4B3TE

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3tE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tE02
1H72C 1J5EI 4X65E 3C4BA 2UXCI 3J81Q 4DUYE 1ZXMA 4DR7E 4XTJA 3WU3A 4GKJI 3CWVA 4DV3I 4LF6I 4B3SI 1N0UA 5LMNI 1HR0E 4HACA 2UXBE 4LF4I 2HFUA 4USMA 4DV5E 2B3TB 1MX0A 4DR3I 1HNZI 4KQVA 2UXBI 4JV5E 1Z0GA 2NA2A 2KHXA 4DV3E 3K17A 1NHHA 3LNUA 4DPTA 1Z5AA 2VQFI 1QZRA 1H7SA 4AQYI 4P7AA 4JI1I 2A2DA 2DEJA 3OTOE 1UILA 4JI0E 4PRXA 4JI2I 4UT4A 1IBKE 4KHPE 2UUCI 2LJHA 3WU5A 2DEIA 1NZ0A 1WHNA 4DR4I 4JI3I 4JI6E 2ZM6E 4DR4E 1Z0VA 1DARA 2AJ4A 4PU9A 1KIJA 2HHHI 4JI5E 3T1YI 4JV5I 1H7UA 4LF4E 4B3MI 3QT7A 3PYGA 2LUQA 3OTOI 3WU6A 3HTXA 2ZM6I 4DV1E 5A2QQ 3ZM7A 1OJ4A 4DPUA 3VYYA 1Z0BA 1A6FA 1N33E 2VQFE 4DU8A 1IBME 2F4VE 1D6TA 2L2MA 1RQ0A 2N3HA 1VISA 4FWDA 4NXME 2MDRA 4LF8I 4LF9I 4DKKA 4DPYA 4DV0E 3LLHA 4LFAI 4RPFA 4DU7A 1BKNA 1H74A 5A2QC 4LFCE 4JI4I 1HNXI 5LMUE 4P52A 3D4JA 1XMOI 3ADJA 4YY3I 1IBLI 1PKPA 4JI7E 3ADIA 4URLA 4DR7I 4OOGC 2BV3A 2R3VA 4LF7I 1UEKA 5LMNE 1FKAE 4X64E 4DV5I 3Q1QA 3V5RA 1WUUA 3PYDA 2LUPB 1XNQI 1FWKA 1S16A 1XNRE 1N0VC 1N34E 2E1RA 1X49A 4X66E 2UUAE 1GQEA 4LFAE 1MU5A 4DR1I 4B3RE 1H73A 4DUYI 4JYAI 1ZM9A 3PYFA 1Z59A 1MG7A 2EZ6A 3HULA 4JG4A 4OX9E 2CZ9A 2UUBI 4HXZA 2RSMA 2RS7A 5GMDA 5BR8I 3ZZUA 4DV4E 1K47A 1Z5CA 2A2CA 2V2VA 2R42A 2VF3A 4DR2I 2B7VA 2UUCE 4FWGA 2XEXA 4DV7E 3GONA 1FI4A 5LL6R 1PIEA 4DV6E 4K0KI 2V8PA 2L3JA 2Q2EB 4DPWA 2L3CA 2L2NA 2BM0A 1NHIA 4JI6I 2LTSA 4DR5E 2HKJA 4B3RI 4AQYE 2N3GA 4X64I 1IBKI 4KHPI 4DR3E 1HNZE 1XMQE 1HNWE 2L2KB 4X66I 4WUCA 1Z0EA 4DXLA 1XNRI 3WU4A 4DV2I 5IWAE 4JI4E 1HNWI 4LF7E 2DIXA 2BM1A 4JI7I 4EMDA 2L33A 1RREA 4DV0I 4B3SE 3B8HA 1PVGA 3T1HI 2DB2A 4DPXA 1XMQI 3JAMQ 4B3TE 2LJPA 4LFCI 4DR5I 1HR0I 2UXCE 1FNMA 2JVAA 2J7KA 2NPFA 4DV6I 2NUFA 1S4EA 1N33I 1ZM4A 2B7TA 1J5EE 2V2ZA 3ZKBA 2HKEA 1IBMI 2F4VI 3LPSA 3V2UC 2UU9E 1ZBTA 1EA6A 1QU6A 3J80C 4WUDA 1XHKA 1WHQA 5FLXQ 1Z0WA 1YYKA 1O0WA 1FJGE 1Z0CA 1ELOA 2EFGA 3QT8A 2ZITA 1KVKA 4B3ME 3J80Q 1Z0TA 4JI8E 4ZVIA 2LBSB 1DI2A 4WFTA 4MYTA 5FLXC 2JY9A 4DV1I 4JI5I 4HY1A 2E5LE 4DR6E 4WYQB 1YYWA 4ED4A 4X62I 4DUZE 2NUGA 4JI2E 2VQEE 2V34A 4DV4I 3K1JA 1KTVA 2HHHE 3JAMC 4GKKE 1XNQE 1Z5BA 4X62E 2HK3A 2IHR1 4JI3E 4M2ZA 1N34I 4HYMA 5CFFE 4GKKI 4YHHE 4FW9A 1EKZA 2WW4A 4FWHA 4B3TI 2VQEI 3B78A 1FJGI 2LTRA 2X36A 3QT6A 4YY3E 4DR6I 1ZXNA 2OI2A 2X7IA 1B62A 2DMYA 1IBLE 4I3HA 2UXDE 4LFBE 3P1XA 4UTGA 2LRSA 4X65I 2HK2A 3J81C 3B82A 4JYAE 4GKJE 4Z7CA 1XMOE 2V2QA 2UUAI 3LTOA 1NHJA 4LF5E 4PRVA 4LF6E 4WUBA 1T4OA 1I94E 1FWLA 5L3JA 1UHZA 1I94I 2UXDI 4DV7I 4LF9E 4LF8E 2ZBKB 4LF5I 1RR9A 2GS8A 4Z7YA 4NXMI 3M6AA 2YT4A 2RTXA 4NXNE 3J7AG 3ADGA 3T1HE 5IT9C 3J7Yp 5IWAI 3VYXA 4X8WA 1HNXE 1N32E 4LFBI 1YYOA 2UUBE 3ZZ0A 1KKHA 5GMEA 4DV2E 1X48A 3QT5A 2CPNA 1N36I 3T1YE 4M1KA 4DR1E 4DUZI 3F0NA 3ZKDA 1EI1A 1N36E 3H4LA 1U2RA 2HFSA 4JI8I 4YHHI 4K0KE 4R1FA 2E5LI 1YZ9A 4JI1E 1ZM2A 4DR2E 3ADLA 1B63A 1T4LB 4USKA 4MYUA 3J7AM 4M30A 1T4NA 1X47A 1J26A 1ZM3A 2RS6A 1N32I 1STUA 4HACB 5LMUI 5BR8E 3PYEA 4JI0I 3C4TA 2NUEA 2UU9I 4NXNI 5IT9Q 3ZZTA 4FN5A 1RC7A 4OX9I
chains in the Genus database with same CATH superfamily
1H72C 1J5EI 3BIDA 2EM3A 2VRDA 4X65E 1YHCA 3AUZA 2LVHA 2RPCA 2YTQA 4BA1B 5K36F 3C4BA 5DNYA 4BCAA 2DRPA 1OYRA 3J81Q 2NABA 4DUYE 1ZXMA 4DR7E 4XTJA 3WU3A 4GKJI 2EPCA 2KOUA 4IZJB 2YTFA 3B4TA 3CWVA 4DV3I 5AE2A 2LT7A 2EPUA 4ZYHA 4OO1F 4BHBA 4WX9A 4B3SI 4LF6I 2EE8A 3Q6NA 1E3PA 1N0UA 5LMNI 2LCEA 2EM8A 5KL5A 2EP3A 1HR0E 5K36E 4HACA 2UXBE 2YWQA 2V86A 2WCC3 2HFUA 3P3GA 4IZJA 4F9AB 3P3EA 4DV5E 1BB8A 2B3TB 1MX0A 4USMA 4DR3I 4KQVA 5JEAC 1HNZI 2UXBI 4JV5E 1X6EA 4BC9A 2ENCA 2WNRB 2CVEA 1Z0GA 2NA2A 4OZEA 4OO1E 2EL6A 2EPKX 1VI7A 2J65A 2KHXA 2NN6F 4LF4I 2EPOA 4DV3E 2R76A 4HEIA 4OO1D 2NN6C 3HKMA 4TUIA 3IWCA 3K17A 2YRKA 3GLLA 1NHHA 4BHCA 3LNUA 4NBQA 4DPTA 1Z5AA 2VQFI 4QNKA 2UXCI 5A69A 1QZRA 1H7SA 1RHYA 5DNXA 4P7AA 3K85A 2LMZA 4AQYI 5JEAF 4LCFA 4P7DA 2O1VA 4JI1I 2EMBA 1BBGA 5KL7A 2CSHA 2JEAA 2A2DA 2DEJA 2FGGA 3OTOE 1UILA 2EMHA 2ELYA 2V85A 3C6KA 3IWDA 4O24A 2RQLA 4JI0E 4PRXA 4F6NA 4IFDB 1A1GA 4JI2I 2M9AA 4UT4A 2EOEA 1IBKE 4KHPE 2UUCI 4OO1C 2LJHA 3WU5A 2Z5CB 5DRPA 3TQMA 2DEIA 4O43A 1NZ0A 2LV2A 1DGCA 1WHNA 2J7JA 4LCGA 4DR4I 4MU4A 1F2IG 4JI3I 3M7ND 2Z5BA 1Y5YA 1USVA 4JI6E 2ZM6E 4DR4E 2JOBA 3M7NG 