4LF8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8I00
4LFAI 4LF5I 4KHPI 4ZVIA 4B3TI 2A2DA 3WU4A 4AQYI 3WU6A 1XNRI 4YY3I 3M6AA 1U2RA 1Z5AA 4PU9A 4PRVA 4HACA 3JAMQ 4JI3E 1Z0WA 2ZITA 2UUBE 4PRXA 3F0NA 2V2QA 1N33E 2UXCE 1FJGE 3ZZ0A 4USKA 3WU5A 2VF3A 4JV5I 2BM1A 1FKAE 4DV7E 4DUYI 1KIJA 1EA6A 1XMQE 5BR8E 4K0KI 2VQFE 1KKHA 1N0VC 1XNQE 3GONA 4DPXA 1PKPA 4LFBI 5LMNI 4DR1E 1VISA 4OX9I 4X64E 4JI7I 4HACB 1PVGA 1N0UA 2UU9I 4DV1E 4YHHI 4DV0E 2AJ4A 1HNXI 4DXLA 4LF8I 4KHPE 4X64I 1IBKI 1XHKA 1N33I 3ZKDA 1IBMI 4NXMI 1J5EE 1BKNA 1NZ0A 4B3MI 1RR9A 4JI2E 4ED4A 3LTOA 1MG7A 2UUCE 3B82A 2HK2A 3T1YE 1ZM3A 5LMUE 5BR8I 4K0KE 4LF4I 1B63A 4Z7YA 5IWAI 1QZRA 5GMEA 4LF8E 4JI5I 4B3RE 4JI1E 4X62E 1J5EI 2UXCI 4MYTA 4DR7E 1KTVA 2UXBE 1Z59A 2UXDE 4JI5E 3V5RA 1N32E 2XEXA 2V8PA 1HNZI 1IBLE 2LJPA 1Z0CA 4FWGA 4JV5E 2UXDI 4WUCA 2HFSA 3OTOI 4JI3I 1A6FA 3J7AG 1ZM2A 2V34A 1IBLI 2E1RA 3QT7A 2NPFA 1HR0I 2Q2EB 4DV1I 1H7SA 1KVKA 5FLXQ 1NHJA 4X65I 4B3RI 2WW4A 3WU3A 4JYAE 1Z5CA 4YY3E 2UUBI 1HNWE 3JAMC 2DEIA 3T1HI 4FW9A 4LF4E 2HK3A 3J81C 3J7AM 4LFCI 1IBKE 1NHIA 4UT4A 1ELOA 3T1YI 4JI8E 4JI0E 1NHHA 4DPTA 4DV6E 3V2UC 4B3TE 4FWDA 4LF6I 3ZKBA 1XMOI 4DR6E 4LFBE 3K1JA 2ZM6E 1I94E 1Z0VA 3PYFA 2VQEE 4OX9E 2UUAI 4X65E 4FN5A 3J81Q 2HHHE 1FWKA 2V2VA 2J7KA 2UXBI 1H73A 4DUZI 1RREA 4LF9I 3PYDA 2ZBKB 2E5LE 1WUUA 1EI1A 3ZZUA 4DR5E 3CWVA 5LL6R 4X66E 4DR7I 4LF7E 1DARA 1N34I 1K47A 4GKJE 4WUDA 1HNZE 4P52A 1XMQI 2ZM6I 4URLA 1FJGI 5IWAE 4DV2I 4DR3I 1D6TA 2R42A 4USMA 3Q1QA 1H74A 4DPWA 3K17A 4DU8A 4DV5E 1S4EA 4DUZE 4LF9E 5FLXC 2V2ZA 3J80C 1Z0GA 4JG4A 3QT6A 2UU9E 4I3HA 4R1FA 4JI4E 5LMNE 2BM0A 3QT5A 3H4LA 4DU7A 4X66I 3PYEA 4JYAI 4XTJA 2VQFI 5IT9Q 1N36E 4GKKE 4DR2E 1H72C 2EFGA 4GKJI 2HKJA 4JI6E 1Z0EA 1XNQI 4DUYE 4MYUA 5A2QQ 3OTOE 4DR4E 3ZM7A 4YHHE 4DV0I 4KQVA 2UUAE 4HY1A 4DV6I 4DR2I 4UTGA 4FWHA 2F4VE 4M1KA 3QT8A 4DV4E 4LFAE 2OI2A 3D4JA 4B3ME 1I94I 4HYMA 2HKEA 4NXME 4LF7I 2HHHI 1XMOE 4DV5I 1Z5BA 5GMDA 4DPYA 3LPSA 4JI7E 2GS8A 3PYGA 1HR0E 1HNWI 4DV4I 4JI4I 1XNRE 1MX0A 2VQEI 4LFCE 4B3SE 1H7UA 1FNMA 4JI2I 4DR1I 4DV3I 2BV3A 2CZ9A 5LMUI 4DV7I 4JI0I 4LF5E 4DR4I 1ZM9A 1PIEA 4RPFA 1N34E 4WUBA 1ZM4A 4DV2E 2E5LI 4DR5I 1FI4A 1B62A 1MU5A 1UEKA 4DR3E 1OJ4A 3B78A 3ZZTA 2F4VI 1N32I 4Z7CA 2R3VA 3J80Q 4JI6I 1S16A 4GKKI 2X36A 5L3JA 1ZXMA 4DPUA 4NXNI 2X7IA 3HULA 4DV3E 4EMDA 4HXZA 2UUCI 3B8HA 2HFUA 1N36I 1Z0TA 5IT9C 4LF6E 4AQYE 2DEJA 4X62I 4JI8I 4B3SI 4P7AA 1ZXNA 1HNXE 1Z0BA 2A2CA 4NXNE 4DR6I 1IBME 3LNUA 4JI1I 3T1HE 5A2QC 1FWLA
chains in the Genus database with same CATH superfamily
