4TUGA 2DSYA 2NN6B 1L4SA 3C4TA 4DV6E 2C37A 4DV3E 2K4VA 1H7SA 2PO1A 3L7ZA 1XXEA 2NN6E 1N3GA 5DRQA 2C38A 3K6QA 4LF6E 2E1RA 2EMAA 3WU4A 2DGCA 1B63A 5KL2A 1Z0BA 1STUA 1TF6A 4JI3E 4JI2I 2JOBA 4NXNI 2JEAA 3H1CA 1OYPA 1WHNA 2O1UA 4DMIA 4FW7A 2EE8A 1UEKA 3THNA 2ELZA 4XTJA 5JEAC 3F0NA 3V5RA 4JI1E 2JE6B 2PNLA 2Z5BB 5K36A 4O43A 1ZU1A 4LTYA 4BA2A 3B8HA 5T6JA 4DV4I 2BA0D 2VQFE 2L2MA 3T1HE 3J7AG 4LF8I 4J3DA 1J5EI 4BHBA 3HULA 2I9IA 4MYTA 4PRXA 1JK1A 4M9VC 2LJUA 4JI0E 2EMGA 3TQMA 1H72C 3JTZA 5IV8B 4DR7E 4DR1I 1Y4SA 1UN6B 4DUYI 2JEAB 1A1JA 2GS8A 2YRMA 4DUYE 4DV6I 4R2DA 2V2ZA 4MU3A 1PIEA 4MU1A 1ZXMA 2EPZA 5C0XD 4OO1F 1UDOA 2V89A 1IQOA 4DPWA 1X48A 2BA1D 4IZJD 4IZKA 3F6GA 3LTOA 4KHPI 2EM2A 1UDSA 1ZBTA 4DU7A 1ZAAC 4F9BB 2PO2A 3EPHA 3CDJA 4DV7E 2ELYA 3H4LA 4M0VA 1NCSA 1G2FC 2OI2A 5F3WA 4ZYGA 4LF9I 2NABA 4R2QA 2LV2A 1NHJA 2CT1A 2MC5A 1UDNA 3NZKA 4JI5I 5A6KA 3P3EA 4B3TI 3KZYA 2EL5A 4DV4E 5ADZA 4JI7I 4L8NA 2EOZA 2MKNA 2YTJA 2YRKA 3ADLA 4FW6A 5GMEA 1X6HA 4LFAI 2JPAA 2RSMA 5EL9A 2NN6C 1FKAE 1FWKA 5FLXQ 2MDRA 4J8ZA 2C39B 2H36X 4WXDA 1Z0EA 5C0XC 1DI2A 4R2SA 1NHHA 3LNUA 5DNLA 4DR1E 2EOIA 1B62A 4BBYA 4OX9E 4R2PA 2EPUA 3HQ1A 3U1YA 4ZYHA 4IFDB 1MU5A 4KZSA 2A25A 4P7DA 4GKJI 2EN8A 3HXLA 1WXRA 3GCMA 1T38A 3P3CA 1H7UA 1YFHA
chains in the Genus database with same CATH topology
4DR6E 1DARA 3OMLA 4JI4I 1XNQE 1XNRE 4TUIA 3H09A 4Q28A 5LL6R 4DR3E 3PRYA 4PRVA 1PKPA 2V88A 4JI7E 3RMPA 4I3HA 3QT8A 1YYKA 2CZ9A 1HNZE 2NUEA 4I8OA 1H74A 1Z0WA 3ZOQB 4HACA 2DB2A 2M7QA 4JI2E 4DR6I 3AUZA 3IWBA 4ED4A 1HR0I 1T4LB 4X64I 3HPSA 3FIGA 4UT4A 3B78A 3ADJA 1T4OA 2KHXA 4JI8E 1USVA 2FV4B 4JV5I 4B3RE 4FWGA 4WFTA 1GZ6A 4GKKE 1Z5BA 4DPXA 3OTOI 1Z59A 2ZBKB 2LRSA 4X66E 5AE1A 1Z0CA 3Q1QA 4B3SE 3IWCA 3LPSA 1N33E 5IT9C 3J7AM 4IZJA 2VF1A 2LTSA 2UUAE 2JOXA 4LF4I 3QT5A 4DR5E 1UILA 3ZM7A 1IBLI 1I94E 2JY9A 3J80Q 4USMA 3ADGA 5L3JA 1HK7A 3J81Q 4DKKA 1X49A 4DPYA 4PU9A 3JAMC 2XEXA 2V34A 3Q6MA 1MG7A 4Z7CA 4LF5E 2A2CA 5A2QC 3VYXA 4F9AB 2A2DA 1BKNA 1HNWE 1NHIA 2V83A 4X62E 1A6FA 2V8PA 4DR4I 2JVAA 2M1SA 5IT9Q 4M1KA 1KKHA 2HHHE 2ODRC 2RS6A 1IBKE 2O1TA 2V87A 4WUBA 1D6TA 2UUCI 5IWAE 1ZXNA 2UU9E 2EZ6A 1VISA 4DV5I 4JYAI 1N0VC 1HNXE 1YYWA 4UTGA 4DR5I 1RQ0A 2JR1A 3T1YE 2CGEA 2V86A 4KQVA 2HK3A 4BCAA 1KVKA 4FW9A 4DU8A 2L33A 4DR3I 2KONA 4HXZA 1N32I 2VQEI 5LMUI 1MX0A 5LMNI 4HYMA 5IWAI 4JI6I 2NPFA 4DV7I 4DV0I 3P06A 5FLXC 2ZITA 1IBME 4HACB 4WPYA 2UUBE 2V2QA 3WU6A 2DMYA 5A2QQ 1IBMI 4HY1A 3LMLA 4LFCI 2B7VA 1FJGI 3ZKBA 1EI1A 3Q6NA 2M4IA 1N0UA 5GMDA 2HFUA 2NA2A 2WZOA 4GEQB 3V2UC 4M2ZA 3T1HI 3PYGA 1XMQE 4X8WA 1FNMA 2L3JA 2RS7A 1T4NA 5AE2A 4X65I 4F54A 4JI1I 1N36E 4LF7I 4JYAE 2LMZA 2WW4A 2RTXA 4DV1E 2UUAI 4Z7YA 4K0KE 3QT7A 4DXLA 2E1MA 3ZZTA 4B3ME 2N3GA 1S4EA 4X66I 2ODRD 2LUQA 2E5LE 3VK6A 2L92A 4K0KI 1Z0GA 4BC7A 4GKJE 1XMOE 2Z5EA 3ZZUA 4MYUA 2UXDI 4LF5I 3VYYA 1KIJA 3PYDA 4AQYE 4DUZI 2R3VA 4GKKI 4DV0E 4FN5A 4IZKB 1Z5AA 4URLA 3PYEA 3HJCA 1DQ3A 2F4VE 4USKA 1ZM9A 3WU5A 2LBSB 1S16A 2HFSA 4YHHI 3DF6A 1IBLE 2PNMA 1KTVA 1H73A 4X65E 4IZJB 2CPNA 2VQFI 3ZZ0A 4X64E 1HR0E 1XMQI 2UUCE 2O1WA 1EA6A 2HHHI 3D4JA 2UXCI 5FWKA 2LJHA 