4LF8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8I00
1N0UA 1ZXMA 4RPFA 3WU6A 5FLXQ 4LFAE 4K0KE 2Q2EB 5LMUE 4DV2I 4JI6I 4JV5E 2BM1A 4AQYI 3PYGA 1Z0WA 1FJGI 1QZRA 2ZM6E 3QT5A 4DV3I 4LFAI 3ZKBA 4K0KI 1PKPA 1Z0EA 5LMUI 5L3JA 4JI0E 1A6FA 3ZM7A 4P52A 2A2CA 1KVKA 1UEKA 1N36E 3F0NA 1KTVA 1N33E 4LF6E 1NHJA 5LL6R 4NXME 2ZITA 1NHIA 4DUZE 3J7AG 4WUCA 4LF4I 1PIEA 4ED4A 1XMQE 1N33I 3J7AM 3J80Q 4DR1E 1N34I 4USMA 1XNRE 3OTOI 2LJPA 3GONA 4DV5E 3T1YI 4MYTA 4DUZI 1OJ4A 2VQEI 4EMDA 5LMNI 2UUBE 4DXLA 1XMQI 2WW4A 3PYFA 4DR1I 1Z0VA 1H7SA 4DV5I 3LTOA 4JI5E 1FNMA 2AJ4A 2BM0A 4DV2E 1IBLI 1N32I 4LF5I 4JG4A 3K1JA 2E1RA 4DPWA 5A2QC 5IT9Q 4DU8A 3LPSA 3T1HI 1Z5AA 4AQYE 2HHHI 1FJGE 1HNXI 1ZXNA 1RREA 4DV3E 4JI5I 5A2QQ 1S16A 1HNZI 2UXBI 4KHPE 3H4LA 1D6TA 1H72C 4JI7I 1H74A 3V2UC 1EI1A 4MYUA 1IBKI 1IBME 2HKJA 1KIJA 3LNUA 1XNQE 2J7KA 2XEXA 4PRVA 4KHPI 2VF3A 4FW9A 1Z0BA 4B3SI 2UXDE 2UUCE 3Q1QA 1MG7A 4LF4E 2CZ9A 4DV4I 4JI8I 1IBMI 4HXZA 4JI3E 1XNQI 1N0VC 1N34E 2E5LE 2V2ZA 3J80C 3JAMQ 3OTOE 4FWDA 3WU4A 3T1YE 4JYAI 4WUDA 4M1KA 2UXDI 1MU5A 2UUCI 2VQEE 5LMNE 4LF9I 4LFBI 2BV3A 4KQVA 4WUBA 3QT7A 1XMOE 2UUAE 1HNWI 4JI3I 4HACA 3K17A 2E5LI 2UU9E 3PYDA 1K47A 4X64E 1FWLA 3J81Q 1B63A 1NHHA 4USKA 2NPFA 1S4EA 2F4VE 3PYEA 1Z59A 3ZZUA 1Z5BA 1H73A 4HY1A 1IBLE 4GKJE 1N32E 4LF5E 1J5EI 4DUYE 1XMOI 2UUAI 3T1HE 5IT9C 4PU9A 2HHHE 2UU9I 4GKKE 3B8HA 1HNXE 1DARA 4X64I 2V8PA 3QT8A 2GS8A 3WU5A 2F4VI 1HNZE 1I94E 4GKJI 2UXBE 4HACB 4FN5A 2A2DA 4DUYI 1B62A 2X36A 4UT4A 2V34A 4X65E 4GKKI 4JI7E 4DR5I 1FI4A 4HYMA 2VQFE 1EA6A 1IBKE 4DR2I 2HKEA 1XHKA 1Z0TA 1ZM4A 5IWAI 1I94I 2HK3A 4DPXA 4LFCE 4X66I 4DR6I 3ZZTA 4OX9I 3B78A 4B3SE 4X65I 1Z0GA 4P7AA 4YY3E 4DV6I 2HFUA 4DV4E 4JI8E 2VQFI 4YHHE 4DPTA 4JI2I 2ZBKB 4DR7I 1HR0E 4LF7I 4NXNE 4LF8I 1MX0A 4DR3E 4I3HA 1Z5CA 2V2VA 4LFCI 4JYAE 3JAMC 3ZKDA 1ELOA 4XTJA 4DR4E 4YY3I 4B3TE 4DV1E 1NZ0A 1U2RA 3D4JA 4YHHI 4DPUA 1FKAE 4LF9E 4LFBE 1RR9A 1HNWE 5BR8E 1HR0I 1BKNA 2R3VA 4NXNI 4JV5I 4DV7E 4DR3I 4FWGA 1VISA 4Z7YA 3J81C 2X7IA 2ZM6I 4B3ME 4DV0E 4DR4I 4B3TI 3WU3A 4DV1I 2V2QA 1J5EE 3B82A 5BR8I 1FWKA 4UTGA 1PVGA 4JI0I 2DEIA 4DV7I 4PRXA 5GMEA 4ZVIA 4Z7CA 4X62E 4B3MI 4DV0I 3V5RA 1N36I 4JI4E 4R1FA 4LF6I 1KKHA 4DPYA 4NXMI 3CWVA 4JI1E 1WUUA 4B3RE 4DR5E 3M6AA 2UXCE 2DEJA 2OI2A 3ZZ0A 4X62I 4DR2E 2R42A 5IWAE 4JI4I 2EFGA 4X66E 4DR6E 1ZM2A 4OX9E 4JI1I 2HFSA 1XNRI 1H7UA 4B3RI 3HULA 4FWHA 2UXCI 1ZM9A 4DV6E 3QT6A 5FLXC 4JI2E 2HK2A 4DR7E 1ZM3A 1Z0CA 4JI6E 4LF7E 4LF8E 2UUBI 5GMDA 4DU7A 4URLA
chains in the Genus database with same CATH superfamily
