4LF8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8I00
2HK3A 2E5LI 2UXCE 4ED4A 4LF7I 4JI5I 1N0UA 1Z59A 3PYFA 4DU7A 4USMA 2NPFA 3T1HE 3PYEA 4Z7CA 2UUCE 5IT9C 4PRXA 4AQYE 1IBLI 2UU9I 5L3JA 4LFAI 1Z0GA 4B3SI 3V5RA 1Z0VA 4JI1I 4YHHE 1HNXI 1ELOA 4DUYE 3M6AA 4X65I 4OX9I 2HFUA 1Z0TA 4FWGA 4EMDA 4KQVA 2HFSA 4JI3I 4JV5E 5BR8E 4DV0E 4B3RI 1U2RA 4LF8E 2XEXA 4DV4I 4DPYA 3J7AG 1NHJA 2VQFI 2HHHI 4LF5E 1RREA 2R42A 4M1KA 4DR4E 4DR7E 3WU5A 1RR9A 4DUZI 4KHPI 1Z0EA 4PU9A 1XNQI 4DR3E 4GKJE 3QT8A 2E1RA 1ZXNA 3JAMC 4DR1E 1N34I 4DPUA 3LNUA 2UXBE 1N32I 1MU5A 1H7SA 1N36I 3QT5A 1H73A 3D4JA 1EI1A 4LF9I 1IBME 5A2QQ 5LMUI 3Q1QA 4USKA 4DV3E 1Z5CA 4UTGA 1HR0I 3GONA 2VQEI 1BKNA 4DR2I 1ZM4A 4JYAE 2J7KA 4DPXA 1KKHA 4JI8I 1XMOI 2WW4A 1HNWE 4DV1I 1ZM2A 1KIJA 1NZ0A 1HNZI 4DR6I 2F4VE 4NXMI 4LF7E 4JI5E 3B78A 4DV7E 4LFBI 1FNMA 1FJGE 2UU9E 2A2DA 4URLA 4HYMA 1FI4A 1Z0WA 4HXZA 4YY3E 4JI1E 1H7UA 5IT9Q 1HNXE 3LPSA 3ZZUA 4OX9E 3HULA 1D6TA 4JI0E 3ZZTA 4JG4A 3OTOE 4K0KI 3ZZ0A 2HK2A 4JI3E 1H72C 3T1YI 1XNRI 4X62E 4RPFA 3ZKDA 4B3RE 1ZM9A 3T1HI 4DPTA 2UUCI 1N0VC 5IWAI 2V2ZA 2HHHE 4X64I 2A2CA 4HACA 4DUYI 1FKAE 5GMDA 2BM0A 2LJPA 1XNQE 4WUBA 4P7AA 1N34E 1Z0CA 4XTJA 4JI6I 4JI2I 4HACB 4JI4I 1S4EA 4JV5I 5BR8I 3K1JA 3WU4A 4DPWA 1XMQE 1N36E 4FN5A 3JAMQ 3QT6A 4LF9E 3CWVA 5LMUE 3J81C 2UUBI 4LF5I 1HR0E 4LF6E 4DR7I 4DR2E 4JI7E 4DV6I 3H4LA 4B3ME 2X7IA 4LFCI 4R1FA 2HKJA 4DR1I 4B3TI 1QZRA 5FLXQ 4DV2I 2UXBI 3J80Q 4MYTA 1EA6A 4UT4A 4MYUA 4GKKE 1B63A 4DR5E 1NHIA 4NXNI 4DV1E 1IBKE 1I94E 4FWHA 1ZM3A 2CZ9A 2ZM6I 4DV5E 3B8HA 4NXME 4LF4I 5GMEA 2E5LE 2ZITA 1NHHA 2UXDI 4X66I 2Q2EB 1PKPA 1Z0BA 1PVGA 1KVKA 1IBLE 3J7AM 2DEJA 1J5EI 4LFAE 2AJ4A 1N33I 4B3SE 1OJ4A 2V2VA 2UUAI 2BV3A 5LMNI 2F4VI 1ZXMA 4K0KE 4X65E 1PIEA 3ZM7A 3T1YE 2UXCI 3PYDA 1XNRE 1FWLA 4DV7I 3WU3A 1A6FA 3LTOA 1FJGI 2V2QA 1VISA 3ZKBA 5IWAE 4AQYI 4DV4E 4YY3I 2GS8A 4X64E 4ZVIA 2VQFE 2R3VA 4I3HA 4DXLA 4YHHI 4JI0I 3V2UC 1KTVA 1H74A 3OTOI 1MX0A 4DUZE 4KHPE 2DEIA 4JI6E 4JI2E 4JI4E 4X62I 3WU6A 4PRVA 4DV0I 1N32E 4LF8I 3K17A 2UUBE 4HY1A 4P52A 2EFGA 3J81Q 4DV6E 2VQEE 4DR4I 4LFCE 4B3TE 2X36A 2ZBKB 4DV2E 4DR3I 2V34A 4GKJI 3QT7A 5A2QC 3PYGA 1XMQI 1FWKA 4JI8E 5LL6R 1XMOE 4NXNE 1S16A 2ZM6E 1UEKA 1Z5BA 2OI2A 1IBMI 4WUDA 4LF4E 1K47A 1HNZE 4LF6I 4DV3I 2VF3A 5FLXC 4DR6E 2UXDE 1XHKA 3J80C 4X66E 1B62A 4JI7I 1Z5AA 4B3MI 4DU8A 1DARA 4LFBE 2BM1A 4JYAI 4FWDA 2HKEA 3B82A 4GKKI 1J5EE 2V8PA 4DR5I 3F0NA 1N33E 4WUCA 4Z7YA 1IBKI 1I94I 4FW9A 4DV5I 1HNWI 1WUUA 2UUAE 5LMNE 1MG7A
chains in the Genus database with same CATH superfamily
