3J80C

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j80C01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j80C02
2UUCI 4DV0E 4M1KA 1Z0GA 4RPFA 3ZZ0A 4KQVA 4HACB 2UUBE 1EA6A 1ZM9A 4WUBA 1XNRI 5LMNE 4JI4E 4AQYE 4YY3I 4X65E 2UXDI 3B8HA 2R42A 3T1HI 2Q2EB 1IBMI 1B63A 4JI8E 4DU8A 4HYMA 1XNQE 3J81C 4FWHA 4JI0E 3H4LA 2VQEI 4NXMI 4DR7I 1H7SA 3QT6A 4K0KE 1D6TA 3K17A 4JI7E 3OTOI 1Z0EA 3J7AG 1N33E 4LF6I 3B82A 2VF3A 4DV1E 4JI6E 1FNMA 4DR5I 4DPUA 4DPXA 4EMDA 3M6AA 4DUYE 3PYEA 4DV7E 2A2CA 4DV3I 1ZXNA 3J80C 2CZ9A 1HNXE 1N36I 2UUAI 4DR6E 2E5LE 4DUZI 4X62I 1S16A 4Z7YA 1H7UA 5GMDA 2UUCE 2V2VA 3GONA 4LFBI 4B3RI 1H74A 1Z5CA 3J81Q 4PU9A 3ZZTA 4X64I 1A6FA 2UXDE 4WUCA 2WW4A 2X7IA 1KKHA 1QZRA 4JI1E 1KVKA 4LFCI 3HULA 4GKJI 4B3ME 1Z0BA 2ZM6E 2VQEE 4JI5E 4URLA 4B3SE 3WU3A 3OTOE 4DV2I 3J80Q 4LF6E 1N34I 5BR8E 2R3VA 1FI4A 1IBLI 2BM0A 1OJ4A 1U2RA 4NXNE 4OX9E 1ZM3A 2GS8A 4ED4A 2HHHI 1H72C 4LF7I 5IT9Q 4JV5I 4LF4I 1B62A 4DR1I 4HACA 3WU4A 4DR2E 3Q1QA 4LFBE 4HY1A 4B3RE 4DV4E 5IWAI 1HR0E 4DV5E 4DV6I 2UXCI 1MX0A 1I94I 4JI3I 1FJGI 3ZZUA 4GKKI 4LF9I 4LF5I 4DPYA 1HNZE 1MU5A 3JAMC 1J5EI 1RR9A 4GKJE 2DEJA 1XMQI 3T1YI 4PRXA 1N32E 2UXBI 2HKJA 2XEXA 2VQFE 1Z0WA 4B3TI 1KTVA 4FWGA 1ZXMA 2HKEA 2F4VI 4P7AA 1PVGA 4HXZA 4LF8I 4DR3I 2UUBI 1XNRE 2AJ4A 1Z0TA 1KIJA 5LMNI 4JI4I 4YY3E 2V2ZA 4AQYI 2HK3A 3D4JA 2LJPA 4JI2I 3T1HE 4DR1E 1IBME 3QT7A 5GMEA 4DU7A 4JI8I 1DARA 4USMA 5IWAE 1XNQI 1N0UA 1NHHA 4JI0I 4KHPI 3F0NA 2BV3A 3QT8A 4UTGA 5FLXC 4X66I 4YHHI 1I94E 4LFAI 1FJGE 4NXME 4DR7E 4LF9E 4K0KI 5LMUI 4LF5E 1FWLA 4R1FA 1N33I 3T1YE 2J7KA 3LTOA 4MYUA 4DXLA 4JI6I 4DR5E 5L3JA 4PRVA 2ZBKB 4DUYI 4DV7I 1S4EA 4DV3E 1Z0VA 3V5RA 4B3TE 3CWVA 3PYFA 1N36E 1HNXI 2UUAE 4DUZE 4X62E 2E5LI 4DR6I 1UEKA 3LPSA 1NZ0A 4MYTA 1Z5BA 2V2QA 3B78A 1ZM4A 2F4VE 3PYDA 4Z7CA 1FKAE 4USKA 2HFSA 4LF8E 4DR3E 4X64E 2UU9I 5FLXQ 2HFUA 4JI2E 1FWKA 4ZVIA 4DPWA 2A2DA 1WUUA 4JI1I 4XTJA 1PIEA 3J7AM 2BM1A 4JYAI 4LFCE 1XMOI 5A2QC 2NPFA 4B3MI 2V34A 4KHPE 4X66E 4YHHE 4LFAE 1Z0CA 3PYGA 4DPTA 2ZM6I 4JI5I 2OI2A 1HNWI 1IBKI 4B3SI 4FWDA 5LMUE 3V2UC 4DV2E 1ELOA 1BKNA 2X36A 1N34E 4DR4I 4P52A 1K47A 3QT5A 5BR8I 5LL6R 4DV0I 2DEIA 1IBLE 3K1JA 1XHKA 2EFGA 1Z5AA 1N0VC 4UT4A 2V8PA 4NXNI 4WUDA 4OX9I 2HHHE 2ZITA 4LF7E 4JV5E 4LF4E 1EI1A 1NHJA 4X65I 1PKPA 4DR2I 1H73A 3JAMQ 4DV4I 1HR0I 4DV6E 1Z59A 4DV5I 5A2QQ 2UXCE 3WU6A 4FN5A 3WU5A 3ZKDA 5IT9C 4JI3E 2UU9E 4GKKE 4JG4A 3ZKBA 4JI7I 1HNZI 1J5EE 4JYAE 3LNUA 1XMQE 1XMOE 2E1RA 3ZM7A 2HK2A 4DV1I 1NHIA 1N32I 1ZM2A 1MG7A 1VISA 2UXBE 1HNWE 4I3HA 1IBKE 2VQFI 4DR4E 4FW9A 1RREA
chains in the Genus database with same CATH superfamily
4IFDC 3ADLA 3KWRA 2BA1D 2VRDA 5A6KA 2CVEA 2UUCI 5IXMB 2EOEA 4DV0E 3CDIA 4ZYHA 5ADZA 4M1KA 1Z0GA 2M4IA 2EPLX 2V87A 4RPFA 3ZZ0A 4KQVA 5A6JA 4F6MA 4HACB 1HR0I 2GQ0A 1A1GA 2J7JA 2Z5BB 2Q8UA 4OOGC 2EM2A 1HK7A 5JEAC 1X6HA 2UUBE 1EA6A 1ZM9A 4WUBA 2YTJA 2DIXA 1XNRI 5LMNE 4JI4E 2LJHA 4AQYE 2Z5CA 3L00A 2JOXA 4YY3I 2CTDA 4X65E 1F2IG 2UXDI 3B8HA 4IZKA 1KYQA 2L3CA 2WNRB 1ZR9A 4R03A 2O1VA 2R42A 2Q2EB 3T1HI 1B63A 3PS1A 1IBMI 2RPCA 4JI8E 4DU8A 3DF6A 2JT2A 1YHCA 3ADJA 5C0XC 1ZU1A 4DMIA 4HYMA 4KWYA 4O4KA 1R6MA 3EPKA 2KOUA 1XNQE 2ODRD 1TN9A 2CPNA 3J81C 4FWHA 2RSMA 3ADGA 3M85D 4Q35B 3BF2A 4M30A 4JI0E 2NUFA 3GCMA 2LV2A 2YTOA 4HTGA 1Y6ZA 4LCFA 2EOSA 3H4LA 2L8TA 4R8OA 2EMLA 2VQEI 4NXMI 1YFHA 4ZYEA 2IHR1 4TUIA 1H7SA 4K0KE 3QT6A 4DR7I 5K36D 2NN6D 2YSPA 1UN6B 1D6TA 3K17A 1PJQA 2EMGA 4JI7E 4R2DA 2NA2A 1Z0EA 3OTOI 2B7TA 3P3EA 4GZNC 3THNA 2EOOA 2EMYA 3J7AG 1N33E 3KRNA 4LF6I 4F2JC 3BBGA 4X9JA 3RMPA 2EOYA 4IJDA 3B82A 2O1WA 2VF3A 2YTFA 4DV1E 3HKMA 2EL5A 4R2EA 3C6MA 4JI6E 1IMUA 1FNMA 2EOMA 4DR5I 2VESA 4DPUA 3F6GA 4DPXA 4EMDA 3M6AA 4OO1D 2EPAA 3IWCA 2PRTA 4DUYE 2V83A 2R1FA 3PYEA 2ENHA 4DV7E 2ENCA 2A2CA 3MSWA 3PRYA 5C0XB 2EN3A 4BA1B 4DV3I 4BA2B 1XXEA 2IOQA 1ZXNA 4WXDA 2N3GA 4J3DA 3J80C 2CZ9A 4O43A 4BBYA 3P1XA 2EMBA 1HNXE 2JP9A 1N36I 5KL4A 2EMXA 2UUAI 2L6MA 4GEQB 2E5LE 4DR6E 4X62I 1EH7A 4DUZI 5AC4A 1T39A 1S16A 4Z7YA 3K85A 3DD6A 3MHSC 1H7UA 2UUCE 2DGCA 5GMDA 1P42A 3F6HA 2YRKA 4R2RA 2V2VA 1WRJA 2EMAA 4IZJD 4N3OA 2AE8A 1J26A 3GONA 