3J80C

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j80C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j80C02
1N33I 3QT8A 3J81Q 1XMQE 3HULA 4JI7E 2VQEI 4FW9A 2ZM6E 4AQYE 2HK3A 1ZM9A 4Z7CA 2UUCE 4DV0E 4JI6E 1ZM2A 4JI0I 1N0VC 3GONA 4WUCA 2UXDI 5LMNI 4UT4A 1Z5BA 2VQEE 4ZVIA 4YY3E 1FKAE 3J80Q 4FWGA 4DPUA 3PYGA 4USKA 4LF6I 1PVGA 4DPTA 1EA6A 2BM1A 1N32I 5FLXC 4HYMA 4JI6I 1U2RA 3PYEA 1ZXNA 3QT7A 1XNQI 2LJPA 2HHHE 1FWKA 1IBMI 1Z5CA 4PU9A 4DV6I 4LF5I 4LFAI 3QT6A 2UU9I 4WUDA 2X36A 5GMDA 1IBME 2WW4A 3ZKBA 4LF7I 1N0UA 3T1HE 2A2CA 1FJGE 1N33E 4P7AA 1IBLE 1KKHA 4B3SE 1HNXI 4DV3E 3OTOI 2ZM6I 1NHHA 3CWVA 4YHHE 4JI5I 1Z59A 4DV0I 4DR2E 5IT9C 1WUUA 1PKPA 4K0KI 2UUBE 3J7AM 3WU4A 2UUAE 5FLXQ 1N34E 3J81C 1XNRI 4LFCE 1Z0EA 4M1KA 1VISA 4WUBA 4DR5E 2HKEA 4X66I 5LMUE 1ZM4A 4B3SI 4JI5E 4PRXA 4DR2I 4DV1E 4DR3E 4YHHI 2VQFI 4LF4I 1N34I 1FI4A 2BV3A 2HK2A 4LF9E 1Z0WA 4JI1E 1KIJA 2E5LE 2F4VE 2R42A 3V5RA 2HFSA 4DV1I 4JI3I 4DR6I 2V2QA 4FN5A 4X64E 3J7AG 2R3VA 4YY3I 2E5LI 1HR0E 2AJ4A 3K17A 4USMA 4DV5E 3V2UC 4DPWA 4P52A 1BKNA 3J80C 4DR6E 2NPFA 2UXBI 1KTVA 1XMOE 4KHPE 2A2DA 4DV3I 4DV6E 4DR4I 4DR1E 4NXNE 4DV7I 4JYAI 2ZITA 4B3RE 4DR7E 3ZZ0A 2GS8A 4UTGA 3F0NA 4K0KE 2VF3A 2UXBE 4DXLA 4DUZI 1B62A 1Z0BA 4RPFA 1XMOI 4KHPI 3PYDA 3M6AA 4HY1A 5LMUI 4FWHA 1N32E 4JI8I 4NXNI 4DPXA 5BR8I 1ELOA 5LMNE 1I94I 4JI4E 2BM0A 1IBKI 4I3HA 4DU8A 2UUAI 4LFBI 2HFUA 3T1YI 3WU3A 1XNRE 1H7SA 1S4EA 4B3TI 1I94E 4DR3I 4X66E 1NHIA 2XEXA 5A2QQ 5IWAI 2UXCI 2UU9E 3WU6A 4LF8I 1HNZI 5GMEA 3B78A 4JI2E 1NHJA 4DR4E 4B3TE 4GKKI 4NXME 4ED4A 2ZBKB 2OI2A 5IWAE 1HNWI 3K1JA 4DV2I 4LF7E 4B3ME 4DUZE 1HNZE 1EI1A 4DU7A 3PYFA 4URLA 1QZRA 4GKKE 4JI2I 5IT9Q 2E1RA 1Z5AA 4GKJE 1D6TA 1J5EI 3LNUA 4DV4E 4DUYE 1RR9A 1H72C 1Z0TA 2HKJA 1MX0A 2UUCI 4HACA 4GKJI 3B82A 3WU5A 3Q1QA 4JI0E 4X64I 1J5EE 1DARA 4PRVA 2DEJA 3T1HI 3ZZUA 4MYTA 1FNMA 2V2VA 1ZM3A 3LTOA 5A2QC 2V2ZA 2V34A 4JV5E 1Z0CA 4HXZA 1B63A 4AQYI 1XMQI 2Q2EB 1H74A 3QT5A 3ZKDA 4DPYA 4DV7E 4JYAE 2DEIA 4JV5I 4FWDA 1MG7A 4R1FA 4DR7I 4LF5E 4LFAE 3B8HA 1Z0GA 4NXMI 4LFBE 2V8PA 1FJGI 4JI1I 3T1YE 1A6FA 1H7UA 1IBLI 1XHKA 4X65E 4KQVA 4LF9I 4OX9I 3OTOE 1UEKA 1S16A 4JI3E 2UUBI 4B3RI 3JAMC 3JAMQ 4DV4I 2J7KA 4HACB 1FWLA 5L3JA 2HHHI 4LF8E 4JI4I 1HNXE 1Z0VA 5LL6R 4OX9E 4XTJA 4DV5I 2UXDE 2EFGA 4JG4A 4B3MI 1HNWE 1NZ0A 3ZM7A 3ZZTA 4DV2E 4DR5I 1PIEA 3D4JA 2F4VI 4LF6E 1MU5A 4DR1I 1IBKE 1KVKA 1OJ4A 1ZXMA 1N36I 1XNQE 1H73A 1HR0I 3LPSA 4JI8E 1K47A 4JI7I 5BR8E 2UXCE 4X62I 1N36E 2X7IA 4EMDA 4X65I 4LFCI 2CZ9A 3H4LA 1RREA 4Z7YA 4LF4E 2VQFE 4DUYI 4MYUA 4X62E
chains in the Genus database with same CATH superfamily
1N33I 3QT8A 3IWDA 1XMQE 2NN6D 4JI7E 1UDQA 3AV0A 3HULA 2L2KB 3J81Q 1KYQA 5AE2A 1A1IA 2KOUA 2VQEI 3P3EA 4FW9A 2ZM6E 4AQYE 2HK3A 4O43A 1ZM9A 2WNRB 4Z7CA 5AC4A 2UUCE 4F9CB 2EM0A 2LTSA 1YPNA 4DV0E 2RSIA 4JI6E 1ZM2A 3LMLA 3U1YA 4JI0I 2YTQA 4R2DA 1N0VC 1X6EA 3GONA 4WUCA 2UXDI 3THNA 2B7VA 2NUFA 4M0VA 4OKGA 1QU6A 1OYRA 5LMNI 4UT4A 1Z5BA 3H1CA 2VQEE 4ZVIA 4Q28A 4YY3E 2K4VA 1FKAE 3HKMA 3ADIA 1G2FC 4U3BA 2PO1A 5KL3A 3J80Q 5K36D 4FWGA 2B7TA 4DPUA 2JE6A 3PYGA 4USKA 2LO3A 3KZZA 1PVGA 4LF6I 4DPTA 3FIGA 1EA6A 1Y60A 5C0XE 2BM1A 1N32I 3UK3C 2EMHA 2EOMA 1WXRA 5FLXC 1USUA 4HYMA 4JI6I 1U2RA 2YRMA 2RTXA 3RMPA 3PYEA 4HEIA 4P78A 1ZXNA 2EPAA 3H09A 5A69A 2EMYA 3NZKA 3M85D 3QT7A 1IQOA 2FTXB 2EQ1A 2O1UA 1XNQI 2LJPA 2MDRA 2HHHE 2HC5A 1FWKA 2EMBA 2YTOA 1IBMI 2Z5EA 2JOXA 2HGHA 1Z5CA 4MU0A 2BR2A 4IZJD 4PU9A 2H36X 1YHCA 4AM3A 2DIXA 4BCAA 5JEAA 4DV6I 4LF5I 4LFAI 3DF6A 1DQ3A 2YU5A 1O0WA 4FW6A 4F9AB 4BHCA 3K6QA 2EM8A 3QT6A 2UU9I 4WUDA 2VRDA 2EN2A 3HPZA 2J7JA 2X36A 1YYOA 2MC6A 2R1FA 5GMDA 4R2PA 2LUQA 1ZAAC 3VYXA 2YT4A 2GPIA 3HTXA 2RSMA 2RQLA 4LU9A 3J7Yp 1IBME 1E3HA 3PRYA 2EM5A 2EPUA 3P76A 1HK7A 2ELYA 5KL5A 4IFDA 2WW4A 4OO1D 2DMIA 2EPNA 2EOXA 4IZJB 2ODRD 2BR2B 1EH8A 3ZKBA 2L8TA 4LF7I 1FJGE 3T1HE 1N0UA 2A2CA 2ENHA 3Q6MA 1N33E 4P7AA 1IBLE 1KKHA 4B3SE 2YWQA 1HNXI 4DV3E 2L92A 3HPSA 2EMLA 3OTOI 2WZOA 4LCFA 2ZM6I 4MLVA 4KZSA 4L5NC 3M7NG 1NHHA 4YHHE 2L3JA 3CWVA 1ZBTA 2JT2A 2YU8A 1Z59A 4JI5I 4FW3A 2EOOA 2LE2A 4DV0I 4DR2E 5IT9C 1WUUA 3K85A 4F6NA 