4B3TE

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3tE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tE02
1UILA 4LFBE 1YYKA 2UUBI 1YYWA 4JI6E 2A2DA 3PYFA 2X7IA 2UU9I 1RREA 2IHR1 4AQYE 1N34E 3T1HI 3WU3A 3OTOE 4OOGC 1Z59A 4JI0I 1I94I 3PYEA 1Z5AA 1X47A 1Z0VA 2UU9E 3HULA 3T1HE 2LUPB 1XHKA 1EI1A 2DB2A 1RR9A 1UEKA 4DU7A 3HTXA 2ZBKB 4DV4E 1BKNA 4M30A 2RS6A 1FI4A 4XTJA 1IBLE 4B3RI 4JI0E 4NXNI 3ADJA 4LF6I 2LJHA 2XEXA 1FKAE 4LF4I 4WUBA 4DV0E 2E5LE 2F4VE 4JI3I 4DR7I 3PYGA 4NXNE 1T4OA 4RPFA 4LF5I 4K0KI 1FNMA 3JAMQ 1T4LB 4GKKI 4JYAI 4DUZI 4DR7E 1XNQE 4DV1I 2YT4A 1D6TA 4LF5E 3ZM7A 2ZM6I 3J7AM 1X48A 3ZKBA 4KHPI 1H72C 2HK2A 4DV7I 1ZBTA 3T1YI 4Z7YA 4JYAE 2L33A 1EA6A 4DV1E 4DPXA 2B7VA 4I3HA 4MYUA 2ZM6E 4UTGA 2RTXA 4DPUA 3J7Yp 1N33E 4B3SE 3J80Q 2VQEE 4M1KA 5IWAI 4YY3E 4Z7CA 4DV5I 1PIEA 2DEJA 4DKKA 3ADGA 3V2UC 1NHJA 2BM0A 2HKJA 2OI2A 4YHHI 2V8PA 3JAMC 4B3MI 4DR6I 4JI2I 4DR2I 1K47A 1HNWE 1ZXMA 1EKZA 4JI4I 1QZRA 2KHXA 1N0VC 3LPSA 1ZM3A 1HNZE 4HXZA 4DR4I 2DIXA 4DR5I 4LF8E 4YHHE 4B3ME 4JI2E 2CZ9A 4DR2E 1XMOI 4OX9I 4EMDA 4HY1A 3B82A 1OJ4A 2LTSA 4JI4E 4X66I 2HFSA 4UT4A 4DR4E 4DR5E 1MX0A 4NXME 1Z0EA 4JI5I 2MDRA 1N36I 1IBMI 3J80C 3J7AG 1Z5CA 2LBSB 1O0WA 3VYXA 2UUBE 4P52A 4HACA 3H4LA 4DV2I 1WHNA 3K17A 2N3HA 4DXLA 1YYOA 1I94E 4GKJI 3ZZTA 5BR8I 2NUEA 2L2NA 3WU4A 4DV2E 1KKHA 3ZZUA 4JI7I 5LL6R 1KVKA 1ZM2A 2B3TB 4B3RE 2BV3A 2RSMA 1YZ9A 4LF6E 4GKJE 4LF4E 4URLA 3QT6A 3CWVA 5FLXQ 4JI7E 1U2RA 1DARA 3QT5A 1IBKI 4JI3E 2NUFA 4X64I 2UXDI 1KTVA 2DEIA 4K0KE 1HNXI 3F0NA 1KIJA 3LTOA 1S16A 1Z0GA 3D4JA 4GKKE 3PYDA 4DPTA 4DUZE 4X62I 4X64E 2UXDE 2DMYA 3ZKDA 1FJGI 4KHPE 4P7AA 4DV7E 3T1YE 2GS8A 5GMEA 4JV5I 1N0UA 4R1FA 1RC7A 4JI8I 3M6AA 1X49A 1GQEA 4M2ZA 2AJ4A 4WUDA 4JG4A 4KQVA 1FJGE 3ADIA 5LMUI 2L2KB 2NPFA 1Z0WA 4JI1I 4USMA 4HACB 5FLXC 5IWAE 4FW9A 2EZ6A 1B63A 4DV5E 2V2VA 2RS7A 1PKPA 3VYYA 3ZZ0A 5GMDA 2VF3A 4JI1E 2A2CA 2UXBI 4MYTA 4DR6E 4DUYI 4WYQB 4X65I 1NZ0A 1J26A 2NUGA 4DV3I 2E1RA 4DV6I 1WUUA 2EFGA 1XMOE 3C4BA 4OX9E 3Q1QA 4LFBI 2LRSA 4FWDA 4X66E 4JI6I 1UHZA 4DV6E 1RQ0A 2UUCI 1N34I 1DI2A 3J81Q 4PU9A 3OTOI 1MG7A 4DR3I 4JI5E 4FWHA 5A2QQ 4PRXA 1N36E 2B7TA 1IBME 4ZVIA 4B3TI 4ED4A 4HYMA 4LF7I 2UUCE 1Z0TA 4DU8A 4FN5A 4DPYA 4DV4I 4DR3E 2LTRA 1IBLI 4B3TE 3WU6A 2HKEA 2HHHI 1Z5BA 4LF7E 1N32I 4DV0I 1XMQI 2BM1A 2E5LI 2F4VI 4LFCI 5LMNI 5BR8E 4LF9I 3B78A 2V2ZA 2HHHE 2Q2EB 2X36A 2ZITA 1N32E 1MU5A 1HR0I 1XMQE 2WW4A 1PVGA 4PRVA 1J5EI 4DPWA 5L3JA 4LFCE 5LMNE 4LF9E 2VQFI 1T4NA 1H74A 3J81C 1XNQI 3B8HA 1IBKE 2CPNA 2L2MA 3QT7A 3WU5A 1HR0E 2J7KA 5A2QC 1J5EE 2R42A 3K1JA 1VISA 2VQFE 1HNXE 2JVAA 4X8WA 1NHIA 1H73A 1FWLA 3P1XA 2JY9A 1ELOA 4X62E 2R3VA 4WUCA 4USKA 1N33I 4B3SI 2V2QA 2UXCI 1STUA 2L3JA 3LNUA 1WHQA 5IT9Q 2VQEI 1A6FA 2N3GA 1H7UA 4JV5E 4YY3I 1S4EA 4JI8E 1B62A 1H7SA 1Z0BA 2UUAI 2UXCE 4FWGA 1ZXNA 1Z0CA 3C4TA 5LMUE 3LLHA 3ADLA 1HNWI 2HK3A 3GONA 4DR1I 4LFAI 1XNRI 2UUAE 1HNZI 1ZM9A 4LF8I 2LJPA 1QU6A 5CFFE 1NHHA 2V34A 3V5RA 4DR1E 4LFAE 1XNRE 2UXBE 1FWKA 2L3CA 4DUYE 4WFTA 2HFUA 4X65E 4DV3E 4NXMI 2LUQA 4AQYI 1ZM4A 2NA2A 3QT8A 5IT9C
chains in the Genus database with same CATH superfamily
3NZKA 1UILA 1MEYC 4LFBE 2ELZA 3EPLA 1YYKA 1E3PA 2UUBI 1YYWA 4JI6E 2Z5BA 5IXMB 2A2DA 1R6LA 5FWKA 2V85A 2X7IA 3PYFA 1RREA 1IQSA 5JEAB 2UU9I 2IHR1 3B4TA 4AQYE 1BBOA 1N34E 4P78A 2EN4A 4LOMA 4MU3A 3WU3A 3T1HI 3OTOE 4BMJA 4OOGC 3QG5C 2PO1B 2YTNA 2M1SA 2O1UA 1Y5YA 1Z59A 5DNYA 4JI0I 2Z5CB 1I94I 2JXPA 3PYEA 1Z5AA 4MU0A 1X47A 2EN7A 1Z0VA 3K6QA 2UU9E 3HULA 1TF3A 4AIMA 3T1HE 2EMYA 2LUPB 1XHKA 4IZJB 1EI1A 5K36D 2JEBB 2A25A 2DB2A 1RR9A 1UEKA 2O1WA 4DU7A 2BA1G 3HTXA 2ZBKB 2CGEA 4DV4E 1BKNA 5JEAC 5C0XE 4M30A 2FV4B 2RS6A 4O4KA 1FI4A 3L7ZA 4XTJA 4GQUA 1IBLE 1SFEA 2EL4A 3MHSC 4R2SA 4B3RI 2EN8A 2YRKA 4JI0E 4BA1B 4NXNI 2JEAA 2YTPA 5AC4A 3ADJA 4LPFA 4LF6I 1PJSA 2LJHA 2XEXA 1FKAE 2JPAA 3HXLA 4WUBA 4LF4I 2JR1A 2EPMX 1BB8A 4DV0E 2KOUA 2E5LE 2EMAA 3MSWA 4BS9A 4F6NA 2F4VE 4JI3I 2MC6A 5A6KA 4DR7I 2EE8A 4MLQA 2I13A 3PYGA 4J3DA 2PNZB 5K36B 4NXNE 1T4OA 4RPFA 2BA0G 4LF5I 2K4VA 4K0KI 3BIDA 4M0VA 1FNMA 3JAMQ 1T4LB 4ISAA 4GKKI 4JYAI 4DUZI 3L00A 3K85A 2CG9A 2JOXA 4DR7E 2PO1A 1XNQE 5ADZA 2YT4A 2EMIA 1A1JA 4DV1I 2NABA 1D6TA 1BBGA 1A1HA 4WSGA 5LLQA 4LF5E 3ZM7A 3AV0A 2ZM6I 2LT7A 1X48A 3ZKBA 3J7AM 4KHPI 4AIDA 