4LF8I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8I00
4ZVIA 4FW9A 3QT6A 3OTOE 1Z5BA 3QT5A 3J81Q 4LF6I 1XNQE 2VQEI 3WU6A 4ED4A 2VQFE 1Z5AA 3PYDA 1VISA 3WU3A 1HNZI 1XNRE 4LFAI 4DPXA 4HACA 5GMDA 1FJGI 4DV0E 1D6TA 1Z0GA 1N0UA 2VQFI 4KHPE 5LMUE 5IT9C 3T1HE 4JI2I 2HKEA 4DPUA 5A2QQ 2R42A 4JI7E 4B3RE 4DV2I 4YHHE 4DR2E 3ZZ0A 4JI1I 1RREA 4NXME 3ZKDA 2UUCI 4DR3I 1PIEA 4X62E 4DV6I 1HNXI 5IT9Q 1H73A 4X65I 4B3ME 2ZBKB 1IBKI 1Z5CA 1PVGA 2UUAE 5FLXC 1XMQE 3T1YE 2DEIA 3K17A 1MU5A 2UU9E 4YHHI 3J80C 2AJ4A 1I94E 2WW4A 4LF4E 2UXBE 1IBLI 1H72C 5GMEA 1HR0E 2GS8A 1ZM3A 4LFCE 1U2RA 2CZ9A 4DV7E 4MYTA 2V34A 4FWHA 4DR7I 4XTJA 4WUBA 2UUAI 3J80Q 4DR4E 2HKJA 1NHIA 4Z7CA 3J7AG 1N32E 3CWVA 4UTGA 1ZM9A 2V2QA 4JYAI 1ZM4A 2HFSA 1MX0A 2E5LI 4YY3I 4LF6E 4FWGA 4LFCI 3F0NA 2VQEE 4LF7I 1B63A 2BV3A 1FNMA 4LF5I 4I3HA 5BR8I 4X66I 1N36I 1Z0EA 1HNWI 1HNZE 4DUZE 1NZ0A 4LFAE 1NHHA 1DARA 1KKHA 2UXDI 4HY1A 4DPTA 1Z0CA 4URLA 1FJGE 4DU8A 3PYGA 4JG4A 2X7IA 2ZM6I 3M6AA 4JI2E 4NXNE 2XEXA 4DV2E 4DUZI 4JI1E 4AQYI 1FWKA 5A2QC 2UUCE 4DR3E 4JI0I 2UUBI 4DPWA 4DV6E 1N34I 1HNXE 1ZXMA 4X65E 3HULA 4LFBI 1EI1A 1IBKE 4DPYA 2HHHI 4NXNI 3WU4A 4LF9I 2HFUA 1EA6A 1BKNA 1NHJA 4JI3I 4JI5I 1IBLE 2X36A 1XMOI 4JI4I 1WUUA 1FWLA 4DR7E 3QT7A 2UXCI 4R1FA 1ELOA 4DR6I 3LPSA 4DUYI 4B3TI 2BM1A 5IWAI 4JI6E 4JYAE 2A2DA 3ZZTA 4X64I 3WU5A 4OX9I 2HK3A 1H7SA 2E5LE 1N33I 4YY3E 1XHKA 5LMNI 1S16A 4LF7E 2A2CA 2NPFA 2ZITA 1H7UA 3PYFA 1MG7A 2E1RA 2DEJA 4RPFA 4FWDA 4JI6I 4LF5E 4Z7YA 3JAMC 4WUCA 5BR8E 3GONA 4HXZA 4X66E 4DV1E 1Z59A 1N36E 1HNWE 4DV3I 4MYUA 1RR9A 4PRXA 4DR5I 1FKAE 2LJPA 4K0KI 1Z0VA 2UXDE 3LNUA 3D4JA 3JAMQ 1UEKA 2ZM6E 4GKJI 4JI8I 4LF8I 4FN5A 4DV5I 1OJ4A 4DV1I 1QZRA 4DU7A 3ZM7A 3V2UC 5LL6R 4AQYE 3H4LA 4B3SI 2UUBE 4JI0E 3B82A 1N34E 3V5RA 4DR1I 1J5EI 1N0VC 4GKKI 4LFBE 1IBMI 2HHHE 4JV5I 4DV4E 3B8HA 4LF9E 1K47A 2F4VI 2V8PA 4JI3E 4HYMA 4JI5E 3K1JA 1XMOE 4JI4E 1A6FA 4WUDA 1B62A 2V2VA 3OTOI 4DV4I 2UXCE 4P7AA 4DR6E 4USMA 4B3TE 4DUYE 1XNQI 5IWAE 3ZKBA 4X64E 1Z0BA 4OX9E 1KVKA 4KQVA 3LTOA 3J7AM 1N33E 4M1KA 5LMNE 1FI4A 1XNRI 2V2ZA 4PU9A 2Q2EB 2R3VA 3QT8A 4DV0I 3ZZUA 4DV3E 4KHPI 5LMUI 5L3JA 3T1HI 4DXLA 4DR5E 4K0KE 1Z0TA 4JI7I 4B3RI 4DR2I 1H74A 4USKA 4NXMI 4GKJE 4JI8E 2BM0A 4X62I 4LF8E 1KIJA 4DV5E 1PKPA 5FLXQ 4HACB 4B3MI 4B3SE 2EFGA 1XMQI 3T1YI 1Z0WA 1ZXNA 2UU9I 4DR1E 1J5EE 4PRVA 4GKKE 1I94I 3B78A 2VF3A 4LF4I 2UXBI 1HR0I 1IBME 1ZM2A 4JV5E 2F4VE 2HK2A 4DV7I 4UT4A 4P52A 3Q1QA 2J7KA 4DR4I 3J81C 3PYEA 1N32I 2OI2A 1S4EA 1KTVA 4EMDA
chains in the Genus database with same CATH superfamily