3AUZA 1PKPA 1ZU1A 2EL6A 2EOYA 2LMZA 1VI7A 5EL9A 4K0KI 2UUBE 3J7AM 3ECRA 4QNJA 3WU4A 2UUAE 2PNLA 2EPPA 4P7DA 2Z5CA 5A6AA 5ADZA 5KL2A 4X9JA 3PS1A 1N34E 5DRRA 5FLXQ 3J81C 2JEAA 4N3OA 1XNRI 4LFCE 1Z0EA 4DR5E 1VISA 4M1KA 4WUBA 2EPOA 4N4RB 4BA2B 2BA1G 3EPLA 2HKEA 4X66I 2GLIA 5LMUE 1ZM4A 4B3SI 4GEQB 4JI5E 3ADLA 4OOGC 4PRXA 3EPHA 2Z5BB 5AE1A 4DR2I 4DV1E 2EWLA 4DR3E 4YHHI 4OO1A 2EOEA 4IFDE 2N3HA 1RQ0A 2YRKA 4FW4A 2VQFI 4U3DA 2EN4A 4LF4I 2NN6E 3M7ND 3C6KA 1N34I 2ENAA 2EOIA 5A6BA 2JWOA 5AC5A 1FI4A 1UDOA 2BV3A 2HK2A 4LF9E 5IXMB 4JI1E 2JVAA 1Z0WA 5DROA 5F3WA 1KIJA 1NCSA 4BHBA 2E5LE 2GO3A 3U1KA 2DMYA 4F2JC 1GTKA 1X48A 2O1TA 1BB8A 2F4VE 2JEAB 2R42A 4LOMA 3PS2A 5K36A 3V5RA 2G7HA 1Z1BA 4OZEA 5AASA 4J3DA 4X62E 1YUJA 2EM2A 2HFSA 4BA2A 4DV1I 3M99B 4JI3I 2YTPA 2EMCA 2JY9A 4DR6I 2V2QA 1YFHA 4X64E 2EP3A 4FN5A 2VF1A 1N3GA 4MU4A 4ZYEA 4R03A 1BBGA 2L2MA 4R8OA 1JK1A 2O3ZA 4OO1E 4OO1B 3J7AG 4IFDB 2E1MA 2R3VA 4IZJA 2RS7A 2EOQA 3GLLA 2EPCA 2YTFA 2LCEA 4YY3I 2F8BA 1B69A 2E5LI 1HR0E 1TF3A 2AJ4A 3K17A 1UHZA 3C4BA 3ADJA 1LLMC 4I8OA 5TSEA 4MU3A 3M85G 4ISAA 4USMA 4DV5E 3V2UC 5C0XA 2LTRA 2YTEA 3THOB 4DPWA 2F1DA 4P52A 1BKNA 3J80C 3GCMA 1YYKA 4DR6E 2NPFA 2UXBI 3EPKA 1KTVA 1OYPA 4DMIA 4IZKB 1XMOE 4KHPE 2RS6A 2N8XA 4OO1F 2A2DA 1AAYA 5A6JA 4DV3I 4DV6E 4DR4I 4WPYA 2YTDA 2LVHA 4DR1E 2Z5CB 4NXNE 1SR9A 1UILA 4QNKA 4DV7I 4JYAI 1USVA 2EMAA 2JOBA 2V83A 4B3RE 2ZITA 2EJ4A 2EMXA 4DR7E 2J65A 1MEYC 2GS8A 3ZZ0A 4R2EA 2EMZA 4UTGA 3F0NA 4K0KE 2EPKX 2V86A 2L6MA 2PNZA 2VF3A 4WYQB 1A1GA 2UXBE 5JEAE 2Z5BA 4DXLA 4DUZI 1B62A 4FW7A 1Z0BA 4ZYHA 4RPFA 5IV8B 2JP9A 1MGTA 1XMOI 4KHPI 3PYDA 3M6AA 2V85A 2YSPA 4FK5C 4HY1A 2EPZA 5LMUI 2NABA 2JYAA 1L4SA 1N32E 4FWHA 2IESA 4IZKA 2JEBB 1RHYA 4NXNI 4JI8I 4IS9A 4DPXA 4AIDA 1ELOA 5BR8I 3MHHC 5A6BD 5LMNE 2EN6A 2YSOA 5DRQA 2YTGA 1A1HA 2CTDA 1I94I 1Y6ZA 2I9IA 4BC9A 2DLQA 1RMDA 4JI4E 1X6HA 2EN3A 2M7QA 1BBOA 2EPRA 2BM0A 2O1WA 2O1VA 2C37B 4BA1B 1IBKI 4I3HA 1Y5YA 2EM4A 2JR1A 4RH8A 4OO1C 4DU8A 4O4KA 2UUAI 2JPAA 1TF6A 5JEAF 4LFBI 3QG5C 2C39A 2HFUA 3GMEA 3HJCA 2EOFA 5KL4A 2EOJA 3T1YI 2JEBA 3IWBA 2N3GA 1YH8A 3WU3A 2FGGA 1XNRE 2EOHA 5C0XB 1H7SA 1E3PA 3MSWA 2CPNA 1S4EA 1I94E 4B3TI 4DR3I 1PJSA 4X66E 1NHIA 2XEXA 4BS9A 5A2QQ 4M2ZA 4MLQA 1R6MA 2KHXA 4LTYA 2EMKA 1WHQA 2EM6A 1P42A 2E72A 5IWAI 4ZYGA 3B4TA 2UU9E 4TUGA 1J26A 2MKNA 2NN6C 4AIMA 3WU6A 4LF8I 2EL5A 1T4OA 1YUIA 1IMUA 3P3GA 1HNZI 5GMEA 2Q8UA 3B78A 2ELZA 4ZYDA 4NBQA 3BF2A 4JI2E 1NHJA 1JK2A 2EZ6A 2PRTA 5EKWA 2NUGA 1SFEA 4MQYA 2PNZB 4DR4E 4B3TE 4Q35B 4GKKI 5DNLA 2EOSA 4NXME 4ED4A 2ZBKB 2C38A 2WBUA 5IWAE 2OI2A 2YTIA 1QNTA 4DKKA 5K36E 1HNWI 3K1JA 4DV2I 4O24A 4X8WA 4LF7E 3C4TA 1WJPA 4R2RA 4B3ME 3L7ZA 4IFDF 4DUZE 1YZ9A 4TUIA 1HNZE 1EI1A 5JEAC 4DU7A 3PYFA 2EN1A 4URLA 3BIDA 4GKKE 1QZRA 2BA1D 4BBYA 4JI2I 2LJHA 1Z5AA 3MHSC 2HJJA 2E1RA 5IT9Q 4GKJE 1T38A 2GO4A 1D6TA 2EQ3A 4R2CA 1J5EI 4DV4E 3LNUA 1WRJA 4DUYE 2VESA 3P06A 4MDTA 2V8QB 2RPCA 2L3CA 2C37A 4BA1A 1A1FA 2EL4A 2YRHA 4R2QA 1RR9A 5T6JA 2EPXA 4L8NA 2C38B 1H72C 1Z0TA 2HKJA 2L2NA 3ZOQB 2EM7A 3EPJA 3P1XA 1MX0A 2BA0D 1UBDC 2NN6B 2UUCI 4HACA 4GKJI 2BBGA 2ADRA 4WXCA 2C39B 2NA2A 4F9BB 2CSHA 1X6FA 1F2IG 3B82A 2DGCA 2EPLX 3L7ZB 3WU5A 3Q1QA 4GQUA 4JV5I 4JI0E 2CVEA 1G2DC 4HTGA 4X64I 2EQ0A 3HXLA 1J5EE 3CDJA 1DARA 3CDIA 4LCGA 4LCHA 2EOZA 2DEJA 4LPFA 4PRVA 3BGHA 2PO2A 2WP8B 3T1HI 3ZZUA 1XXEA 3EQ1A 2L33A 1P47A 1FNMA 4MYTA 2V2VA 1R6LA 1ZM3A 3LTOA 1DGCA 2GQ0A 2WBTA 5A2QC 1Y4UA 1GQEA 2V2ZA 2V34A 1IQSA 2ENCA 4JV5E 2M9AA 4GZNC 1Z0CA 4HXZA 3OMLA 4R2AA 1B63A 2V87A 2PO0A 3F6GA 4AQYI 3ADGA 1XMQI 2Q2EB 2I13A 1H74A 3QT5A 3ZKDA 2EORA 3F6HA 4DPYA 2NN6F 2WCC3 4DV7E 4JYAE 2DEIA 1WHNA 1EH7A 3VYYA 4FWDA 1MG7A 2PO2B 2R76A 4R1FA 4DR7I 4LF5E 4LFAE 3B8HA 4R2SA 3KZYA 1EKZA 1YSAC 1Z0GA 4NXMI 1YYWA 1ZBQA 1PJQA 2M1SA 4LFBE 4M9VC 2V8PA 1UDNA 1FJGI 4JI1I 3T1YE 1T4NA 1A6FA 2FV4B 1H7UA 2CGEA 1IBLI 4X65E 1XHKA 4KQVA 3KWRA 4LF9I 4OX9I 5C0XF 3OTOE 3VHTB 2D9HA 2ODRC 1A1KA 1UEKA 4IFDD 2PO0B 2WBSA 1X49A 3JU0A 4IFDC 2LJUA 1S16A 3Q6NA 4JI3E 1A1LA 2UUBI 4B3RI 3JAMC 4NZVA 3JAMQ 4DV4I 2J7KA 2VE7C 2EMGA 2NN6A 1PDAA 2YPNA 1OYSA 1FWLA 2AE8A 4HACB 