4B3TE

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3tE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tE02
4DPUA 1HR0E 4XTJA 4DV4I 1XHKA 2HFUA 4DPTA 4JI2E 3OTOE 4JV5I 3ADIA 5CFFE 2L3JA 2NUGA 1S4EA 2MDRA 3T1HE 4HXZA 4DR6I 4JI1I 1ELOA 1EA6A 4KHPI 4WUBA 2HK3A 4DR5I 4DV3I 2V2VA 1MG7A 2L2MA 5IWAE 3QT8A 4FWHA 4P7AA 5LMNE 5A2QQ 4JI4E 2ZITA 1PKPA 2ZM6I 4KQVA 4JI7E 5BR8E 2RSMA 4JI8E 5LMUI 4X62E 4YY3E 3B78A 1XMQI 1KIJA 1RREA 4JI6I 4LF9E 4YHHI 4URLA 4ZVIA 2ZBKB 1N36I 4MYTA 4PU9A 4DV0I 3K1JA 4X65E 3M6AA 4R1FA 4DR1E 1MU5A 3ADLA 1D6TA 4M1KA 1NHJA 5GMEA 1QZRA 1UHZA 4X64E 1IBKI 4LF5I 4JI0I 1HNXE 4GKJI 4OX9E 1Z0BA 2N3HA 1Z0TA 1H72C 1N34E 2R3VA 1EKZA 1N33E 3ZZ0A 2IHR1 3H4LA 4JYAI 4AQYE 1YZ9A 4HYMA 4LFAE 4GKKE 2DEIA 2VQFI 1YYKA 4NXNE 2DB2A 4JI5E 2UUAE 3PYEA 1S16A 4DR2E 3ZZTA 1YYWA 1RQ0A 2HKJA 4K0KI 2UU9E 1IBMI 5A2QC 1PVGA 3WU3A 1N32I 3LLHA 3C4BA 3J80Q 2NUEA 2UXDE 4EMDA 4LFBE 1Z0VA 4UTGA 4LF7I 2LUPB 4M2ZA 4DV1E 2HHHE 4HY1A 3ZM7A 2YT4A 2RS7A 2HK2A 4DV2I 4DR3I 4DV4E 2VQEI 4LFCI 4JV5E 4JG4A 2RS6A 2L3CA 4DR6E 4JI1E 2UUCI 2V2QA 4KHPE 2UUBI 3J81Q 4DR5E 4DV3E 3PYFA 1NHIA 4WFTA 1QU6A 5FLXQ 1IBLI 3T1YI 1XMOI 1Z59A 2L33A 2ZM6E 3VYYA 2XEXA 1X48A 2LRSA 4PRXA 4B3TI 5LMUE 5L3JA 4LF4I 4WUCA 1FNMA 3Q1QA 4B3RI 1HNZI 4JI6E 4HACB 4YHHE 1T4NA 1N36E 3J7Yp 5GMDA 4DV0E 3QT6A 4DXLA 1HNWI 4X66I 2F4VI 3J80C 2BV3A 4M30A 1IBKE 4LF5E 3WU5A 1O0WA 4JI0E 1RC7A 4GKJE 2UXBI 2V34A 2NPFA 1DARA 1WHNA 2AJ4A 2BM1A 4JYAE 4DV7I 2NUFA 4DV6E 2KHXA 1Z5BA 2EFGA 4DR7E 1WHQA 2VQFE 2UXCI 4DV5I 2JY9A 1NHHA 3J81C 1H7SA 4K0KE 1FI4A 3JAMQ 1XNQI 3J7AG 2J7KA 5FLXC 2E5LI 1X49A 3K17A 3LTOA 1K47A 1KKHA 1Z0CA 1N32E 2LJHA 1ZM9A 5BR8I 2LBSB 1X47A 4LF7E 4B3MI 3WU4A 4OOGC 1Z5AA 4MYUA 1ZM4A 1J26A 1NZ0A 1J5EI 4Z7YA 2L2NA 1Z0GA 3J7AM 4Z7CA 2A2CA 4DPYA 4DV2E 4DR3E 3HTXA 4LFCE 2LTSA 3LNUA 2UUCE 4USMA 1UEKA 1B63A 2UUBE 1OJ4A 4UT4A 4JI3I 4DU8A 4DUYI 1IBLE 1FWKA 1XMOE 3CWVA 3HULA 2OI2A 1UILA 4DR4I 2N3GA 3QT5A 2GS8A 1I94I 1ZM3A 4B3TE 4LF4E 3ADJA 1FWLA 4B3RE 1HNZE 4HACA 1STUA 3PYDA 3B82A 1N0UA 2DIXA 4B3SI 3ADGA 1Z0WA 3JAMC 4DPWA 1H7UA 5IT9Q 4FW9A 2LUQA 1HNWE 1FJGI 2F4VE 1N0VC 1FKAE 3ZKBA 4DUZI 2E1RA 4LF6I 4DV1I 1XMQE 2UXBE 3LPSA 4DU7A 1ZXMA 1H74A 3PYGA 2X36A 1DI2A 1ZXNA 4LF8I 4DV7E 1KVKA 4NXMI 4RPFA 2UXCE 4DV5E 2DEJA 1B62A 2V8PA 3WU6A 4DKKA 1XNRI 3D4JA 3GONA 1Z5CA 1HR0I 1Z0EA 1ZBTA 1XNQE 1MX0A 2CZ9A 3F0NA 2E5LE 1T4LB 3V2UC 2LJPA 2HKEA 4JI2I 3OTOI 2A2DA 3T1HI 2B7TA 4FWGA 2CPNA 1GQEA 4B3ME 2B7VA 1J5EE 5IWAI 5LMNI 3ZZUA 4PRVA 1IBME 2WW4A 4JI4I 1EI1A 1VISA 4FN5A 4DPXA 5IT9C 1RR9A 4JI7I 1YYOA 4JI8I 4X62I 4YY3I 1U2RA 2L2KB 4JI3E 2EZ6A 2NA2A 4LF9I 2X7IA 4DUYE 1A6FA 3B8HA 1WUUA 3QT7A 2R42A 4DR4E 2VQEE 5LL6R 4X65I 4DR1I 1I94E 4DV6I 3V5RA 3VYXA 4DR7I 4X64I 4WUDA 1HNXI 4OX9I 4WYQB 4USKA 2HFSA 2Q2EB 3ZKDA 4X8WA 1BKNA 1N34I 4ED4A 3T1YE 2B3TB 4B3SE 1N33I 1KTVA 2JVAA 4AQYI 1FJGE 4LFAI 4GKKI 3C4TA 4DUZE 1H73A 4FWDA 1T4OA 4LF6E 4NXNI 4JI5I 3P1XA 2UUAI 2BM0A 4DR2I 2LTRA 1PIEA 2UU9I 2DMYA 2RTXA 4P52A 4LF8E 4X66E 1ZM2A 4NXME 4I3HA 2UXDI 4LFBI 1XNRE 2VF3A 2HHHI 2V2ZA
chains in the Genus database with same CATH superfamily
4DPUA 1HR0E 2EMWA 2WBTA 3GLLA 4MDTA 2ADRA 4U3DA 2JOXA 4XTJA 2LCEA 1F2IG 1NEIA 3H09A 2AE8A 4FW3A 2JE6A 1R6MA 3GMEA 2O3ZA 4MU4A 1TN9A 2I13A 4DV4I 1A1KA 1XHKA 2HFUA 4DPTA 4JI2E 3C6KA 1YPNA 3OTOE 3ADIA 4JV5I 5CFFE 4R2SA 2L3JA 2NUGA 2MDRA 1S4EA 2EPLX 3T1HE 4MQYA 4HXZA 2V87A 2CGEA 4DR6I 4JI1I 4TUIA 1ELOA 4F9CB 1EA6A 2EMYA 1TF6A 1UN6B 4KHPI 4WUBA 1OYSA 5A69A 2K7IA 2Z5CB 2HK3A 4DR5I 2EMKA 4DV3I 4I8OA 2V2VA 4MU3A 1MG7A 1A1LA 2L2MA 5IWAE 3QT8A 2L8TA 4FWHA 5LMNE 4J3DA 4P7AA 4QNKA 5A2QQ 5KL6A 2YWQA 3UK3C 4JI4E 2ZITA 3EPKA 2JEBA 1PKPA 2M1SA 3DJWA 2ZM6I 2EMLA 4KQVA 2PO0A 4JI7E 5BR8E 2RSMA 4JI8E 2D9HA 2E1MA 2EM7A 1P47A 5LMUI 2NABA 4WPYA 3FIGA 4X62E 2KOUA 4YY3E 1KJKA 3B78A 4ZYHA 2HJJA 5K36B 2JT2A 2JEAA 2EM9A 5JEAF 3ECRA 1XMQI 1KIJA 1RREA 4JI6I 4LF9E 1E3HA 4YHHI 2YRMA 2H36X 4URLA 4ZVIA 5C0XF 2GHFA 4OO1C 3EPLA 2ZBKB 2LJUA 5AE3A 1N36I 2YTGA 4MYTA 5DNXA 4AM3A 2NN6D 2MC5A 4F9AB 4PU9A 4DV0I 3AUZA 2YTIA 3EPHA 5A6BD 3K1JA 4X65E 3M6AA 4R1FA 2LV2A 4DR1E 4Q35B 1GZ6A 2EPOA 1MU5A 3ADLA 2EOQA 4M1KA 4OO1E 1D6TA 1BBOA 4NBQA 1NHJA 5GMEA 4IFDF 1QZRA 1UHZA 4X64E 1IBKI 4LF5I 2CT1A 2NN6A 4JI0I 1HNXE 2I9IA 