4LFBI 4B3RI 2RSIA 5AE1A 2EQ1A 2IESA 2DMYA 1H74A 1Z5CA 1YZ9A 3J81Q 2EMCA 1RQ0A 2JY9A 5EKWA 4PU9A 5DNLA 2WCC3 3ZZTA 4X64I 1A6FA 2B7VA 2EPXA 4BCAA 4P7DA 1WXRA 2C38B 5K36A 5LLQA 2UXDE 2NN6A 2EPPA 2WW4A 4F9CB 4WUCA 2X7IA 2V86A 1KKHA 1QZRA 2L2MA 2EPCA 2YU8A 4JI1E 1MGTA 2CGEA 1KVKA 2WP8A 4LFCI 2LTSA 4MLVA 2V85A 2YTNA 4WYQB 3VYYA 2HGHA 3HULA 2JEAB 4GKJI 2V89A 3GLLA 4RHBB 4B3ME 4F9AB 2LTRA 5K36F 2L33A 2NN6F 3GMEA 2H36X 3KZYA 1BBOA 4OO1A 1Z0BA 2ZM6E 2EPOA 2VQEE 2I13A 4JI5E 2MDGA 1WJPA 5EL9A 4URLA 2ELYA 4B3SE 5KL6A 1USUA 3WU3A 1X6EA 3UK3C 4KZSA 1JK2A 1Z1BA 4FW6A 2Z5EA 4U3BA 3OTOE 2RQLA 4LTYA 2DLKA 2B3TB 2BBGA 3LLHA 1DGCA 2WZOA 1SR9A 4DV2I 4RH8A 4X8WA 4OKGA 4LF6E 3J80Q 2DLQA 5AE3A 2MC6A 2EJ4A 1N34I 4OO1F 1ZAAC 3M7NG 4IZJA 2YTEA 2EORA 3VK6A 5BR8E 1FI4A 3EPLA 2R3VA 1UILA 1IBLI 2BR2A 4MU4A 4MU3A 1EH8A 2BM0A 1OJ4A 2L3JA 1U2RA 4FW4A 2PO1A 1E3PA 4AM3A 4NXNE 3P76A 2MKDA 3EPJA 4OX9E 3U1KA 1ZM3A 2F1DA 2GS8A 2A25A 4ED4A 2HHHI 2DB2A 1T4LB 1H72C 2YRMA 4LF7I 5IT9Q 4JV5I 1Y60A 4LF4I 4BHCA 4WSGA 2EOFA 1B62A 4DR1I 3C6KA 2RS7A 4HACA 4R2SA 3WU4A 4DR2E 2Z5BA 3Q1QA 4LFBE 4HY1A 1JK1A 4B3RE 4DV4E 2GHFA 2EM9A 3H09A 2NUGA 5IWAI 1HR0E 4DV5E 4DV6I 4WX9A 3C4BA 4MU1A 2UXCI 2EP3A 2GPIA 1MX0A 5DNXA 4IFDE 4IFDB 1I94I 4JI3I 1FJGI 3HQ1A 3JU0A 4O5GA 2WNRA 3ZZUA 2LUPB 2LMZA 4GKKI 4LF9I 4LF5I 3P3CA 1X47A 2EPMX 4DPYA 5CFFE 4F9BB 1NCSA 2YU5A 1HNZE 1MU5A 3JAMC 3PS2A 1J5EI 5JEAB 5JEAE 1RR9A 1T4OA 4GKJE 4JI1I 2DEJA 1IQSA 2ODRC 4Q28A 1XMQI 5T6JA 2M9AA 2MKNA 3T1YI 2YWQA 4PRXA 5DRQA 3EQ1A 1WHQA 3LMLA 4FK5C 2PNZB 1N32E 4QNJA 2BA0D 2LE2A 2YTDA 2EPRA 2UXBI 5K36C 3QG5C 2C37B 2HKJA 1MEYC 2NN6C 4BHBA 2O3ZA 1Y4UA 2XEXA 3L7ZB 5C0XE 2VQFE 1Z0WA 4B3TI 2PNMA 2EN1A 1A1JA 1ZBTA 1KTVA 5KL3A 4FWGA 2YPNA 2ELZA 5AE2A 1ZXMA 2HKEA 3AUZA 2JR1A 2O1UA 4MDTA 4WFTA 4OO1C 2F4VI 3K6QA 4P7AA 5C0XA 5DROA 1GQEA 1GZ6A 4BA1A 4X66I 4BA2A 3OMLA 2DSYA 3BGHA 1PVGA 2IOPA 2RS6A 3B4TA 2WBUA 3H1CA 4HXZA 3VHTB 2JVAA 1T4NA 4DR3I 2EMHA 2UUBI 2LVHA 3MHHC 4LF8I 4O24A 2EMWA 1XNRE 2C39B 2JOBA 1Z0TA 1KIJA 1EH6A 2AJ4A 4YY3E 5LMNI 4JI4I 2V2ZA 4J8ZA 4AQYI 4BC9A 2R76A 3HPSA 2RTXA 5TSEA 2HK3A 3D4JA 4FW7A 4I8OA 5AASA 1P47A 2LJPA 5C0XF 4JI2I 5A6BD 3T1HE 4DR1E 2MC5A 2EM5A 3JTZA 1IBME 3QT7A 2EPUA 2JE6B 4FW5A 5GMEA 4R2CA 2EOJA 4JI8I 4DU7A 2EOQA 2ENAA 1PJSA 2VF1A 2LT7A 2NABA 1BB8A 1DARA 3NZKA 4USMA 5IWAE 5AC5A 2C39A 2EMIA 4LOMA 1XNQI 2L2KB 2EMFA 4BS9A 5KL2A 1NHHA 1N0UA 2EN4A 4JI0I 2EOXA 2C38A 3HTXA 4KHPI 2L92A 1I94E 2BV3A 3F0NA 5FLXC 3QT8A 2YTIA 1YH8A 3HJCA 1FJGE 2J65A 4LPFA 4YHHI 4LFAI 4NXME 3M85G 4DR7E 3ADIA 5F3WA 4LF9E 4K0KI 1A1HA 5LMUI 4LF5E 1YYOA 2EWLA 2JEAA 1FWLA 4R1FA 1OYPA 2EN2A 1A1FA 1B69A 5KL7A 2PO2B 1DQ3A 1BBGA 1AH5A 2YZTA 3PS3A 4M9VC 4NBQA 1N33I 3T1YE 3M99B 2J7KA 3LTOA 4IFDD 4MYUA 2JWOA 4N4RB 2PO0B 4DXLA 4JI6I 2N8XA 2YRHA 4NHRA 3VYXA 1X3CA 4WXCA 4DR5E 5DRRA 3UHMA 1OYSA 5L3JA 2KHXA 4PRVA 1NEIA 1UDNA 2LBSB 1TF6A 4WPYA 2ZBKB 4DUYI 2EOZA 4DV7I 3C4TA 1S4EA 4M2ZA 4DV3E 4MQYA 1Z0VA 2PO2A 5JEAD 3V5RA 4B3TE 5A6AA 3P06A 3CWVA 3PYFA 2EE8A 1N36E 1HNXI 2EPZA 2UUAE 1QNTA 4DUZE 1YYKA 4X62E 2E5LI 4DR6I 4L5NC 1UEKA 3LPSA 5A6BA 2Z5CB 1NZ0A 4MYTA 4LU9A 1Z5BA 2V2QA 3B78A 3CDJA 1ZM4A 4IZKB 3ECRA 2F4VE 3PYDA 2EOHA 3Q6MA 1RHYA 2EPNA 2LCEA 1UDOA 2FV4B 3J7Yp 1FKAE 1G2FC 2YSOA 4USKA 4Z7CA 5C0XD 1YSAC 2KONA 2HFSA 4M0VA 4MU0A 4LF8E 4DR3E 1YPNA 4AIDA 2LO3A 2DMIA 4BC7A 2EM3A 4JYAI 4R2AA 3DJWA 4DKKA 4X64E 3IWDA 4TUGA 2M7QA 2V8QB 5FLXQ 2UU9I 1PDAA 2YTPA 5FWKA 2HFUA 4ZYGA 4NZVA 4JI2E 1FWKA 4ZVIA 1ZBQA 2E1MA 2JXPA 2A2DA 4HEIA 2B9DA 4IS9A 4DPWA 2V88A 1WUUA 1PJTA 4F6NA 1PIEA 4XTJA 2YTGA 2BM1A 2CG9A 1AAYA 4LFCE 1Y4SA 3J7AM 2E72A 2EM8A 1XMOI 5A2QC 5ELWA 4IFDA 1T38A 1R6LA 5DRPA 4U3DA 2NPFA 4B3MI 4QNKA 2D9HA 4WSPA 2V34A 1YYWA 4KHPE 4X66E 1A1LA 4YHHE 1A1KA 4L8NA 4LFAE 1Z0CA 3PYGA 4DPTA 2ZM6I 4JI5I 4IS1C 2OI2A 1HNWI 5DNYA 2EQ3A 2NUEA 1DI2A 1IBKI 2MDRA 4FWDA 4B3SI 3P3GA 5LMUE 2EPKX 5JEAA 1TF3A 3TQMA 3V2UC 3KZZA 1IQOA 3FIGA 4MLQA 4IFDF 3ZOQB 4DV2E 1ELOA 3M7ND 2HC5A 2VE7C 2F8BA 2JEBB 2EN6A 2PNZA 1BKNA 1N34E 2X36A 4DR4I 2JYAA 2FGGA 4P52A 1VI7A 1K47A 3AV0A 2HJJA 5A69A 3QT5A 3IWBA 5BR8I 5LL6R 