4LFAI 2NN6A 3M7NG 4LF5I 4KHPI 4ZVIA 4B3TI 2A2DA 3WU4A 4LOMA 4AQYI 5A2QC 2C37B 3WU6A 1XNRI 4YY3I 3PS3A 3M6AA 2NN6C 2BA1G 1U2RA 4IFDF 1Z5AA 4PU9A 4PRVA 2JT2A 4HACA 2GO4A 4LCGA 3JAMQ 4JI3E 2O1TA 1Z0WA 2ZITA 5EKWA 2UUBE 5DRRA 4PRXA 3F0NA 2V2QA 1N33E 2UXCE 1FJGE 4BA1A 3ZZ0A 1HK7A 4USKA 3WU5A 2VF3A 4JV5I 2BM1A 1FKAE 4DV7E 4DUYI 1KIJA 1EA6A 1XMQE 5BR8E 4K0KI 2VQFE 1KKHA 3B4TA 1N0VC 1XNQE 2PNZB 4OO1F 3GONA 2JEAA 4DPXA 1PKPA 4LFBI 2C37A 4FW3A 5LMNI 5K36E 2F1DA 4DR1E 1P42A 1VISA 4OX9I 4U3DA 4X64E 1OYPA 1YH8A 4JI7I 4HACB 1PVGA 1N0UA 2PNMA 2UU9I 4DV1E 5JEAC 3CDIA 4YHHI 4DV0E 2AJ4A 4OO1E 1HNXI 4DXLA 4LF8I 4KHPE 4X64I 2IOQA 1IBKI 1XHKA 1N33I 3ZKDA 1IBMI 4NXMI 1J5EE 1BKNA 5C0XB 5DRQA 1NZ0A 4B3MI 1RR9A 4ISAA 4ED4A 3LTOA 4JI2E 1MG7A 2UUCE 1Y5YA 3B82A 2HK2A 3T1YE 1ZM3A 5LMUE 2IERA 5BR8I 4K0KE 5K36D 4LF4I 1B63A 4Z7YA 5IWAI 1QZRA 5GMEA 4LF8E 4JI5I 4B3RE 4JI1E 4X62E 1J5EI 1USVA 2UXCI 2C38A 3Q6NA 4OO1B 4MYTA 4DR7E 1KTVA 5K36C 2UXBE 1Z59A 2UXDE 4JI5E 3V5RA 3Q6MA 2BA1D 1N32E 2XEXA 1VI7A 2V8PA 1HNZI 1IBLE 2AE8A 2LJPA 1Z0CA 4FWGA 4JV5E 5C0XE 4WUCA 2UXDI 2HFSA 3OTOI 4JI3I 5JEAD 1A6FA 2PO0A 3J7AG 5JEAA 1ZM2A 2V34A 1IBLI 2E1RA 2PNLA 3GLLA 3QT7A 2BR2A 2NPFA 1E3HA 2GO3A 1HR0I 2Q2EB 4DV1I 2Z5CB 1H7SA 1KVKA 5FLXQ 2Z5CA 1R6LA 1NHJA 4FW6A 4X65I 4B3RI 2WW4A 4FW5A 4JYAE 1Z5CA 4YY3E 2UUBI 1HNWE 3JAMC 2DEIA 3T1HI 4FW9A 4LF4E 2HK3A 3J81C 3J7AM 3GCMA 4LFCI 1IBKE 3PRYA 1NHIA 4UT4A 1ELOA 4LPFA 3T1YI 4JI8E 4JI0E 2PO1B 1NHHA 3P3EA 4DPTA 5K36A 4DV6E 3V2UC 2PNZA 1USUA 4MQYA 4B3TE 4FWDA 4LF6I 3M85D 4GQUA 1OYRA 3ZKBA 3K85A 1XMOI 4DR6E 4IZJA 4LFBE 3K1JA 4IZJD 2ZM6E 1I94E 1Z0VA 2JEBA 3GMEA 3PYFA 2VQEE 4OX9E 2UUAI 4LCFA 4FN5A 4X65E 3J81Q 2Z5BA 2HHHE 1FWKA 2V2VA 2J7KA 2UXBI 5DROA 1H73A 2O3ZA 4DUZI 1RREA 4LF9I 3PYDA 2ZBKB 2E5LE 1WUUA 4U3BA 5DRPA 2WP8A 1Y60A 4IFDE 1EI1A 3ZZUA 4DR5E 3CWVA 5LL6R 4X66E 2NN6B 4DR7I 4LF7E 3U1YA 1DARA 1UDOA 1N34I 4IFDC 3P3GA 2NN6F 5EL9A 1K47A 3H1CA 4GKJE 4WUDA 1HNZE 2CG9A 4P52A 1XMQI 2ZM6I 4URLA 2CVEA 2JEAB 1FJGI 5IWAE 2Z5BB 4MU3A 4DV2I 4DR3I 1D6TA 2R42A 5C0XF 4USMA 3Q1QA 1H74A 4DPWA 4LCHA 3K17A 4DU8A 4DV5E 2WNRA 1S4EA 3M85G 4DUZE 4LF9E 3HJCA 5FLXC 2C39A 2O1UA 2V2ZA 3J80C 1Z0GA 4JG4A 3QT6A 2Z5EA 2UU9E 4I3HA 4R1FA 4IZKB 5LMNE 4JI4E 2BM0A 3UHMA 2PO2B 3QT5A 3H4LA 4DU7A 4X66I 2PO2A 2NN6D 3PYEA 4JYAI 4XTJA 4AM3A 4MDTA 2VQFI 3P06A 4AIMA 5C0XC 5IT9Q 4IZJB 1N36E 3M7ND 4GKKE 4DR2E 1UDSA 2BA0D 2IESA 1H72C 2C38B 4OO1A 2EFGA 5JEAE 4GKJI 2HKJA 2O1VA 4JI6E 1YHCA 2BA0G 2WNRB 1Z0EA 1XNQI 1E3PA 3U1KA 2CGEA 5DNLA 4DUYE 4MYUA 4IZKA 5A2QQ 3OTOE 4QNJA 4DR4E 3ZM7A 4YHHE 4DV0I 4KQVA 2UUAE 4HY1A 4DV6I 4DR2I 1RHYA 2J65A 4UTGA 4FWHA 2F4VE 4AIDA 4M1KA 5K36B 3QT8A 2GQ0A 4DV4E 4LFAE 2OI2A 1UDNA 3D4JA 4B3ME 1I94I 5JEAB 1OYSA 4HYMA 2HKEA 4NXME 4LF7I 2HHHI 1XMOE 2BR2B 4BA2B 5ELWA 4DV5I 1Z5BA 1Y6ZA 4OZEA 2JEBB 1R6MA 5GMDA 4MU1A 4DPYA 3LPSA 1XXEA 4JI7E 2GS8A 3PYGA 1HR0E 1Y4UA 3PS2A 4DV4I 1HNWI 4JI4I 1XNRE 4FW7A 5JEAF 1MX0A 2VQEI 5C0XA 4LFCE 2IOPA 5DNXA 4B3SE 3NZKA 1H7UA 2VESA 4N3OA 1FNMA 4JI2I 