2J65A 3M85D 4IZJD 2YRKA 5A6BA 4OX9E 2N3HA 2EM0A 4KWYA 1Z0BA 1Z0TA 4GKJI 3U1YA 4WXCA 2F8BA 5A6JA 1H72C 2JWOA 1UDQA 2O1UA 2FV4B 3Q6MA 1N34E 2R3VA 1EKZA 2JR1A 2BBGA 1N33E 3ZZ0A 2IHR1 4R8OA 3H4LA 4JYAI 4AQYE 1YZ9A 2IOQA 4HYMA 2EN7A 2EE8A 3L7ZA 4LFAE 1GTKA 4GKKE 2DEIA 2EOSA 3TQMA 4U3BA 2VQFI 2EM6A 2ODRC 1YYKA 4X9JA 2WP8A 4NXNE 2DB2A 4JI5E 2UUAE 3AV0A 4R2QA 2EL6A 1S16A 4DR2E 3PYEA 3ZZTA 5IXMB 1YYWA 1RQ0A 2GQ0A 2HKJA 4K0KI 2UU9E 1IBMI 1IMUA 5A2QC 3K85A 3PS3A 1PVGA 4OO1D 2BA1D 3WU3A 2CTDA 1YHCA 1N32I 3LLHA 4IZJB 3C4BA 2V86A 1WXRA 3J80Q 4F6NA 2DRPA 2NUEA 2UXDE 2EQ1A 2LE2A 4LFBE 1Z0VA 2C38B 4UTGA 4EMDA 4LF7I 4R2PA 5LLQA 4L8NA 2LUPB 2RQLA 4M2ZA 1Y4SA 2WBUA 4DV1E 1QNTA 2HHHE 2YTOA 3DD6A 3QG5C 3U1KA 4HY1A 4RHBB 2EP3A 4Q28A 2EMXA 2YT4A 3ZM7A 2RS7A 2PNLA 2FGGA 2V83A 4F9BB 4FW4A 4BA1B 3M7ND 4M0VA 2YU5A 2HK2A 4LTYA 4DV2I 4DR3I 2HGHA 4DV4E 2YPNA 2VQEI 4LFCI 2GLIA 4JV5E 4JG4A 2RS6A 3P3EA 4LOMA 4BMJA 2L3CA 4BA2B 4DR6E 2CG9A 4JI1E 4GQUA 4OKGA 2UUCI 4F2JC 1UDNA 4BC9A 1AAYA 2V2QA 4KHPE 2UUBI 3C6MA 1G2DC 3J81Q 2Z5CA 4OO1B 4DR5E 4DV3E 3PYFA 1NHIA 2LO3A 4WFTA 1QU6A 2ODRD 3THNA 5FLXQ 1UBDC 3MHSC 1IBLI 4LCHA 2EN2A 4HTGA 1R6LA 3T1YI 1XMOI 5K36D 1KYQA 1PJSA 2FTXB 4R2AA 1Z59A 2EM4A 2L33A 2EM8A 1L4SA 1YH8A 2ZM6E 3VYYA 5KL2A 2XEXA 1X48A 3P76A 2LRSA 3GCMA 2L92A 4F54A 4PRXA 4B3TI 2DLKA 5LMUE 5L3JA 4LF4I 1YFHA 2F1DA 2CVEA 1A1GA 5K36A 3MSWA 1DQ3A 4WUCA 1FNMA 2KONA 2WCC3 1HNZI 1Y60A 3Q1QA 4B3RI 4O43A 2GO3A 4JI6E 4HACB 4YHHE 1T4NA 3M85G 2DLQA 2M9AA 3L00A 3J7Yp 1N36E 2V85A 5DRRA 5GMDA 2G7HA 5JEAC 2EMFA 1VI7A 3LMLA 4DV0E 3QT6A 4N3OA 1N3GA 5C0XC 4GEQB 4DXLA 1HNWI 1WJPA 1T38A 4X66I 2F4VI 2EN3A 3J80C 2BV3A 4M30A 5JEAE 1IBKE 4LF5E 2NN6F 3WU5A 1O0WA 2EOMA 4JI0E 1RC7A 5C0XE 4L5NC 2ELZA 2RPCA 4GKJE 1A1IA 2V34A 2UXBI 2EPXA 2YTJA 2EMIA 5AC5A 1UDOA 2NPFA 1DARA 1WHNA 3BF2A 2AJ4A 3DF6A 2EOHA 2V89A 2R1FA 2BM1A 4MLQA 2HC5A 2VE7C 4NHRA 4JYAE 1ZR9A 4LCGA 1EH8A 4IFDE 4DV7I 4WX9A 1YUIA 4KZSA 2NUFA 4DV6E 3HPZA 1SFEA 2KHXA 1Z5BA 2BA1G 2EFGA 4DR7E 1WHQA 2EN8A 4FW6A 2VQFE 2Z5EA 3JTZA 5T6JA 4DV5I 2JY9A 2UXCI 1NHHA 5ADZA 4R2DA 3J81C 1H7SA 5FWKA 2YTDA 4K0KE 3CDIA 1FI4A 3JAMQ 3J7AG 4MU1A 2PNZB 1XNQI 2J7KA 5FLXC 2E5LI 1X49A 4WSPA 3K17A 1K47A 3LTOA 2RSIA 1KKHA 1PJTA 1N32E 1Z0CA 2LJHA 1ZM9A 1HK7A 4IZJA 3M7NG 4IJDA 2IERA 5BR8I 2C39B 2LBSB 5C0XD 3IWBA 2C38A 3HJCA 1X47A 2EN1A 4GZNC 4LF7E 3MHHC 4B3MI 3WU4A 4OOGC 3F6GA 1Z5AA 4OZEA 5EL9A 2EPKX 2YZTA 4MYUA 2R76A 1ZM4A 1J26A 1P42A 1NZ0A 4NZVA 1J5EI 3VK6A 2EQ0A 1ZU1A 5F3WA 4Z7YA 1B69A 2L2NA 4BA1A 1Z0GA 3J7AM 1A1JA 4Z7CA 2A2CA 3THOB 4DPYA 2EOYA 4DV2E 4DR3E 3UHMA 1YSAC 4DMIA 1EH6A 3HTXA 4LFCE 3PS2A 2LTSA 3LNUA 2JOBA 4ZYGA 4BA2A 1USUA 2EPRA 4J8ZA 2UUCE 2GPIA 1UEKA 1B63A 3NZKA 4USMA 5DNLA 3HPSA 2EM5A 2UUBE 1OJ4A 2MC6A 4OO1A 4UT4A 2C37B 1OYPA 1BBGA 4BC7A 4JI3I 4R2RA 2DGCA 4DU8A 5JEAB 4DUYI 1UDSA 2VESA 1IBLE 1FWKA 1XMOE 5C0XB 3CWVA 3HULA 2OI2A 1UILA 4DR4I 4IS1C 5KL7A 2N3GA 2EL4A 5EKWA 3QT5A 2GS8A 5DRPA 2LT7A 1I94I 3F6HA 4LU9A 1ZM3A 3ZOQB 2LVHA 4B3TE 4LF4E 5A6KA 5K36F 3ADJA 4IFDB 3PRYA 1FWLA 2YTQA 1HNZE 4B3RE 2EMAA 1A1FA 2BB8A 2EM2A 4HACA 5DROA 2PO1B 1STUA 4IZKB 2EMGA 2MKDA 3PYDA 4FW5A 4O4KA 3OMLA 2M4IA 3B82A 4FW7A 1N0UA 3P06A 2DIXA 2WBSA 4B3SI 3ADGA 3JAMC 1Z0WA 2GO4A 1ZAAC 1H7UA 2WNRB 4DPWA 5AE2A 5IT9Q 1Z1BA 4FW9A 2EMHA 3KWRA 2JYAA 2LUQA 3JU0A 5DNYA 1T39A 2E72A 1HNWE 3BIDA 1E3PA 2O1VA 1N34I 3Q6NA 4ZYEA 2F4VE 1N0VC 1FJGI 1FKAE 3ZKBA 4BCAA 4IS9A 1DGCA 2DMIA 2MDGA 4DUZI 2YSPA 4R2EA 1JK2A 1YUJA 2BR2B 2E1RA 2DSYA 5AE1A 4DV1I 4LF6I 1XMQE 2UXBE 1Y4UA 4O24A 3LPSA 5ELWA 4DU7A 2NN6C 2B9DA 1ZXMA 4QNJA 1H74A 2EMBA 3PYGA 5KL3A 3B4TA 3CDJA 2X36A 2IESA 1DI2A 2PO2B 1ZXNA 4LF8I 4DV7E 2EM3A 2EPUA 2NN6E 1KVKA 2L6MA 1AH5A 4NXMI 2Z5BB 4RPFA 4R2CA 2JP9A 1PJQA 2UXCE 4DV5E 2EOFA 2YSOA 1B62A 2BA0D 4DKKA 2DEJA 4WXDA 2V8PA 5A6AA 3D4JA 3WU6A 1XNRI 4BHCA 2EOEA 2LMZA 1Z5CA 3GONA 4AIMA 2YU8A 1HR0I 3EQ1A 1Z0EA 2YTEA 2EJ4A 4IFDC 2EMCA 1IQOA 1ZBTA 2PNZA 2O1TA 2EMZA 1XNQE 1MX0A 2CZ9A 3F0NA 2E5LE 5AC4A 2JE6B 1T4LB 3V2UC 2LJPA 2EL5A 2YTPA 2HKEA 4JI2I 3OTOI 4WSGA 1X6HA 1NCSA 1SR9A 5KL4A 2C39A 2A2DA 3T1HI 2B7TA 2M7QA 1EH7A 2CSHA 1LLMC 4FWGA 1MEYC 2CPNA 1GQEA 3BGHA 4B3ME 2PRTA 1Y5YA 3P3GA 2B7VA 4R03A 2EQ3A 3HKMA 1Y6ZA 2YTFA 2YTNA 2EPZA 2EPNA 1J5EE 4MU0A 3EPJA 5IWAI 