4LF8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8I00
4LF4E 2EFGA 4DPUA 4JI2E 4LF8E 1WUUA 4LF5E 1PKPA 2BV3A 4B3SE 2HHHE 1N32I 4JI3I 1Z0TA 2ZITA 3B78A 2E1RA 1PIEA 2UU9I 4DV4E 4PU9A 3B8HA 4GKKI 1Z0EA 4JI0I 5FLXQ 5LMUE 3LPSA 4HY1A 1NHJA 4DV1E 4JI8E 3QT6A 1HNZI 4DUZE 1N0VC 4NXMI 4DU7A 4B3ME 4B3TE 4DV7I 1KIJA 4DPXA 2E5LE 4JI5I 4B3RE 5LMNI 4PRVA 2A2CA 4JI3E 1XNRI 4B3SI 4KQVA 4UTGA 2F4VI 1ZXNA 5BR8E 3HULA 5IWAI 1FWKA 1ZM4A 4EMDA 4GKKE 1EI1A 3D4JA 1N34I 3OTOI 2AJ4A 2VQFI 4LF5I 4XTJA 4DV3I 5IT9C 1I94E 4X64E 1XMQI 3GONA 4AQYE 2V8PA 4DR2E 4LF9E 4DUZI 1Z5BA 4WUCA 3PYDA 1FJGE 4OX9I 4DR7I 4B3RI 4JI1I 4FN5A 2UXDI 1Z0WA 5IT9Q 4FWGA 4DR1E 1H7SA 3JAMQ 4DV5I 4DV0I 4JI6I 1D6TA 4DU8A 4JI7I 4JYAI 4HACB 3ZZ0A 3B82A 3H4LA 4LF7I 4HACA 1EA6A 1NHIA 1UEKA 4LFBE 4X62I 2GS8A 1ZXMA 4X64I 1H73A 4WUBA 4YHHE 3WU6A 1XMQE 1I94I 2VQEI 3T1YI 1Z5CA 3V5RA 4YY3I 4DR6E 1IBKE 2ZM6I 1K47A 4LF6I 4DR7E 2V2VA 1N32E 1FKAE 1HR0I 2BM0A 2X36A 1HNXI 1H74A 4DV0E 2R3VA 2HKEA 4USMA 2HFUA 2J7KA 5A2QQ 4JYAE 4NXNI 2UXCE 1KTVA 3ZM7A 3K17A 1DARA 1IBLE 3J81C 2HFSA 4DUYI 4GKJE 4X62E 4JV5E 4RPFA 1RR9A 1ZM3A 1HNZE 4DR5I 4LF8I 2UUCI 4DXLA 5GMDA 1MX0A 4URLA 1H72C 2Q2EB 4YY3E 2VQEE 3T1YE 4DR6I 1Z59A 1S16A 4DV7E 4JG4A 3J81Q 2DEJA 2UUAE 3F0NA 1HNXE 2HK3A 5A2QC 4K0KE 4UT4A 2X7IA 5GMEA 4DPWA 2V2QA 2R42A 1XNQI 4MYTA 4DR4I 3ZKDA 4KHPI 4M1KA 3WU4A 3T1HI 1HNWI 2ZM6E 1KKHA 4FWDA 4X66E 4DPTA 2HKJA 1HR0E 1XNRE 4JI4E 2VF3A 1FJGI 4HYMA 2V2ZA 2DEIA 4JI1E 3J7AG 1KVKA 2XEXA 2UXBE 4USKA 1Z0GA 1NHHA 2UU9E 1MG7A 1S4EA 2UUBE 1N34E 1XNQE 4DR1I 3ZZTA 1ELOA 4DV5E 4LFAI 3OTOE 4DR4E 4KHPE 2NPFA 4JI0E 2OI2A 4I3HA 1XHKA 1FI4A 1HNWE 4PRXA 3M6AA 3J80Q 4AQYI 1N33I 4LF7E 4P52A 4LF9I 4Z7CA 4Z7YA 4DR3I 4JI2I 3LTOA 2WW4A 1FNMA 1ZM2A 4X66I 1B62A 3PYFA 2LJPA 1NZ0A 3ZKBA 4FW9A 4P7AA 3QT7A 2UXDE 4NXME 1B63A 2HHHI 4JI4I 3ZZUA 4B3MI 3J80C 1J5EI 1RREA 4JI6E 1PVGA 3JAMC 5IWAE 1BKNA 2BM1A 1N36I 2UXBI 1N0UA 2UUBI 5LL6R 2UXCI 4ED4A 1OJ4A 1FWLA 3V2UC 4DV6I 2V34A 4X65I 1MU5A 4DV3E 4NXNE 4B3TI 1QZRA 1VISA 3K1JA 1N33E 4DV2I 3WU3A 2E5LI 4JI5E 1Z0CA 4GKJI 5LMNE 4DR2I 1IBKI 4LF6E 4WUDA 4LFCI 2F4VE 4LF4I 4OX9E 1J5EE 4LFAE 1Z5AA 4DPYA 5BR8I 4R1FA 1IBME 4MYUA 1XMOI 4DUYE 1N36E 2UUAI 2CZ9A 1A6FA 4DR3E 3PYGA 2UUCE 2VQFE 4DV6E 4JV5I 4X65E 4DR5E 5LMUI 3J7AM 4LFBI 3LNUA 3Q1QA 4DV1I 4DV2E 3PYEA 4YHHI 1ZM9A 4FWHA 4K0KI 4HXZA 4DV4I 4LFCE 3CWVA 3QT8A 1Z0BA 1IBMI 4JI7E 3T1HE 1H7UA 2ZBKB 3QT5A 2HK2A 1XMOE 3WU5A 4ZVIA 5FLXC 1U2RA 5L3JA 1IBLI 2A2DA 1Z0VA 4JI8I
chains in the Genus database with same CATH superfamily