4DR1I 2PO1A 4DV3I 4MU0A 4IS9A 2JE6A 4QNKA 4IFDB 2BV3A 2CZ9A 4OO1C 4OO1D 5LMUI 5C0XD 4DV7I 4JI0I 4MU4A 4LF5E 4DR4I 1ZM9A 1PIEA 4RPFA 1N34E 4BA2A 1Y4SA 4WUBA 1ZM4A 4DV2E 2E5LI 4DR5I 1FI4A 1B62A 3KRNA 3PS1A 1MU5A 1UEKA 4DR3E 2WP8B 1OJ4A 4OKGA 3B78A 3ZZTA 2F4VI 1N32I 4Z7CA 4J3DA 2R3VA 3J80Q 4JI6I 2NN6E 5FWKA 2PO0B 1S16A 4GKKI 2X36A 5L3JA 3CDJA 1ZXMA 1UDQA 2JE6B 4DPUA 4IFDA 5K36F 4NXNI 3HKMA 2X7IA 3HULA 4DV3E 4EMDA 3L7ZA 4HXZA 3B8HA 2UUCI 4IFDD 2HFUA 1N36I 1Z0TA 5IT9C 3L7ZB 4LF6E 4AQYE 2DEJA 4X62I 4JI8I 4B3SI 4P7AA 3P3CA 4NBQA 4FW4A 3DD6A 1ZXNA 1HNXE 3P76A 4BA1B 1Z0BA 2A2CA 2O1WA 4NXNE 4DR6I 1IBME 3LNUA 4JI1I 2C39B 3T1HE 3WU3A 1FWLA
chains in the Genus database with same CATH topology
4LFAI 4LF5I 4KHPI 4ZVIA 4B3TI 2A2DA 3WU4A 4AQYI 3WU6A 1XNRI 4YY3I 3M6AA 1U2RA 1Z5AA 4PU9A 4PRVA 4HACA 3JAMQ 4JI3E 2O1TA 1Z0WA 2ZITA 2UUBE 4PRXA 3F0NA 2V2QA 1N33E 2UXCE 1FJGE 3ZZ0A 1HK7A 4USKA 3WU5A 2VF3A 4JV5I 2BM1A 1FKAE 4DV7E 4DUYI 1KIJA 1EA6A 1XMQE 5BR8E 4K0KI 2VQFE 1KKHA 1N0VC 1XNQE 3GONA 4DPXA 1PKPA 4LFBI 5LMNI 4DR1E 1VISA 4OX9I 4X64E 4JI7I 4HACB 1PVGA 1N0UA 2PNMA 2UU9I 4DV1E 4YHHI 4DV0E 2AJ4A 1HNXI 4DXLA 4LF8I 4KHPE 4X64I 2IOQA 1IBKI 1XHKA 1N33I 3ZKDA 1IBMI 4NXMI 1J5EE 1BKNA 1NZ0A 4B3MI 1RR9A 4JI2E 4ED4A 3LTOA 1MG7A 2UUCE 3B82A 2HK2A 3T1YE 1ZM3A 5LMUE 5BR8I 4K0KE 4LF4I 1B63A 4Z7YA 5IWAI 1QZRA 5GMEA 4LF8E 4JI5I 4B3RE 4JI1E 4X62E 1J5EI 1USVA 2UXCI 3Q6NA 4MYTA 4DR7E 1KTVA 2UXBE 1Z59A 2UXDE 4JI5E 3V5RA 3Q6MA 1N32E 2XEXA 2V8PA 1HNZI 1IBLE 2LJPA 1Z0CA 4FWGA 4JV5E 2UXDI 4WUCA 2HFSA 3OTOI 4JI3I 1A6FA 3J7AG 1ZM2A 2V34A 1IBLI 2E1RA 2PNLA 3QT7A 2NPFA 1HR0I 2Q2EB 4DV1I 2Z5CB 1H7SA 1KVKA 5FLXQ 2Z5CA 1NHJA 4X65I 4B3RI 2WW4A 3WU3A 4JYAE 1Z5CA 4YY3E 2UUBI 1HNWE 3JAMC 2DEIA 3T1HI 4FW9A 4LF4E 2HK3A 3J81C 3J7AM 4LFCI 1IBKE 3PRYA 1NHIA 4UT4A 1ELOA 3T1YI 4JI8E 4JI0E 1NHHA 4DPTA 4DV6E 3V2UC 1USUA 4B3TE 4FWDA 4LF6I 3ZKBA 3K85A 1XMOI 4DR6E 4IZJA 4LFBE 3K1JA 4IZJD 2ZM6E 1I94E 1Z0VA 3PYFA 2VQEE 4OX9E 2UUAI 4X65E 4FN5A 3J81Q 2Z5BA 2HHHE 1FWKA 2V2VA 2J7KA 2UXBI 1H73A 4DUZI 1RREA 4LF9I 3PYDA 2ZBKB 2E5LE 1WUUA 1EI1A 3ZZUA 4DR5E 3CWVA 5LL6R 4X66E 4DR7I 4LF7E 1DARA 1N34I 1K47A 4GKJE 4WUDA 1HNZE 2CG9A 4P52A 1XMQI 2ZM6I 4URLA 1FJGI 5IWAE 2Z5BB 4DV2I 4DR3I 1D6TA 2R42A 4USMA 3Q1QA 1H74A 4DPWA 3K17A 4DU8A 4DV5E 1S4EA 4DUZE 4LF9E 3HJCA 5FLXC 2O1UA 2V2ZA 3J80C 1Z0GA 4JG4A 3QT6A 2Z5EA 2UU9E 4I3HA 4R1FA 4IZKB 5LMNE 4JI4E 2BM0A 3QT5A 3H4LA 4DU7A 4X66I 3PYEA 4JYAI 4XTJA 2VQFI 3P06A 5IT9Q 4IZJB 1N36E 4GKKE 4DR2E 1H72C 2EFGA 4GKJI 2HKJA 2O1VA 4JI6E 1Z0EA 1XNQI 2CGEA 4DUYE 4MYUA 4IZKA 5A2QQ 3OTOE 4DR4E 3ZM7A 4YHHE 4DV0I 4KQVA 2UUAE 4HY1A 4DV6I 4DR2I 4UTGA 4FWHA 2F4VE 4M1KA 3QT8A 2GQ0A 4DV4E 4LFAE 2OI2A 3D4JA 4B3ME 1I94I 4HYMA 2HKEA 4NXME 4LF7I 2HHHI 1XMOE 4DV5I 1Z5BA 1Y6ZA 5GMDA 