1YZ9A 2Z5CA 1RC7A 1HNZI 1ELOA 4DR4E 4P78A 3K85A 4JI3I 4B3SI 2MC6A 2CG9A 4JI6E 4OOGC 4RPFA 1QU6A 4P7AA 2EFGA 2LUPB 4JV5E 1N32E 2KOUA 3J81C 1PVGA 2V85A 2E5LI 4OX9I 4JG4A 2L3CA 5AE3A 2Q2EB 1SR9A 5BR8I 1Y4UA 3J80C 3QT6A 4DPUA 3ZKDA 2VQEE 1RREA 3MSWA 2Z5CB 1XHKA 3PYFA 4DR2E 2BV3A 4WUDA 2L8TA 1O0WA 2UXBI 4FWHA 1USUA 2V8QB 3K17A 3JAMQ 1HNXI 5AASA 4YHHE 4P52A 2FGGA 2IOPA 1GQEA 3DJWA 4JI5E 3HPZA 1FJGE 4LFBI 4LFCE 4NXNE 4LU9A 2NUFA 1HNWI 1IBKI 4AQYI 2ZM6I 2X7IA 1J26A 1XNRI 1XNQI 4B3RI 1Z0TA 2R42A 2J7KA 4R1FA 4M30A 5CFFE 3CWVA 2DEIA 2V2VA 1ZM2A 2BM1A 4B3MI 2B7TA 2B9DA 3HTXA 4KHPE 3T1YI 2Z5BA 1QZRA 4N3OA 4F9CB 4BMJA 2UXCE 2L2NA 4JI8I 1OJ4A 1I94I 3B82A 4LF7E 4DV5E 1N36I 4LF8E 3LLHA 4LFAE 1X47A 1FI4A 2HKJA 4LF4E 2YZTA 1RR9A 2ZM6E 2IOQA 4YY3E 3F6HA 1WHQA 4JI0I 3KWRA 2B3TB 1ZBQA 4L5NC 4LFBE 2YT4A 2O1VA 2X36A 2VF3A 4DR2I 1J5EE 4DV2E 4B3TE 4WUCA 2AJ4A 2UU9I 2FTXB 1YYOA 4YY3I 1EKZA 2NUGA 2UXBE 2BM0A 3WU3A 4BS9A 2HK2A 2LJPA 2G7HA 3JU0A 4X62I 2DEJA 1K47A 3K1JA 1NZ0A 3ADIA 4LF6I 2JWOA 5BR8E 5LMNE 4DV1I 2N3HA 4ZVIA 2F8BA 4R8OA 4NXME 2L2KB 1U2RA 2LTRA 1UHZA 1WUUA 1ZM4A 3J7Yp 1Z0VA 1N34E 4WSPA 2DIXA 3M6AA 2IHR1 1Y6ZA 4JI4E 2GQ0A 4DV2I 3P1XA 4LF9E 1Z5CA 1N33I 3C4BA 4NXMI 1FWLA 2L6MA 4DUZE 3IWDA 5DNYA 4EMDA 2UXDE 4BC9A 2UUBI 1N34I 4R03A 2VE7C 1XMOI 2EWLA 4WYQB 3OTOE 2F4VI 3GONA 4FWDA 1ZM3A 3AV0A 2LE2A 5LMUE 4DV3I 4DR7I 4DPTA 2HKEA 4TUGA 2DSYA 3C4TA 4DV6E 4DV3E 2K4VA 1H7SA 3K6QA 4LF6E 2E1RA 3WU4A 1B63A 4JI2I 1Z0BA 1STUA 4JI3E 2JOBA 4NXNI 1WHNA 2O1UA 4DMIA 1UEKA 4XTJA 3F0NA 3V5RA 4JI1E 2PNLA 2Z5BB 4LTYA 3B8HA 5T6JA 4DV4I 2VQFE 2L2MA 3T1HE 3J7AG 4LF8I 1J5EI 3HULA 4MYTA 4PRXA 4JI0E 1H72C 3JTZA 4DR7E 4DR1I 1Y4SA 4DUYI 2GS8A 4DUYE 4DV6I 2V2ZA 1PIEA 1ZXMA 2V89A 4DPWA 1X48A 4IZJD 4IZKA 3F6GA 3LTOA 4KHPI 1ZBTA 4DU7A 4F9BB 4DV7E 3H4LA 4M0VA 2OI2A 4LF9I 5F3WA 1NHJA 2MC5A 4JI5I 4B3TI 4DV4E 5ADZA 4JI7I 4L8NA 3ADLA 5GMEA 4LFAI 2RSMA 1FKAE 1FWKA 5FLXQ 2MDRA 4J8ZA 2H36X 1Z0EA 1DI2A 1NHHA 3LNUA 4DR1E 1B62A 4BBYA 4OX9E 3HQ1A 1MU5A 4KZSA 4P7DA 4GKJI 3HXLA 1WXRA 1H7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 E;  1DAR A;  4JI4 I;  1XNQ E;  1XNR E;  5LL6 R;  4DR3 E;  4PRV A;  1PKP A;  4JI7 E;  4I3H A;  3QT8 A;  2CZ9 A;  1HNZ E;  1H74 A;  1Z0W A;  4HAC A;  4JI2 E;  4DR6 I;  4ED4 A;  1HR0 I;  4X64 I;  4UT4 A;  3B78 A;  4JI8 E;  4JV5 I;  4FWG A;  4B3R E;  4GKK E;  1Z5B A;  4DPX A;  3OTO I;  1Z59 A;  2ZBK B;  4X66 E;  1Z0C A;  3Q1Q A;  4B3S E;  3LPS A;  1N33 E;  5IT9 C;  3J7A M;  2UUA E;  4LF4 I;  3QT5 A;  4DR5 E;  3ZM7 A;  1IBL I;  1I94 E;  3J80 Q;  4USM A;  5L3J A;  3J81 Q;  4DPY A;  4PU9 A;  3JAM C;  2XEX A;  2V34 A;  1MG7 A;  4Z7C A;  4LF5 E;  2A2C A;  5A2Q C;  2A2D A;  1BKN A;  1HNW E;  1NHI A;  4X62 E;  1A6F A;  2V8P A;  4DR4 I;  5IT9 Q;  4M1K A;  1KKH A;  2HHH E;  1IBK E;  4WUB A;  1D6T A;  2UUC I;  5IWA E;  1ZXN A;  2UU9 E;  1VIS A;  4DV5 I;  4JYA I;  1N0V C;  1HNX E;  4UTG A;  4DR5 I;  3T1Y E;  4KQV A;  2HK3 A;  1KVK A;  4FW9 A;  4DU8 A;  4DR3 I;  4HXZ A;  1N32 I;  2VQE I;  5LMU I;  1MX0 A;  5LMN I;  4HYM A;  5IWA I;  4JI6 I;  2NPF A;  