4B3TE

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3tE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tE02
3B82A 4LFCI 4X64E 4DR4E 4JI0E 2UXBE 4DUZI 1N34I 2UUCE 1YYWA 1FWKA 4JI1E 3WU5A 4EMDA 2UUBI 1H7UA 4AQYE 2B7VA 1PKPA 4B3TE 1Z59A 4X66I 4FN5A 2Q2EB 1FJGI 5GMEA 1IBKE 4MYTA 1UHZA 3P1XA 3VYYA 3J80Q 5LMUE 4JI2E 4HYMA 4LF6I 4LF4I 4M1KA 4JI8E 4M2ZA 2UU9I 1Z0BA 2HKEA 4DV7E 1Z0EA 3LLHA 4LF4E 2UUAI 2NUFA 3PYEA 4DPTA 3V2UC 4WUCA 4B3MI 4NXNE 4XTJA 1VISA 2DEJA 5FLXQ 4WUDA 3C4BA 4X8WA 4DPUA 4DV5E 4LF5E 3HULA 3Q1QA 1XNQI 4PRXA 4HXZA 1UILA 3T1YI 3T1HE 4YY3E 2EFGA 4WUBA 4LF9E 2DEIA 3WU3A 3J80C 5L3JA 3C4TA 4B3RE 1ZM3A 4X64I 1HNXI 1B62A 1X49A 2LTSA 3HTXA 2KHXA 4OX9I 4RPFA 3CWVA 4DR5E 2HHHE 4USMA 1YYKA 2JY9A 4JI3I 4JI5I 5FLXC 2LTRA 1QU6A 1EA6A 2J7KA 1MU5A 3F0NA 4DKKA 4DV0E 3QT8A 4YHHE 1RREA 2DIXA 4JI3E 3ZKDA 1T4OA 1ZXNA 4K0KE 2V2VA 2HK3A 4JI0I 1H73A 1H72C 1XNRE 4B3SI 1RC7A 4DR2I 1H7SA 4LF7E 4DU8A 4JI8I 3OTOI 2VQEI 4B3SE 1XNRI 1N0UA 1FKAE 4AQYI 4FWDA 1IBLI 4KQVA 2LRSA 2V8PA 2JVAA 4DR3E 4X66E 2LJHA 3ADGA 2R42A 3PYGA 1ZXMA 4DV2E 2RTXA 2ZM6E 1HNZE 1YZ9A 1N0VC 4X65I 2VF3A 1I94E 2VQFI 4HACB 2LBSB 2IHR1 4B3RI 2DB2A 2DMYA 2AJ4A 1KIJA 1KVKA 4DPXA 4DV3E 3LNUA 5A2QC 2B7TA 4DUYI 2LUPB 2WW4A 4DR1E 4R1FA 4OOGC 3ZZUA 4LF7I 4DV0I 3B78A 4JI4I 4K0KI 1FNMA 4KHPI 2E5LE 4LF6E 4DV6E 4DV4I 2EZ6A 2HK2A 3ADJA 3J7AM 1DARA 1PIEA 3B8HA 1U2RA 3PYFA 2E5LI 4FWHA 4DUZE 1N34E 1MX0A 5BR8I 1IBLE 3V5RA 2NA2A 2MDRA 3JAMC 5IWAI 3ADIA 1HR0E 1Z0TA 2X36A 4JI6I 1NZ0A 1BKNA 4PU9A 5IT9C 4P52A 4X65E 1KKHA 1X47A 2CPNA 2R3VA 1ZM4A 1Z5AA 4NXMI 1FJGE 2A2CA 4LF8E 4DPYA 4DR6I 3ZZ0A 4GKJI 4Z7CA 1ELOA 4JV5I 2A2DA 2UU9E 5LMUI 2L3JA 3JAMQ 2LUQA 1WHQA 2HKJA 3J81C 4DV3I 3VYXA 2UXCE 2GS8A 4DV6I 1WUUA 3H4LA 3WU6A 2XEXA 2UXDI 4GKKE 1HNWE 1XMQI 3ADLA 4YY3I 2RSMA 1A6FA 4M30A 2L2MA 4X62E 4P7AA 1J5EE 4DR7E 2F4VI 4HACA 4DR4I 2UXBI 2L3CA 2E1RA 1J5EI 4JI1I 4ED4A 4OX9E 1HNXE 4DR7I 2V2ZA 2X7IA 1T4NA 4GKJE 2RS7A 4JV5E 1KTVA 1MG7A 3K17A 4JG4A 5A2QQ 1EKZA 5GMDA 4JI2I 4USKA 4JYAE 3QT7A 4DPWA 4DR2E 5IWAE 4B3TI 3ZM7A 1ZBTA 4LFBI 2RS6A 4Z7YA 1IBMI 3J7AG 1D6TA 1N33E 1NHIA 4DV1I 2B3TB 2ZM6I 1HNZI 5LL6R 2UUCI 1IBME 3QT6A 4LF5I 4NXNI 1RR9A 4FW9A 1ZM9A 1OJ4A 2F4VE 1X48A 4KHPE 1XMQE 4PRVA 2UUAE 1Z0GA 1J26A 1NHJA 4LFAI 4LF9I 1T4LB 2ZITA 3ZZTA 2BM0A 4DR1I 1XMOE 1HR0I 4LFAE 1UEKA 2UXCI 3T1YE 2BV3A 3QT5A 2UXDE 4JI5E 1WHNA 4LFCE 4DR5I 2HHHI 1N36E 2HFUA 4WYQB 4DU7A 4JI7E 4YHHI 4DXLA 1H74A 2UUBE 4HY1A 2OI2A 1K47A 4B3ME 3J81Q 4JI7I 1XHKA 2L33A 4JI4E 3J7Yp 3T1HI 3OTOE 4FWGA 4I3HA 4LFBE 3LPSA 1N32E 1FWLA 2ZBKB 3LTOA 1O0WA 1DI2A 1FI4A 1N33I 2N3HA 3PYDA 5BR8E 4JI6E 5CFFE 5IT9Q 1EI1A 2NUGA 1S4EA 3D4JA 3GONA 2NPFA 1Z5BA 1QZRA 1STUA 4UT4A 4X62I 4DR3I 1RQ0A 4NXME 2V2QA 2NUEA 4URLA 5LMNI 4UTGA 1N36I 2N3GA 2V34A 4DV1E 2VQFE 1YYOA 1I94I 1GQEA 2CZ9A 4LF8I 2L2KB 4DR6E 2BM1A 3ZKBA 4GKKI 5LMNE 4DV7I 1IBKI 1B63A 1Z0VA 2VQEE 1PVGA 4WFTA 4ZVIA 2LJPA 4MYUA 2HFSA 3K1JA 4DUYE 1Z5CA 1NHHA 1ZM2A 1Z0CA 1HNWI 4DV5I 1N32I 1XNQE 2L2NA 1Z0WA 4JYAI 4DV2I 2YT4A 1XMOI 1S16A 4DV4E 3WU4A 3M6AA
chains in the Genus database with same CATH superfamily
3B82A 2GO3A 2O1VA 5KL2A 4U3DA 4LFCI 2JPAA 4RH8A 4X64E 4JI0E 4DR4E 2UXBE 4DUZI 1YUJA 2LCEA 1N34I 1USUA 2GO4A 2YTGA 2UUCE 1YYWA 4JI1E 1FWKA 3WU5A 4EMDA 5C0XD 2UUBI 5AE2A 1Y4UA 3HPZA 3U1KA 4NBQA 4F6MA 1H7UA 2EN7A 2EOXA 5F3WA 4AQYE 2CT1A 2EPNA 1ZBQA 2B7VA 2EPLX 2EM4A 1YUIA 1PKPA 4B3TE 2EM9A 1Z59A 4X66I 5T6JA 3PS2A 3TQMA 4FN5A 2Q2EB 2PO1A 4IFDE 3U1YA 4OO1C 1FJGI 2EMXA 1GZ6A 1IBKE 5GMEA 4MYTA 1OYSA 1UHZA 3KZZA 2PO2B 3EPLA 5EKWA 3P1XA 3VYYA 1Y4SA 5LMUE 4FK5C 1G2FC 4JI2E 2C38A 3J80Q 2ELYA 1YSAC 5AE3A 4HYMA 4N4RB 2RSIA 1UDQA 4JI8E 5LLQA 4IZJD 4M1KA 4LF4I 3LMLA 4M2ZA 1EH6A 5AC4A 2UU9I 1Z0BA 2HKEA 1DGCA 4F9BB 4Q28A 3THOB 4DV7E 2PNZA 1Z0EA 3IWCA 2PO2A 3LLHA 4WXDA 4BS9A 2EL6A 4LF4E 2GLIA 4M9VC 2UUAI 2NUFA 3RMPA 3PYEA 3V2UC 4DPTA 1PDAA 2M4IA 4WUCA 4BBYA 4B3MI 1YHCA 1N3GA 4NXNE 