4DPYA 3LPSA 4JI7E 2GS8A 3PYGA 1HR0E 1Y4UA 1HNWI 4DV4I 4JI4I 1XNRE 1MX0A 2VQEI 4LFCE 2IOPA 4B3SE 1H7UA 4N3OA 1FNMA 4JI2I 4DR1I 4DV3I 2BV3A 2CZ9A 5LMUI 4DV7I 4JI0I 4LF5E 4DR4I 1ZM9A 1PIEA 4RPFA 1N34E 1Y4SA 4WUBA 1ZM4A 4DV2E 2E5LI 4DR5I 1FI4A 1B62A 1MU5A 1UEKA 4DR3E 1OJ4A 3B78A 3ZZTA 2F4VI 1N32I 4Z7CA 2R3VA 3J80Q 4JI6I 5FWKA 1S16A 4GKKI 2X36A 5L3JA 1ZXMA 4DPUA 4NXNI 2X7IA 3HULA 4DV3E 4EMDA 4HXZA 2UUCI 3B8HA 2HFUA 1N36I 1Z0TA 5IT9C 4LF6E 4AQYE 2DEJA 4X62I 4JI8I 4B3SI 4P7AA 1ZXNA 1HNXE 1Z0BA 2A2CA 2O1WA 4NXNE 4DR6I 1IBME 3LNUA 4JI1I 3T1HE 5A2QC 1FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA I;  4LF5 I;  4KHP I;  4ZVI A;  4B3T I;  2A2D A;  3WU4 A;  4AQY I;  3WU6 A;  1XNR I;  4YY3 I;  3M6A A;  1U2R A;  1Z5A A;  4PU9 A;  4PRV A;  4HAC A;  3JAM Q;  4JI3 E;  1Z0W A;  2ZIT A;  2UUB E;  4PRX A;  3F0N A;  2V2Q A;  1N33 E;  2UXC E;  1FJG E;  3ZZ0 A;  4USK A;  3WU5 A;  2VF3 A;  4JV5 I;  2BM1 A;  1FKA E;  4DV7 E;  4DUY I;  1KIJ A;  1EA6 A;  1XMQ E;  5BR8 E;  4K0K I;  2VQF E;  1KKH A;  1N0V C;  1XNQ E;  3GON A;  4DPX A;  1PKP A;  4LFB I;  5LMN I;  4DR1 E;  1VIS A;  4OX9 I;  4X64 E;  4JI7 I;  4HAC B;  1PVG A;  1N0U A;  2UU9 I;  4DV1 E;  4YHH I;  4DV0 E;  2AJ4 A;  1HNX I;  4DXL A;  4LF8 I;  4KHP E;  4X64 I;  1IBK I;  1XHK A;  1N33 I;  3ZKD A;  1IBM I;  4NXM I;  1J5E E;  1BKN A;  1NZ0 A;  4B3M I;  1RR9 A;  4JI2 E;  4ED4 A;  3LTO A;  1MG7 A;  2UUC E;  3B82 A;  2HK2 A;  3T1Y E;  1ZM3 A;  5LMU E;  5BR8 I;  4K0K E;  4LF4 I;  1B63 A;  4Z7Y A;  5IWA I;  1QZR A;  5GME A;  4LF8 E;  4JI5 I;  4B3R E;  4JI1 E;  4X62 E;  1J5E I;  2UXC I;  4MYT A;  4DR7 E;  1KTV A;  2UXB E;  1Z59 A;  2UXD E;  4JI5 E;  3V5R A;  1N32 E;  2XEX A;  2V8P A;  1HNZ I;  1IBL E;  2LJP A;  1Z0C A;  4FWG A;  4JV5 E;  2UXD I;  4WUC A;  2HFS A;  3OTO I;  4JI3 I;  1A6F A;  3J7A G;  1ZM2 A;  2V34 A;  1IBL I;  2E1R A;  3QT7 A;  2NPF A;  1HR0 I;  2Q2E B;  4DV1 I;  1H7S A;  1KVK A;  5FLX Q;  1NHJ A;  4X65 I;  4B3R I;  2WW4 A;  3WU3 A;  4JYA E;  1Z5C A;  4YY3 E;  2UUB I;  1HNW E;  3JAM C;  2DEI A;  3T1H I;  4FW9 A;  4LF4 E;  2HK3 A;  3J81 C;  3J7A M;  4LFC I;  1IBK E;  1NHI A;  4UT4 A;  1ELO A;  3T1Y I;  4JI8 E;  4JI0 E;  1NHH A;  4DPT A;  4DV6 E;  3V2U C;  4B3T E;  4FWD A;  4LF6 I;  3ZKB A;  1XMO I;  4DR6 E;  4LFB E;  3K1J A;  2ZM6 E;  1I94 E;  1Z0V A;  3PYF A;  2VQE E;  4OX9 E;  2UUA I;  4X65 E;  4FN5 A;  3J81 Q;  2HHH E;  1FWK A;  2V2V A;  2J7K A;  2UXB I;  1H73 A;  4DUZ I;  1RRE A;  4LF9 I;  3PYD A;  2ZBK B;  2E5L E;  1WUU A;  1EI1 A;  3ZZU A;  4DR5 E;  3CWV A;  5LL6 R;  4X66 E;  4DR7 I;  4LF7 E;  1DAR A;  1N34 I;  1K47 A;  4GKJ E;  4WUD A;  1HNZ E;  4P52 A;  1XMQ I;  2ZM6 I;  4URL A;  1FJG I;  5IWA E;  4DV2 I;  4DR3 I;  1D6T A;  2R42 A;  4USM A;  3Q1Q A;  1H74 A;  