2PO2B 2HK3A 2BA1D 3PS3A 2E5LI 4MU3A 2UXCE 4ED4A 4LF7I 4JI5I 1N0UA 1Z59A 1E3HA 3GLLA 1UDNA 3PYFA 4DU7A 4USMA 4MDTA 2NPFA 5DNLA 2IERA 3T1HE 3PYEA 4Z7CA 2UUCE 5IT9C 4PRXA 4AQYE 1IBLI 2Z5BA 1UDQA 2UU9I 5L3JA 4LFAI 4QNJA 4FW7A 1Z0GA 4U3DA 4LOMA 3P76A 1R6MA 3M7ND 4B3SI 3V5RA 1Z0VA 4JI1I 3HKMA 4YHHE 5C0XA 1HNXI 1ELOA 2Z5BB 4DUYE 3M6AA 4X65I 4OX9I 5K36A 4LCHA 2HFUA 1Z0TA 4FWGA 2JT2A 4EMDA 4KQVA 5C0XB 2HFSA 2O1WA 3U1YA 4JI3I 4JV5E 1Y60A 5BR8E 5K36B 4DV0E 4B3RI 1U2RA 4LF8E 2XEXA 5ELWA 4DV4I 4DPYA 3J7AG 2JEBA 5DNXA 1NHJA 2IOPA 2VQFI 2HHHI 4LF5E 1RREA 2Z5CA 2R42A 4M1KA 4DR4E 4DR7E 3WU5A 1OYPA 2JEBB 2NN6D 1RR9A 4DUZI 4KHPI 4MU4A 1YH8A 1Z0EA 4PU9A 1XNQI 5C0XF 3P3CA 4DR3E 4GKJE 3QT8A 2E1RA 1ZXNA 4MQYA 2NN6F 3JAMC 2Z5CB 4DR1E 1N34I 4DPUA 3LNUA 2UXBE 2BA0D 3M85G 1N32I 1MU5A 1H7SA 1N36I 3QT5A 1H73A 3D4JA 4NBQA 1EI1A 4LF9I 1IBME 2O1VA 3PS1A 5A2QQ 5LMUI 3Q1QA 4USKA 4DV3E 5JEAA 1Z5CA 4UTGA 1HR0I 3GONA 2VQEI 2PO1A 2PNMA 1BKNA 4DR2I 4IFDD 1HK7A 1ZM4A 2J65A 5JEAB 4JYAE 2J7KA 4DPXA 2BR2A 2PNLA 4OKGA 1RHYA 1KKHA 2PO1B 5FWKA 4JI8I 2C38A 4AIMA 1XMOI 2WW4A 3P3GA 2BR2B 1HNWE 5C0XC 4DV1I 4IS9A 1ZM2A 3L7ZA 2O1TA 1KIJA 1NZ0A 5K36C 1HNZI 4DR6I 2F4VE 4NXMI 4LF7E 4ISAA 4LCGA 4JI5E 4MU0A 3B78A 3L7ZB 5JEAF 4DV7E 4LFBI 2F1DA 1FNMA 1FJGE 2UU9E 2A2DA 4URLA 4HYMA 4OO1D 1FI4A 2WNRA 1Z0WA 4HXZA 4YY3E 4JI1E 1H7UA 5IT9Q 1HNXE 4AIDA 3LPSA 3ZZUA 2PO0A 4OX9E 3HULA 1D6TA 3Q6MA 4JI0E 3ZZTA 4JG4A 2WNRB 3OTOE 2NN6A 4K0KI 4FW5A 3ZZ0A 2HK2A 4JI3E 2IESA 1H72C 3T1YI 2PO0B 1XNRI 4X62E 4RPFA 3ZKDA 3M7NG 4B3RE 5DRQA 1ZM9A 3T1HI 4DPTA 2UUCI 2NN6B 1N0VC 5IWAI 2CGEA 5JEAC 2V2ZA 3B4TA 2HHHE 4X64I 5C0XE 2A2CA 4HACA 4DUYI 1FKAE 5GMDA 2BM0A 2LJPA 2PNZA 1XNQE 5K36E 4WUBA 4IFDA 4FW3A 4P7AA 1N34E 1Z0CA 4XTJA 4JI6I 5EKWA 4HACB 4JI2I 1S4EA 4JI4I 4JV5I 5BR8I 3K1JA 2PNZB 4MU1A 3WU4A 2GQ0A 4DPWA 1XMQE 1N36E 2JEAA 4FN5A 3JAMQ 3QT6A 4LF9E 3CWVA 4IFDB 1USUA 3DD6A 5LMUE 4IZJD 3M85D 3J81C 2UUBI 1Y4UA 4LF5I 3P06A 2JEAB 1HR0E 4LF6E 4DR7I 4DR2E 3HJCA 4JI7E 4DV6I 3H4LA 2C39A 4B3ME 2X7IA 2GO4A 3PS2A 4LFCI 4R1FA 2HKJA 5DRRA 4DR1I 4B3TI 1QZRA 5FLXQ 4DV2I 2UXBI 3J80Q 1OYSA 4MYTA 1EA6A 4UT4A 4MYUA 4IFDF 4GKKE 1B63A 4DR5E 2C39B 4OO1A 1NHIA 4NXNI 4DV1E 5EL9A 1IBKE 1I94E 4FWHA 1ZM3A 2CZ9A 2ZM6I 4DV5E 1UDSA 3B8HA 4NXME 2NN6C 5JEAE 4J3DA 4LF4I 2CVEA 4OO1B 5GMEA 2E5LE 2ZITA 1NHHA 2UXDI 3GMEA 4X66I 2Q2EB 1PKPA 1Z0BA 2Z5EA 1PVGA 1KVKA 4U3BA 2VESA 3UHMA 1XXEA 1IBLE 3J7AM 2DEJA 1J5EI 4LFAE 2BA1G 2AJ4A 5DRPA 1N33I 4B3SE 1OJ4A 1VI7A 2V2VA 4OO1F 2UUAI 2BV3A 5LMNI 2F4VI 1ZXMA 4K0KE 4X65E 1PIEA 4IFDC 2WP8A 1P42A 1YHCA 2AE8A 3ZM7A 3T1YE 2UXCI 3PYDA 1XNRE 1FWLA 4BA1A 4DV7I 4N3OA 3WU3A 1A6FA 4IZKA 3LTOA 4LPFA 2IOQA 1FJGI 2V2QA 1Y5YA 2WP8B 1VISA 3ZKBA 5IWAE 4AQYI 4BA1B 4DV4E 4YY3I 4IZJA 2GS8A 4IZKB 4X64E 4ZVIA 2VQFE 1Y6ZA 2R3VA 5DROA 4I3HA 4DXLA 4YHHI 4JI0I 3V2UC 1KTVA 1H74A 3OTOI 1E3PA 3KRNA 1MX0A 4IZJB 4DUZE 4KHPE 2DEIA 2NN6E 4JI6E 4JI2E 4JI4E 4X62I 3WU6A 4FW4A 4PRVA 4OO1C 4DV0I 1N32E 4LF8I 2JE6A 3K17A 3U1KA 2UUBE 4FW6A 4HY1A 4P52A 5C0XD 