5K36C 2M4IA 2RPCA 1H72C 2HK2A 1N3GA 1EH7A 4DV7I 1ZBTA 3T1YI 4Z7YA 4JYAE 2EQ1A 2L33A 2ELYA 1EA6A 1P47A 4DV1E 4LCHA 2PO0B 3M7NG 2ADRA 2WP8B 4DPXA 2EM5A 2B7VA 2BA0D 4BA1A 2LE2A 4I3HA 4MYUA 2V87A 2ZM6E 3IWDA 4FW7A 4UTGA 2RTXA 4DPUA 2NN6B 3J7Yp 1YUIA 2PNLA 2V83A 1N33E 4O43A 4B3SE 4IS9A 1YUJA 1X6EA 2EMZA 2EN6A 2Z5BB 3M85D 3J80Q 2EN1A 2VQEE 4M1KA 2EPAA 2V8QB 5IWAI 2EOJA 1YFHA 5A6AA 4YY3E 4QNJA 3C6KA 1A1IA 4Z7CA 1G2DC 4DV5I 1PIEA 2DEJA 4DKKA 3ADGA 2E1MA 1NHJA 2O3ZA 2BM0A 3V2UC 1Z1BA 2NN6C 4F2JC 2EM9A 2G7HA 2HKJA 2CT1A 3JAMC 1Y4UA 2OI2A 3BF2A 2V8PA 4B3MI 4JI2I 4DR6I 4DR2I 2EL5A 5AE1A 1K47A 4M9VC 1HNWE 1ZXMA 1EKZA 4JI4I 1QZRA 2KHXA 1N0VC 2WNRB 3LPSA 3L7ZB 3LMLA 1ZM3A 1HNZE 5JEAD 4HXZA 4DR4I 2DIXA 4DR5I 2JEAB 4LF8E 2YTGA 4YHHE 1HK7A 2IOPA 5JEAF 4B3ME 4JI2E 2CZ9A 1RHYA 4DR2E 2K7IA 1XMOI 2V86A 2L8TA 1T39A 4EMDA 4HY1A 4OX9I 4N4RB 1UN6B 3B82A 1PJTA 1OJ4A 2LTSA 2EOIA 4JI4E 2EQ3A 4X66I 2O1TA 2HFSA 1SR9A 2EM6A 2EN3A 4UT4A 2EOZA 5EL9A 4DR4E 4R2EA 3DJWA 2YPNA 2WBTA 4DR5E 1MX0A 3AUZA 2PRTA 1OYPA 2GQ0A 4IZJD 2FGGA 2YRHA 4QNKA 3DD6A 4NXME 1Z0EA 2N8XA 2HJJA 4JI5I 1KJKA 4FW4A 2EOSA 2MDRA 4MQYA 1N36I 1IBMI 3J80C 3JU0A 3J7AG 1Z5CA 2LBSB 1O0WA 1X6HA 2IERA 2MC5A 4DMIA 3VYXA 4X9JA 2UUBE 2HGHA 4P52A 3U1YA 2VE7C 2DMIA 2YRMA 4R2CA 4HACA 3H4LA 5TSEA 2C37A 3DF6A 2EPCA 4DV2I 1WHNA 4BC9A 2ENCA 2LO3A 2GLIA 2WNRA 4GZNC 2F8BA 4TUGA 2EOOA 5K36F 2EL6A 4ZYGA 1YHCA 2N3HA 3K17A 4OO1A 3PRYA 4DXLA 1YYOA 1I94E 4NZVA 4GKJI 3ZZTA 5BR8I 2NUEA 2L2NA 3WU4A 4DV2E 1KKHA 3ZZUA 4BCAA 4JI7I 4AM3A 1ZR9A 5JEAE 5LL6R 2C39A 1KVKA 1ZM2A 2B3TB 4B3RE 2BV3A 2EMGA 2RSMA 1AAYA 1YZ9A 4LF6E 4GKJE 2WBSA 2EWLA 3ECRA 4LF4E 2F1DA 3QT6A 4URLA 3CWVA 5DNXA 3HPZA 5FLXQ 4JI7E 1U2RA 1DARA 3QT5A 1UDQA 3Q6MA 1IBKI 4JI3E 1F2IG 2NN6D 4FW6A 5C0XA 2NUFA 3M85G 2GO3A 4X64I 3EPJA 3H09A 1ZAAC 2EM8A 2UXDI 4N3OA 1KTVA 2DEIA 2NN6F 5EKWA 4K0KE 1VI7A 1HNXI 3F0NA 1KIJA 3LTOA 2EQ0A 2D9HA 1S16A 1R6MA 1Z0GA 3CDIA 3D4JA 3P76A 4Q28A 3HPSA 4GKKE 2EMLA 1AH5A 2EPKX 3H1CA 3EQ1A 4DUZE 3THOB 1TN9A 3PYDA 4DPTA 1UDNA 2EM0A 4R03A 1WXRA 1OYRA 4X62I 1YH8A 4X64E 1ZBQA 2UXDE 2EOMA 4U3BA 1YPNA 2EOHA 2DMYA 1WJPA 3MHHC 2EM7A 3ZKDA 4KHPE 4P7AA 2EM4A 1FJGI 3PS2A 5K36E 5DNLA 4DV7E 3T1YE 2M9AA 4YHHI 2GS8A 4R2AA 4ZYDA 2YTQA 5GMEA 1PDAA 4JV5I 1N0UA 2EOXA 4R1FA 4BBYA 2WBUA 1RC7A 1YSAC 4JI8I 3M6AA 1X49A 1GQEA 4M2ZA 2AJ4A 4WUDA 3ZOQB 4JG4A 4KQVA 1FJGE 3F6GA 2YTJA 3ADIA 5LMUI 3VK6A 4WX9A 2EMHA 2L2KB 4IFDB 2EPLX 2NPFA 4ZYHA 1Z0WA 4JI1I 2ENAA 2DGCA 4RHBB 4HACB 5FLXC 4USMA 1RMDA 2C37B 4U3DA 5IWAE 2DRPA 4R2RA 2YTDA 4MU1A 4FW9A 4FW3A 2EPZA 2EJ4A 2EMBA 2EZ6A 1B63A 2JT2A 4DV5E 4WXDA 2EMXA 2EPUA 2RS7A 2V2VA 1PKPA 3VYYA 4R2DA 2NN6E 5DRQA 5GMDA 2VF3A 3ZZ0A 4OO1B 4JI1E 2A2CA 2UXBI 4MYTA 4DR6E 4DUYI 2JYAA 1LLMC 4IFDC 1ZU1A 4WYQB 4X65I 1OYSA 2EORA 2EPPA 1NZ0A 4WSPA 2GHFA 1J26A 2NUGA 2BR2A 2C39B 4DV3I 2CSHA 4BA2B 4IZKA 2JE6A 2EP3A 2E1RA 4DV6I 4KWYA 2IOQA 1A1LA 2AE8A 1WUUA 3THNA 2EFGA 1GZ6A 3GLLA 3M7ND 2V88A 3UHMA 1XMOE 1MGTA 3C4BA 4OX9E 3Q1QA 4OO1C 1KYQA 4LFBI 2DSYA 2LRSA 2RSIA 5AC5A 4FWDA 3M99B 4X66E 4JI6I 2MKDA 1UHZA 2EM3A 2C38B 1NCSA 4DV6E 1RQ0A 2UUCI 5C0XB 1L4SA 1G2FC 2IESA 2DLQA 1DI2A 1UDOA 1X5WA 2JWOA 3GMEA 3J81Q 2YTEA 1N34I 4IFDA 1IMUA 4PU9A 3OTOI 5KL3A 1MG7A 4NHRA 4DR3I 1B69A 2BB8A 5DRPA 5A6BA 4JI5E 4FWHA 1IQOA 5A2QQ 3C6MA 3RMPA 1N36E 2B7TA 1IBME 4PRXA 4ZVIA 4ED4A 1EH6A 5KL4A 4B3TI 4HYMA 4RH8A 3BBGA 2LMZA 3BGHA 2UUCE 2PNMA 4LF7I 2LJUA 1UBDC 2YSOA 1Z0TA 4DU8A 2EMCA 2YTFA 4FN5A 4DPYA 5C0XC 2M7QA 2LTRA 2EOEA 4DR3E 4DV4I 1JK2A 2EPRA 4P7DA 4IS1C 1E3HA 4FW5A 1IBLI 1XXEA 4R2PA 1QNTA 2H36X 5T6JA 4B3TE 2EMWA 3WU6A 2HKEA 2HHHI 2RQLA 1Z5BA 2L6MA 4LF7E 2PO2A 4BA2A 1N32I 3KWRA 4NBQA 3IWBA 1USUA 4ZYEA 4MLVA 5A6JA 2BM1A 4DV0I 1XMQI 2E5LI 1DQ3A 3EPKA 2F4VI 2CTDA 2L92A 2YSPA 4LFCI 5LMNI 5BR8E 4F6MA 1WRJA 4LF9I 2HC5A 3B78A 3U1KA 2V2ZA 2ODRD 2V89A 2Q8UA 3JTZA 5KL7A 5KL2A 2HHHE 2O1VA 2Q2EB 2X36A 2ZITA 1N32E 2C38A 1MU5A 1HR0I 3PS1A 2JOBA 1XMQE 4Q35B 3CDJA 2WW4A 1PVGA 1TF6A 4PRVA 1J5EI 4DPWA 5L3JA 1UDSA 4LFCE 5LMNE 4LF9E 2VQFI 1T4NA 2EPXA 1H74A 3J81C 1EH8A 1USVA 1Y60A 1T38A 3VHTB 1XNQI 2J65A 2GPIA 5IV8B 3B8HA 4GEQB 2CPNA 2L2MA 1IBKE 5AASA 3QT7A 5DRRA 3WU5A 1HR0E 2YTOA 5KL5A 5KL6A 4OZEA 4TUIA 5JEAA 2J7KA 4L5NC 5A2QC 2FTXB 4HEIA 3EPHA 2E72A 4LU9A 