4OO1E 1Y4UA 3UHMA 4LF4E 2O1VA 2PO2A 2EFGA 3P06A 4DPUA 4JI2E 2JEAB 4LF8E 3U1KA 1WUUA 4LF5E 4IFDA 1R6LA 2PNLA 4IZKA 4FW4A 5DNXA 4IZJD 1UDQA 2CVEA 1PKPA 2BV3A 4B3SE 2HHHE 4IFDC 1N32I 4JI3I 4FW6A 1Z0TA 2ZITA 2JEBA 3B78A 2E1RA 1PIEA 2UU9I 2IOQA 2BR2A 4DV4E 1Y60A 4PU9A 3B8HA 2JEBB 4GKKI 1Z0EA 2WNRB 4JI0I 5FLXQ 5LMUE 3LPSA 4HY1A 1NHJA 2J65A 4DV1E 4QNKA 4JI8E 4N3OA 3QT6A 1HNZI 4IFDE 4DUZE 1N0VC 2C39B 4NXMI 4LPFA 4DU7A 1OYRA 4B3ME 3PS2A 4B3TE 2C39A 4DV7I 1KIJA 4DPXA 5JEAE 2E5LE 4JI5I 4B3RE 5LMNI 4PRVA 2A2CA 4JI3E 4OO1C 1XNRI 4IZJA 4B3SI 4KQVA 4UTGA 2F4VI 1ZXNA 2WP8A 3HULA 5BR8E 5IWAI 1FWKA 1ZM4A 4IZJB 2F1DA 4EMDA 2CGEA 4MQYA 4GKKE 1EI1A 3D4JA 2WP8B 1N34I 4U3BA 5JEAF 5C0XC 3OTOI 2AJ4A 2VQFI 4LF5I 4XTJA 4DV3I 1R6MA 2CG9A 5IT9C 1I94E 5DRRA 4FW7A 4X64E 2JEAA 1XMQI 3GONA 4AQYE 4LCFA 2V8PA 2JT2A 4DR2E 4LF9E 4DUZI 1Z5BA 4WUCA 3PYDA 1FJGE 2PNZA 4OX9I 4DR7I 4AM3A 4B3RI 4JI1I 4FN5A 2UXDI 1VI7A 1Z0WA 5IT9Q 4FWGA 4DR1E 2BR2B 3M85G 1H7SA 3JAMQ 4DV5I 4DV0I 4JI6I 3NZKA 4OO1D 1D6TA 2WNRA 5DNLA 4DU8A 5JEAD 4JI7I 4JYAI 4HACB 2PO1A 3ZZ0A 3B82A 3H4LA 1Y5YA 2NN6B 3P3EA 5K36C 4LF7I 4HACA 1EA6A 1NHIA 1UEKA 4LFBE 4X62I 2GS8A 1ZXMA 4X64I 1H73A 5C0XE 5C0XD 4WUBA 4YHHE 5DRQA 4BA2A 3WU6A 2C37A 1XMQE 4IFDF 1I94I 3Q6MA 2VQEI 3T1YI 1Z5CA 3V5RA 4YY3I 4DR6E 1IBKE 5K36F 2ZM6I 1K47A 4LF6I 4ISAA 4DR7E 2V2VA 4MU1A 1N32E 1FKAE 1HR0I 2BM0A 2X36A 1HNXI 1H74A 4DV0E 2R3VA 4J3DA 1E3HA 3Q6NA 4IFDD 2HKEA 4GQUA 4USMA 1RHYA 2HFUA 2J7KA 2JE6A 5A2QQ 4JYAE 1P42A 5K36D 4NXNI 2UXCE 3M7NG 1KTVA 3GCMA 3ZM7A 1HK7A 3K17A 1DARA 1IBLE 2JE6B 3P3GA 3J81C 2HFSA 4DUYI 4GKJE 3HJCA 4X62E 4JV5E 4RPFA 1OYSA 1RR9A 1ZM3A 1HNZE 4DR5I 4LF8I 2UUCI 4OO1F 2Z5EA 4DXLA 5GMDA 1MX0A 2PNZB 4URLA 1H72C 2Q2EB 4YY3E 2VQEE 3T1YE 4DR6I 1Z59A 5DROA 5K36E 1S16A 4DV7E 4JG4A 3J81Q 2DEJA 2PNMA 2UUAE 1USVA 3F0NA 1HNXE 5C0XF 2HK3A 2PO1B 1UDOA 5A2QC 2AE8A 4K0KE 4UT4A 2NN6A 4QNJA 2X7IA 5GMEA 4DPWA 2V2QA 2R42A 1XNQI 4MYTA 4DR4I 3ZKDA 4KHPI 1E3PA 4M1KA 3WU4A 4BA2B 3T1HI 3B4TA 2C37B 1HNWI 5K36B 2PO0A 2ZM6E 4LCHA 1KKHA 4FWDA 3PS3A 4NBQA 4X66E 3M7ND 4DPTA 3GLLA 2HKJA 4LCGA 1HR0E 3CDJA 5EL9A 2PO0B 1XNRE 4BA1B 4JI4E 3L7ZB 2VF3A 1FJGI 4MDTA 4HYMA 2V2ZA 2DEIA 4JI1E 2Z5BA 1YH8A 1USUA 2O3ZA 3CDIA 3J7AG 1KVKA 3L7ZA 2XEXA 2UXBE 4USKA 5DRPA 1Z0GA 4MU4A 1NHHA 2UU9E 2C38A 1MG7A 1S4EA 1Y4SA 3DD6A 2UUBE 1N34E 1XNQE 4DR1I 4OZEA 3ZZTA 1ELOA 4DV5E 4LFAI 3OTOE 4DR4E 4KHPE 2C38B 2NPFA 4JI0E 5JEAC 2OI2A 4I3HA 1XHKA 1FI4A 1HNWE 4PRXA 3M6AA 3J80Q 4AQYI 1N33I 2BA0D 4LF7E 4P52A 5C0XA 4LF9I 2O1UA 4Z7CA 4Z7YA 4DR3I 4JI2I 3LTOA 3GMEA 4FW5A 2NN6F 2BA0G 2WW4A 1FNMA 3P76A 1ZM2A 2GO3A 4X66I 1B62A 3PYFA 1YHCA 2LJPA 1NZ0A 1UDNA 3ZKBA 4FW9A 4P7AA 3QT7A 2UXDE 4NXME 1B63A 2HHHI 4JI4I 3ZZUA 3J80C 4B3MI 1J5EI 1RREA 2O1TA 2IOPA 4JI6E 4LOMA 1PVGA 3JAMC 5IWAE 1BKNA 4AIMA 2BM1A 1N36I 2UXBI 1N0UA 2UUBI 5ELWA 5LL6R 2UXCI 4ED4A 5K36A 1OJ4A 1FWLA 3V2UC 4DV6I 1UDSA 2V34A 4X65I 5FWKA 1MU5A 4DV3E 4NXNE 4B3TI 1QZRA 1VISA 2BA1D 4BA1A 3K1JA 1N33E 2GO4A 4DV2I 3WU3A 2E5LI 4JI5E 1Z0CA 4U3DA 