1SR9A 1Z0VA 1DARA 2JE6B 2AJ4A 2BR2A 4PU9A 2Q8UA 1KIJA 2VF1A 4JI5E 4FW6A 3BBGA 3T1YI 2HHHI 4JV5I 5K36C 3KZYA 3UK3C 2BR2B 1H7UA 3EPHA 2I13A 3DJWA 1GTKA 4LF4E 2JPAA 4B3MI 1UDSA 4U3DA 2C38B 3QT7A 3PYGA 2LUQA 3OTOI 3WU6A 1XXEA 3HTXA 1UDOA 1USUA 2ZM6I 2JXPA 4DV1E 3ZM7A 5A2QQ 1OJ4A 4DPUA 3VYYA 1Z0BA 1A6FA 2DGCA 1N33E 2VQFE 4DU8A 5JEAB 4IFDD 1IBME 2F4VE 2JP9A 4LPFA 1QNTA 1D6TA 2ENHA 2L2MA 1RQ0A 2N3HA 5KL6A 1VISA 4FWDA 2EPXA 2FTXB 2PO0B 4NXME 1IQOA 2EQ3A 1A1IA 4IFDC 2DLKA 2NN6B 2PO1B 2MDRA 2V88A 4LF8I 4LF9I 4DKKA 4DPYA 3U1KA 4DV0E 3LLHA 4LFAI 4RPFA 2EOSA 1BKNA 4DU7A 1H74A 5A2QC 2FV4B 4LFCE 4JI4I 2YRHA 2LE2A 2R1FA 1HNXI 5LMUE 4P52A 3FIGA 1SFEA 2EM5A 3D4JA 2CT1A 5AE3A 4ZYDA 1XMOI 3ADJA 4YY3I 4NZVA 2WP8B 1X5WA 1IBLI 1PKPA 4JI7E 1WXRA 2YU5A 2EOQA 5AC5A 3ADIA 2O1TA 4OOGC 2BV3A 2R3VA 4URLA 2EN6A 4LF7I 4DR7I 1UEKA 2IOQA 5LMNE 1FKAE 2EM6A 2EM9A 3KWRA 4X64E 4DV5I 3IWBA 2CG9A 5A6KA 3Q1QA 3V5RA 1PJSA 1WUUA 3PYDA 1P47A 2LUPB 1XNQI 2WBUA 1FWKA 2EPMX 2EOXA 2EQ1A 1UN6B 1XNRE 1N0VC 1S16A 2C37B 2BBGA 2YPNA 5ELWA 1N34E 2E1RA 1X49A 2JEBB 4X66E 3UHMA 3F6GA 1WJPA 1L4SA 1E3HA 2UUAE 2M7QA 4R2EA 2VESA 1GQEA 4IJDA 4LFAE 1MU5A 3PS1A 4LCHA 4DR1I 2YRMA 3ZOQB 4B3RE 1H73A 2EMYA 2EN8A 1ZM9A 4TUGA 3PYFA 5C0XD 4DUYI 2YTGA 1Z59A 3MHHC 1MG7A 5A6BA 2EZ6A 4NHRA 3HULA 2L6MA 4JG4A 2I9IA 2JOXA 2ELZA 1R6MA 1GZ6A 4OX9E 2CZ9A 5IXMB 2UUBI 4DMIA 2EMGA 4HXZA 4BA2A 2RSMA 2RS7A 2EN7A 2O1UA 4J8ZA 2EMZA 2JWOA 5GMDA 2PO2B 3ZZUA 5BR8I 4R2RA 1YPNA 4DV4E 1ZR9A 1K47A 2EMKA 5A6AA 1Z5CA 2A2CA 4L5NC 2V2VA 2R42A 5EKWA 2VF3A 4DR2I 2B7VA 2UUCE 1KJKA 3CDJA 4M9VC 4R2AA 3L00A 2WZOA 4FW3A 4FWGA 2XEXA 3RMPA 2YTNA 5LLQA 4DV7E 1FI4A 3GONA 1DQ3A 2DMIA 5LL6R 1PIEA 4DV6E 1IMUA 4K0KI 2V8PA 4MLVA 2L3JA 1OYSA 2Q2EB 4L8NA 2L3CA 4OKGA 4DPWA 2L2NA 4Q28A 2BM0A 1NHIA 4AIMA 2LTSA 2WBSA 1N3GA 4DR5E 2HKJA 2JEBA 4JI6I 4IFDE 4B3RI 4AQYE 2N3GA 3KZZA 5KL2A 2L92A 4X64I 1IBKI 4KHPI 3EPLA 4MQYA 1ZBQA 1ZU1A 2EPAA 4DR3E 1HNZE 2YTIA 1XMQE 2PNMA 3H09A 4F9CB 2EJ4A 2ODRC 5KL4A 2V8QB 1HNWE 2L2KB 2BA0G 2EN4A 2YU8A 2GO3A 4MU1A 4WUCA 4X66I 2O1WA 1Z0EA 4DXLA 3F6HA 1XNRI 3WU4A 1T39A 1EH6A 2YZTA 3U1YA 5IWAE 3HXLA 4DV2I 2F8BA 2EMFA 2WNRA 4JI4E 2ODRD 2EMLA 4GZNC 1HNWI 4LF7E 4QNJA 2DIXA 2BM1A 4JI7I 4EMDA 2L33A 4IS9A 1RREA 4DV0I 4B3SE 3B8HA 1UDNA 2EPNA 1G2FC 1PVGA 2V83A 3T1HI 2DB2A 2GHFA 2NN6D 2KONA 2L8TA 2EOZA 5AASA 3P06A 2PNLA 3P3CA 4DPXA 1XMQI 3DD6A 3JAMQ 2A25A 2EOOA 1T38A 4B3TE 2C39A 2LJPA 2NN6E 2G7HA 4LFCI 2AE8A 4DR5I 1HR0I 2UXCE 1FNMA 2M1SA 2JVAA 3THOB 2EM2A 2J7KA 4IZJD 5C0XF 1BBOA 2NPFA 2JE6A 3MSWA 4DV6I 2M4IA 2NUFA 1S4EA 4O5GA 1N33I 5IV8B 2B7TA 1ZM4A 2YTDA 1P42A 2F1DA 4ZYGA 4IFDA 5A6BD 5DNLA 1J5EE 4WXDA 3EPJA 2V2ZA 3ZKBA 2HKEA 1ZAAC 5JEAE 3DF6A 1A1LA 2WBTA 1Y60A 1IBMI 3LPSA 2F4VI 3V2UC 4BA2B 1YUIA 2EOHA 2UU9E 2EN2A 1RMDA 2MDGA 1ZBTA 2DLQA 1EA6A 2YTPA 1QU6A 3J80C 3Q6MA 2BA0D 4WUDA 2YTEA 1XHKA 1Y4UA 5C0XE 1WHQA 4AIDA 5FLXQ 2BB8A 1OYPA 4F54A 1Y6ZA 1Z0WA 2PNZB 3EQ1A 4F6MA 1O0WA 1YYKA 1FJGE 1Z0CA 1ELOA 2K4VA 1A1FA 2EFGA 3QT8A 2ZITA 4R2DA 1MGTA 1KVKA 4B3ME 3J80Q 1Z0TA 4JI8E 4ZVIA 2LBSB 1DI2A 4WFTA 5FLXC 4MYTA 2JY9A 5C0XC 4MLQA 4DV1I 4JI5I 4HY1A 4IS1C 2E5LE 4MDTA 4DR6E 4WYQB 1YYWA 4ED4A 1AAYA 4X62I 4DUZE 2JT2A 2NUGA 4JI2E 2VQEE 2HGHA 2EQ0A 2V34A 4DV4I 1X6FA 3K1JA 1WRJA 1KTVA 2HHHE 3JAMC 3L7ZB 1TF3A 4GKKE 1XNQE 1Z5BA 4X62E 4HTGA 4N4RB 2HK3A 4R2PA 3VK6A 2IHR1 2EPPA 4JI3E 4M2ZA 5TSEA 4BC7A 1N34I 4HYMA 3BGHA 2BA1G 5CFFE 4GKKI 1B69A 4YHHE 1UDQA 2C37A 4FW9A 1EKZA 2EM4A 1IQSA 4F2JC 4Q35B 1TF6A 2WW4A 3HQ1A 4FWHA 4J3DA 4B3TI 2VQEI 3B78A 3HPSA 1FJGI 4RHBB 2LTRA 4O4KA 3VHTB 1A1JA 3BF2A 4RH8A 4ZYEA 5A6JA 4YY3E 2X36A 3QT6A 4MU3A 5DRRA 4DR6I 1MEYC 3CDIA 1ZXNA 2OI2A 2X7IA 3GCMA 3M85G 4BBYA 1B62A 2DMYA 1IBLE 2PRTA 4I3HA 2UXDE 4LFBE 1AH5A 3P1XA 3L7ZA 3P76A 4UTGA 1Z1BA 3H1CA 4LU9A 2ENAA 1HK7A 1TN9A 4N3OA 2EN3A 3M99B 2LRSA 2ADRA 4GEQB 2EL4A 4X65I 2EM7A 2IOPA 2HK2A 3J81C 2EOMA 2EPZA 3JTZA 2GPIA 2HJJA 1YFHA 3B82A 2LJUA 4MU0A 5F3WA 4JYAE 4GKJE 2EOIA 2EMXA 4R03A 2YSPA 4OO1A 4WSPA 4Z7CA 4BA1A 1XMOE 2V2QA 2E1MA 5EL9A 2B9DA 2UUAI 3LTOA 1EH7A 1NHJA 4LF5E 4ISAA 1JK2A 4PRVA 4LF6E 4WUBA 4AM3A 3KRNA 2Z5EA 4FW4A 1T4OA 3THNA 2PNZA 2CGEA 1I94E 2PO1A 1FWLA 1YH8A 2PO0A 5L3JA 5K36A 2C39B 1UHZA 5FWKA 1I94I 2UXDI 1PJQA 1JK1A 2WP8A 2EPLX 5T6JA 