4DV7 I;  4DV0 I;  5FLX C;  2ZIT A;  1IBM E;  4HAC B;  2V2Q A;  2UUB E;  3WU6 A;  5A2Q Q;  1IBM I;  4HY1 A;  4LFC I;  1FJG I;  3ZKB A;  1EI1 A;  1N0U A;  5GMD A;  2HFU A;  3V2U C;  3T1H I;  3PYG A;  1FNM A;  1XMQ E;  4X65 I;  4JI1 I;  1N36 E;  4LF7 I;  4JYA E;  2WW4 A;  4DV1 E;  2UUA I;  4Z7Y A;  4K0K E;  3QT7 A;  4DXL A;  3ZZT A;  4B3M E;  1S4E A;  4X66 I;  2E5L E;  4K0K I;  1Z0G A;  3ZZU A;  4GKJ E;  1XMO E;  4MYU A;  2UXD I;  4LF5 I;  1KIJ A;  3PYD A;  4AQY E;  4DUZ I;  2R3V A;  4GKK I;  4FN5 A;  4DV0 E;  1Z5A A;  4URL A;  3PYE A;  2F4V E;  4USK A;  1ZM9 A;  3WU5 A;  1S16 A;  2HFS A;  4YHH I;  1IBL E;  1KTV A;  1H73 A;  4X65 E;  2VQF I;  3ZZ0 A;  4X64 E;  1HR0 E;  1XMQ I;  2UUC E;  1EA6 A;  2HHH I;  3D4J A;  2UXC I;  1HNZ I;  1ELO A;  4DR4 E;  4JI3 I;  4B3S I;  4JI6 E;  4RPF A;  4P7A A;  2EFG A;  4JV5 E;  1N32 E;  3J81 C;  1PVG A;  2E5L I;  4OX9 I;  4JG4 A;  2Q2E B;  5BR8 I;  3J80 C;  3QT6 A;  4DPU A;  3ZKD A;  2VQE E;  1RRE A;  1XHK A;  3PYF A;  4DR2 E;  2BV3 A;  4WUD A;  2UXB I;  4FWH A;  3K17 A;  3JAM Q;  1HNX I;  4YHH E;  4P52 A;  4JI5 E;  1FJG E;  4LFB I;  4LFC E;  4NXN E;  1HNW I;  1IBK I;  4AQY I;  2ZM6 I;  2X7I A;  1XNR I;  1XNQ I;  4B3R I;  1Z0T A;  2R42 A;  2J7K A;  4R1F A;  3CWV A;  2DEI A;  2V2V A;  1ZM2 A;  2BM1 A;  4B3M I;  4KHP E;  3T1Y I;  1QZR A;  2UXC E;  4JI8 I;  1OJ4 A;  1I94 I;  3B82 A;  1N36 I;  4DV5 E;  4LF7 E;  4LF8 E;  1FI4 A;  4LFA E;  2HKJ A;  4LF4 E;  1RR9 A;  2ZM6 E;  4YY3 E;  4JI0 I;  4LFB E;  2X36 A;  4DR2 I;  2VF3 A;  1J5E E;  4DV2 E;  4B3T E;  4WUC A;  2AJ4 A;  2UU9 I;  4YY3 I;  2UXB E;  2BM0 A;  3WU3 A;  2HK2 A;  2LJP A;  4X62 I;  2DEJ A;  1K47 A;  3K1J A;  1NZ0 A;  4LF6 I;  5LMN E;  5BR8 E;  4DV1 I;  4ZVI A;  4NXM E;  1U2R A;  1WUU A;  1ZM4 A;  1Z0V A;  1N34 E;  3M6A A;  4JI4 E;  4DV2 I;  4LF9 E;  1Z5C A;  1N33 I;  4NXM I;  1FWL A;  4DUZ E;  4EMD A;  2UXD E;  2UUB I;  1N34 I;  1XMO I;  3OTO E;  2F4V I;  3GON A;  4FWD A;  1ZM3 A;  5LMU E;  4DV3 I;  4DR7 I;  4DPT A;  2HKE A;  4DV6 E;  4DV3 E;  1H7S A;  4LF6 E;  2E1R A;  3WU4 A;  1B63 A;  4JI2 I;  1Z0B A;  4JI3 E;  4NXN I;  1UEK A;  4XTJ A;  3F0N A;  3V5R A;  4JI1 E;  3B8H A;  4DV4 I;  2VQF E;  3T1H E;  3J7A G;  4LF8 I;  1J5E I;  3HUL A;  4MYT A;  4PRX A;  4JI0 E;  1H72 C;  4DR7 E;  4DR1 I;  4DUY I;  2GS8 A;  4DUY E;  4DV6 I;  2V2Z A;  1PIE A;  1ZXM A;  4DPW A;  3LTO A;  4KHP I;  4DU7 A;  4DV7 E;  3H4L A;  2OI2 A;  4LF9 I;  1NHJ A;  4JI5 I;  4B3T I;  4DV4 E;  4JI7 I;  5GME A;  4LFA I;  1FKA E;  1FWK A;  5FLX Q;  1Z0E A;  1NHH A;  3LNU A;  4DR1 E;  1B62 A;  4OX9 E;  1MU5 A;  4GKJ I;  1H7U A; 
#chains in the Genus database with same CATH topology