4ZVIA 4FW9A 3QT6A 3OTOE 1Z5BA 3P3GA 3QT5A 2JEAB 2IERA 3J81Q 4LF6I 2C37B 1XXEA 1OYRA 1XNQE 2VQEI 2PO0B 3WU6A 3GCMA 3U1KA 2O1UA 4LOMA 1UDNA 2JE6B 4ED4A 2VQFE 3P3EA 1Z5AA 3HKMA 3PYDA 4IFDC 1VISA 3WU3A 3M85G 1HNZI 1XNRE 4LFAI 4DPXA 4HACA 5K36B 5GMDA 1FJGI 2O3ZA 4DV0E 3GMEA 1D6TA 1Z0GA 1N0UA 2VQFI 3P3CA 4KHPE 4LCGA 5LMUE 5IT9C 5C0XC 3KRNA 3T1HE 4JI2I 2HKEA 4DPUA 5K36F 4U3DA 1E3PA 5A2QQ 2R42A 4MDTA 3DD6A 4IFDD 4JI7E 2PNMA 5JEAF 2IOPA 4DV2I 4YHHE 4DR2E 4B3RE 3ZZ0A 3M7ND 4JI1I 1RREA 4OO1E 4NXME 3ZKDA 2UUCI 4DR3I 1PIEA 4X62E 4DV6I 1HNXI 5IT9Q 1H73A 4X65I 4B3ME 1UDQA 2ZBKB 1IBKI 1Z5CA 1PVGA 5C0XD 2UUAE 5FLXC 2WNRA 1XMQE 3T1YE 4GQUA 2DEIA 3K17A 1MU5A 2UU9E 4YHHI 1YHCA 2PNLA 3J80C 2AJ4A 1I94E 2JEAA 2WW4A 4LF4E 4OZEA 2UXBE 1IBLI 1H72C 5GMEA 1HR0E 2C38B 2PO0A 5K36C 2GS8A 1ZM3A 4LFCE 1U2RA 2CZ9A 4DV7E 4MYTA 5DRQA 2V34A 4BA1B 4FWHA 4DR7I 4XTJA 4WUBA 2UUAI 3J80Q 4DR4E 2HKJA 1NHIA 4Z7CA 3J7AG 1R6LA 1N32E 3CWVA 4UTGA 5DRPA 2IOQA 1ZM9A 2V2QA 2BR2B 4JYAI 2JT2A 1ZM4A 1P42A 2HFSA 1MX0A 2E5LI 4YY3I 4LF6E 4FWGA 4LFCI 4IFDF 3F0NA 3U1YA 5K36A 2PO1B 3HJCA 2VESA 2VQEE 4LF7I 1B63A 5JEAA 3K85A 2C39A 5C0XB 2BV3A 1FNMA 1E3HA 4LF5I 4AIDA 4I3HA 5BR8I 4BA2B 2Z5BB 4X66I 1N36I 1Z0EA 5C0XF 4IZKB 1VI7A 1HNWI 1HNZE 4DUZE 1USVA 1NZ0A 4LFAE 1NHHA 2JEBB 3H1CA 1DARA 1KKHA 2UXDI 4HY1A 4DPTA 1Z0CA 4URLA 1FJGE 4DU8A 3PYGA 4JG4A 2X7IA 2ZM6I 3M6AA 4JI2E 4IZJD 2BA1G 3NZKA 4NXNE 2XEXA 2PNZB 2AE8A 4DV2E 4DUZI 4JI1E 4AQYI 1FWKA 5A2QC 2C38A 2UUCE 4DR3E 4JI0I 2UUBI 4DPWA 1HK7A 4DV6E 1N34I 1HNXE 1ZXMA 4X65E 2CG9A 2CVEA 3HULA 4LFBI 4IFDE 2CGEA 1EI1A 1IBKE 4DPYA 3PS1A 4LCHA 2HHHI 4NXNI 3WU4A 4IFDA 4LF9I 2HFUA 1Y5YA 4N3OA 1EA6A 3L7ZB 1BKNA 1NHJA 4JI3I 4JI5I 2WP8B 1IBLE 2X36A 1XMOI 2NN6B 4JI4I 3PS3A 1WUUA 1FWLA 4MU1A 5C0XA 4DR7E 3QT7A 2UXCI 4R1FA 2IESA 4IZJB 4BA2A 1ELOA 3UHMA 4AM3A 2Z5BA 4DR6I 3LPSA 4FW3A 4DUYI 4B3TI 2BM1A 5IWAI 4IZKA 3PRYA 4JI6E 4JYAE 2A2DA 3ZZTA 4X64I 3WU5A 2C37A 4OO1D 4OX9I 4MU3A 4QNJA 2HK3A 1H7SA 2E5LE 1N33I 2JEBA 4YY3E 1XHKA 2O1VA 5LMNI 2JE6A 1S16A 4LF7E 2A2CA 2NPFA 2ZITA 5FWKA 1YH8A 1H7UA 3PYFA 1MG7A 2E1RA 2DEJA 4RPFA 4FWDA 4JI6I 2PNZA 4LF5E 4Z7YA 2PO2B 3JAMC 4FW7A 4U3BA 4WUCA 5BR8E 3GONA 4HXZA 4X66E 4DV1E 1Z59A 1N36E 5K36E 1HNWE 4DV3I 4MYUA 1RR9A 4PRXA 2NN6C 1Y6ZA 5JEAE 4DR5I 1FKAE 2LJPA 4FW6A 4K0KI 1Z0VA 2UXDE 1OYSA 3LNUA 3D4JA 3JAMQ 1UEKA 1RHYA 2ZM6E 4GKJI 3CDIA 4JI8I 1Y4UA 4LF8I 4FN5A 4DV5I 2BA0D 1OJ4A 4DV1I 1QZRA 4DU7A 3ZM7A 4OO1B 3V2UC 4FW5A 5LL6R 2WP8A 4AQYE 3H4LA 1UDOA 2NN6D 4B3SI 2UUBE 4JI0E 3B82A 1N34E 3V5RA 4MU4A 4DR1I 3M7NG 3GLLA 1J5EI 1N0VC 4GKKI 4AIMA 5ELWA 4LFBE 4IZJA 5DROA 1IBMI 2HHHE 4JV5I 4DV4E 3B8HA 4LF9E 1K47A 2F4VI 1R6MA 2V8PA 2Z5CB 4JI3E 4HYMA 4JI5E 3K1JA 1XMOE 3Q6MA 4BA1A 4JI4E 1A6FA 4WUDA 1B62A 2GO4A 2V2VA 3OTOI 3B4TA 4DV4I 2BR2A 2UXCE 2PO2A 4P7AA 4DR6E 4USMA 4B3TE 4DUYE 4OO1C 1XNQI 5IWAE 3ZKBA 4X64E 1UDSA 1Z0BA 4OX9E 2PO1A 1KVKA 4KQVA 3LTOA 3J7AM 1N33E 4M1KA 5JEAB 5C0XE 4LPFA 5DRRA 5LMNE 2C39B 2F1DA 2NN6F 1FI4A 1XNRI 2V2ZA 4PU9A 1Y4SA 2Q2EB 4QNKA 