4GKJI 5LMNE 4DR2I 1IBKI 5JEAA 2Z5BB 4LF6E 4WUDA 2NN6D 4LFCI 2F4VE 4IFDB 4LF4I 4IZKB 4OX9E 5JEAB 1J5EE 4LFAE 1Z5AA 4DPYA 3K85A 5BR8I 4R1FA 1IBME 4MYUA 1OYPA 3KRNA 3PS1A 1XMOI 4DUYE 2O1WA 2NN6E 1N36E 2UUAI 2CZ9A 1A6FA 4DR3E 3PYGA 2UUCE 2IESA 2VQFE 4DV6E 5C0XB 4JV5I 3M85D 4X65E 4DR5E 3U1YA 5LMUI 3J7AM 4FW3A 4OO1A 4MU3A 4LFBI 1XXEA 3LNUA 3Q1QA 4DV1I 3PRYA 4DV2E 3PYEA 4YHHI 1ZM9A 2IERA 4FWHA 4AIDA 4K0KI 4OO1B 4HXZA 2NN6C 4DV4I 4LFCE 2BA1G 3CWVA 3QT8A 1Z0BA 3H1CA 5EKWA 4OKGA 1IBMI 4JI7E 3T1HE 3HKMA 1H7UA 1Y6ZA 2Z5CB 2ZBKB 3QT5A 4MU0A 2VESA 2HK2A 3P3CA 1XMOE 3WU5A 4ZVIA 5FLXC 1U2RA 5L3JA 1IBLI 2Z5CA 2PO2B 2A2DA 1Z0VA 4IS9A 4JI8I 2GQ0A
chains in the Genus database with same CATH topology
1Y4UA 4LF4E 2O1VA 2EFGA 3P06A 4DPUA 4JI2E 4LF8E 1WUUA 4LF5E 2PNLA 4IZKA 4IZJD 1PKPA 2BV3A 4B3SE 2HHHE 1N32I 4JI3I 1Z0TA 2ZITA 3B78A 2E1RA 1PIEA 2UU9I 2IOQA 4DV4E 4PU9A 3B8HA 4GKKI 1Z0EA 4JI0I 5FLXQ 5LMUE 3LPSA 4HY1A 1NHJA 4DV1E 4JI8E 4N3OA 3QT6A 1HNZI 4DUZE 1N0VC 4NXMI 4DU7A 4B3ME 4B3TE 4DV7I 1KIJA 4DPXA 2E5LE 4JI5I 4B3RE 5LMNI 4PRVA 2A2CA 4JI3E 1XNRI 4IZJA 4B3SI 4KQVA 4UTGA 2F4VI 1ZXNA 5BR8E 3HULA 5IWAI 1FWKA 1ZM4A 4IZJB 4EMDA 2CGEA 4GKKE 1EI1A 3D4JA 1N34I 3OTOI 2AJ4A 2VQFI 4LF5I 4XTJA 4DV3I 2CG9A 5IT9C 1I94E 4X64E 1XMQI 3GONA 4AQYE 2V8PA 4DR2E 4LF9E 4DUZI 1Z5BA 4WUCA 3PYDA 1FJGE 4OX9I 4DR7I 4B3RI 4JI1I 4FN5A 2UXDI 1Z0WA 5IT9Q 4FWGA 4DR1E 1H7SA 3JAMQ 4DV5I 4DV0I 4JI6I 1D6TA 4DU8A 4JI7I 4JYAI 4HACB 3ZZ0A 3B82A 3H4LA 4LF7I 4HACA 1EA6A 1NHIA 1UEKA 4LFBE 4X62I 2GS8A 1ZXMA 4X64I 1H73A 4WUBA 4YHHE 3WU6A 1XMQE 1I94I 3Q6MA 2VQEI 3T1YI 1Z5CA 3V5RA 4YY3I 4DR6E 1IBKE 2ZM6I 1K47A 4LF6I 4DR7E 2V2VA 1N32E 1FKAE 1HR0I 2BM0A 2X36A 1HNXI 1H74A 4DV0E 2R3VA 3Q6NA 2HKEA 4USMA 2HFUA 2J7KA 5A2QQ 4JYAE 4NXNI 2UXCE 1KTVA 3ZM7A 1HK7A 3K17A 1DARA 1IBLE 3J81C 2HFSA 4DUYI 4GKJE 3HJCA 4X62E 4JV5E 4RPFA 1RR9A 1ZM3A 1HNZE 4DR5I 4LF8I 2UUCI 2Z5EA 4DXLA 5GMDA 1MX0A 4URLA 1H72C 2Q2EB 4YY3E 2VQEE 3T1YE 4DR6I 1Z59A 1S16A 4DV7E 4JG4A 3J81Q 2DEJA 2PNMA 2UUAE 1USVA 3F0NA 1HNXE 2HK3A 5A2QC 4K0KE 4UT4A 2X7IA 5GMEA 4DPWA 2V2QA 2R42A 1XNQI 4MYTA 4DR4I 3ZKDA 4KHPI 4M1KA 3WU4A 3T1HI 1HNWI 2ZM6E 1KKHA 4FWDA 4X66E 4DPTA 2HKJA 1HR0E 1XNRE 4JI4E 2VF3A 1FJGI 4HYMA 2V2ZA 2DEIA 4JI1E 2Z5BA 1USUA 3J7AG 1KVKA 2XEXA 2UXBE 4USKA 1Z0GA 1NHHA 2UU9E 1MG7A 1S4EA 1Y4SA 2UUBE 1N34E 1XNQE 4DR1I 3ZZTA 1ELOA 4DV5E 4LFAI 3OTOE 4DR4E 4KHPE 2NPFA 4JI0E 2OI2A 4I3HA 1XHKA 1FI4A 1HNWE 4PRXA 3M6AA 3J80Q 4AQYI 1N33I 4LF7E 4P52A 4LF9I 2O1UA 4Z7CA 4Z7YA 4DR3I 4JI2I 3LTOA 2WW4A 1FNMA 1ZM2A 4X66I 1B62A 3PYFA 2LJPA 1NZ0A 3ZKBA 4FW9A 4P7AA 3QT7A 2UXDE 4NXME 1B63A 2HHHI 4JI4I 3ZZUA 4B3MI 3J80C 1J5EI 1RREA 2O1TA 2IOPA 4JI6E 1PVGA 3JAMC 5IWAE 1BKNA 2BM1A 1N36I 2UXBI 1N0UA 2UUBI 5LL6R 2UXCI 4ED4A 1OJ4A 1FWLA 3V2UC 4DV6I 