 4DR6 E;  2EN4 A;  1DAR A;  3EQ1 A;  4NHR A;  1A1K A;  2R1F A;  3OML A;  4O5G A;  4QNJ A;  1XNQ E;  1XNR E;  3U1K A;  4JI4 I;  4TUI A;  4MU0 A;  3H09 A;  4Q28 A;  5LL6 R;  4DR3 E;  2WNR A;  2YTN A;  3PRY A;  2EJ4 A;  4PRV A;  2YTP A;  1PKP A;  2NN6 D;  2V88 A;  4JI7 E;  3RMP A;  1WJP A;  4I3H A;  1QNT A;  3QT8 A;  1YYK A;  2CZ9 A;  1P47 A;  2BR2 B;  1HNZ E;  2NUE A;  4I8O A;  5K36 F;  1H74 A;  1Z0W A;  2GPI A;  3ZOQ B;  2EMB A;  4HAC A;  2DB2 A;  5EKW A;  2YTE A;  2M7Q A;  4JI2 E;  3AUZ A;  3IWB A;  4OKG A;  4ED4 A;  1HR0 I;  4DR6 I;  1T4L B;  5AC5 A;  2EOJ A;  5JEA F;  4X64 I;  3HPS A;  2YTO A;  1BBG A;  3FIG A;  1JK2 A;  4UT4 A;  1WRJ A;  3B78 A;  3ADJ A;  5JEA B;  2EN6 A;  1T4O A;  2EPN A;  2KHX A;  5DRR A;  5A6A A;  4JI8 E;  2YWQ A;  1USV A;  2EM5 A;  2FV4 B;  1YH8 A;  4JV5 I;  1RMD A;  4B3R E;  4FWG A;  1AAY A;  2LCE A;  1UDQ A;  4WFT A;  1GZ6 A;  2EN3 A;  2ENC A;  1EH6 A;  2EOQ A;  1A1H A;  2BR2 A;  1A1F A;  2BBG A;  3BF2 A;  4GKK E;  1Z5B A;  1A1L A;  4LCF A;  4DPX A;  3OTO I;  4RH8 A;  2EOO A;  1UBD C;  1KYQ A;  1Z59 A;  2ZBK B;  2JYA A;  4AM3 A;  2LRS A;  2YTD A;  2EMK A;  4X66 E;  5AE1 A;  1Z0C A;  3HKM A;  3UHM A;  4IFD E;  2HJJ A;  2EOH A;  3Q1Q A;  4B3S E;  3GLL A;  3IWC A;  3LPS A;  1N33 E;  5IT9 C;  3J7A M;  2DRP A;  2DLQ A;  2LTS A;  2VF1 A;  4WXC A;  3DD6 A;  4IZJ A;  4FW4 A;  2UUA E;  5C0X A;  2PRT A;  2JOX A;  4LF4 I;  3QT5 A;  4DR5 E;  1UIL A;  5IXM B;  3ZM7 A;  1IBL I;  1I94 E;  2GHF A;  2JY9 A;  3J80 Q;  2EPL X;  2LT7 A;  4USM A;  3ADG A;  4AIM A;  4U3B A;  2EMF A;  5L3J A;  1HK7 A;  3J81 Q;  4DKK A;  1X49 A;  4DPY A;  4PU9 A;  3JAM C;  2MDG A;  2XEX A;  2V34 A;  3Q6M A;  1PDA A;  4AID A;  1R6M A;  1MG7 A;  4Z7C A;  1G2D C;  4MLV A;  4LF5 E;  5AC4 A;  2A2C A;  5A2Q C;  3VYX A;  4F9A B;  3C6K A;  2A2D A;  1MEY C;  1BKN A;  1Z1B A;  2RQL A;  1HNW E;  3L00 A;  2YTI A;  1NHI A;  5LLQ A;  2V83 A;  4X62 E;  1A6F A;  2V8P A;  4DR4 I;  2LVH A;  4O24 A;  3M85 G;  2JVA A;  2M1S A;  5IT9 Q;  4M1K A;  1KKH A;  2HHH E;  2I13 A;  2ODR C;  2RS6 A;  1IBK E;  2O1T A;  2V87 A;  4WUB A;  3EPL A;  1D6T A;  1SFE A;  5IWA E;  2UUC I;  2EN1 A;  1ZXN A;  2EMX A;  2YTF A;  4IFD F;  4U3D A;  2UU9 E;  2EN2 A;  2VES A;  2EQ1 A;  5K36 D;  2JXP A;  1EH8 A;  2EZ6 A;  1VIS A;  4DV5 I;  4JYA I;  1N0V C;  1HNX E;  1IMU A;  2N8X A;  4O4K A;  1YYW A;  4UTG A;  4DR5 I;  1RQ0 A;  2JR1 A;  2PO0 B;  3T1Y E;  2CGE A;  2V86 A;  4KQV A;  2PNZ B;  2EP3 A;  2HK3 A;  2ENA A;  4BCA A;  1KVK A;  4NBQ A;  4FW9 A;  5DRO A;  2L33 A;  4DU8 A;  4DR3 I;  2KON A;  4HXZ A;  1N32 I;  1DGC A;  2VQE I;  2J65 A;  1MX0 A;  5LMU I;  5LMN I;  2GO3 A;  4HYM A;  5IWA I;  4KWY A;  4JI6 I;  2NPF A;  2ENH A;  2EQ0 A;  4DV0 I;  4DV7 I;  1X5W A;  3P06 A;  5FLX C;  4GZN C;  2ZIT A;  2EPP A;  1IBM E;  4HAC B;  4GQU A;  4WPY A;  1E3H A;  2UUB E;  2V2Q A;  2PO1 B;  4F2J C;  2YU5 A;  2DMY A;  3WU6 A;  3P3G A;  2EM6 A;  5ELW A;  2YU8 A;  5A2Q Q;  1IBM I;  4HY1 A;  2C37 B;  2E72 A;  3LML A;  4LFC I;  2B7V A;  2EN7 A;  2C38 B;  1FJG I;  3ZKB A;  4OO1 A;  1EI1 A;  3Q6N A;  2M4I A;  1N0U A;  3MHS C;  1OYS A;  2NA2 A;  2HFU A;  3CDI A;  5GMD A;  2EMH A;  2WZO A;  4GEQ B;  3V2U C;  4M2Z A;  3T1H I;  3PYG A;  1XMQ E;  4X8W A;  2YRH A;  5TSE A;  1FNM A;  2M9A A;  2L3J A;  2RS7 A;  1T4N A;  5AE2 A;  4X65 I;  4F54 A;  4JI1 I;  4RHB B;  4X9J A;  1N36 E;  4LF7 I;  1YUI A;  4JYA E;  4FK5 C;  2LMZ A;  2WW4 A;  2RTX A;  4DV1 E;  2UUA I;  4Z7Y