4OO1A 2R3VA 3P76A 2BA1D 3QT8A 4DV0I 3ZZUA 3M85D 4DV3E 4KHPI 4IS9A 5LMUI 5L3JA 3T1HI 3Q6NA 2O1WA 2BA0G 4DXLA 4DR5E 4K0KE 1Z0TA 3PS2A 2J65A 4JI7I 4B3RI 4DR2I 1H74A 4USKA 4NXMI 4GKJE 4JI8E 2BM0A 4MU0A 4OKGA 4X62I 4LF8E 1KIJA 4DV5E 5EL9A 1PKPA 4ISAA 2Z5CA 4LCFA 5FLXQ 4HACB 4B3MI 4J3DA 5JEAC 4B3SE 2EFGA 1XMQI 3T1YI 1Z0WA 1ZXNA 1USUA 2O1TA 2UU9I 2GQ0A 4DR1E 1J5EE 4PRVA 4NBQA 4GKKE 1I94I 4IFDB 3B78A 2VF3A 4LF4I 2UXBI 2GO3A 3L7ZA 1HR0I 1IBME 1ZM2A 4JV5E 2Z5EA 2NN6E 2F4VE 2HK2A 4DV7I 3P06A 4UT4A 4P52A 5K36D 5DNXA 2J7KA 3Q1QA 2NN6A 4MQYA 4DR4I 3J81C 1Y60A 5JEAD 5DNLA 4OO1F 3PYEA 1N32I 4FW4A 2OI2A 1S4EA 1KTVA 2WNRB 4EMDA 3CDJA 5EKWA 1OYPA
chains in the Genus database with same CATH topology
4ZVIA 4FW9A 3QT6A 3OTOE 1Z5BA 3QT5A 3J81Q 4LF6I 1XNQE 2VQEI 3WU6A 2O1UA 4ED4A 2VQFE 1Z5AA 3PYDA 1VISA 3WU3A 1HNZI 1XNRE 4LFAI 4DPXA 4HACA 5GMDA 1FJGI 4DV0E 1D6TA 1Z0GA 1N0UA 2VQFI 4KHPE 5LMUE 5IT9C 3T1HE 4JI2I 2HKEA 4DPUA 5A2QQ 2R42A 4JI7E 2PNMA 4B3RE 2IOPA 4DV2I 4YHHE 4DR2E 3ZZ0A 4JI1I 1RREA 4NXME 3ZKDA 2UUCI 4DR3I 1PIEA 4X62E 4DV6I 1HNXI 5IT9Q 1H73A 4X65I 4B3ME 2ZBKB 1IBKI 1Z5CA 1PVGA 2UUAE 5FLXC 1XMQE 3T1YE 2DEIA 3K17A 1MU5A 2UU9E 4YHHI 2PNLA 3J80C 2AJ4A 1I94E 2WW4A 4LF4E 2UXBE 1IBLI 1H72C 5GMEA 1HR0E 2GS8A 1ZM3A 4LFCE 1U2RA 2CZ9A 4DV7E 4MYTA 2V34A 4FWHA 4DR7I 4XTJA 4WUBA 2UUAI 3J80Q 4DR4E 2HKJA 1NHIA 4Z7CA 3J7AG 1N32E 3CWVA 4UTGA 2IOQA 1ZM9A 2V2QA 4JYAI 1ZM4A 2HFSA 1MX0A 2E5LI 4YY3I 4LF6E 4FWGA 4LFCI 3F0NA 3HJCA 2VQEE 4LF7I 1B63A 3K85A 2BV3A 1FNMA 4LF5I 4I3HA 5BR8I 2Z5BB 4X66I 1N36I 1Z0EA 4IZKB 1HNWI 1HNZE 4DUZE 1USVA 1NZ0A 4LFAE 1NHHA 1DARA 1KKHA 2UXDI 4HY1A 4DPTA 1Z0CA 4URLA 1FJGE 4DU8A 3PYGA 4JG4A 2X7IA 2ZM6I 3M6AA 4JI2E 4IZJD 4NXNE 2XEXA 4DV2E 4DUZI 4JI1E 4AQYI 1FWKA 5A2QC 2UUCE 4DR3E 4JI0I 2UUBI 4DPWA 1HK7A 4DV6E 1N34I 1HNXE 1ZXMA 4X65E 2CG9A 3HULA 4LFBI 2CGEA 1EI1A 1IBKE 4DPYA 2HHHI 4NXNI 3WU4A 4LF9I 2HFUA 4N3OA 1EA6A 1BKNA 1NHJA 4JI3I 4JI5I 1IBLE 2X36A 1XMOI 4JI4I 1WUUA 1FWLA 4DR7E 3QT7A 2UXCI 4R1FA 4IZJB 1ELOA 4DR6I 2Z5BA 3LPSA 4DUYI 4B3TI 2BM1A 5IWAI 4IZKA 3PRYA 4JI6E 4JYAE 2A2DA 3ZZTA 4X64I 3WU5A 4OX9I 2HK3A 1H7SA 2E5LE 1N33I 4YY3E 1XHKA 2O1VA 5LMNI 1S16A 4LF7E 2A2CA 2NPFA 2ZITA 5FWKA 1H7UA 3PYFA 1MG7A 2E1RA 2DEJA 4RPFA 4FWDA 4JI6I 4LF5E 4Z7YA 3JAMC 4WUCA 5BR8E 3GONA 4HXZA 4X66E 4DV1E 1Z59A 1N36E 1HNWE 4DV3I 4MYUA 1RR9A 4PRXA 1Y6ZA 4DR5I 1FKAE 2LJPA 4K0KI 1Z0VA 2UXDE 3LNUA 3D4JA 3JAMQ 1UEKA 2ZM6E 4GKJI 4JI8I 1Y4UA 4LF8I 4FN5A 4DV5I 1OJ4A 4DV1I 1QZRA 4DU7A 3ZM7A 3V2UC 5LL6R 4AQYE 3H4LA 4B3SI 2UUBE 4JI0E 3B82A 1N34E 3V5RA 4DR1I 1J5EI 1N0VC 4GKKI 4LFBE 4IZJA 1IBMI 2HHHE 4JV5I 4DV4E 3B8HA 4LF9E 1K47A 2F4VI 2V8PA 2Z5CB 4JI3E 4HYMA 4JI5E 3K1JA 1XMOE 3Q6MA 4JI4E 1A6FA 4WUDA 1B62A 2V2VA 3OTOI 4DV4I 2UXCE 4P7AA 4DR6E 4USMA 4B3TE 4DUYE 