1R6LA 2CG9A 2EFGA 2JE6B 3CDJA 4LCFA 5K36D 2C37A 3J81Q 4DV6E 2VQEE 4DR4I 2BA0G 4LFCE 4B3TE 5K36F 2X36A 2ZBKB 4DV2E 4DR3I 2V34A 3Q6NA 4IFDE 4GKJI 3GCMA 4BA2A 2C37B 3QT7A 5A2QC 3PYGA 1XMQI 2GO3A 1FWKA 4JI8E 5LL6R 1XMOE 4NXNE 4OZEA 3NZKA 1S16A 2O1UA 3P3EA 2ZM6E 1UEKA 1Z5BA 4BA2B 4QNKA 2OI2A 1IBMI 4WUDA 3PRYA 4LF4E 1K47A 1HNZE 4LF6I 4DV3I 2VF3A 3CDIA 5FLXC 4DR6E 2UXDE 1XHKA 3H1CA 3J80C 4X66E 3K85A 1B62A 4JI7I 1OYRA 1Z5AA 4B3MI 4DU8A 1DARA 4LFBE 2BM1A 4JYAI 4FWDA 1USVA 2HKEA 4GQUA 2O3ZA 1UDOA 3B82A 4GKKI 1J5EE 2PO2A 2V8PA 4AM3A 4DR5I 3F0NA 1N33E 4WUCA 4Z7YA 1IBKI 4OO1E 1I94I 4FW9A 4DV5I 1HNWI 2C38B 1WUUA 1Y4SA 5JEAD 2UUAE 5LMNE 1MG7A
chains in the Genus database with same CATH topology
2HK3A 2E5LI 2UXCE 4ED4A 4LF7I 4JI5I 1N0UA 1Z59A 3PYFA 4DU7A 4USMA 2NPFA 3T1HE 3PYEA 4Z7CA 2UUCE 5IT9C 4PRXA 4AQYE 1IBLI 2Z5BA 2UU9I 5L3JA 4LFAI 1Z0GA 4B3SI 3V5RA 1Z0VA 4JI1I 4YHHE 1HNXI 1ELOA 2Z5BB 4DUYE 3M6AA 4X65I 4OX9I 2HFUA 1Z0TA 4FWGA 4EMDA 4KQVA 2HFSA 2O1WA 4JI3I 4JV5E 5BR8E 4DV0E 4B3RI 1U2RA 4LF8E 2XEXA 4DV4I 4DPYA 3J7AG 1NHJA 2IOPA 2VQFI 2HHHI 4LF5E 1RREA 2Z5CA 2R42A 4M1KA 4DR4E 4DR7E 3WU5A 1RR9A 4DUZI 4KHPI 1Z0EA 4PU9A 1XNQI 4DR3E 4GKJE 3QT8A 2E1RA 1ZXNA 3JAMC 2Z5CB 4DR1E 1N34I 4DPUA 3LNUA 2UXBE 1N32I 1MU5A 1H7SA 1N36I 3QT5A 1H73A 3D4JA 1EI1A 4LF9I 1IBME 2O1VA 5A2QQ 5LMUI 3Q1QA 4USKA 4DV3E 1Z5CA 4UTGA 1HR0I 3GONA 2VQEI 2PNMA 1BKNA 4DR2I 1HK7A 1ZM4A 4JYAE 2J7KA 4DPXA 2PNLA 1KKHA 5FWKA 4JI8I 1XMOI 2WW4A 1HNWE 4DV1I 1ZM2A 2O1TA 1KIJA 1NZ0A 1HNZI 4DR6I 2F4VE 4NXMI 4LF7E 4JI5E 3B78A 4DV7E 4LFBI 1FNMA 1FJGE 2UU9E 2A2DA 4URLA 4HYMA 1FI4A 1Z0WA 4HXZA 4YY3E 4JI1E 1H7UA 5IT9Q 1HNXE 3LPSA 3ZZUA 4OX9E 3HULA 1D6TA 3Q6MA 4JI0E 3ZZTA 4JG4A 3OTOE 4K0KI 3ZZ0A 2HK2A 4JI3E 1H72C 3T1YI 1XNRI 4X62E 4RPFA 3ZKDA 4B3RE 1ZM9A 3T1HI 4DPTA 2UUCI 1N0VC 5IWAI 2CGEA 2V2ZA 2HHHE 4X64I 2A2CA 4HACA 4DUYI 1FKAE 5GMDA 2BM0A 2LJPA 1XNQE 4WUBA 4P7AA 1N34E 1Z0CA 4XTJA 4JI6I 4JI2I 4HACB 4JI4I 1S4EA 4JV5I 5BR8I 3K1JA 3WU4A 2GQ0A 4DPWA 1XMQE 1N36E 4FN5A 3JAMQ 3QT6A 4LF9E 3CWVA 1USUA 5LMUE 4IZJD 3J81C 2UUBI 1Y4UA 4LF5I 3P06A 1HR0E 4LF6E 4DR7I 4DR2E 3HJCA 4JI7E 4DV6I 3H4LA 4B3ME 2X7IA 4LFCI 4R1FA 2HKJA 4DR1I 4B3TI 1QZRA 5FLXQ 4DV2I 2UXBI 3J80Q 4MYTA 1EA6A 4UT4A 4MYUA 4GKKE 1B63A 4DR5E 1NHIA 4NXNI 4DV1E 1IBKE 1I94E 4FWHA 1ZM3A 2CZ9A 2ZM6I 4DV5E 3B8HA 4NXME 4LF4I 5GMEA 2E5LE 2ZITA 1NHHA 2UXDI 4X66I 2Q2EB 1PKPA 1Z0BA 2Z5EA 1PVGA 1KVKA 1IBLE 3J7AM 2DEJA 1J5EI 4LFAE 2AJ4A 1N33I 4B3SE 1OJ4A 2V2VA 2UUAI 2BV3A 5LMNI 2F4VI 1ZXMA 4K0KE 4X65E 1PIEA 3ZM7A 3T1YE 2UXCI 3PYDA 1XNRE 1FWLA 4DV7I 4N3OA 3WU3A 1A6FA 4IZKA 3LTOA 2IOQA 1FJGI 2V2QA 1VISA 3ZKBA 5IWAE 4AQYI 4DV4E 4YY3I 4IZJA 2GS8A 4IZKB 4X64E 4ZVIA 2VQFE 1Y6ZA 2R3VA 4I3HA 4DXLA 4YHHI 4JI0I 3V2UC 1KTVA 1H74A 3OTOI 1MX0A 4IZJB 4DUZE 