1J5EE 2BA1D 2R42A 3K1JA 4IFDD 2I9IA 3OMLA 4F9CB 2BR2B 1VISA 5A69A 2YU5A 2VQFE 4FK5C 2EMKA 2YTIA 1A1FA 2JVAA 4X8WA 2ENHA 1HNXE 2JE6B 4L8NA 4IZKB 4IFDF 5A6BD 2EN2A 4BHCA 4HTGA 4O24A 1NHIA 1H73A 1FWLA 3P1XA 5AE2A 4F54A 4R8OA 2Z5CA 3P3CA 5DROA 2JY9A 4O5GA 1ELOA 2EOQA 4MDTA 4X62E 2R3VA 4WUCA 3IWCA 2GO4A 3KZYA 2Z5EA 4USKA 1N33I 4IZJA 2MKNA 2BBGA 2JEBA 4B3SI 2V2QA 4OO1D 2UXCI 1STUA 2L3JA 3LNUA 2WCC3 1WHQA 4WPYA 1A1KA 2ODRC 1P42A 3TQMA 2VRDA 5IT9Q 2VQEI 4OO1F 2EPNA 1A6FA 1A1GA 2N3GA 4MU4A 2VESA 1H7UA 3KZZA 1GTKA 2LVHA 4JV5E 4YY3I 1S4EA 1X6FA 4JI8E 1B62A 2YZTA 1H7SA 1Z0BA 4LCFA 2UUAI 1X3CA 2UXCE 3GCMA 4LTYA 3PS3A 3HKMA 4FWGA 2JP9A 4OKGA 1ZXNA 1Z0CA 4LCGA 3C4TA 3F6HA 5LMUE 2EM2A 3LLHA 5F3WA 2YWQA 2PNZA 3ADLA 1Y4SA 1PJQA 5K36A 1HNWI 2YU8A 3P3GA 2R1FA 2HK3A 2LCEA 3GONA 4DR1I 4LFAI 1XNRI 5ELWA 1Y6ZA 5AE3A 2KONA 3P3EA 2UUAE 1HNZI 5C0XD 2R76A 4R2QA 4BC7A 1ZM9A 4LF8I 4I8OA 2B9DA 3HJCA 2VF1A 4BHBA 2LV2A 2WZOA 2PO2B 5C0XF 2EOYA 4J8ZA 2LJPA 1QU6A 3KRNA 5CFFE 1NHHA 4WXCA 1DGCA 2V34A 3V5RA 4DR1E 4LFAE 2DLKA 4F9BB 1XNRE 3P06A 2UXBE 3UK3C 1NEIA 1FWKA 4IFDE 2L3CA 4DUYE 4WFTA 2HFUA 4X65E 2EPOA 3FIGA 1JK1A 2EOFA 4F9AB 4DV3E 3HQ1A 4NXMI 2PO0A 2WP8A 2EMFA 3Q6NA 2LUQA 4AQYI 2CVEA 2J7JA 1ZM4A 2NA2A 2MDGA 4IJDA 4KZSA 3QT8A 2NN6A 5IT9C 4OO1E
chains in the Genus database with same CATH topology
1UILA 4LFBE 1YYKA 2UUBI 1YYWA 4JI6E 2Z5BA 5FWKA 2A2DA 2V85A 2X7IA 3PYFA 1RREA 2UU9I 2IHR1 4AQYE 1N34E 4P78A 3T1HI 3WU3A 3OTOE 4BMJA 4OOGC 2O1UA 2M1SA 1Z59A 5DNYA 4JI0I 2Z5CB 1I94I 3PYEA 1Z5AA 1X47A 1Z0VA 3K6QA 2UU9E 3HULA 3T1HE 2LUPB 1XHKA 4IZJB 1EI1A 2DB2A 1RR9A 1UEKA 2O1WA 4DU7A 3HTXA 2ZBKB 2CGEA 4DV4E 1BKNA 4M30A 2FV4B 2RS6A 1FI4A 4XTJA 1IBLE 4B3RI 4JI0E 4NXNI 3ADJA 4LF6I 2LJHA 2XEXA 1FKAE 4LF4I 3HXLA 4WUBA 2JR1A 4DV0E 2KOUA 2E5LE 3MSWA 4BS9A 2F4VE 4JI3I 2MC6A 4DR7I 3PYGA 4NXNE 1T4OA 4RPFA 4LF5I 2K4VA 4K0KI 4M0VA 1FNMA 3JAMQ 1T4LB 4GKKI 4JYAI 4DUZI 3K85A 2CG9A 2JOXA 4DR7E 1XNQE 5ADZA 2YT4A 4DV1I 1D6TA 4LF5E 3ZM7A 3AV0A 2ZM6I 3J7AM 1X48A 3ZKBA 4KHPI 2M4IA 1H72C 2HK2A 4DV7I 1ZBTA 3T1YI 4Z7YA 4JYAE 2L33A 1EA6A 4DV1E 4DPXA 2B7VA 2LE2A 4I3HA 4MYUA 2V87A 2ZM6E 3IWDA 4UTGA 2RTXA 4DPUA 3J7Yp 2PNLA 2V83A 1N33E 4B3SE 2Z5BB 3J80Q 2VQEE 4M1KA 2V8QB 5IWAI 4YY3E 4Z7CA 4DV5I 1PIEA 2DEJA 4DKKA 3ADGA 2E1MA 1NHJA 3V2UC 2BM0A 2HKJA 2G7HA 2OI2A 4YHHI 3JAMC 1Y4UA 2V8PA 4B3MI 4DR6I 4JI2I 4DR2I 5AE1A 1K47A 1HNWE 1ZXMA 1EKZA 4JI4I 1QZRA 2KHXA 1N0VC 3LPSA 3LMLA 1ZM3A 1HNZE 4HXZA 4DR4I 2DIXA 4DR5I 4LF8E 2IOPA 4YHHE 1HK7A 4B3ME 4JI2E 2CZ9A 4DR2E 1XMOI 2V86A 2L8TA 4EMDA 4OX9I 4HY1A 3B82A 1OJ4A 2LTSA 4JI4E 4X66I 2O1TA 2HFSA 1SR9A 4UT4A 4DR4E 3DJWA 4DR5E 1MX0A 4IZJD 3AUZA 2GQ0A 2FGGA 4NXME 1Z0EA 4JI5I 2MDRA 1N36I 1IBMI 3J80C 3JU0A 3J7AG 1Z5CA 2LBSB 1O0WA 2MC5A 4DMIA 3VYXA 2UUBE 4P52A 2VE7C 4HACA 3H4LA 3DF6A 4DV2I 1WHNA 4BC9A 2F8BA 4TUGA 3K17A 2N3HA 3PRYA 4DXLA 1YYOA 1I94E 4GKJI 3ZZTA 5BR8I 2NUEA 2L2NA 3WU4A 4DV2E 1KKHA 3ZZUA 4BCAA 4JI7I 5LL6R 1KVKA 1ZM2A 2B3TB 4B3RE 2BV3A 2RSMA 1YZ9A 4LF6E 4GKJE 4LF4E 2EWLA 4URLA 3QT6A 3CWVA 5FLXQ 3HPZA 4JI7E 1U2RA 1DARA 3QT5A 3Q6MA 1IBKI 4JI3E 2NUFA 4X64I 3H09A 2UXDI 4N3OA 1KTVA 2DEIA 4K0KE 1HNXI 3F0NA 1KIJA 3LTOA 1S16A 1Z0GA 3D4JA 4Q28A 3HPSA 4GKKE 3HJCA 3PYDA 4DPTA 4DUZE 4R03A 1WXRA 4X62I 4X64E 1ZBQA 2UXDE 2DMYA 3ZKDA 1FJGI 4KHPE 4P7AA 4DV7E 3T1YE 2GS8A 5GMEA 4JV5I 1N0UA 4R1FA 4BBYA 1RC7A 4JI8I 3M6AA 1X49A 1GQEA 4M2ZA 2AJ4A 4WUDA 3ZOQB 4JG4A 4KQVA 1FJGE 3F6GA 3ADIA 5LMUI 3VK6A 2L2KB 2NPFA 1Z0WA 4JI1I 4USMA 4HACB 5FLXC 5IWAE 4FW9A 2EZ6A 1B63A 4DV5E 2V2VA 2RS7A 1PKPA 3VYYA 3ZZ0A 5GMDA 2VF3A 4JI1E 2A2CA 2UXBI 4MYTA 4DR6E 4DUYI 4WYQB 4X65I 1NZ0A 4WSPA 1J26A 2NUGA 4DV3I 4IZKA 2E1RA 4DV6I 2IOQA 1WUUA 2EFGA 1GZ6A 2V88A 1XMOE 3C4BA 4OX9E 3Q1QA 4LFBI 2DSYA 2LRSA 4FWDA 4X66E 4JI6I 1UHZA 4DV6E 1RQ0A 2UUCI 1N34I 1DI2A 3J81Q 2JWOA 4PU9A 3OTOI 1MG7A 4DR3I 4JI5E 4FWHA 5A2QQ 3RMPA 1N36E 2B7TA 1IBME 4PRXA 4ZVIA 4ED4A 4B3TI 4HYMA 4LF7I 2LMZA 2UUCE 2PNMA 1Z0TA 4DU8A 4FN5A 4DPYA 4DV4I 2M7QA 2LTRA 4DR3E 4P7DA 1IBLI 2H36X 5T6JA 4B3TE 3WU6A 2HKEA 2HHHI 1Z5BA 2L6MA 4LF7E 1N32I 3KWRA 3IWBA 1USUA 4DV0I 1XMQI 2BM1A 2E5LI 1DQ3A 2F4VI 2L92A 4LFCI 5LMNI 5BR8E 4LF9I 3B78A 2V2ZA 2ODRD 2V89A 3JTZA 2HHHE 2O1VA 2Q2EB 2X36A 2ZITA 1N32E 1MU5A 1HR0I 2JOBA 1XMQE 