5JEAD 4DV7I 4LF9E 4LF8E 2ZBKB 5K36D 4LF5I 3EPKA 3PS2A 3ECRA 4BS9A 4R2CA 1RR9A 3OMLA 2GS8A 1Y4SA 1X3CA 2EL5A 4WSGA 4Z7YA 5JEAA 4NXMI 2EPRA 2MC6A 3M6AA 2YT4A 2RTXA 4NXNE 3J7AG 5C0XB 2JYAA 3ADGA 1PJTA 2RSIA 4R2QA 4M0VA 3T1HE 5IT9C 2EWLA 4WPYA 2LO3A 2C38A 2V89A 3J7Yp 5IWAI 3VYXA 5KL3A 4X8WA 2NN6A 4FW5A 2YTOA 3QG5C 3HPZA 1LLMC 1HNXE 1N32E 4WXCA 4X9JA 4LFBI 1YYOA 2UUBE 2EOJA 2Z5BB 3ZZ0A 4R8OA 4BMJA 1KKHA 5AE1A 5C0XA 2E72A 1EH8A 2DSYA 4GQUA 5GMEA 2N8XA 1X48A 4DV2E 3QT5A 2CPNA 2BA1D 3JU0A 3T1YE 1R6LA 2VE7C 1N36I 4M1KA 4DR1E 4OO1B 4P78A 4DUZI 2HC5A 2O3ZA 4I8OA 3AV0A 3PS3A 3F0NA 3ZKDA 1EI1A 4KWYA 2GO4A 1N36E 4F9BB 3H4LA 1U2RA 2EOYA 2HFSA 4JI8I 2V87A 4YHHI 4K0KE 5K36B 1G2DC 4R1FA 2EM0A 5AC4A 3M85D 1PDAA 3MHSC 2E5LI 3NZKA 4U3BA 4JYAI 2EMAA 2YTJA 1YZ9A 4JI1E 2CTDA 1ZM2A 4DR2E 3ADLA 5ADZA 2EMCA 4KZSA 2YSOA 2MKNA 1X6HA 1T4LB 1B63A 2IERA 2Z5CA 4LOMA 4MYUA 4USKA 2D9HA 4IFDF 2PO2A 3J7AM 1UBDC 4M30A 1T4NA 1X47A 1A1HA 3LMLA 2JR1A 1J26A 2H36X 2MKDA 1ZM3A 4IZKB 2MC5A 4R2SA 2EN1A 2RS6A 1YSAC 1N32I 2GLIA 2EOFA 5DROA 2JEAB 1STUA 4FK5C 4FW7A 3HJCA 1KYQA 4HACB 5LMUI 1NCSA 3C6MA 5DRQA 5BR8E 1YUJA 2EMWA 3PYEA 4LTYA 3PRYA 4JI0I 3C4TA 2NUEA 3GMEA 2UU9I 1NEIA 3K6QA 4IZKA 4NXNI 3ZZTA 5IT9Q 1A1KA 4FN5A 2EMIA 1RC7A 4OX9I 2K7IA 2IESA 2EORA 2GQ0A
chains in the Genus database with same CATH topology
1H72C 1J5EI 4X65E 3AUZA 3C4BA 5DNYA 4BCAA 2UXCI 3J81Q 4DUYE 1ZXMA 4DR7E 4XTJA 3WU3A 4GKJI 2KOUA 4IZJB 3CWVA 4DV3I 5AE2A 4LF6I 4B3SI 3Q6NA 1N0UA 5LMNI 1HR0E 4HACA 2UXBE 4LF4I 2V86A 2HFUA 4IZJA 4F9AB 4USMA 4DV5E 2B3TB 1MX0A 4DR3I 1HNZI 4KQVA 2UXBI 4JV5E 4BC9A 1Z0GA 2NA2A 2KHXA 4DV3E 4TUIA 3IWCA 3K17A 1NHHA 3LNUA 4DPTA 1Z5AA 2VQFI 1QZRA 1H7SA 4AQYI 4P7AA 3K85A 2LMZA 4P7DA 2O1VA 4JI1I 2A2DA 2DEJA 2FGGA 3OTOE 1UILA 2V85A 3IWDA 4JI0E 4PRXA 4JI2I 4UT4A 1IBKE 4KHPE 2UUCI 2LJHA 3WU5A 2Z5CB 2DEIA 1NZ0A 1WHNA 4DR4I 4JI3I 2Z5BA 1USVA 4JI6E 2ZM6E 4DR4E 2JOBA 1SR9A 1Z0VA 1DARA 2AJ4A 4PU9A 1KIJA 2VF1A 4JI5E 2HHHI 3T1YI 4JV5I 1H7UA 3DJWA 4LF4E 4B3MI 3QT7A 3PYGA 2LUQA 3OTOI 3WU6A 3HTXA 1USUA 2ZM6I 4DV1E 5A2QQ 3ZM7A 1OJ4A 4DPUA 3VYYA 1Z0BA 1A6FA 1N33E 2VQFE 4DU8A 1IBME 2F4VE 1D6TA 2L2MA 1RQ0A 2N3HA 1VISA 4FWDA 2FTXB 4NXME 2MDRA 2V88A 4LF8I 4LF9I 4DKKA 4DPYA 4DV0E 3LLHA 4LFAI 4RPFA 4DU7A 1BKNA 1H74A 5A2QC 2FV4B 4LFCE 4JI4I 2LE2A 1HNXI 5LMUE 4P52A 3FIGA 3D4JA 5AE3A 1XMOI 3ADJA 4YY3I 1IBLI 1PKPA 4JI7E 1WXRA 3ADIA 4URLA 2O1TA 4DR7I 4OOGC 2BV3A 2R3VA 4LF7I 1UEKA 2IOQA 5LMNE 1FKAE 3KWRA 4X64E 4DV5I 3IWBA 2CG9A 3Q1QA 3V5RA 1WUUA 3PYDA 2LUPB 1XNQI 1FWKA 1S16A 1XNRE 1N0VC 1N34E 2E1RA 1X49A 4X66E 3F6GA 2UUAE 2M7QA 1GQEA 4LFAE 1MU5A 4DR1I 4B3RE 3ZOQB 1H73A 4DUYI 4JYAI 1ZM9A 4TUGA 3PYFA 1Z59A 1MG7A 2EZ6A 3HULA 2L6MA 4JG4A 2JOXA 1GZ6A 4OX9E 2CZ9A 2UUBI 4DMIA 4HXZA 2RSMA 2RS7A 2O1UA 4J8ZA 2JWOA 5GMDA 5BR8I 3ZZUA 4DV4E 1K47A 1Z5CA 2A2CA 4L5NC 2V2VA 2R42A 2VF3A 4DR2I 2B7VA 2UUCE 2WZOA 4FWGA 2XEXA 3RMPA 4DV7E 3GONA 1FI4A 1PIEA 1DQ3A 5LL6R 4DV6E 4K0KI 2V8PA 2L3JA 2Q2EB 4DPWA 4L8NA 2L3CA 2L2NA 4Q28A 2BM0A 1NHIA 4JI6I 2LTSA 4DR5E 2HKJA 4B3RI 4AQYE 2N3GA 2L92A 4X64I 1IBKI 4KHPI 1ZBQA 4DR3E 1HNZE 1XMQE 2PNMA 3H09A 4F9CB 2ODRC 2V8QB 1HNWE 2L2KB 4X66I 4WUCA 2O1WA 1Z0EA 4DXLA 3F6HA 1XNRI 3WU4A 2YZTA 4DV2I 5IWAE 3HXLA 2F8BA 4JI4E 2ODRD 1HNWI 4LF7E 2DIXA 2BM1A 4JI7I 4EMDA 2L33A 1RREA 4DV0I 4B3SE 3B8HA 1PVGA 2V83A 3T1HI 2DB2A 2KONA 2L8TA 5AASA 3P06A 2PNLA 4DPXA 1XMQI 3JAMQ 4B3TE 2LJPA 2G7HA 4LFCI 4DR5I 1HR0I 2UXCE 1FNMA 2M1SA 2JVAA 2J7KA 4IZJD 2NPFA 3MSWA 4DV6I 2M4IA 2NUFA 1S4EA 1N33I 1ZM4A 2B7TA 1J5EE 2V2ZA 3ZKBA 2HKEA 3DF6A 1IBMI 2F4VI 3LPSA 3V2UC 2UU9E 1ZBTA 1EA6A 1QU6A 3J80C 3Q6MA 4WUDA 1XHKA 1Y4UA 1WHQA 5FLXQ 4F54A 1Y6ZA 1Z0WA 1YYKA 1O0WA 1FJGE 1Z0CA 1ELOA 2K4VA 2EFGA 3QT8A 2ZITA 1KVKA 4B3ME 3J80Q 1Z0TA 4JI8E 4ZVIA 1DI2A 2LBSB 4WFTA 5FLXC 4MYTA 2JY9A 4DV1I 4JI5I 4HY1A 2E5LE 4DR6E 4WYQB 1YYWA 4ED4A 4X62I 4DUZE 2NUGA 4JI2E 2VQEE 2V34A 4DV4I 3K1JA 1KTVA 2HHHE 3JAMC 4GKKE 1XNQE 1Z5BA 4X62E 2HK3A 3VK6A 2IHR1 4JI3E 4M2ZA 1N34I 4BC7A 4HYMA 5CFFE 4GKKI 4YHHE 4FW9A 1EKZA 2WW4A 3HQ1A 4FWHA 4B3TI 2VQEI 3B78A 3HPSA 1FJGI 2LTRA 2X36A 3QT6A 4YY3E 4DR6I 1ZXNA 2OI2A 2X7IA 4BBYA 1B62A 2DMYA 1IBLE 4I3HA 2UXDE 4LFBE 3P1XA 4UTGA 4LU9A 1HK7A 4N3OA 2LRSA 4GEQB 4X65I 2IOPA 2HK2A 3J81C 3JTZA 3B82A 