1XNQI 5IWAE 3ZKBA 4X64E 1Z0BA 4OX9E 1KVKA 4KQVA 3LTOA 3J7AM 1N33E 4M1KA 5LMNE 1FI4A 1XNRI 2V2ZA 4PU9A 1Y4SA 2Q2EB 2R3VA 3QT8A 4DV0I 3ZZUA 4DV3E 4KHPI 5LMUI 5L3JA 3T1HI 3Q6NA 2O1WA 4DXLA 4DR5E 4K0KE 1Z0TA 4JI7I 4B3RI 4DR2I 1H74A 4USKA 4NXMI 4GKJE 4JI8E 2BM0A 4X62I 4LF8E 1KIJA 4DV5E 1PKPA 2Z5CA 5FLXQ 4HACB 4B3MI 4B3SE 2EFGA 1XMQI 3T1YI 1Z0WA 1ZXNA 1USUA 2O1TA 2UU9I 2GQ0A 4DR1E 1J5EE 4PRVA 4GKKE 1I94I 3B78A 2VF3A 4LF4I 2UXBI 1HR0I 1IBME 1ZM2A 4JV5E 2Z5EA 2F4VE 2HK2A 4DV7I 3P06A 4UT4A 4P52A 3Q1QA 2J7KA 4DR4I 3J81C 3PYEA 1N32I 2OI2A 1S4EA 1KTVA 4EMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVI A;  4FW9 A;  3QT6 A;  3OTO E;  1Z5B A;  3QT5 A;  3J81 Q;  4LF6 I;  1XNQ E;  2VQE I;  3WU6 A;  4ED4 A;  2VQF E;  1Z5A A;  3PYD A;  1VIS A;  3WU3 A;  1HNZ I;  1XNR E;  4LFA I;  4DPX A;  4HAC A;  5GMD A;  1FJG I;  4DV0 E;  1D6T A;  1Z0G A;  1N0U A;  2VQF I;  4KHP E;  5LMU E;  5IT9 C;  3T1H E;  4JI2 I;  2HKE A;  4DPU A;  5A2Q Q;  2R42 A;  4JI7 E;  4B3R E;  4DV2 I;  4YHH E;  4DR2 E;  3ZZ0 A;  4JI1 I;  1RRE A;  4NXM E;  3ZKD A;  2UUC I;  4DR3 I;  1PIE A;  4X62 E;  4DV6 I;  1HNX I;  5IT9 Q;  1H73 A;  4X65 I;  4B3M E;  2ZBK B;  1IBK I;  1Z5C A;  1PVG A;  2UUA E;  5FLX C;  1XMQ E;  3T1Y E;  2DEI A;  3K17 A;  1MU5 A;  2UU9 E;  4YHH I;  3J80 C;  2AJ4 A;  1I94 E;  2WW4 A;  4LF4 E;  2UXB E;  1IBL I;  1H72 C;  5GME A;  1HR0 E;  2GS8 A;  1ZM3 A;  4LFC E;  1U2R A;  2CZ9 A;  4DV7 E;  4MYT A;  2V34 A;  4FWH A;  4DR7 I;  4XTJ A;  4WUB A;  2UUA I;  3J80 Q;  4DR4 E;  2HKJ A;  1NHI A;  4Z7C A;  3J7A G;  1N32 E;  3CWV A;  4UTG A;  1ZM9 A;  2V2Q A;  4JYA I;  1ZM4 A;  2HFS A;  1MX0 A;  2E5L I;  4YY3 I;  4LF6 E;  4FWG A;  4LFC I;  3F0N A;  2VQE E;  4LF7 I;  1B63 A;  2BV3 A;  1FNM A;  4LF5 I;  4I3H A;  5BR8 I;  4X66 I;  1N36 I;  1Z0E A;  1HNW I;  1HNZ E;  4DUZ E;  1NZ0 A;  4LFA E;  1NHH A;  1DAR A;  1KKH A;  2UXD I;  4HY1 A;  4DPT A;  1Z0C A;  4URL A;  1FJG E;  4DU8 A;  3PYG A;  4JG4 A;  2X7I A;  2ZM6 I;  3M6A A;  4JI2 E;  4NXN E;  2XEX A;  4DV2 E;  4DUZ I;  4JI1 E;  4AQY I;  1FWK A;  5A2Q C;  2UUC E;  4DR3 E;  4JI0 I;  2UUB I;  4DPW A;  4DV6 E;  1N34 I;  1HNX E;  1ZXM A;  4X65 E;  3HUL A;  4LFB I;  1EI1 A;  1IBK E;  4DPY A;  2HHH I;  4NXN I;  3WU4 A;  4LF9 I;  2HFU A;  1EA6 A;  1BKN A;  1NHJ A;  4JI3 I;  4JI5 I;  1IBL E;  2X36 A;  1XMO I;  4JI4 I;  1WUU A;  1FWL A;  4DR7 E;  3QT7 A;  2UXC I;  4R1F A;  1ELO A;  4DR6 I;  3LPS A;  4DUY I;  4B3T I;  2BM1 A;  5IWA I;  4JI6 E;  4JYA E;  2A2D A;  3ZZT A;  4X64 I;  3WU5 A;  4OX9 I;  2HK3 A;  1H7S A;  2E5L E;  1N33 I;  4YY3 E;  1XHK A;  5LMN I;  1S16 A;  4LF7 E;  2A2C A;  2NPF A;  2ZIT A;  1H7U A;  3PYF A;  1MG7 A;  2E1R A;  2DEJ A;  4RPF A;  4FWD A;  4JI6 I;  4LF5 E;  4Z7Y A;  3JAM C;  4WUC A;  5BR8 E;  