1IBLE 2DEIA 4DV0I 1N3GA 1WHNA 2C37A 2BA0G 1EKZA 3K1JA 4UTGA 3L7ZA 1XHKA 4R2PA 2EFGA 4GQUA 5JEAF 2O1TA 2BA1G 1Z5AA 1N0VC 2WBSA 4UT4A 1SFEA 2IERA 2YTQA 2V8PA 4NXNI 5KL5A 1QU6A 1RMDA 2GO3A 2EM6A 3EPHA 2JEBA 1USVA 4WUDA 4OX9I 1L4SA 2HHHE 1STUA 1X6FA 4LF7E 2ZITA 4JV5E 4LF4E 4P78A 3BIDA 1EI1A 1NHJA 4X65I 2BB8A 1PKPA 1A1IA 2FTXB 4FW3A 5K36E 2CSHA 5K36B 3Q6NA 2NN6B 2NN6E 2GO4A 4AIMA 2M1SA 4DR2I 1H73A 2EL6A 2PNLA 3JAMQ 4LCHA 2WP8B 4DV4I 1UHZA 4OZEA 2EL4A 2EN7A 1O0WA 2EM4A 4DV6E 1UDQA 1Z59A 5A2QQ 2UXCE 2EMZA 3WU6A 4DV5I 4FN5A 2EN8A 2DRPA 2ADRA 2EMKA 3WU5A 1RC7A 3ZKDA 5IT9C 4JI3E 2UU9E 1GTKA 2LJUA 4R2QA 1LLMC 2EZ6A 2LRSA 3HXLA 2LUQA 3THOB 2JE6A 4GKKE 4OO1B 4OO1E 5IV8B 1X5WA 4JG4A 1KJKA 1X48A 3ZKBA 4JI7I 2K7IA 4JYAE 1J5EE 3U1YA 1HNZI 3HPZA 3LNUA 1XMQE 2EM7A 1YUJA 4LCGA 1XMOE 2E1RA 3ZM7A 2WBTA 1OYRA 2G7HA 2HK2A 4DV1I 1NHIA 1N32I 1ZM2A 1G2DC 4ZYDA 4IZJB 1MG7A 4ISAA 1RREA 2UXBE 1VISA 2EM0A 1HNWE 2L2NA 4I3HA 1YUIA 1IBKE 2EQ0A 4BMJA 2GLIA 2BR2B 2I9IA 1Y5YA 2K4VA 1X49A 2VQFI 2PO1B 4F54A 2N3HA 1E3HA 1UDSA 2CT1A 2YT4A 2EOIA 1UBDC 2PO0A 4DR4E 4FW9A 2JPAA
chains in the Genus database with same CATH topology
3ADLA 3KWRA 2UUCI 4DV0E 5ADZA 4M1KA 1Z0GA 2M4IA 4RPFA 2V87A 3ZZ0A 4KQVA 4HACB 2GQ0A 2Z5BB 4OOGC 1HK7A 2UUBE 1EA6A 1ZM9A 4WUBA 2DIXA 1XNRI 5LMNE 4JI4E 2LJHA 4AQYE 2Z5CA 4YY3I 2JOXA 4X65E 2UXDI 3B8HA 4IZKA 2L3CA 4R03A 2O1VA 2R42A 2Q2EB 3T1HI 1B63A 1IBMI 4JI8E 4DU8A 3DF6A 3ADJA 4DMIA 4HYMA 2KOUA 1XNQE 2ODRD 2CPNA 3J81C 4FWHA 2RSMA 3ADGA 4M30A 4JI0E 2NUFA 1Y6ZA 3H4LA 2L8TA 4R8OA 2VQEI 4NXMI 2IHR1 4TUIA 1H7SA 4K0KE 3QT6A 4DR7I 1D6TA 3K17A 4JI7E 3OTOI 1Z0EA 2NA2A 2B7TA 3J7AG 1N33E 4LF6I 3B82A 3RMPA 2O1WA 2VF3A 4DV1E 4JI6E 1FNMA 4DR5I 4DPUA 3F6GA 4DPXA 4EMDA 3M6AA 3IWCA 4DUYE 2V83A 3PYEA 4DV7E 2A2CA 3MSWA 3PRYA 4DV3I 2IOQA 1ZXNA 2N3GA 3J80C 2CZ9A 4BBYA 3P1XA 1HNXE 1N36I 2UUAI 4DR6E 2L6MA 4GEQB 2E5LE 4X62I 4DUZI 1S16A 4Z7YA 3K85A 1H7UA 2UUCE 5GMDA 3F6HA 4IZJD 2V2VA 4N3OA 1J26A 3GONA 4LFBI 4B3RI 5AE1A 2DMYA 1H74A 1Z5CA 1YZ9A 3J81Q 1RQ0A 2JY9A 4PU9A 3ZZTA 4X64I 1A6FA 2B7VA 1WXRA 4BCAA 4P7DA 2UXDE 4WUCA 2WW4A 4F9CB 2X7IA 2V86A 1KKHA 1QZRA 2L2MA 4JI1E 2CGEA 1KVKA 4LFCI 2LTSA 4WYQB 2V85A 3VYYA 3HULA 4GKJI 2V89A 4B3ME 4F9AB 2LTRA 2L33A 2H36X 1Z0BA 2ZM6E 2VQEE 4JI5E 4URLA 4B3SE 1USUA 3WU3A 4KZSA 2Z5EA 3OTOE 4LTYA 2B3TB 3LLHA 2WZOA 1SR9A 4DV2I 4X8WA 3J80Q 4LF6E 5AE3A 2MC6A 1N34I 4IZJA 5BR8E 3VK6A 2R3VA 1FI4A 1UILA 1IBLI 2BM0A 1OJ4A 2L3JA 1U2RA 4NXNE 4OX9E 1ZM3A 2GS8A 4ED4A 2HHHI 2DB2A 1T4LB 1H72C 4LF7I 5IT9Q 4JV5I 4LF4I 1B62A 4DR1I 2RS7A 4HACA 3WU4A 4DR2E 2Z5BA 3Q1QA 4LFBE 4HY1A 4B3RE 4DV4E 2NUGA 5IWAI 3H09A 1HR0E 4DV5E 4DV6I 3C4BA 2UXCI 1MX0A 1I94I 4JI3I 1FJGI 3HQ1A 3JU0A 3ZZUA 2LUPB 2LMZA 4GKKI 4LF9I 4LF5I 4DPYA 1X47A 5CFFE 4F9BB 1HNZE 1MU5A 3JAMC 1J5EI 1RR9A 1T4OA 4GKJE 2DEJA 1XMQI 2ODRC 4Q28A 5T6JA 3T1YI 4PRXA 3LMLA 1WHQA 1N32E 2LE2A 2UXBI 2HKJA 1Y4UA 2XEXA 2VQFE 1Z0WA 4B3TI 2PNMA 1ZBTA 1KTVA 4FWGA 5AE2A 1ZXMA 2HKEA 3AUZA 2JR1A 2O1UA 4WFTA 2F4VI 3K6QA 4P7AA 1GZ6A 1GQEA 3OMLA 2DSYA 1PVGA 2IOPA 4HXZA 2RS6A 4LF8I 2JVAA 1T4NA 4DR3I 2UUBI 1XNRE 2JOBA 1Z0TA 1KIJA 2AJ4A 5LMNI 4YY3E 4JI4I 2V2ZA 4J8ZA 4AQYI 4BC9A 3HPSA 2RTXA 2HK3A 3D4JA 4I8OA 5AASA 2LJPA 4JI2I 3T1HE 4DR1E 2MC5A 1IBME 3JTZA 3QT7A 5GMEA 4DU7A 4JI8I 2VF1A 1DARA 4USMA 5IWAE 1XNQI 2L2KB 1N0UA 4BS9A 1NHHA 4JI0I 3HTXA 4KHPI 2L92A 1I94E 2BV3A 3F0NA 5FLXC 3QT8A 4UTGA 3HJCA 4X66I 1FJGE 4YHHI 4LFAI 4NXME 4DR7E 3ADIA 5F3WA 4LF9E 4K0KI 5LMUI 4LF5E 1YYOA 2EWLA 1FWLA 4R1FA 1N33I 1DQ3A 2YZTA 3T1YE 2J7KA 3LTOA 4MYUA 2JWOA 4DXLA 4JI6I 3VYXA 4DR5E 5L3JA 2KHXA 4PRVA 2LBSB 4WPYA 2ZBKB 4DUYI 4DV7I 3C4TA 1S4EA 4M2ZA 4DV3E 1Z0VA 3V5RA 4B3TE 3P06A 3CWVA 3PYFA 1N36E 1HNXI 2UUAE 4DUZE 1YYKA 4X62E 2E5LI 4DR6I 4L5NC 1UEKA 3LPSA 2Z5CB 1NZ0A 4MYTA 4LU9A 1Z5BA 2V2QA 3B78A 1ZM4A 4IZKB 2F4VE 3PYDA 3Q6MA 4Z7CA 2FV4B 3J7Yp 1FKAE 4USKA 2KONA 2HFSA 4M0VA 4LF8E 4DR3E 4BC7A 3DJWA 4DKKA 4X64E 3IWDA 4TUGA 2M7QA 2V8QB 5FLXQ 2UU9I 5FWKA 2HFUA 4JI2E 1FWKA 4ZVIA 1ZBQA 2E1MA 2A2DA 4DPWA 2B9DA 2V88A 1WUUA 4JI1I 4XTJA 1PIEA 3J7AM 2BM1A 2CG9A 4JYAI 4LFCE 1Y4SA 1XMOI 