2V34A 4X65I 5FWKA 1MU5A 4DV3E 4NXNE 4B3TI 1QZRA 1VISA 3K1JA 1N33E 4DV2I 3WU3A 2E5LI 4JI5E 1Z0CA 4GKJI 5LMNE 4DR2I 1IBKI 2Z5BB 4LF6E 4WUDA 4LFCI 2F4VE 4LF4I 4IZKB 4OX9E 1J5EE 4LFAE 1Z5AA 4DPYA 3K85A 5BR8I 4R1FA 1IBME 4MYUA 1XMOI 4DUYE 2O1WA 1N36E 2UUAI 2CZ9A 1A6FA 4DR3E 3PYGA 2UUCE 2VQFE 4DV6E 4JV5I 4X65E 4DR5E 5LMUI 3J7AM 4LFBI 3LNUA 3Q1QA 4DV1I 3PRYA 4DV2E 3PYEA 4YHHI 1ZM9A 4FWHA 4K0KI 4HXZA 4DV4I 4LFCE 3CWVA 3QT8A 1Z0BA 1IBMI 4JI7E 3T1HE 1H7UA 1Y6ZA 2Z5CB 2ZBKB 3QT5A 2HK2A 1XMOE 3WU5A 4ZVIA 5FLXC 1U2RA 5L3JA 1IBLI 2Z5CA 2A2DA 1Z0VA 4JI8I 2GQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 E;  2EFG A;  4DPU A;  4JI2 E;  4LF8 E;  1WUU A;  4LF5 E;  1PKP A;  2BV3 A;  4B3S E;  2HHH E;  1N32 I;  4JI3 I;  1Z0T A;  2ZIT A;  3B78 A;  2E1R A;  1PIE A;  2UU9 I;  4DV4 E;  4PU9 A;  3B8H A;  4GKK I;  1Z0E A;  4JI0 I;  5FLX Q;  5LMU E;  3LPS A;  4HY1 A;  1NHJ A;  4DV1 E;  4JI8 E;  3QT6 A;  1HNZ I;  4DUZ E;  1N0V C;  4NXM I;  4DU7 A;  4B3M E;  4B3T E;  4DV7 I;  1KIJ A;  4DPX A;  2E5L E;  4JI5 I;  4B3R E;  5LMN I;  4PRV A;  2A2C A;  4JI3 E;  1XNR I;  4B3S I;  4KQV A;  4UTG A;  2F4V I;  1ZXN A;  5BR8 E;  3HUL A;  5IWA I;  1FWK A;  1ZM4 A;  4EMD A;  4GKK E;  1EI1 A;  3D4J A;  1N34 I;  3OTO I;  2AJ4 A;  2VQF I;  4LF5 I;  4XTJ A;  4DV3 I;  5IT9 C;  1I94 E;  4X64 E;  1XMQ I;  3GON A;  4AQY E;  2V8P A;  4DR2 E;  4LF9 E;  4DUZ I;  1Z5B A;  4WUC A;  3PYD A;  1FJG E;  4OX9 I;  4DR7 I;  4B3R I;  4JI1 I;  4FN5 A;  2UXD I;  1Z0W A;  5IT9 Q;  4FWG A;  4DR1 E;  1H7S A;  3JAM Q;  4DV5 I;  4DV0 I;  4JI6 I;  1D6T A;  4DU8 A;  4JI7 I;  4JYA I;  4HAC B;  3ZZ0 A;  3B82 A;  3H4L A;  4LF7 I;  4HAC A;  1EA6 A;  1NHI A;  1UEK A;  4LFB E;  4X62 I;  2GS8 A;  1ZXM A;  4X64 I;  1H73 A;  4WUB A;  4YHH E;  3WU6 A;  1XMQ E;  1I94 I;  2VQE I;  3T1Y I;  1Z5C A;  3V5R A;  4YY3 I;  4DR6 E;  1IBK E;  2ZM6 I;  1K47 A;  4LF6 I;  4DR7 E;  2V2V A;  1N32 E;  1FKA E;  1HR0 I;  2BM0 A;  2X36 A;  1HNX I;  1H74 A;  4DV0 E;  2R3V A;  2HKE A;  4USM A;  2HFU A;  2J7K A;  5A2Q Q;  4JYA E;  4NXN I;  2UXC E;  1KTV A;  3ZM7 A;  3K17 A;  1DAR A;  1IBL E;  3J81 C;  2HFS A;  4DUY I;  4GKJ E;  4X62 E;  4JV5 E;  4RPF A;  1RR9 A;  1ZM3 A;  1HNZ E;  4DR5 I;  4LF8 I;  2UUC I;  4DXL A;  5GMD A;  1MX0 A;  4URL A;  1H72 C;  2Q2E B;  4YY3 E;  2VQE E;  3T1Y E;  4DR6 I;  1Z59 A;  1S16 A;  4DV7 E;  4JG4 A;  3J81 Q;  2DEJ A;  2UUA E;  3F0N A;  1HNX E;  2HK3 A;  5A2Q C;  4K0K E;  4UT4 A;  2X7I A;  5GME A;  4DPW A;  2V2Q A;  2R42 A;  1XNQ I;  4MYT A;  4DR4 I;  3ZKD A;  4KHP I;  4M1K A;  3WU4 A;  3T1H I;  1HNW I;  2ZM6 E;  1KKH A;  4FWD A;  4X66 E;  4DPT A;  2HKJ A;  1HR0 E;  1XNR E;  4JI4 E;  2VF3 A;  1FJG I;  4HYM A;  2V2Z A;  2DEI A;  4JI1 E;  3J7A G;  1KVK A;  2XEX A;  2UXB E;  4USK A;  