2WW4A 1PVGA 4PRVA 1J5EI 4DPWA 5L3JA 4LFCE 5LMNE 4LF9E 2VQFI 1T4NA 1H74A 3J81C 1USVA 1XNQI 3B8HA 4GEQB 2CPNA 2L2MA 1IBKE 5AASA 3QT7A 3WU5A 1HR0E 4TUIA 2J7KA 4L5NC 5A2QC 2FTXB 4LU9A 1J5EE 2R42A 3K1JA 3OMLA 4F9CB 1VISA 2VQFE 1HNXE 2JVAA 4X8WA 4IZKB 4L8NA 1NHIA 1H73A 1FWLA 3P1XA 5AE2A 4F54A 4R8OA 2Z5CA 2JY9A 1ELOA 4X62E 2R3VA 4WUCA 3IWCA 2Z5EA 4USKA 1N33I 4IZJA 4B3SI 2V2QA 2UXCI 1STUA 2L3JA 3LNUA 1WHQA 4WPYA 2ODRC 5IT9Q 2VQEI 1A6FA 2N3GA 1H7UA 4JV5E 4YY3I 1S4EA 4JI8E 1B62A 2YZTA 1H7SA 1Z0BA 2UUAI 2UXCE 4LTYA 4FWGA 1ZXNA 1Z0CA 3C4TA 3F6HA 5LMUE 3LLHA 5F3WA 3ADLA 1Y4SA 1HNWI 2HK3A 3GONA 4DR1I 4LFAI 1XNRI 1Y6ZA 5AE3A 2KONA 2UUAE 1HNZI 4BC7A 1ZM9A 4LF8I 4I8OA 2B9DA 2VF1A 2WZOA 2LJPA 4J8ZA 1QU6A 5CFFE 1NHHA 2V34A 3V5RA 4DR1E 4LFAE 4F9BB 1XNRE 3P06A 2UXBE 1FWKA 2L3CA 4DUYE 4WFTA 2HFUA 4X65E 3FIGA 4F9AB 4DV3E 3HQ1A 4NXMI 3Q6NA 2LUQA 4AQYI 1ZM4A 2NA2A 4KZSA 3QT8A 5IT9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIL A;  4LFB E;  1YYK A;  2UUB I;  1YYW A;  4JI6 E;  2A2D A;  3PYF A;  2X7I A;  2UU9 I;  1RRE A;  2IHR 1;  4AQY E;  1N34 E;  3T1H I;  3WU3 A;  3OTO E;  4OOG C;  1Z59 A;  4JI0 I;  1I94 I;  3PYE A;  1Z5A A;  1X47 A;  1Z0V A;  2UU9 E;  3HUL A;  3T1H E;  2LUP B;  1XHK A;  1EI1 A;  2DB2 A;  1RR9 A;  1UEK A;  4DU7 A;  3HTX A;  2ZBK B;  4DV4 E;  1BKN A;  4M30 A;  2RS6 A;  1FI4 A;  4XTJ A;  1IBL E;  4B3R I;  4JI0 E;  4NXN I;  3ADJ A;  4LF6 I;  2LJH A;  2XEX A;  1FKA E;  4LF4 I;  4WUB A;  4DV0 E;  2E5L E;  2F4V E;  4JI3 I;  4DR7 I;  3PYG A;  4NXN E;  1T4O A;  4RPF A;  4LF5 I;  4K0K I;  1FNM A;  3JAM Q;  1T4L B;  4GKK I;  4JYA I;  4DUZ I;  4DR7 E;  1XNQ E;  4DV1 I;  2YT4 A;  1D6T A;  4LF5 E;  3ZM7 A;  2ZM6 I;  3J7A M;  1X48 A;  3ZKB A;  4KHP I;  1H72 C;  2HK2 A;  4DV7 I;  1ZBT A;  3T1Y I;  4Z7Y A;  4JYA E;  2L33 A;  1EA6 A;  4DV1 E;  4DPX A;  2B7V A;  4I3H A;  4MYU A;  2ZM6 E;  4UTG A;  2RTX A;  4DPU A;  3J7Y p;  1N33 E;  4B3S E;  3J80 Q;  2VQE E;  4M1K A;  5IWA I;  4YY3 E;  4Z7C A;  4DV5 I;  1PIE A;  2DEJ A;  4DKK A;  3ADG A;  3V2U C;  1NHJ A;  2BM0 A;  2HKJ A;  2OI2 A;  4YHH I;  2V8P A;  3JAM C;  4B3M I;  4DR6 I;  4JI2 I;  4DR2 I;  1K47 A;  1HNW E;  1ZXM A;  1EKZ A;  4JI4 I;  1QZR A;  2KHX A;  1N0V C;  3LPS A;  1ZM3 A;  1HNZ E;  4HXZ A;  4DR4 I;  2DIX A;  4DR5 I;  4LF8 E;  4YHH E;  4B3M E;  4JI2 E;  2CZ9 A;  4DR2 E;  1XMO I;  4OX9 I;  4EMD A;  4HY1 A;  3B82 A;  1OJ4 A;  2LTS A;  4JI4 E;  4X66 I;  2HFS A;  4UT4 A;  4DR4 E;  4DR5 E;  1MX0 A;  4NXM E;  1Z0E A;  4JI5 I;  2MDR A;  1N36 I;  1IBM I;  3J80 C;  3J7A G;  1Z5C A;  2LBS B;  1O0W A;  3VYX A;  2UUB E;  4P52 A;  4HAC A;  3H4L A;  4DV2 I;  1WHN A;  3K17 A;  2N3H A;  4DXL A;  1YYO A;  1I94 E;  4GKJ I;  3ZZT A;  5BR8 I;  2NUE A;  2L2N A;  3WU4 A;  4DV2 E;  1KKH A;  3ZZU A;  4JI7 I;  5LL6 R;  1KVK A;  1ZM2 A;  2B3T B;  4B3R E;  2BV3 A;  2RSM A;  1YZ9 A;  4LF6 E;  4GKJ E;  4LF4 E;  4URL A;  3QT6 A;  3CWV A;  5FLX Q;  4JI7 E;  1U2R A;  1DAR A;  3QT5 A;  1IBK I;  4JI3 E;  2NUF A;  4X64 I;  2UXD I;  1KTV A;  2DEI A;  4K0K E;  1HNX I;  3F0N A;  1KIJ A;  3LTO A;  1S16 A;  1Z0G A;  3D4J A;  4GKK E;  3PYD A;  4DPT A;  4DUZ E;  4X62 I;  4X64 E;  2UXD E;  2DMY A;  3ZKD A;  1FJG I;  4KHP E;  4P7A A;  4DV7 E;  3T1Y E;  2GS8 A;  5GME A;  4JV5 I;  1N0U A;  4R1F A;  1RC7 A;  4JI8 I;  3M6A A;  1X49 A;  1GQE A;  4M2Z A;  2AJ4 A;  4WUD A;  4JG4 A;  4KQV A;  1FJG E;  3ADI A;  5LMU I;  2L2K B;  2NPF A;  1Z0W A;  4JI1 I;  4USM A;  4HAC B;  5FLX C;  5IWA E;  4FW9 A;  2EZ6 A;  1B63 A;  4DV5 E;  2V2V A;  2RS7 A;  1PKP A;  3VYY A;  3ZZ0 A;  5GMD A;  2VF3 A;  4JI1 E;  2A2C A;  2UXB I;  4MYT A;  4DR6 E;  4DUY I;  4WYQ B;  4X65 I;  1NZ0 A;  1J26 A;  2NUG A;  4DV3 I;  2E1R A;  4DV6 I;  1WUU A;  2EFG A;  1XMO E;  3C4B A;  4OX9 E;  3Q1Q A;  4LFB I;  2LRS A;  4FWD A;  4X66 E;  4JI6 I;  1UHZ A;  4DV6 E;  1RQ0 A;  2UUC I;  1N34 I;  1DI2 A;  3J81 Q;  4PU9 A;  3OTO I;  1MG7 A;  4DR3 I;  4JI5 E;  4FWH A;  5A2Q Q;  4PRX A;  1N36 E;  2B7T A;  1IBM E;  4ZVI A;  4B3T I;  4ED4 A;  4HYM A;  4LF7 I;  2UUC E;  1Z0T A;  4DU8 A;  4FN5 A;  4DPY A;  4DV4 I;  4DR3 E;  2LTR A;  1IBL I;  4B3T E;  3WU6 A;  2HKE A;  2HHH I;  1Z5B A;  4LF7 E;  1N32 I;  4DV0 I;  1XMQ I;  2BM1 A;  2E5L I;  2F4V I;  4LFC I;  