5A2QC 2NPFA 4B3MI 4WSPA 2V34A 1YYWA 4KHPE 4X66E 4YHHE 4LFAE 4L8NA 1Z0CA 3PYGA 4DPTA 2ZM6I 4JI5I 2OI2A 1HNWI 5DNYA 2NUEA 1DI2A 1IBKI 2MDRA 4FWDA 4B3SI 5LMUE 3V2UC 3FIGA 3ZOQB 4DV2E 1ELOA 2VE7C 2F8BA 1BKNA 1N34E 2X36A 4DR4I 2FGGA 4P52A 1K47A 3AV0A 3QT5A 3IWBA 5BR8I 5LL6R 1IBLE 2DEIA 4DV0I 1WHNA 1EKZA 3K1JA 1XHKA 2EFGA 2O1TA 1Z5AA 1N0VC 4UT4A 2V8PA 4NXNI 1QU6A 1USVA 4WUDA 4OX9I 2HHHE 1STUA 4LF7E 2ZITA 4JV5E 4LF4E 4P78A 1EI1A 1NHJA 4X65I 1PKPA 2FTXB 3Q6NA 4DR2I 2M1SA 1H73A 2PNLA 3JAMQ 4DV4I 1UHZA 4DV6E 1Z59A 1O0WA 4DV5I 5A2QQ 1HR0I 2UXCE 3WU6A 4FN5A 3WU5A 1RC7A 3ZKDA 5IT9C 4JI3E 2UU9E 2EZ6A 2LRSA 3HXLA 2LUQA 4GKKE 4JG4A 1X48A 3ZKBA 4JI7I 4JYAE 1J5EE 1HNZI 3HPZA 3LNUA 1XMQE 1XMOE 2E1RA 3ZM7A 2G7HA 2HK2A 4DV1I 1NHIA 1N32I 1ZM2A 4IZJB 1MG7A 2UXBE 1VISA 1HNWE 2L2NA 4I3HA 1IBKE 4BMJA 2K4VA 1X49A 2VQFI 4F54A 2N3HA 2YT4A 4DR4E 4FW9A 1RREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC I;  4DV0 E;  4M1K A;  1Z0G A;  4RPF A;  3ZZ0 A;  4KQV A;  4HAC B;  2UUB E;  1EA6 A;  1ZM9 A;  4WUB A;  1XNR I;  5LMN E;  4JI4 E;  4AQY E;  4YY3 I;  4X65 E;  2UXD I;  3B8H A;  2R42 A;  3T1H I;  2Q2E B;  1IBM I;  1B63 A;  4JI8 E;  4DU8 A;  4HYM A;  1XNQ E;  3J81 C;  4FWH A;  4JI0 E;  3H4L A;  2VQE I;  4NXM I;  4DR7 I;  1H7S A;  3QT6 A;  4K0K E;  1D6T A;  3K17 A;  4JI7 E;  3OTO I;  1Z0E A;  3J7A G;  1N33 E;  4LF6 I;  3B82 A;  2VF3 A;  4DV1 E;  4JI6 E;  1FNM A;  4DR5 I;  4DPU A;  4DPX A;  4EMD A;  3M6A A;  4DUY E;  3PYE A;  4DV7 E;  2A2C A;  4DV3 I;  1ZXN A;  3J80 C;  2CZ9 A;  1HNX E;  1N36 I;  2UUA I;  4DR6 E;  2E5L E;  4DUZ I;  4X62 I;  1S16 A;  4Z7Y A;  1H7U A;  5GMD A;  2UUC E;  2V2V A;  3GON A;  4LFB I;  4B3R I;  1H74 A;  1Z5C A;  3J81 Q;  4PU9 A;  3ZZT A;  4X64 I;  1A6F A;  2UXD E;  4WUC A;  2WW4 A;  2X7I A;  1KKH A;  1QZR A;  4JI1 E;  1KVK A;  4LFC I;  3HUL A;  4GKJ I;  4B3M E;  1Z0B A;  2ZM6 E;  2VQE E;  4JI5 E;  4URL A;  4B3S E;  3WU3 A;  3OTO E;  4DV2 I;  3J80 Q;  4LF6 E;  1N34 I;  5BR8 E;  2R3V A;  1FI4 A;  1IBL I;  2BM0 A;  1OJ4 A;  1U2R A;  4NXN E;  4OX9 E;  1ZM3 A;  2GS8 A;  4ED4 A;  2HHH I;  1H72 C;  4LF7 I;  5IT9 Q;  4JV5 I;  4LF4 I;  1B62 A;  4DR1 I;  4HAC A;  3WU4 A;  4DR2 E;  3Q1Q A;  4LFB E;  4HY1 A;  4B3R E;  4DV4 E;  5IWA I;  1HR0 E;  4DV5 E;  4DV6 I;  2UXC I;  1MX0 A;  1I94 I;  4JI3 I;  1FJG I;  3ZZU A;  4GKK I;  4LF9 I;  4LF5 I;  4DPY A;  1HNZ E;  1MU5 A;  3JAM C;  1J5E I;  1RR9 A;  4GKJ E;  2DEJ A;  1XMQ I;  3T1Y I;  4PRX A;  1N32 E;  2UXB I;  2HKJ A;  2XEX A;  2VQF E;  1Z0W A;  4B3T I;  1KTV A;  4FWG A;  1ZXM A;  2HKE A;  2F4V I;  4P7A A;  1PVG A;  4HXZ A;  4LF8 I;  4DR3 I;  2UUB I;  1XNR E;  2AJ4 A;  1Z0T A;  1KIJ A;  5LMN I;  4JI4 I;  4YY3 E;  2V2Z A;  4AQY I;  2HK3 A;  3D4J A;  2LJP A;  4JI2 I;  3T1H E;  4DR1 E;  1IBM E;  3QT7 A;  5GME A;  4DU7 A;  4JI8 I;  1DAR A;  4USM A;  5IWA E;  1XNQ I;  1N0U A;  1NHH A;  4JI0 I;  4KHP I;  3F0N A;  2BV3 A;  3QT8 A;  4UTG A;  5FLX C;  4X66 I;  4YHH I;  1I94 E;  4LFA I;  1FJG E;  4NXM E;  4DR7 E;  4LF9 E;  4K0K I;  5LMU I;  4LF5 E;  1FWL A;  4R1F A;  1N33 I;  3T1Y E;  2J7K A;  3LTO A;  4MYU A;  4DXL A;  4JI6 I;  4DR5 E;  5L3J A;  4PRV A;  2ZBK B;  4DUY I;  4DV7 I;  1S4E A;  4DV3 E;  1Z0V A;  3V5R A;  4B3T E;  3CWV A;  3PYF A;  1N36 E;  1HNX I;  2UUA E;  4DUZ E;  4X62 E;  2E5L I;  4DR6 I;  1UEK A;  3LPS A;  1NZ0 A;  4MYT A;  1Z5B A;  2V2Q A;  3B78 A;  1ZM4 A;  2F4V E;  3PYD A;  4Z7C A;  1FKA E;  4USK A;  2HFS A;  4LF8 E;  4DR3 E;  4X64 E;  2UU9 I;  5FLX Q;  2HFU A;  4JI2 E;  1FWK A;  4ZVI A;  4DPW A;  2A2D A;  1WUU A;  4JI1 I;  4XTJ A;  1PIE A;  3J7A M;  2BM1 A;  4JYA I;  4LFC E;  1XMO I;  5A2Q C;  2NPF A;  4B3M I;  2V34 A;  4KHP E;  4X66 E;  4YHH E;  4LFA E;  1Z0C A;  3PYG A;  4DPT A;  2ZM6 I;  4JI5 I;  2OI2 A;  1HNW I;  1IBK I;  4B3S I;  4FWD A;  5LMU E;  3V2U C;  4DV2 E;  1ELO A;  1BKN A;  2X36 A;  1N34 E;  4DR4 I;  4P52 A;  1K47 A;  3QT5 A;  5BR8 I;  5LL6 R;  4DV0 I;  2DEI A;  1IBL E;  3K1J A;  1XHK A;  2EFG A;  1Z5A A;  1N0V C;  4UT4 A;  2V8P A;  4NXN I;  4WUD A;  4OX9 I;  2HHH E;  2ZIT A;  4LF7 E;  4JV5 E;  4LF4 E;  1EI1 A;  1NHJ A;  4X65 I;  1PKP A;  4DR2 I;  1H73 A;  3JAM Q;  4DV4 I;  1HR0 I;  4DV6 E;  1Z59 A;  4DV5 I;  5A2Q Q;  2UXC E;  3WU6 A;  4FN5 A;  3WU5 A;  3ZKD A;  5IT9 C;  4JI3 E;  2UU9 E;  4GKK E;  4JG4 A;  3ZKB A;  4JI7 I;  1HNZ I;  1J5E E;  4JYA E;  3LNU A;  1XMQ E;  1XMO E;  2E1R A;  3ZM7 A;  2HK2 A;  4DV1 I;  1NHI A;  1N32 I;  1ZM2 A;  1MG7 A;  1VIS A;  2UXB E;  1HNW E;  4I3H A;  1IBK E;  2VQF I;  4DR4 E;  4FW9 A;  1RRE A; 