4KHPE 2DEIA 4JI6E 4JI2E 4JI4E 4X62I 3WU6A 4PRVA 4DV0I 1N32E 4LF8I 3K17A 2UUBE 4HY1A 4P52A 2CG9A 2EFGA 3J81Q 4DV6E 2VQEE 4DR4I 4LFCE 4B3TE 2X36A 2ZBKB 4DV2E 4DR3I 2V34A 3Q6NA 4GKJI 3QT7A 5A2QC 3PYGA 1XMQI 1FWKA 4JI8E 5LL6R 1XMOE 4NXNE 1S16A 2O1UA 2ZM6E 1UEKA 1Z5BA 2OI2A 1IBMI 4WUDA 3PRYA 4LF4E 1K47A 1HNZE 4LF6I 4DV3I 2VF3A 5FLXC 4DR6E 2UXDE 1XHKA 3J80C 4X66E 3K85A 1B62A 4JI7I 1Z5AA 4B3MI 4DU8A 1DARA 4LFBE 2BM1A 4JYAI 4FWDA 1USVA 2HKEA 3B82A 4GKKI 1J5EE 2V8PA 4DR5I 3F0NA 1N33E 4WUCA 4Z7YA 1IBKI 1I94I 4FW9A 4DV5I 1HNWI 1WUUA 1Y4SA 2UUAE 5LMNE 1MG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  2E5L I;  2UXC E;  4ED4 A;  4LF7 I;  4JI5 I;  1N0U A;  1Z59 A;  3PYF A;  4DU7 A;  4USM A;  2NPF A;  3T1H E;  3PYE A;  4Z7C A;  2UUC E;  5IT9 C;  4PRX A;  4AQY E;  1IBL I;  2UU9 I;  5L3J A;  4LFA I;  1Z0G A;  4B3S I;  3V5R A;  1Z0V A;  4JI1 I;  4YHH E;  1HNX I;  1ELO A;  4DUY E;  3M6A A;  4X65 I;  4OX9 I;  2HFU A;  1Z0T A;  4FWG A;  4EMD A;  4KQV A;  2HFS A;  4JI3 I;  4JV5 E;  5BR8 E;  4DV0 E;  4B3R I;  1U2R A;  4LF8 E;  2XEX A;  4DV4 I;  4DPY A;  3J7A G;  1NHJ A;  2VQF I;  2HHH I;  4LF5 E;  1RRE A;  2R42 A;  4M1K A;  4DR4 E;  4DR7 E;  3WU5 A;  1RR9 A;  4DUZ I;  4KHP I;  1Z0E A;  4PU9 A;  1XNQ I;  4DR3 E;  4GKJ E;  3QT8 A;  2E1R A;  1ZXN A;  3JAM C;  4DR1 E;  1N34 I;  4DPU A;  3LNU A;  2UXB E;  1N32 I;  1MU5 A;  1H7S A;  1N36 I;  3QT5 A;  1H73 A;  3D4J A;  1EI1 A;  4LF9 I;  1IBM E;  5A2Q Q;  5LMU I;  3Q1Q A;  4USK A;  4DV3 E;  1Z5C A;  4UTG A;  1HR0 I;  3GON A;  2VQE I;  1BKN A;  4DR2 I;  1ZM4 A;  4JYA E;  2J7K A;  4DPX A;  1KKH A;  4JI8 I;  1XMO I;  2WW4 A;  1HNW E;  4DV1 I;  1ZM2 A;  1KIJ A;  1NZ0 A;  1HNZ I;  4DR6 I;  2F4V E;  4NXM I;  4LF7 E;  4JI5 E;  3B78 A;  4DV7 E;  4LFB I;  1FNM A;  1FJG E;  2UU9 E;  2A2D A;  4URL A;  4HYM A;  1FI4 A;  1Z0W A;  4HXZ A;  4YY3 E;  4JI1 E;  1H7U A;  5IT9 Q;  1HNX E;  3LPS A;  3ZZU A;  4OX9 E;  3HUL A;  1D6T A;  4JI0 E;  3ZZT A;  4JG4 A;  3OTO E;  4K0K I;  3ZZ0 A;  2HK2 A;  4JI3 E;  1H72 C;  3T1Y I;  1XNR I;  4X62 E;  4RPF A;  3ZKD A;  4B3R E;  1ZM9 A;  3T1H I;  4DPT A;  2UUC I;  1N0V C;  5IWA I;  2V2Z A;  2HHH E;  4X64 I;  2A2C A;  4HAC A;  4DUY I;  1FKA E;  5GMD A;  2BM0 A;  2LJP A;  1XNQ E;  4WUB A;  4P7A A;  1N34 E;  1Z0C A;  4XTJ A;  4JI6 I;  4JI2 I;  4HAC B;  4JI4 I;  1S4E A;  4JV5 I;  5BR8 I;  3K1J A;  3WU4 A;  4DPW A;  1XMQ E;  1N36 E;  4FN5 A;  3JAM Q;  3QT6 A;  4LF9 E;  3CWV A;  5LMU E;  3J81 C;  2UUB I;  4LF5 I;  1HR0 E;  4LF6 E;  4DR7 I;  4DR2 E;  4JI7 E;  4DV6 I;  3H4L A;  4B3M E;  2X7I A;  4LFC I;  4R1F A;  2HKJ A;  4DR1 I;  4B3T I;  1QZR A;  5FLX Q;  4DV2 I;  2UXB I;  3J80 Q;  4MYT A;  1EA6 A;  4UT4 A;  4MYU A;  4GKK E;  1B63 A;  4DR5 E;  1NHI A;  4NXN I;  4DV1 E;  1IBK