1Z0G A;  1NHH A;  2UU9 E;  1MG7 A;  1S4E A;  2UUB E;  1N34 E;  1XNQ E;  4DR1 I;  3ZZT A;  1ELO A;  4DV5 E;  4LFA I;  3OTO E;  4DR4 E;  4KHP E;  2NPF A;  4JI0 E;  2OI2 A;  4I3H A;  1XHK A;  1FI4 A;  1HNW E;  4PRX A;  3M6A A;  3J80 Q;  4AQY I;  1N33 I;  4LF7 E;  4P52 A;  4LF9 I;  4Z7C A;  4Z7Y A;  4DR3 I;  4JI2 I;  3LTO A;  2WW4 A;  1FNM A;  1ZM2 A;  4X66 I;  1B62 A;  3PYF A;  2LJP A;  1NZ0 A;  3ZKB A;  4FW9 A;  4P7A A;  3QT7 A;  2UXD E;  4NXM E;  1B63 A;  2HHH I;  4JI4 I;  3ZZU A;  4B3M I;  3J80 C;  1J5E I;  1RRE A;  4JI6 E;  1PVG A;  3JAM C;  5IWA E;  1BKN A;  2BM1 A;  1N36 I;  2UXB I;  1N0U A;  2UUB I;  5LL6 R;  2UXC I;  4ED4 A;  1OJ4 A;  1FWL A;  3V2U C;  4DV6 I;  2V34 A;  4X65 I;  1MU5 A;  4DV3 E;  4NXN E;  4B3T I;  1QZR A;  1VIS A;  3K1J A;  1N33 E;  4DV2 I;  3WU3 A;  2E5L I;  4JI5 E;  1Z0C A;  4GKJ I;  5LMN E;  4DR2 I;  1IBK I;  4LF6 E;  4WUD A;  4LFC I;  2F4V E;  4LF4 I;  4OX9 E;  1J5E E;  4LFA E;  1Z5A A;  4DPY A;  5BR8 I;  4R1F A;  1IBM E;  4MYU A;  1XMO I;  4DUY E;  1N36 E;  2UUA I;  2CZ9 A;  1A6F A;  4DR3 E;  3PYG A;  2UUC E;  2VQF E;  4DV6 E;  4JV5 I;  4X65 E;  4DR5 E;  5LMU I;  3J7A M;  4LFB I;  3LNU A;  3Q1Q A;  4DV1 I;  4DV2 E;  3PYE A;  4YHH I;  1ZM9 A;  4FWH A;  4K0K I;  4HXZ A;  4DV4 I;  4LFC E;  3CWV A;  3QT8 A;  1Z0B A;  1IBM I;  4JI7 E;  3T1H E;  1H7U A;  2ZBK B;  3QT5 A;  2HK2 A;  1XMO E;  3WU5 A;  4ZVI A;  5FLX C;  1U2R A;  5L3J A;  1IBL I;  2A2D A;  1Z0V A;  4JI8 I; 
#chains in the Genus database with same CATH topology
 4OO1 E;  1Y4U A;  3UHM A;  4LF4 E;  2O1V A;  2PO2 A;  2EFG A;  3P06 A;  4DPU A;  4JI2 E;  2JEA B;  4LF8 E;  3U1K A;  1WUU A;  4LF5 E;  4IFD A;  1R6L A;  2PNL A;  4IZK A;  4FW4 A;  5DNX A;  4IZJ D;  1UDQ A;  2CVE A;  1PKP A;  2BV3 A;  4B3S E;  2HHH E;  4IFD C;  1N32 I;  4JI3 I;  4FW6 A;  1Z0T A;  2ZIT A;  2JEB A;  3B78 A;  2E1R A;  1PIE A;  2UU9 I;  2IOQ A;  2BR2 A;  4DV4 E;  1Y60 A;  4PU9 A;  3B8H A;  2JEB B;  4GKK I;  1Z0E A;  2WNR B;  4JI0 I;  5FLX Q;  5LMU E;  3LPS A;  4HY1 A;  1NHJ A;  2J65 A;  4DV1 E;  4QNK A;  4JI8 E;  4N3O A;  3QT6 A;  1HNZ I;  4IFD E;  4DUZ E;  1N0V C;  2C39 B;  4NXM I;  4LPF A;  4DU7 A;  1OYR A;  4B3M E;  3PS2 A;  4B3T E;  2C39 A;  4DV7 I;  1KIJ A;  4DPX A;  5JEA E;  2E5L E;  4JI5 I;  4B3R E;  5LMN I;  4PRV A;  2A2C A;  4JI3 E;  4OO1 C;  1XNR I;  4IZJ A;  4B3S I;  4KQV A;  4UTG A;  2F4V I;  1ZXN A;  2WP8 A;  3HUL A;  5BR8 E;  5IWA I;  1FWK A;  1ZM4 A;  4IZJ B;  2F1D A;  4EMD A;  2CGE A;  4MQY A;  4GKK E;  1EI1 A;  3D4J A;  2WP8 B;  1N34 I;  4U3B A;  5JEA F;  5C0X C;  3OTO I;  2AJ4 A;  2VQF I;  4LF5 I;  4XTJ A;  4DV3 I;  1R6M A;  2CG9 A;  5IT9 C;  1I94 E;  5DRR A;  4FW7 A;  4X64 E;  2JEA A;  1XMQ I;  3GON A;  4AQY E;  4LCF A;  2V8P A;  2JT2 A;  4DR2 