3L7ZB 2DGCA 4XTJA 1VISA 2DEJA 1BBOA 5FLXQ 2FGGA 3C4BA 4WUDA 3K6QA 2EMHA 4X8WA 4DPUA 4DV5E 4LF5E 3HULA 3Q1QA 4MU4A 4HEIA 1ZAAC 4MU0A 4PRXA 1XNQI 2EOQA 2J65A 4HXZA 4KWYA 1UILA 3GCMA 4FW5A 4LCFA 3T1YI 3T1HE 2EPKX 4O4KA 1Z1BA 5JEAB 4YY3E 1NEIA 1OYPA 2HJJA 2EFGA 4WUBA 4LF9E 2DEIA 2EOOA 2JEAB 3WU3A 3J80C 4R2DA 5L3JA 4IZKA 4OO1B 3C4TA 4LF6I 2WBSA 4B3RE 3DJWA 2PNLA 3BF2A 1ZM3A 3GLLA 2BA0G 4X64I 1HNXI 2EP3A 2Z5CA 2PO1B 3M99B 1B62A 1X49A 2MKNA 3B4TA 1Y5YA 2LTSA 3HTXA 2KHXA 4BA2B 4OX9I 3KWRA 3CWVA 4RPFA 4DR5E 4ZYEA 2HHHE 1YYKA 2E72A 2JY9A 2Z5BB 4USMA 4JI3I 5ADZA 3THNA 1UDOA 4JI5I 5FLXC 2LTRA 1QU6A 2ENHA 4BHCA 1EA6A 1MU5A 2J7KA 4DKKA 2PRTA 2GHFA 1E3PA 3F0NA 2LV2A 2B9DA 1ZR9A 2AE8A 4IFDF 2RPCA 2EM6A 4DV0E 4YHHE 3EPJA 2YPNA 2DIXA 2EJ4A 2EPOA 4JI3E 1RREA 3QT8A 3ZKDA 1T4OA 1ZXNA 2Z5BA 4K0KE 2V2VA 2PO0B 2HK3A 4JI0I 1X6FA 2EOJA 1H73A 1H72C 4U3BA 4BA1B 5A6KA 3BIDA 1XNRE 4B3SI 1RC7A 5EL9A 4DR2I 4KZSA 1OYRA 1H7SA 1KJKA 4LF7E 4DU8A 4JI8I 2EM5A 5JEAC 1YPNA 2DLKA 4BHBA 2FTXB 3HXLA 1WXRA 3OTOI 2VQEI 1SFEA 2HC5A 4B3SE 5AC5A 1XNRI 5KL3A 1N0UA 1FKAE 4AQYI 4FWDA 1IBLI 4TUGA 2YZTA 4KQVA 2LRSA 2NN6C 3CDIA 2YU5A 2V8PA 2JVAA 2GPIA 4WPYA 2C39B 5C0XA 2Q8UA 4DR3E 1X6EA 1MEYC 4X66E 4FW4A 4J3DA 2EPAA 2LJHA 4QNJA 3ADGA 2R42A 3PYGA 2YTQA 2EMCA 3FIGA 2MKDA 4P78A 2PNZB 2H36X 1UBDC 2N8XA 1ZXMA 2EMYA 4DV2E 3M7NG 2YTJA 2JYAA 2EN4A 2RTXA 2BB8A 4BCAA 2A25A 5AE1A 3EPKA 3OMLA 2JT2A 2ZM6E 1HNZE 1YZ9A 5DROA 2EN2A 5K36B 1PJQA 3KZYA 1X5WA 2EL4A 2KOUA 5K36D 2M1SA 1N0VC 2EOZA 4X65I 2JEBB 2VF3A 1B69A 2EPXA 1I94E 2VQFI 4HACB 4ZYDA 2LBSB 2IHR1 2BR2B 4B3RI 5JEAA 2DB2A 2DMYA 2ODRD 3DD6A 4R2RA 2L92A 2AJ4A 4IZJA 2VF1A 2YTFA 1KIJA 3HQ1A 4M0VA 1KVKA 1P47A 2BA0D 4IFDD 1PJTA 4DPXA 2IERA 4DV3E 3LNUA 3PS1A 4RHBB 4R2SA 5A2QC 2B7TA 4DUYI 2LUPB 2F8BA 2BA1G 2WCC3 2WW4A 1KYQA 3HKMA 2JWOA 4DR1E 4R1FA 4DMIA 4OOGC 3ZZUA 4LF7I 2JXPA 4DV0I 2LJUA 2YTOA 3B78A 2EMAA 5KL5A 2YRKA 5JEAE 4JI4I 4K0KI 1YFHA 1AH5A 2EOEA 1TF6A 1FNMA 2CVEA 4KHPI 2E5LE 4MU1A 4LF6E 4DV6E 4DV4I 2EZ6A 2HK2A 2WP8A 5C0XE 1G2DC 3ADJA 4R2QA 2BA1D 1DARA 2CG9A 3J7AM 2NN6A 2R76A 2EQ0A 4F2JC 1PIEA 3B8HA 1U2RA 3PYFA 2E5LI 4FWHA 4DUZE 2DMIA 1N34E 5JEAF 1MX0A 5BR8I 1IBLE 2WZOA 3V5RA 1ZU1A 4BMJA 2YRHA 2NA2A 2MDRA 3JAMC 5IWAI 2EE8A 2EWLA 1TF3A 3ADIA 1HR0E 2YRMA 1Z0TA 1A1GA 2X36A 5FWKA 4JI6I 4BC7A 2D9HA 5IT9C 3BBGA 4R2PA 1BKNA 4O24A 1NZ0A 4P52A 4PU9A 4BA2A 2MC6A 4X65E 1KKHA 2O1UA 2V89A 2C39A 1X47A 2CPNA 5KL6A 2ELZA 2VESA 2R3VA 4OZEA 5DNLA 4IJDA 2I9IA 1ZM4A 1RHYA 1Z5AA 4OO1D 4NXMI 3VK6A 2WBTA 3AV0A 4L8NA 1FJGE 2A2CA 4IS9A 1A1JA 2EM7A 5IXMB 2JE6B 2V86A 4FW7A 4F54A 4LOMA 4GZNC 4LF8E 4DPYA 4DR6I 5K36F 3P3CA 2K7IA 5TSEA 2EPCA 5DNXA 3ZZ0A 4GKJI 4MU3A 3HJCA 4F6NA 2RQLA 4Z7CA 1ELOA 2V8QB 4JV5I 2J7JA 2EN8A 2MDGA 2PO0A 2A2DA 2UU9E 1BBGA 2BBGA 5LMUI 4AIMA 2L3JA 3JAMQ 2LUQA 2GQ0A 1WHQA 2HKJA 3ZOQB 3EPHA 3J81C 4MDTA 2ENCA 1IMUA 4DV3I 3C6KA 3VYXA 2UXCE 2GS8A 5JEAD 4DV6I 2FV4B 1WUUA 5A69A 2EMWA 3H4LA 3P76A 2V88A 3PRYA 2I13A 1UDNA 2XEXA 3WU6A 2UXDI 4I8OA 2ADRA 4GKKE 4R2EA 1R6MA 4IZJB 2CGEA 4GQUA 1R6LA 1HNWE 3F6GA 4R2AA 3K85A 3Q6NA 2EMIA 1XMQI 3ADLA 2NABA 2EN6A 4MLVA 1L4SA 4YY3I 3MSWA 1F2IG 1JK1A 2EPRA 2RSMA 4NHRA 1WRJA 1A6FA 3JU0A 2EOFA 2JEAA 4M30A 2L2MA 4X62E 4OO1F 1WJPA 4P7AA 1J5EE 4QNKA 3UHMA 5K36A 3BGHA 2CTDA 3AUZA 4DR7E 4R03A 2F4VI 4O5GA 4HACA 4LU9A 1UDSA 4DR4I 2EOYA 1GTKA 2UXBI 2NN6F 2L3CA 2EOHA 2E1RA 1J5EI 4JI1I 2C37B 4ED4A 4OX9E 1HNXE 2YSOA 4DR7I 2F1DA 4WX9A 2LT7A 4N3OA 2EL5A 5KL7A 4TUIA 2V2ZA 2YSPA 2X7IA 1T4NA 1EH7A 2YTPA 3JTZA 4GKJE 2RS7A 3GMEA 4GEQB 5K36E 4JV5E 4WSPA 4FW3A 2EM2A 1KTVA 1MG7A 3K17A 5AASA 4JG4A 5A2QQ 1EKZA 5GMDA 3HPSA 1A1LA 2EQ3A 4JI2I 4X9JA 1BB8A 3P3GA 1E3HA 2V85A 4USKA 1A1IA 5A6AA 4ZYHA 2M9AA 4JYAE 3QT7A 3M85G 2EMFA 4DR2E 4DPWA 2EM0A 4F9AB 2JOBA 5IWAE 1AAYA 4IZKB 4OO1A 4B3TI 4MQYA 3ZM7A 1ZBTA 2IESA 2NN6D 2EM8A 4LFBI 1YH8A 2RS6A 2Z5EA 4Z7YA 1IBMI 1HK7A 3J7AG 4J8ZA 1D6TA 1N33E 1NHIA 3QG5C 4DV1I 2B3TB 