5F3WA 4JYAE 4GKJE 4R03A 4WSPA 4Z7CA 1XMOE 2V2QA 2E1MA 2UUAI 2B9DA 3LTOA 1NHJA 4LF5E 4PRVA 4LF6E 4WUBA 2Z5EA 1T4OA 2CGEA 1I94E 1FWLA 5L3JA 1UHZA 5FWKA 1I94I 2UXDI 5T6JA 4DV7I 4LF9E 4LF8E 2ZBKB 4LF5I 1RR9A 4BS9A 3OMLA 2GS8A 1Y4SA 4Z7YA 4NXMI 2MC6A 3M6AA 2YT4A 2RTXA 4NXNE 3J7AG 3ADGA 4M0VA 3T1HE 5IT9C 2EWLA 4WPYA 2V89A 3J7Yp 5IWAI 3VYXA 4X8WA 3HPZA 1HNXE 1N32E 4LFBI 1YYOA 2UUBE 3ZZ0A 2Z5BB 4R8OA 4BMJA 1KKHA 5AE1A 2DSYA 5GMEA 4DV2E 1X48A 3QT5A 2CPNA 3JU0A 3T1YE 1N36I 2VE7C 4M1KA 4DR1E 4P78A 4DUZI 4I8OA 3AV0A 3F0NA 3ZKDA 1EI1A 1N36E 4F9BB 3H4LA 1U2RA 2HFSA 4JI8I 2V87A 4YHHI 4K0KE 4R1FA 2E5LI 1YZ9A 4JI1E 1ZM2A 4DR2E 3ADLA 5ADZA 4KZSA 1B63A 1T4LB 2Z5CA 4MYUA 4USKA 3J7AM 4M30A 1T4NA 1X47A 3LMLA 2JR1A 1J26A 2H36X 1ZM3A 4IZKB 2MC5A 2RS6A 1N32I 1STUA 3HJCA 4HACB 5LMUI 5BR8E 3PYEA 4LTYA 3PRYA 4JI0I 3C4TA 2NUEA 2UU9I 4NXNI 3K6QA 4IZKA 3ZZTA 5IT9Q 4FN5A 1RC7A 4OX9I 2GQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H72 C;  1J5E I;  4X65 E;  3C4B A;  2UXC I;  3J81 Q;  4DUY E;  1ZXM A;  4DR7 E;  4XTJ A;  3WU3 A;  4GKJ I;  3CWV A;  4DV3 I;  4LF6 I;  4B3S I;  1N0U A;  5LMN I;  1HR0 E;  4HAC A;  2UXB E;  4LF4 I;  2HFU A;  4USM A;  4DV5 E;  2B3T B;  1MX0 A;  4DR3 I;  1HNZ I;  4KQV A;  2UXB I;  4JV5 E;  1Z0G A;  2NA2 A;  2KHX A;  4DV3 E;  3K17 A;  1NHH A;  3LNU A;  4DPT A;  1Z5A A;  2VQF I;  1QZR A;  1H7S A;  4AQY I;  4P7A A;  4JI1 I;  2A2D A;  2DEJ A;  3OTO E;  1UIL A;  4JI0 E;  4PRX A;  4JI2 I;  4UT4 A;  1IBK E;  4KHP E;  2UUC I;  2LJH A;  3WU5 A;  2DEI A;  1NZ0 A;  1WHN A;  4DR4 I;  4JI3 I;  4JI6 E;  2ZM6 E;  4DR4 E;  1Z0V A;  1DAR A;  2AJ4 A;  4PU9 A;  1KIJ A;  2HHH I;  4JI5 E;  3T1Y I;  4JV5 I;  1H7U A;  4LF4 E;  4B3M I;  3QT7 A;  3PYG A;  2LUQ A;  3OTO I;  3WU6 A;  3HTX A;  2ZM6 I;  4DV1 E;  5A2Q Q;  3ZM7 A;  1OJ4 A;  4DPU A;  3VYY A;  1Z0B A;  1A6F A;  1N33 E;  2VQF E;  4DU8 A;  1IBM E;  2F4V E;  1D6T A;  2L2M A;  1RQ0 A;  2N3H A;  1VIS A;  4FWD A;  4NXM E;  2MDR A;  4LF8 I;  4LF9 I;  4DKK A;  4DPY A;  4DV0 E;  3LLH A;  4LFA I;  4RPF A;  4DU7 A;  1BKN A;  1H74 A;  5A2Q C;  4LFC E;  4JI4 I;  1HNX I;  5LMU E;  4P52 A;  3D4J A;  1XMO I;  3ADJ A;  4YY3 I;  1IBL I;  1PKP A;  4JI7 E;  3ADI A;  4URL A;  4DR7 I;  4OOG C;  2BV3 A;  2R3V A;  4LF7 I;  1UEK A;  5LMN E;  1FKA E;  4X64 E;  4DV5 I;  3Q1Q A;  3V5R A;  1WUU A;  3PYD A;  2LUP B;  1XNQ I;  1FWK A;  1S16 A;  1XNR E;  1N0V C;  1N34 E;  2E1R A;  1X49 A;  4X66 E;  2UUA E;  1GQE A;  4LFA E;  1MU5 A;  4DR1 I;  4B3R E;  1H73 A;  4DUY I;  4JYA I;  1ZM9 A;  3PYF A;  1Z59 A;  1MG7 A;  2EZ6 A;  3HUL A;  4JG4 A;  4OX9 E;  2CZ9 A;  2UUB I;  4HXZ A;  2RSM A;  2RS7 A;  5GMD A;  5BR8 I;  3ZZU A;  4DV4 E;  1K47 A;  1Z5C A;  2A2C A;  2V2V A;  2R42 A;  2VF3 A;  4DR2 I;  2B7V A;  2UUC E;  4FWG A;  2XEX A;  4DV7 E;  3GON A;  1FI4 A;  5LL6 R;  1PIE A;  4DV6 E;  4K0K I;  2V8P A;  2L3J A;  2Q2E B;  4DPW A;  2L3C A;  2L2N A;  2BM0 A;  1NHI A;  4JI6 I;  2LTS A;  4DR5 E;  2HKJ A;  4B3R I;  4AQY E;  2N3G A;  4X64 I;  1IBK I;  4KHP I;  4DR3 E;  1HNZ E;  1XMQ E;  1HNW E;  2L2K B;  4X66 I;  4WUC A;  1Z0E A;  4DXL A;  1XNR I;  3WU4 A;  4DV2 I;  5IWA E;  4JI4 E;  1HNW I;  4LF7 E;  2DIX A;  2BM1 A;  4JI7 I;  4EMD A;  2L33 A;  1RRE A;  4DV0 I;  4B3S E;  3B8H A;  1PVG A;  3T1H I;  2DB2 A;  4DPX A;  1XMQ I;  3JAM Q;  4B3T E;  2LJP A;  4LFC I;  4DR5 I;  1HR0 I;  2UXC E;  1FNM A;  2JVA A;  2J7K A;  2NPF A;  4DV6 I;  2NUF A;  1S4E A;  1N33 I;  1ZM4 A;  2B7T A;  1J5E E;  2V2Z A;  3ZKB A;  2HKE A;  1IBM I;  2F4V I;  3LPS A;  3V2U C;  2UU9 E;  1ZBT A;  1EA6 A;  1QU6 A;  3J80 C;  4WUD A;  1XHK A;  1WHQ A;  5FLX Q;  1Z0W A;  1YYK A;  1O0W A;  1FJG E;  1Z0C A;  1ELO A;  2EFG A;  3QT8 A;  2ZIT A;  1KVK A;  4B3M E;  3J80 Q;  1Z0T A;  4JI8 E;  4ZVI A;  2LBS B;  1DI2 A;  4WFT A;  4MYT A;  5FLX C;  2JY9 A;  4DV1 I;  4JI5 I;  4HY1 A;  2E5L E;  4DR6 E;  4WYQ B;  1YYW A;  4ED4 A;  4X62 I;  4DUZ E;  2NUG A;  4JI2 E;  2VQE E;  2V34 A;  4DV4 I;  3K1J A;  1KTV A;  2HHH E;  3JAM C;  4GKK E;  1XNQ E;  1Z5B A;  4X62 E;  2HK3 A;  2IHR 1;  4JI3 E;  4M2Z A;  1N34 I;  4HYM A;  5CFF E;  4GKK I;  4YHH E;  4FW9 A;  1EKZ A;  2WW4 A;  4FWH A;  4B3T I;  2VQE I;  3B78 A;  1FJG I;  2LTR A;  2X36 A;  3QT6 A;  4YY3 E;  4DR6 I;  