A;  4K0K E;  2D9H A;  4HEI A;  3QT7 A;  2E1M A;  4DXL A;  3ZZT A;  4B3M E;  2N3G A;  4IS9 A;  2EPK X;  1S4E A;  2K7I A;  2ODR D;  1LLM C;  4X66 I;  2LUQ A;  2E5L E;  3VK6 A;  2L92 A;  4K0K I;  1Z0G A;  4BC7 A;  4GKJ E;  1XMO E;  2Z5E A;  2EM9 A;  4MYU A;  3ZZU A;  2UXD I;  2WBU A;  4LF5 I;  3VYY A;  1KIJ A;  5JEA E;  3GME A;  3PYD A;  3UK3 C;  4ISA A;  4FW3 A;  4AQY E;  2EOX A;  2R3V A;  4DUZ I;  2EMW A;  4GKK I;  1YUJ A;  5K36 C;  2CTD A;  2EQ3 A;  4DV0 E;  4FN5 A;  3EPK A;  4IZK B;  2EOS A;  4ZYE A;  1Z5A A;  4R2A A;  4URL A;  3PYE A;  3HJC A;  1DQ3 A;  2F4V E;  4FW5 A;  4USK A;  1ZM9 A;  3WU5 A;  2LBS B;  1S16 A;  2HFS A;  4YHH I;  3DF6 A;  1IBL E;  2PNM A;  1KTV A;  1H73 A;  4LOM A;  4X65 E;  4BA1 B;  1AH5 A;  4IZJ B;  2CPN A;  2VQF I;  3ZZ0 A;  4X64 E;  5C0X B;  2JEB B;  1HR0 E;  1XMQ I;  2UUC E;  2BB8 A;  2O1W A;  1YSA C;  1EA6 A;  1KJK A;  4LCG A;  4WX9 A;  2HGH A;  3D4J A;  2RSI A;  1ZR9 A;  2HHH I;  4IFD C;  2UXC I;  1X6E A;  2LJH A;  2RPC A;  1YZ9 A;  2Z5C A;  1RC7 A;  3KRN A;  5FWK A;  1HNZ I;  1ELO A;  4DR4 E;  3ECR A;  3BID A;  4P78 A;  3K85 A;  2DLK A;  4JI3 I;  4NZV A;  4B3S I;  2MC6 A;  2CG9 A;  2EPA A;  4JI6 E;  4OOG C;  4RPF A;  1QU6 A;  1NEI A;  2Q8U A;  2EFG A;  4MU4 A;  4P7A A;  5KL5 A;  2LUP B;  2EPR A;  4JV5 E;  1N32 E;  2VRD A;  2KOU A;  3J81 C;  1PVG A;  2V85 A;  2E5L I;  4OX9 I;  4JG4 A;  2L3C A;  2EM4 A;  5AE3 A;  2Q2E B;  4Q35 B;  1SR9 A;  5BR8 I;  1Y4U A;  1BBO A;  3J80 C;  1TN9 A;  3L7Z B;  3QT6 A;  4DPU A;  1PJS A;  3ZKD A;  2EMC A;  2VQE E;  1RRE A;  4IJD A;  2WCC 3;  3MSW A;  1TF3 A;  1P42 A;  2Z5C B;  1XHK A;  3B4T A;  3PYF A;  4DR2 E;  2EML A;  4ZYD A;  2BV3 A;  4WUD A;  2L8T A;  1YHC A;  2EPM X;  1O0W A;  4IFD D;  4MDT A;  2F1D A;  2UXB I;  1GTK A;  2JE6 A;  4FWH A;  1USU A;  2GO4 A;  2V8Q B;  1Y5Y A;  3K17 A;  3JAM Q;  1HNX I;  5AAS A;  1X6F A;  4YHH E;  4P52 A;  2FGG A;  2IOP A;  3PS3 A;  1GQE A;  3DJW A;  4JI5 E;  3THO B;  3HPZ A;  1FJG E;  4LFB I;  4LFC E;  2JP9 A;  4NXN E;  4LU9 A;  2NUF A;  1HNW I;  1IBK I;  4AQY I;  2ZM6 I;  2EOR A;  2EMZ A;  2X7I A;  1J26 A;  1XNR I;  1XNQ I;  2CVE A;  5DNX A;  4B3R I;  2IES A;  4F6M A;  4F6N A;  1Z0T A;  2R42 A;  1E3P A;  2YTQ A;  3M7N D;  2J7K A;  4R1F A;  4M30 A;  5CFF E;  3CWV A;  2DEI A;  2V2V A;  2HC5 A;  1ZM2 A;  2BM1 A;  4B3M I;  2B7T A;  2B9D A;  3HTX A;  4KHP E;  3P76 A;  3PS2 A;  2Z5B A;  2EM0 A;  3T1Y I;  1QZR A;  4N3O A;  2CSH A;  1A1I A;  4BA2 B;  2YSP A;  4F9C B;  4BMJ A;  2UXC E;  2L2N A;  2JT2 A;  1OJ4 A;  2MKD A;  4JI8 I;  1I94 I;  2WBT A;  3B82 A;  4LF7 E;  4DV5 E;  2EOF A;  1N36 I;  4LF8 E;  3LLH A;  4LFA E;  1X47 A;  1FI4 A;  2HKJ A;  4LF4 E;  2YZT A;  2GLI A;  1RR9 A;  2BA1 G;  4MQY A;  2ZM6 E;  3PS1 A;  2IOQ A;  3QG5 C;  4YY3 E;  4OO1 B;  3F6H A;  1WHQ A;  2EM8 A;  4JI0 I;  3KWR A;  2B3T B;  1ZBQ A;  4L5N C;  4LFB E;  2YT4 A;  2O1V A;  2EM3 A;  1T39 A;  4R2E A;  1J5E E;  4DV2 E;  2VF3 A;  2X36 A;  4DR2 I;  4B3T E;  4WUC A;  5KL7 A;  3EPJ A;  2AJ4 A;  4LCH A;  2UU9 I;  3M99 B;  2FTX B;  1YYO A;  4OZE A;  