1N0UA 2Z5BA 2C37A 4MU0A 5DRPA 4LCHA 2BA1D 1ZXMA 4RPFA 3WU6A 4FW6A 5FLXQ 4MU4A 4BA2B 4LFAE 4K0KE 2CVEA 2Q2EB 5LMUE 3GMEA 4DV2I 5DNLA 4JI6I 4JV5E 5C0XC 2BM1A 4AQYI 3PYGA 1Z0WA 1FJGI 1USVA 1QZRA 2ZM6E 3QT5A 4DV3I 4LFAI 1R6LA 2JEBA 3ZKBA 2PO0B 4K0KI 2C38B 1PKPA 2J65A 1Z0EA 1XXEA 5LMUI 5L3JA 4JI0E 2Z5BB 2C39A 1A6FA 3ZM7A 4P52A 2PNZA 2A2CA 3HJCA 3Q6MA 2IOQA 1UDSA 1KVKA 5C0XD 5DNXA 2NN6F 1UEKA 1N36E 3F0NA 1KTVA 1N33E 3P3EA 4LF6E 4ISAA 1NHJA 5LL6R 4NXME 4J3DA 2JE6A 2ZITA 1NHIA 2O3ZA 4DUZE 3J7AG 4WUCA 5DRRA 2PNLA 4LF4I 1Y6ZA 4OO1D 1PIEA 3M7NG 4ED4A 1XMQE 4IZKA 1N33I 3J7AM 3J80Q 4DR1E 1N34I 4USMA 1Y4UA 1XNRE 2PNZB 3OTOI 2LJPA 3M85G 3GONA 4N3OA 2VESA 4DV5E 3T1YI 4MYTA 4DUZI 2GO3A 4MU3A 1UDNA 1OJ4A 2VQEI 4EMDA 4IS9A 5LMNI 2UUBE 4DXLA 1XMQI 3U1KA 4FW3A 5JEAC 2WW4A 3PYFA 4DR1I 4MQYA 1Z0VA 1H7SA 5C0XE 1HK7A 2GQ0A 4DV5I 5C0XF 1RHYA 3LTOA 4JI5E 1E3HA 1FNMA 3Q6NA 2AJ4A 4AM3A 2BM0A 4DV2E 1IBLI 2BA0G 1N32I 4IZJA 4LF5I 4JG4A 1Y60A 3K1JA 2E1RA 4DPWA 5A2QC 5IT9Q 4DU8A 4U3DA 5C0XB 3LPSA 1YHCA 3T1HI 1Z5AA 4AQYE 2HHHI 1FJGE 1HNXI 1ZXNA 4OO1E 3NZKA 1RREA 4DV3E 4OO1F 4JI5I 3PRYA 5A2QQ 2Z5CB 4FW4A 1S16A 1HNZI 2UXBI 1OYPA 3GLLA 4FW5A 2O1VA 4KHPE 4IFDA 4OO1B 3H4LA 1D6TA 1H72C 4JI7I 1H74A 3V2UC 1EI1A 3P06A 4MYUA 1IBKI 3CDIA 1IBME 2HKJA 2Z5EA 1KIJA 3LNUA 4IZJB 4MU1A 1XNQE 2J7KA 2XEXA 4PRVA 5JEAA 2JT2A 2C37B 2NN6A 4KHPI 2VF3A 5K36C 4FW9A 1Z0BA 4B3SI 2UXDE 1UDOA 2UUCE 3Q1QA 3L7ZA 1MG7A 4LF4E 3M85D 2CZ9A 4DV4I 2PO1A 4JI8I 1IBMI 2BR2A 4HXZA 4JI3E 1XNQI 1N0VC 1N34E 2E5LE 2V2ZA 3GCMA 3J80C 3JAMQ 3OTOE 4FWDA 3WU4A 4AIDA 5JEAE 3T1YE 4JYAI 4WUDA 4M1KA 2UXDI 1MU5A 5DRQA 2UUCI 5EL9A 2VQEE 2JEBB 5LMNE 2O1UA 2JEAA 4LF9I 4LFBI 2BV3A 4KQVA 1E3PA 4WUBA 3QT7A 4AIMA 2CG9A 1XMOE 2UUAE 1HNWI 4JI3I 4HACA 3K17A 4IFDC 2E5LI 1UDQA 2BA0D 5JEAB 2UU9E 2C39B 3PS3A 2IERA 3PYDA 1K47A 4X64E 1FWLA 3J81Q 1B63A 1NHHA 4IZJD 4USKA 2NPFA 3L7ZB 1S4EA 2F4VE 3PYEA 1Z59A 1YH8A 2PO1B 3ZZUA 1Z5BA 1H73A 4HY1A 1IBLE 4GKJE 1N32E 4LF5E 2WNRA 2WP8A 1J5EI 4DUYE 1XMOI 2UUAI 2NN6C 2JE6B 3P3GA 3T1HE 3P76A 4LCFA 5IT9C 4PU9A 2HHHE 2UU9I 3KRNA 4U3BA 4GKKE 3B8HA 4X64I 1DARA 1HNXE 2V8PA 4GQUA 5K36A 4BA2A 3QT8A 3B4TA 1USUA 2GS8A 1R6MA 3WU5A 2F4VI 1VI7A 2PO2A 1I94E 4IZKB 1HNZE 4GKJI 2UXBE 4HACB 4FN5A 2A2DA 2CGEA 4DUYI 4QNJA 1B62A 2X36A 4UT4A 2V34A 4X65E 4GKKI 4JI7E 4DR5I 1FI4A 4HYMA 4LCGA 2VQFE 1P42A 1EA6A 4NBQA 1IBKE 5JEAD 5K36E 4DR2I 2HKEA 1XHKA 2PO0A 1Z0TA 1ZM4A 5IWAI 3P3CA 1I94I 2HK3A 4DPXA 4LFCE 4X66I 4DR6I 3ZZTA 4OX9I 3B78A 4B3SE 4X65I 5K36B 1Z0GA 4OZEA 4P7AA 4YY3E 4DV6I 2HFUA 5FWKA 4DV4E 4JI8E 3U1YA 2VQFI 4YHHE 4DPTA 4JI2I 2ZBKB 3HKMA 2PO2B 4DR7I 1HR0E 4LF7I 4NXNE 4LF8I 3K85A 1MX0A 4DR3E 3M7ND 4I3HA 1Z5CA 2V2VA 4LFCI 3H1CA 2IOPA 2AE8A 4LPFA 4JYAE 1Y4SA 3JAMC 2IESA 3ZKDA 4IFDE 1ELOA 4XTJA 4DR4E 4YY3I 5EKWA 4B3TE 4IFDF 4DV1E 1NZ0A 1U2RA 3D4JA 4YHHI 4DPUA 1FKAE 4LF9E 4LFBE 1RR9A 1HNWE 5BR8E 1HR0I 1BKNA 2R3VA 4NXNI 4JV5I 2BA1G 5ELWA 4DV7E 4OO1C 4DR3I 4IFDB 4FWGA 1VISA 4Z7YA 2NN6E 3J81C 2X7IA 2O1TA 2ZM6I 4B3ME 5JEAF 4DV0E 