E;  4LF9 E;  4DUZ I;  1Z5B A;  4WUC A;  3PYD A;  1FJG E;  2PNZ A;  4OX9 I;  4DR7 I;  4AM3 A;  4B3R I;  4JI1 I;  4FN5 A;  2UXD I;  1VI7 A;  1Z0W A;  5IT9 Q;  4FWG A;  4DR1 E;  2BR2 B;  3M85 G;  1H7S A;  3JAM Q;  4DV5 I;  4DV0 I;  4JI6 I;  3NZK A;  4OO1 D;  1D6T A;  2WNR A;  5DNL A;  4DU8 A;  5JEA D;  4JI7 I;  4JYA I;  4HAC B;  2PO1 A;  3ZZ0 A;  3B82 A;  3H4L A;  1Y5Y A;  2NN6 B;  3P3E A;  5K36 C;  4LF7 I;  4HAC A;  1EA6 A;  1NHI A;  1UEK A;  4LFB E;  4X62 I;  2GS8 A;  1ZXM A;  4X64 I;  1H73 A;  5C0X E;  5C0X D;  4WUB A;  4YHH E;  5DRQ A;  4BA2 A;  3WU6 A;  2C37 A;  1XMQ E;  4IFD F;  1I94 I;  3Q6M A;  2VQE I;  3T1Y I;  1Z5C A;  3V5R A;  4YY3 I;  4DR6 E;  1IBK E;  5K36 F;  2ZM6 I;  1K47 A;  4LF6 I;  4ISA A;  4DR7 E;  2V2V A;  4MU1 A;  1N32 E;  1FKA E;  1HR0 I;  2BM0 A;  2X36 A;  1HNX I;  1H74 A;  4DV0 E;  2R3V A;  4J3D A;  1E3H A;  3Q6N A;  4IFD D;  2HKE A;  4GQU A;  4USM A;  1RHY A;  2HFU A;  2J7K A;  2JE6 A;  5A2Q Q;  4JYA E;  1P42 A;  5K36 D;  4NXN I;  2UXC E;  3M7N G;  1KTV A;  3GCM A;  3ZM7 A;  1HK7 A;  3K17 A;  1DAR A;  1IBL E;  2JE6 B;  3P3G A;  3J81 C;  2HFS A;  4DUY I;  4GKJ E;  3HJC A;  4X62 E;  4JV5 E;  4RPF A;  1OYS A;  1RR9 A;  1ZM3 A;  1HNZ E;  4DR5 I;  4LF8 I;  2UUC I;  4OO1 F;  2Z5E A;  4DXL A;  5GMD A;  1MX0 A;  2PNZ B;  4URL A;  1H72 C;  2Q2E B;  4YY3 E;  2VQE E;  3T1Y E;  4DR6 I;  1Z59 A;  5DRO A;  5K36 E;  1S16 A;  4DV7 E;  4JG4 A;  3J81 Q;  2DEJ A;  2PNM A;  2UUA E;  1USV A;  3F0N A;  1HNX E;  5C0X F;  2HK3 A;  2PO1 B;  1UDO A;  5A2Q C;  2AE8 A;  4K0K E;  4UT4 A;  2NN6 A;  4QNJ A;  2X7I A;  5GME A;  4DPW A;  2V2Q A;  2R42 A;  1XNQ I;  4MYT A;  4DR4 I;  3ZKD A;  4KHP I;  1E3P A;  4M1K A;  3WU4 A;  4BA2 B;  3T1H I;  3B4T A;  2C37 B;  1HNW I;  5K36 B;  2PO0 A;  2ZM6 E;  4LCH A;  1KKH A;  4FWD A;  3PS3 A;  4NBQ A;  4X66 E;  3M7N D;  4DPT A;  3GLL A;  2HKJ A;  4LCG A;  1HR0 E;  3CDJ A;  5EL9 A;  2PO0 B;  1XNR E;  4BA1 B;  4JI4 E;  3L7Z B;  2VF3 A;  1FJG I;  4MDT A;  4HYM A;  2V2Z A;  2DEI A;  4JI1 E;  2Z5B A;  1YH8 A;  1USU A;  2O3Z A;  3CDI A;  3J7A G;  1KVK A;  3L7Z A;  2XEX A;  2UXB E;  4USK A;  5DRP A;  1Z0G A;  4MU4 A;  1NHH A;  2UU9 E;  2C38 A;  1MG7 A;  1S4E A;  1Y4S A;  3DD6 A;  2UUB E;  1N34 E;  1XNQ E;  4DR1 I;  4OZE A;  3ZZT A;  1ELO A;  4DV5 E;  4LFA I;  3OTO E;  4DR4 E;  4KHP E;  2C38 B;  2NPF A;  4JI0 E;  5JEA C;  2OI2 A;  4I3H A;  1XHK A;  1FI4 A;  1HNW E;  4PRX A;  3M6A A;  3J80 Q;  4AQY I;  1N33 I;  2BA0 D;  4LF7 E;  4P52 A;  5C0X A;  4LF9 I;  2O1U A;  4Z7C A;  4Z7Y A;  4DR3 I;  4JI2 I;  3LTO A;  3GME A;  4FW5 A;  2NN6 F;  2BA0 G;  2WW4 A;  1FNM A;  3P76 A;  1ZM2 A;  2GO3 A;  4X66 I;  1B62 A;  3PYF A;  1YHC A;  2LJP A;  1NZ0 A;  1UDN A;  3ZKB A;  4FW9 A;  4P7A A;  3QT7 A;  2UXD E;  4NXM