2EPUA 2ZM6I 1HNZI 4LPFA 3C6MA 2HGHA 5LL6R 2UUCI 1IBME 4Q35B 3QT6A 4AM3A 4LF5I 3CDJA 4NXNI 4BC9A 1LLMC 5C0XB 1RR9A 2LE2A 3KRNA 2YWQA 4FW9A 2YTIA 1ZM9A 1OJ4A 1X6HA 2F4VE 1X48A 4KHPE 5K36C 2EMKA 3ECRA 2CSHA 4R8OA 1XMQE 4PRVA 2C37A 4FW6A 2UUAE 1Z0GA 3M7ND 1J26A 5DRQA 2WBUA 1NHJA 4LFAI 2JP9A 4LF9I 3H1CA 2EN3A 1P42A 2DSYA 2IOPA 2Z5CB 4BA1A 1T4LB 1MGTA 1IQOA 2ZITA 2LVHA 3ZZTA 2EPZA 4LCHA 2BM0A 1RMDA 4DR1I 5A6BA 4P7DA 1XMOE 1HR0I 4LFAE 1UEKA 2UXCI 4WXCA 3T1YE 2YTNA 2WP8B 2DLQA 2PNMA 5A6BD 2BV3A 3PS3A 3QT5A 2UXDE 4JI5E 2O1WA 3L7ZA 4IFDB 2O3ZA 1WHNA 2EQ1A 4LFCE 2E1MA 4LTYA 2M7QA 4DR5I 1N36E 2HHHI 2HFUA 4WYQB 3UK3C 4JI7E 4DU7A 4DXLA 4YHHI 1H74A 2UUBE 4HY1A 2OI2A 1K47A 1UN6B 2K4VA 4B3ME 3J81Q 4ZYGA 3Q6MA 4IS1C 1PJSA 2O1TA 4IFDA 5IV8B 4O43A 4JI7I 2WNRA 3MHSC 2DRPA 1XHKA 2C38B 2EPPA 2JEBA 3P3EA 1DQ3A 2L33A 4JI4E 1NCSA 4HTGA 3J7Yp 1Y6ZA 4NZVA 4LCGA 3OTOE 3T1HI 4FWGA 4I3HA 1QNTA 2L6MA 1T39A 5DRPA 4LFBE 2EN1A 1N32E 3LPSA 1FWLA 2YU8A 2ZBKB 2L8TA 3LTOA 1O0WA 1DI2A 1FI4A 5DRRA 2VRDA 1N33I 2N3HA 3PYDA 2EMLA 2EM3A 2WNRB 2JOXA 1SR9A 3IWDA 5BR8E 2EOMA 5C0XF 4JI6E 1TN9A 3DF6A 1VI7A 2ENAA 2EORA 3P06A 3M85D 5CFFE 5IT9Q 1EI1A 2NUGA 1S4EA 4AIDA 2KONA 3D4JA 5C0XC 4ISAA 3GONA 2EMZA 3NZKA 4L5NC 2NPFA 1Y60A 1Z5BA 1QZRA 1STUA 4UT4A 2EMBA 4X62I 2BR2A 4DR3I 1XXEA 1RQ0A 3L00A 4NXME 2V2QA 2NUEA 1A1KA 2JE6A 4URLA 5LMNI 4UTGA 2V87A 4WSGA 5ELWA 1N36I 2N3GA 2V34A 4DV1E 2VQFE 1YYOA 2LMZA 4R2CA 1GQEA 5A6JA 2CZ9A 2NN6B 1I94I 2L2KB 4DR6E 4LF8I 2BM1A 4OO1E 2JR1A 2EOSA 2G7HA 3ZKBA 4GKKI 1USVA 3F6HA 5LMNE 2EMGA 5KL4A 4DV7I 1IBKI 3VHTB 1IQSA 1B63A 1Z0VA 2VQEE 1PVGA 3MHHC 4WFTA 4F9CB 4IFDC 4ZVIA 2LJPA 2YTDA 2IOQA 2EPMX 2HFSA 3K1JA 2V83A 2YTEA 4MYUA 4DUYE 3IWBA 1A1HA 1Z5CA 1NHHA 1ZM2A 1Z0CA 1T38A 4OKGA 2LO3A 2VE7C 3EQ1A 1X3CA 4DV5I 1HNWI 1N32I 2EOIA 2NN6E 2R1FA 1XNQE 1EH8A 2L2NA 1Z0WA 4JYAI 2ODRC 4DV2I 2MC5A 2YT4A 3H09A 1JK2A 5DNYA 1XMOI 1S16A 4DV4E 3WU4A 4MLQA 3M6AA 1A1FA
chains in the Genus database with same CATH topology
3B82A 2O1VA 4LFCI 4X64E 4DR4E 4JI0E 2UXBE 4DUZI 1N34I 1USUA 2UUCE 1YYWA 1FWKA 4JI1E 3WU5A 4EMDA 2UUBI 5AE2A 1Y4UA 3HPZA 1H7UA 5F3WA 4AQYE 1ZBQA 2B7VA 1PKPA 4B3TE 1Z59A 4X66I 5T6JA 4FN5A 2Q2EB 1FJGI 1GZ6A 1IBKE 5GMEA 4MYTA 1UHZA 3P1XA 3VYYA 1Y4SA 5LMUE 4JI2E 3J80Q 4HYMA 5AE3A 4LF6I 4LF4I 4IZJD 4JI8E 4M1KA 3LMLA 4M2ZA 2UU9I 1Z0BA 2HKEA 4F9BB 4Q28A 4DV7E 1Z0EA 3IWCA 3LLHA 4BS9A 4LF4E 2UUAI 2NUFA 3RMPA 3PYEA 3V2UC 4DPTA 2M4IA 4WUCA 4BBYA 4B3MI 4NXNE 4XTJA 1VISA 2DEJA 5FLXQ 2FGGA 3C4BA 4WUDA 3K6QA 4X8WA 4DPUA 4DV5E 4LF5E 3HULA 3Q1QA 1XNQI 4PRXA 4HXZA 1UILA 3T1YI 3T1HE 4YY3E 2EFGA 4WUBA 4LF9E 2DEIA 3WU3A 3J80C 5L3JA 4IZKA 3C4TA 4B3RE 3DJWA 2PNLA 1ZM3A 4X64I 1HNXI 2Z5CA 1B62A 1X49A 2LTSA 3HTXA 2KHXA 4OX9I 3KWRA 3CWVA 4RPFA 4DR5E 2HHHE 2Z5BB 1YYKA 4USMA 2JY9A 4JI3I 5ADZA 4JI5I 5FLXC 2LTRA 1QU6A 1EA6A 2J7KA 1MU5A 3F0NA 4DKKA 2B9DA 4DV0E 4YHHE 3QT8A 1RREA 2DIXA 4JI3E 3ZKDA 1T4OA 1ZXNA 2Z5BA 4K0KE 2V2VA 2HK3A 4JI0I 1H73A 1H72C 1XNRE 4B3SI 1RC7A 4DR2I 4KZSA 1H7SA 4LF7E 4DU8A 4JI8I 1WXRA 2FTXB 3HXLA 3OTOI 2VQEI 4B3SE 1XNRI 1N0UA 1FKAE 4AQYI 4FWDA 1IBLI 4TUGA 2YZTA 4KQVA 2LRSA 2V8PA 2JVAA 4WPYA 4DR3E 4X66E 2LJHA 3ADGA 2R42A 3PYGA 3FIGA 4P78A 2H36X 1ZXMA 4DV2E 2RTXA 4BCAA 5AE1A 3OMLA 2ZM6E 1HNZE 1YZ9A 2KOUA 2M1SA 1N0VC 4X65I 2VF3A 1I94E 2VQFI 4HACB 2LBSB 2IHR1 4B3RI 2DB2A 2DMYA 2ODRD 2L92A 2AJ4A 4IZJA 2VF1A 1KIJA 3HQ1A 4M0VA 1KVKA 4DPXA 4DV3E 3LNUA 5A2QC 2B7TA 4DUYI 2LUPB 2F8BA 2WW4A 2JWOA 4DR1E 4R1FA 4DMIA 4OOGC 3ZZUA 4LF7I 4DV0I 3B78A 4JI4I 4K0KI 1FNMA 4KHPI 2E5LE 4LF6E 4DV6E 4DV4I 2EZ6A 2HK2A 3ADJA 2CG9A 3J7AM 1DARA 1PIEA 3B8HA 1U2RA 3PYFA 2E5LI 4FWHA 4DUZE 1N34E 1MX0A 5BR8I 1IBLE 2WZOA 3V5RA 4BMJA 2NA2A 2MDRA 3JAMC 5IWAI 2EWLA 3ADIA 1HR0E 1Z0TA 2X36A 5FWKA 4JI6I 4BC7A 5IT9C 1BKNA 1NZ0A 4PU9A 4P52A 2MC6A 4X65E 1KKHA 2O1UA 2V89A 1X47A 2CPNA 2R3VA 1ZM4A 1Z5AA 4NXMI 3AV0A 3VK6A 4L8NA 1FJGE 2A2CA 2V86A 4F54A 4LF8E 4DPYA 4DR6I 3ZZ0A 