4DR4I 4B3TI 3WU3A 4DV1I 2V2QA 1OYSA 1J5EE 4BA1A 5K36D 3B82A 5BR8I 1FWKA 4UTGA 1PVGA 4JI0I 2DEIA 2NN6B 4DV7I 4PRXA 5GMEA 1Y5YA 2F1DA 4ZVIA 4Z7CA 4LOMA 2GO4A 4X62E 4B3MI 4DV0I 3CDJA 3V5RA 2BR2B 2O1WA 1N36I 4JI4E 4R1FA 4LF6I 1KKHA 4DPYA 5C0XA 4NXMI 3CWVA 4JI1E 1WUUA 5DROA 4B3RE 4DR5E 3M6AA 2UXCE 2PNMA 2DEJA 3UHMA 2OI2A 3ZZ0A 4X62I 4DR2E 2R42A 4IFDD 4OKGA 5IWAE 2JEAB 4MDTA 2Z5CA 4BA1B 4JI4I 2EFGA 4X66E 4DR6E 3PS1A 1ZM2A 4QNKA 4OX9E 4JI1I 4OO1A 2HFSA 1XNRI 1H7UA 4B3RI 3HULA 3DD6A 4FWHA 2UXCI 1ZM9A 4DV6E 3QT6A 5FLXC 3PS2A 1OYRA 4JI2E 2HK2A 2NN6D 4FW7A 4DR7E 1ZM3A 1Z0CA 4JI6E 2C38A 4LF7E 2WNRB 4LF8E 2WP8B 5K36F 2UUBI 5GMDA 4DU7A 4URLA
chains in the Genus database with same CATH topology
1N0UA 2Z5BA 1ZXMA 4RPFA 3WU6A 5FLXQ 4LFAE 4K0KE 2Q2EB 5LMUE 4DV2I 4JI6I 4JV5E 2BM1A 4AQYI 3PYGA 1Z0WA 1FJGI 1USVA 1QZRA 2ZM6E 3QT5A 4DV3I 4LFAI 3ZKBA 4K0KI 1PKPA 1Z0EA 5LMUI 5L3JA 4JI0E 2Z5BB 1A6FA 3ZM7A 4P52A 2A2CA 3HJCA 3Q6MA 2IOQA 1KVKA 1UEKA 1N36E 3F0NA 1KTVA 1N33E 4LF6E 1NHJA 5LL6R 4NXME 2ZITA 1NHIA 4DUZE 3J7AG 4WUCA 4LF4I 2PNLA 1Y6ZA 1PIEA 4ED4A 1XMQE 4IZKA 1N33I 3J7AM 3J80Q 4DR1E 1N34I 4USMA 1Y4UA 1XNRE 3OTOI 2LJPA 3GONA 4N3OA 4DV5E 3T1YI 4MYTA 4DUZI 1OJ4A 2VQEI 4EMDA 5LMNI 2UUBE 4DXLA 1XMQI 2WW4A 3PYFA 4DR1I 1Z0VA 1H7SA 1HK7A 2GQ0A 4DV5I 3LTOA 4JI5E 1FNMA 3Q6NA 2AJ4A 2BM0A 4DV2E 1IBLI 1N32I 4IZJA 4LF5I 4JG4A 3K1JA 2E1RA 4DPWA 5A2QC 5IT9Q 4DU8A 3LPSA 3T1HI 1Z5AA 4AQYE 2HHHI 1FJGE 1HNXI 1ZXNA 1RREA 4DV3E 4JI5I 3PRYA 5A2QQ 2Z5CB 1S16A 1HNZI 2UXBI 2O1VA 4KHPE 3H4LA 1D6TA 1H72C 4JI7I 1H74A 3V2UC 1EI1A 3P06A 4MYUA 1IBKI 1IBME 2HKJA 2Z5EA 1KIJA 3LNUA 4IZJB 1XNQE 2J7KA 2XEXA 4PRVA 4KHPI 2VF3A 4FW9A 1Z0BA 4B3SI 2UXDE 2UUCE 3Q1QA 1MG7A 4LF4E 2CZ9A 4DV4I 4JI8I 1IBMI 4HXZA 4JI3E 1XNQI 1N0VC 1N34E 2E5LE 2V2ZA 3J80C 3JAMQ 3OTOE 4FWDA 3WU4A 3T1YE 4JYAI 4WUDA 4M1KA 2UXDI 1MU5A 2UUCI 2VQEE 5LMNE 2O1UA 4LF9I 4LFBI 2BV3A 4KQVA 4WUBA 3QT7A 2CG9A 1XMOE 2UUAE 1HNWI 4JI3I 4HACA 3K17A 2E5LI 2UU9E 3PYDA 1K47A 4X64E 1FWLA 3J81Q 1B63A 1NHHA 4IZJD 4USKA 2NPFA 1S4EA 2F4VE 3PYEA 1Z59A 3ZZUA 1Z5BA 1H73A 4HY1A 1IBLE 4GKJE 1N32E 4LF5E 1J5EI 4DUYE 1XMOI 2UUAI 3T1HE 5IT9C 4PU9A 2HHHE 2UU9I 4GKKE 3B8HA 4X64I 1DARA 1HNXE 2V8PA 3QT8A 1USUA 2GS8A 3WU5A 2F4VI 1HNZE 1I94E 4IZKB 4GKJI 2UXBE 4HACB 4FN5A 2A2DA 2CGEA 4DUYI 1B62A 2X36A 4UT4A 2V34A 4X65E 4GKKI 4JI7E 4DR5I 1FI4A 4HYMA 2VQFE 1EA6A 1IBKE 4DR2I 2HKEA 1XHKA 1Z0TA 1ZM4A 5IWAI 1I94I 2HK3A 4DPXA 4LFCE 4X66I 4DR6I 3ZZTA 4OX9I 3B78A 4B3SE 4X65I 1Z0GA 4P7AA 4YY3E 4DV6I 2HFUA 5FWKA 4DV4E 4JI8E 2VQFI 4YHHE 4DPTA 4JI2I 2ZBKB 4DR7I 1HR0E 4LF7I 4NXNE 4LF8I 3K85A 1MX0A 4DR3E 4I3HA 1Z5CA 2V2VA 4LFCI 2IOPA 4JYAE 1Y4SA 3JAMC 3ZKDA 1ELOA 4XTJA 4DR4E 4YY3I 4B3TE 4DV1E 1NZ0A 1U2RA 3D4JA 4YHHI 4DPUA 1FKAE 4LF9E 4LFBE 1RR9A 1HNWE 5BR8E 