1EH7 A;  1Y60 A;  1F2I G;  4YY3 I;  1EKZ A;  2NUG A;  5KL4 A;  2UXB E;  2BM0 A;  2EMI A;  5KL3 A;  2PO2 B;  2YPN A;  2BA0 G;  3WU3 A;  2EOE A;  4BS9 A;  2YSO A;  2HK2 A;  2LJP A;  2G7H A;  2WP8 A;  3JU0 A;  5DRP A;  4X62 I;  2DEJ A;  1K47 A;  3K1J A;  5K36 E;  4LPF A;  4IS1 C;  2EOY A;  1NZ0 A;  3M7N G;  3ADI A;  4LF6 I;  1VI7 A;  3M85 D;  5C0X E;  2JWO A;  5BR8 E;  5LMN E;  4N4R B;  1B69 A;  4DV1 I;  2N3H A;  4HTG A;  2YTG A;  1A1G A;  4OO1 D;  4ZVI A;  2F8B A;  2IER A;  2EL6 A;  3MHH C;  1X3C A;  4R2R A;  4R8O A;  4NXM E;  2L2K B;  2EL4 A;  2C39 A;  1U2R A;  2NN6 F;  2LTR A;  1UHZ A;  1WUU A;  1ZM4 A;  4QNK A;  3BBG A;  3J7Y p;  2WBS A;  1Z0V A;  4OO1 E;  2WP8 B;  2EPO A;  1N34 E;  4WSP A;  2DIX A;  3M6A A;  4BA1 A;  2IHR 1;  4JI4 E;  1Y6Z A;  4WSG A;  5KL6 A;  2GQ0 A;  4DV2 I;  5A6B D;  3P1X A;  2JEB A;  2NN6 A;  3C6M A;  2O3Z A;  4LF9 E;  2DMI A;  1Z5C A;  1YPN A;  4IFD A;  1N33 I;  2EOM A;  5A6J A;  2AE8 A;  3C4B A;  1PJQ A;  2EPC A;  1BB8 A;  2PO0 A;  1FWL A;  4NXM I;  2L6M A;  4DUZ E;  3IWD A;  5DNY A;  2J7J A;  4EMD A;  2R76 A;  3KZZ A;  5JEA D;  2PNZ A;  1PJT A;  2UXD E;  4BC9 A;  2UUB I;  1N34 I;  4R03 A;  2VE7 C;  5A69 A;  5JEA A;  2EWL A;  4WYQ B;  1XMO I;  2EMY A;  4BHC A;  3OTO E;  2F4V I;  3GON A;  1OYR A;  3BGH A;  5C0X F;  1R6L A;  4FWD A;  1ZM3 A;  4MLQ A;  4OO1 C;  2WNR B;  2EM7 A;  3AV0 A;  4R2C A;  2LE2 A;  3VHT B;  5A6B A;  1IQS A;  5K36 B;  5LMU E;  4DV3 I;  4DR7 I;  2LO3 A;  1RHY A;  2HKE A;  4DPT A;  2EPX A;  1MGT A;  2ADR A;  4TUG A;  2DSY A;  2NN6 B;  1L4S A;  3C4T A;  4DV6 E;  2C37 A;  4DV3 E;  2K4V A;  1H7S A;  2PO1 A;  3L7Z A;  1XXE A;  2NN6 E;  1N3G A;  5DRQ A;  2C38 A;  3K6Q A;  4LF6 E;  2E1R A;  2EMA A;  3WU4 A;  2DGC A;  1B63 A;  5KL2 A;  1Z0B A;  1STU A;  1TF6 A;  4JI3 E;  4JI2 I;  2JOB A;  4NXN I;  2JEA A;  3H1C A;  1OYP A;  1WHN A;  2O1U A;  4DMI A;  4FW7 A;  2EE8 A;  1UEK A;  3THN A;  2ELZ A;  4XTJ A;  5JEA C;  3F0N A;  3V5R A;  4JI1 E;  2JE6 B;  2PNL A;  2Z5B B;  5K36 A;  4O43 A;  1ZU1 A;  4LTY A;  4BA2 A;  3B8H A;  5T6J A;  4DV4 I;  2BA0 D;  2VQF E;  2L2M A;  3T1H E;  3J7A G;  4LF8 I;  4J3D A;  1J5E I;  4BHB A;  3HUL A;  2I9I A;  4MYT A;  4PRX A;  1JK1 A;  4M9V C;  2LJU A;  4JI0 E;  2EMG A;  3TQM A;  1H72 C;  3JTZ A;  5IV8 B;  4DR7 E;  4DR1 I;  1Y4S A;  1UN6 B;  4DUY I;  2JEA B;  1A1J A;  2GS8 A;  2YRM A;  4DUY E;  4DV6 I;  4R2D A;  2V2Z A;  4MU3 A;  1PIE A;  4MU1 A;  1ZXM A;  2EPZ A;  5C0X D;  4OO1 F;  1UDO A;  2V89 A;  1IQO A;  4DPW A;  1X48 A;  2BA1 D;  4IZJ D;  4IZK A;  3F6G A;  3LTO A;  4KHP I;  2EM2 A;  1UDS A;  1ZBT A;  4DU7 A;  1ZAA C;  4F9B B;  2PO2 A;  3EPH A;  3CDJ A;  4DV7 E;  2ELY A;  3H4L A;  4M0V A;  1NCS A;  1G2F C;  2OI2 A;  5F3W A;  4ZYG A;  4LF9 I;  2NAB A;  4R2Q A;  2LV2 A;  1NHJ A;  2CT1 A;  2MC5 A;  1UDN A;  3NZK A;  4JI5 I;  5A6K A;  3P3E A;  4B3T I;  3KZY A;  2EL5 A;  4DV4 E;  5ADZ A;  4JI7 I;  4L8N A;  2EOZ A;  2MKN A;  2YTJ A;  2YRK A;  3ADL A;  4FW6 A;  5GME A;  1X6H A;  4LFA I;  2JPA A;  2RSM A;  5EL9 A;  2NN6 C;  1FKA E;  1FWK A;  5FLX Q;  2MDR A;  4J8Z A;  2C39 B;  2H36 X;  4WXD A;  1Z0E A;  5C0X C;  1DI2 A;  4R2S A;  1NHH A;  3LNU A;  5DNL A;  4DR1 E;  2EOI A;  1B62 A;  4BBY A;  4OX9 E;  4R2P A;  2EPU A;  3HQ1 A;  3U1Y A;  4ZYH A;  4IFD B;  1MU5 A;  4KZS A;  2A25 A;  4P7D A;  4GKJ I;  2EN8 A;  3HXL A;  1WXR A;  3GCM A;  1T38 A;  3P3C A;  1H7U A;  1YFH A; 