4FK5C 2YRHA 5LMNI 3ZZUA 4PRVA 1IBME 2Q8UA 3HQ1A 2ELYA 2WW4A 4JI4I 1EI1A 4RH8A 2N8XA 1VISA 4FN5A 5JEAD 2EPCA 5IT9C 2JEBB 4DPXA 1RR9A 2MKNA 4JI7I 2PO0B 1YYOA 4JI8I 3H1CA 2ENCA 4X62I 2A25A 4YY3I 1U2RA 4OO1F 2L2KB 2C37A 1A1HA 2JEAB 4JI3E 2EWLA 2EZ6A 5JEAA 2NA2A 5IV8B 4LF9I 4BS9A 2X7IA 1IQSA 2PNMA 4P78A 4DUYE 1A6FA 3B8HA 5KL5A 1WUUA 1BB8A 3QT7A 2R42A 1OYRA 3M99B 4LCFA 1X3CA 5C0XA 4IFDD 2EPAA 3VHTB 1WRJA 4DR4E 2VQEE 5LL6R 4M9VC 4X65I 4DR1I 1MGTA 1I94E 1G2FC 1XXEA 4DV6I 2EORA 3V5RA 1PDAA 4BHBA 3VYXA 2VRDA 4DR7I 4P7DA 4X64I 4IFDA 2EOOA 3BBGA 4F6MA 1RMDA 2EPMX 3HXLA 4WUDA 2NN6B 1HNXI 4LPFA 2PO1A 1RHYA 4OX9I 4WYQB 4IZKA 4USKA 2V8QB 3KRNA 5DRQA 5K36C 2HFSA 2Q2EB 1X6FA 3ZKDA 4O5GA 4X8WA 1BKNA 4ED4A 5AASA 2EN6A 3T1YE 2B3TB 4B3SE 2WNRA 1JK1A 1N33I 2JPAA 2IOPA 2O1WA 1KTVA 2JVAA 4N4RB 3PS1A 4AQYI 3P3CA 5K36E 1FJGE 2EOZA 2V88A 4HEIA 3L7ZB 2VF1A 4LFAI 3IWCA 4GKKI 2JXPA 3C4TA 4BBYA 2BR2A 4TUGA 4DUZE 1ZBQA 1TF3A 1H73A 4FWDA 1T4OA 4LF6E 3KZYA 4NXNI 3RMPA 2WP8B 4JI5I 2EN4A 3P1XA 2UUAI 3IWDA 2BA0G 2BM0A 4DR2I 2LTRA 2ENAA 4MLVA 1PIEA 2EOIA 2UU9I 2ENHA 2J7JA 5TSEA 4ISAA 2DMYA 2RTXA 4AIDA 2PO2A 4P52A 2EOXA 4LF8E 4ZYDA 3K6QA 4X66E 2EOJA 2Z5BA 1ZM2A 4NXME 4I3HA 1X5WA 3KZZA 2UXDI 2WZOA 2K4VA 4LFBI 1USVA 1X6EA 1XNRE 2VF3A 2EPPA 2HHHI 2V2ZA
chains in the Genus database with same CATH topology
4DPUA 1HR0E 2JOXA 4XTJA 3H09A 4DV4I 1XHKA 2HFUA 4DPTA 4JI2E 3OTOE 4JV5I 3ADIA 5CFFE 2L3JA 2NUGA 1S4EA 2MDRA 3T1HE 4HXZA 2V87A 2CGEA 4DR6I 4JI1I 4TUIA 1ELOA 4F9CB 1EA6A 4KHPI 4WUBA 2Z5CB 2HK3A 4DR5I 4DV3I 4I8OA 2V2VA 1MG7A 2L2MA 5IWAE 3QT8A 2L8TA 4FWHA 5LMNE 4P7AA 5A2QQ 4JI4E 2ZITA 1PKPA 2M1SA 3DJWA 2ZM6I 4KQVA 4JI7E 5BR8E 2RSMA 4JI8E 2E1MA 5LMUI 4WPYA 3FIGA 4X62E 2KOUA 4YY3E 3B78A 1XMQI 1KIJA 1RREA 4JI6I 4LF9E 4YHHI 2H36X 4URLA 4ZVIA 2ZBKB 5AE3A 1N36I 4MYTA 2MC5A 4F9AB 4PU9A 4DV0I 3AUZA 3K1JA 4X65E 3M6AA 4R1FA 4DR1E 1GZ6A 1MU5A 3ADLA 1D6TA 4M1KA 1NHJA 5GMEA 1QZRA 1UHZA 4X64E 1IBKI 4LF5I 4JI0I 1HNXE 4IZJD 4GKJI 4OX9E 1Z0BA 2N3HA 1Z0TA 2F8BA 1H72C 2JWOA 2O1UA 2FV4B 3Q6MA 1N34E 2R3VA 1EKZA 2JR1A 1N33E 3ZZ0A 2IHR1 4R8OA 3H4LA 4JYAI 4AQYE 1YZ9A 2IOQA 4HYMA 4LFAE 4GKKE 2DEIA 2VQFI 2ODRC 1YYKA 4NXNE 2DB2A 4JI5E 2UUAE 3AV0A 3PYEA 1S16A 4DR2E 3ZZTA 1YYWA 2GQ0A 1RQ0A 2HKJA 4K0KI 2UU9E 1IBMI 3K85A 5A2QC 1PVGA 3WU3A 1N32I 3LLHA 4IZJB 3C4BA 2V86A 1WXRA 3J80Q 2NUEA 2UXDE 4EMDA 2LE2A 4LFBE 1Z0VA 4UTGA 4LF7I 4L8NA 2LUPB 4M2ZA 1Y4SA 4DV1E 2HHHE 4HY1A 3ZM7A 4Q28A 2YT4A 2RS7A 2PNLA 2FGGA 2V83A 4F9BB 4M0VA 2HK2A 4LTYA 4DV2I 4DR3I 4DV4E 2VQEI 4LFCI 4JV5E 4JG4A 2RS6A 4BMJA 2L3CA 4DR6E 2CG9A 4JI1E 2UUCI 4BC9A 2V2QA 4KHPE 2UUBI 3J81Q 2Z5CA 4DR5E 4DV3E 3PYFA 1NHIA 4WFTA 1QU6A 2ODRD 5FLXQ 1IBLI 3T1YI 1XMOI 2FTXB 1Z59A 2L33A 2ZM6E 3VYYA 2XEXA 1X48A 2LRSA 2L92A 4F54A 4PRXA 4B3TI 5LMUE 5L3JA 4LF4I 3MSWA 1DQ3A 4WUCA 1FNMA 2KONA 3Q1QA 1HNZI 4B3RI 4JI6E 4HACB 4YHHE 1T4NA 1N36E 3J7Yp 5GMDA 2V85A 2G7HA 3LMLA 4DV0E 3QT6A 4N3OA 4GEQB 4DXLA 1HNWI 4X66I 2F4VI 3J80C 2BV3A 4M30A 1IBKE 4LF5E 3WU5A 1O0WA 4JI0E 1RC7A 4L5NC 4GKJE 2UXBI 2V34A 2NPFA 1DARA 1WHNA 2AJ4A 3DF6A 2V89A 2BM1A 2VE7C 4JYAE 4DV7I 4KZSA 2NUFA 4DV6E 3HPZA 2KHXA 1Z5BA 2EFGA 4DR7E 1WHQA 2VQFE 2Z5EA 3JTZA 5T6JA 4DV5I 2JY9A 2UXCI 1NHHA 5ADZA 3J81C 1H7SA 5FWKA 4K0KE 1FI4A 3JAMQ 3J7AG 1XNQI 2J7KA 5FLXC 2E5LI 1X49A 4WSPA 3K17A 1K47A 3LTOA 1KKHA 1N32E 1Z0CA 2LJHA 1ZM9A 1HK7A 4IZJA 5BR8I 2LBSB 3IWBA 3HJCA 1X47A 4LF7E 4B3MI 3WU4A 4OOGC 3F6GA 1Z5AA 2YZTA 4MYUA 1ZM4A 1J26A 1NZ0A 1J5EI 3VK6A 5F3WA 4Z7YA 2L2NA 1Z0GA 3J7AM 4Z7CA 2A2CA 4DPYA 4DV2E 4DR3E 4DMIA 3HTXA 4LFCE 2LTSA 3LNUA 2JOBA 1USUA 4J8ZA 2UUCE 4USMA 1UEKA 1B63A 3HPSA 2UUBE 1OJ4A 2MC6A 4UT4A 4BC7A 4JI3I 4DU8A 4DUYI 1IBLE 1FWKA 1XMOE 3CWVA 3HULA 2OI2A 1UILA 4DR4I 2N3GA 3QT5A 2GS8A 1I94I 3F6HA 4LU9A 1ZM3A 3ZOQB 4B3TE 4LF4E 3ADJA 3PRYA 1FWLA 4B3RE 1HNZE 4HACA 1STUA 4IZKB 3PYDA 3OMLA 2M4IA 3B82A 1N0UA 3P06A 2DIXA 4B3SI 3ADGA 3JAMC 1Z0WA 4DPWA 1H7UA 5AE2A 5IT9Q 4FW9A 3KWRA 2LUQA 3JU0A 5DNYA 1HNWE 2O1VA 3Q6NA 2F4VE 1FJGI 1N0VC 1FKAE 3ZKBA 4BCAA 4DUZI 2E1RA 2DSYA 5AE1A 4DV1I 4LF6I 1XMQE 2UXBE 1Y4UA 3LPSA 4DU7A 2B9DA 1ZXMA 1H74A 3PYGA 2X36A 1DI2A 1ZXNA 4LF8I 4DV7E 1KVKA 2L6MA 4NXMI 2Z5BB 4RPFA 2UXCE 4DV5E 2DEJA 1B62A 2V8PA 3WU6A 4DKKA 1XNRI 3D4JA 2LMZA 1Z5CA 3GONA 1HR0I 