1HR0I 1BKNA 2R3VA 4NXNI 4JV5I 4DV7E 4DR3I 4FWGA 1VISA 4Z7YA 3J81C 2X7IA 2O1TA 2ZM6I 4B3ME 4DV0E 4DR4I 4B3TI 3WU3A 4DV1I 2V2QA 1J5EE 3B82A 5BR8I 1FWKA 4UTGA 1PVGA 4JI0I 2DEIA 4DV7I 4PRXA 5GMEA 4ZVIA 4Z7CA 4X62E 4B3MI 4DV0I 3V5RA 2O1WA 1N36I 4JI4E 4R1FA 4LF6I 1KKHA 4DPYA 4NXMI 3CWVA 4JI1E 1WUUA 4B3RE 4DR5E 3M6AA 2UXCE 2PNMA 2DEJA 2OI2A 3ZZ0A 4X62I 4DR2E 2R42A 5IWAE 2Z5CA 4JI4I 2EFGA 4X66E 4DR6E 1ZM2A 4OX9E 4JI1I 2HFSA 1XNRI 1H7UA 4B3RI 3HULA 4FWHA 2UXCI 1ZM9A 4DV6E 3QT6A 5FLXC 4JI2E 2HK2A 4DR7E 1ZM3A 1Z0CA 4JI6E 4LF7E 4LF8E 2UUBI 5GMDA 4DU7A 4URLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0U A;  1ZXM A;  4RPF A;  3WU6 A;  5FLX Q;  4LFA E;  4K0K E;  2Q2E B;  5LMU E;  4DV2 I;  4JI6 I;  4JV5 E;  2BM1 A;  4AQY I;  3PYG A;  1Z0W A;  1FJG I;  1QZR A;  2ZM6 E;  3QT5 A;  4DV3 I;  4LFA I;  3ZKB A;  4K0K I;  1PKP A;  1Z0E A;  5LMU I;  5L3J A;  4JI0 E;  1A6F A;  3ZM7 A;  4P52 A;  2A2C A;  1KVK A;  1UEK A;  1N36 E;  3F0N A;  1KTV A;  1N33 E;  4LF6 E;  1NHJ A;  5LL6 R;  4NXM E;  2ZIT A;  1NHI A;  4DUZ E;  3J7A G;  4WUC A;  4LF4 I;  1PIE A;  4ED4 A;  1XMQ E;  1N33 I;  3J7A M;  3J80 Q;  4DR1 E;  1N34 I;  4USM A;  1XNR E;  3OTO I;  2LJP A;  3GON A;  4DV5 E;  3T1Y I;  4MYT A;  4DUZ I;  1OJ4 A;  2VQE I;  4EMD A;  5LMN I;  2UUB E;  4DXL A;  1XMQ I;  2WW4 A;  3PYF A;  4DR1 I;  1Z0V A;  1H7S A;  4DV5 I;  3LTO A;  4JI5 E;  1FNM A;  2AJ4 A;  2BM0 A;  4DV2 E;  1IBL I;  1N32 I;  4LF5 I;  4JG4 A;  3K1J A;  2E1R A;  4DPW A;  5A2Q C;  5IT9 Q;  4DU8 A;  3LPS A;  3T1H I;  1Z5A A;  4AQY E;  2HHH I;  1FJG E;  1HNX I;  1ZXN A;  1RRE A;  4DV3 E;  4JI5 I;  5A2Q Q;  1S16 A;  1HNZ I;  2UXB I;  4KHP E;  3H4L A;  1D6T A;  1H72 C;  4JI7 I;  1H74 A;  3V2U C;  1EI1 A;  4MYU A;  1IBK I;  1IBM E;  2HKJ A;  1KIJ A;  3LNU A;  1XNQ E;  2J7K A;  2XEX A;  4PRV A;  4KHP I;  2VF3 A;  4FW9 A;  1Z0B A;  4B3S I;  2UXD E;  2UUC E;  3Q1Q A;  1MG7 A;  4LF4 E;  2CZ9 A;  4DV4 I;  4JI8 I;  1IBM I;  4HXZ A;  4JI3 E;  1XNQ I;  1N0V C;  1N34 E;  2E5L E;  2V2Z A;  3J80 C;  3JAM Q;  3OTO E;  4FWD A;  3WU4 A;  3T1Y E;  4JYA I;  4WUD A;  4M1K A;  2UXD I;  1MU5 A;  2UUC I;  2VQE E;  5LMN E;  4LF9 I;  4LFB I;  2BV3 A;  4KQV A;  4WUB A;  3QT7 A;  1XMO E;  2UUA E;  1HNW I;  4JI3 I;  4HAC A;  3K17 A;  2E5L I;  2UU9 E;  3PYD A;  1K47 A;  4X64 E;  1FWL A;  3J81 Q;  1B63 A;  1NHH A;  4USK A;  2NPF A;  1S4E A;  2F4V E;  3PYE A;  1Z59 A;  3ZZU A;  1Z5B A;  1H73 A;  4HY1 A;  1IBL E;  4GKJ E;  1N32 E;  4LF5 E;  1J5E I;  4DUY E;  1XMO I;  2UUA I;  3T1H E;  5IT9 C;  4PU9 A;  2HHH E;  2UU9 I;  4GKK E;  3B8H A;  1HNX E;  1DAR A;  4X64 I;  2V8P A;  3QT8 A;  2GS8 A;  3WU5 A;  2F4V I;  1HNZ E;  1I94 E;  4GKJ I;  2UXB E;  4HAC B;  4FN5 A;  2A2D A;  4DUY I;  1B62 A;  2X36 A;  4UT4 A;  2V34 A;  