#chains in the Genus database with same CATH homology
 4DR6 E;  1DAR A;  3OML A;  4JI4 I;  1XNQ E;  1XNR E;  4TUI A;  3H09 A;  4Q28 A;  5LL6 R;  4DR3 E;  3PRY A;  4PRV A;  1PKP A;  2V88 A;  4JI7 E;  3RMP A;  4I3H A;  3QT8 A;  1YYK A;  2CZ9 A;  1HNZ E;  2NUE A;  4I8O A;  1H74 A;  1Z0W A;  3ZOQ B;  4HAC A;  2DB2 A;  2M7Q A;  4JI2 E;  4DR6 I;  3AUZ A;  3IWB A;  4ED4 A;  1HR0 I;  1T4L B;  4X64 I;  3HPS A;  3FIG A;  4UT4 A;  3B78 A;  3ADJ A;  1T4O A;  2KHX A;  4JI8 E;  1USV A;  2FV4 B;  4JV5 I;  4B3R E;  4FWG A;  4WFT A;  1GZ6 A;  4GKK E;  1Z5B A;  4DPX A;  3OTO I;  1Z59 A;  2ZBK B;  2LRS A;  4X66 E;  5AE1 A;  1Z0C A;  3Q1Q A;  4B3S E;  3IWC A;  3LPS A;  1N33 E;  5IT9 C;  3J7A M;  4IZJ A;  2VF1 A;  2LTS A;  2UUA E;  2JOX A;  4LF4 I;  3QT5 A;  4DR5 E;  1UIL A;  3ZM7 A;  1IBL I;  1I94 E;  2JY9 A;  3J80 Q;  4USM A;  3ADG A;  5L3J A;  1HK7 A;  3J81 Q;  4DKK A;  1X49 A;  4DPY A;  4PU9 A;  3JAM C;  2XEX A;  2V34 A;  3Q6M A;  1MG7 A;  4Z7C A;  4LF5 E;  2A2C A;  5A2Q C;  3VYX A;  4F9A B;  2A2D A;  1BKN A;  1HNW E;  1NHI A;  2V83 A;  4X62 E;  1A6F A;  2V8P A;  4DR4 I;  2JVA A;  2M1S A;  5IT9 Q;  4M1K A;  1KKH A;  2HHH E;  2ODR C;  2RS6 A;  1IBK E;  2O1T A;  2V87 A;  4WUB A;  1D6T A;  2UUC I;  5IWA E;  1ZXN A;  2UU9 E;  2EZ6 A;  1VIS A;  4DV5 I;  4JYA I;  1N0V C;  1HNX E;  1YYW A;  4UTG A;  4DR5 I;  1RQ0 A;  2JR1 A;  3T1Y E;  2CGE A;  2V86 A;  4KQV A;  2HK3 A;  4BCA A;  1KVK A;  4FW9 A;  4DU8 A;  2L33 A;  4DR3 I;  2KON A;  4HXZ A;  1N32 I;  2VQE I;  5LMU I;  1MX0 A;  5LMN I;  4HYM A;  5IWA I;  4JI6 I;  2NPF A;  4DV7 I;  4DV0 I;  3P06 A;  5FLX C;  2ZIT A;  1IBM E;  4HAC B;  4WPY A;  2UUB E;  2V2Q A;  3WU6 A;  2DMY A;  5A2Q Q;  1IBM I;  4HY1 A;  3LML A;  4LFC I;  2B7V A;  1FJG I;  3ZKB A;  1EI1 A;  3Q6N A;  2M4I A;  1N0U A;  5GMD A;  2HFU A;  2NA2 A;  2WZO A;  4GEQ B;  3V2U C;  4M2Z A;  3T1H I;  3PYG A;  1XMQ E;  4X8W A;  1FNM A;  2L3J A;  2RS7 A;  1T4N A;  5AE2 A;  4X65 I;  4F54 A;  4JI1 I;  1N36 E;  4LF7 I;  4JYA E;  2LMZ A;  2WW4 A;  2RTX A;  4DV1 E;  2UUA I;  4Z7Y A;  4K0K E;  3QT7 A;  4DXL A;  2E1M A;  3ZZT A;  4B3M E;  2N3G A;  1S4E A;  4X66 I;  2ODR D;  2LUQ A;  2E5L E;  3VK6 A;  2L92 A;  4K0K I;  1Z0G A;  4BC7 A;  4GKJ E;  1XMO E;  2Z5E A;  3ZZU A;  4MYU A;  2UXD I;  4LF5 I;  3VYY A;  1KIJ A;  3PYD A;  4AQY E;  4DUZ I;  2R3V A;  4GKK I;  4DV0 E;  4FN5 A;  4IZK B;  1Z5A A;  4URL A;  3PYE A;  3HJC A;  1DQ3 A;  2F4V E;  4USK A;  1ZM9 A;  3WU5 A;  2LBS B;  1S16 A;  2HFS A;  4YHH I;  3DF6 A;  1IBL E;  2PNM A;  1KTV A;  1H73 A;  4X65 E;  4IZJ B;  2CPN A;  2VQF I;  3ZZ0 A;  4X64 E;  1HR0 E;  1XMQ I;  2UUC E;  2O1W A;  1EA6 A;  2HHH I;  3D4J A;  2UXC I;  5FWK A;  2LJH A;  1YZ9 A;  2Z5C A;  1RC7 A;  