1Z0EA 1ZBTA 2O1TA 1XNQE 1MX0A 2CZ9A 3F0NA 2E5LE 1T4LB 3V2UC 2LJPA 2HKEA 4JI2I 3OTOI 1SR9A 2A2DA 3T1HI 2B7TA 2M7QA 4FWGA 2CPNA 1GQEA 4B3ME 2B7VA 4R03A 1Y6ZA 1J5EE 5IWAI 5LMNI 3ZZUA 4PRVA 1IBME 3HQ1A 2WW4A 4JI4I 1EI1A 1VISA 4FN5A 5IT9C 4DPXA 1RR9A 4JI7I 1YYOA 4JI8I 4X62I 4YY3I 1U2RA 2L2KB 4JI3E 2EZ6A 2EWLA 2NA2A 4LF9I 4BS9A 2X7IA 2PNMA 4P78A 4DUYE 1A6FA 3B8HA 1WUUA 3QT7A 2R42A 4DR4E 2VQEE 5LL6R 4X65I 4DR1I 1I94E 4DV6I 3V5RA 3VYXA 4DR7I 4P7DA 4X64I 3HXLA 4WUDA 1HNXI 4OX9I 4WYQB 4IZKA 4USKA 2V8QB 2HFSA 2Q2EB 3ZKDA 4X8WA 1BKNA 1N34I 4ED4A 5AASA 3T1YE 2B3TB 4B3SE 1N33I 2IOPA 2O1WA 1KTVA 2JVAA 4AQYI 1FJGE 2V88A 4LFAI 2VF1A 4GKKI 3IWCA 3C4TA 4BBYA 4TUGA 4DUZE 1ZBQA 1H73A 4FWDA 1T4OA 4LF6E 4NXNI 3RMPA 4JI5I 3P1XA 2UUAI 3IWDA 2BM0A 4DR2I 2LTRA 1PIEA 2UU9I 2DMYA 2RTXA 4P52A 4LF8E 3K6QA 4X66E 2Z5BA 1ZM2A 4NXME 4I3HA 2UXDI 2WZOA 2K4VA 4LFBI 1USVA 1XNRE 2VF3A 2HHHI 2V2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPU A;  1HR0 E;  4XTJ A;  4DV4 I;  1XHK A;  2HFU A;  4DPT A;  4JI2 E;  3OTO E;  4JV5 I;  3ADI A;  5CFF E;  2L3J A;  2NUG A;  1S4E A;  2MDR A;  3T1H E;  4HXZ A;  4DR6 I;  4JI1 I;  1ELO A;  1EA6 A;  4KHP I;  4WUB A;  2HK3 A;  4DR5 I;  4DV3 I;  2V2V A;  1MG7 A;  2L2M A;  5IWA E;  3QT8 A;  4FWH A;  4P7A A;  5LMN E;  5A2Q Q;  4JI4 E;  2ZIT A;  1PKP A;  2ZM6 I;  4KQV A;  4JI7 E;  5BR8 E;  2RSM A;  4JI8 E;  5LMU I;  4X62 E;  4YY3 E;  3B78 A;  1XMQ I;  1KIJ A;  1RRE A;  4JI6 I;  4LF9 E;  4YHH I;  4URL A;  4ZVI A;  2ZBK B;  1N36 I;  4MYT A;  4PU9 A;  4DV0 I;  3K1J A;  4X65 E;  3M6A A;  4R1F A;  4DR1 E;  1MU5 A;  3ADL A;  1D6T A;  4M1K A;  1NHJ A;  5GME A;  1QZR A;  1UHZ A;  4X64 E;  1IBK I;  4LF5 I;  4JI0 I;  1HNX E;  4GKJ I;  4OX9 E;  1Z0B A;  2N3H A;  1Z0T A;  1H72 C;  1N34 E;  2R3V A;  1EKZ A;  1N33 E;  3ZZ0 A;  2IHR 1;  3H4L A;  4JYA I;  4AQY E;  1YZ9 A;  4HYM A;  4LFA E;  4GKK E;  2DEI A;  2VQF I;  1YYK A;  4NXN E;  2DB2 A;  4JI5 E;  2UUA E;  3PYE A;  1S16 A;  4DR2 E;  3ZZT A;  1YYW A;  1RQ0 A;  2HKJ A;  4K0K I;  2UU9 E;  1IBM I;  5A2Q C;  1PVG A;  3WU3 A;  1N32 I;  3LLH A;  3C4B A;  3J80 Q;  2NUE A;  2UXD E;  4EMD A;  4LFB E;  1Z0V A;  4UTG A;  4LF7 I;  2LUP B;  4M2Z A;  4DV1 E;  2HHH E;  4HY1 A;  3ZM7 A;  2YT4 A;  2RS7 A;  2HK2 A;  4DV2 I;  4DR3 I;  4DV4 E;  2VQE I;  4LFC I;  4JV5 E;  4JG4 A;  2RS6 A;  2L3C A;  4DR6 E;  4JI1 E;  2UUC I;  2V2Q A;  4KHP E;  2UUB I;  3J81 Q;  4DR5 E;  4DV3 E;  3PYF A;  1NHI A;  4WFT A;  1QU6 A;  5FLX Q;  1IBL I;  3T1Y I;  1XMO I;  1Z59 A;  2L33 A;  2ZM6 E;  3VYY A;  2XEX A;  1X48 A;  2LRS A;  4PRX A;  4B3T I;  5LMU E;  5L3J A;  4LF4 I;  4WUC A;  1FNM A;  3Q1Q A;  4B3R I;  1HNZ I;  4JI6 E;  4HAC B;  4YHH E;  1T4N A;  1N36 E;  3J7Y p;  5GMD A;  4DV0 E;  3QT6 A;  4DXL A;  1HNW I;  4X66 I;  2F4V I;  3J80 C;  2BV3 A;  4M30 A;  1IBK E;  4LF5 E;  3WU5 A;  1O0W A;  4JI0 E;  1RC7 A;  4GKJ E;  2UXB I;  2V34 A;  2NPF A;  1DAR A;  1WHN A;  2AJ4 A;  2BM1 A;  4JYA E;  4DV7 I;  2NUF A;  4DV6 E;  2KHX A;  1Z5B A;  2EFG A;  4DR7 E;  1WHQ A;  2VQF E;  2UXC I;  4DV5 I;  2JY9 A;  1NHH A;  3J81 C;  1H7S A;  4K0K E;  1FI4 A;  3JAM Q;  1XNQ I;  3J7A G;  2J7K A;  5FLX C;  2E5L I;  1X49 A;  3K17 A;  3LTO A;  1K47 A;  1KKH A;  1Z0C A;  1N32 E;  2LJH A;  1ZM9 A;  5BR8 I;  2LBS B;  1X47 A;  4LF7 E;  4B3M I;  3WU4 A;  4OOG C;  1Z5A A;  4MYU A;  1ZM4 A;  1J26 A;  1NZ0 A;  1J5E I;  4Z7Y A;  2L2N A;  1Z0G A;  3J7A M;  4Z7C A;  2A2C A;  4DPY A;  4DV2 E;  4DR3 E;  3HTX A;  4LFC E;  2LTS A;  3LNU A;  2UUC E;  4USM A;  1UEK A;  1B63 A;  2UUB E;  1OJ4 A;  4UT4 A;  4JI3 I;  4DU8 A;  4DUY I;  1IBL E;  1FWK A;  1XMO E;  3CWV A;  3HUL A;  2OI2 A;  1UIL A;  4DR4 I;  2N3G A;  3QT5 A;  2GS8 A;  1I94 I;  1ZM3 A;  4B3T E;  4LF4 E;  3ADJ A;  1FWL A;  4B3R E;  1HNZ E;  4HAC A;  1STU A;  3PYD A;  3B82 A;  1N0U A;  2DIX A;  4B3S I;  3ADG A;  1Z0W A;  3JAM C;  4DPW A;  1H7U A;  5IT9 Q;  4FW9 A;  2LUQ A;  1HNW E;  1FJG I;  2F4V E;  1N0V C;  1FKA E;  3ZKB A;  4DUZ I;  2E1R A;  4LF6 I;  4DV1 I;  1XMQ E;  2UXB E;  3LPS A;  4DU7 A;  1ZXM A;  1H74 A;  3PYG A;  2X36 A;  1DI2 A;  1ZXN A;  4LF8 I;  4DV7 E;  1KVK A;  4NXM I;  4RPF A;  2UXC E;  4DV5 E;  2DEJ A;  1B62 A;  2V8P A;  3WU6 A;  4DKK A;  1XNR I;  3D4J A;  3GON A;  