E;  1I94 E;  4FWH A;  1ZM3 A;  2CZ9 A;  2ZM6 I;  4DV5 E;  3B8H A;  4NXM E;  4LF4 I;  5GME A;  2E5L E;  2ZIT A;  1NHH A;  2UXD I;  4X66 I;  2Q2E B;  1PKP A;  1Z0B A;  1PVG A;  1KVK A;  1IBL E;  3J7A M;  2DEJ A;  1J5E I;  4LFA E;  2AJ4 A;  1N33 I;  4B3S E;  1OJ4 A;  2V2V A;  2UUA I;  2BV3 A;  5LMN I;  2F4V I;  1ZXM A;  4K0K E;  4X65 E;  1PIE A;  3ZM7 A;  3T1Y E;  2UXC I;  3PYD A;  1XNR E;  1FWL A;  4DV7 I;  3WU3 A;  1A6F A;  3LTO A;  1FJG I;  2V2Q A;  1VIS A;  3ZKB A;  5IWA E;  4AQY I;  4DV4 E;  4YY3 I;  2GS8 A;  4X64 E;  4ZVI A;  2VQF E;  2R3V A;  4I3H A;  4DXL A;  4YHH I;  4JI0 I;  3V2U C;  1KTV A;  1H74 A;  3OTO I;  1MX0 A;  4DUZ E;  4KHP E;  2DEI A;  4JI6 E;  4JI2 E;  4JI4 E;  4X62 I;  3WU6 A;  4PRV A;  4DV0 I;  1N32 E;  4LF8 I;  3K17 A;  2UUB E;  4HY1 A;  4P52 A;  2EFG A;  3J81 Q;  4DV6 E;  2VQE E;  4DR4 I;  4LFC E;  4B3T E;  2X36 A;  2ZBK B;  4DV2 E;  4DR3 I;  2V34 A;  4GKJ I;  3QT7 A;  5A2Q C;  3PYG A;  1XMQ I;  1FWK A;  4JI8 E;  5LL6 R;  1XMO E;  4NXN E;  1S16 A;  2ZM6 E;  1UEK A;  1Z5B A;  2OI2 A;  1IBM I;  4WUD A;  4LF4 E;  1K47 A;  1HNZ E;  4LF6 I;  4DV3 I;  2VF3 A;  5FLX C;  4DR6 E;  2UXD E;  1XHK A;  3J80 C;  4X66 E;  1B62 A;  4JI7 I;  1Z5A A;  4B3M I;  4DU8 A;  1DAR A;  4LFB E;  2BM1 A;  4JYA I;  4FWD A;  2HKE A;  3B82 A;  4GKK I;  1J5E E;  2V8P A;  4DR5 I;  3F0N A;  1N33 E;  4WUC A;  4Z7Y A;  1IBK I;  1I94 I;  4FW9 A;  4DV5 I;  1HNW I;  1WUU A;  2UUA E;  5LMN E;  1MG7 A; 
#chains in the Genus database with same CATH topology
 2PO2 B;  2HK3 A;  2BA1 D;  3PS3 A;  2E5L I;  4MU3 A;  2UXC E;  4ED4 A;  4LF7 I;  4JI5 I;  1N0U A;  1Z59 A;  1E3H A;  3GLL A;  1UDN A;  3PYF A;  4DU7 A;  4USM A;  4MDT A;  2NPF A;  5DNL A;  2IER A;  3T1H E;  3PYE A;  4Z7C A;  2UUC E;  5IT9 C;  4PRX A;  4AQY E;  1IBL I;  2Z5B A;  1UDQ A;  2UU9 I;  5L3J A;  4LFA I;  4QNJ A;  4FW7 A;  1Z0G A;  4U3D A;  4LOM A;  3P76 A;  1R6M A;  3M7N D;  4B3S I;  3V5R A;  1Z0V A;  4JI1 I;  3HKM A;  4YHH E;  5C0X A;  1HNX I;  1ELO A;  2Z5B B;  4DUY E;  3M6A A;  4X65 I;  4OX9 I;  5K36 A;  4LCH A;  2HFU A;  1Z0T A;  4FWG A;  2JT2 A;  4EMD A;  4KQV A;  5C0X B;  2HFS A;  2O1W A;  3U1Y A;  4JI3 I;  4JV5 E;  1Y60 A;  5BR8 E;  5K36 B;  4DV0 E;  4B3R I;  1U2R A;  4LF8 E;  2XEX A;  5ELW A;  4DV4 I;  4DPY A;  3J7A G;  2JEB A;  5DNX A;  1NHJ A;  2IOP A;  2VQF I;  2HHH I;  4LF5 E;  1RRE A;  2Z5C A;  2R42 A;  4M1K A;  4DR4 E;  4DR7 E;  3WU5 A;  1OYP A;  2JEB B;  2NN6 D;  1RR9 A;  4DUZ I;  4KHP I;  4MU4 A;  1YH8 A;  1Z0E A;  4PU9 A;  1XNQ I;  5C0X F;  3P3C A;  4DR3 E;  4GKJ E;  3QT8 A;  2E1R A;  1ZXN A;  4MQY A;  2NN6 F;  3JAM C;  2Z5C B;  4DR1 E;  1N34 I;  4DPU A;  3LNU A;  2UXB E;  2BA0 D;  3M85 G;  1N32 I;  1MU5 A;  1H7S A;  1N36 I;  3QT5 A;  1H73 A;  3D4J A;  