1ZXN A;  2OI2 A;  2X7I A;  1B62 A;  2DMY A;  1IBL E;  4I3H A;  2UXD E;  4LFB E;  3P1X A;  4UTG A;  2LRS A;  4X65 I;  2HK2 A;  3J81 C;  3B82 A;  4JYA E;  4GKJ E;  4Z7C A;  1XMO E;  2V2Q A;  2UUA I;  3LTO A;  1NHJ A;  4LF5 E;  4PRV A;  4LF6 E;  4WUB A;  1T4O A;  1I94 E;  1FWL A;  5L3J A;  1UHZ A;  1I94 I;  2UXD I;  4DV7 I;  4LF9 E;  4LF8 E;  2ZBK B;  4LF5 I;  1RR9 A;  2GS8 A;  4Z7Y A;  4NXM I;  3M6A A;  2YT4 A;  2RTX A;  4NXN E;  3J7A G;  3ADG A;  3T1H E;  5IT9 C;  3J7Y p;  5IWA I;  3VYX A;  4X8W A;  1HNX E;  1N32 E;  4LFB I;  1YYO A;  2UUB E;  3ZZ0 A;  1KKH A;  5GME A;  4DV2 E;  1X48 A;  3QT5 A;  2CPN A;  1N36 I;  3T1Y E;  4M1K A;  4DR1 E;  4DUZ I;  3F0N A;  3ZKD A;  1EI1 A;  1N36 E;  3H4L A;  1U2R A;  2HFS A;  4JI8 I;  4YHH I;  4K0K E;  4R1F A;  2E5L I;  1YZ9 A;  4JI1 E;  1ZM2 A;  4DR2 E;  3ADL A;  1B63 A;  1T4L B;  4USK A;  4MYU A;  3J7A M;  4M30 A;  1T4N A;  1X47 A;  1J26 A;  1ZM3 A;  2RS6 A;  1N32 I;  1STU A;  4HAC B;  5LMU I;  5BR8 E;  3PYE A;  4JI0 I;  3C4T A;  2NUE A;  2UU9 I;  4NXN I;  5IT9 Q;  3ZZT A;  4FN5 A;  1RC7 A;  4OX9 I; 
#chains in the Genus database with same CATH topology
 1H72 C;  1J5E I;  3BID A;  2EM3 A;  2VRD A;  4X65 E;  1YHC A;  3AUZ A;  2LVH A;  2RPC A;  2YTQ A;  4BA1 B;  5K36 F;  3C4B A;  5DNY A;  4BCA A;  2DRP A;  1OYR A;  3J81 Q;  2NAB A;  4DUY E;  1ZXM A;  4DR7 E;  4XTJ A;  3WU3 A;  4GKJ I;  2EPC A;  2KOU A;  4IZJ B;  2YTF A;  3B4T A;  3CWV A;  4DV3 I;  5AE2 A;  2LT7 A;  2EPU A;  4ZYH A;  4OO1 F;  4BHB A;  4WX9 A;  4B3S I;  4LF6 I;  2EE8 A;  3Q6N A;  1E3P A;  1N0U A;  5LMN I;  2LCE A;  2EM8 A;  5KL5 A;  2EP3 A;  1HR0 E;  5K36 E;  4HAC A;  2UXB E;  2YWQ A;  2V86 A;  2WCC 3;  2HFU A;  3P3G A;  4IZJ A;  4F9A B;  3P3E A;  4DV5 E;  1BB8 A;  2B3T B;  1MX0 A;  4USM A;  4DR3 I;  4KQV A;  5JEA C;  1HNZ I;  2UXB I;  4JV5 E;  1X6E A;  4BC9 A;  2ENC A;  2WNR B;  2CVE A;  1Z0G A;  2NA2 A;  4OZE A;  4OO1 E;  2EL6 A;  2EPK X;  1VI7 A;  2J65 A;  2KHX A;  2NN6 F;  4LF4 I;  2EPO A;  4DV3 E;  2R76 A;  4HEI A;  4OO1 D;  2NN6 C;  3HKM A;  4TUI A;  3IWC A;  3K17 A;  2YRK A;  3GLL A;  1NHH A;  4BHC A;  3LNU A;  4NBQ A;  4DPT A;  1Z5A A;  2VQF I;  4QNK A;  2UXC I;  5A69 A;  1QZR A;  1H7S A;  1RHY A;  5DNX A;  4P7A A;  3K85 A;  2LMZ A;  4AQY I;  5JEA F;  4LCF A;  4P7D A;  2O1V A;  4JI1 I;  2EMB A;  1BBG A;  5KL7 A;  2CSH A;  2JEA A;  2A2D A;  2DEJ A;  2FGG A;  3OTO E;  1UIL A;  2EMH A;  2ELY A;  2V85 A;  3C6K A;  3IWD A;  4O24 A;  2RQL A;  4JI0 E;  4PRX A;  4F6N A;  4IFD B;  1A1G A;  4JI2 I;  2M9A A;  4UT4 A;  2EOE A;  1IBK E;  4KHP E;  2UUC I;  4OO1 C;  2LJH A;  3WU5 A;  2Z5C B;  5DRP A;  3TQM A;  2DEI A;  4O43 A;  1NZ0 A;  2LV2 A;  1DGC A;  1WHN A;  2J7J A;  4LCG A;  4DR4 I;  4MU4 A;  1F2I G;  4JI3 I;  3M7N D;  2Z5B A;  1Y5Y A;  1USV A;  4JI6 E;  2ZM6 E;  4DR4 E;  2JOB A;  3M7N G;  1SR9 A;  1Z0V A;  1DAR A;  2JE6 B;  2AJ4 A;  2BR2 A;  4PU9 A;  2Q8U A;  1KIJ A;  2VF1 A;  4JI5 E;  4FW6 A;  3BBG A;  3T1Y I;  2HHH I;  4JV5 I;  5K36 C;  3KZY A;  3UK3 C;  2BR2 B;  1H7U A;  3EPH A;  2I13 A;  3DJW A;  1GTK A;  4LF4 E;  2JPA A;  4B3M I;  1UDS A;  4U3D A;  2C38 B;  3QT7 A;  3PYG A;  2LUQ A;  3OTO I;  3WU6 A;  1XXE A;  3HTX A;  1UDO A;  1USU A;  2ZM6 I;  2JXP A;  4DV1 E;  3ZM7 A;  5A2Q Q;  1OJ4 A;  4DPU A;  3VYY A;  1Z0B A;  1A6F A;  2DGC A;  1N33 E;  2VQF E;  4DU8 A;  5JEA B;  4IFD D;  1IBM E;  2F4V E;  2JP9 A;  4LPF A;  1QNT A;  1D6T A;  2ENH A;  2L2M A;  1RQ0 A;  2N3H A;  5KL6 A;  1VIS A;  4FWD A;  2EPX A;  2FTX B;  2PO0 B;  4NXM E;  1IQO A;  2EQ3 A;  1A1I A;  4IFD C;  2DLK A;  2NN6 B;  2PO1 B;  2MDR A;  2V88 A;  4LF8 I;  4LF9 I;  4DKK A;  4DPY A;  3U1K A;  4DV0 E;  3LLH A;  4LFA I;  4RPF A;  2EOS A;  1BKN A;  4DU7 A;  1H74 A;  5A2Q C;  2FV4 B;  4LFC E;  4JI4 I;  2YRH A;  2LE2 A;  2R1F A;  1HNX I;  5LMU E;  4P52 A;  3FIG A;  1SFE A;  2EM5 A;  3D4J A;  2CT1 A;  5AE3 A;  4ZYD A;  1XMO I;  3ADJ A;  4YY3 I;  4NZV A;  2WP8 B;  1X5W A;  1IBL I;  1PKP A;  4JI7 E;  1WXR A;  2YU5 A;  2EOQ A;  5AC5 A;  3ADI A;  2O1T A;  4OOG C;  2BV3 A;  2R3V A;  4URL A;  2EN6 A;  4LF7 I;  4DR7 I;  1UEK A;  2IOQ A;  5LMN E;  1FKA E;  2EM6 A;  2EM9 A;  3KWR A;  4X64 E;  4DV5 I;  3IWB A;  2CG9 A;  5A6K A;  3Q1Q A;  3V5R A;  