4X65 E;  4GKK I;  4JI7 E;  4DR5 I;  1FI4 A;  4HYM A;  2VQF E;  1EA6 A;  1IBK E;  4DR2 I;  2HKE A;  1XHK A;  1Z0T A;  1ZM4 A;  5IWA I;  1I94 I;  2HK3 A;  4DPX A;  4LFC E;  4X66 I;  4DR6 I;  3ZZT A;  4OX9 I;  3B78 A;  4B3S E;  4X65 I;  1Z0G A;  4P7A A;  4YY3 E;  4DV6 I;  2HFU A;  4DV4 E;  4JI8 E;  2VQF I;  4YHH E;  4DPT A;  4JI2 I;  2ZBK B;  4DR7 I;  1HR0 E;  4LF7 I;  4NXN E;  4LF8 I;  1MX0 A;  4DR3 E;  4I3H A;  1Z5C A;  2V2V A;  4LFC I;  4JYA E;  3JAM C;  3ZKD A;  1ELO A;  4XTJ A;  4DR4 E;  4YY3 I;  4B3T E;  4DV1 E;  1NZ0 A;  1U2R A;  3D4J A;  4YHH I;  4DPU A;  1FKA E;  4LF9 E;  4LFB E;  1RR9 A;  1HNW E;  5BR8 E;  1HR0 I;  1BKN A;  2R3V A;  4NXN I;  4JV5 I;  4DV7 E;  4DR3 I;  4FWG A;  1VIS A;  4Z7Y A;  3J81 C;  2X7I A;  2ZM6 I;  4B3M E;  4DV0 E;  4DR4 I;  4B3T I;  3WU3 A;  4DV1 I;  2V2Q A;  1J5E E;  3B82 A;  5BR8 I;  1FWK A;  4UTG A;  1PVG A;  4JI0 I;  2DEI A;  4DV7 I;  4PRX A;  5GME A;  4ZVI A;  4Z7C A;  4X62 E;  4B3M I;  4DV0 I;  3V5R A;  1N36 I;  4JI4 E;  4R1F A;  4LF6 I;  1KKH A;  4DPY A;  4NXM I;  3CWV A;  4JI1 E;  1WUU A;  4B3R E;  4DR5 E;  3M6A A;  2UXC E;  2DEJ A;  2OI2 A;  3ZZ0 A;  4X62 I;  4DR2 E;  2R42 A;  5IWA E;  4JI4 I;  2EFG A;  4X66 E;  4DR6 E;  1ZM2 A;  4OX9 E;  4JI1 I;  2HFS A;  1XNR I;  1H7U A;  4B3R I;  3HUL A;  4FWH A;  2UXC I;  1ZM9 A;  4DV6 E;  3QT6 A;  5FLX C;  4JI2 E;  2HK2 A;  4DR7 E;  1ZM3 A;  1Z0C A;  4JI6 E;  4LF7 E;  4LF8 E;  2UUB I;  5GMD A;  4DU7 A;  4URL A; 
#chains in the Genus database with same CATH topology
 1N0U A;  2Z5B A;  2C37 A;  4MU0 A;  5DRP A;  4LCH A;  2BA1 D;  1ZXM A;  4RPF A;  3WU6 A;  4FW6 A;  5FLX Q;  4MU4 A;  4BA2 B;  4LFA E;  4K0K E;  2CVE A;  2Q2E B;  5LMU E;  3GME A;  4DV2 I;  5DNL A;  4JI6 I;  4JV5 E;  5C0X C;  2BM1 A;  4AQY I;  3PYG A;  1Z0W A;  1FJG I;  1USV A;  1QZR A;  2ZM6 E;  3QT5 A;  4DV3 I;  4LFA I;  1R6L A;  2JEB A;  3ZKB A;  2PO0 B;  4K0K I;  2C38 B;  1PKP A;  2J65 A;  1Z0E A;  1XXE A;  5LMU I;  5L3J A;  4JI0 E;  2Z5B B;  2C39 A;  1A6F A;  3ZM7 A;  4P52 A;  2PNZ A;  2A2C A;  3HJC A;  3Q6M A;  2IOQ A;  1UDS A;  1KVK A;  5C0X D;  5DNX A;  2NN6 F;  1UEK A;  1N36 E;  3F0N A;  1KTV A;  1N33 E;  3P3E A;  4LF6 E;  4ISA A;  1NHJ A;  5LL6 R;  4NXM E;  4J3D A;  2JE6 A;  2ZIT A;  1NHI A;  2O3Z A;  4DUZ E;  3J7A G;  4WUC A;  5DRR A;  2PNL A;  4LF4 I;  1Y6Z A;  4OO1 D;  1PIE A;  3M7N G;  4ED4 A;  1XMQ E;  4IZK A;  1N33 I;  3J7A M;  3J80 Q;  4DR1 E;  1N34 I;  4USM A;  1Y4U A;  1XNR E;  2PNZ B;  3OTO I;  2LJP A;  3M85 G;  3GON A;  4N3O A;  2VES A;  4DV5 E;  3T1Y I;  4MYT A;  4DUZ I;  2GO3 A;  4MU3 A;  1UDN A;  1OJ4 A;  2VQE I;  4EMD A;  4IS9 A;  5LMN I;  2UUB E;  4DXL A;  1XMQ I;  3U1K A;  4FW3 A;  5JEA C;  2WW4 A;  3PYF A;  4DR1 I;  4MQY A;  1Z0V A;  1H7S A;  5C0X