1Z5C A;  1HR0 I;  1Z0E A;  1ZBT A;  1XNQ E;  1MX0 A;  2CZ9 A;  3F0N A;  2E5L E;  1T4L B;  3V2U C;  2LJP A;  2HKE A;  4JI2 I;  3OTO I;  2A2D A;  3T1H I;  2B7T A;  4FWG A;  2CPN A;  1GQE A;  4B3M E;  2B7V A;  1J5E E;  5IWA I;  5LMN I;  3ZZU A;  4PRV A;  1IBM E;  2WW4 A;  4JI4 I;  1EI1 A;  1VIS A;  4FN5 A;  4DPX A;  5IT9 C;  1RR9 A;  4JI7 I;  1YYO A;  4JI8 I;  4X62 I;  4YY3 I;  1U2R A;  2L2K B;  4JI3 E;  2EZ6 A;  2NA2 A;  4LF9 I;  2X7I A;  4DUY E;  1A6F A;  3B8H A;  1WUU A;  3QT7 A;  2R42 A;  4DR4 E;  2VQE E;  5LL6 R;  4X65 I;  4DR1 I;  1I94 E;  4DV6 I;  3V5R A;  3VYX A;  4DR7 I;  4X64 I;  4WUD A;  1HNX I;  4OX9 I;  4WYQ B;  4USK A;  2HFS A;  2Q2E B;  3ZKD A;  4X8W A;  1BKN A;  1N34 I;  4ED4 A;  3T1Y E;  2B3T B;  4B3S E;  1N33 I;  1KTV A;  2JVA A;  4AQY I;  1FJG E;  4LFA I;  4GKK I;  3C4T A;  4DUZ E;  1H73 A;  4FWD A;  1T4O A;  4LF6 E;  4NXN I;  4JI5 I;  3P1X A;  2UUA I;  2BM0 A;  4DR2 I;  2LTR A;  1PIE A;  2UU9 I;  2DMY A;  2RTX A;  4P52 A;  4LF8 E;  4X66 E;  1ZM2 A;  4NXM E;  4I3H A;  2UXD I;  4LFB I;  1XNR E;  2VF3 A;  2HHH I;  2V2Z A; 
#chains in the Genus database with same CATH topology
 4DPU A;  1HR0 E;  2EMW A;  2WBT A;  3GLL A;  4MDT A;  2ADR A;  4U3D A;  2JOX A;  4XTJ A;  2LCE A;  1F2I G;  1NEI A;  3H09 A;  2AE8 A;  4FW3 A;  2JE6 A;  1R6M A;  3GME A;  2O3Z A;  4MU4 A;  1TN9 A;  2I13 A;  4DV4 I;  1A1K A;  1XHK A;  2HFU A;  4DPT A;  4JI2 E;  3C6K A;  1YPN A;  3OTO E;  3ADI A;  4JV5 I;  5CFF E;  4R2S A;  2L3J A;  2NUG A;  2MDR A;  1S4E A;  2EPL X;  3T1H E;  4MQY A;  4HXZ A;  2V87 A;  2CGE A;  4DR6 I;  4JI1 I;  4TUI A;  1ELO A;  4F9C B;  1EA6 A;  2EMY A;  1TF6 A;  1UN6 B;  4KHP I;  4WUB A;  1OYS A;  5A69 A;  2K7I A;  2Z5C B;  2HK3 A;  4DR5 I;  2EMK A;  4DV3 I;  4I8O A;  2V2V A;  4MU3 A;  1MG7 A;  1A1L A;  2L2M A;  5IWA E;  3QT8 A;  2L8T A;  4FWH A;  5LMN E;  4J3D A;  4P7A A;  4QNK A;  5A2Q Q;  5KL6 A;  2YWQ A;  3UK3 C;  4JI4 E;  2ZIT A;  3EPK A;  2JEB A;  1PKP A;  2M1S A;  3DJW A;  2ZM6 I;  2EML A;  4KQV A;  2PO0 A;  4JI7 E;  5BR8 E;  2RSM A;  4JI8 E;  2D9H A;  2E1M A;  2EM7 A;  1P47 A;  5LMU I;  2NAB A;  4WPY A;  3FIG A;  4X62 E;  2KOU A;  4YY3 E;  1KJK A;  3B78 A;  4ZYH A;  2HJJ A;  5K36 B;  2JT2 A;  2JEA A;  2EM9 A;  5JEA F;  3ECR A;  1XMQ I;  1KIJ A;  1RRE A;  4JI6 I;  4LF9 E;  1E3H A;  4YHH I;  2YRM A;  2H36 X;  4URL A;  4ZVI A;  5C0X F;  2GHF A;  4OO1 C;  3EPL A;  2ZBK B;  2LJU A;  5AE3 A;  1N36 I;  2YTG A;  4MYT A;  5DNX A;  4AM3 A;  2NN6 D;  2MC5 A;  4F9A B;  4PU9 A;  4DV0 I;  3AUZ A;  2YTI A;  3EPH A;  5A6B D;  3K1J A;  4X65 E;  3M6A A;  4R1F A;  2LV2 A;  4DR1 E;  4Q35 B;  1GZ6 A;  2EPO A;  1MU5 A;  3ADL A;  2EOQ A;  4M1K A;  4OO1 E;  1D6T A;  1BBO A;  4NBQ A;  1NHJ A;  5GME A;  4IFD F;  1QZR A;  1UHZ A;  4X64 E;  1IBK I;  4LF5 I;  2CT1 A;  2NN6 A;  4JI0 I;  1HNX E;  2I9I A;  2J65 A;  3M85 D;  4IZJ D;  2YRK A;  5A6B A;  4OX9 E;  2N3H A;  2EM0 A;  4KWY A;  1Z0B A;  1Z0T A;  4GKJ I;  3U1Y A;  4WXC A;  2F8B A;  5A6J A;  1H72 C;  2JWO A;  1UDQ A;  2O1U A;  2FV4 B;  3Q6M A;  1N34 E;  2R3V A;  1EKZ A;  2JR1 A;  2BBG A;  1N33 E;  3ZZ0 A;  2IHR 1;  4R8O A;  3H4L A;  4JYA I;  4AQY E;  1YZ9 A;  2IOQ A;  4HYM A;  2EN7 A;  2EE8 A;  3L7Z A;  4LFA E;  1GTK A;  4GKK E;  2DEI A;  2EOS A;  3TQM A;  4U3B A;  2VQF I;  2EM6 A;  2ODR C;  1YYK A;  4X9J A;  2WP8 A;  4NXN E;  2DB2 A;  4JI5 E;  2UUA E;  3AV0 A;  4R2Q A;  2EL6 A;  1S16 A;  4DR2 E;  3PYE A;  3ZZT A;  5IXM B;  1YYW A;  1RQ0 A;  2GQ0 A;  2HKJ A;  4K0K I;  2UU9 E;  1IBM I;  1IMU A;  5A2Q C;  3K85 A;  3PS3 A;  1PVG A;  4OO1 D;  2BA1 D;  3WU3 A;  2CTD A;  1YHC A;  1N32 I;  3LLH A;  4IZJ B;  3C4B A;  2V86 A;  1WXR A;  3J80 Q;  4F6N A;  2DRP A;  2NUE A;  2UXD E;  2EQ1 A;  2LE2 A;  4LFB E;  1Z0V A;  2C38 B;  4UTG A;  4EMD A;  4LF7 I;  4R2P A;  5LLQ A;  4L8N A;  2LUP B;  2RQL A;  4M2Z A;  1Y4S A;  2WBU A;  4DV1 E;  1QNT A;  2HHH E;  2YTO A;  3DD6 A;  3QG5 C;  3U1K A;  4HY1 A;  4RHB B;  2EP3 A;  4Q28 A;  2EMX A;  2YT4 A;  3ZM7 A;  2RS7 A;  2PNL A;  2FGG A;  2V83 A;  4F9B B;  4FW4 A;  4BA1 B;  3M7N D;  4M0V A;  2YU5 A;  2HK2 A;  4LTY A;  4DV2 I;  4DR3 I;  2HGH A;  4DV4 E;  2YPN A;  2VQE I;  4LFC I;  2GLI A;  4JV5 E;  4JG4 A;  2RS6 A;  3P3E A;  4LOM A;  