#chains in the Genus database with same CATH topology
 4IFD C;  3ADL A;  3KWR A;  2BA1 D;  2VRD A;  5A6K A;  2CVE A;  2UUC I;  5IXM B;  2EOE A;  4DV0 E;  3CDI A;  4ZYH A;  5ADZ A;  4M1K A;  1Z0G A;  2M4I A;  2EPL X;  2V87 A;  4RPF A;  3ZZ0 A;  4KQV A;  5A6J A;  4F6M A;  4HAC B;  1HR0 I;  2GQ0 A;  1A1G A;  2J7J A;  2Z5B B;  2Q8U A;  4OOG C;  2EM2 A;  1HK7 A;  5JEA C;  1X6H A;  2UUB E;  1EA6 A;  1ZM9 A;  4WUB A;  2YTJ A;  2DIX A;  1XNR I;  5LMN E;  4JI4 E;  2LJH A;  4AQY E;  2Z5C A;  3L00 A;  2JOX A;  4YY3 I;  2CTD A;  4X65 E;  1F2I G;  2UXD I;  3B8H A;  4IZK A;  1KYQ A;  2L3C A;  2WNR B;  1ZR9 A;  4R03 A;  2O1V A;  2R42 A;  2Q2E B;  3T1H I;  1B63 A;  3PS1 A;  1IBM I;  2RPC A;  4JI8 E;  4DU8 A;  3DF6 A;  2JT2 A;  1YHC A;  3ADJ A;  5C0X C;  1ZU1 A;  4DMI A;  4HYM A;  4KWY A;  4O4K A;  1R6M A;  3EPK A;  2KOU A;  1XNQ E;  2ODR D;  1TN9 A;  2CPN A;  3J81 C;  4FWH A;  2RSM A;  3ADG A;  3M85 D;  4Q35 B;  3BF2 A;  4M30 A;  4JI0 E;  2NUF A;  3GCM A;  2LV2 A;  2YTO A;  4HTG A;  1Y6Z A;  4LCF A;  2EOS A;  3H4L A;  2L8T A;  4R8O A;  2EML A;  2VQE I;  4NXM I;  1YFH A;  4ZYE A;  2IHR 1;  4TUI A;  1H7S A;  4K0K E;  3QT6 A;  4DR7 I;  5K36 D;  2NN6 D;  2YSP A;  1UN6 B;  1D6T A;  3K17 A;  1PJQ A;  2EMG A;  4JI7 E;  4R2D A;  2NA2 A;  1Z0E A;  3OTO I;  2B7T A;  3P3E A;  4GZN C;  3THN A;  2EOO A;  2EMY A;  3J7A G;  1N33 E;  3KRN A;  4LF6 I;  4F2J C;  3BBG A;  4X9J A;  3RMP A;  2EOY A;  4IJD A;  3B82 A;  2O1W A;  2VF3 A;  2YTF A;  4DV1 E;  3HKM A;  2EL5 A;  4R2E A;  3C6M A;  4JI6 E;  1IMU A;  1FNM A;  2EOM A;  4DR5 I;  2VES A;  4DPU A;  3F6G A;  4DPX A;  4EMD A;  3M6A A;  4OO1 D;  2EPA A;  3IWC A;  2PRT A;  4DUY E;  2V83 A;  2R1F A;  3PYE A;  2ENH A;  4DV7 E;  2ENC A;  2A2C A;  3MSW A;  3PRY A;  5C0X B;  2EN3 A;  4BA1 B;  4DV3 I;  4BA2 B;  1XXE A;  2IOQ A;  1ZXN A;  4WXD A;  2N3G A;  4J3D A;  3J80 C;  2CZ9 A;  4O43 A;  4BBY A;  3P1X A;  2EMB A;  1HNX E;  2JP9 A;  1N36 I;  5KL4 A;  2EMX A;  2UUA I;  2L6M A;  4GEQ B;  2E5L E;  4DR6 E;  4X62 I;  1EH7 A;  4DUZ I;  5AC4 A;  1T39 A;  1S16 A;  4Z7Y A;  3K85 A;  3DD6 A;  3MHS C;  1H7U A;  2UUC E;  2DGC A;  5GMD A;  1P42 A;  3F6H A;  2YRK A;  4R2R A;  2V2V A;  1WRJ A;  2EMA A;  4IZJ D;  4N3O A;  2AE8 A;  1J26 A;  3GON A;  4LFB I;  4B3R I;  2RSI A;  5AE1 A;  2EQ1 A;  2IES A;  2DMY A;  1H74 A;  1Z5C A;  1YZ9 A;  3J81 Q;  2EMC A;  1RQ0 A;  2JY9 A;  5EKW A;  4PU9 A;  5DNL A;  2WCC 3;  3ZZT A;  4X64 I;  1A6F A;  2B7V A;  2EPX A;  4BCA A;  4P7D A;  1WXR A;  2C38 B;  5K36 A;  5LLQ A;  2UXD E;  2NN6 A;  2EPP A;  2WW4 A;  4F9C B;  4WUC A;  2X7I A;  2V86 A;  1KKH A;  1QZR A;  2L2M A;  2EPC A;  2YU8 A;  4JI1 E;  1MGT A;  2CGE A;  1KVK A;  2WP8 A;  4LFC I;  2LTS A;  4MLV A;  2V85 A;  2YTN A;  4WYQ B;  3VYY A;  2HGH A;  3HUL A;  2JEA B;  4GKJ I;  2V89 A;  3GLL A;  4RHB B;  4B3M E;  4F9A B;  2LTR A;  5K36 F;  2L33 A;  2NN6 F;  3GME A;  2H36 X;  3KZY A;  1BBO A;  4OO1 A;  1Z0B A;  2ZM6 E;  2EPO A;  2VQE E;  2I13 A;  4JI5 E;  2MDG A;  1WJP A;  5EL9 A;  4URL A;  2ELY A;  4B3S E;  5KL6 A;  1USU A;  3WU3 A;  1X6E A;  3UK3 C;  4KZS A;  1JK2 A;  1Z1B A;  4FW6 A;  2Z5E A;  4U3B A;  3OTO E;  2RQL A;  4LTY A;  2DLK A;  2B3T B;  2BBG A;  3LLH A;  1DGC A;  2WZO A;  1SR9 A;  4DV2 I;  4RH8 A;  4X8W A;  4OKG A;  4LF6 E;  3J80 Q;  2DLQ A;  5AE3 A;  2MC6 A;  2EJ4 A;  1N34 I;  4OO1 F;  1ZAA C;  3M7N G;  4IZJ A;  2YTE A;  2EOR A;  3VK6 A;  5BR8 E;  1FI4 A;  3EPL A;  2R3V A;  1UIL A;  1IBL I;  2BR2 A;  4MU4 A;  4MU3 A;  1EH8 A;  2BM0 A;  1OJ4 A;  2L3J A;  1U2R A;  4FW4 A;  2PO1 A;  1E3P A;  4AM3 A;  4NXN E;  3P76 A;  2MKD