5LMN I;  5BR8 E;  4LF9 I;  3B78 A;  2V2Z A;  2HHH E;  2Q2E B;  2X36 A;  2ZIT A;  1N32 E;  1MU5 A;  1HR0 I;  1XMQ E;  2WW4 A;  1PVG A;  4PRV A;  1J5E I;  4DPW A;  5L3J A;  4LFC E;  5LMN E;  4LF9 E;  2VQF I;  1T4N A;  1H74 A;  3J81 C;  1XNQ I;  3B8H A;  1IBK E;  2CPN A;  2L2M A;  3QT7 A;  3WU5 A;  1HR0 E;  2J7K A;  5A2Q C;  1J5E E;  2R42 A;  3K1J A;  1VIS A;  2VQF E;  1HNX E;  2JVA A;  4X8W A;  1NHI A;  1H73 A;  1FWL A;  3P1X A;  2JY9 A;  1ELO A;  4X62 E;  2R3V A;  4WUC A;  4USK A;  1N33 I;  4B3S I;  2V2Q A;  2UXC I;  1STU A;  2L3J A;  3LNU A;  1WHQ A;  5IT9 Q;  2VQE I;  1A6F A;  2N3G A;  1H7U A;  4JV5 E;  4YY3 I;  1S4E A;  4JI8 E;  1B62 A;  1H7S A;  1Z0B A;  2UUA I;  2UXC E;  4FWG A;  1ZXN A;  1Z0C A;  3C4T A;  5LMU E;  3LLH A;  3ADL A;  1HNW I;  2HK3 A;  3GON A;  4DR1 I;  4LFA I;  1XNR I;  2UUA E;  1HNZ I;  1ZM9 A;  4LF8 I;  2LJP A;  1QU6 A;  5CFF E;  1NHH A;  2V34 A;  3V5R A;  4DR1 E;  4LFA E;  1XNR E;  2UXB E;  1FWK A;  2L3C A;  4DUY E;  4WFT A;  2HFU A;  4X65 E;  4DV3 E;  4NXM I;  2LUQ A;  4AQY I;  1ZM4 A;  2NA2 A;  3QT8 A;  5IT9 C; 
#chains in the Genus database with same CATH topology
 3NZK A;  1UIL A;  1MEY C;  4LFB E;  2ELZ A;  3EPL A;  1YYK A;  1E3P A;  2UUB I;  1YYW A;  4JI6 E;  2Z5B A;  5IXM B;  2A2D A;  1R6L A;  5FWK A;  2V85 A;  2X7I A;  3PYF A;  1RRE A;  1IQS A;  5JEA B;  2UU9 I;  2IHR 1;  3B4T A;  4AQY E;  1BBO A;  1N34 E;  4P78 A;  2EN4 A;  4LOM A;  4MU3 A;  3WU3 A;  3T1H I;  3OTO E;  4BMJ A;  4OOG C;  3QG5 C;  2PO1 B;  2YTN A;  2M1S A;  2O1U A;  1Y5Y A;  1Z59 A;  5DNY A;  4JI0 I;  2Z5C B;  1I94 I;  2JXP A;  3PYE A;  1Z5A A;  4MU0 A;  1X47 A;  2EN7 A;  1Z0V A;  3K6Q A;  2UU9 E;  3HUL A;  1TF3 A;  4AIM A;  3T1H E;  2EMY A;  2LUP B;  1XHK A;  4IZJ B;  1EI1 A;  5K36 D;  2JEB B;  2A25 A;  2DB2 A;  1RR9 A;  1UEK A;  2O1W A;  4DU7 A;  2BA1 G;  3HTX A;  2ZBK B;  2CGE A;  4DV4 E;  1BKN A;  5JEA C;  5C0X E;  4M30 A;  2FV4 B;  2RS6 A;  4O4K A;  1FI4 A;  3L7Z A;  4XTJ A;  4GQU A;  1IBL E;  1SFE A;  2EL4 A;  3MHS C;  4R2S A;  4B3R I;  2EN8 A;  2YRK A;  4JI0 E;  4BA1 B;  4NXN I;  2JEA A;  2YTP A;  5AC4 A;  3ADJ A;  4LPF A;  4LF6 I;  1PJS A;  2LJH A;  2XEX A;  1FKA E;  2JPA A;  3HXL A;  4WUB A;  4LF4 I;  2JR1 A;  2EPM X;  1BB8 A;  4DV0 E;  2KOU A;  2E5L E;  2EMA A;  3MSW A;  4BS9 A;  4F6N A;  2F4V E;  4JI3 I;  2MC6 A;  5A6K A;  4DR7 I;  2EE8 A;  4MLQ A;  2I13 A;  3PYG A;  4J3D A;  2PNZ B;  5K36 B;  4NXN E;  1T4O A;  4RPF A;  2BA0 G;  4LF5 I;  2K4V A;  4K0K I;  3BID A;  4M0V A;  1FNM A;  3JAM Q;  1T4L B;  4ISA A;  4GKK I;  4JYA I;  4DUZ I;  3L00 A;  3K85 A;  2CG9 A;  2JOX A;  4DR7 E;  2PO1 A;  1XNQ E;  5ADZ A;  2YT4 A;  2EMI A;  1A1J A;  4DV1 I;  2NAB A;  1D6T A;  1BBG A;  1A1H A;  4WSG A;  5LLQ A;  4LF5 E;  3ZM7 A;  3AV0 A;  2ZM6 I;  2LT7 A;  1X48 A;  3ZKB A;  3J7A M;  4KHP I;  4AID A;  5K36 C;  2M4I A;  2RPC A;  1H72 C;  2HK2 A;  1N3G A;  1EH7 A;  4DV7 I;  1ZBT A;  3T1Y I;  4Z7Y A;  4JYA E;  2EQ1 A;  2L33 A;  2ELY A;  1EA6 A;  1P47 A;  4DV1 E;  4LCH A;  2PO0 B;  3M7N G;  2ADR A;  2WP8 B;  4DPX A;  2EM5 A;  2B7V A;  2BA0 D;  4BA1 A;  2LE2 A;  4I3H A;  4MYU A;  2V87 A;  2ZM6 E;  3IWD A;  4FW7 A;  4UTG A;  2RTX A;  4DPU A;  2NN6 B;  3J7Y p;  1YUI A;  2PNL A;  2V83 A;  1N33 E;  4O43 A;  4B3S E;  4IS9 A;  1YUJ A;  1X6E A;  2EMZ A;  2EN6 A;  2Z5B B;  3M85 D;  3J80 Q;  2EN1 A;  2VQE E;  4M1K A;  2EPA A;  2V8Q B;  5IWA I;  2EOJ A;  1YFH A;  5A6A A;  4YY3 E;  4QNJ A;  3C6K A;  1A1I A;  4Z7C A;  1G2D C;  4DV5 I;  1PIE A;  2DEJ A;  4DKK A;  3ADG A;  2E1M A;  1NHJ A;  2O3Z A;  2BM0 A;  3V2U C;  1Z1B A;  2NN6 C;  4F2J C;  2EM9 A;  2G7H A;  2HKJ A;  2CT1 A;  3JAM C;  1Y4U A;  2OI2 A;  3BF2 A;  2V8P A;  4B3M I;  4JI2 I;  4DR6 I;  4DR2 I;  2EL5 A;  5AE1 A;  1K47 A;  4M9V C;  1HNW E;  1ZXM A;  1EKZ A;  4JI4 I;  1QZR A;  2KHX A;  1N0V C;  2WNR B;  3LPS A;  3L7Z B;  3LML A;  1ZM3 A;  1HNZ E;  5JEA D;  4HXZ A;  4DR4 I;  2DIX A;  4DR5 I;  2JEA B;  4LF8 E;  2YTG A;  4YHH E;  1HK7 A;  2IOP A;  5JEA F;  4B3M E;  4JI2 E;  2CZ9 A;  1RHY A;  4DR2 E;  2K7I A;  1XMO I;  2V86 A;  2L8T A;  1T39 A;  4EMD A;  4HY1 A;  4OX9 I;  4N4R B;  1UN6 B;  3B82 A;  1PJT A;  1OJ4 A;  2LTS A;  2EOI A;  4JI4 E;  2EQ3 A;  4X66 I;  2O1T A;  2HFS A;  1SR9 A;  2EM6 A;  2EN3 A;  4UT4 A;  2EOZ A;  5EL9 A;  4DR4 E;  4R2E A;  3DJW A;  2YPN A;  2WBT A;  4DR5 E;  1MX0 A;  3AUZ A;  2PRT A;  1OYP A;  2GQ0 A;  4IZJ D;  2FGG A;  2YRH A;  4QNK A;  3DD6 A;  4NXM E;  1Z0E A;  2N8X A;  2HJJ A;  4JI5 I;  1KJK A;  4FW4 A;  2EOS A;  2MDR A;  4MQY A;  1N36 I;  1IBM I;  3J80 C;  3JU0 A;  3J7A G;  1Z5C A;  2LBS B;  1O0W A;  1X6H A;  2IER A;  2MC5 A;  4DMI A;  3VYX A;  4X9J A;  2UUB E;  2HGH A;  4P52 A;  3U1Y A;  2VE7 C;  2DMI A;  2YRM A;  4R2C A;  4HAC A;  3H4L A;  5TSE A;  2C37 A;  3DF6 A;  2EPC A;  4DV2 I;  1WHN A;  4BC9 A;  2ENC A;  2LO3 A;  2GLI A;  2WNR A;  4GZN C;  2F8B A;  4TUG A;  2EOO A;  5K36 F;  2EL6 A;  4ZYG A;  1YHC A;  2N3H A;  3K17 A;  4OO1 A;  3PRY A;  4DXL A;  1YYO A;  1I94 E;  4NZV A;  4GKJ I;  3ZZT A;  5BR8 I;  2NUE A;  2L2N A;  3WU4 A;  4DV2 E;  1KKH A;  3ZZU A;  4BCA A;  4JI7 I;  4AM3 A;  1ZR9 A;  5JEA E;  5LL6 R;  2C39 A;  1KVK A;  1ZM2 A;  2B3T B;  4B3R E;  2BV3 A;  2EMG A;  2RSM A;  1AAY A;  1YZ9 A;  4LF6 E;  4GKJ E;  2WBS A;  2EWL A;  3ECR A;  4LF4 E;  2F1D A;  3QT6 A;  4URL A;  3CWV A;  5DNX A;  3HPZ A;  5FLX Q;  4JI7 E;  1U2R A;  1DAR A;  3QT5 A;  1UDQ A;  3Q6M A;  1IBK I;  4JI3 E;  1F2I G;  2NN6 D;  4FW6 A;  5C0X A;  2NUF A;  3M85 G;  2GO3 A;  4X64 I;  3EPJ A;  3H09 A;  1ZAA C;  2EM8 A;  2UXD I;  4N3O A;  1KTV A;  2DEI A;  2NN6 F;  5EKW A;  4K0K E;  1VI7 A;  1HNX I;  3F0N A;  1KIJ A;  3LTO A;  2EQ0 A;  2D9H A;  1S16 A;  1R6M A;  1Z0G A;  3CDI A;  3D4J A;  3P76 A;  4Q28 A;  3HPS A;  4GKK E;  2EML A;  1AH5 A;  2EPK X;  3H1C A;  3EQ1 A;  4DUZ E;  3THO B;  1TN9 A;  3PYD A;  4DPT A;  1UDN A;  2EM0 A;  4R03 A;  1WXR A;  1OYR A;  4X62 I;  1YH8 A;  4X64 E;  1ZBQ A;  2UXD E;  2EOM A;  4U3B A;  1YPN A;  2EOH A;  2DMY A;  1WJP A;  3MHH C;  2EM7 A;  3ZKD A;  4KHP E;  4P7A A;  2EM4 A;  1FJG I;  3PS2 A;  5K36 E;  5DNL A;  4DV7 E;  3T1Y E;  2M9A A;  4YHH I;  2GS8 A;  4R2A A;  4ZYD A;  2YTQ A;  5GME A;  1PDA A;  4JV5 I;  1N0U A;  2EOX A;  4R1F A;  4BBY A;  2WBU A;  1RC7 A;  1YSA C;  4JI8 I;  3M6A A;  1X49 A;  1GQE A;  4M2Z A;  2AJ4 A;  4WUD A;  3ZOQ B;  4JG4 A;  4KQV A;  1FJG E;  3F6G A;  2YTJ A;  3ADI A;  5LMU I;  3VK6 A;  4WX9 A;  2EMH A;  2L2K B;  4IFD B;  2EPL X;  2NPF A;  4ZYH A;  1Z0W A;  4JI1 I;  2ENA A;  2DGC A;  4RHB B;  4HAC B;  5FLX C;  4USM A;  1RMD A;  2C37 B;  4U3D A;  5IWA E;  2DRP A;  4R2R A;  2YTD A;  4MU1 A;  4FW9 A;  4FW3 A;  2EPZ A;  2EJ4 A;  2EMB A;  2EZ6 A;  1B63 A;  2JT2 A;  4DV5 E;  4WXD A;  2EMX A;  2EPU A;  2RS7 A;  2V2V A;  1PKP A;  3VYY A;  4R2D A;  2NN6 E;  5DRQ A;  5GMD A;  2VF3 A;  3ZZ0 A;  4OO1 B;  4JI1 E;  2A2C A;  2UXB I;  4MYT A;  4DR6 E;  4DUY I;  2JYA A;  1LLM C;  4IFD C;  1ZU1 A;  4WYQ B;  4X65 I;  1OYS A;  2EOR A;  2EPP A;  1NZ0 A;  4WSP A;  2GHF A;  1J26 A;  2NUG A;  2BR2 A;  2C39 B;  4DV3 I;  2CSH A;  4BA2 B;  4IZK A;  2JE6 A;  2EP3 A;  2E1R A;  4DV6 I;  4KWY A;  2IOQ A;  1A1L A;  2AE8 A;  1WUU A;  3THN A;  2EFG A;  1GZ6 A;  3GLL A;  3M7N D;  2V88 A;  3UHM A;  1XMO E;  1MGT A;  3C4B A;  4OX9 E;  3Q1Q A;  4OO1 C;  1KYQ A;  4LFB I;  2DSY A;  2LRS A;  2RSI A;  5AC5 A;  4FWD A;  3M99 B;  4X66 E;  4JI6 I;  2MKD A;  1UHZ A;  2EM3 A;  2C38 B;  1NCS A;  4DV6 E;  1RQ0 A;  2UUC I;  5C0X B;  1L4S A;  1G2F C;  2IES A;  2DLQ A;  1DI2 A;  1UDO A;  1X5W A;  2JWO A;  3GME A;  3J81 Q;  2YTE A;  1N34 I;  4IFD A;  1IMU A;  4PU9 A;  3OTO I;  5KL3 A;  1MG7 A;  4NHR A;  4DR3 I;  1B69 A;  2BB8 A;  5DRP A;  5A6B A;  4JI5 E;  4FWH A;  1IQO A;  5A2Q Q;  3C6M A;  3RMP A;  1N36 E;  2B7T A;  1IBM E;  4PRX A;  4ZVI A;  4ED4 A;  1EH6 A;  5KL4 A;  4B3T I;  4HYM A;  4RH8 A;  3BBG A;  2LMZ A;  3BGH A;  2UUC E;  2PNM A;  4LF7 I;  2LJU A;  1UBD C;  2YSO A;  1Z0T A;  4DU8 A;  2EMC A;  2YTF A;  4FN5 A;  4DPY A;  5C0X C;  2M7Q A;  2LTR A;  2EOE A;  4DR3 E;  4DV4 I;  1JK2 A;  2EPR A;  4P7D A;  4IS1 C;  1E3H A;  4FW5 A;  1IBL I;  1XXE A;  4R2P A;  1QNT A;  2H36 X;  5T6J A;  4B3T E;  2EMW A;  3WU6 A;  2HKE A;  2HHH I;  2RQL A;  1Z5B A;  2L6M A;  4LF7 E;  2PO2 A;  4BA2 A;  1N32 I;  3KWR A;  4NBQ A;  3IWB A;  1USU A;  4ZYE A;  4MLV A;  5A6J A;  2BM1 A;  4DV0 I;  1XMQ I;  2E5L I;  1DQ3 A;  3EPK A;  2F4V I;  2CTD A;  2L92 A;  2YSP A;  4LFC I;  