2IERA 5L3JA 5K36B 2HHHI 2MDGA 2EMIA 4LF8E 4JI4I 1ZR9A 2GHFA 3HQ1A 1HNXE 2CT1A 2DRPA 1Z0VA 2JXPA 2MC5A 5DRPA 5LL6R 4OX9E 4XTJA 1X47A 3P3CA 5LLQA 3DD6A 4KWYA 4DV5I 2WP8A 2UXDE 2EFGA 5FWKA 2LRSA 2LUPB 4BC7A 4JG4A 1AH5A 5JEAD 4WXDA 4F6MA 4B3MI 1HNWE 3L00A 1NZ0A 3TQMA 3ZM7A 2UXCI 5K36F 4IS1C 2EM9A 3ZZTA 4DV2E 1Y4SA 1X5WA 2YTJA 4DR5I 1A1JA 1PIEA 3D4JA 2EMFA 2F4VI 4LF6E 2DSYA 3BBGA 5DNXA 2BB8A 4O5GA 1KJKA 3LLHA 5AE3A 1MU5A 2NUEA 2B9DA 2LV2A 4DR1I 1IBKE 1KVKA 4BMJA 1T4LB 3KRNA 1OJ4A 1GZ6A 2EMWA 2LBSB 1ZXMA 1STUA 2PO1B 5KL6A 2B3TB 1N36I 2BA0G 2V88A 1UDSA 2JE6B 5DNYA 3C6MA 1XNQE 1TN9A 1H73A 2IHR1 5ELWA 4RHBB 4NHRA 3PS3A 3JTZA 5CFFE 1UN6B 1HR0I 3LPSA 4WFTA 4WSPA 4JI8E 2DLKA 4MU1A 2LT7A 3DJWA 4F54A 4M30A 5A6KA 1K47A 2WNRA 4JI7I 2IOQA 2YZTA 2CG9A 2MKDA 5BR8E 1EH6A 2EM3A 4J8ZA 2YTNA 2UXCE 1RC7A 1NEIA 2DB2A 1N36E 5JEAB 2X7IA 4X62I 3VK6A 1X3CA 4EMDA 4X65I 2EN7A 4LFCI 2A25A 3IWCA 1T39A 4IJDA 2KONA 2M4IA 2CZ9A 5KL7A 2PNMA 5K36C 2IOPA 3H4LA 1RREA 5C0XD 4Z7YA 4WX9A 2VQFE 2EN8A 4LF4E 5C0XC 4DUYI 4MYUA 1PJTA 2V89A 2EE8A 4FW5A 3UHMA 1DI2A 4WSGA 2EPMX 2K7IA
chains in the Genus database with same CATH topology
1N33I 3QT8A 3IWDA 1XMQE 3J81Q 4JI7E 3HULA 3AV0A 2L2KB 5AE2A 2KOUA 2VQEI 4FW9A 2ZM6E 4AQYE 2HK3A 1ZM9A 4Z7CA 2UUCE 4F9CB 2LTSA 4DV0E 4JI6E 1ZM2A 3LMLA 4JI0I 1N0VC 3GONA 4WUCA 2UXDI 2NUFA 2B7VA 4M0VA 1QU6A 5LMNI 4UT4A 1Z5BA 2VQEE 4ZVIA 4Q28A 4YY3E 2K4VA 1FKAE 3ADIA 3J80Q 4FWGA 2B7TA 4DPUA 3PYGA 4USKA 4LF6I 1PVGA 4DPTA 3FIGA 1EA6A 2BM1A 1N32I 5FLXC 1WXRA 1USUA 4HYMA 4JI6I 1U2RA 2RTXA 3RMPA 3PYEA 4P78A 1ZXNA 3H09A 3QT7A 2FTXB 2O1UA 1XNQI 2LJPA 2MDRA 2HHHE 1FWKA 1IBMI 2Z5EA 2JOXA 1Z5CA 4IZJD 4PU9A 2H36X 2DIXA 4BCAA 4DV6I 4LF5I 4LFAI 3DF6A 1DQ3A 1O0WA 4F9AB 3K6QA 3QT6A 2UU9I 4WUDA 3HPZA 2X36A 1YYOA 2MC6A 5GMDA 2LUQA 3VYXA 2YT4A 3HTXA 2RSMA 4LU9A 3J7Yp 3PRYA 1IBME 1HK7A 2WW4A 4IZJB 2ODRD 3ZKBA 2L8TA 4LF7I 1FJGE 3T1HE 1N0UA 2A2CA 3Q6MA 1N33E 4P7AA 1IBLE 1KKHA 4B3SE 1HNXI 4DV3E 2L92A 3HPSA 3OTOI 2WZOA 2ZM6I 4KZSA 4L5NC 1NHHA 4YHHE 2L3JA 3CWVA 1ZBTA 4JI5I 1Z59A 2LE2A 4DV0I 4DR2E 5IT9C 1WUUA 3K85A 3AUZA 1PKPA 2LMZA 4K0KI 2UUBE 3J7AM 3WU4A 2UUAE 2PNLA 4P7DA 2Z5CA 5FLXQ 5ADZA 1N34E 3J81C 4N3OA 1XNRI 4LFCE 1Z0EA 4DR5E 1VISA 4M1KA 4WUBA 2HKEA 4X66I 5LMUE 1ZM4A 4B3SI 4GEQB 4JI5E 3ADLA 4OOGC 4PRXA 2Z5BB 4DR2I 5AE1A 4DV1E 2EWLA 4DR3E 4YHHI 2N3HA 1RQ0A 2VQFI 4LF4I 1N34I 2JWOA 1FI4A 2BV3A 2HK2A 4LF9E 4JI1E 2JVAA 1Z0WA 5F3WA 1KIJA 2E5LE 2DMYA 1X48A 2O1TA 2F4VE 2R42A 3V5RA 2G7HA 5AASA 2HFSA 4DV1I 4JI3I 4DR6I 2JY9A 2V2QA 4FN5A 4X64E 2VF1A 4R03A 2L2MA 4R8OA 3J7AG 2E1MA 2R3VA 4IZJA 2RS7A 4YY3I 2F8BA 2E5LI 1HR0E 2AJ4A 3K17A 1UHZA 3C4BA 3ADJA 4I8OA 4USMA 4DV5E 3V2UC 2LTRA 4DPWA 4P52A 1BKNA 3J80C 1YYKA 4DR6E 2NPFA 2UXBI 1KTVA 4DMIA 4IZKB 1XMOE 4KHPE 2RS6A 2A2DA 4DV3I 4DV6E 4DR4I 4WPYA 4DR1E 2Z5CB 4NXNE 1SR9A 1UILA 4DV7I 4JYAI 1USVA 2JOBA 2V83A 4B3RE 2ZITA 4DR7E 3ZZ0A 2GS8A 4UTGA 3F0NA 4K0KE 2V86A 2L6MA 2VF3A 4WYQB 2UXBE 2Z5BA 4DXLA 4DUZI 1B62A 1Z0BA 4RPFA 1XMOI 4KHPI 3PYDA 3M6AA 2V85A 4HY1A 5LMUI 1N32E 4FWHA 4IZKA 4JI8I 4NXNI 4DPXA 5BR8I 1ELOA 5LMNE 1I94I 1Y6ZA 4BC9A 4JI4E 2M7QA 2BM0A 2O1WA 2O1VA 1IBKI 4I3HA 2JR1A 4DU8A 2UUAI 4LFBI 3HJCA 2HFUA 3T1YI 3IWBA 2N3GA 3WU3A 2FGGA 1XNRE 1H7SA 1S4EA 3MSWA 2CPNA 4B3TI 1I94E 4DR3I 4X66E 1NHIA 2XEXA 4BS9A 5A2QQ 4M2ZA 2KHXA 4LTYA 1WHQA 5IWAI 2UXCI 2UU9E 4TUGA 1J26A 3WU6A 4LF8I 1HNZI 1T4OA 5GMEA 3B78A 4JI2E 1NHJA 2EZ6A 2NUGA 4DR4E 4B3TE 4GKKI 4NXME 4ED4A 2ZBKB 2OI2A 5IWAE 4DKKA 1HNWI 3K1JA 4DV2I 4X8WA 4LF7E 3C4TA 4B3ME 4DUZE 1YZ9A 4TUIA 1HNZE 1EI1A 4DU7A 3PYFA 4URLA 4GKKE 1QZRA 4JI2I 4BBYA 5IT9Q 2LJHA 1Z5AA 2E1RA 4GKJE 1D6TA 1J5EI 4DV4E 3LNUA 4DUYE 3P06A 2V8QB 2L3CA 1RR9A 5T6JA 4L8NA 1H72C 1Z0TA 2HKJA 2L2NA 3ZOQB 3P1XA 1MX0A 2UUCI 4HACA 4GKJI 2NA2A 4F9BB 3B82A 3WU5A 3Q1QA 4JI0E 4X64I 3HXLA 1J5EE 1DARA 4PRVA 2DEJA 3T1HI 3ZZUA 4MYTA 2L33A 1FNMA 2V2VA 1ZM3A 3LTOA 2GQ0A 1Y4UA 5A2QC 1GQEA 2V2ZA 2V34A 4JV5E 1Z0CA 4HXZA 3OMLA 1B63A 2V87A 3F6GA 4AQYI 3ADGA 1XMQI 2Q2EB 1H74A 3QT5A 3ZKDA 3F6HA 4DPYA 4DV7E 4JYAE 2DEIA 1WHNA 4JV5I 3VYYA 4FWDA 1MG7A 4R1FA 4DR7I 4LF5E 