1PJS A;  1WUU A;  3PYD A;  1P47 A;  2LUP B;  1XNQ I;  2WBU A;  1FWK A;  2EPM X;  2EOX A;  2EQ1 A;  1UN6 B;  1XNR E;  1N0V C;  1S16 A;  2C37 B;  2BBG A;  2YPN A;  5ELW A;  1N34 E;  2E1R A;  1X49 A;  2JEB B;  4X66 E;  3UHM A;  3F6G A;  1WJP A;  1L4S A;  1E3H A;  2UUA E;  2M7Q A;  4R2E A;  2VES A;  1GQE A;  4IJD A;  4LFA E;  1MU5 A;  3PS1 A;  4LCH A;  4DR1 I;  2YRM A;  3ZOQ B;  4B3R E;  1H73 A;  2EMY A;  2EN8 A;  1ZM9 A;  4TUG A;  3PYF A;  5C0X D;  4DUY I;  2YTG A;  1Z59 A;  3MHH C;  1MG7 A;  5A6B A;  2EZ6 A;  4NHR A;  3HUL A;  2L6M A;  4JG4 A;  2I9I A;  2JOX A;  2ELZ A;  1R6M A;  1GZ6 A;  4OX9 E;  2CZ9 A;  5IXM B;  2UUB I;  4DMI A;  2EMG A;  4HXZ A;  4BA2 A;  2RSM A;  2RS7 A;  2EN7 A;  2O1U A;  4J8Z A;  2EMZ A;  2JWO A;  5GMD A;  2PO2 B;  3ZZU A;  5BR8 I;  4R2R A;  1YPN A;  4DV4 E;  1ZR9 A;  1K47 A;  2EMK A;  5A6A A;  1Z5C A;  2A2C A;  4L5N C;  2V2V A;  2R42 A;  5EKW A;  2VF3 A;  4DR2 I;  2B7V A;  2UUC E;  1KJK A;  3CDJ A;  4M9V C;  4R2A A;  3L00 A;  2WZO A;  4FW3 A;  4FWG A;  2XEX A;  3RMP A;  2YTN A;  5LLQ A;  4DV7 E;  1FI4 A;  3GON A;  1DQ3 A;  2DMI A;  5LL6 R;  1PIE A;  4DV6 E;  1IMU A;  4K0K I;  2V8P A;  4MLV A;  2L3J A;  1OYS A;  2Q2E B;  4L8N A;  2L3C A;  4OKG A;  4DPW A;  2L2N A;  4Q28 A;  2BM0 A;  1NHI A;  4AIM A;  2LTS A;  2WBS A;  1N3G A;  4DR5 E;  2HKJ A;  2JEB A;  4JI6 I;  4IFD E;  4B3R I;  4AQY E;  2N3G A;  3KZZ A;  5KL2 A;  2L92 A;  4X64 I;  1IBK I;  4KHP I;  3EPL A;  4MQY A;  1ZBQ A;  1ZU1 A;  2EPA A;  4DR3 E;  1HNZ E;  2YTI A;  1XMQ E;  2PNM A;  3H09 A;  4F9C B;  2EJ4 A;  2ODR C;  5KL4 A;  2V8Q B;  1HNW E;  2L2K B;  2BA0 G;  2EN4 A;  2YU8 A;  2GO3 A;  4MU1 A;  4WUC A;  4X66 I;  2O1W A;  1Z0E A;  4DXL A;  3F6H A;  1XNR I;  3WU4 A;  1T39 A;  1EH6 A;  2YZT A;  3U1Y A;  5IWA E;  3HXL A;  4DV2 I;  2F8B A;  2EMF A;  2WNR A;  4JI4 E;  2ODR D;  2EML A;  4GZN C;  1HNW I;  4LF7 E;  4QNJ A;  2DIX A;  2BM1 A;  4JI7 I;  4EMD A;  2L33 A;  4IS9 A;  1RRE A;  4DV0 I;  4B3S E;  3B8H A;  1UDN A;  2EPN A;  1G2F C;  1PVG A;  2V83 A;  3T1H I;  2DB2 A;  2GHF A;  2NN6 D;  2KON A;  2L8T A;  2EOZ A;  5AAS A;  3P06 A;  2PNL A;  3P3C A;  4DPX A;  1XMQ I;  3DD6 A;  3JAM Q;  2A25 A;  2EOO A;  1T38 A;  4B3T E;  2C39 A;  2LJP A;  2NN6 E;  2G7H A;  4LFC I;  2AE8 A;  4DR5 I;  1HR0 I;  2UXC E;  1FNM A;  2M1S A;  2JVA A;  3THO B;  2EM2 A;  2J7K A;  4IZJ D;  5C0X F;  1BBO A;  2NPF A;  2JE6 A;  3MSW A;  4DV6 I;  2M4I A;  2NUF A;  1S4E A;  4O5G A;  1N33 I;  5IV8 B;  2B7T A;  1ZM4 A;  2YTD A;  1P42 A;  2F1D A;  4ZYG A;  4IFD A;  5A6B D;  5DNL A;  1J5E E;  4WXD A;  3EPJ A;  2V2Z A;  3ZKB A;  2HKE A;  1ZAA C;  5JEA E;  3DF6 A;  1A1L A;  2WBT A;  1Y60 A;  1IBM I;  3LPS A;  2F4V I;  3V2U C;  4BA2 B;  1YUI A;  2EOH A;  2UU9 E;  2EN2 A;  1RMD A;  2MDG A;  1ZBT A;  2DLQ A;  1EA6 A;  2YTP A;  1QU6 A;  3J80 C;  3Q6M A;  2BA0 D;  4WUD A;  2YTE A;  1XHK A;  1Y4U A;  5C0X E;  1WHQ A;  4AID A;  5FLX Q;  2BB8 A;  1OYP A;  4F54 A;  1Y6Z A;  1Z0W A;  2PNZ B;  3EQ1 A;  4F6M A;  1O0W A;  1YYK A;  1FJG E;  1Z0C A;  1ELO A;  2K4V A;  1A1F A;  2EFG A;  3QT8 A;  2ZIT A;  4R2D A;  1MGT A;  1KVK A;  4B3M E;  3J80 Q;  1Z0T A;  4JI8 E;  4ZVI A;  2LBS B;  1DI2 A;  4WFT A;  5FLX C;  4MYT A;  2JY9 A;  5C0X C;  4MLQ A;  4DV1 I;  4JI5 I;  4HY1 A;  4IS1 C;  2E5L E;  4MDT A;  4DR6 E;  4WYQ B;  1YYW A;  4ED4 A;  1AAY A;  4X62 I;  4DUZ E;  2JT2 A;  2NUG A;  4JI2 E;  2VQE E;  2HGH A;  2EQ0 A;  2V34 A;  4DV4 I;  1X6F A;  3K1J A;  1WRJ A;  1KTV A;  2HHH E;  3JAM C;  3L7Z B;  1TF3 A;  4GKK E;  1XNQ E;  1Z5B A;  4X62 E;  4HTG A;  4N4R B;  2HK3 A;  4R2P A;  3VK6 A;  2IHR 1;  2EPP A;  4JI3 E;  4M2Z A;  5TSE A;  4BC7 A;  1N34 I;  4HYM A;  3BGH A;  2BA1 G;  5CFF E;  4GKK I;  1B69 A;  4YHH E;  1UDQ A;  2C37 A;  4FW9 A;  1EKZ A;  2EM4 A;  1IQS A;  4F2J C;  4Q35 B;  1TF6 A;  2WW4 A;  3HQ1 A;  4FWH A;  4J3D A;  4B3T I;  2VQE I;  3B78 A;  3HPS A;  1FJG I;  4RHB B;  2LTR A;  4O4K A;  3VHT B;  1A1J A;  3BF2 A;  4RH8 A;  4ZYE A;  5A6J A;  4YY3 E;  2X36 A;  3QT6 A;  4MU3 A;  5DRR A;  4DR6 I;  1MEY C;  3CDI A;  1ZXN A;  2OI2 A;  2X7I A;  3GCM A;  3M85 G;  4BBY A;  1B62 A;  2DMY A;  1IBL E;  2PRT A;  4I3H A;  2UXD E;  4LFB E;  1AH5 A;  3P1X A;  3L7Z A;  3P76 A;  4UTG A;  