E;  1B63 A;  2HHH I;  4JI4 I;  3ZZU A;  3J80 C;  4B3M I;  1J5E I;  1RRE A;  2O1T A;  2IOP A;  4JI6 E;  4LOM A;  1PVG A;  3JAM C;  5IWA E;  1BKN A;  4AIM A;  2BM1 A;  1N36 I;  2UXB I;  1N0U A;  2UUB I;  5ELW A;  5LL6 R;  2UXC I;  4ED4 A;  5K36 A;  1OJ4 A;  1FWL A;  3V2U C;  4DV6 I;  1UDS A;  2V34 A;  4X65 I;  5FWK A;  1MU5 A;  4DV3 E;  4NXN E;  4B3T I;  1QZR A;  1VIS A;  2BA1 D;  4BA1 A;  3K1J A;  1N33 E;  2GO4 A;  4DV2 I;  3WU3 A;  2E5L I;  4JI5 E;  1Z0C A;  4U3D A;  4GKJ I;  5LMN E;  4DR2 I;  1IBK I;  5JEA A;  2Z5B B;  4LF6 E;  4WUD A;  2NN6 D;  4LFC I;  2F4V E;  4IFD B;  4LF4 I;  4IZK B;  4OX9 E;  5JEA B;  1J5E E;  4LFA E;  1Z5A A;  4DPY A;  3K85 A;  5BR8 I;  4R1F A;  1IBM E;  4MYU A;  1OYP A;  3KRN A;  3PS1 A;  1XMO I;  4DUY E;  2O1W A;  2NN6 E;  1N36 E;  2UUA I;  2CZ9 A;  1A6F A;  4DR3 E;  3PYG A;  2UUC E;  2IES A;  2VQF E;  4DV6 E;  5C0X B;  4JV5 I;  3M85 D;  4X65 E;  4DR5 E;  3U1Y A;  5LMU I;  3J7A M;  4FW3 A;  4OO1 A;  4MU3 A;  4LFB I;  1XXE A;  3LNU A;  3Q1Q A;  4DV1 I;  3PRY A;  4DV2 E;  3PYE A;  4YHH I;  1ZM9 A;  2IER A;  4FWH A;  4AID A;  4K0K I;  4OO1 B;  4HXZ A;  2NN6 C;  4DV4 I;  4LFC E;  2BA1 G;  3CWV A;  3QT8 A;  1Z0B A;  3H1C A;  5EKW A;  4OKG A;  1IBM I;  4JI7 E;  3T1H E;  3HKM A;  1H7U A;  1Y6Z A;  2Z5C B;  2ZBK B;  3QT5 A;  4MU0 A;  2VES A;  2HK2 A;  3P3C A;  1XMO E;  3WU5 A;  4ZVI A;  5FLX C;  1U2R A;  5L3J A;  1IBL I;  2Z5C A;  2PO2 B;  2A2D A;  1Z0V A;  4IS9 A;  4JI8 I;  2GQ0 A; 
#chains in the Genus database with same CATH homology
 1Y4U A;  4LF4 E;  2O1V A;  2EFG A;  3P06 A;  4DPU A;  4JI2 E;  4LF8 E;  1WUU A;  4LF5 E;  2PNL A;  4IZK A;  4IZJ D;  1PKP A;  2BV3 A;  4B3S E;  2HHH E;  1N32 I;  4JI3 I;  1Z0T A;  2ZIT A;  3B78 A;  2E1R A;  1PIE A;  2UU9 I;  2IOQ A;  4DV4 E;  4PU9 A;  3B8H A;  4GKK I;  1Z0E A;  4JI0 I;  5FLX Q;  5LMU E;  3LPS A;  4HY1 A;  1NHJ A;  4DV1 E;  4JI8 E;  4N3O A;  3QT6 A;  1HNZ I;  4DUZ E;  1N0V C;  4NXM I;  4DU7 A;  4B3M E;  4B3T E;  4DV7 I;  1KIJ A;  4DPX A;  2E5L E;  4JI5 I;  4B3R E;  5LMN I;  4PRV A;  2A2C A;  4JI3 E;  1XNR I;  4IZJ A;  4B3S I;  4KQV A;  4UTG A;  2F4V I;  1ZXN A;  5BR8 E;  3HUL A;  5IWA I;  1FWK A;  1ZM4 A;  4IZJ B;  4EMD A;  2CGE A;  4GKK E;  1EI1 A;  3D4J A;  1N34 I;  3OTO I;  2AJ4 A;  2VQF I;  4LF5 I;  4XTJ A;  4DV3 I;  2CG9 A;  5IT9 C;  1I94 E;  4X64 E;  1XMQ I;  3GON A;  4AQY E;  2V8P A;  4DR2 E;  4LF9 E;  4DUZ I;  1Z5B A;  4WUC A;  3PYD A;  1FJG E;  4OX9 I;  4DR7 I;  4B3R I;  4JI1 I;  4FN5 A;  2UXD I;  1Z0W A;  5IT9 Q;  4FWG A;  4DR1 E;  1H7S A;  3JAM Q;  4DV5 I;  4DV0 I;  4JI6 I;  1D6T A;  4DU8 A;  4JI7 I;  4JYA I;  4HAC B;  3ZZ0 A;  3B82 A;  3H4L A;  4LF7 I;  4HAC A;  1EA6 A;  1NHI A;  1UEK A;  4LFB E;  4X62 I;  2GS8 A;  1ZXM A;  4X64 I;  