4DPW A;  3K17 A;  4DU8 A;  4DV5 E;  1S4E A;  4DUZ E;  4LF9 E;  5FLX C;  2V2Z A;  3J80 C;  1Z0G A;  4JG4 A;  3QT6 A;  2UU9 E;  4I3H A;  4R1F A;  4JI4 E;  5LMN E;  2BM0 A;  3QT5 A;  3H4L A;  4DU7 A;  4X66 I;  3PYE A;  4JYA I;  4XTJ A;  2VQF I;  5IT9 Q;  1N36 E;  4GKK E;  4DR2 E;  1H72 C;  2EFG A;  4GKJ I;  2HKJ A;  4JI6 E;  1Z0E A;  1XNQ I;  4DUY E;  4MYU A;  5A2Q Q;  3OTO E;  4DR4 E;  3ZM7 A;  4YHH E;  4DV0 I;  4KQV A;  2UUA E;  4HY1 A;  4DV6 I;  4DR2 I;  4UTG A;  4FWH A;  2F4V E;  4M1K A;  3QT8 A;  4DV4 E;  4LFA E;  2OI2 A;  3D4J A;  4B3M E;  1I94 I;  4HYM A;  2HKE A;  4NXM E;  4LF7 I;  2HHH I;  1XMO E;  4DV5 I;  1Z5B A;  5GMD A;  4DPY A;  3LPS A;  4JI7 E;  2GS8 A;  3PYG A;  1HR0 E;  1HNW I;  4DV4 I;  4JI4 I;  1XNR E;  1MX0 A;  2VQE I;  4LFC E;  4B3S E;  1H7U A;  1FNM A;  4JI2 I;  4DR1 I;  4DV3 I;  2BV3 A;  2CZ9 A;  5LMU I;  4DV7 I;  4JI0 I;  4LF5 E;  4DR4 I;  1ZM9 A;  1PIE A;  4RPF A;  1N34 E;  4WUB A;  1ZM4 A;  4DV2 E;  2E5L I;  4DR5 I;  1FI4 A;  1B62 A;  1MU5 A;  1UEK A;  4DR3 E;  1OJ4 A;  3B78 A;  3ZZT A;  2F4V I;  1N32 I;  4Z7C A;  2R3V A;  3J80 Q;  4JI6 I;  1S16 A;  4GKK I;  2X36 A;  5L3J A;  1ZXM A;  4DPU A;  4NXN I;  2X7I A;  3HUL A;  4DV3 E;  4EMD A;  4HXZ A;  2UUC I;  3B8H A;  2HFU A;  1N36 I;  1Z0T A;  5IT9 C;  4LF6 E;  4AQY E;  2DEJ A;  4X62 I;  4JI8 I;  4B3S I;  4P7A A;  1ZXN A;  1HNX E;  1Z0B A;  2A2C A;  4NXN E;  4DR6 I;  1IBM E;  3LNU A;  4JI1 I;  3T1H E;  5A2Q C;  1FWL A; 
#chains in the Genus database with same CATH topology
 4LFA I;  2NN6 A;  3M7N G;  4LF5 I;  4KHP I;  4ZVI A;  4B3T I;  2A2D A;  3WU4 A;  4LOM A;  4AQY I;  5A2Q C;  2C37 B;  3WU6 A;  1XNR I;  4YY3 I;  3PS3 A;  3M6A A;  2NN6 C;  2BA1 G;  1U2R A;  4IFD F;  1Z5A A;  4PU9 A;  4PRV A;  2JT2 A;  4HAC A;  2GO4 A;  4LCG A;  3JAM Q;  4JI3 E;  2O1T A;  1Z0W A;  2ZIT A;  5EKW A;  2UUB E;  5DRR A;  4PRX A;  3F0N A;  2V2Q A;  1N33 E;  2UXC E;  1FJG E;  4BA1 A;  3ZZ0 A;  1HK7 A;  4USK A;  3WU5 A;  2VF3 A;  4JV5 I;  2BM1 A;  1FKA E;  4DV7 E;  4DUY I;  1KIJ A;  1EA6 A;  1XMQ E;  5BR8 E;  4K0K I;  2VQF E;  1KKH A;  3B4T A;  1N0V C;  1XNQ E;  2PNZ B;  4OO1 F;  3GON A;  2JEA A;  4DPX A;  1PKP A;  4LFB I;  2C37 A;  4FW3 A;  5LMN I;  5K36 E;  2F1D A;  4DR1 E;  1P42 A;  1VIS A;  4OX9 I;  4U3D A;  4X64 E;  1OYP A;  1YH8 A;  4JI7 I;  4HAC B;  1PVG A;  1N0U A;  2PNM A;  2UU9 I;  4DV1 E;  5JEA C;  3CDI A;  4YHH I;  4DV0 E;  2AJ4 A;  4OO1 E;  1HNX I;  4DXL A;  4LF8 I;  4KHP E;  4X64 I;  2IOQ A;  1IBK I;  1XHK A;  1N33 I;  3ZKD A;  1IBM I;  4NXM I;  1J5E E;  1BKN A;  5C0X B;  5DRQ A;  1NZ0 A;  4B3M I;  1RR9 A;  4ISA A;  4ED4 A;  3LTO A;  4JI2 E;  1MG7 A;  2UUC E;  1Y5Y A;  3B82 A;  2HK2 A;  3T1Y E;  1ZM3 A;  5LMU E;  2IER A;  5BR8 I;  4K0K E;  5K36 D;  4LF4 