4NBQ A;  1EI1 A;  4LF9 I;  1IBM E;  2O1V A;  3PS1 A;  5A2Q Q;  5LMU I;  3Q1Q A;  4USK A;  4DV3 E;  5JEA A;  1Z5C A;  4UTG A;  1HR0 I;  3GON A;  2VQE I;  2PO1 A;  2PNM A;  1BKN A;  4DR2 I;  4IFD D;  1HK7 A;  1ZM4 A;  2J65 A;  5JEA B;  4JYA E;  2J7K A;  4DPX A;  2BR2 A;  2PNL A;  4OKG A;  1RHY A;  1KKH A;  2PO1 B;  5FWK A;  4JI8 I;  2C38 A;  4AIM A;  1XMO I;  2WW4 A;  3P3G A;  2BR2 B;  1HNW E;  5C0X C;  4DV1 I;  4IS9 A;  1ZM2 A;  3L7Z A;  2O1T A;  1KIJ A;  1NZ0 A;  5K36 C;  1HNZ I;  4DR6 I;  2F4V E;  4NXM I;  4LF7 E;  4ISA A;  4LCG A;  4JI5 E;  4MU0 A;  3B78 A;  3L7Z B;  5JEA F;  4DV7 E;  4LFB I;  2F1D A;  1FNM A;  1FJG E;  2UU9 E;  2A2D A;  4URL A;  4HYM A;  4OO1 D;  1FI4 A;  2WNR A;  1Z0W A;  4HXZ A;  4YY3 E;  4JI1 E;  1H7U A;  5IT9 Q;  1HNX E;  4AID A;  3LPS A;  3ZZU A;  2PO0 A;  4OX9 E;  3HUL A;  1D6T A;  3Q6M A;  4JI0 E;  3ZZT A;  4JG4 A;  2WNR B;  3OTO E;  2NN6 A;  4K0K I;  4FW5 A;  3ZZ0 A;  2HK2 A;  4JI3 E;  2IES A;  1H72 C;  3T1Y I;  2PO0 B;  1XNR I;  4X62 E;  4RPF A;  3ZKD A;  3M7N G;  4B3R E;  5DRQ A;  1ZM9 A;  3T1H I;  4DPT A;  2UUC I;  2NN6 B;  1N0V C;  5IWA I;  2CGE A;  5JEA C;  2V2Z A;  3B4T A;  2HHH E;  4X64 I;  5C0X E;  2A2C A;  4HAC A;  4DUY I;  1FKA E;  5GMD A;  2BM0 A;  2LJP A;  2PNZ A;  1XNQ E;  5K36 E;  4WUB A;  4IFD A;  4FW3 A;  4P7A A;  1N34 E;  1Z0C A;  4XTJ A;  4JI6 I;  5EKW A;  4HAC B;  4JI2 I;  1S4E A;  4JI4 I;  4JV5 I;  5BR8 I;  3K1J A;  2PNZ B;  4MU1 A;  3WU4 A;  2GQ0 A;  4DPW A;  1XMQ E;  1N36 E;  2JEA A;  4FN5 A;  3JAM Q;  3QT6 A;  4LF9 E;  3CWV A;  4IFD B;  1USU A;  3DD6 A;  5LMU E;  4IZJ D;  3M85 D;  3J81 C;  2UUB I;  1Y4U A;  4LF5 I;  3P06 A;  2JEA B;  1HR0 E;  4LF6 E;  4DR7 I;  4DR2 E;  3HJC A;  4JI7 E;  4DV6 I;  3H4L A;  2C39 A;  4B3M E;  2X7I A;  2GO4 A;  3PS2 A;  4LFC I;  4R1F A;  2HKJ A;  5DRR A;  4DR1 I;  4B3T I;  1QZR A;  5FLX Q;  4DV2 I;  2UXB I;  3J80 Q;  1OYS A;  4MYT A;  1EA6 A;  4UT4 A;  4MYU A;  4IFD F;  4GKK E;  1B63 A;  4DR5 E;  2C39 B;  4OO1 A;  1NHI A;  4NXN I;  4DV1 E;  5EL9 A;  1IBK E;  1I94 E;  4FWH A;  1ZM3 A;  2CZ9 A;  2ZM6 I;  4DV5 E;  1UDS A;  3B8H A;  4NXM E;  2NN6 C;  5JEA E;  4J3D A;  4LF4 I;  2CVE A;  4OO1 B;  5GME A;  2E5L E;  2ZIT A;  1NHH A;  2UXD I;  3GME A;  4X66 I;  2Q2E B;  1PKP A;  1Z0B A;  2Z5E A;  1PVG A;  1KVK A;  4U3B A;  2VES A;  3UHM A;  1XXE A;  1IBL E;  3J7A M;  2DEJ A;  1J5E I;  4LFA E;  2BA1 G;  2AJ4 A;  5DRP A;  1N33 I;  4B3S E;  1OJ4 A;  1VI7 A;  2V2V A;  4OO1 F;  2UUA I;  2BV3 A;  5LMN I;  2F4V I;  1ZXM A;  4K0K E;  4X65 E;  1PIE A;  4IFD C;  2WP8 A;  1P42 A;  1YHC A;  2AE8 A;  3ZM7 A;  3T1Y E;  2UXC I;  3PYD A;  1XNR E;  1FWL A;  4BA1 A;  4DV7 I;  4N3O A;  3WU3 A;  1A6F A;  4IZK A;  3LTO A;  4LPF A;  2IOQ A;  1FJG I;  2V2Q A;  1Y5Y