E;  1HK7 A;  2GQ0 A;  4DV5 I;  5C0X F;  1RHY A;  3LTO A;  4JI5 E;  1E3H A;  1FNM A;  3Q6N A;  2AJ4 A;  4AM3 A;  2BM0 A;  4DV2 E;  1IBL I;  2BA0 G;  1N32 I;  4IZJ A;  4LF5 I;  4JG4 A;  1Y60 A;  3K1J A;  2E1R A;  4DPW A;  5A2Q C;  5IT9 Q;  4DU8 A;  4U3D A;  5C0X B;  3LPS A;  1YHC A;  3T1H I;  1Z5A A;  4AQY E;  2HHH I;  1FJG E;  1HNX I;  1ZXN A;  4OO1 E;  3NZK A;  1RRE A;  4DV3 E;  4OO1 F;  4JI5 I;  3PRY A;  5A2Q Q;  2Z5C B;  4FW4 A;  1S16 A;  1HNZ I;  2UXB I;  1OYP A;  3GLL A;  4FW5 A;  2O1V A;  4KHP E;  4IFD A;  4OO1 B;  3H4L A;  1D6T A;  1H72 C;  4JI7 I;  1H74 A;  3V2U C;  1EI1 A;  3P06 A;  4MYU A;  1IBK I;  3CDI A;  1IBM E;  2HKJ A;  2Z5E A;  1KIJ A;  3LNU A;  4IZJ B;  4MU1 A;  1XNQ E;  2J7K A;  2XEX A;  4PRV A;  5JEA A;  2JT2 A;  2C37 B;  2NN6 A;  4KHP I;  2VF3 A;  5K36 C;  4FW9 A;  1Z0B A;  4B3S I;  2UXD E;  1UDO A;  2UUC E;  3Q1Q A;  3L7Z A;  1MG7 A;  4LF4 E;  3M85 D;  2CZ9 A;  4DV4 I;  2PO1 A;  4JI8 I;  1IBM I;  2BR2 A;  4HXZ A;  4JI3 E;  1XNQ I;  1N0V C;  1N34 E;  2E5L E;  2V2Z A;  3GCM A;  3J80 C;  3JAM Q;  3OTO E;  4FWD A;  3WU4 A;  4AID A;  5JEA E;  3T1Y E;  4JYA I;  4WUD A;  4M1K A;  2UXD I;  1MU5 A;  5DRQ A;  2UUC I;  5EL9 A;  2VQE E;  2JEB B;  5LMN E;  2O1U A;  2JEA A;  4LF9 I;  4LFB I;  2BV3 A;  4KQV A;  1E3P A;  4WUB A;  3QT7 A;  4AIM A;  2CG9 A;  1XMO E;  2UUA E;  1HNW I;  4JI3 I;  4HAC A;  3K17 A;  4IFD C;  2E5L I;  1UDQ A;  2BA0 D;  5JEA B;  2UU9 E;  2C39 B;  3PS3 A;  2IER A;  3PYD A;  1K47 A;  4X64 E;  1FWL A;  3J81 Q;  1B63 A;  1NHH A;  4IZJ D;  4USK A;  2NPF A;  3L7Z B;  1S4E A;  2F4V E;  3PYE A;  1Z59 A;  1YH8 A;  2PO1 B;  3ZZU A;  1Z5B A;  1H73 A;  4HY1 A;  1IBL E;  4GKJ E;  1N32 E;  4LF5 E;  2WNR A;  2WP8 A;  1J5E I;  4DUY E;  1XMO I;  2UUA I;  2NN6 C;  2JE6 B;  3P3G A;  3T1H E;  3P76 A;  4LCF A;  5IT9 C;  4PU9 A;  2HHH E;  2UU9 I;  3KRN A;  4U3B A;  4GKK E;  3B8H A;  4X64 I;  1DAR A;  1HNX E;  2V8P A;  4GQU A;  5K36 A;  4BA2 A;  3QT8 A;  3B4T A;  1USU A;  2GS8 A;  1R6M A;  3WU5 A;  2F4V I;  1VI7 A;  2PO2 A;  1I94 E;  4IZK B;  1HNZ E;  4GKJ I;  2UXB E;  4HAC B;  4FN5 A;  2A2D A;  2CGE A;  4DUY I;  4QNJ A;  1B62 A;  2X36 A;  4UT4 A;  2V34 A;  4X65 E;  4GKK I;  4JI7 E;  4DR5 I;  1FI4 A;  4HYM A;  4LCG A;  2VQF E;  1P42 A;  1EA6 A;  4NBQ A;  1IBK E;  5JEA D;  5K36 E;  4DR2 I;  2HKE A;  1XHK A;  2PO0 A;  1Z0T A;  1ZM4 A;  5IWA I;  3P3C A;  1I94 I;  2HK3 A;  4DPX A;  4LFC E;  4X66 I;  4DR6 I;  3ZZT A;  4OX9 I;  3B78 A;  4B3S E;  4X65 I;  5K36 B;  1Z0G A;  4OZE A;  4P7A A;  4YY3 E;  4DV6 I;  2HFU A;  5FWK A;  4DV4 E;  4JI8 E;  3U1Y A;  2VQF I;  4YHH E;  4DPT A;  4JI2 I;  2ZBK B;  3HKM A;  2PO2 B;  4DR7 I;  1HR0 E;  4LF7 I;  4NXN E;  4LF8 I;  3K85 A;  1MX0 A;  4DR3 E;  3M7N D;  4I3H A;  1Z5C A;  2V2V