4GKJI 3HJCA 4Z7CA 1ELOA 2V8QB 4JV5I 2A2DA 2UU9E 5LMUI 2L3JA 3JAMQ 2LUQA 2GQ0A 1WHQA 2HKJA 3ZOQB 3J81C 4DV3I 3VYXA 2UXCE 2GS8A 4DV6I 2FV4B 1WUUA 3H4LA 2V88A 3PRYA 2XEXA 3WU6A 2UXDI 4I8OA 4GKKE 4IZJB 2CGEA 1HNWE 3F6GA 3K85A 3Q6NA 1XMQI 3ADLA 4YY3I 3MSWA 2RSMA 1A6FA 3JU0A 4M30A 2L2MA 4X62E 4P7AA 1J5EE 3AUZA 4DR7E 4R03A 2F4VI 4HACA 4LU9A 4DR4I 2UXBI 2L3CA 2E1RA 1J5EI 4JI1I 4ED4A 4OX9E 1HNXE 4DR7I 4N3OA 4TUIA 2V2ZA 2X7IA 1T4NA 3JTZA 4GKJE 2RS7A 4GEQB 4JV5E 4WSPA 1KTVA 1MG7A 3K17A 5AASA 4JG4A 5A2QQ 1EKZA 5GMDA 3HPSA 4JI2I 2V85A 4USKA 4JYAE 3QT7A 4DPWA 4DR2E 4F9AB 2JOBA 5IWAE 4IZKB 4B3TI 3ZM7A 1ZBTA 4LFBI 2RS6A 2Z5EA 4Z7YA 1IBMI 1HK7A 3J7AG 4J8ZA 1D6TA 1N33E 1NHIA 4DV1I 2B3TB 2ZM6I 1HNZI 5LL6R 2UUCI 1IBME 3QT6A 4LF5I 4NXNI 4BC9A 1RR9A 2LE2A 4FW9A 1ZM9A 1OJ4A 2F4VE 1X48A 4KHPE 4R8OA 1XMQE 4PRVA 2UUAE 1Z0GA 1J26A 1NHJA 4LFAI 4LF9I 2DSYA 2IOPA 2Z5CB 1T4LB 2ZITA 3ZZTA 2BM0A 4DR1I 4P7DA 1XMOE 1HR0I 4LFAE 1UEKA 2UXCI 3T1YE 2PNMA 2BV3A 3QT5A 2UXDE 4JI5E 2O1WA 1WHNA 4LFCE 2E1MA 4LTYA 2M7QA 4DR5I 1N36E 2HHHI 2HFUA 4WYQB 4DU7A 4JI7E 4YHHI 4DXLA 1H74A 2UUBE 4HY1A 2OI2A 1K47A 2K4VA 4B3ME 3J81Q 3Q6MA 2O1TA 4JI7I 1XHKA 1DQ3A 2L33A 4JI4E 3J7Yp 1Y6ZA 3T1HI 3OTOE 4FWGA 4I3HA 2L6MA 4LFBE 3LPSA 1N32E 1FWLA 2ZBKB 2L8TA 3LTOA 1O0WA 1DI2A 1FI4A 1N33I 2N3HA 3PYDA 2JOXA 1SR9A 3IWDA 5BR8E 4JI6E 3DF6A 3P06A 5CFFE 5IT9Q 1EI1A 2NUGA 1S4EA 2KONA 3D4JA 3GONA 4L5NC 2NPFA 1Z5BA 1QZRA 1STUA 4UT4A 4X62I 4DR3I 1RQ0A 4NXME 2V2QA 2NUEA 4URLA 5LMNI 4UTGA 2V87A 1N36I 2N3GA 2V34A 4DV1E 2VQFE 1YYOA 2LMZA 1I94I 1GQEA 2CZ9A 4LF8I 2L2KB 4DR6E 2BM1A 2JR1A 2G7HA 3ZKBA 4GKKI 1USVA 3F6HA 5LMNE 4DV7I 1IBKI 1B63A 1Z0VA 2VQEE 1PVGA 4WFTA 4F9CB 4ZVIA 2LJPA 2IOQA 2HFSA 3K1JA 4MYUA 2V83A 4DUYE 3IWBA 1Z5CA 1NHHA 1ZM2A 1Z0CA 2VE7C 1HNWI 4DV5I 1N32I 1XNQE 2L2NA 1Z0WA 4JYAI 2ODRC 4DV2I 2MC5A 2YT4A 3H09A 5DNYA 1XMOI 1S16A 4DV4E 3WU4A 3M6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B82 A;  4LFC I;  4X64 E;  4DR4 E;  4JI0 E;  2UXB E;  4DUZ I;  1N34 I;  2UUC E;  1YYW A;  1FWK A;  4JI1 E;  3WU5 A;  4EMD A;  2UUB I;  1H7U A;  4AQY E;  2B7V A;  1PKP A;  4B3T E;  1Z59 A;  4X66 I;  4FN5 A;  2Q2E B;  1FJG I;  5GME A;  1IBK E;  4MYT A;  1UHZ A;  3P1X A;  3VYY A;  3J80 Q;  5LMU E;  4JI2 E;  4HYM A;  4LF6 I;  4LF4 I;  4M1K A;  4JI8 E;  4M2Z A;  2UU9 I;  1Z0B A;  2HKE A;  4DV7 E;  1Z0E A;  3LLH A;  4LF4 E;  2UUA I;  2NUF A;  3PYE A;  4DPT A;  3V2U C;  4WUC A;  4B3M I;  4NXN E;  4XTJ A;  1VIS A;  2DEJ A;  5FLX Q;  4WUD A;  3C4B A;  4X8W A;  4DPU A;  4DV5 E;  4LF5 E;  3HUL A;  3Q1Q A;  1XNQ I;  4PRX A;  4HXZ A;  1UIL A;  3T1Y I;  3T1H E;  4YY3 E;  2EFG A;  4WUB A;  4LF9 E;  2DEI A;  3WU3 A;  3J80 C;  5L3J A;  3C4T A;  4B3R E;  1ZM3 A;  4X64 I;  1HNX I;  1B62 A;  1X49 A;  2LTS A;  3HTX A;  2KHX A;  4OX9 I;  4RPF A;  3CWV A;  4DR5 E;  2HHH E;  4USM A;  1YYK A;  2JY9 A;  4JI3 I;  4JI5 I;  5FLX C;  2LTR A;  1QU6 A;  1EA6 A;  2J7K A;  1MU5 A;  3F0N A;  4DKK A;  4DV0 E;  3QT8 A;  4YHH E;  1RRE A;  2DIX A;  4JI3 E;  3ZKD A;  1T4O A;  1ZXN A;  4K0K E;  2V2V A;  2HK3 A;  4JI0 I;  1H73 A;  1H72 C;  1XNR E;  4B3S I;  1RC7 A;  4DR2 I;  1H7S A;  4LF7 E;  4DU8 A;  4JI8 I;  3OTO I;  2VQE I;  4B3S E;  1XNR I;  1N0U A;  1FKA E;  4AQY I;  4FWD A;  1IBL I;  4KQV A;  2LRS A;  2V8P A;  2JVA A;  4DR3 E;  4X66 E;  2LJH A;  3ADG A;  2R42 A;  3PYG A;  1ZXM A;  4DV2 E;  2RTX A;  2ZM6 E;  1HNZ E;  1YZ9 A;  1N0V C;  4X65 I;  2VF3 A;  1I94 E;  2VQF I;  4HAC B;  2LBS B;  2IHR 1;  4B3R I;  2DB2 A;  2DMY A;  2AJ4 A;  1KIJ A;  1KVK A;  4DPX A;  4DV3 E;  3LNU A;  5A2Q C;  2B7T A;  4DUY I;  2LUP B;  2WW4 A;  4DR1 E;  4R1F A;  4OOG C;  3ZZU A;  4LF7 I;  4DV0 I;  3B78 A;  4JI4 I;  4K0K I;  1FNM A;  4KHP I;  2E5L E;  4LF6 E;  4DV6 E;  4DV4 I;  2EZ6 A;  2HK2 A;  3ADJ A;  3J7A M;  1DAR A;  1PIE A;  3B8H A;  1U2R A;  3PYF A;  2E5L I;  4FWH A;  4DUZ E;  1N34 E;  1MX0 A;  5BR8 I;  1IBL E;  3V5R A;  2NA2 