3GON A;  4HXZ A;  4X66 E;  4DV1 E;  1Z59 A;  1N36 E;  1HNW E;  4DV3 I;  4MYU A;  1RR9 A;  4PRX A;  4DR5 I;  1FKA E;  2LJP A;  4K0K I;  1Z0V A;  2UXD E;  3LNU A;  3D4J A;  3JAM Q;  1UEK A;  2ZM6 E;  4GKJ I;  4JI8 I;  4LF8 I;  4FN5 A;  4DV5 I;  1OJ4 A;  4DV1 I;  1QZR A;  4DU7 A;  3ZM7 A;  3V2U C;  5LL6 R;  4AQY E;  3H4L A;  4B3S I;  2UUB E;  4JI0 E;  3B82 A;  1N34 E;  3V5R A;  4DR1 I;  1J5E I;  1N0V C;  4GKK I;  4LFB E;  1IBM I;  2HHH E;  4JV5 I;  4DV4 E;  3B8H A;  4LF9 E;  1K47 A;  2F4V I;  2V8P A;  4JI3 E;  4HYM A;  4JI5 E;  3K1J A;  1XMO E;  4JI4 E;  1A6F A;  4WUD A;  1B62 A;  2V2V A;  3OTO I;  4DV4 I;  2UXC E;  4P7A A;  4DR6 E;  4USM A;  4B3T E;  4DUY E;  1XNQ I;  5IWA E;  3ZKB A;  4X64 E;  1Z0B A;  4OX9 E;  1KVK A;  4KQV A;  3LTO A;  3J7A M;  1N33 E;  4M1K A;  5LMN E;  1FI4 A;  1XNR I;  2V2Z A;  4PU9 A;  2Q2E B;  2R3V A;  3QT8 A;  4DV0 I;  3ZZU A;  4DV3 E;  4KHP I;  5LMU I;  5L3J A;  3T1H I;  4DXL A;  4DR5 E;  4K0K E;  1Z0T A;  4JI7 I;  4B3R I;  4DR2 I;  1H74 A;  4USK A;  4NXM I;  4GKJ E;  4JI8 E;  2BM0 A;  4X62 I;  4LF8 E;  1KIJ A;  4DV5 E;  1PKP A;  5FLX Q;  4HAC B;  4B3M I;  4B3S E;  2EFG A;  1XMQ I;  3T1Y I;  1Z0W A;  1ZXN A;  2UU9 I;  4DR1 E;  1J5E E;  4PRV A;  4GKK E;  1I94 I;  3B78 A;  2VF3 A;  4LF4 I;  2UXB I;  1HR0 I;  1IBM E;  1ZM2 A;  4JV5 E;  2F4V E;  2HK2 A;  4DV7 I;  4UT4 A;  4P52 A;  3Q1Q A;  2J7K A;  4DR4 I;  3J81 C;  3PYE A;  1N32 I;  2OI2 A;  1S4E A;  1KTV A;  4EMD A; 
#chains in the Genus database with same CATH topology
 4ZVI A;  4FW9 A;  3QT6 A;  3OTO E;  1Z5B A;  3P3G A;  3QT5 A;  2JEA B;  2IER A;  3J81 Q;  4LF6 I;  2C37 B;  1XXE A;  1OYR A;  1XNQ E;  2VQE I;  2PO0 B;  3WU6 A;  3GCM A;  3U1K A;  2O1U A;  4LOM A;  1UDN A;  2JE6 B;  4ED4 A;  2VQF E;  3P3E A;  1Z5A A;  3HKM A;  3PYD A;  4IFD C;  1VIS A;  3WU3 A;  3M85 G;  1HNZ I;  1XNR E;  4LFA I;  4DPX A;  4HAC A;  5K36 B;  5GMD A;  1FJG I;  2O3Z A;  4DV0 E;  3GME A;  1D6T A;  1Z0G A;  1N0U A;  2VQF I;  3P3C A;  4KHP E;  4LCG A;  5LMU E;  5IT9 C;  5C0X C;  3KRN A;  3T1H E;  4JI2 I;  2HKE A;  4DPU A;  5K36 F;  4U3D A;  1E3P A;  5A2Q Q;  2R42 A;  4MDT A;  3DD6 A;  4IFD D;  4JI7 E;  2PNM A;  5JEA F;  2IOP A;  4DV2 I;  4YHH E;  4DR2 E;  4B3R E;  3ZZ0 A;  3M7N D;  4JI1 I;  1RRE A;  4OO1 E;  4NXM E;  3ZKD A;  2UUC I;  4DR3 I;  1PIE A;  4X62 E;  4DV6 I;  1HNX I;  5IT9 Q;  1H73 A;  4X65 I;  4B3M E;  1UDQ A;  2ZBK B;  1IBK I;  1Z5C A;  1PVG A;  5C0X D;  2UUA E;  5FLX C;  2WNR A;  1XMQ E;  3T1Y E;  4GQU A;  2DEI A;  3K17 A;  1MU5 A;  2UU9 E;  4YHH I;  1YHC A;  2PNL A;  3J80 C;  2AJ4 A;  1I94 E;  2JEA A;  2WW4 A;  4LF4 E;  4OZE A;  2UXB E;  1IBL I;  1H72 C;  5GME A;  1HR0 E;  2C38 B;  2PO0 A;  5K36 C;  2GS8 A;  1ZM3 A;  4LFC E;  1U2R A;  2CZ9 A;  4DV7 