A;  3EPJ A;  4OX9 E;  3U1K A;  1ZM3 A;  2F1D A;  2GS8 A;  2A25 A;  4ED4 A;  2HHH I;  2DB2 A;  1T4L B;  1H72 C;  2YRM A;  4LF7 I;  5IT9 Q;  4JV5 I;  1Y60 A;  4LF4 I;  4BHC A;  4WSG A;  2EOF A;  1B62 A;  4DR1 I;  3C6K A;  2RS7 A;  4HAC A;  4R2S A;  3WU4 A;  4DR2 E;  2Z5B A;  3Q1Q A;  4LFB E;  4HY1 A;  1JK1 A;  4B3R E;  4DV4 E;  2GHF A;  2EM9 A;  3H09 A;  2NUG A;  5IWA I;  1HR0 E;  4DV5 E;  4DV6 I;  4WX9 A;  3C4B A;  4MU1 A;  2UXC I;  2EP3 A;  2GPI A;  1MX0 A;  5DNX A;  4IFD E;  4IFD B;  1I94 I;  4JI3 I;  1FJG I;  3HQ1 A;  3JU0 A;  4O5G A;  2WNR A;  3ZZU A;  2LUP B;  2LMZ A;  4GKK I;  4LF9 I;  4LF5 I;  3P3C A;  1X47 A;  2EPM X;  4DPY A;  5CFF E;  4F9B B;  1NCS A;  2YU5 A;  1HNZ E;  1MU5 A;  3JAM C;  3PS2 A;  1J5E I;  5JEA B;  5JEA E;  1RR9 A;  1T4O A;  4GKJ E;  4JI1 I;  2DEJ A;  1IQS A;  2ODR C;  4Q28 A;  1XMQ I;  5T6J A;  2M9A A;  2MKN A;  3T1Y I;  2YWQ A;  4PRX A;  5DRQ A;  3EQ1 A;  1WHQ A;  3LML A;  4FK5 C;  2PNZ B;  1N32 E;  4QNJ A;  2BA0 D;  2LE2 A;  2YTD A;  2EPR A;  2UXB I;  5K36 C;  3QG5 C;  2C37 B;  2HKJ A;  1MEY C;  2NN6 C;  4BHB A;  2O3Z A;  1Y4U A;  2XEX A;  3L7Z B;  5C0X E;  2VQF E;  1Z0W A;  4B3T I;  2PNM A;  2EN1 A;  1A1J A;  1ZBT A;  1KTV A;  5KL3 A;  4FWG A;  2YPN A;  2ELZ A;  5AE2 A;  1ZXM A;  2HKE A;  3AUZ A;  2JR1 A;  2O1U A;  4MDT A;  4WFT A;  4OO1 C;  2F4V I;  3K6Q A;  4P7A A;  5C0X A;  5DRO A;  1GQE A;  1GZ6 A;  4BA1 A;  4X66 I;  4BA2 A;  3OML A;  2DSY A;  3BGH A;  1PVG A;  2IOP A;  2RS6 A;  3B4T A;  2WBU A;  3H1C A;  4HXZ A;  3VHT B;  2JVA A;  1T4N A;  4DR3 I;  2EMH A;  2UUB I;  2LVH A;  3MHH C;  4LF8 I;  4O24 A;  2EMW A;  1XNR E;  2C39 B;  2JOB A;  1Z0T A;  1KIJ A;  1EH6 A;  2AJ4 A;  4YY3 E;  5LMN I;  4JI4 I;  2V2Z A;  4J8Z A;  4AQY I;  4BC9 A;  2R76 A;  3HPS A;  2RTX A;  5TSE A;  2HK3 A;  3D4J A;  4FW7 A;  4I8O A;  5AAS A;  1P47 A;  2LJP A;  5C0X F;  4JI2 I;  5A6B D;  3T1H E;  4DR1 E;  2MC5 A;  2EM5 A;  3JTZ A;  1IBM E;  3QT7 A;  2EPU A;  2JE6 B;  4FW5 A;  5GME A;  4R2C A;  2EOJ A;  4JI8 I;  4DU7 A;  2EOQ A;  2ENA A;  1PJS A;  2VF1 A;  2LT7 A;  2NAB A;  1BB8 A;  1DAR A;  3NZK A;  4USM A;  5IWA E;  5AC5 A;  2C39 A;  2EMI A;  4LOM A;  1XNQ I;  2L2K B;  2EMF A;  4BS9 A;  5KL2 A;  1NHH A;  1N0U A;  2EN4 A;  4JI0 I;  2EOX A;  2C38 A;  3HTX A;  4KHP I;  2L92 A;  1I94 E;  2BV3 A;  3F0N A;  5FLX C;  3QT8 A;  2YTI A;  1YH8 A;  3HJC A;  1FJG E;  2J65 A;  4LPF A;  4YHH I;  4LFA I;  4NXM E;  3M85 G;  4DR7 E;  3ADI A;  5F3W A;  4LF9 E;  4K0K I;  1A1H A;  5LMU I;  4LF5 E;  1YYO A;  2EWL A;  2JEA A;  1FWL A;  4R1F A;  1OYP A;  2EN2 A;  1A1F A;  1B69 A;  5KL7 A;  2PO2 B;  1DQ3 A;  1BBG A;  1AH5 A;  2YZT A;  3PS3 A;  4M9V C;  4NBQ A;  1N33 I;  3T1Y E;  3M99 B;  2J7K A;  3LTO A;  4IFD D;  4MYU A;  2JWO A;  4N4R B;  2PO0 B;  4DXL A;  4JI6 I;  2N8X A;  2YRH A;  4NHR A;  3VYX A;  1X3C A;  4WXC A;  4DR5 E;  5DRR A;  3UHM A;  1OYS A;  5L3J A;  2KHX A;  4PRV A;  1NEI A;  1UDN A;  2LBS B;  1TF6 A;  4WPY A;  2ZBK B;  4DUY I;  2EOZ A;  4DV7 I;  3C4T A;  1S4E A;  4M2Z A;  4DV3 E;  4MQY A;  1Z0V A;  2PO2 A;  5JEA D;  3V5R A;  4B3T E;  5A6A A;  3P06 A;  3CWV A;  3PYF A;  2EE8 A;  1N36 E;  1HNX I;  2EPZ A;  2UUA E;  1QNT A;  4DUZ E;  1YYK A;  4X62 E;  2E5L I;  4DR6 I;  4L5N C;  1UEK A;  3LPS A;  5A6B A;  2Z5C B;  1NZ0 A;  4MYT A;  4LU9 A;  1Z5B A;  2V2Q A;  3B78 A;  3CDJ A;  1ZM4 A;  4IZK B;  3ECR A;  2F4V E;  3PYD A;  2EOH A;  3Q6M A;  1RHY A;  2EPN A;  2LCE A;  1UDO A;  2FV4 B;  3J7Y p;  1FKA E;  1G2F C;  2YSO A;  4USK A;  4Z7C A;  5C0X D;  1YSA C;  2KON A;  2HFS A;  4M0V A;  4MU0 A;  4LF8 E;  4DR3 E;  1YPN A;  4AID A;  2LO3 A;  2DMI A;  4BC7 A;  2EM3 A;  4JYA I;  4R2A A;  3DJW A;  4DKK A;  4X64 E;  3IWD A;  4TUG A;  2M7Q A;  2V8Q B;  5FLX Q;  2UU9 I;  1PDA A;  2YTP A;  5FWK A;  2HFU A;  4ZYG A;  4NZV A;  4JI2 E;  1FWK A;  4ZVI A;  1ZBQ A;  2E1M A;  2JXP A;  2A2D A;  4HEI A;  2B9D A;  4IS9 A;  4DPW A;  2V88 A;  1WUU A;  1PJT A;  4F6N A;  1PIE A;  4XTJ A;  2YTG A;  2BM1 A;  2CG9 A;  1AAY A;  4LFC E;  1Y4S A;  3J7A M;  2E72 A;  2EM8 A;  1XMO I;  5A2Q