A;  2WP8 B;  1VIS A;  3ZKB A;  5IWA E;  4AQY I;  4BA1 B;  4DV4 E;  4YY3 I;  4IZJ A;  2GS8 A;  4IZK B;  4X64 E;  4ZVI A;  2VQF E;  1Y6Z A;  2R3V A;  5DRO A;  4I3H A;  4DXL A;  4YHH I;  4JI0 I;  3V2U C;  1KTV A;  1H74 A;  3OTO I;  1E3P A;  3KRN A;  1MX0 A;  4IZJ B;  4DUZ E;  4KHP E;  2DEI A;  2NN6 E;  4JI6 E;  4JI2 E;  4JI4 E;  4X62 I;  3WU6 A;  4FW4 A;  4PRV A;  4OO1 C;  4DV0 I;  1N32 E;  4LF8 I;  2JE6 A;  3K17 A;  3U1K A;  2UUB E;  4FW6 A;  4HY1 A;  4P52 A;  5C0X D;  1R6L A;  2CG9 A;  2EFG A;  2JE6 B;  3CDJ A;  4LCF A;  5K36 D;  2C37 A;  3J81 Q;  4DV6 E;  2VQE E;  4DR4 I;  2BA0 G;  4LFC E;  4B3T E;  5K36 F;  2X36 A;  2ZBK B;  4DV2 E;  4DR3 I;  2V34 A;  3Q6N A;  4IFD E;  4GKJ I;  3GCM A;  4BA2 A;  2C37 B;  3QT7 A;  5A2Q C;  3PYG A;  1XMQ I;  2GO3 A;  1FWK A;  4JI8 E;  5LL6 R;  1XMO E;  4NXN E;  4OZE A;  3NZK A;  1S16 A;  2O1U A;  3P3E A;  2ZM6 E;  1UEK A;  1Z5B A;  4BA2 B;  4QNK A;  2OI2 A;  1IBM I;  4WUD A;  3PRY A;  4LF4 E;  1K47 A;  1HNZ E;  4LF6 I;  4DV3 I;  2VF3 A;  3CDI A;  5FLX C;  4DR6 E;  2UXD E;  1XHK A;  3H1C A;  3J80 C;  4X66 E;  3K85 A;  1B62 A;  4JI7 I;  1OYR A;  1Z5A A;  4B3M I;  4DU8 A;  1DAR A;  4LFB E;  2BM1 A;  4JYA I;  4FWD A;  1USV A;  2HKE A;  4GQU A;  2O3Z A;  1UDO A;  3B82 A;  4GKK I;  1J5E E;  2PO2 A;  2V8P A;  4AM3 A;  4DR5 I;  3F0N A;  1N33 E;  4WUC A;  4Z7Y A;  1IBK I;  4OO1 E;  1I94 I;  4FW9 A;  4DV5 I;  1HNW I;  2C38 B;  1WUU A;  1Y4S A;  5JEA D;  2UUA E;  5LMN E;  1MG7 A; 
#chains in the Genus database with same CATH homology
 2HK3 A;  2E5L I;  2UXC E;  4ED4 A;  4LF7 I;  4JI5 I;  1N0U A;  1Z59 A;  3PYF A;  4DU7 A;  4USM A;  2NPF A;  3T1H E;  3PYE A;  4Z7C A;  2UUC E;  5IT9 C;  4PRX A;  4AQY E;  1IBL I;  2Z5B A;  2UU9 I;  5L3J A;  4LFA I;  1Z0G A;  4B3S I;  3V5R A;  1Z0V A;  4JI1 I;  4YHH E;  1HNX I;  1ELO A;  2Z5B B;  4DUY E;  3M6A A;  4X65 I;  4OX9 I;  2HFU A;  1Z0T A;  4FWG A;  4EMD A;  4KQV A;  2HFS A;  2O1W A;  4JI3 I;  4JV5 E;  5BR8 E;  4DV0 E;  4B3R I;  1U2R A;  4LF8 E;  2XEX A;  4DV4 I;  4DPY A;  3J7A G;  1NHJ A;  2IOP A;  2VQF I;  2HHH I;  4LF5 E;  1RRE A;  2Z5C A;  2R42 A;  4M1K A;  4DR4 E;  4DR7 E;  3WU5 A;  1RR9 A;  4DUZ I;  4KHP I;  1Z0E A;  4PU9 A;  1XNQ I;  4DR3 E;  4GKJ E;  3QT8 A;  2E1R A;  1ZXN A;  3JAM C;  2Z5C B;  4DR1 E;  1N34 I;  4DPU A;  3LNU A;  2UXB E;  1N32 I;  1MU5 A;  1H7S A;  1N36 I;  3QT5 A;  1H73 A;  3D4J A;  1EI1 A;  4LF9 I;  1IBM E;  2O1V A;  5A2Q Q;  5LMU I;  3Q1Q A;  4USK A;  4DV3 E;  1Z5C A;  4UTG A;  1HR0 I;  3GON A;  2VQE I;  2PNM A;  1BKN A;  4DR2 I;  1HK7 A;  1ZM4 A;  4JYA E;  2J7K A;  4DPX A;  2PNL A;  1KKH A;  5FWK A;  4JI8 I;  1XMO I;  2WW4 A;  1HNW E;  4DV1 I;  1ZM2 A;  2O1T A;  1KIJ A;  1NZ0 A;  1HNZ I;  4DR6 I;  2F4V E;  4NXM I;  4LF7 E;  