I;  1B63 A;  4Z7Y A;  5IWA I;  1QZR A;  5GME A;  4LF8 E;  4JI5 I;  4B3R E;  4JI1 E;  4X62 E;  1J5E I;  1USV A;  2UXC I;  2C38 A;  3Q6N A;  4OO1 B;  4MYT A;  4DR7 E;  1KTV A;  5K36 C;  2UXB E;  1Z59 A;  2UXD E;  4JI5 E;  3V5R A;  3Q6M A;  2BA1 D;  1N32 E;  2XEX A;  1VI7 A;  2V8P A;  1HNZ I;  1IBL E;  2AE8 A;  2LJP A;  1Z0C A;  4FWG A;  4JV5 E;  5C0X E;  4WUC A;  2UXD I;  2HFS A;  3OTO I;  4JI3 I;  5JEA D;  1A6F A;  2PO0 A;  3J7A G;  5JEA A;  1ZM2 A;  2V34 A;  1IBL I;  2E1R A;  2PNL A;  3GLL A;  3QT7 A;  2BR2 A;  2NPF A;  1E3H A;  2GO3 A;  1HR0 I;  2Q2E B;  4DV1 I;  2Z5C B;  1H7S A;  1KVK A;  5FLX Q;  2Z5C A;  1R6L A;  1NHJ A;  4FW6 A;  4X65 I;  4B3R I;  2WW4 A;  4FW5 A;  4JYA E;  1Z5C A;  4YY3 E;  2UUB I;  1HNW E;  3JAM C;  2DEI A;  3T1H I;  4FW9 A;  4LF4 E;  2HK3 A;  3J81 C;  3J7A M;  3GCM A;  4LFC I;  1IBK E;  3PRY A;  1NHI A;  4UT4 A;  1ELO A;  4LPF A;  3T1Y I;  4JI8 E;  4JI0 E;  2PO1 B;  1NHH A;  3P3E A;  4DPT A;  5K36 A;  4DV6 E;  3V2U C;  2PNZ A;  1USU A;  4MQY A;  4B3T E;  4FWD A;  4LF6 I;  3M85 D;  4GQU A;  1OYR A;  3ZKB A;  3K85 A;  1XMO I;  4DR6 E;  4IZJ A;  4LFB E;  3K1J A;  4IZJ D;  2ZM6 E;  1I94 E;  1Z0V A;  2JEB A;  3GME A;  3PYF A;  2VQE E;  4OX9 E;  2UUA I;  4LCF A;  4FN5 A;  4X65 E;  3J81 Q;  2Z5B A;  2HHH E;  1FWK A;  2V2V A;  2J7K A;  2UXB I;  5DRO A;  1H73 A;  2O3Z A;  4DUZ I;  1RRE A;  4LF9 I;  3PYD A;  2ZBK B;  2E5L E;  1WUU A;  4U3B A;  5DRP A;  2WP8 A;  1Y60 A;  4IFD E;  1EI1 A;  3ZZU A;  4DR5 E;  3CWV A;  5LL6 R;  4X66 E;  2NN6 B;  4DR7 I;  4LF7 E;  3U1Y A;  1DAR A;  1UDO A;  1N34 I;  4IFD C;  3P3G A;  2NN6 F;  5EL9 A;  1K47 A;  3H1C A;  4GKJ E;  4WUD A;  1HNZ E;  2CG9 A;  4P52 A;  1XMQ I;  2ZM6 I;  4URL A;  2CVE A;  2JEA B;  1FJG I;  5IWA E;  2Z5B B;  4MU3 A;  4DV2 I;  4DR3 I;  1D6T A;  2R42 A;  5C0X F;  4USM A;  3Q1Q A;  1H74 A;  4DPW A;  4LCH A;  3K17 A;  4DU8 A;  4DV5 E;  2WNR A;  1S4E A;  3M85 G;  4DUZ E;  4LF9 E;  3HJC A;  5FLX C;  2C39 A;  2O1U A;  2V2Z A;  3J80 C;  1Z0G A;  4JG4 A;  3QT6 A;  2Z5E A;  2UU9 E;  4I3H A;  4R1F A;  4IZK B;  5LMN E;  4JI4 E;  2BM0 A;  3UHM A;  2PO2 B;  3QT5 A;  3H4L A;  4DU7 A;  4X66 I;  2PO2 A;  2NN6 D;  3PYE A;  4JYA I;  4XTJ A;  4AM3 A;  4MDT A;  2VQF I;  3P06 A;  4AIM A;  5C0X C;  5IT9 Q;  4IZJ B;  1N36 E;  3M7N D;  4GKK E;  4DR2 E;  1UDS A;  2BA0 D;  2IES A;  1H72 C;  2C38 B;  4OO1 A;  2EFG A;  5JEA E;  4GKJ I;  2HKJ A;  2O1V A;  4JI6 E;  1YHC A;  2BA0 G;  2WNR B;  1Z0E A;  1XNQ I;  1E3P A;  3U1K A;  2CGE A;  5DNL A;  4DUY E;  4MYU A;  4IZK A;  5A2Q Q;  3OTO E;  4QNJ A;  4DR4 E;  3ZM7 A;  4YHH E;  4DV0 I;  4KQV A;  2UUA E;  4HY1 A;  4DV6 I;  4DR2 I;  1RHY A;  2J65 A;  4UTG A;  4FWH A;  2F4V E;  4AID A;  4M1K A;  5K36 B;  3QT8 A;  2GQ0 A;  4DV4 E;  