A;  4LFC I;  3H1C A;  2IOP A;  2AE8 A;  4LPF A;  4JYA E;  1Y4S A;  3JAM C;  2IES A;  3ZKD A;  4IFD E;  1ELO A;  4XTJ A;  4DR4 E;  4YY3 I;  5EKW A;  4B3T E;  4IFD F;  4DV1 E;  1NZ0 A;  1U2R A;  3D4J A;  4YHH I;  4DPU A;  1FKA E;  4LF9 E;  4LFB E;  1RR9 A;  1HNW E;  5BR8 E;  1HR0 I;  1BKN A;  2R3V A;  4NXN I;  4JV5 I;  2BA1 G;  5ELW A;  4DV7 E;  4OO1 C;  4DR3 I;  4IFD B;  4FWG A;  1VIS A;  4Z7Y A;  2NN6 E;  3J81 C;  2X7I A;  2O1T A;  2ZM6 I;  4B3M E;  5JEA F;  4DV0 E;  4DR4 I;  4B3T I;  3WU3 A;  4DV1 I;  2V2Q A;  1OYS A;  1J5E E;  4BA1 A;  5K36 D;  3B82 A;  5BR8 I;  1FWK A;  4UTG A;  1PVG A;  4JI0 I;  2DEI A;  2NN6 B;  4DV7 I;  4PRX A;  5GME A;  1Y5Y A;  2F1D A;  4ZVI A;  4Z7C A;  4LOM A;  2GO4 A;  4X62 E;  4B3M I;  4DV0 I;  3CDJ A;  3V5R A;  2BR2 B;  2O1W A;  1N36 I;  4JI4 E;  4R1F A;  4LF6 I;  1KKH A;  4DPY A;  5C0X A;  4NXM I;  3CWV A;  4JI1 E;  1WUU A;  5DRO A;  4B3R E;  4DR5 E;  3M6A A;  2UXC E;  2PNM A;  2DEJ A;  3UHM A;  2OI2 A;  3ZZ0 A;  4X62 I;  4DR2 E;  2R42 A;  4IFD D;  4OKG A;  5IWA E;  2JEA B;  4MDT A;  2Z5C A;  4BA1 B;  4JI4 I;  2EFG A;  4X66 E;  4DR6 E;  3PS1 A;  1ZM2 A;  4QNK A;  4OX9 E;  4JI1 I;  4OO1 A;  2HFS A;  1XNR I;  1H7U A;  4B3R I;  3HUL A;  3DD6 A;  4FWH A;  2UXC I;  1ZM9 A;  4DV6 E;  3QT6 A;  5FLX C;  3PS2 A;  1OYR A;  4JI2 E;  2HK2 A;  2NN6 D;  4FW7 A;  4DR7 E;  1ZM3 A;  1Z0C A;  4JI6 E;  2C38 A;  4LF7 E;  2WNR B;  4LF8 E;  2WP8 B;  5K36 F;  2UUB I;  5GMD A;  4DU7 A;  4URL A; 
#chains in the Genus database with same CATH homology
 1N0U A;  2Z5B A;  1ZXM A;  4RPF A;  3WU6 A;  5FLX Q;  4LFA E;  4K0K E;  2Q2E B;  5LMU E;  4DV2 I;  4JI6 I;  4JV5 E;  2BM1 A;  4AQY I;  3PYG A;  1Z0W A;  1FJG I;  1USV A;  1QZR A;  2ZM6 E;  3QT5 A;  4DV3 I;  4LFA I;  3ZKB A;  4K0K I;  1PKP A;  1Z0E A;  5LMU I;  5L3J A;  4JI0 E;  2Z5B B;  1A6F A;  3ZM7 A;  4P52 A;  2A2C A;  3HJC A;  3Q6M A;  2IOQ A;  1KVK A;  1UEK A;  1N36 E;  3F0N A;  1KTV A;  1N33 E;  4LF6 E;  1NHJ A;  5LL6 R;  4NXM E;  2ZIT A;  1NHI A;  4DUZ E;  3J7A G;  4WUC A;  4LF4 I;  2PNL A;  1Y6Z A;  1PIE A;  4ED4 A;  1XMQ E;  4IZK A;  1N33 I;  3J7A M;  3J80 Q;  4DR1 E;  1N34 I;  4USM A;  1Y4U A;  1XNR E;  3OTO I;  2LJP A;  3GON A;  4N3O A;  4DV5 E;  3T1Y I;  4MYT A;  4DUZ I;  1OJ4 A;  2VQE I;  4EMD A;  5LMN I;  2UUB E;  4DXL A;  1XMQ I;  2WW4 A;  3PYF A;  4DR1 I;  1Z0V A;  1H7S A;  1HK7 A;  2GQ0 A;  4DV5 I;  3LTO A;  4JI5 E;  1FNM A;  3Q6N A;  2AJ4 A;  2BM0 A;  4DV2 E;  1IBL I;  1N32 I;  4IZJ A;  4LF5 I;  4JG4 A;  3K1J A;  2E1R A;  4DPW A;  5A2Q C;  5IT9 Q;  4DU8 A;  3LPS A;  3T1H I;  1Z5A A;  4AQY E;  2HHH I;  1FJG E;  1HNX I;  1ZXN A;  1RRE A;  4DV3 E;  4JI5 I;  3PRY A;  5A2Q Q;  2Z5C B;  1S16 A;  1HNZ I;  2UXB I;  2O1V A;  4KHP E;  3H4L A;  1D6T A;  