4LFAE 3B8HA 1EKZA 1Z0GA 4NXMI 1YYWA 1ZBQA 2M1SA 4LFBE 2V8PA 1FJGI 4JI1I 3T1YE 1T4NA 1A6FA 2FV4B 1H7UA 2CGEA 1IBLI 4X65E 1XHKA 4KQVA 3KWRA 4LF9I 4OX9I 3OTOE 2ODRC 1UEKA 1X49A 3JU0A 1S16A 3Q6NA 4JI3E 2UUBI 4B3RI 3JAMC 3JAMQ 4DV4I 2J7KA 2VE7C 4HACB 1FWLA 5L3JA 2HHHI 4LF8E 4JI4I 3HQ1A 1HNXE 1Z0VA 2MC5A 5LL6R 4OX9E 4XTJA 1X47A 4DV5I 2UXDE 2EFGA 5FWKA 2LRSA 2LUPB 4BC7A 4JG4A 4B3MI 1HNWE 1NZ0A 3ZM7A 3ZZTA 4DV2E 1Y4SA 4DR5I 1PIEA 3D4JA 2F4VI 4LF6E 2DSYA 1MU5A 3LLHA 5AE3A 2NUEA 2B9DA 4DR1I 1IBKE 1KVKA 4BMJA 1T4LB 1OJ4A 1GZ6A 2LBSB 1ZXMA 1STUA 2B3TB 1N36I 2V88A 5DNYA 1XNQE 1H73A 2IHR1 3JTZA 5CFFE 1HR0I 3LPSA 4WFTA 4WSPA 4JI8E 3DJWA 4F54A 4M30A 1K47A 4JI7I 2IOQA 2YZTA 2CG9A 4J8ZA 5BR8E 2UXCE 4X62I 1RC7A 1N36E 2DB2A 2X7IA 3VK6A 4EMDA 4X65I 4LFCI 3IWCA 2CZ9A 2KONA 2M4IA 2PNMA 2IOPA 3H4LA 1RREA 4Z7YA 2VQFE 4LF4E 4DUYI 4MYUA 2V89A 1DI2A 4X62E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 I;  3QT8 A;  3J81 Q;  1XMQ E;  3HUL A;  4JI7 E;  2VQE I;  4FW9 A;  2ZM6 E;  4AQY E;  2HK3 A;  1ZM9 A;  4Z7C A;  2UUC E;  4DV0 E;  4JI6 E;  1ZM2 A;  4JI0 I;  1N0V C;  3GON A;  4WUC A;  2UXD I;  5LMN I;  4UT4 A;  1Z5B A;  2VQE E;  4ZVI A;  4YY3 E;  1FKA E;  3J80 Q;  4FWG A;  4DPU A;  3PYG A;  4USK A;  4LF6 I;  1PVG A;  4DPT A;  1EA6 A;  2BM1 A;  1N32 I;  5FLX C;  4HYM A;  4JI6 I;  1U2R A;  3PYE A;  1ZXN A;  3QT7 A;  1XNQ I;  2LJP A;  2HHH E;  1FWK A;  1IBM I;  1Z5C A;  4PU9 A;  4DV6 I;  4LF5 I;  4LFA I;  3QT6 A;  2UU9 I;  4WUD A;  2X36 A;  5GMD A;  1IBM E;  2WW4 A;  3ZKB A;  4LF7 I;  1N0U A;  3T1H E;  2A2C A;  1FJG E;  1N33 E;  4P7A A;  1IBL E;  1KKH A;  4B3S E;  1HNX I;  4DV3 E;  3OTO I;  2ZM6 I;  1NHH A;  3CWV A;  4YHH E;  4JI5 I;  1Z59 A;  4DV0 I;  4DR2 E;  5IT9 C;  1WUU A;  1PKP A;  4K0K I;  2UUB E;  3J7A M;  3WU4 A;  2UUA E;  5FLX Q;  1N34 E;  3J81 C;  1XNR I;  4LFC E;  1Z0E A;  4M1K A;  1VIS A;  4WUB A;  4DR5 E;  2HKE A;  4X66 I;  5LMU E;  1ZM4 A;  4B3S I;  4JI5 E;  4PRX A;  4DR2 I;  4DV1 E;  4DR3 E;  4YHH I;  2VQF I;  4LF4 I;  1N34 I;  1FI4 A;  2BV3 A;  2HK2 A;  4LF9 E;  1Z0W A;  4JI1 E;  1KIJ A;  2E5L E;  2F4V E;  2R42 A;  3V5R A;  2HFS A;  4DV1 I;  4JI3 I;  4DR6 I;  2V2Q A;  4FN5 A;  4X64 E;  3J7A G;  2R3V A;  4YY3 I;  2E5L I;  1HR0 E;  2AJ4 A;  3K17 A;  4USM A;  4DV5 E;  3V2U C;  4DPW A;  4P52 A;  1BKN A;  3J80 C;  4DR6 E;  2NPF A;  2UXB I;  1KTV A;  1XMO E;  4KHP E;  2A2D A;  4DV3 I;  4DV6 E;  4DR4 I;  4DR1 E;  4NXN E;  4DV7 I;  4JYA I;  2ZIT A;  4B3R E;  4DR7 E;  3ZZ0 A;  2GS8 A;  4UTG A;  3F0N A;  4K0K E;  2VF3 A;  2UXB E;  4DXL A;  4DUZ I;  1B62 A;  1Z0B A;  4RPF A;  1XMO I;  4KHP I;  3PYD A;  3M6A A;  4HY1 A;  5LMU I;  4FWH A;  1N32 E;  4JI8 I;  4NXN I;  4DPX A;  5BR8 I;  1ELO A;  5LMN E;  1I94 I;  4JI4 E;  2BM0 A;  1IBK I;  4I3H A;  4DU8 A;  2UUA I;  4LFB I;  2HFU A;  3T1Y I;  3WU3 A;  1XNR E;  1H7S A;  1S4E A;  4B3T I;  1I94 E;  4DR3 I;  4X66 E;  1NHI A;  2XEX A;  5A2Q Q;  5IWA I;  2UXC I;  2UU9 E;  3WU6 A;  4LF8 I;  1HNZ I;  5GME A;  3B78 A;  4JI2 E;  1NHJ A;  4DR4 E;  4B3T E;  4GKK I;  4NXM E;  4ED4 A;  2ZBK B;  2OI2 A;  5IWA E;  1HNW I;  3K1J A;  4DV2 I;  4LF7 E;  4B3M E;  4DUZ E;  1HNZ E;  1EI1 A;  4DU7 A;  3PYF A;  4URL A;  1QZR A;  4GKK E;  4JI2 I;  5IT9 Q;  2E1R A;  1Z5A A;  4GKJ E;  1D6T A;  1J5E I;  3LNU A;  4DV4 E;  4DUY E;  1RR9 A;  1H72 C;  1Z0T A;  2HKJ A;  1MX0 A;  2UUC I;  4HAC A;  4GKJ I;  3B82 A;  3WU5 A;  3Q1Q A;  4JI0 E;  4X64 I;  1J5E E;  1DAR A;  4PRV A;  2DEJ A;  3T1H I;  3ZZU A;  4MYT A;  1FNM A;  2V2V A;  1ZM3 A;  3LTO A;  5A2Q C;  2V2Z A;  2V34 A;  4JV5 E;  1Z0C A;  4HXZ A;  1B63 A;  4AQY I;  1XMQ I;  2Q2E B;  1H74 A;  3QT5 A;  3ZKD A;  4DPY A;  4DV7 E;  4JYA E;  2DEI A;  4JV5 I;  4FWD A;  1MG7 A;  4R1F A;  4DR7 I;  4LF5 E;  4LFA E;  3B8H A;  1Z0G A;  4NXM I;  4LFB E;  2V8P A;  1FJG I;  4JI1 I;  3T1Y E;  1A6F A;  1H7U A;  1IBL I;  1XHK A;  4X65 E;  4KQV A;  4LF9 I;  4OX9 I;  3OTO E;  1UEK A;  1S16 A;  4JI3 E;  2UUB I;  4B3R I;  3JAM C;  3JAM Q;  4DV4 I;  2J7K A;  4HAC B;  1FWL A;  5L3J A;  2HHH I;  4LF8 E;  4JI4 I;  1HNX E;  1Z0V A;  5LL6 R;  4OX9 E;  4XTJ A;  4DV5 I;  2UXD E;  2EFG A;  4JG4 A;  4B3M I;  1HNW E;  1NZ0 A;  3ZM7 A;  3ZZT A;  4DV2 E;  4DR5 I;  1PIE A;  3D4J A;  2F4V I;  4LF6 E;  1MU5 A;  4DR1 I;  1IBK E;  1KVK A;  1OJ4 A;  1ZXM A;  1N36 I;  1XNQ E;  1H73 A;  1HR0 I;  3LPS A;  4JI8 E;  1K47 A;  4JI7 I;  5BR8 E;  2UXC E;  4X62 I;  1N36 E;  2X7I A;  4EMD A;  4X65 I;  4LFC I;  2CZ9 A;  3H4L A;  1RRE A;  4Z7Y A;  4LF4 E;  2VQF E;  4DUY I;  4MYU A;  4X62 E; 