4BMJ A;  2L3C A;  4BA2 B;  4DR6 E;  2CG9 A;  4JI1 E;  4GQU A;  4OKG A;  2UUC I;  4F2J C;  1UDN A;  4BC9 A;  1AAY A;  2V2Q A;  4KHP E;  2UUB I;  3C6M A;  1G2D C;  3J81 Q;  2Z5C A;  4OO1 B;  4DR5 E;  4DV3 E;  3PYF A;  1NHI A;  2LO3 A;  4WFT A;  1QU6 A;  2ODR D;  3THN A;  5FLX Q;  1UBD C;  3MHS C;  1IBL I;  4LCH A;  2EN2 A;  4HTG A;  1R6L A;  3T1Y I;  1XMO I;  5K36 D;  1KYQ A;  1PJS A;  2FTX B;  4R2A A;  1Z59 A;  2EM4 A;  2L33 A;  2EM8 A;  1L4S A;  1YH8 A;  2ZM6 E;  3VYY A;  5KL2 A;  2XEX A;  1X48 A;  3P76 A;  2LRS A;  3GCM A;  2L92 A;  4F54 A;  4PRX A;  4B3T I;  2DLK A;  5LMU E;  5L3J A;  4LF4 I;  1YFH A;  2F1D A;  2CVE A;  1A1G A;  5K36 A;  3MSW A;  1DQ3 A;  4WUC A;  1FNM A;  2KON A;  2WCC 3;  1HNZ I;  1Y60 A;  3Q1Q A;  4B3R I;  4O43 A;  2GO3 A;  4JI6 E;  4HAC B;  4YHH E;  1T4N A;  3M85 G;  2DLQ A;  2M9A A;  3L00 A;  3J7Y p;  1N36 E;  2V85 A;  5DRR A;  5GMD A;  2G7H A;  5JEA C;  2EMF A;  1VI7 A;  3LML A;  4DV0 E;  3QT6 A;  4N3O A;  1N3G A;  5C0X C;  4GEQ B;  4DXL A;  1HNW I;  1WJP A;  1T38 A;  4X66 I;  2F4V I;  2EN3 A;  3J80 C;  2BV3 A;  4M30 A;  5JEA E;  1IBK E;  4LF5 E;  2NN6 F;  3WU5 A;  1O0W A;  2EOM A;  4JI0 E;  1RC7 A;  5C0X E;  4L5N C;  2ELZ A;  2RPC A;  4GKJ E;  1A1I A;  2V34 A;  2UXB I;  2EPX A;  2YTJ A;  2EMI A;  5AC5 A;  1UDO A;  2NPF A;  1DAR A;  1WHN A;  3BF2 A;  2AJ4 A;  3DF6 A;  2EOH A;  2V89 A;  2R1F A;  2BM1 A;  4MLQ A;  2HC5 A;  2VE7 C;  4NHR A;  4JYA E;  1ZR9 A;  4LCG A;  1EH8 A;  4IFD E;  4DV7 I;  4WX9 A;  1YUI A;  4KZS A;  2NUF A;  4DV6 E;  3HPZ A;  1SFE A;  2KHX A;  1Z5B A;  2BA1 G;  2EFG A;  4DR7 E;  1WHQ A;  2EN8 A;  4FW6 A;  2VQF E;  2Z5E A;  3JTZ A;  5T6J A;  4DV5 I;  2JY9 A;  2UXC I;  1NHH A;  5ADZ A;  4R2D A;  3J81 C;  1H7S A;  5FWK A;  2YTD A;  4K0K E;  3CDI A;  1FI4 A;  3JAM Q;  3J7A G;  4MU1 A;  2PNZ B;  1XNQ I;  2J7K A;  5FLX C;  2E5L I;  1X49 A;  4WSP A;  3K17 A;  1K47 A;  3LTO A;  2RSI A;  1KKH A;  1PJT A;  1N32 E;  1Z0C A;  2LJH A;  1ZM9 A;  1HK7 A;  4IZJ A;  3M7N G;  4IJD A;  2IER A;  5BR8 I;  2C39 B;  2LBS B;  5C0X D;  3IWB A;  2C38 A;  3HJC A;  1X47 A;  2EN1 A;  4GZN C;  4LF7 E;  3MHH C;  4B3M I;  3WU4 A;  4OOG C;  3F6G A;  1Z5A A;  4OZE A;  5EL9 A;  2EPK X;  2YZT A;  4MYU A;  2R76 A;  1ZM4 A;  1J26 A;  1P42 A;  1NZ0 A;  4NZV A;  1J5E I;  3VK6 A;  2EQ0 A;  1ZU1 A;  5F3W A;  4Z7Y A;  1B69 A;  2L2N A;  4BA1 A;  1Z0G A;  3J7A M;  1A1J A;  4Z7C A;  2A2C A;  3THO B;  4DPY A;  2EOY A;  4DV2 E;  4DR3 E;  3UHM A;  1YSA C;  4DMI A;  1EH6 A;  3HTX A;  4LFC E;  3PS2 A;  2LTS A;  3LNU A;  2JOB A;  4ZYG A;  4BA2 A;  1USU A;  2EPR A;  4J8Z A;  2UUC E;  2GPI A;  1UEK A;  1B63 A;  3NZK A;  4USM A;  5DNL A;  3HPS A;  2EM5 A;  2UUB E;  1OJ4 A;  2MC6 A;  4OO1 A;  4UT4 A;  2C37 B;  1OYP A;  1BBG A;  4BC7 A;  4JI3 I;  4R2R A;  2DGC A;  4DU8 A;  5JEA B;  4DUY I;  1UDS A;  2VES A;  1IBL E;  1FWK A;  1XMO E;  5C0X B;  3CWV A;  3HUL A;  2OI2 A;  1UIL A;  4DR4 I;  4IS1 C;  5KL7 A;  2N3G A;  2EL4 A;  5EKW A;  3QT5 A;  2GS8 A;  5DRP A;  2LT7 A;  1I94 I;  3F6H A;  4LU9 A;  1ZM3 A;  3ZOQ B;  2LVH A;  4B3T E;  4LF4 E;  5A6K A;  5K36 F;  3ADJ A;  4IFD B;  3PRY A;  1FWL A;  2YTQ A;  1HNZ E;  4B3R E;  2EMA A;  1A1F A;  2BB8 A;  2EM2 A;  4HAC A;  5DRO A;  2PO1 B;  1STU A;  4IZK B;  2EMG A;  2MKD A;  3PYD A;  4FW5 A;  4O4K A;  3OML A;  2M4I A;  3B82 A;  4FW7 A;  1N0U A;  3P06 A;  2DIX A;  2WBS A;  4B3S I;  3ADG A;  3JAM C;  1Z0W A;  2GO4 A;  1ZAA C;  1H7U A;  2WNR B;  4DPW A;  5AE2 A;  5IT9 Q;  1Z1B A;  4FW9 A;  2EMH A;  3KWR A;  2JYA A;  2LUQ A;  3JU0 A;  5DNY A;  1T39 A;  2E72 A;  1HNW E;  3BID A;  1E3P A;  2O1V A;  1N34 I;  3Q6N A;  4ZYE A;  2F4V E;  1N0V C;  1FJG I;  1FKA E;  3ZKB A;  4BCA A;  4IS9 A;  1DGC A;  2DMI A;  2MDG A;  4DUZ I;  2YSP A;  4R2E A;  1JK2 A;  1YUJ A;  2BR2 B;  2E1R A;  2DSY A;  5AE1 A;  4DV1 I;  4LF6 I;  1XMQ E;  2UXB E;  1Y4U A;  4O24 A;  3LPS A;  5ELW A;  4DU7 A;  2NN6 C;  2B9D A;  1ZXM A;  4QNJ A;  1H74 A;  2EMB A;  3PYG A;  5KL3 A;  3B4T A;  3CDJ A;  2X36 A;  2IES A;  1DI2 A;  2PO2 B;  1ZXN A;  4LF8 I;  4DV7 E;  2EM3 A;  2EPU A;  2NN6 E;  1KVK A;  2L6M A;  1AH5 A;  4NXM I;  2Z5B B;  4RPF A;  4R2C A;  2JP9 A;  1PJQ A;  2UXC E;  4DV5 E;  2EOF A;  2YSO A;  1B62 A;  