4LFA E;  2OI2 A;  1UDN A;  3D4J A;  4B3M E;  1I94 I;  5JEA B;  1OYS A;  4HYM A;  2HKE A;  4NXM E;  4LF7 I;  2HHH I;  1XMO E;  2BR2 B;  4BA2 B;  5ELW A;  4DV5 I;  1Z5B A;  1Y6Z A;  4OZE A;  2JEB B;  1R6M A;  5GMD A;  4MU1 A;  4DPY A;  3LPS A;  1XXE A;  4JI7 E;  2GS8 A;  3PYG A;  1HR0 E;  1Y4U A;  3PS2 A;  4DV4 I;  1HNW I;  4JI4 I;  1XNR E;  4FW7 A;  5JEA F;  1MX0 A;  2VQE I;  5C0X A;  4LFC E;  2IOP A;  5DNX A;  4B3S E;  3NZK A;  1H7U A;  2VES A;  4N3O A;  1FNM A;  4JI2 I;  4DR1 I;  2PO1 A;  4DV3 I;  4MU0 A;  4IS9 A;  2JE6 A;  4QNK A;  4IFD B;  2BV3 A;  2CZ9 A;  4OO1 C;  4OO1 D;  5LMU I;  5C0X D;  4DV7 I;  4JI0 I;  4MU4 A;  4LF5 E;  4DR4 I;  1ZM9 A;  1PIE A;  4RPF A;  1N34 E;  4BA2 A;  1Y4S A;  4WUB A;  1ZM4 A;  4DV2 E;  2E5L I;  4DR5 I;  1FI4 A;  1B62 A;  3KRN A;  3PS1 A;  1MU5 A;  1UEK A;  4DR3 E;  2WP8 B;  1OJ4 A;  4OKG A;  3B78 A;  3ZZT A;  2F4V I;  1N32 I;  4Z7C A;  4J3D A;  2R3V A;  3J80 Q;  4JI6 I;  2NN6 E;  5FWK A;  2PO0 B;  1S16 A;  4GKK I;  2X36 A;  5L3J A;  3CDJ A;  1ZXM A;  1UDQ A;  2JE6 B;  4DPU A;  4IFD A;  5K36 F;  4NXN I;  3HKM A;  2X7I A;  3HUL A;  4DV3 E;  4EMD A;  3L7Z A;  4HXZ A;  3B8H A;  2UUC I;  4IFD D;  2HFU A;  1N36 I;  1Z0T A;  5IT9 C;  3L7Z B;  4LF6 E;  4AQY E;  2DEJ A;  4X62 I;  4JI8 I;  4B3S I;  4P7A A;  3P3C A;  4NBQ A;  4FW4 A;  3DD6 A;  1ZXN A;  1HNX E;  3P76 A;  4BA1 B;  1Z0B A;  2A2C A;  2O1W A;  4NXN E;  4DR6 I;  1IBM E;  3LNU A;  4JI1 I;  2C39 B;  3T1H E;  3WU3 A;  1FWL A; 
#chains in the Genus database with same CATH homology
 4LFA I;  4LF5 I;  4KHP I;  4ZVI A;  4B3T I;  2A2D A;  3WU4 A;  4AQY I;  3WU6 A;  1XNR I;  4YY3 I;  3M6A A;  1U2R A;  1Z5A A;  4PU9 A;  4PRV A;  4HAC A;  3JAM Q;  4JI3 E;  2O1T A;  1Z0W A;  2ZIT A;  2UUB E;  4PRX A;  3F0N A;  2V2Q A;  1N33 E;  2UXC E;  1FJG E;  3ZZ0 A;  1HK7 A;  4USK A;  3WU5 A;  2VF3 A;  4JV5 I;  2BM1 A;  1FKA E;  4DV7 E;  4DUY I;  1KIJ A;  1EA6 A;  1XMQ E;  5BR8 E;  4K0K I;  2VQF E;  1KKH A;  1N0V C;  1XNQ E;  3GON A;  4DPX A;  1PKP A;  4LFB I;  5LMN I;  4DR1 E;  1VIS A;  4OX9 I;  4X64 E;  4JI7 I;  4HAC B;  1PVG A;  1N0U A;  2PNM A;  2UU9 I;  4DV1 E;  4YHH I;  4DV0 E;  2AJ4 A;  1HNX I;  4DXL A;  4LF8 I;  4KHP E;  4X64 I;  2IOQ A;  1IBK I;  1XHK A;  1N33 I;  3ZKD A;  1IBM I;  4NXM I;  1J5E E;  1BKN A;  1NZ0 A;  4B3M I;  1RR9 A;  4JI2 E;  4ED4 A;  3LTO A;  1MG7 A;  2UUC E;  3B82 A;  2HK2 A;  3T1Y E;  1ZM3 A;  5LMU E;  5BR8 I;  4K0K E;  4LF4 I;  1B63 A;  4Z7Y A;  5IWA I;  1QZR A;  5GME A;  4LF8 E;  4JI5 I;  4B3R E;  4JI1 E;  4X62 E;  1J5E I;  1USV A;  2UXC I;  3Q6N A;  4MYT A;  4DR7 E;  1KTV A;  2UXB E;  1Z59 A;  2UXD E;  4JI5 E;  3V5R A;  3Q6M A;  1N32 E;  2XEX A;  2V8P A;  1HNZ I;  1IBL E;  2LJP A;  1Z0C A;  4FWG A;  4JV5 E;  2UXD I;  4WUC A;  