A;  2MDR A;  3JAM C;  5IWA I;  3ADI A;  1HR0 E;  1Z0T A;  2X36 A;  4JI6 I;  1NZ0 A;  1BKN A;  4PU9 A;  5IT9 C;  4P52 A;  4X65 E;  1KKH A;  1X47 A;  2CPN A;  2R3V A;  1ZM4 A;  1Z5A A;  4NXM I;  1FJG E;  2A2C A;  4LF8 E;  4DPY A;  4DR6 I;  3ZZ0 A;  4GKJ I;  4Z7C A;  1ELO A;  4JV5 I;  2A2D A;  2UU9 E;  5LMU I;  2L3J A;  3JAM Q;  2LUQ A;  1WHQ A;  2HKJ A;  3J81 C;  4DV3 I;  3VYX A;  2UXC E;  2GS8 A;  4DV6 I;  1WUU A;  3H4L A;  3WU6 A;  2XEX A;  2UXD I;  4GKK E;  1HNW E;  1XMQ I;  3ADL A;  4YY3 I;  2RSM A;  1A6F A;  4M30 A;  2L2M A;  4X62 E;  4P7A A;  1J5E E;  4DR7 E;  2F4V I;  4HAC A;  4DR4 I;  2UXB I;  2L3C A;  2E1R A;  1J5E I;  4JI1 I;  4ED4 A;  4OX9 E;  1HNX E;  4DR7 I;  2V2Z A;  2X7I A;  1T4N A;  4GKJ E;  2RS7 A;  4JV5 E;  1KTV A;  1MG7 A;  3K17 A;  4JG4 A;  5A2Q Q;  1EKZ A;  5GMD A;  4JI2 I;  4USK A;  4JYA E;  3QT7 A;  4DPW A;  4DR2 E;  5IWA E;  4B3T I;  3ZM7 A;  1ZBT A;  4LFB I;  2RS6 A;  4Z7Y A;  1IBM I;  3J7A G;  1D6T A;  1N33 E;  1NHI A;  4DV1 I;  2B3T B;  2ZM6 I;  1HNZ I;  5LL6 R;  2UUC I;  1IBM E;  3QT6 A;  4LF5 I;  4NXN I;  1RR9 A;  4FW9 A;  1ZM9 A;  1OJ4 A;  2F4V E;  1X48 A;  4KHP E;  1XMQ E;  4PRV A;  2UUA E;  1Z0G A;  1J26 A;  1NHJ A;  4LFA I;  4LF9 I;  1T4L B;  2ZIT A;  3ZZT A;  2BM0 A;  4DR1 I;  1XMO E;  1HR0 I;  4LFA E;  1UEK A;  2UXC I;  3T1Y E;  2BV3 A;  3QT5 A;  2UXD E;  4JI5 E;  1WHN A;  4LFC E;  4DR5 I;  2HHH I;  1N36 E;  2HFU A;  4WYQ B;  4DU7 A;  4JI7 E;  4YHH I;  4DXL A;  1H74 A;  2UUB E;  4HY1 A;  2OI2 A;  1K47 A;  4B3M E;  3J81 Q;  4JI7 I;  1XHK A;  2L33 A;  4JI4 E;  3J7Y p;  3T1H I;  3OTO E;  4FWG A;  4I3H A;  4LFB E;  3LPS A;  1N32 E;  1FWL A;  2ZBK B;  3LTO A;  1O0W A;  1DI2 A;  1FI4 A;  1N33 I;  2N3H A;  3PYD A;  5BR8 E;  4JI6 E;  5CFF E;  5IT9 Q;  1EI1 A;  2NUG A;  1S4E A;  3D4J A;  3GON A;  2NPF A;  1Z5B A;  1QZR A;  1STU A;  4UT4 A;  4X62 I;  4DR3 I;  1RQ0 A;  4NXM E;  2V2Q A;  2NUE A;  4URL A;  5LMN I;  4UTG A;  1N36 I;  2N3G A;  2V34 A;  4DV1 E;  2VQF E;  1YYO A;  1I94 I;  1GQE A;  2CZ9 A;  4LF8 I;  2L2K B;  4DR6 E;  2BM1 A;  3ZKB A;  4GKK I;  5LMN E;  4DV7 I;  1IBK I;  1B63 A;  1Z0V A;  2VQE E;  1PVG A;  4WFT A;  4ZVI A;  2LJP A;  4MYU A;  2HFS A;  3K1J A;  4DUY E;  1Z5C A;  1NHH A;  1ZM2 A;  1Z0C A;  1HNW I;  4DV5 I;  1N32 I;  1XNQ E;  2L2N A;  1Z0W A;  4JYA I;  4DV2 I;  2YT4 A;  1XMO I;  1S16 A;  4DV4 E;  3WU4 A;  3M6A A; 
#chains in the Genus database with same CATH topology
 3B82 A;  2GO3 A;  2O1V A;  5KL2 A;  4U3D A;  4LFC I;  2JPA A;  4RH8 A;  4X64 E;  4JI0 E;  4DR4 E;  2UXB E;  4DUZ I;  1YUJ A;  2LCE A;  1N34 I;  1USU A;  2GO4 A;  2YTG A;  2UUC E;  1YYW A;  4JI1 E;  1FWK A;  3WU5 A;  4EMD A;  5C0X D;  2UUB I;  5AE2 A;  1Y4U A;  3HPZ A;  3U1K A;  4NBQ A;  4F6M A;  1H7U A;  2EN7 A;  2EOX A;  5F3W A;  4AQY E;  2CT1 A;  2EPN A;  1ZBQ A;  2B7V A;  2EPL X;  2EM4 A;  1YUI A;  1PKP A;  4B3T E;  2EM9 A;  1Z59 A;  4X66 I;  5T6J A;  3PS2 A;  3TQM A;  4FN5 A;  2Q2E B;  2PO1 A;  4IFD E;  3U1Y A;  4OO1 C;  1FJG I;  2EMX A;  1GZ6 A;  1IBK E;  5GME A;  4MYT A;  1OYS A;  1UHZ A;  3KZZ A;  2PO2 B;  3EPL A;  5EKW A;  3P1X A;  3VYY A;  1Y4S A;  5LMU E;  4FK5 C;  1G2F C;  4JI2 E;  2C38 A;  3J80 Q;  2ELY A;  1YSA C;  5AE3 A;  4HYM A;  4N4R B;  2RSI A;  1UDQ A;  4JI8 E;  5LLQ A;  4IZJ D;  4M1K A;  4LF4 I;  3LML A;  4M2Z A;  1EH6 A;  5AC4 A;  2UU9 I;  1Z0B A;  2HKE A;  1DGC A;  4F9B B;  4Q28 A;  3THO B;  4DV7 E;  2PNZ A;  1Z0E A;  3IWC A;  2PO2 A;  3LLH A;  4WXD A;  4BS9 A;  2EL6 A;  4LF4 E;  2GLI A;  4M9V C;  2UUA I;  2NUF A;  3RMP A;  3PYE A;  3V2U C;  4DPT A;  1PDA A;  2M4I A;  4WUC A;  4BBY A;  4B3M I;  1YHC A;  1N3G A;  4NXN E;  3L7Z B;  2DGC A;  4XTJ A;  1VIS A;  2DEJ A;  1BBO A;  5FLX Q;  2FGG A;  3C4B A;  4WUD A;  3K6Q A;  2EMH A;  4X8W A;  4DPU A;  4DV5 E;  4LF5 E;  3HUL A;  3Q1Q A;  4MU4 A;  4HEI A;  1ZAA C;  4MU0 A;  4PRX A;  1XNQ I;  2EOQ A;  2J65 A;  4HXZ A;  4KWY A;  1UIL A;  3GCM A;  4FW5 A;  4LCF A;  3T1Y I;  3T1H E;  2EPK X;  4O4K A;  1Z1B A;  5JEA B;  4YY3 E;  1NEI A;  1OYP A;  2HJJ A;  2EFG A;  4WUB A;  4LF9 E;  2DEI A;  2EOO A;  2JEA B;  3WU3 A;  3J80 C;  4R2D A;  5L3J A;  4IZK A;  4OO1 B;  3C4T A;  4LF6 I;  2WBS A;  4B3R E;  3DJW A;  2PNL A;  3BF2 A;  1ZM3 A;  3GLL A;  2BA0 G;  4X64 I;  1HNX I;  2EP3 A;  2Z5C A;  2PO1 B;  3M99 B;  1B62 A;  1X49 A;  2MKN A;  3B4T A;  1Y5Y A;  2LTS A;  3HTX A;  2KHX A;  4BA2 B;  4OX9 I;  3KWR A;  3CWV A;  4RPF A;  4DR5 E;  4ZYE A;  2HHH E;  1YYK A;  2E72 A;  2JY9 A;  2Z5B B;  4USM A;  4JI3 I;  5ADZ A;  3THN A;  1UDO A;  4JI5 I;  5FLX C;  2LTR A;  1QU6 A;  2ENH A;  4BHC A;  1EA6 A;  1MU5 A;  2J7K A;  4DKK A;  2PRT A;  2GHF A;  1E3P A;  3F0N A;  2LV2 A;  2B9D A;  1ZR9 A;  2AE8 A;  4IFD F;  2RPC A;  2EM6 A;  4DV0 E;  4YHH E;  3EPJ A;  2YPN A;  2DIX A;  2EJ4 A;  2EPO A;  4JI3 E;  1RRE A;  3QT8 A;  3ZKD A;  1T4O A;  1ZXN A;  2Z5B A;  4K0K E;  2V2V A;  2PO0 B;  2HK3 A;  4JI0 I;  1X6F A;  2EOJ A;  1H73 A;  1H72 C;  4U3B A;  4BA1 B;  5A6K A;  3BID A;  1XNR E;  4B3S I;  1RC7 A;  5EL9 A;  4DR2 I;  4KZS A;  1OYR A;  1H7S A;  1KJK A;  4LF7 E;  4DU8 A;  4JI8 I;  2EM5 A;  5JEA C;  1YPN A;  2DLK A;  4BHB A;  2FTX B;  3HXL A;  1WXR A;  3OTO I;  2VQE I;  1SFE A;  2HC5 A;  4B3S E;  5AC5 A;  1XNR I;  5KL3 A;  1N0U A;  1FKA E;  4AQY I;  4FWD A;  1IBL I;  4TUG A;  2YZT A;  4KQV A;  2LRS A;  2NN6 C;  3CDI A;  2YU5 A;  2V8P A;  2JVA A;  2GPI A;  4WPY A;  2C39 B;  5C0X A;  2Q8U A;  4DR3 E;  1X6E A;  1MEY C;  4X66 E;  4FW4 A;  4J3D A;  2EPA A;  2LJH A;  4QNJ A;  3ADG A;  2R42 A;  3PYG A;  2YTQ A;  2EMC A;  3FIG A;  2MKD A;  4P78 A;  2PNZ B;  2H36 X;  1UBD C;  2N8X A;  1ZXM A;  2EMY A;  4DV2 E;  3M7N G;  2YTJ A;  2JYA A;  2EN4 A;  2RTX A;  2BB8 A;  4BCA A;  2A25 A;  5AE1 A;  3EPK A;  3OML A;  2JT2 A;  2ZM6 E;  1HNZ E;  1YZ9 A;  5DRO A;  2EN2 A;  5K36 B;  1PJQ A;  3KZY A;  1X5W A;  2EL4 A;  2KOU A;  5K36 D;  2M1S A;  1N0V C;  2EOZ A;  4X65 I;  2JEB B;  2VF3 A;  1B69 A;  2EPX A;  1I94 E;  2VQF I;  4HAC B;  4ZYD A;  2LBS B;  2IHR 1;  2BR2 B;  4B3R I;  5JEA A;  2DB2 A;  2DMY A;  2ODR D;  3DD6 A;  4R2R A;  2L92 A;  2AJ4 A;  4IZJ A;  2VF1 A;  2YTF A;  1KIJ A;  3HQ1 A;  4M0V A;  1KVK A;  1P47 A;  2BA0 D;  4IFD D;  1PJT A;  4DPX A;  2IER A;  4DV3 E;  3LNU A;  3PS1 A;  4RHB B;  4R2S A;  5A2Q C;  2B7T A;  4DUY I;  2LUP B;  2F8B A;  2BA1 G;  2WCC 3;  2WW4 A;  1KYQ A;  3HKM A;  2JWO A;  4DR1 E;  4R1F A;  4DMI A;  4OOG C;  3ZZU A;  4LF7 I;  2JXP A;  4DV0 I;  2LJU A;  2YTO A;  3B78 A;  2EMA A;  5KL5 A;  2YRK A;  5JEA E;  4JI4 I;  4K0K I;  1YFH A;  1AH5 A;  2EOE A;  1TF6 A;  1FNM A;  2CVE A;  4KHP I;  2E5L E;  4MU1 A;  4LF6 E;  4DV6 E;  4DV4 I;  2EZ6 A;  2HK2 A;  2WP8 A;  5C0X E;  1G2D C;  3ADJ A;  4R2Q A;  2BA1 D;  1DAR A;  2CG9 A;  3J7A M;  2NN6 A;  2R76 A;  2EQ0 A;  4F2J C;  1PIE A;  3B8H A;  1U2R A;  3PYF A;  2E5L I;  4FWH A;  4DUZ E;  2DMI A;  1N34 E;  5JEA F;  1MX0 A;  5BR8 I;  1IBL E;  2WZO A;  3V5R A;  1ZU1 A;  4BMJ A;  2YRH A;  2NA2 A;  2MDR A;  3JAM C;  5IWA I;  2EE8 A;  2EWL A;  1TF3 A;  3ADI A;  1HR0 E;  2YRM A;  1Z0T A;  1A1G A;  2X36 A;  5FWK A;  4JI6 I;  4BC7 A;  2D9H A;  5IT9 C;  3BBG A;  4R2P A;  1BKN A;  4O24 A;  1NZ0 A;  4P52 A;  4PU9 A;  4BA2 A;  2MC6 A;  4X65 E;  1KKH A;  2O1U A;  2V89 A;  2C39 A;  1X47 A;  2CPN A;  5KL6 A;  2ELZ A;  2VES A;  2R3V A;  4OZE A;  5DNL A;  4IJD A;  2I9I A;  1ZM4 A;  1RHY A;  1Z5A A;  4OO1 D;  4NXM I;  3VK6 A;  2WBT A;  3AV0 A;  4L8N A;  1FJG E;  2A2C A;  4IS9 A;  1A1J A;  2EM7 A;  5IXM B;  2JE6 B;  2V86 A;  4FW7 A;  4F54 A;  4LOM A;  4GZN C;  4LF8 E;  4DPY A;  4DR6 I;  5K36 F;  3P3C A;  2K7I A;  5TSE A;  2EPC A;  5DNX A;  3ZZ0 A;  4GKJ I;  4MU3 A;  3HJC A;  4F6N A;  2RQL A;  4Z7C A;  1ELO A;  2V8Q B;  4JV5 I;  2J7J A;  2EN8 A;  2MDG A;  2PO0 A;  2A2D A;  2UU9 E;  1BBG A;  2BBG A;  5LMU I;  