#chains in the Genus database with same CATH topology
 1N33 I;  3QT8 A;  3IWD A;  1XMQ E;  2NN6 D;  4JI7 E;  1UDQ A;  3AV0 A;  3HUL A;  2L2K B;  3J81 Q;  1KYQ A;  5AE2 A;  1A1I A;  2KOU A;  2VQE I;  3P3E A;  4FW9 A;  2ZM6 E;  4AQY E;  2HK3 A;  4O43 A;  1ZM9 A;  2WNR B;  4Z7C A;  5AC4 A;  2UUC E;  4F9C B;  2EM0 A;  2LTS A;  1YPN A;  4DV0 E;  2RSI A;  4JI6 E;  1ZM2 A;  3LML A;  3U1Y A;  4JI0 I;  2YTQ A;  4R2D A;  1N0V C;  1X6E A;  3GON A;  4WUC A;  2UXD I;  3THN A;  2B7V A;  2NUF A;  4M0V A;  4OKG A;  1QU6 A;  1OYR A;  5LMN I;  4UT4 A;  1Z5B A;  3H1C A;  2VQE E;  4ZVI A;  4Q28 A;  4YY3 E;  2K4V A;  1FKA E;  3HKM A;  3ADI A;  1G2F C;  4U3B A;  2PO1 A;  5KL3 A;  3J80 Q;  5K36 D;  4FWG A;  2B7T A;  4DPU A;  2JE6 A;  3PYG A;  4USK A;  2LO3 A;  3KZZ A;  1PVG A;  4LF6 I;  4DPT A;  3FIG A;  1EA6 A;  1Y60 A;  5C0X E;  2BM1 A;  1N32 I;  3UK3 C;  2EMH A;  2EOM A;  1WXR A;  5FLX C;  1USU A;  4HYM A;  4JI6 I;  1U2R A;  2YRM A;  2RTX A;  3RMP A;  3PYE A;  4HEI A;  4P78 A;  1ZXN A;  2EPA A;  3H09 A;  5A69 A;  2EMY A;  3NZK A;  3M85 D;  3QT7 A;  1IQO A;  2FTX B;  2EQ1 A;  2O1U A;  1XNQ I;  2LJP A;  2MDR A;  2HHH E;  2HC5 A;  1FWK A;  2EMB A;  2YTO A;  1IBM I;  2Z5E A;  2JOX A;  2HGH A;  1Z5C A;  4MU0 A;  2BR2 A;  4IZJ D;  4PU9 A;  2H36 X;  1YHC A;  4AM3 A;  2DIX A;  4BCA A;  5JEA A;  4DV6 I;  4LF5 I;  4LFA I;  3DF6 A;  1DQ3 A;  2YU5 A;  1O0W A;  4FW6 A;  4F9A B;  4BHC A;  3K6Q A;  2EM8 A;  3QT6 A;  2UU9 I;  4WUD A;  2VRD A;  2EN2 A;  3HPZ A;  2J7J A;  2X36 A;  1YYO A;  2MC6 A;  2R1F A;  5GMD A;  4R2P A;  2LUQ A;  1ZAA C;  3VYX A;  2YT4 A;  2GPI A;  3HTX A;  2RSM A;  2RQL A;  4LU9 A;  3J7Y p;  1IBM E;  1E3H A;  3PRY A;  2EM5 A;  2EPU A;  3P76 A;  1HK7 A;  2ELY A;  5KL5 A;  4IFD A;  2WW4 A;  4OO1 D;  2DMI A;  2EPN A;  2EOX A;  4IZJ B;  2ODR D;  2BR2 B;  1EH8 A;  3ZKB A;  2L8T A;  4LF7 I;  1FJG E;  3T1H E;  1N0U A;  2A2C A;  2ENH A;  3Q6M A;  1N33 E;  4P7A A;  1IBL E;  1KKH A;  4B3S E;  2YWQ A;  1HNX I;  4DV3 E;  2L92 A;  3HPS A;  2EML A;  3OTO I;  2WZO A;  4LCF A;  2ZM6 I;  4MLV A;  4KZS A;  4L5N C;  3M7N G;  1NHH A;  4YHH E;  2L3J A;  3CWV A;  1ZBT A;  2JT2 A;  2YU8 A;  1Z59 A;  4JI5 I;  4FW3 A;  2EOO A;  2LE2 A;  4DV0 I;  4DR2 E;  5IT9 C;  1WUU A;  3K85 A;  4F6N A;  3AUZ A;  1PKP A;  1ZU1 A;  2EL6 A;  2EOY A;  2LMZ A;  1VI7 A;  5EL9 A;  4K0K I;  2UUB E;  3J7A M;  3ECR A;  4QNJ A;  3WU4 A;  2UUA E;  2PNL A;  2EPP A;  4P7D A;  2Z5C A;  5A6A A;  5ADZ A;  5KL2 A;  4X9J A;  3PS1 A;  1N34 E;  5DRR A;  5FLX Q;  3J81 C;  2JEA A;  4N3O A;  1XNR I;  4LFC E;  1Z0E A;  4DR5 E;  1VIS A;  4M1K A;  4WUB A;  2EPO A;  4N4R B;  4BA2 B;  2BA1 G;  3EPL A;  2HKE A;  4X66 I;  2GLI A;  5LMU E;  1ZM4 A;  4B3S I;  4GEQ B;  4JI5 E;  3ADL A;  4OOG C;  4PRX A;  3EPH A;  2Z5B B;  5AE1 A;  4DR2 I;  4DV1 E;  2EWL A;  4DR3 E;  4YHH I;  4OO1 A;  2EOE A;  4IFD E;  2N3H A;  1RQ0 A;  2YRK A;  4FW4 A;  2VQF I;  4U3D A;  2EN4 A;  4LF4 I;  2NN6 E;  3M7N D;  3C6K A;  1N34 I;  2ENA A;  2EOI A;  5A6B A;  2JWO A;  5AC5 A;  1FI4 A;  1UDO A;  2BV3 A;  2HK2 A;  4LF9 E;  5IXM B;  4JI1 E;  2JVA A;  1Z0W A;  5DRO A;  5F3W A;  1KIJ A;  1NCS A;  4BHB A;  2E5L E;  2GO3 A;  3U1K A;  2DMY A;  4F2J C;  1GTK A;  1X48 A;  2O1T A;  1BB8 A;  2F4V E;  2JEA B;  2R42 A;  4LOM A;  3PS2 A;  5K36 A;  3V5R A;  2G7H A;  1Z1B A;  4OZE A;  5AAS A;  4J3D A;  4X62 E;  1YUJ A;  2EM2 A;  2HFS A;  4BA2 A;  4DV1 I;  3M99 B;  4JI3 I;  2YTP A;  2EMC A;  2JY9 A;  4DR6 I;  2V2Q A;  1YFH A;  4X64 E;  2EP3 A;  4FN5 A;  2VF1 A;  1N3G A;  4MU4 A;  4ZYE A;  4R03 A;  1BBG A;  2L2M A;  4R8O A;  1JK1 A;  2O3Z