E;  4MYT A;  5DRQ A;  2V34 A;  4BA1 B;  4FWH A;  4DR7 I;  4XTJ A;  4WUB A;  2UUA I;  3J80 Q;  4DR4 E;  2HKJ A;  1NHI A;  4Z7C A;  3J7A G;  1R6L A;  1N32 E;  3CWV A;  4UTG A;  5DRP A;  2IOQ A;  1ZM9 A;  2V2Q A;  2BR2 B;  4JYA I;  2JT2 A;  1ZM4 A;  1P42 A;  2HFS A;  1MX0 A;  2E5L I;  4YY3 I;  4LF6 E;  4FWG A;  4LFC I;  4IFD F;  3F0N A;  3U1Y A;  5K36 A;  2PO1 B;  3HJC A;  2VES A;  2VQE E;  4LF7 I;  1B63 A;  5JEA A;  3K85 A;  2C39 A;  5C0X B;  2BV3 A;  1FNM A;  1E3H A;  4LF5 I;  4AID A;  4I3H A;  5BR8 I;  4BA2 B;  2Z5B B;  4X66 I;  1N36 I;  1Z0E A;  5C0X F;  4IZK B;  1VI7 A;  1HNW I;  1HNZ E;  4DUZ E;  1USV A;  1NZ0 A;  4LFA E;  1NHH A;  2JEB B;  3H1C A;  1DAR A;  1KKH A;  2UXD I;  4HY1 A;  4DPT A;  1Z0C A;  4URL A;  1FJG E;  4DU8 A;  3PYG A;  4JG4 A;  2X7I A;  2ZM6 I;  3M6A A;  4JI2 E;  4IZJ D;  2BA1 G;  3NZK A;  4NXN E;  2XEX A;  2PNZ B;  2AE8 A;  4DV2 E;  4DUZ I;  4JI1 E;  4AQY I;  1FWK A;  5A2Q C;  2C38 A;  2UUC E;  4DR3 E;  4JI0 I;  2UUB I;  4DPW A;  1HK7 A;  4DV6 E;  1N34 I;  1HNX E;  1ZXM A;  4X65 E;  2CG9 A;  2CVE A;  3HUL A;  4LFB I;  4IFD E;  2CGE A;  1EI1 A;  1IBK E;  4DPY A;  3PS1 A;  4LCH A;  2HHH I;  4NXN I;  3WU4 A;  4IFD A;  4LF9 I;  2HFU A;  1Y5Y A;  4N3O A;  1EA6 A;  3L7Z B;  1BKN A;  1NHJ A;  4JI3 I;  4JI5 I;  2WP8 B;  1IBL E;  2X36 A;  1XMO I;  2NN6 B;  4JI4 I;  3PS3 A;  1WUU A;  1FWL A;  4MU1 A;  5C0X A;  4DR7 E;  3QT7 A;  2UXC I;  4R1F A;  2IES A;  4IZJ B;  4BA2 A;  1ELO A;  3UHM A;  4AM3 A;  2Z5B A;  4DR6 I;  3LPS A;  4FW3 A;  4DUY I;  4B3T I;  2BM1 A;  5IWA I;  4IZK A;  3PRY A;  4JI6 E;  4JYA E;  2A2D A;  3ZZT A;  4X64 I;  3WU5 A;  2C37 A;  4OO1 D;  4OX9 I;  4MU3 A;  4QNJ A;  2HK3 A;  1H7S A;  2E5L E;  1N33 I;  2JEB A;  4YY3 E;  1XHK A;  2O1V A;  5LMN I;  2JE6 A;  1S16 A;  4LF7 E;  2A2C A;  2NPF A;  2ZIT A;  5FWK A;  1YH8 A;  1H7U A;  3PYF A;  1MG7 A;  2E1R A;  2DEJ A;  4RPF A;  4FWD A;  4JI6 I;  2PNZ A;  4LF5 E;  4Z7Y A;  2PO2 B;  3JAM C;  4FW7 A;  4U3B A;  4WUC A;  5BR8 E;  3GON A;  4HXZ A;  4X66 E;  4DV1 E;  1Z59 A;  1N36 E;  5K36 E;  1HNW E;  4DV3 I;  4MYU A;  1RR9 A;  4PRX A;  2NN6 C;  1Y6Z A;  5JEA E;  4DR5 I;  1FKA E;  2LJP A;  4FW6 A;  4K0K I;  1Z0V A;  2UXD E;  1OYS A;  3LNU A;  3D4J A;  3JAM Q;  1UEK A;  1RHY A;  2ZM6 E;  4GKJ I;  3CDI A;  4JI8 I;  1Y4U A;  4LF8 I;  4FN5 A;  4DV5 I;  2BA0 D;  1OJ4 A;  4DV1 I;  1QZR A;  4DU7 A;  3ZM7 A;  4OO1 B;  3V2U C;  4FW5 A;  5LL6 R;  2WP8 A;  4AQY E;  3H4L A;  1UDO A;  2NN6 D;  4B3S I;  2UUB E;  4JI0 E;  3B82 A;  1N34 E;  3V5R A;  4MU4 A;  4DR1 I;  3M7N G;  3GLL A;  1J5E I;  1N0V C;  4GKK I;  4AIM A;  5ELW A;  4LFB E;  4IZJ A;  5DRO A;  1IBM I;  2HHH E;  4JV5 I;  4DV4 E;  3B8H A;  4LF9 E;  1K47 A;  2F4V I;  1R6M A;  2V8P A;  2Z5C B;  4JI3 E;  