4AIM A;  2L3J A;  3JAM Q;  2LUQ A;  2GQ0 A;  1WHQ A;  2HKJ A;  3ZOQ B;  3EPH A;  3J81 C;  4MDT A;  2ENC A;  1IMU A;  4DV3 I;  3C6K A;  3VYX A;  2UXC E;  2GS8 A;  5JEA D;  4DV6 I;  2FV4 B;  1WUU A;  5A69 A;  2EMW A;  3H4L A;  3P76 A;  2V88 A;  3PRY A;  2I13 A;  1UDN A;  2XEX A;  3WU6 A;  2UXD I;  4I8O A;  2ADR A;  4GKK E;  4R2E A;  1R6M A;  4IZJ B;  2CGE A;  4GQU A;  1R6L A;  1HNW E;  3F6G A;  4R2A A;  3K85 A;  3Q6N A;  2EMI A;  1XMQ I;  3ADL A;  2NAB A;  2EN6 A;  4MLV A;  1L4S A;  4YY3 I;  3MSW A;  1F2I G;  1JK1 A;  2EPR A;  2RSM A;  4NHR A;  1WRJ A;  1A6F A;  3JU0 A;  2EOF A;  2JEA A;  4M30 A;  2L2M A;  4X62 E;  4OO1 F;  1WJP A;  4P7A A;  1J5E E;  4QNK A;  3UHM A;  5K36 A;  3BGH A;  2CTD A;  3AUZ A;  4DR7 E;  4R03 A;  2F4V I;  4O5G A;  4HAC A;  4LU9 A;  1UDS A;  4DR4 I;  2EOY A;  1GTK A;  2UXB I;  2NN6 F;  2L3C A;  2EOH A;  2E1R A;  1J5E I;  4JI1 I;  2C37 B;  4ED4 A;  4OX9 E;  1HNX E;  2YSO A;  4DR7 I;  2F1D A;  4WX9 A;  2LT7 A;  4N3O A;  2EL5 A;  5KL7 A;  4TUI A;  2V2Z A;  2YSP A;  2X7I A;  1T4N A;  1EH7 A;  2YTP A;  3JTZ A;  4GKJ E;  2RS7 A;  3GME A;  4GEQ B;  5K36 E;  4JV5 E;  4WSP A;  4FW3 A;  2EM2 A;  1KTV A;  1MG7 A;  3K17 A;  5AAS A;  4JG4 A;  5A2Q Q;  1EKZ A;  5GMD A;  3HPS A;  1A1L A;  2EQ3 A;  4JI2 I;  4X9J A;  1BB8 A;  3P3G A;  1E3H A;  2V85 A;  4USK A;  1A1I A;  5A6A A;  4ZYH A;  2M9A A;  4JYA E;  3QT7 A;  3M85 G;  2EMF A;  4DR2 E;  4DPW A;  2EM0 A;  4F9A B;  2JOB A;  5IWA E;  1AAY A;  4IZK B;  4OO1 A;  4B3T I;  4MQY A;  3ZM7 A;  1ZBT A;  2IES A;  2NN6 D;  2EM8 A;  4LFB I;  1YH8 A;  2RS6 A;  2Z5E A;  4Z7Y A;  1IBM I;  1HK7 A;  3J7A G;  4J8Z A;  1D6T A;  1N33 E;  1NHI A;  3QG5 C;  4DV1 I;  2B3T B;  2EPU A;  2ZM6 I;  1HNZ I;  4LPF A;  3C6M A;  2HGH A;  5LL6 R;  2UUC I;  1IBM E;  4Q35 B;  3QT6 A;  4AM3 A;  4LF5 I;  3CDJ A;  4NXN I;  4BC9 A;  1LLM C;  5C0X B;  1RR9 A;  2LE2 A;  3KRN A;  2YWQ A;  4FW9 A;  2YTI A;  1ZM9 A;  1OJ4 A;  1X6H A;  2F4V E;  1X48 A;  4KHP E;  5K36 C;  2EMK A;  3ECR A;  2CSH A;  4R8O A;  1XMQ E;  4PRV A;  2C37 A;  4FW6 A;  2UUA E;  1Z0G A;  3M7N D;  1J26 A;  5DRQ A;  2WBU A;  1NHJ A;  4LFA I;  2JP9 A;  4LF9 I;  3H1C A;  2EN3 A;  1P42 A;  2DSY A;  2IOP A;  2Z5C B;  4BA1 A;  1T4L B;  1MGT A;  1IQO A;  2ZIT A;  2LVH A;  3ZZT A;  2EPZ A;  4LCH A;  2BM0 A;  1RMD A;  4DR1 I;  5A6B A;  4P7D A;  1XMO E;  1HR0 I;  4LFA E;  1UEK A;  2UXC I;  4WXC A;  3T1Y E;  2YTN A;  2WP8 B;  2DLQ A;  2PNM A;  5A6B D;  2BV3 A;  3PS3 A;  3QT5 A;  2UXD E;  4JI5 E;  2O1W A;  3L7Z A;  4IFD B;  2O3Z A;  1WHN A;  2EQ1 A;  4LFC E;  2E1M A;  4LTY A;  2M7Q A;  4DR5 I;  1N36 E;  2HHH I;  2HFU A;  4WYQ B;  3UK3 C;  4JI7 E;  4DU7 A;  4DXL A;  4YHH I;  1H74 A;  2UUB E;  4HY1 A;  2OI2 A;  1K47 A;  1UN6 B;  2K4V A;  4B3M E;  3J81 Q;  4ZYG A;  3Q6M A;  4IS1 C;  1PJS A;  2O1T A;  4IFD A;  5IV8 B;  4O43 A;  4JI7 I;  2WNR A;  3MHS C;  2DRP A;  1XHK A;  2C38 B;  2EPP A;  2JEB A;  3P3E A;  1DQ3 A;  2L33 A;  4JI4 E;  1NCS A;  4HTG A;  3J7Y p;  1Y6Z A;  4NZV A;  4LCG A;  3OTO E;  3T1H I;  4FWG A;  4I3H A;  1QNT A;  2L6M A;  1T39 A;  5DRP A;  4LFB E;  2EN1 A;  1N32 E;  3LPS A;  1FWL A;  2YU8 A;  2ZBK B;  2L8T A;  3LTO A;  1O0W A;  1DI2 A;  1FI4 A;  5DRR A;  2VRD A;  1N33 I;  2N3H A;  3PYD A;  2EML A;  2EM3 A;  2WNR B;  2JOX A;  1SR9 A;  3IWD A;  5BR8 E;  2EOM A;  5C0X F;  4JI6 E;  1TN9 A;  3DF6 A;  1VI7 A;  2ENA A;  2EOR A;  3P06 A;  3M85 D;  5CFF E;  5IT9 Q;  1EI1 A;  2NUG A;  1S4E A;  4AID A;  2KON A;  3D4J A;  5C0X C;  4ISA A;  3GON A;  2EMZ A;  3NZK A;  4L5N C;  2NPF A;  1Y60 A;  1Z5B A;  1QZR A;  1STU A;  4UT4 A;  2EMB A;  4X62 I;  2BR2 A;  4DR3 I;  1XXE A;  1RQ0 A;  3L00 A;  4NXM E;  2V2Q A;  2NUE A;  1A1K A;  2JE6 A;  4URL A;  5LMN I;  4UTG A;  2V87 A;  4WSG A;  5ELW A;  1N36 I;  2N3G A;  2V34 A;  4DV1 E;  2VQF E;  1YYO A;  2LMZ A;  4R2C A;  1GQE A;  5A6J A;  2CZ9 A;  2NN6 B;  1I94 I;  2L2K B;  