C;  5ELW A;  4IFD A;  1T38 A;  1R6L A;  5DRP A;  4U3D A;  2NPF A;  4B3M I;  4QNK A;  2D9H A;  4WSP A;  2V34 A;  1YYW A;  4KHP E;  4X66 E;  1A1L A;  4YHH E;  1A1K A;  4L8N A;  4LFA E;  1Z0C A;  3PYG A;  4DPT A;  2ZM6 I;  4JI5 I;  4IS1 C;  2OI2 A;  1HNW I;  5DNY A;  2EQ3 A;  2NUE A;  1DI2 A;  1IBK I;  2MDR A;  4FWD A;  4B3S I;  3P3G A;  5LMU E;  2EPK X;  5JEA A;  1TF3 A;  3TQM A;  3V2U C;  3KZZ A;  1IQO A;  3FIG A;  4MLQ A;  4IFD F;  3ZOQ B;  4DV2 E;  1ELO A;  3M7N D;  2HC5 A;  2VE7 C;  2F8B A;  2JEB B;  2EN6 A;  2PNZ A;  1BKN A;  1N34 E;  2X36 A;  4DR4 I;  2JYA A;  2FGG A;  4P52 A;  1VI7 A;  1K47 A;  3AV0 A;  2HJJ A;  5A69 A;  3QT5 A;  3IWB A;  5BR8 I;  5LL6 R;  1IBL E;  2DEI A;  4DV0 I;  1N3G A;  1WHN A;  2C37 A;  2BA0 G;  1EKZ A;  3K1J A;  4UTG A;  3L7Z A;  1XHK A;  4R2P A;  2EFG A;  4GQU A;  5JEA F;  2O1T A;  2BA1 G;  1Z5A A;  1N0V C;  2WBS A;  4UT4 A;  1SFE A;  2IER A;  2YTQ A;  2V8P A;  4NXN I;  5KL5 A;  1QU6 A;  1RMD A;  2GO3 A;  2EM6 A;  3EPH A;  2JEB A;  1USV A;  4WUD A;  4OX9 I;  1L4S A;  2HHH E;  1STU A;  1X6F A;  4LF7 E;  2ZIT A;  4JV5 E;  4LF4 E;  4P78 A;  3BID A;  1EI1 A;  1NHJ A;  4X65 I;  2BB8 A;  1PKP A;  1A1I A;  2FTX B;  4FW3 A;  5K36 E;  2CSH A;  5K36 B;  3Q6N A;  2NN6 B;  2NN6 E;  2GO4 A;  4AIM A;  2M1S A;  4DR2 I;  1H73 A;  2EL6 A;  2PNL A;  3JAM Q;  4LCH A;  2WP8 B;  4DV4 I;  1UHZ A;  4OZE A;  2EL4 A;  2EN7 A;  1O0W A;  2EM4 A;  4DV6 E;  1UDQ A;  1Z59 A;  5A2Q Q;  2UXC E;  2EMZ A;  3WU6 A;  4DV5 I;  4FN5 A;  2EN8 A;  2DRP A;  2ADR A;  2EMK A;  3WU5 A;  1RC7 A;  3ZKD A;  5IT9 C;  4JI3 E;  2UU9 E;  1GTK A;  2LJU A;  4R2Q A;  1LLM C;  2EZ6 A;  2LRS A;  3HXL A;  2LUQ A;  3THO B;  2JE6 A;  4GKK E;  4OO1 B;  4OO1 E;  5IV8 B;  1X5W A;  4JG4 A;  1KJK A;  1X48 A;  3ZKB A;  4JI7 I;  2K7I A;  4JYA E;  1J5E E;  3U1Y A;  1HNZ I;  3HPZ A;  3LNU A;  1XMQ E;  2EM7 A;  1YUJ A;  4LCG A;  1XMO E;  2E1R A;  3ZM7 A;  2WBT A;  1OYR A;  2G7H A;  2HK2 A;  4DV1 I;  1NHI A;  1N32 I;  1ZM2 A;  1G2D C;  4ZYD A;  4IZJ B;  1MG7 A;  4ISA A;  1RRE A;  2UXB E;  1VIS A;  2EM0 A;  1HNW E;  2L2N A;  4I3H A;  1YUI A;  1IBK E;  2EQ0 A;  4BMJ A;  2GLI A;  2BR2 B;  2I9I A;  1Y5Y A;  2K4V A;  1X49 A;  2VQF I;  2PO1 B;  4F54 A;  2N3H A;  1E3H A;  1UDS A;  2CT1 A;  2YT4 A;  2EOI A;  1UBD C;  2PO0 A;  4DR4 E;  4FW9 A;  2JPA A; 
#chains in the Genus database with same CATH homology
 3ADL A;  3KWR A;  2UUC I;  4DV0 E;  5ADZ A;  4M1K A;  1Z0G A;  2M4I A;  4RPF A;  2V87 A;  3ZZ0 A;  4KQV A;  4HAC B;  2GQ0 A;  2Z5B B;  4OOG C;  1HK7 A;  2UUB E;  1EA6 A;  1ZM9 A;  4WUB A;  2DIX A;  1XNR I;  5LMN E;  4JI4 E;  2LJH A;  4AQY E;  2Z5C A;  4YY3 I;  2JOX A;  4X65 E;  2UXD I;  3B8H A;  4IZK A;  2L3C A;  4R03 A;  2O1V A;  2R42 A;  2Q2E B;  3T1H I;  1B63 A;  1IBM I;  4JI8 E;  4DU8 A;  3DF6 A;  3ADJ A;  4DMI A;  4HYM A;  2KOU A;  1XNQ E;  2ODR D;  2CPN A;  3J81 C;  4FWH A;  2RSM A;  3ADG A;  4M30 A;  4JI0 E;  2NUF A;  1Y6Z A;  3H4L A;  2L8T A;  4R8O A;  2VQE I;  4NXM I;  2IHR 1;  4TUI A;  1H7S A;  4K0K E;  3QT6 A;  4DR7 I;  1D6T A;  3K17 A;  4JI7 E;  3OTO I;  1Z0E A;  2NA2 A;  2B7T A;  3J7A G;  1N33 E;  4LF6 I;  3B82 A;  3RMP A;  2O1W A;  2VF3 A;  4DV1 E;  4JI6 E;  1FNM A;  4DR5 I;  4DPU A;  3F6G A;  4DPX A;  4EMD A;  3M6A A;  3IWC A;  4DUY E;  2V83 A;  3PYE A;  4DV7 E;  2A2C A;  3MSW A;  3PRY A;  4DV3 I;  2IOQ A;  1ZXN A;  2N3G A;  3J80 C;  2CZ9 A;  4BBY A;  3P1X A;  1HNX E;  1N36 I;  2UUA I;  4DR6 E;  2L6M A;  4GEQ B;  2E5L E;  4X62 I;  4DUZ I;  1S16 A;  4Z7Y A;  3K85 A;  1H7U A;  2UUC E;  5GMD A;  3F6H A;  4IZJ D;  2V2V A;  4N3O A;  1J26 A;  3GON A;  4LFB I;  4B3R I;  5AE1 A;  2DMY A;  1H74 A;  1Z5C A;  1YZ9 A;  3J81 Q;  1RQ0 A;  2JY9 A;  4PU9 A;  3ZZT A;  4X64 I;  1A6F A;  2B7V A;  1WXR A;  4BCA A;  4P7D A;  2UXD E;  4WUC A;  2WW4 A;  4F9C B;  2X7I A;  2V86 A;  1KKH A;  1QZR A;  2L2M A;  4JI1 E;  2CGE A;  1KVK A;  4LFC I;  2LTS A;  4WYQ B;  2V85 A;  3VYY A;  3HUL A;  4GKJ I;  2V89 A;  4B3M E;  4F9A B;  2LTR A;  2L33 A;  2H36 X;  1Z0B A;  2ZM6 E;  2VQE E;  4JI5 E;  4URL A;  4B3S