4HYM A;  4JI5 E;  3K1J A;  1XMO E;  3Q6M A;  4BA1 A;  4JI4 E;  1A6F A;  4WUD A;  1B62 A;  2GO4 A;  2V2V A;  3OTO I;  3B4T A;  4DV4 I;  2BR2 A;  2UXC E;  2PO2 A;  4P7A A;  4DR6 E;  4USM A;  4B3T E;  4DUY E;  4OO1 C;  1XNQ I;  5IWA E;  3ZKB A;  4X64 E;  1UDS A;  1Z0B A;  4OX9 E;  2PO1 A;  1KVK A;  4KQV A;  3LTO A;  3J7A M;  1N33 E;  4M1K A;  5JEA B;  5C0X E;  4LPF A;  5DRR A;  5LMN E;  2C39 B;  2F1D A;  2NN6 F;  1FI4 A;  1XNR I;  2V2Z A;  4PU9 A;  1Y4S A;  2Q2E B;  4QNK A;  4OO1 A;  2R3V A;  3P76 A;  2BA1 D;  3QT8 A;  4DV0 I;  3ZZU A;  3M85 D;  4DV3 E;  4KHP I;  4IS9 A;  5LMU I;  5L3J A;  3T1H I;  3Q6N A;  2O1W A;  2BA0 G;  4DXL A;  4DR5 E;  4K0K E;  1Z0T A;  3PS2 A;  2J65 A;  4JI7 I;  4B3R I;  4DR2 I;  1H74 A;  4USK A;  4NXM I;  4GKJ E;  4JI8 E;  2BM0 A;  4MU0 A;  4OKG A;  4X62 I;  4LF8 E;  1KIJ A;  4DV5 E;  5EL9 A;  1PKP A;  4ISA A;  2Z5C A;  4LCF A;  5FLX Q;  4HAC B;  4B3M I;  4J3D A;  5JEA C;  4B3S E;  2EFG A;  1XMQ I;  3T1Y I;  1Z0W A;  1ZXN A;  1USU A;  2O1T A;  2UU9 I;  2GQ0 A;  4DR1 E;  1J5E E;  4PRV A;  4NBQ A;  4GKK E;  1I94 I;  4IFD B;  3B78 A;  2VF3 A;  4LF4 I;  2UXB I;  2GO3 A;  3L7Z A;  1HR0 I;  1IBM E;  1ZM2 A;  4JV5 E;  2Z5E A;  2NN6 E;  2F4V E;  2HK2 A;  4DV7 I;  3P06 A;  4UT4 A;  4P52 A;  5K36 D;  5DNX A;  2J7K A;  3Q1Q A;  2NN6 A;  4MQY A;  4DR4 I;  3J81 C;  1Y60 A;  5JEA D;  5DNL A;  4OO1 F;  3PYE A;  1N32 I;  4FW4 A;  2OI2 A;  1S4E A;  1KTV A;  2WNR B;  4EMD A;  3CDJ A;  5EKW A;  1OYP A; 
#chains in the Genus database with same CATH homology
 4ZVI A;  4FW9 A;  3QT6 A;  3OTO E;  1Z5B A;  3QT5 A;  3J81 Q;  4LF6 I;  1XNQ E;  2VQE I;  3WU6 A;  2O1U A;  4ED4 A;  2VQF E;  1Z5A A;  3PYD A;  1VIS A;  3WU3 A;  1HNZ I;  1XNR E;  4LFA I;  4DPX A;  4HAC A;  5GMD A;  1FJG I;  4DV0 E;  1D6T A;  1Z0G A;  1N0U A;  2VQF I;  4KHP E;  5LMU E;  5IT9 C;  3T1H E;  4JI2 I;  2HKE A;  4DPU A;  5A2Q Q;  2R42 A;  4JI7 E;  2PNM A;  4B3R E;  2IOP A;  4DV2 I;  4YHH E;  4DR2 E;  3ZZ0 A;  4JI1 I;  1RRE A;  4NXM E;  3ZKD A;  2UUC I;  4DR3 I;  1PIE A;  4X62 E;  4DV6 I;  1HNX I;  5IT9 Q;  1H73 A;  4X65 I;  4B3M E;  2ZBK B;  1IBK I;  1Z5C A;  1PVG A;  2UUA E;  5FLX C;  1XMQ E;  3T1Y E;  2DEI A;  3K17 A;  1MU5 A;  2UU9 E;  4YHH I;  2PNL A;  3J80 C;  2AJ4 A;  1I94 E;  2WW4 A;  4LF4 E;  2UXB E;  1IBL I;  1H72 C;  5GME A;  1HR0 E;  2GS8 A;  1ZM3 A;  4LFC E;  1U2R A;  2CZ9 A;  4DV7 E;  4MYT A;  2V34 A;  4FWH A;  4DR7 I;  4XTJ A;  4WUB A;  2UUA I;  3J80 Q;  4DR4 E;  2HKJ A;  1NHI A;  4Z7C A;  3J7A G;  1N32 E;  3CWV A;  4UTG A;  2IOQ A;  1ZM9 A;  2V2Q A;  4JYA I;  1ZM4 A;  2HFS A;  1MX0 A;  2E5L I;  4YY3 I;  4LF6 E;  4FWG A;  4LFC I;  3F0N A;  3HJC A;  2VQE E;  4LF7 I;  1B63 A;  3K85 A;  2BV3 A;  1FNM A;  4LF5 I;  4I3H A;  5BR8 I;  2Z5B B;  