A;  4OO1 E;  4OO1 B;  3J7A G;  4IFD B;  2E1M A;  2R3V A;  4IZJ A;  2RS7 A;  2EOQ A;  3GLL A;  2EPC A;  2YTF A;  2LCE A;  4YY3 I;  2F8B A;  1B69 A;  2E5L I;  1HR0 E;  1TF3 A;  2AJ4 A;  3K17 A;  1UHZ A;  3C4B A;  3ADJ A;  1LLM C;  4I8O A;  5TSE A;  4MU3 A;  3M85 G;  4ISA A;  4USM A;  4DV5 E;  3V2U C;  5C0X A;  2LTR A;  2YTE A;  3THO B;  4DPW A;  2F1D A;  4P52 A;  1BKN A;  3J80 C;  3GCM A;  1YYK A;  4DR6 E;  2NPF A;  2UXB I;  3EPK A;  1KTV A;  1OYP A;  4DMI A;  4IZK B;  1XMO E;  4KHP E;  2RS6 A;  2N8X A;  4OO1 F;  2A2D A;  1AAY A;  5A6J A;  4DV3 I;  4DV6 E;  4DR4 I;  4WPY A;  2YTD A;  2LVH A;  4DR1 E;  2Z5C B;  4NXN E;  1SR9 A;  1UIL A;  4QNK A;  4DV7 I;  4JYA I;  1USV A;  2EMA A;  2JOB A;  2V83 A;  4B3R E;  2ZIT A;  2EJ4 A;  2EMX A;  4DR7 E;  2J65 A;  1MEY C;  2GS8 A;  3ZZ0 A;  4R2E A;  2EMZ A;  4UTG A;  3F0N A;  4K0K E;  2EPK X;  2V86 A;  2L6M A;  2PNZ A;  2VF3 A;  4WYQ B;  1A1G A;  2UXB E;  5JEA E;  2Z5B A;  4DXL A;  4DUZ I;  1B62 A;  4FW7 A;  1Z0B A;  4ZYH A;  4RPF A;  5IV8 B;  2JP9 A;  1MGT A;  1XMO I;  4KHP I;  3PYD A;  3M6A A;  2V85 A;  2YSP A;  4FK5 C;  4HY1 A;  2EPZ A;  5LMU I;  2NAB A;  2JYA A;  1L4S A;  1N32 E;  4FWH A;  2IES A;  4IZK A;  2JEB B;  1RHY A;  4NXN I;  4JI8 I;  4IS9 A;  4DPX A;  4AID A;  1ELO A;  5BR8 I;  3MHH C;  5A6B D;  5LMN E;  2EN6 A;  2YSO A;  5DRQ A;  2YTG A;  1A1H A;  2CTD A;  1I94 I;  1Y6Z A;  2I9I A;  4BC9 A;  2DLQ A;  1RMD A;  4JI4 E;  1X6H A;  2EN3 A;  2M7Q A;  1BBO A;  2EPR A;  2BM0 A;  2O1W A;  2O1V A;  2C37 B;  4BA1 B;  1IBK I;  4I3H A;  1Y5Y A;  2EM4 A;  2JR1 A;  4RH8 A;  4OO1 C;  4DU8 A;  4O4K A;  2UUA I;  2JPA A;  1TF6 A;  5JEA F;  4LFB I;  3QG5 C;  2C39 A;  2HFU A;  3GME A;  3HJC A;  2EOF A;  5KL4 A;  2EOJ A;  3T1Y I;  2JEB A;  3IWB A;  2N3G A;  1YH8 A;  3WU3 A;  2FGG A;  1XNR E;  2EOH A;  5C0X B;  1H7S A;  1E3P A;  3MSW A;  2CPN A;  1S4E A;  1I94 E;  4B3T I;  4DR3 I;  1PJS A;  4X66 E;  1NHI A;  2XEX A;  4BS9 A;  5A2Q Q;  4M2Z A;  4MLQ A;  1R6M A;  2KHX A;  4LTY A;  2EMK A;  1WHQ A;  2EM6 A;  1P42 A;  2E72 A;  5IWA I;  4ZYG A;  3B4T A;  2UU9 E;  4TUG A;  1J26 A;  2MKN A;  2NN6 C;  4AIM A;  3WU6 A;  4LF8 I;  2EL5 A;  1T4O A;  1YUI A;  1IMU A;  3P3G A;  1HNZ I;  5GME A;  2Q8U A;  3B78 A;  2ELZ A;  4ZYD A;  4NBQ A;  3BF2 A;  4JI2 E;  1NHJ A;  1JK2 A;  2EZ6 A;  2PRT A;  5EKW A;  2NUG A;  1SFE A;  4MQY A;  2PNZ B;  4DR4 E;  4B3T E;  4Q35 B;  4GKK I;  5DNL A;  2EOS A;  4NXM E;  4ED4 A;  2ZBK B;  2C38 A;  2WBU A;  5IWA E;  2OI2 A;  2YTI A;  1QNT A;  4DKK A;  5K36 E;  1HNW I;  3K1J A;  4DV2 I;  4O24 A;  4X8W A;  4LF7 E;  3C4T A;  1WJP A;  4R2R A;  4B3M E;  3L7Z A;  4IFD F;  4DUZ E;  1YZ9 A;  4TUI A;  1HNZ E;  1EI1 A;  5JEA C;  4DU7 A;  3PYF A;  2EN1 A;  4URL A;  3BID A;  4GKK E;  1QZR A;  2BA1 D;  4BBY A;  4JI2 I;  2LJH A;  1Z5A A;  3MHS C;  2HJJ A;  2E1R A;  5IT9 Q;  4GKJ E;  1T38 A;  2GO4 A;  1D6T A;  2EQ3 A;  4R2C A;  1J5E I;  4DV4 E;  3LNU A;  1WRJ A;  4DUY E;  2VES A;  3P06 A;  4MDT A;  2V8Q B;  2RPC A;  2L3C A;  2C37 A;  4BA1 A;  1A1F A;  2EL4 A;  2YRH A;  4R2Q A;  1RR9 A;  5T6J A;  2EPX A;  4L8N A;  2C38 B;  1H72 C;  1Z0T A;  2HKJ A;  2L2N A;  3ZOQ B;  2EM7 A;  3EPJ A;  3P1X A;  1MX0 A;  2BA0 D;  1UBD C;  2NN6 B;  2UUC I;  4HAC A;  4GKJ I;  2BBG A;  2ADR A;  4WXC A;  2C39 B;  2NA2 A;  4F9B B;  2CSH A;  1X6F A;  1F2I G;  3B82 A;  2DGC A;  2EPL X;  3L7Z B;  3WU5 A;  3Q1Q A;  4GQU A;  4JV5 I;  4JI0 E;  2CVE A;  1G2D C;  4HTG A;  4X64 I;  2EQ0 A;  3HXL A;  1J5E E;  3CDJ A;  1DAR A;  3CDI A;  4LCG A;  4LCH A;  2EOZ A;  2DEJ A;  4LPF A;  4PRV A;  3BGH A;  2PO2 A;  2WP8 B;  3T1H I;  3ZZU A;  1XXE A;  3EQ1 A;  2L33 A;  1P47 A;  1FNM A;  4MYT A;  2V2V A;  1R6L A;  1ZM3 A;  3LTO A;  1DGC A;  2GQ0 A;  2WBT A;  5A2Q C;  1Y4U A;  1GQE A;  2V2Z A;  2V34 A;  1IQS A;  2ENC A;  4JV5 E;  2M9A A;  4GZN C;  1Z0C A;  4HXZ A;  3OML A;  4R2A A;  1B63 A;  2V87 A;  2PO0 A;  3F6G A;  4AQY I;  3ADG A;  1XMQ I;  2Q2E B;  2I13 A;  1H74 A;  3QT5 A;  3ZKD A;  2EOR A;  3F6H A;  4DPY A;  2NN6 F;  2WCC 3;  4DV7 E;  4JYA E;  2DEI A;  1WHN