1H73 A;  4WUB A;  4YHH E;  3WU6 A;  1XMQ E;  1I94 I;  3Q6M A;  2VQE I;  3T1Y I;  1Z5C A;  3V5R A;  4YY3 I;  4DR6 E;  1IBK E;  2ZM6 I;  1K47 A;  4LF6 I;  4DR7 E;  2V2V A;  1N32 E;  1FKA E;  1HR0 I;  2BM0 A;  2X36 A;  1HNX I;  1H74 A;  4DV0 E;  2R3V A;  3Q6N A;  2HKE A;  4USM A;  2HFU A;  2J7K A;  5A2Q Q;  4JYA E;  4NXN I;  2UXC E;  1KTV A;  3ZM7 A;  1HK7 A;  3K17 A;  1DAR A;  1IBL E;  3J81 C;  2HFS A;  4DUY I;  4GKJ E;  3HJC A;  4X62 E;  4JV5 E;  4RPF A;  1RR9 A;  1ZM3 A;  1HNZ E;  4DR5 I;  4LF8 I;  2UUC I;  2Z5E A;  4DXL A;  5GMD A;  1MX0 A;  4URL A;  1H72 C;  2Q2E B;  4YY3 E;  2VQE E;  3T1Y E;  4DR6 I;  1Z59 A;  1S16 A;  4DV7 E;  4JG4 A;  3J81 Q;  2DEJ A;  2PNM A;  2UUA E;  1USV A;  3F0N A;  1HNX E;  2HK3 A;  5A2Q C;  4K0K E;  4UT4 A;  2X7I A;  5GME A;  4DPW A;  2V2Q A;  2R42 A;  1XNQ I;  4MYT A;  4DR4 I;  3ZKD A;  4KHP I;  4M1K A;  3WU4 A;  3T1H I;  1HNW I;  2ZM6 E;  1KKH A;  4FWD A;  4X66 E;  4DPT A;  2HKJ A;  1HR0 E;  1XNR E;  4JI4 E;  2VF3 A;  1FJG I;  4HYM A;  2V2Z A;  2DEI A;  4JI1 E;  2Z5B A;  1USU A;  3J7A G;  1KVK A;  2XEX A;  2UXB E;  4USK A;  1Z0G A;  1NHH A;  2UU9 E;  1MG7 A;  1S4E A;  1Y4S A;  2UUB E;  1N34 E;  1XNQ E;  4DR1 I;  3ZZT A;  1ELO A;  4DV5 E;  4LFA I;  3OTO E;  4DR4 E;  4KHP E;  2NPF A;  4JI0 E;  2OI2 A;  4I3H A;  1XHK A;  1FI4 A;  1HNW E;  4PRX A;  3M6A A;  3J80 Q;  4AQY I;  1N33 I;  4LF7 E;  4P52 A;  4LF9 I;  2O1U A;  4Z7C A;  4Z7Y A;  4DR3 I;  4JI2 I;  3LTO A;  2WW4 A;  1FNM A;  1ZM2 A;  4X66 I;  1B62 A;  3PYF A;  2LJP A;  1NZ0 A;  3ZKB A;  4FW9 A;  4P7A A;  3QT7 A;  2UXD E;  4NXM E;  1B63 A;  2HHH I;  4JI4 I;  3ZZU A;  4B3M I;  3J80 C;  1J5E I;  1RRE A;  2O1T A;  2IOP A;  4JI6 E;  1PVG A;  3JAM C;  5IWA E;  1BKN A;  2BM1 A;  1N36 I;  2UXB I;  1N0U A;  2UUB I;  5LL6 R;  2UXC I;  4ED4 A;  1OJ4 A;  1FWL A;  3V2U C;  4DV6 I;  2V34 A;  4X65 I;  5FWK A;  1MU5 A;  4DV3 E;  4NXN E;  4B3T I;  1QZR A;  1VIS A;  3K1J A;  1N33 E;  4DV2 I;  3WU3 A;  2E5L I;  4JI5 E;  1Z0C A;  4GKJ I;  5LMN E;  4DR2 I;  1IBK I;  2Z5B B;  4LF6 E;  4WUD A;  4LFC I;  2F4V E;  4LF4 I;  4IZK B;  4OX9 E;  1J5E E;  4LFA E;  1Z5A A;  4DPY A;  3K85 A;  5BR8 I;  4R1F A;  1IBM E;  4MYU A;  1XMO I;  4DUY E;  2O1W A;  1N36 E;  2UUA I;  2CZ9 A;  1A6F A;  4DR3 E;  3PYG A;  2UUC E;  2VQF E;  4DV6 E;  4JV5 I;  4X65 E;  4DR5 E;  5LMU I;  3J7A M;  4LFB I;  3LNU A;  3Q1Q A;  4DV1 I;  3PRY A;  4DV2 E;  3PYE A;  4YHH I;  1ZM9 A;  4FWH A;  4K0K I;  4HXZ A;  4DV4 I;  4LFC E;  3CWV A;  3QT8 A;  1Z0B A;  1IBM I;  4JI7 E;  3T1H E;  1H7U A;  1Y6Z A;  2Z5C B;  2ZBK B;  3QT5 A;  2HK2 A;  1XMO E;  3WU5 A;  4ZVI A;  5FLX C;  1U2R A;  5L3J A;  1IBL I;  2Z5C A;  2A2D A;  1Z0V A;  4JI8 I;  2GQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...