1Z1B A;  3H1C A;  4LU9 A;  2ENA A;  1HK7 A;  1TN9 A;  4N3O A;  2EN3 A;  3M99 B;  2LRS A;  2ADR A;  4GEQ B;  2EL4 A;  4X65 I;  2EM7 A;  2IOP A;  2HK2 A;  3J81 C;  2EOM A;  2EPZ A;  3JTZ A;  2GPI A;  2HJJ A;  1YFH A;  3B82 A;  2LJU A;  4MU0 A;  5F3W A;  4JYA E;  4GKJ E;  2EOI A;  2EMX A;  4R03 A;  2YSP A;  4OO1 A;  4WSP A;  4Z7C A;  4BA1 A;  1XMO E;  2V2Q A;  2E1M A;  5EL9 A;  2B9D A;  2UUA I;  3LTO A;  1EH7 A;  1NHJ A;  4LF5 E;  4ISA A;  1JK2 A;  4PRV A;  4LF6 E;  4WUB A;  4AM3 A;  3KRN A;  2Z5E A;  4FW4 A;  1T4O A;  3THN A;  2PNZ A;  2CGE A;  1I94 E;  2PO1 A;  1FWL A;  1YH8 A;  2PO0 A;  5L3J A;  5K36 A;  2C39 B;  1UHZ A;  5FWK A;  1I94 I;  2UXD I;  1PJQ A;  1JK1 A;  2WP8 A;  2EPL X;  5T6J A;  5JEA D;  4DV7 I;  4LF9 E;  4LF8 E;  2ZBK B;  5K36 D;  4LF5 I;  3EPK A;  3PS2 A;  3ECR A;  4BS9 A;  4R2C A;  1RR9 A;  3OML A;  2GS8 A;  1Y4S A;  1X3C A;  2EL5 A;  4WSG A;  4Z7Y A;  5JEA A;  4NXM I;  2EPR A;  2MC6 A;  3M6A A;  2YT4 A;  2RTX A;  4NXN E;  3J7A G;  5C0X B;  2JYA A;  3ADG A;  1PJT A;  2RSI A;  4R2Q A;  4M0V A;  3T1H E;  5IT9 C;  2EWL A;  4WPY A;  2LO3 A;  2C38 A;  2V89 A;  3J7Y p;  5IWA I;  3VYX A;  5KL3 A;  4X8W A;  2NN6 A;  4FW5 A;  2YTO A;  3QG5 C;  3HPZ A;  1LLM C;  1HNX E;  1N32 E;  4WXC A;  4X9J A;  4LFB I;  1YYO A;  2UUB E;  2EOJ A;  2Z5B B;  3ZZ0 A;  4R8O A;  4BMJ A;  1KKH A;  5AE1 A;  5C0X A;  2E72 A;  1EH8 A;  2DSY A;  4GQU A;  5GME A;  2N8X A;  1X48 A;  4DV2 E;  3QT5 A;  2CPN A;  2BA1 D;  3JU0 A;  3T1Y E;  1R6L A;  2VE7 C;  1N36 I;  4M1K A;  4DR1 E;  4OO1 B;  4P78 A;  4DUZ I;  2HC5 A;  2O3Z A;  4I8O A;  3AV0 A;  3PS3 A;  3F0N A;  3ZKD A;  1EI1 A;  4KWY A;  2GO4 A;  1N36 E;  4F9B B;  3H4L A;  1U2R A;  2EOY A;  2HFS A;  4JI8 I;  2V87 A;  4YHH I;  4K0K E;  5K36 B;  1G2D C;  4R1F A;  2EM0 A;  5AC4 A;  3M85 D;  1PDA A;  3MHS C;  2E5L I;  3NZK A;  4U3B A;  4JYA I;  2EMA A;  2YTJ A;  1YZ9 A;  4JI1 E;  2CTD A;  1ZM2 A;  4DR2 E;  3ADL A;  5ADZ A;  2EMC A;  4KZS A;  2YSO A;  2MKN A;  1X6H A;  1T4L B;  1B63 A;  2IER A;  2Z5C A;  4LOM A;  4MYU A;  4USK A;  2D9H A;  4IFD F;  2PO2 A;  3J7A M;  1UBD C;  4M30 A;  1T4N A;  1X47 A;  1A1H A;  3LML A;  2JR1 A;  1J26 A;  2H36 X;  2MKD A;  1ZM3 A;  4IZK B;  2MC5 A;  4R2S A;  2EN1 A;  2RS6 A;  1YSA C;  1N32 I;  2GLI A;  2EOF A;  5DRO A;  2JEA B;  1STU A;  4FK5 C;  4FW7 A;  3HJC A;  1KYQ A;  4HAC B;  5LMU I;  1NCS A;  3C6M A;  5DRQ A;  5BR8 E;  1YUJ A;  2EMW A;  3PYE A;  4LTY A;  3PRY A;  4JI0 I;  3C4T A;  2NUE A;  3GME A;  2UU9 I;  1NEI A;  3K6Q A;  4IZK A;  4NXN I;  3ZZT A;  5IT9 Q;  1A1K A;  4FN5 A;  2EMI A;  1RC7 A;  4OX9 I;  2K7I A;  2IES A;  2EOR A;  2GQ0 A; 
#chains in the Genus database with same CATH homology
 1H72 C;  1J5E I;  4X65 E;  3AUZ A;  3C4B A;  5DNY A;  4BCA A;  2UXC I;  3J81 Q;  4DUY E;  1ZXM A;  4DR7 E;  4XTJ A;  3WU3 A;  4GKJ I;  2KOU A;  4IZJ B;  3CWV A;  4DV3 I;  5AE2 A;  4LF6 I;  4B3S I;  3Q6N A;  1N0U A;  5LMN I;  1HR0 E;  4HAC A;  2UXB E;  4LF4 I;  2V86 A;  2HFU A;  4IZJ A;  4F9A B;  4USM A;  4DV5 E;  2B3T B;  1MX0 A;  4DR3 I;  1HNZ I;  4KQV A;  2UXB I;  4JV5 E;  4BC9 A;  1Z0G A;  2NA2 A;  2KHX A;  4DV3 E;  4TUI A;  3IWC A;  3K17 A;  1NHH A;  3LNU A;  4DPT A;  1Z5A A;  2VQF I;  1QZR A;  1H7S A;  4AQY I;  4P7A A;  3K85 A;  2LMZ A;  4P7D A;  2O1V A;  4JI1 I;  2A2D A;  2DEJ A;  2FGG A;  3OTO E;  1UIL A;  2V85 A;  3IWD A;  4JI0 E;  4PRX A;  4JI2 I;  4UT4 A;  1IBK E;  4KHP E;  2UUC I;  2LJH A;  3WU5 A;  2Z5C B;  2DEI A;  1NZ0 A;  1WHN A;  4DR4 I;  4JI3 I;  2Z5B A;  1USV A;  4JI6 E;  2ZM6 E;  4DR4 E;  2JOB A;  1SR9 A;  1Z0V A;  1DAR A;  2AJ4 A;  4PU9 A;  1KIJ A;  2VF1 A;  4JI5 E;  2HHH I;  3T1Y I;  4JV5 I;  1H7U A;  3DJW A;  4LF4 E;  4B3M I;  3QT7 A;  3PYG A;  2LUQ A;  3OTO I;  3WU6 A;  3HTX A;  1USU A;  2ZM6 I;  4DV1 E;  5A2Q Q;  3ZM7 A;  1OJ4 A;  4DPU A;  3VYY A;  1Z0B A;  1A6F A;  1N33 E;  2VQF E;  4DU8 A;  1IBM E;  2F4V E;  1D6T A;  2L2M A;  1RQ0 A;  2N3H A;  1VIS A;  4FWD A;  2FTX B;  4NXM E;  2MDR A;  2V88 A;  4LF8 I;  4LF9 I;  4DKK A;  4DPY A;  4DV0 E;  3LLH A;  4LFA I;  4RPF A;  4DU7 A;  1BKN A;  1H74 A;  5A2Q C;  2FV4 B;  4LFC E;  4JI4 I;  2LE2 A;  1HNX I;  5LMU E;  4P52 A;  3FIG A;  3D4J A;  5AE3 A;  1XMO I;  3ADJ A;  4YY3 