A;  1EH7 A;  3VYY A;  4FWD A;  1MG7 A;  2PO2 B;  2R76 A;  4R1F A;  4DR7 I;  4LF5 E;  4LFA E;  3B8H A;  4R2S A;  3KZY A;  1EKZ A;  1YSA C;  1Z0G A;  4NXM I;  1YYW A;  1ZBQ A;  1PJQ A;  2M1S A;  4LFB E;  4M9V C;  2V8P A;  1UDN A;  1FJG I;  4JI1 I;  3T1Y E;  1T4N A;  1A6F A;  2FV4 B;  1H7U A;  2CGE A;  1IBL I;  4X65 E;  1XHK A;  4KQV A;  3KWR A;  4LF9 I;  4OX9 I;  5C0X F;  3OTO E;  3VHT B;  2D9H A;  2ODR C;  1A1K A;  1UEK A;  4IFD D;  2PO0 B;  2WBS A;  1X49 A;  3JU0 A;  4IFD C;  2LJU A;  1S16 A;  3Q6N A;  4JI3 E;  1A1L A;  2UUB I;  4B3R I;  3JAM C;  4NZV A;  3JAM Q;  4DV4 I;  2J7K A;  2VE7 C;  2EMG A;  2NN6 A;  1PDA A;  2YPN A;  1OYS A;  1FWL A;  2AE8 A;  4HAC B;  2IER A;  5L3J A;  5K36 B;  2HHH I;  2MDG A;  2EMI A;  4LF8 E;  4JI4 I;  1ZR9 A;  2GHF A;  3HQ1 A;  1HNX E;  2CT1 A;  2DRP A;  1Z0V A;  2JXP A;  2MC5 A;  5DRP A;  5LL6 R;  4OX9 E;  4XTJ A;  1X47 A;  3P3C A;  5LLQ A;  3DD6 A;  4KWY A;  4DV5 I;  2WP8 A;  2UXD E;  2EFG A;  5FWK A;  2LRS A;  2LUP B;  4BC7 A;  4JG4 A;  1AH5 A;  5JEA D;  4WXD A;  4F6M A;  4B3M I;  1HNW E;  3L00 A;  1NZ0 A;  3TQM A;  3ZM7 A;  2UXC I;  5K36 F;  4IS1 C;  2EM9 A;  3ZZT A;  4DV2 E;  1Y4S A;  1X5W A;  2YTJ A;  4DR5 I;  1A1J A;  1PIE A;  3D4J A;  2EMF A;  2F4V I;  4LF6 E;  2DSY A;  3BBG A;  5DNX A;  2BB8 A;  4O5G A;  1KJK A;  3LLH A;  5AE3 A;  1MU5 A;  2NUE A;  2B9D A;  2LV2 A;  4DR1 I;  1IBK E;  1KVK A;  4BMJ A;  1T4L B;  3KRN A;  1OJ4 A;  1GZ6 A;  2EMW A;  2LBS B;  1ZXM A;  1STU A;  2PO1 B;  5KL6 A;  2B3T B;  1N36 I;  2BA0 G;  2V88 A;  1UDS A;  2JE6 B;  5DNY A;  3C6M A;  1XNQ E;  1TN9 A;  1H73 A;  2IHR 1;  5ELW A;  4RHB B;  4NHR A;  3PS3 A;  3JTZ A;  5CFF E;  1UN6 B;  1HR0 I;  3LPS A;  4WFT A;  4WSP A;  4JI8 E;  2DLK A;  4MU1 A;  2LT7 A;  3DJW A;  4F54 A;  4M30 A;  5A6K A;  1K47 A;  2WNR A;  4JI7 I;  2IOQ A;  2YZT A;  2CG9 A;  2MKD A;  5BR8 E;  1EH6 A;  2EM3 A;  4J8Z A;  2YTN A;  2UXC E;  1RC7 A;  1NEI A;  2DB2 A;  1N36 E;  5JEA B;  2X7I A;  4X62 I;  3VK6 A;  1X3C A;  4EMD A;  4X65 I;  2EN7 A;  4LFC I;  2A25 A;  3IWC A;  1T39 A;  4IJD A;  2KON A;  2M4I A;  2CZ9 A;  5KL7 A;  2PNM A;  5K36 C;  2IOP A;  3H4L A;  1RRE A;  5C0X D;  4Z7Y A;  4WX9 A;  2VQF E;  2EN8 A;  4LF4 E;  5C0X C;  4DUY I;  4MYU A;  1PJT A;  2V89 A;  2EE8 A;  4FW5 A;  3UHM A;  1DI2 A;  4WSG A;  2EPM X;  2K7I A; 
#chains in the Genus database with same CATH homology
 1N33 I;  3QT8 A;  3IWD A;  1XMQ E;  3J81 Q;  4JI7 E;  3HUL A;  3AV0 A;  2L2K B;  5AE2 A;  2KOU A;  2VQE I;  4FW9 A;  2ZM6 E;  4AQY E;  2HK3 A;  1ZM9 A;  4Z7C A;  2UUC E;  4F9C B;  2LTS A;  4DV0 E;  4JI6 E;  1ZM2 A;  3LML A;  4JI0 I;  1N0V C;  3GON A;  4WUC A;  2UXD I;  2NUF A;  2B7V A;  4M0V A;  1QU6 A;  5LMN I;  4UT4 A;  1Z5B A;  2VQE E;  4ZVI A;  4Q28 A;  4YY3 E;  2K4V A;  1FKA E;  3ADI A;  3J80 Q;  4FWG A;  2B7T A;  4DPU A;  3PYG A;  4USK A;  4LF6 I;  1PVG A;  4DPT A;  3FIG A;  1EA6 A;  2BM1 A;  1N32 I;  5FLX C;  1WXR A;  1USU A;  4HYM A;  4JI6 I;  1U2R A;  2RTX A;  3RMP A;  3PYE A;  4P78 A;  1ZXN A;  3H09 A;  3QT7 A;  2FTX B;  2O1U A;  1XNQ I;  2LJP A;  2MDR A;  2HHH E;  1FWK A;  1IBM I;  2Z5E A;  2JOX A;  1Z5C A;  4IZJ D;  4PU9 A;  2H36 X;  2DIX A;  4BCA A;  4DV6 I;  4LF5 I;  4LFA I;  3DF6 A;  1DQ3 A;  1O0W A;  4F9A B;  3K6Q A;  3QT6 A;  2UU9 I;  4WUD A;  3HPZ A;  2X36 A;  1YYO A;  2MC6 A;  5GMD A;  2LUQ A;  3VYX A;  2YT4 A;  3HTX A;  2RSM A;  4LU9 A;  3J7Y p;  3PRY A;  1IBM E;  1HK7 A;  2WW4 A;  4IZJ B;  2ODR D;  3ZKB A;  2L8T A;  4LF7 I;  1FJG E;  3T1H E;  1N0U A;  2A2C A;  3Q6M A;  1N33 E;  4P7A A;  1IBL E;  1KKH A;  4B3S E;  1HNX I;  4DV3 E;  2L92 A;  3HPS A;  3OTO I;  2WZO A;  2ZM6 I;  4KZS A;  4L5N C;  1NHH A;  4YHH E;  2L3J A;  3CWV A;  1ZBT A;  4JI5 I;  1Z59 A;  2LE2 A;  4DV0 I;  4DR2 E;  5IT9 C;  1WUU A;  3K85 A;  3AUZ A;  1PKP A;  2LMZ A;  4K0K I;  2UUB E;  3J7A M;  3WU4 A;  2UUA E;  2PNL A;  4P7D A;  2Z5C A;  5FLX Q;  5ADZ A;  1N34 E;  3J81 C;  4N3O A;  1XNR I;  4LFC E;  1Z0E A;  4DR5 E;  1VIS A;  4M1K A;  4WUB A;  2HKE A;  4X66 I;  5LMU E;  1ZM4 A;  4B3S I;  4GEQ B;  4JI5 