E;  1USU A;  3WU3 A;  4KZS A;  2Z5E A;  3OTO E;  4LTY A;  2B3T B;  3LLH A;  2WZO A;  1SR9 A;  4DV2 I;  4X8W A;  3J80 Q;  4LF6 E;  5AE3 A;  2MC6 A;  1N34 I;  4IZJ A;  5BR8 E;  3VK6 A;  2R3V A;  1FI4 A;  1UIL A;  1IBL I;  2BM0 A;  1OJ4 A;  2L3J A;  1U2R A;  4NXN E;  4OX9 E;  1ZM3 A;  2GS8 A;  4ED4 A;  2HHH I;  2DB2 A;  1T4L B;  1H72 C;  4LF7 I;  5IT9 Q;  4JV5 I;  4LF4 I;  1B62 A;  4DR1 I;  2RS7 A;  4HAC A;  3WU4 A;  4DR2 E;  2Z5B A;  3Q1Q A;  4LFB E;  4HY1 A;  4B3R E;  4DV4 E;  2NUG A;  5IWA I;  3H09 A;  1HR0 E;  4DV5 E;  4DV6 I;  3C4B A;  2UXC I;  1MX0 A;  1I94 I;  4JI3 I;  1FJG I;  3HQ1 A;  3JU0 A;  3ZZU A;  2LUP B;  2LMZ A;  4GKK I;  4LF9 I;  4LF5 I;  4DPY A;  1X47 A;  5CFF E;  4F9B B;  1HNZ E;  1MU5 A;  3JAM C;  1J5E I;  1RR9 A;  1T4O A;  4GKJ E;  2DEJ A;  1XMQ I;  2ODR C;  4Q28 A;  5T6J A;  3T1Y I;  4PRX A;  3LML A;  1WHQ A;  1N32 E;  2LE2 A;  2UXB I;  2HKJ A;  1Y4U A;  2XEX A;  2VQF E;  1Z0W A;  4B3T I;  2PNM A;  1ZBT A;  1KTV A;  4FWG A;  5AE2 A;  1ZXM A;  2HKE A;  3AUZ A;  2JR1 A;  2O1U A;  4WFT A;  2F4V I;  3K6Q A;  4P7A A;  1GZ6 A;  1GQE A;  3OML A;  2DSY A;  1PVG A;  2IOP A;  4HXZ A;  2RS6 A;  4LF8 I;  2JVA A;  1T4N A;  4DR3 I;  2UUB I;  1XNR E;  2JOB A;  1Z0T A;  1KIJ A;  2AJ4 A;  5LMN I;  4YY3 E;  4JI4 I;  2V2Z A;  4J8Z A;  4AQY I;  4BC9 A;  3HPS A;  2RTX A;  2HK3 A;  3D4J A;  4I8O A;  5AAS A;  2LJP A;  4JI2 I;  3T1H E;  4DR1 E;  2MC5 A;  1IBM E;  3JTZ A;  3QT7 A;  5GME A;  4DU7 A;  4JI8 I;  2VF1 A;  1DAR A;  4USM A;  5IWA E;  1XNQ I;  2L2K B;  1N0U A;  4BS9 A;  1NHH A;  4JI0 I;  3HTX A;  4KHP I;  2L92 A;  1I94 E;  2BV3 A;  3F0N A;  5FLX C;  3QT8 A;  4UTG A;  3HJC A;  4X66 I;  1FJG E;  4YHH I;  4LFA I;  4NXM E;  4DR7 E;  3ADI A;  5F3W A;  4LF9 E;  4K0K I;  5LMU I;  4LF5 E;  1YYO A;  2EWL A;  1FWL A;  4R1F A;  1N33 I;  1DQ3 A;  2YZT A;  3T1Y E;  2J7K A;  3LTO A;  4MYU A;  2JWO A;  4DXL A;  4JI6 I;  3VYX A;  4DR5 E;  5L3J A;  2KHX A;  4PRV A;  2LBS B;  4WPY A;  2ZBK B;  4DUY I;  4DV7 I;  3C4T A;  1S4E A;  4M2Z A;  4DV3 E;  1Z0V A;  3V5R A;  4B3T E;  3P06 A;  3CWV A;  3PYF A;  1N36 E;  1HNX I;  2UUA E;  4DUZ E;  1YYK A;  4X62 E;  2E5L I;  4DR6 I;  4L5N C;  1UEK A;  3LPS A;  2Z5C B;  1NZ0 A;  4MYT A;  4LU9 A;  1Z5B A;  2V2Q A;  3B78 A;  1ZM4 A;  4IZK B;  2F4V E;  3PYD A;  3Q6M A;  4Z7C A;  2FV4 B;  3J7Y p;  1FKA E;  4USK A;  2KON A;  2HFS A;  4M0V A;  4LF8 E;  4DR3 E;  4BC7 A;  3DJW A;  4DKK A;  4X64 E;  3IWD A;  4TUG A;  2M7Q A;  2V8Q B;  5FLX Q;  2UU9 I;  5FWK A;  2HFU A;  4JI2 E;  1FWK A;  4ZVI A;  1ZBQ A;  2E1M A;  2A2D A;  4DPW A;  2B9D A;  2V88 A;  1WUU A;  4JI1 I;  4XTJ A;  1PIE A;  3J7A M;  2BM1 A;  2CG9 A;  4JYA I;  4LFC E;  1Y4S A;  1XMO I;  5A2Q C;  2NPF A;  4B3M I;  4WSP A;  2V34 A;  1YYW A;  4KHP E;  4X66 E;  4YHH E;  4LFA E;  4L8N A;  1Z0C A;  3PYG A;  4DPT A;  2ZM6 I;  4JI5 I;  2OI2 A;  1HNW I;  5DNY A;  2NUE A;  1DI2 A;  1IBK I;  2MDR A;  4FWD A;  4B3S I;  5LMU E;  3V2U C;  3FIG A;  3ZOQ B;  4DV2 E;  1ELO A;  2VE7 C;  2F8B A;  1BKN A;  1N34 E;  2X36 A;  4DR4 I;  2FGG A;  4P52 A;  1K47 A;  3AV0 A;  3QT5 A;  3IWB A;  5BR8 I;  5LL6 R;  1IBL E;  2DEI A;  4DV0 I;  1WHN A;  1EKZ A;  3K1J A;  1XHK A;  2EFG A;  2O1T A;  1Z5A A;  1N0V C;  4UT4 A;  2V8P A;  4NXN I;  1QU6 A;  1USV A;  4WUD A;  4OX9 I;  2HHH E;  1STU A;  4LF7 E;  2ZIT A;  4JV5 E;  4LF4 E;  4P78 A;  1EI1 A;  1NHJ A;  4X65 I;  1PKP A;  2FTX B;  3Q6N A;  4DR2 I;  2M1S A;  1H73 A;  2PNL A;  3JAM Q;  4DV4 I;  1UHZ A;  4DV6 E;  1Z59 A;  1O0W A;  4DV5 I;  5A2Q Q;  1HR0 I;  2UXC E;  3WU6 A;  4FN5 A;  3WU5 A;  1RC7 A;  3ZKD A;  5IT9 C;  4JI3 E;  2UU9 E;  2EZ6 A;  2LRS A;  3HXL A;  2LUQ A;  4GKK E;  4JG4 A;  1X48 A;  3ZKB A;  4JI7 I;  4JYA E;  1J5E E;  1HNZ I;  3HPZ A;  3LNU A;  1XMQ E;  1XMO E;  2E1R A;  3ZM7 A;  2G7H A;  2HK2 A;  4DV1 I;  1NHI A;  1N32 I;  1ZM2 A;  4IZJ B;  1MG7 A;  2UXB E;  1VIS A;  1HNW E;  2L2N A;  4I3H A;  1IBK E;  4BMJ A;  2K4V A;  1X49 A;  2VQF I;  4F54 A;  2N3H A;  2YT4 A;  4DR4 E;  4FW9 A;  1RRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...