I;  1IBL I;  1PKP A;  4JI7 E;  1WXR A;  3ADI A;  4URL A;  2O1T A;  4DR7 I;  4OOG C;  2BV3 A;  2R3V A;  4LF7 I;  1UEK A;  2IOQ A;  5LMN E;  1FKA E;  3KWR A;  4X64 E;  4DV5 I;  3IWB A;  2CG9 A;  3Q1Q A;  3V5R A;  1WUU A;  3PYD A;  2LUP B;  1XNQ I;  1FWK A;  1S16 A;  1XNR E;  1N0V C;  1N34 E;  2E1R A;  1X49 A;  4X66 E;  3F6G A;  2UUA E;  2M7Q A;  1GQE A;  4LFA E;  1MU5 A;  4DR1 I;  4B3R E;  3ZOQ B;  1H73 A;  4DUY I;  4JYA I;  1ZM9 A;  4TUG A;  3PYF A;  1Z59 A;  1MG7 A;  2EZ6 A;  3HUL A;  2L6M A;  4JG4 A;  2JOX A;  1GZ6 A;  4OX9 E;  2CZ9 A;  2UUB I;  4DMI A;  4HXZ A;  2RSM A;  2RS7 A;  2O1U A;  4J8Z A;  2JWO A;  5GMD A;  5BR8 I;  3ZZU A;  4DV4 E;  1K47 A;  1Z5C A;  2A2C A;  4L5N C;  2V2V A;  2R42 A;  2VF3 A;  4DR2 I;  2B7V A;  2UUC E;  2WZO A;  4FWG A;  2XEX A;  3RMP A;  4DV7 E;  3GON A;  1FI4 A;  1PIE A;  1DQ3 A;  5LL6 R;  4DV6 E;  4K0K I;  2V8P A;  2L3J A;  2Q2E B;  4DPW A;  4L8N A;  2L3C A;  2L2N A;  4Q28 A;  2BM0 A;  1NHI A;  4JI6 I;  2LTS A;  4DR5 E;  2HKJ A;  4B3R I;  4AQY E;  2N3G A;  2L92 A;  4X64 I;  1IBK I;  4KHP I;  1ZBQ A;  4DR3 E;  1HNZ E;  1XMQ E;  2PNM A;  3H09 A;  4F9C B;  2ODR C;  2V8Q B;  1HNW E;  2L2K B;  4X66 I;  4WUC A;  2O1W A;  1Z0E A;  4DXL A;  3F6H A;  1XNR I;  3WU4 A;  2YZT A;  4DV2 I;  5IWA E;  3HXL A;  2F8B A;  4JI4 E;  2ODR D;  1HNW I;  4LF7 E;  2DIX A;  2BM1 A;  4JI7 I;  4EMD A;  2L33 A;  1RRE A;  4DV0 I;  4B3S E;  3B8H A;  1PVG A;  2V83 A;  3T1H I;  2DB2 A;  2KON A;  2L8T A;  5AAS A;  3P06 A;  2PNL A;  4DPX A;  1XMQ I;  3JAM Q;  4B3T E;  2LJP A;  2G7H A;  4LFC I;  4DR5 I;  1HR0 I;  2UXC E;  1FNM A;  2M1S A;  2JVA A;  2J7K A;  4IZJ D;  2NPF A;  3MSW A;  4DV6 I;  2M4I A;  2NUF A;  1S4E A;  1N33 I;  1ZM4 A;  2B7T A;  1J5E E;  2V2Z A;  3ZKB A;  2HKE A;  3DF6 A;  1IBM I;  2F4V I;  3LPS A;  3V2U C;  2UU9 E;  1ZBT A;  1EA6 A;  1QU6 A;  3J80 C;  3Q6M A;  4WUD A;  1XHK A;  1Y4U A;  1WHQ A;  5FLX Q;  4F54 A;  1Y6Z A;  1Z0W A;  1YYK A;  1O0W A;  1FJG E;  1Z0C A;  1ELO A;  2K4V A;  2EFG A;  3QT8 A;  2ZIT A;  1KVK A;  4B3M E;  3J80 Q;  1Z0T A;  4JI8 E;  4ZVI A;  1DI2 A;  2LBS B;  4WFT A;  5FLX C;  4MYT A;  2JY9 A;  4DV1 I;  4JI5 I;  4HY1 A;  2E5L E;  4DR6 E;  4WYQ B;  1YYW A;  4ED4 A;  4X62 I;  4DUZ E;  2NUG A;  4JI2 E;  2VQE E;  2V34 A;  4DV4 I;  3K1J A;  1KTV A;  2HHH E;  3JAM C;  4GKK E;  1XNQ E;  1Z5B A;  4X62 E;  2HK3 A;  3VK6 A;  2IHR 1;  4JI3 E;  4M2Z A;  1N34 I;  4BC7 A;  4HYM A;  5CFF E;  4GKK I;  4YHH E;  4FW9 A;  1EKZ A;  2WW4 A;  3HQ1 A;  4FWH A;  4B3T I;  2VQE I;  3B78 A;  3HPS A;  1FJG I;  2LTR A;  2X36 A;  3QT6 A;  4YY3 E;  4DR6 I;  1ZXN A;  2OI2 A;  2X7I A;  4BBY A;  1B62 A;  2DMY A;  1IBL E;  4I3H A;  2UXD E;  4LFB E;  3P1X A;  4UTG A;  4LU9 A;  1HK7 A;  4N3O A;  2LRS A;  4GEQ B;  4X65 I;  2IOP A;  2HK2 A;  3J81 C;  3JTZ A;  3B82 A;  5F3W A;  4JYA E;  4GKJ E;  4R03 A;  4WSP A;  4Z7C A;  1XMO E;  2V2Q A;  2E1M A;  2UUA I;  2B9D A;  3LTO A;  1NHJ A;  4LF5 E;  4PRV A;  4LF6 E;  4WUB A;  2Z5E A;  1T4O A;  2CGE A;  1I94 E;  1FWL A;  5L3J A;  1UHZ A;  5FWK A;  1I94 I;  2UXD I;  5T6J A;  4DV7 I;  4LF9 E;  4LF8 E;  2ZBK B;  4LF5 I;  1RR9 A;  4BS9 A;  3OML A;  2GS8 A;  1Y4S A;  4Z7Y A;  4NXM I;  2MC6 A;  3M6A A;  2YT4 A;  2RTX A;  4NXN E;  3J7A G;  3ADG A;  4M0V A;  3T1H E;  5IT9 C;  2EWL A;  4WPY A;  2V89 A;  3J7Y p;  5IWA I;  3VYX A;  4X8W A;  3HPZ A;  1HNX E;  1N32 E;  4LFB I;  1YYO A;  2UUB E;  3ZZ0 A;  2Z5B B;  4R8O A;  4BMJ A;  1KKH A;  5AE1 A;  2DSY A;  5GME A;  4DV2 E;  1X48 A;  3QT5 A;  2CPN A;  3JU0 A;  3T1Y E;  1N36 I;  2VE7 C;  4M1K A;  4DR1 E;  4P78 A;  4DUZ I;  4I8O A;  3AV0 A;  3F0N A;  3ZKD A;  1EI1 A;  1N36 E;  4F9B B;  3H4L A;  1U2R A;  2HFS A;  4JI8 I;  2V87 A;  4YHH I;  4K0K E;  4R1F A;  2E5L I;  1YZ9 A;  4JI1 E;  1ZM2 A;  4DR2 E;  3ADL A;  5ADZ A;  4KZS A;  1B63 A;  1T4L B;  2Z5C A;  4MYU A;  4USK A;  3J7A M;  4M30 A;  1T4N A;  1X47 A;  3LML A;  2JR1 A;  1J26 A;  2H36 X;  1ZM3 A;  4IZK B;  2MC5 A;  2RS6 A;  1N32 I;  1STU A;  3HJC A;  4HAC B;  5LMU I;  5BR8 E;  3PYE A;  4LTY A;  3PRY A;  4JI0 I;  3C4T A;  2NUE A;  2UU9 I;  4NXN I;  3K6Q A;  4IZK A;  3ZZT A;  5IT9 Q;  4FN5 A;  1RC7 A;  4OX9 I;  2GQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...