4JI5 E;  3B78 A;  4DV7 E;  4LFB I;  1FNM A;  1FJG E;  2UU9 E;  2A2D A;  4URL A;  4HYM A;  1FI4 A;  1Z0W A;  4HXZ A;  4YY3 E;  4JI1 E;  1H7U A;  5IT9 Q;  1HNX E;  3LPS A;  3ZZU A;  4OX9 E;  3HUL A;  1D6T A;  3Q6M A;  4JI0 E;  3ZZT A;  4JG4 A;  3OTO E;  4K0K I;  3ZZ0 A;  2HK2 A;  4JI3 E;  1H72 C;  3T1Y I;  1XNR I;  4X62 E;  4RPF A;  3ZKD A;  4B3R E;  1ZM9 A;  3T1H I;  4DPT A;  2UUC I;  1N0V C;  5IWA I;  2CGE A;  2V2Z A;  2HHH E;  4X64 I;  2A2C A;  4HAC A;  4DUY I;  1FKA E;  5GMD A;  2BM0 A;  2LJP A;  1XNQ E;  4WUB A;  4P7A A;  1N34 E;  1Z0C A;  4XTJ A;  4JI6 I;  4JI2 I;  4HAC B;  4JI4 I;  1S4E A;  4JV5 I;  5BR8 I;  3K1J A;  3WU4 A;  2GQ0 A;  4DPW A;  1XMQ E;  1N36 E;  4FN5 A;  3JAM Q;  3QT6 A;  4LF9 E;  3CWV A;  1USU A;  5LMU E;  4IZJ D;  3J81 C;  2UUB I;  1Y4U A;  4LF5 I;  3P06 A;  1HR0 E;  4LF6 E;  4DR7 I;  4DR2 E;  3HJC A;  4JI7 E;  4DV6 I;  3H4L A;  4B3M E;  2X7I A;  4LFC I;  4R1F A;  2HKJ A;  4DR1 I;  4B3T I;  1QZR A;  5FLX Q;  4DV2 I;  2UXB I;  3J80 Q;  4MYT A;  1EA6 A;  4UT4 A;  4MYU A;  4GKK E;  1B63 A;  4DR5 E;  1NHI A;  4NXN I;  4DV1 E;  1IBK E;  1I94 E;  4FWH A;  1ZM3 A;  2CZ9 A;  2ZM6 I;  4DV5 E;  3B8H A;  4NXM E;  4LF4 I;  5GME A;  2E5L E;  2ZIT A;  1NHH A;  2UXD I;  4X66 I;  2Q2E B;  1PKP A;  1Z0B A;  2Z5E A;  1PVG A;  1KVK A;  1IBL E;  3J7A M;  2DEJ A;  1J5E I;  4LFA E;  2AJ4 A;  1N33 I;  4B3S E;  1OJ4 A;  2V2V A;  2UUA I;  2BV3 A;  5LMN I;  2F4V I;  1ZXM A;  4K0K E;  4X65 E;  1PIE A;  3ZM7 A;  3T1Y E;  2UXC I;  3PYD A;  1XNR E;  1FWL A;  4DV7 I;  4N3O A;  3WU3 A;  1A6F A;  4IZK A;  3LTO A;  2IOQ A;  1FJG I;  2V2Q A;  1VIS A;  3ZKB A;  5IWA E;  4AQY I;  4DV4 E;  4YY3 I;  4IZJ A;  2GS8 A;  4IZK B;  4X64 E;  4ZVI A;  2VQF E;  1Y6Z A;  2R3V A;  4I3H A;  4DXL A;  4YHH I;  4JI0 I;  3V2U C;  1KTV A;  1H74 A;  3OTO I;  1MX0 A;  4IZJ B;  4DUZ E;  4KHP E;  2DEI A;  4JI6 E;  4JI2 E;  4JI4 E;  4X62 I;  3WU6 A;  4PRV A;  4DV0 I;  1N32 E;  4LF8 I;  3K17 A;  2UUB E;  4HY1 A;  4P52 A;  2CG9 A;  2EFG A;  3J81 Q;  4DV6 E;  2VQE E;  4DR4 I;  4LFC E;  4B3T E;  2X36 A;  2ZBK B;  4DV2 E;  4DR3 I;  2V34 A;  3Q6N A;  4GKJ I;  3QT7 A;  5A2Q C;  3PYG A;  1XMQ I;  1FWK A;  4JI8 E;  5LL6 R;  1XMO E;  4NXN E;  1S16 A;  2O1U A;  2ZM6 E;  1UEK A;  1Z5B A;  2OI2 A;  1IBM I;  4WUD A;  3PRY A;  4LF4 E;  1K47 A;  1HNZ E;  4LF6 I;  4DV3 I;  2VF3 A;  5FLX C;  4DR6 E;  2UXD E;  1XHK A;  3J80 C;  4X66 E;  3K85 A;  1B62 A;  4JI7 I;  1Z5A A;  4B3M I;  4DU8 A;  1DAR A;  4LFB E;  2BM1 A;  4JYA I;  4FWD A;  1USV A;  2HKE A;  3B82 A;  4GKK I;  1J5E E;  2V8P A;  4DR5 I;  3F0N A;  1N33 E;  4WUC A;  4Z7Y A;  1IBK I;  1I94 I;  4FW9 A;  4DV5 I;  1HNW I;  1WUU A;  1Y4S A;  2UUA E;  5LMN E;  1MG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...