E;  3ADL A;  4OOG C;  4PRX A;  2Z5B B;  4DR2 I;  5AE1 A;  4DV1 E;  2EWL A;  4DR3 E;  4YHH I;  2N3H A;  1RQ0 A;  2VQF I;  4LF4 I;  1N34 I;  2JWO A;  1FI4 A;  2BV3 A;  2HK2 A;  4LF9 E;  4JI1 E;  2JVA A;  1Z0W A;  5F3W A;  1KIJ A;  2E5L E;  2DMY A;  1X48 A;  2O1T A;  2F4V E;  2R42 A;  3V5R A;  2G7H A;  5AAS A;  2HFS A;  4DV1 I;  4JI3 I;  4DR6 I;  2JY9 A;  2V2Q A;  4FN5 A;  4X64 E;  2VF1 A;  4R03 A;  2L2M A;  4R8O A;  3J7A G;  2E1M A;  2R3V A;  4IZJ A;  2RS7 A;  4YY3 I;  2F8B A;  2E5L I;  1HR0 E;  2AJ4 A;  3K17 A;  1UHZ A;  3C4B A;  3ADJ A;  4I8O A;  4USM A;  4DV5 E;  3V2U C;  2LTR A;  4DPW A;  4P52 A;  1BKN A;  3J80 C;  1YYK A;  4DR6 E;  2NPF A;  2UXB I;  1KTV A;  4DMI A;  4IZK B;  1XMO E;  4KHP E;  2RS6 A;  2A2D A;  4DV3 I;  4DV6 E;  4DR4 I;  4WPY A;  4DR1 E;  2Z5C B;  4NXN E;  1SR9 A;  1UIL A;  4DV7 I;  4JYA I;  1USV A;  2JOB A;  2V83 A;  4B3R E;  2ZIT A;  4DR7 E;  3ZZ0 A;  2GS8 A;  4UTG A;  3F0N A;  4K0K E;  2V86 A;  2L6M A;  2VF3 A;  4WYQ B;  2UXB E;  2Z5B A;  4DXL A;  4DUZ I;  1B62 A;  1Z0B A;  4RPF A;  1XMO I;  4KHP I;  3PYD A;  3M6A A;  2V85 A;  4HY1 A;  5LMU I;  1N32 E;  4FWH A;  4IZK A;  4JI8 I;  4NXN I;  4DPX A;  5BR8 I;  1ELO A;  5LMN E;  1I94 I;  1Y6Z A;  4BC9 A;  4JI4 E;  2M7Q A;  2BM0 A;  2O1W A;  2O1V A;  1IBK I;  4I3H A;  2JR1 A;  4DU8 A;  2UUA I;  4LFB I;  3HJC A;  2HFU A;  3T1Y I;  3IWB A;  2N3G A;  3WU3 A;  2FGG A;  1XNR E;  1H7S A;  1S4E A;  3MSW A;  2CPN A;  4B3T I;  1I94 E;  4DR3 I;  4X66 E;  1NHI A;  2XEX A;  4BS9 A;  5A2Q Q;  4M2Z A;  2KHX A;  4LTY A;  1WHQ A;  5IWA I;  2UXC I;  2UU9 E;  4TUG A;  1J26 A;  3WU6 A;  4LF8 I;  1HNZ I;  1T4O A;  5GME A;  3B78 A;  4JI2 E;  1NHJ A;  2EZ6 A;  2NUG A;  4DR4 E;  4B3T E;  4GKK I;  4NXM E;  4ED4 A;  2ZBK B;  2OI2 A;  5IWA E;  4DKK A;  1HNW I;  3K1J A;  4DV2 I;  4X8W A;  4LF7 E;  3C4T A;  4B3M E;  4DUZ E;  1YZ9 A;  4TUI A;  1HNZ E;  1EI1 A;  4DU7 A;  3PYF A;  4URL A;  4GKK E;  1QZR A;  4JI2 I;  4BBY A;  5IT9 Q;  2LJH A;  1Z5A A;  2E1R A;  4GKJ E;  1D6T A;  1J5E I;  4DV4 E;  3LNU A;  4DUY E;  3P06 A;  2V8Q B;  2L3C A;  1RR9 A;  5T6J A;  4L8N A;  1H72 C;  1Z0T A;  2HKJ A;  2L2N A;  3ZOQ B;  3P1X A;  1MX0 A;  2UUC I;  4HAC A;  4GKJ I;  2NA2 A;  4F9B B;  3B82 A;  3WU5 A;  3Q1Q A;  4JI0 E;  4X64 I;  3HXL A;  1J5E E;  1DAR A;  4PRV A;  2DEJ A;  3T1H I;  3ZZU A;  4MYT A;  2L33 A;  1FNM A;  2V2V A;  1ZM3 A;  3LTO A;  2GQ0 A;  1Y4U A;  5A2Q C;  1GQE A;  2V2Z A;  2V34 A;  4JV5 E;  1Z0C A;  4HXZ A;  3OML A;  1B63 A;  2V87 A;  3F6G A;  4AQY I;  3ADG A;  1XMQ I;  2Q2E B;  1H74 A;  3QT5 A;  3ZKD A;  3F6H A;  4DPY A;  4DV7 E;  4JYA E;  2DEI A;  1WHN A;  4JV5 I;  3VYY A;  4FWD A;  1MG7 A;  4R1F A;  4DR7 I;  4LF5 E;  4LFA E;  3B8H A;  1EKZ A;  1Z0G A;  4NXM I;  1YYW A;  1ZBQ A;  2M1S A;  4LFB E;  2V8P A;  1FJG I;  4JI1 I;  3T1Y E;  1T4N A;  1A6F A;  2FV4 B;  1H7U A;  2CGE A;  1IBL I;  4X65 E;  1XHK A;  4KQV A;  3KWR A;  4LF9 I;  4OX9 I;  3OTO E;  2ODR C;  1UEK A;  1X49 A;  3JU0 A;  1S16 A;  3Q6N A;  4JI3 E;  2UUB I;  4B3R I;  3JAM C;  3JAM Q;  4DV4 I;  2J7K A;  2VE7 C;  4HAC B;  1FWL A;  5L3J A;  2HHH I;  4LF8 E;  4JI4 I;  3HQ1 A;  1HNX E;  1Z0V A;  2MC5 A;  5LL6 R;  4OX9 E;  4XTJ A;  1X47 A;  4DV5 I;  2UXD E;  2EFG A;  5FWK A;  2LRS A;  2LUP B;  4BC7 A;  4JG4 A;  4B3M I;  1HNW E;  1NZ0 A;  3ZM7 A;  3ZZT A;  4DV2 E;  1Y4S A;  4DR5 I;  1PIE A;  3D4J A;  2F4V I;  4LF6 E;  2DSY A;  1MU5 A;  3LLH A;  5AE3 A;  2NUE A;  2B9D A;  4DR1 I;  1IBK E;  1KVK A;  4BMJ A;  1T4L B;  1OJ4 A;  1GZ6 A;  2LBS B;  1ZXM A;  1STU A;  2B3T B;  1N36 I;  2V88 A;  5DNY A;  1XNQ E;  1H73 A;  2IHR 1;  3JTZ A;  5CFF E;  1HR0 I;  3LPS A;  4WFT A;  4WSP A;  4JI8 E;  3DJW A;  4F54 A;  4M30 A;  1K47 A;  4JI7 I;  2IOQ A;  2YZT A;  2CG9 A;  4J8Z A;  5BR8 E;  2UXC E;  4X62 I;  1RC7 A;  1N36 E;  2DB2 A;  2X7I A;  3VK6 A;  4EMD A;  4X65 I;  4LFC I;  3IWC A;  2CZ9 A;  2KON A;  2M4I A;  2PNM A;  2IOP A;  3H4L A;  1RRE A;  4Z7Y A;  2VQF E;  4LF4 E;  4DUY I;  4MYU A;  2V89 A;  1DI2 A;  4X62 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...