5LMN I;  5BR8 E;  4F6M A;  1WRJ A;  4LF9 I;  2HC5 A;  3B78 A;  3U1K A;  2V2Z A;  2ODR D;  2V89 A;  2Q8U A;  3JTZ A;  5KL7 A;  5KL2 A;  2HHH E;  2O1V A;  2Q2E B;  2X36 A;  2ZIT A;  1N32 E;  2C38 A;  1MU5 A;  1HR0 I;  3PS1 A;  2JOB A;  1XMQ E;  4Q35 B;  3CDJ A;  2WW4 A;  1PVG A;  1TF6 A;  4PRV A;  1J5E I;  4DPW A;  5L3J A;  1UDS A;  4LFC E;  5LMN E;  4LF9 E;  2VQF I;  1T4N A;  2EPX A;  1H74 A;  3J81 C;  1EH8 A;  1USV A;  1Y60 A;  1T38 A;  3VHT B;  1XNQ I;  2J65 A;  2GPI A;  5IV8 B;  3B8H A;  4GEQ B;  2CPN A;  2L2M A;  1IBK E;  5AAS A;  3QT7 A;  5DRR A;  3WU5 A;  1HR0 E;  2YTO A;  5KL5 A;  5KL6 A;  4OZE A;  4TUI A;  5JEA A;  2J7K A;  4L5N C;  5A2Q C;  2FTX B;  4HEI A;  3EPH A;  2E72 A;  4LU9 A;  1J5E E;  2BA1 D;  2R42 A;  3K1J A;  4IFD D;  2I9I A;  3OML A;  4F9C B;  2BR2 B;  1VIS A;  5A69 A;  2YU5 A;  2VQF E;  4FK5 C;  2EMK A;  2YTI A;  1A1F A;  2JVA A;  4X8W A;  2ENH A;  1HNX E;  2JE6 B;  4L8N A;  4IZK B;  4IFD F;  5A6B D;  2EN2 A;  4BHC A;  4HTG A;  4O24 A;  1NHI A;  1H73 A;  1FWL A;  3P1X A;  5AE2 A;  4F54 A;  4R8O A;  2Z5C A;  3P3C A;  5DRO A;  2JY9 A;  4O5G A;  1ELO A;  2EOQ A;  4MDT A;  4X62 E;  2R3V A;  4WUC A;  3IWC A;  2GO4 A;  3KZY A;  2Z5E A;  4USK A;  1N33 I;  4IZJ A;  2MKN A;  2BBG A;  2JEB A;  4B3S I;  2V2Q A;  4OO1 D;  2UXC I;  1STU A;  2L3J A;  3LNU A;  2WCC 3;  1WHQ A;  4WPY A;  1A1K A;  2ODR C;  1P42 A;  3TQM A;  2VRD A;  5IT9 Q;  2VQE I;  4OO1 F;  2EPN A;  1A6F A;  1A1G A;  2N3G A;  4MU4 A;  2VES A;  1H7U A;  3KZZ A;  1GTK A;  2LVH A;  4JV5 E;  4YY3 I;  1S4E A;  1X6F A;  4JI8 E;  1B62 A;  2YZT A;  1H7S A;  1Z0B A;  4LCF A;  2UUA I;  1X3C A;  2UXC E;  3GCM A;  4LTY A;  3PS3 A;  3HKM A;  4FWG A;  2JP9 A;  4OKG A;  1ZXN A;  1Z0C A;  4LCG A;  3C4T A;  3F6H A;  5LMU E;  2EM2 A;  3LLH A;  5F3W A;  2YWQ A;  2PNZ A;  3ADL A;  1Y4S A;  1PJQ A;  5K36 A;  1HNW I;  2YU8 A;  3P3G A;  2R1F A;  2HK3 A;  2LCE A;  3GON A;  4DR1 I;  4LFA I;  1XNR I;  5ELW A;  1Y6Z A;  5AE3 A;  2KON A;  3P3E A;  2UUA E;  1HNZ I;  5C0X D;  2R76 A;  4R2Q A;  4BC7 A;  1ZM9 A;  4LF8 I;  4I8O A;  2B9D A;  3HJC A;  2VF1 A;  4BHB A;  2LV2 A;  2WZO A;  2PO2 B;  5C0X F;  2EOY A;  4J8Z A;  2LJP A;  1QU6 A;  3KRN A;  5CFF E;  1NHH A;  4WXC A;  1DGC A;  2V34 A;  3V5R A;  4DR1 E;  4LFA E;  2DLK A;  4F9B B;  1XNR E;  3P06 A;  2UXB E;  3UK3 C;  1NEI A;  1FWK A;  4IFD E;  2L3C A;  4DUY E;  4WFT A;  2HFU A;  4X65 E;  2EPO A;  3FIG A;  1JK1 A;  2EOF A;  4F9A B;  4DV3 E;  3HQ1 A;  4NXM I;  2PO0 A;  2WP8 A;  2EMF A;  3Q6N A;  2LUQ A;  4AQY I;  2CVE A;  2J7J A;  1ZM4 A;  2NA2 A;  2MDG A;  4IJD A;  4KZS A;  3QT8 A;  2NN6 A;  5IT9 C;  4OO1 E; 
#chains in the Genus database with same CATH homology
 1UIL A;  4LFB E;  1YYK A;  2UUB I;  1YYW A;  4JI6 E;  2Z5B A;  5FWK A;  2A2D A;  2V85 A;  2X7I A;  3PYF A;  1RRE A;  2UU9 I;  2IHR 1;  4AQY E;  1N34 E;  4P78 A;  3T1H I;  3WU3 A;  3OTO E;  4BMJ A;  4OOG C;  2O1U A;  2M1S A;  1Z59 A;  5DNY A;  4JI0 I;  2Z5C B;  1I94 I;  3PYE A;  1Z5A A;  1X47 A;  1Z0V A;  3K6Q A;  2UU9 E;  3HUL A;  3T1H E;  2LUP B;  1XHK A;  4IZJ B;  1EI1 A;  2DB2 A;  1RR9 A;  1UEK A;  2O1W A;  4DU7 A;  3HTX A;  2ZBK B;  2CGE A;  4DV4 E;  1BKN A;  4M30 A;  2FV4 B;  2RS6 A;  1FI4 A;  4XTJ A;  1IBL E;  4B3R I;  4JI0 E;  4NXN I;  3ADJ A;  4LF6 I;  2LJH A;  2XEX A;  1FKA E;  4LF4 I;  3HXL A;  4WUB A;  2JR1 A;  4DV0 E;  2KOU A;  2E5L E;  3MSW A;  4BS9 A;  2F4V E;  4JI3 I;  2MC6 A;  4DR7 I;  3PYG A;  4NXN E;  1T4O A;  4RPF A;  4LF5 I;  2K4V A;  4K0K I;  4M0V A;  1FNM A;  3JAM Q;  1T4L B;  4GKK I;  4JYA I;  4DUZ I;  3K85 A;  2CG9 A;  2JOX A;  4DR7 E;  1XNQ E;  5ADZ A;  2YT4 A;  4DV1 I;  1D6T A;  4LF5 E;  3ZM7 A;  3AV0 A;  2ZM6 I;  3J7A M;  1X48 A;  3ZKB A;  4KHP I;  2M4I A;  1H72 C;  2HK2 A;  4DV7 I;  1ZBT A;  3T1Y I;  4Z7Y A;  4JYA E;  2L33 A;  1EA6 A;  4DV1 E;  4DPX A;  2B7V A;  2LE2 A;  4I3H A;  4MYU A;  2V87 A;  2ZM6 E;  3IWD A;  4UTG A;  2RTX A;  4DPU A;  3J7Y p;  2PNL A;  2V83 A;  1N33 E;  4B3S E;  2Z5B B;  3J80 Q;  2VQE E;  4M1K A;  2V8Q B;  5IWA I;  4YY3 E;  4Z7C A;  4DV5 I;  1PIE A;  2DEJ A;  4DKK A;  3ADG A;  2E1M A;  1NHJ A;  3V2U C;  2BM0 A;  2HKJ A;  2G7H A;  2OI2 A;  4YHH I;  3JAM C;  1Y4U A;  2V8P A;  4B3M I;  4DR6 