1H72 C;  4JI7 I;  1H74 A;  3V2U C;  1EI1 A;  3P06 A;  4MYU A;  1IBK I;  1IBM E;  2HKJ A;  2Z5E A;  1KIJ A;  3LNU A;  4IZJ B;  1XNQ E;  2J7K A;  2XEX A;  4PRV A;  4KHP I;  2VF3 A;  4FW9 A;  1Z0B A;  4B3S I;  2UXD E;  2UUC E;  3Q1Q A;  1MG7 A;  4LF4 E;  2CZ9 A;  4DV4 I;  4JI8 I;  1IBM I;  4HXZ A;  4JI3 E;  1XNQ I;  1N0V C;  1N34 E;  2E5L E;  2V2Z A;  3J80 C;  3JAM Q;  3OTO E;  4FWD A;  3WU4 A;  3T1Y E;  4JYA I;  4WUD A;  4M1K A;  2UXD I;  1MU5 A;  2UUC I;  2VQE E;  5LMN E;  2O1U A;  4LF9 I;  4LFB I;  2BV3 A;  4KQV A;  4WUB A;  3QT7 A;  2CG9 A;  1XMO E;  2UUA E;  1HNW I;  4JI3 I;  4HAC A;  3K17 A;  2E5L I;  2UU9 E;  3PYD A;  1K47 A;  4X64 E;  1FWL A;  3J81 Q;  1B63 A;  1NHH A;  4IZJ D;  4USK A;  2NPF A;  1S4E A;  2F4V E;  3PYE A;  1Z59 A;  3ZZU A;  1Z5B A;  1H73 A;  4HY1 A;  1IBL E;  4GKJ E;  1N32 E;  4LF5 E;  1J5E I;  4DUY E;  1XMO I;  2UUA I;  3T1H E;  5IT9 C;  4PU9 A;  2HHH E;  2UU9 I;  4GKK E;  3B8H A;  4X64 I;  1DAR A;  1HNX E;  2V8P A;  3QT8 A;  1USU A;  2GS8 A;  3WU5 A;  2F4V I;  1HNZ E;  1I94 E;  4IZK B;  4GKJ I;  2UXB E;  4HAC B;  4FN5 A;  2A2D A;  2CGE A;  4DUY I;  1B62 A;  2X36 A;  4UT4 A;  2V34 A;  4X65 E;  4GKK I;  4JI7 E;  4DR5 I;  1FI4 A;  4HYM A;  2VQF E;  1EA6 A;  1IBK E;  4DR2 I;  2HKE A;  1XHK A;  1Z0T A;  1ZM4 A;  5IWA I;  1I94 I;  2HK3 A;  4DPX A;  4LFC E;  4X66 I;  4DR6 I;  3ZZT A;  4OX9 I;  3B78 A;  4B3S E;  4X65 I;  1Z0G A;  4P7A A;  4YY3 E;  4DV6 I;  2HFU A;  5FWK A;  4DV4 E;  4JI8 E;  2VQF I;  4YHH E;  4DPT A;  4JI2 I;  2ZBK B;  4DR7 I;  1HR0 E;  4LF7 I;  4NXN E;  4LF8 I;  3K85 A;  1MX0 A;  4DR3 E;  4I3H A;  1Z5C A;  2V2V A;  4LFC I;  2IOP A;  4JYA E;  1Y4S A;  3JAM C;  3ZKD A;  1ELO A;  4XTJ A;  4DR4 E;  4YY3 I;  4B3T E;  4DV1 E;  1NZ0 A;  1U2R A;  3D4J A;  4YHH I;  4DPU A;  1FKA E;  4LF9 E;  4LFB E;  1RR9 A;  1HNW E;  5BR8 E;  1HR0 I;  1BKN A;  2R3V A;  4NXN I;  4JV5 I;  4DV7 E;  4DR3 I;  4FWG A;  1VIS A;  4Z7Y A;  3J81 C;  2X7I A;  2O1T A;  2ZM6 I;  4B3M E;  4DV0 E;  4DR4 I;  4B3T I;  3WU3 A;  4DV1 I;  2V2Q A;  1J5E E;  3B82 A;  5BR8 I;  1FWK A;  4UTG A;  1PVG A;  4JI0 I;  2DEI A;  4DV7 I;  4PRX A;  5GME A;  4ZVI A;  4Z7C A;  4X62 E;  4B3M I;  4DV0 I;  3V5R A;  2O1W A;  1N36 I;  4JI4 E;  4R1F A;  4LF6 I;  1KKH A;  4DPY A;  4NXM I;  3CWV A;  4JI1 E;  1WUU A;  4B3R E;  4DR5 E;  3M6A A;  2UXC E;  2PNM A;  2DEJ A;  2OI2 A;  3ZZ0 A;  4X62 I;  4DR2 E;  2R42 A;  5IWA E;  2Z5C A;  4JI4 I;  2EFG A;  4X66 E;  4DR6 E;  1ZM2 A;  4OX9 E;  4JI1 I;  2HFS A;  1XNR I;  1H7U A;  4B3R I;  3HUL A;  4FWH A;  2UXC I;  1ZM9 A;  4DV6 E;  3QT6 A;  5FLX C;  4JI2 E;  2HK2 A;  4DR7 E;  1ZM3 A;  1Z0C A;  4JI6 E;  4LF7 E;  4LF8 E;  2UUB I;  5GMD A;  4DU7 A;  4URL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...