4X66 I;  1N36 I;  1Z0E A;  4IZK B;  1HNW I;  1HNZ E;  4DUZ E;  1USV A;  1NZ0 A;  4LFA E;  1NHH A;  1DAR A;  1KKH A;  2UXD I;  4HY1 A;  4DPT A;  1Z0C A;  4URL A;  1FJG E;  4DU8 A;  3PYG A;  4JG4 A;  2X7I A;  2ZM6 I;  3M6A A;  4JI2 E;  4IZJ D;  4NXN E;  2XEX A;  4DV2 E;  4DUZ I;  4JI1 E;  4AQY I;  1FWK A;  5A2Q C;  2UUC E;  4DR3 E;  4JI0 I;  2UUB I;  4DPW A;  1HK7 A;  4DV6 E;  1N34 I;  1HNX E;  1ZXM A;  4X65 E;  2CG9 A;  3HUL A;  4LFB I;  2CGE A;  1EI1 A;  1IBK E;  4DPY A;  2HHH I;  4NXN I;  3WU4 A;  4LF9 I;  2HFU A;  4N3O A;  1EA6 A;  1BKN A;  1NHJ A;  4JI3 I;  4JI5 I;  1IBL E;  2X36 A;  1XMO I;  4JI4 I;  1WUU A;  1FWL A;  4DR7 E;  3QT7 A;  2UXC I;  4R1F A;  4IZJ B;  1ELO A;  4DR6 I;  2Z5B A;  3LPS A;  4DUY I;  4B3T I;  2BM1 A;  5IWA I;  4IZK A;  3PRY A;  4JI6 E;  4JYA E;  2A2D A;  3ZZT A;  4X64 I;  3WU5 A;  4OX9 I;  2HK3 A;  1H7S A;  2E5L E;  1N33 I;  4YY3 E;  1XHK A;  2O1V A;  5LMN I;  1S16 A;  4LF7 E;  2A2C A;  2NPF A;  2ZIT A;  5FWK A;  1H7U A;  3PYF A;  1MG7 A;  2E1R A;  2DEJ A;  4RPF A;  4FWD A;  4JI6 I;  4LF5 E;  4Z7Y A;  3JAM C;  4WUC A;  5BR8 E;  3GON A;  4HXZ A;  4X66 E;  4DV1 E;  1Z59 A;  1N36 E;  1HNW E;  4DV3 I;  4MYU A;  1RR9 A;  4PRX A;  1Y6Z A;  4DR5 I;  1FKA E;  2LJP A;  4K0K I;  1Z0V A;  2UXD E;  3LNU A;  3D4J A;  3JAM Q;  1UEK A;  2ZM6 E;  4GKJ I;  4JI8 I;  1Y4U A;  4LF8 I;  4FN5 A;  4DV5 I;  1OJ4 A;  4DV1 I;  1QZR A;  4DU7 A;  3ZM7 A;  3V2U C;  5LL6 R;  4AQY E;  3H4L A;  4B3S I;  2UUB E;  4JI0 E;  3B82 A;  1N34 E;  3V5R A;  4DR1 I;  1J5E I;  1N0V C;  4GKK I;  4LFB E;  4IZJ A;  1IBM I;  2HHH E;  4JV5 I;  4DV4 E;  3B8H A;  4LF9 E;  1K47 A;  2F4V I;  2V8P A;  2Z5C B;  4JI3 E;  4HYM A;  4JI5 E;  3K1J A;  1XMO E;  3Q6M A;  4JI4 E;  1A6F A;  4WUD A;  1B62 A;  2V2V A;  3OTO I;  4DV4 I;  2UXC E;  4P7A A;  4DR6 E;  4USM A;  4B3T E;  4DUY E;  1XNQ I;  5IWA E;  3ZKB A;  4X64 E;  1Z0B A;  4OX9 E;  1KVK A;  4KQV A;  3LTO A;  3J7A M;  1N33 E;  4M1K A;  5LMN E;  1FI4 A;  1XNR I;  2V2Z A;  4PU9 A;  1Y4S A;  2Q2E B;  2R3V A;  3QT8 A;  4DV0 I;  3ZZU A;  4DV3 E;  4KHP I;  5LMU I;  5L3J A;  3T1H I;  3Q6N A;  2O1W A;  4DXL A;  4DR5 E;  4K0K E;  1Z0T A;  4JI7 I;  4B3R I;  4DR2 I;  1H74 A;  4USK A;  4NXM I;  4GKJ E;  4JI8 E;  2BM0 A;  4X62 I;  4LF8 E;  1KIJ A;  4DV5 E;  1PKP A;  2Z5C A;  5FLX Q;  4HAC B;  4B3M I;  4B3S E;  2EFG A;  1XMQ I;  3T1Y I;  1Z0W A;  1ZXN A;  1USU A;  2O1T A;  2UU9 I;  2GQ0 A;  4DR1 E;  1J5E E;  4PRV A;  4GKK E;  1I94 I;  3B78 A;  2VF3 A;  4LF4 I;  2UXB I;  1HR0 I;  1IBM E;  1ZM2 A;  4JV5 E;  2Z5E A;  2F4V E;  2HK2 A;  4DV7 I;  3P06 A;  4UT4 A;  4P52 A;  3Q1Q A;  2J7K A;  4DR4 I;  3J81 C;  3PYE A;  1N32 I;  2OI2 A;  1S4E A;  1KTV A;  4EMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...