2HFS A;  3OTO I;  4JI3 I;  1A6F A;  3J7A G;  1ZM2 A;  2V34 A;  1IBL I;  2E1R A;  2PNL A;  3QT7 A;  2NPF A;  1HR0 I;  2Q2E B;  4DV1 I;  2Z5C B;  1H7S A;  1KVK A;  5FLX Q;  2Z5C A;  1NHJ A;  4X65 I;  4B3R I;  2WW4 A;  3WU3 A;  4JYA E;  1Z5C A;  4YY3 E;  2UUB I;  1HNW E;  3JAM C;  2DEI A;  3T1H I;  4FW9 A;  4LF4 E;  2HK3 A;  3J81 C;  3J7A M;  4LFC I;  1IBK E;  3PRY A;  1NHI A;  4UT4 A;  1ELO A;  3T1Y I;  4JI8 E;  4JI0 E;  1NHH A;  4DPT A;  4DV6 E;  3V2U C;  1USU A;  4B3T E;  4FWD A;  4LF6 I;  3ZKB A;  3K85 A;  1XMO I;  4DR6 E;  4IZJ A;  4LFB E;  3K1J A;  4IZJ D;  2ZM6 E;  1I94 E;  1Z0V A;  3PYF A;  2VQE E;  4OX9 E;  2UUA I;  4X65 E;  4FN5 A;  3J81 Q;  2Z5B A;  2HHH E;  1FWK A;  2V2V A;  2J7K A;  2UXB I;  1H73 A;  4DUZ I;  1RRE A;  4LF9 I;  3PYD A;  2ZBK B;  2E5L E;  1WUU A;  1EI1 A;  3ZZU A;  4DR5 E;  3CWV A;  5LL6 R;  4X66 E;  4DR7 I;  4LF7 E;  1DAR A;  1N34 I;  1K47 A;  4GKJ E;  4WUD A;  1HNZ E;  2CG9 A;  4P52 A;  1XMQ I;  2ZM6 I;  4URL A;  1FJG I;  5IWA E;  2Z5B B;  4DV2 I;  4DR3 I;  1D6T A;  2R42 A;  4USM A;  3Q1Q A;  1H74 A;  4DPW A;  3K17 A;  4DU8 A;  4DV5 E;  1S4E A;  4DUZ E;  4LF9 E;  3HJC A;  5FLX C;  2O1U A;  2V2Z A;  3J80 C;  1Z0G A;  4JG4 A;  3QT6 A;  2Z5E A;  2UU9 E;  4I3H A;  4R1F A;  4IZK B;  5LMN E;  4JI4 E;  2BM0 A;  3QT5 A;  3H4L A;  4DU7 A;  4X66 I;  3PYE A;  4JYA I;  4XTJ A;  2VQF I;  3P06 A;  5IT9 Q;  4IZJ B;  1N36 E;  4GKK E;  4DR2 E;  1H72 C;  2EFG A;  4GKJ I;  2HKJ A;  2O1V A;  4JI6 E;  1Z0E A;  1XNQ I;  2CGE A;  4DUY E;  4MYU A;  4IZK A;  5A2Q Q;  3OTO E;  4DR4 E;  3ZM7 A;  4YHH E;  4DV0 I;  4KQV A;  2UUA E;  4HY1 A;  4DV6 I;  4DR2 I;  4UTG A;  4FWH A;  2F4V E;  4M1K A;  3QT8 A;  2GQ0 A;  4DV4 E;  4LFA E;  2OI2 A;  3D4J A;  4B3M E;  1I94 I;  4HYM A;  2HKE A;  4NXM E;  4LF7 I;  2HHH I;  1XMO E;  4DV5 I;  1Z5B A;  1Y6Z A;  5GMD A;  4DPY A;  3LPS A;  4JI7 E;  2GS8 A;  3PYG A;  1HR0 E;  1Y4U A;  1HNW I;  4DV4 I;  4JI4 I;  1XNR E;  1MX0 A;  2VQE I;  4LFC E;  2IOP A;  4B3S E;  1H7U A;  4N3O A;  1FNM A;  4JI2 I;  4DR1 I;  4DV3 I;  2BV3 A;  2CZ9 A;  5LMU I;  4DV7 I;  4JI0 I;  4LF5 E;  4DR4 I;  1ZM9 A;  1PIE A;  4RPF A;  1N34 E;  1Y4S A;  4WUB A;  1ZM4 A;  4DV2 E;  2E5L I;  4DR5 I;  1FI4 A;  1B62 A;  1MU5 A;  1UEK A;  4DR3 E;  1OJ4 A;  3B78 A;  3ZZT A;  2F4V I;  1N32 I;  4Z7C A;  2R3V A;  3J80 Q;  4JI6 I;  5FWK A;  1S16 A;  4GKK I;  2X36 A;  5L3J A;  1ZXM A;  4DPU A;  4NXN I;  2X7I A;  3HUL A;  4DV3 E;  4EMD A;  4HXZ A;  2UUC I;  3B8H A;  2HFU A;  1N36 I;  1Z0T A;  5IT9 C;  4LF6 E;  4AQY E;  2DEJ A;  4X62 I;  4JI8 I;  4B3S I;  4P7A A;  1ZXN A;  1HNX E;  1Z0B A;  2A2C A;  2O1W A;  4NXN E;  4DR6 I;  1IBM E;  3LNU A;  4JI1 I;  3T1H E;  5A2Q C;  1FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...