2BA0 D;  4DKK A;  2DEJ A;  4WXD A;  2V8P A;  5A6A A;  3D4J A;  3WU6 A;  1XNR I;  4BHC A;  2EOE A;  2LMZ A;  1Z5C A;  3GON A;  4AIM A;  2YU8 A;  1HR0 I;  3EQ1 A;  1Z0E A;  2YTE A;  2EJ4 A;  4IFD C;  2EMC A;  1IQO A;  1ZBT A;  2PNZ A;  2O1T A;  2EMZ A;  1XNQ E;  1MX0 A;  2CZ9 A;  3F0N A;  2E5L E;  5AC4 A;  2JE6 B;  1T4L B;  3V2U C;  2LJP A;  2EL5 A;  2YTP A;  2HKE A;  4JI2 I;  3OTO I;  4WSG A;  1X6H A;  1NCS A;  1SR9 A;  5KL4 A;  2C39 A;  2A2D A;  3T1H I;  2B7T A;  2M7Q A;  1EH7 A;  2CSH A;  1LLM C;  4FWG A;  1MEY C;  2CPN A;  1GQE A;  3BGH A;  4B3M E;  2PRT A;  1Y5Y A;  3P3G A;  2B7V A;  4R03 A;  2EQ3 A;  3HKM A;  1Y6Z A;  2YTF A;  2YTN A;  2EPZ A;  2EPN A;  1J5E E;  4MU0 A;  3EPJ A;  5IWA I;  4FK5 C;  2YRH A;  5LMN I;  3ZZU A;  4PRV A;  1IBM E;  2Q8U A;  3HQ1 A;  2ELY A;  2WW4 A;  4JI4 I;  1EI1 A;  4RH8 A;  2N8X A;  1VIS A;  4FN5 A;  5JEA D;  2EPC A;  5IT9 C;  2JEB B;  4DPX A;  1RR9 A;  2MKN A;  4JI7 I;  2PO0 B;  1YYO A;  4JI8 I;  3H1C A;  2ENC A;  4X62 I;  2A25 A;  4YY3 I;  1U2R A;  4OO1 F;  2L2K B;  2C37 A;  1A1H A;  2JEA B;  4JI3 E;  2EWL A;  2EZ6 A;  5JEA A;  2NA2 A;  5IV8 B;  4LF9 I;  4BS9 A;  2X7I A;  1IQS A;  2PNM A;  4P78 A;  4DUY E;  1A6F A;  3B8H A;  5KL5 A;  1WUU A;  1BB8 A;  3QT7 A;  2R42 A;  1OYR A;  3M99 B;  4LCF A;  1X3C A;  5C0X A;  4IFD D;  2EPA A;  3VHT B;  1WRJ A;  4DR4 E;  2VQE E;  5LL6 R;  4M9V C;  4X65 I;  4DR1 I;  1MGT A;  1I94 E;  1G2F C;  1XXE A;  4DV6 I;  2EOR A;  3V5R A;  1PDA A;  4BHB A;  3VYX A;  2VRD A;  4DR7 I;  4P7D A;  4X64 I;  4IFD A;  2EOO A;  3BBG A;  4F6M A;  1RMD A;  2EPM X;  3HXL A;  4WUD A;  2NN6 B;  1HNX I;  4LPF A;  2PO1 A;  1RHY A;  4OX9 I;  4WYQ B;  4IZK A;  4USK A;  2V8Q B;  3KRN A;  5DRQ A;  5K36 C;  2HFS A;  2Q2E B;  1X6F A;  3ZKD A;  4O5G A;  4X8W A;  1BKN A;  4ED4 A;  5AAS A;  2EN6 A;  3T1Y E;  2B3T B;  4B3S E;  2WNR A;  1JK1 A;  1N33 I;  2JPA A;  2IOP A;  2O1W A;  1KTV A;  2JVA A;  4N4R B;  3PS1 A;  4AQY I;  3P3C A;  5K36 E;  1FJG E;  2EOZ A;  2V88 A;  4HEI A;  3L7Z B;  2VF1 A;  4LFA I;  3IWC A;  4GKK I;  2JXP A;  3C4T A;  4BBY A;  2BR2 A;  4TUG A;  4DUZ E;  1ZBQ A;  1TF3 A;  1H73 A;  4FWD A;  1T4O A;  4LF6 E;  3KZY A;  4NXN I;  3RMP A;  2WP8 B;  4JI5 I;  2EN4 A;  3P1X A;  2UUA I;  3IWD A;  2BA0 G;  2BM0 A;  4DR2 I;  2LTR A;  2ENA A;  4MLV A;  1PIE A;  2EOI A;  2UU9 I;  2ENH A;  2J7J A;  5TSE A;  4ISA A;  2DMY A;  2RTX A;  4AID A;  2PO2 A;  4P52 A;  2EOX A;  4LF8 E;  4ZYD A;  3K6Q A;  4X66 E;  2EOJ A;  2Z5B A;  1ZM2 A;  4NXM E;  4I3H A;  1X5W A;  3KZZ A;  2UXD I;  2WZO A;  2K4V A;  4LFB I;  1USV A;  1X6E A;  1XNR E;  2VF3 A;  2EPP A;  2HHH I;  2V2Z A; 
#chains in the Genus database with same CATH homology
 4DPU A;  1HR0 E;  2JOX A;  4XTJ A;  3H09 A;  4DV4 I;  1XHK A;  2HFU A;  4DPT A;  4JI2 E;  3OTO E;  4JV5 I;  3ADI A;  5CFF E;  2L3J A;  2NUG A;  1S4E A;  2MDR A;  3T1H E;  4HXZ A;  2V87 A;  2CGE A;  4DR6 I;  4JI1 I;  4TUI A;  1ELO A;  4F9C B;  1EA6 A;  4KHP I;  4WUB A;  2Z5C B;  2HK3 A;  4DR5 I;  4DV3 I;  4I8O A;  2V2V A;  1MG7 A;  2L2M A;  5IWA E;  3QT8 A;  2L8T A;  4FWH A;  5LMN E;  4P7A A;  5A2Q Q;  4JI4 E;  2ZIT A;  1PKP A;  2M1S A;  3DJW A;  2ZM6 I;  4KQV A;  4JI7 E;  5BR8 E;  2RSM A;  4JI8 E;  2E1M A;  5LMU I;  4WPY A;  3FIG A;  4X62 E;  2KOU A;  4YY3 E;  3B78 A;  1XMQ I;  1KIJ A;  1RRE A;  4JI6 I;  4LF9 E;  4YHH I;  2H36 X;  4URL A;  4ZVI A;  2ZBK B;  5AE3 A;  1N36 I;  4MYT A;  2MC5 A;  4F9A B;  4PU9 A;  4DV0 I;  3AUZ A;  3K1J A;  4X65 E;  3M6A A;  4R1F A;  4DR1 E;  1GZ6 A;  1MU5 A;  3ADL A;  1D6T A;  4M1K A;  1NHJ A;  5GME A;  1QZR A;  1UHZ A;  4X64 E;  1IBK I;  4LF5 I;  4JI0 I;  1HNX E;  4IZJ D;  4GKJ I;  4OX9 E;  1Z0B A;  2N3H A;  1Z0T A;  2F8B A;  1H72 C;  2JWO A;  2O1U A;  2FV4 B;  3Q6M A;  1N34 E;  2R3V A;  1EKZ A;  2JR1 A;  1N33 E;  3ZZ0 A;  2IHR 1;  4R8O A;  3H4L A;  4JYA I;  4AQY E;  1YZ9 A;  2IOQ A;  4HYM A;  4LFA E;  4GKK E;  2DEI A;  2VQF I;  2ODR C;  1YYK A;  4NXN E;  2DB2 A;  4JI5 E;  2UUA E;  3AV0 A;  3PYE A;  1S16 A;  4DR2 E;  3ZZT A;  1YYW A;  2GQ0 A;  1RQ0 A;  2HKJ A;  4K0K I;  2UU9 E;  1IBM I;  3K85 A;  5A2Q C;  1PVG A;  3WU3 A;  1N32 I;  3LLH A;  4IZJ B;  3C4B A;  2V86 A;  1WXR A;  3J80 Q;  2NUE A;  2UXD E;  4EMD