1HNZ I;  1ELO A;  4DR4 E;  4P78 A;  3K85 A;  4JI3 I;  4B3S I;  2MC6 A;  2CG9 A;  4JI6 E;  4OOG C;  4RPF A;  1QU6 A;  4P7A A;  2EFG A;  2LUP B;  4JV5 E;  1N32 E;  2KOU A;  3J81 C;  1PVG A;  2V85 A;  2E5L I;  4OX9 I;  4JG4 A;  2L3C A;  5AE3 A;  2Q2E B;  1SR9 A;  5BR8 I;  1Y4U A;  3J80 C;  3QT6 A;  4DPU A;  3ZKD A;  2VQE E;  1RRE A;  3MSW A;  2Z5C B;  1XHK A;  3PYF A;  4DR2 E;  2BV3 A;  4WUD A;  2L8T A;  1O0W A;  2UXB I;  4FWH A;  1USU A;  2V8Q B;  3K17 A;  3JAM Q;  1HNX I;  5AAS A;  4YHH E;  4P52 A;  2FGG A;  2IOP A;  1GQE A;  3DJW A;  4JI5 E;  3HPZ A;  1FJG E;  4LFB I;  4LFC E;  4NXN E;  4LU9 A;  2NUF A;  1HNW I;  1IBK I;  4AQY I;  2ZM6 I;  2X7I A;  1J26 A;  1XNR I;  1XNQ I;  4B3R I;  1Z0T A;  2R42 A;  2J7K A;  4R1F A;  4M30 A;  5CFF E;  3CWV A;  2DEI A;  2V2V A;  1ZM2 A;  2BM1 A;  4B3M I;  2B7T A;  2B9D A;  3HTX A;  4KHP E;  3T1Y I;  2Z5B A;  1QZR A;  4N3O A;  4F9C B;  4BMJ A;  2UXC E;  2L2N A;  4JI8 I;  1OJ4 A;  1I94 I;  3B82 A;  4LF7 E;  4DV5 E;  1N36 I;  4LF8 E;  3LLH A;  4LFA E;  1X47 A;  1FI4 A;  2HKJ A;  4LF4 E;  2YZT A;  1RR9 A;  2ZM6 E;  2IOQ A;  4YY3 E;  3F6H A;  1WHQ A;  4JI0 I;  3KWR A;  2B3T B;  1ZBQ A;  4L5N C;  4LFB E;  2YT4 A;  2O1V A;  2X36 A;  2VF3 A;  4DR2 I;  1J5E E;  4DV2 E;  4B3T E;  4WUC A;  2AJ4 A;  2UU9 I;  2FTX B;  1YYO A;  4YY3 I;  1EKZ A;  2NUG A;  2UXB E;  2BM0 A;  3WU3 A;  4BS9 A;  2HK2 A;  2LJP A;  2G7H A;  3JU0 A;  4X62 I;  2DEJ A;  1K47 A;  3K1J A;  1NZ0 A;  3ADI A;  4LF6 I;  2JWO A;  5BR8 E;  5LMN E;  4DV1 I;  2N3H A;  4ZVI A;  2F8B A;  4R8O A;  4NXM E;  2L2K B;  1U2R A;  2LTR A;  1UHZ A;  1WUU A;  1ZM4 A;  3J7Y p;  1Z0V A;  1N34 E;  4WSP A;  2DIX A;  3M6A A;  2IHR 1;  1Y6Z A;  4JI4 E;  2GQ0 A;  4DV2 I;  3P1X A;  4LF9 E;  1Z5C A;  1N33 I;  3C4B A;  4NXM I;  1FWL A;  2L6M A;  4DUZ E;  3IWD A;  5DNY A;  4EMD A;  2UXD E;  4BC9 A;  2UUB I;  1N34 I;  4R03 A;  2VE7 C;  1XMO I;  2EWL A;  4WYQ B;  3OTO E;  2F4V I;  3GON A;  4FWD A;  1ZM3 A;  3AV0 A;  2LE2 A;  5LMU E;  4DV3 I;  4DR7 I;  4DPT A;  2HKE A;  4TUG A;  2DSY A;  3C4T A;  4DV6 E;  4DV3 E;  2K4V A;  1H7S A;  3K6Q A;  4LF6 E;  2E1R A;  3WU4 A;  1B63 A;  4JI2 I;  1Z0B A;  1STU A;  4JI3 E;  2JOB A;  4NXN I;  1WHN A;  2O1U A;  4DMI A;  1UEK A;  4XTJ A;  3F0N A;  3V5R A;  4JI1 E;  2PNL A;  2Z5B B;  4LTY A;  3B8H A;  5T6J A;  4DV4 I;  2VQF E;  2L2M A;  3T1H E;  3J7A G;  4LF8 I;  1J5E I;  3HUL A;  4MYT A;  4PRX A;  4JI0 E;  1H72 C;  3JTZ A;  4DR7 E;  4DR1 I;  1Y4S A;  4DUY I;  2GS8 A;  4DUY E;  4DV6 I;  2V2Z A;  1PIE A;  1ZXM A;  2V89 A;  4DPW A;  1X48 A;  4IZJ D;  4IZK A;  3F6G A;  3LTO A;  4KHP I;  1ZBT A;  4DU7 A;  4F9B B;  4DV7 E;  3H4L A;  4M0V A;  2OI2 A;  4LF9 I;  5F3W A;  1NHJ A;  2MC5 A;  4JI5 I;  4B3T I;  4DV4 E;  5ADZ A;  4JI7 I;  4L8N A;  3ADL A;  5GME A;  4LFA I;  2RSM A;  1FKA E;  1FWK A;  5FLX Q;  2MDR A;  4J8Z A;  2H36 X;  1Z0E A;  1DI2 A;  1NHH A;  3LNU A;  4DR1 E;  1B62 A;  4BBY A;  4OX9 E;  3HQ1 A;  1MU5 A;  4KZS A;  4P7D A;  4GKJ I;  3HXL A;  1WXR A;  1H7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...