I;  4JI2 I;  4DR2 I;  5AE1 A;  1K47 A;  1HNW E;  1ZXM A;  1EKZ A;  4JI4 I;  1QZR A;  2KHX A;  1N0V C;  3LPS A;  3LML A;  1ZM3 A;  1HNZ E;  4HXZ A;  4DR4 I;  2DIX A;  4DR5 I;  4LF8 E;  2IOP A;  4YHH E;  1HK7 A;  4B3M E;  4JI2 E;  2CZ9 A;  4DR2 E;  1XMO I;  2V86 A;  2L8T A;  4EMD A;  4OX9 I;  4HY1 A;  3B82 A;  1OJ4 A;  2LTS A;  4JI4 E;  4X66 I;  2O1T A;  2HFS A;  1SR9 A;  4UT4 A;  4DR4 E;  3DJW A;  4DR5 E;  1MX0 A;  4IZJ D;  3AUZ A;  2GQ0 A;  2FGG A;  4NXM E;  1Z0E A;  4JI5 I;  2MDR A;  1N36 I;  1IBM I;  3J80 C;  3JU0 A;  3J7A G;  1Z5C A;  2LBS B;  1O0W A;  2MC5 A;  4DMI A;  3VYX A;  2UUB E;  4P52 A;  2VE7 C;  4HAC A;  3H4L A;  3DF6 A;  4DV2 I;  1WHN A;  4BC9 A;  2F8B A;  4TUG A;  3K17 A;  2N3H A;  3PRY A;  4DXL A;  1YYO A;  1I94 E;  4GKJ I;  3ZZT A;  5BR8 I;  2NUE A;  2L2N A;  3WU4 A;  4DV2 E;  1KKH A;  3ZZU A;  4BCA A;  4JI7 I;  5LL6 R;  1KVK A;  1ZM2 A;  2B3T B;  4B3R E;  2BV3 A;  2RSM A;  1YZ9 A;  4LF6 E;  4GKJ E;  4LF4 E;  2EWL A;  4URL A;  3QT6 A;  3CWV A;  5FLX Q;  3HPZ A;  4JI7 E;  1U2R A;  1DAR A;  3QT5 A;  3Q6M A;  1IBK I;  4JI3 E;  2NUF A;  4X64 I;  3H09 A;  2UXD I;  4N3O A;  1KTV A;  2DEI A;  4K0K E;  1HNX I;  3F0N A;  1KIJ A;  3LTO A;  1S16 A;  1Z0G A;  3D4J A;  4Q28 A;  3HPS A;  4GKK E;  3HJC A;  3PYD A;  4DPT A;  4DUZ E;  4R03 A;  1WXR A;  4X62 I;  4X64 E;  1ZBQ A;  2UXD E;  2DMY A;  3ZKD A;  1FJG I;  4KHP E;  4P7A A;  4DV7 E;  3T1Y E;  2GS8 A;  5GME A;  4JV5 I;  1N0U A;  4R1F A;  4BBY A;  1RC7 A;  4JI8 I;  3M6A A;  1X49 A;  1GQE A;  4M2Z A;  2AJ4 A;  4WUD A;  3ZOQ B;  4JG4 A;  4KQV A;  1FJG E;  3F6G A;  3ADI A;  5LMU I;  3VK6 A;  2L2K B;  2NPF A;  1Z0W A;  4JI1 I;  4USM A;  4HAC B;  5FLX C;  5IWA E;  4FW9 A;  2EZ6 A;  1B63 A;  4DV5 E;  2V2V A;  2RS7 A;  1PKP A;  3VYY A;  3ZZ0 A;  5GMD A;  2VF3 A;  4JI1 E;  2A2C A;  2UXB I;  4MYT A;  4DR6 E;  4DUY I;  4WYQ B;  4X65 I;  1NZ0 A;  4WSP A;  1J26 A;  2NUG A;  4DV3 I;  4IZK A;  2E1R A;  4DV6 I;  2IOQ A;  1WUU A;  2EFG A;  1GZ6 A;  2V88 A;  1XMO E;  3C4B A;  4OX9 E;  3Q1Q A;  4LFB I;  2DSY A;  2LRS A;  4FWD A;  4X66 E;  4JI6 I;  1UHZ A;  4DV6 E;  1RQ0 A;  2UUC I;  1N34 I;  1DI2 A;  3J81 Q;  2JWO A;  4PU9 A;  3OTO I;  1MG7 A;  4DR3 I;  4JI5 E;  4FWH A;  5A2Q Q;  3RMP A;  1N36 E;  2B7T A;  1IBM E;  4PRX A;  4ZVI A;  4ED4 A;  4B3T I;  4HYM A;  4LF7 I;  2LMZ A;  2UUC E;  2PNM A;  1Z0T A;  4DU8 A;  4FN5 A;  4DPY A;  4DV4 I;  2M7Q A;  2LTR A;  4DR3 E;  4P7D A;  1IBL I;  2H36 X;  5T6J A;  4B3T E;  3WU6 A;  2HKE A;  2HHH I;  1Z5B A;  2L6M A;  4LF7 E;  1N32 I;  3KWR A;  3IWB A;  1USU A;  4DV0 I;  1XMQ I;  2BM1 A;  2E5L I;  1DQ3 A;  2F4V I;  2L92 A;  4LFC I;  5LMN I;  5BR8 E;  4LF9 I;  3B78 A;  2V2Z A;  2ODR D;  2V89 A;  3JTZ A;  2HHH E;  2O1V A;  2Q2E B;  2X36 A;  2ZIT A;  1N32 E;  1MU5 A;  1HR0 I;  2JOB A;  1XMQ E;  2WW4 A;  1PVG A;  4PRV A;  1J5E I;  4DPW A;  5L3J A;  4LFC E;  5LMN E;  4LF9 E;  2VQF I;  1T4N A;  1H74 A;  3J81 C;  1USV A;  1XNQ I;  3B8H A;  4GEQ B;  2CPN A;  2L2M A;  1IBK E;  5AAS A;  3QT7 A;  3WU5 A;  1HR0 E;  4TUI A;  2J7K A;  4L5N C;  5A2Q C;  2FTX B;  4LU9 A;  1J5E E;  2R42 A;  3K1J A;  3OML A;  4F9C B;  1VIS A;  2VQF E;  1HNX E;  2JVA A;  4X8W A;  4IZK B;  4L8N A;  1NHI A;  1H73 A;  1FWL A;  3P1X A;  5AE2 A;  4F54 A;  4R8O A;  2Z5C A;  2JY9 A;  1ELO A;  4X62 E;  2R3V A;  4WUC A;  3IWC A;  2Z5E A;  4USK A;  1N33 I;  4IZJ A;  4B3S I;  2V2Q A;  2UXC I;  1STU A;  2L3J A;  3LNU A;  1WHQ A;  4WPY A;  2ODR C;  5IT9 Q;  2VQE I;  1A6F A;  2N3G A;  1H7U A;  4JV5 E;  4YY3 I;  1S4E A;  4JI8 E;  1B62 A;  2YZT A;  1H7S A;  1Z0B A;  2UUA I;  2UXC E;  4LTY A;  4FWG A;  1ZXN A;  1Z0C A;  3C4T A;  3F6H A;  5LMU E;  3LLH A;  5F3W A;  3ADL A;  1Y4S A;  1HNW I;  2HK3 A;  3GON A;  4DR1 I;  4LFA I;  1XNR I;  1Y6Z A;  5AE3 A;  2KON A;  2UUA E;  1HNZ I;  4BC7 A;  1ZM9 A;  4LF8 I;  4I8O A;  2B9D A;  2VF1 A;  2WZO A;  2LJP A;  4J8Z A;  1QU6 A;  5CFF E;  1NHH A;  2V34 A;  3V5R A;  4DR1 E;  4LFA E;  4F9B B;  1XNR E;  3P06 A;  2UXB E;  1FWK A;  2L3C A;  4DUY E;  4WFT A;  2HFU A;  4X65 E;  3FIG A;  4F9A B;  4DV3 E;  3HQ1 A;  4NXM I;  3Q6N A;  2LUQ A;  4AQY I;  1ZM4 A;  2NA2 A;  4KZS A;  3QT8 A;  5IT9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...