A;  2LE2 A;  4LFB E;  1Z0V A;  4UTG A;  4LF7 I;  4L8N A;  2LUP B;  4M2Z A;  1Y4S A;  4DV1 E;  2HHH E;  4HY1 A;  3ZM7 A;  4Q28 A;  2YT4 A;  2RS7 A;  2PNL A;  2FGG A;  2V83 A;  4F9B B;  4M0V A;  2HK2 A;  4LTY A;  4DV2 I;  4DR3 I;  4DV4 E;  2VQE I;  4LFC I;  4JV5 E;  4JG4 A;  2RS6 A;  4BMJ A;  2L3C A;  4DR6 E;  2CG9 A;  4JI1 E;  2UUC I;  4BC9 A;  2V2Q A;  4KHP E;  2UUB I;  3J81 Q;  2Z5C A;  4DR5 E;  4DV3 E;  3PYF A;  1NHI A;  4WFT A;  1QU6 A;  2ODR D;  5FLX Q;  1IBL I;  3T1Y I;  1XMO I;  2FTX B;  1Z59 A;  2L33 A;  2ZM6 E;  3VYY A;  2XEX A;  1X48 A;  2LRS A;  2L92 A;  4F54 A;  4PRX A;  4B3T I;  5LMU E;  5L3J A;  4LF4 I;  3MSW A;  1DQ3 A;  4WUC A;  1FNM A;  2KON A;  3Q1Q A;  1HNZ I;  4B3R I;  4JI6 E;  4HAC B;  4YHH E;  1T4N A;  1N36 E;  3J7Y p;  5GMD A;  2V85 A;  2G7H A;  3LML A;  4DV0 E;  3QT6 A;  4N3O A;  4GEQ B;  4DXL A;  1HNW I;  4X66 I;  2F4V I;  3J80 C;  2BV3 A;  4M30 A;  1IBK E;  4LF5 E;  3WU5 A;  1O0W A;  4JI0 E;  1RC7 A;  4L5N C;  4GKJ E;  2UXB I;  2V34 A;  2NPF A;  1DAR A;  1WHN A;  2AJ4 A;  3DF6 A;  2V89 A;  2BM1 A;  2VE7 C;  4JYA E;  4DV7 I;  4KZS A;  2NUF A;  4DV6 E;  3HPZ A;  2KHX A;  1Z5B A;  2EFG A;  4DR7 E;  1WHQ A;  2VQF E;  2Z5E A;  3JTZ A;  5T6J A;  4DV5 I;  2JY9 A;  2UXC I;  1NHH A;  5ADZ A;  3J81 C;  1H7S A;  5FWK A;  4K0K E;  1FI4 A;  3JAM Q;  3J7A G;  1XNQ I;  2J7K A;  5FLX C;  2E5L I;  1X49 A;  4WSP A;  3K17 A;  1K47 A;  3LTO A;  1KKH A;  1N32 E;  1Z0C A;  2LJH A;  1ZM9 A;  1HK7 A;  4IZJ A;  5BR8 I;  2LBS B;  3IWB A;  3HJC A;  1X47 A;  4LF7 E;  4B3M I;  3WU4 A;  4OOG C;  3F6G A;  1Z5A A;  2YZT A;  4MYU A;  1ZM4 A;  1J26 A;  1NZ0 A;  1J5E I;  3VK6 A;  5F3W A;  4Z7Y A;  2L2N A;  1Z0G A;  3J7A M;  4Z7C A;  2A2C A;  4DPY A;  4DV2 E;  4DR3 E;  4DMI A;  3HTX A;  4LFC E;  2LTS A;  3LNU A;  2JOB A;  1USU A;  4J8Z A;  2UUC E;  4USM A;  1UEK A;  1B63 A;  3HPS A;  2UUB E;  1OJ4 A;  2MC6 A;  4UT4 A;  4BC7 A;  4JI3 I;  4DU8 A;  4DUY I;  1IBL E;  1FWK A;  1XMO E;  3CWV A;  3HUL A;  2OI2 A;  1UIL A;  4DR4 I;  2N3G A;  3QT5 A;  2GS8 A;  1I94 I;  3F6H A;  4LU9 A;  1ZM3 A;  3ZOQ B;  4B3T E;  4LF4 E;  3ADJ A;  3PRY A;  1FWL A;  4B3R E;  1HNZ E;  4HAC A;  1STU A;  4IZK B;  3PYD A;  3OML A;  2M4I A;  3B82 A;  1N0U A;  3P06 A;  2DIX A;  4B3S I;  3ADG A;  3JAM C;  1Z0W A;  4DPW A;  1H7U A;  5AE2 A;  5IT9 Q;  4FW9 A;  3KWR A;  2LUQ A;  3JU0 A;  5DNY A;  1HNW E;  2O1V A;  3Q6N A;  2F4V E;  1FJG I;  1N0V C;  1FKA E;  3ZKB A;  4BCA A;  4DUZ I;  2E1R A;  2DSY A;  5AE1 A;  4DV1 I;  4LF6 I;  1XMQ E;  2UXB E;  1Y4U A;  3LPS A;  4DU7 A;  2B9D A;  1ZXM A;  1H74 A;  3PYG A;  2X36 A;  1DI2 A;  1ZXN A;  4LF8 I;  4DV7 E;  1KVK A;  2L6M A;  4NXM I;  2Z5B B;  4RPF A;  2UXC E;  4DV5 E;  2DEJ A;  1B62 A;  2V8P A;  3WU6 A;  4DKK A;  1XNR I;  3D4J A;  2LMZ A;  1Z5C A;  3GON A;  1HR0 I;  1Z0E A;  1ZBT A;  2O1T A;  1XNQ E;  1MX0 A;  2CZ9 A;  3F0N A;  2E5L E;  1T4L B;  3V2U C;  2LJP A;  2HKE A;  4JI2 I;  3OTO I;  1SR9 A;  2A2D A;  3T1H I;  2B7T A;  2M7Q A;  4FWG A;  2CPN A;  1GQE A;  4B3M E;  2B7V A;  4R03 A;  1Y6Z A;  1J5E E;  5IWA I;  5LMN I;  3ZZU A;  4PRV A;  1IBM E;  3HQ1 A;  2WW4 A;  4JI4 I;  1EI1 A;  1VIS A;  4FN5 A;  5IT9 C;  4DPX A;  1RR9 A;  4JI7 I;  1YYO A;  4JI8 I;  4X62 I;  4YY3 I;  1U2R A;  2L2K B;  4JI3 E;  2EZ6 A;  2EWL A;  2NA2 A;  4LF9 I;  4BS9 A;  2X7I A;  2PNM A;  4P78 A;  4DUY E;  1A6F A;  3B8H A;  1WUU A;  3QT7 A;  2R42 A;  4DR4 E;  2VQE E;  5LL6 R;  4X65 I;  4DR1 I;  1I94 E;  4DV6 I;  3V5R A;  3VYX A;  4DR7 I;  4P7D A;  4X64 I;  3HXL A;  4WUD A;  1HNX I;  4OX9 I;  4WYQ B;  4IZK A;  4USK A;  2V8Q B;  2HFS A;  2Q2E B;  3ZKD A;  4X8W A;  1BKN A;  1N34 I;  4ED4 A;  5AAS A;  3T1Y E;  2B3T B;  4B3S E;  1N33 I;  2IOP A;  2O1W A;  1KTV A;  2JVA A;  4AQY I;  1FJG E;  2V88 A;  4LFA I;  2VF1 A;  4GKK I;  3IWC A;  3C4T A;  4BBY A;  4TUG A;  4DUZ E;  1ZBQ A;  1H73 A;  4FWD A;  1T4O A;  4LF6 E;  4NXN I;  3RMP A;  4JI5 I;  3P1X A;  2UUA I;  3IWD A;  2BM0 A;  4DR2 I;  2LTR A;  1PIE A;  2UU9 I;  2DMY A;  2RTX A;  4P52 A;  4LF8 E;  3K6Q A;  4X66 E;  2Z5B A;  1ZM2 A;  4NXM E;  4I3H A;  2UXD I;  2WZO A;  2K4V A;  4LFB I;  1USV A;  1XNR E;  2VF3 A;  2HHH I;  2V2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...