4DR6 E;  4LF8 I;  2BM1 A;  4OO1 E;  2JR1 A;  2EOS A;  2G7H A;  3ZKB A;  4GKK I;  1USV A;  3F6H A;  5LMN E;  2EMG A;  5KL4 A;  4DV7 I;  1IBK I;  3VHT B;  1IQS A;  1B63 A;  1Z0V A;  2VQE E;  1PVG A;  3MHH C;  4WFT A;  4F9C B;  4IFD C;  4ZVI A;  2LJP A;  2YTD A;  2IOQ A;  2EPM X;  2HFS A;  3K1J A;  2V83 A;  2YTE A;  4MYU A;  4DUY E;  3IWB A;  1A1H A;  1Z5C A;  1NHH A;  1ZM2 A;  1Z0C A;  1T38 A;  4OKG A;  2LO3 A;  2VE7 C;  3EQ1 A;  1X3C A;  4DV5 I;  1HNW I;  1N32 I;  2EOI A;  2NN6 E;  2R1F A;  1XNQ E;  1EH8 A;  2L2N A;  1Z0W A;  4JYA I;  2ODR C;  4DV2 I;  2MC5 A;  2YT4 A;  3H09 A;  1JK2 A;  5DNY A;  1XMO I;  1S16 A;  4DV4 E;  3WU4 A;  4MLQ A;  3M6A A;  1A1F A; 
#chains in the Genus database with same CATH homology
 3B82 A;  2O1V A;  4LFC I;  4X64 E;  4DR4 E;  4JI0 E;  2UXB E;  4DUZ I;  1N34 I;  1USU A;  2UUC E;  1YYW A;  1FWK A;  4JI1 E;  3WU5 A;  4EMD A;  2UUB I;  5AE2 A;  1Y4U A;  3HPZ A;  1H7U A;  5F3W A;  4AQY E;  1ZBQ A;  2B7V A;  1PKP A;  4B3T E;  1Z59 A;  4X66 I;  5T6J A;  4FN5 A;  2Q2E B;  1FJG I;  1GZ6 A;  1IBK E;  5GME A;  4MYT A;  1UHZ A;  3P1X A;  3VYY A;  1Y4S A;  5LMU E;  4JI2 E;  3J80 Q;  4HYM A;  5AE3 A;  4LF6 I;  4LF4 I;  4IZJ D;  4JI8 E;  4M1K A;  3LML A;  4M2Z A;  2UU9 I;  1Z0B A;  2HKE A;  4F9B B;  4Q28 A;  4DV7 E;  1Z0E A;  3IWC A;  3LLH A;  4BS9 A;  4LF4 E;  2UUA I;  2NUF A;  3RMP A;  3PYE A;  3V2U C;  4DPT A;  2M4I A;  4WUC A;  4BBY A;  4B3M I;  4NXN E;  4XTJ A;  1VIS A;  2DEJ A;  5FLX Q;  2FGG A;  3C4B A;  4WUD A;  3K6Q A;  4X8W A;  4DPU A;  4DV5 E;  4LF5 E;  3HUL A;  3Q1Q A;  1XNQ I;  4PRX A;  4HXZ A;  1UIL A;  3T1Y I;  3T1H E;  4YY3 E;  2EFG A;  4WUB A;  4LF9 E;  2DEI A;  3WU3 A;  3J80 C;  5L3J A;  4IZK A;  3C4T A;  4B3R E;  3DJW A;  2PNL A;  1ZM3 A;  4X64 I;  1HNX I;  2Z5C A;  1B62 A;  1X49 A;  2LTS A;  3HTX A;  2KHX A;  4OX9 I;  3KWR A;  3CWV A;  4RPF A;  4DR5 E;  2HHH E;  2Z5B B;  1YYK A;  4USM A;  2JY9 A;  4JI3 I;  5ADZ A;  4JI5 I;  5FLX C;  2LTR A;  1QU6 A;  1EA6 A;  2J7K A;  1MU5 A;  3F0N A;  4DKK A;  2B9D A;  4DV0 E;  4YHH E;  3QT8 A;  1RRE A;  2DIX A;  4JI3 E;  3ZKD A;  1T4O A;  1ZXN A;  2Z5B A;  4K0K E;  2V2V A;  2HK3 A;  4JI0 I;  1H73 A;  1H72 C;  1XNR E;  4B3S I;  1RC7 A;  4DR2 I;  4KZS A;  1H7S A;  4LF7 E;  4DU8 A;  4JI8 I;  1WXR A;  2FTX B;  3HXL A;  3OTO I;  2VQE I;  4B3S E;  1XNR I;  1N0U A;  1FKA E;  4AQY I;  4FWD A;  1IBL I;  4TUG A;  2YZT A;  4KQV A;  2LRS A;  2V8P A;  2JVA A;  4WPY A;  4DR3 E;  4X66 E;  2LJH A;  3ADG A;  2R42 A;  3PYG A;  3FIG A;  4P78 A;  2H36 X;  1ZXM A;  4DV2 E;  2RTX A;  4BCA A;  5AE1 A;  3OML A;  2ZM6 E;  1HNZ E;  1YZ9 A;  2KOU A;  2M1S A;  1N0V C;  4X65 I;  2VF3 A;  1I94 E;  2VQF I;  4HAC B;  2LBS B;  2IHR 1;  4B3R I;  2DB2 A;  2DMY A;  2ODR D;  2L92 A;  2AJ4 A;  4IZJ A;  2VF1 A;  1KIJ A;  3HQ1 A;  4M0V A;  1KVK A;  4DPX A;  4DV3 E;  3LNU A;  5A2Q C;  2B7T A;  4DUY I;  2LUP B;  2F8B A;  2WW4 A;  2JWO A;  4DR1 E;  4R1F A;  4DMI A;  4OOG C;  3ZZU A;  4LF7 I;  4DV0 I;  3B78 A;  4JI4 I;  4K0K I;  1FNM A;  4KHP I;  2E5L E;  4LF6 E;  4DV6 E;  4DV4 I;  2EZ6 A;  2HK2 A;  3ADJ A;  2CG9 A;  3J7A M;  1DAR A;  1PIE A;  3B8H A;  1U2R A;  3PYF A;  2E5L I;  4FWH A;  4DUZ E;  1N34 E;  1MX0 A;  5BR8 I;  1IBL E;  2WZO A;  3V5R A;  4BMJ A;  2NA2 A;  2MDR A;  3JAM C;  5IWA I;  2EWL A;  3ADI A;  1HR0 E;  1Z0T A;  2X36 A;  5FWK A;  4JI6 I;  4BC7 A;  5IT9 C;  1BKN A;  1NZ0 A;  4PU9 A;  4P52 A;  2MC6 A;  4X65 E;  1KKH A;  2O1U A;  2V89 A;  1X47 A;  2CPN A;  2R3V A;  1ZM4 A;  1Z5A A;  4NXM I;  3AV0 A;  3VK6 A;  4L8N A;  1FJG E;  2A2C A;  2V86 A;  4F54 A;  4LF8 E;  4DPY A;  4DR6 I;  3ZZ0 A;  4GKJ I;  3HJC A;  4Z7C A;  1ELO A;  2V8Q B;  4JV5 I;  2A2D A;  2UU9 E;  5LMU I;  2L3J A;  3JAM Q;  2LUQ A;  2GQ0 A;  1WHQ A;  2HKJ A;  3ZOQ B;  3J81 C;  4DV3 I;  3VYX A;  2UXC E;  2GS8 A;  4DV6 I;  2FV4 B;  1WUU A;  3H4L A;  2V88 A;  3PRY A;  2XEX A;  3WU6 A;  2UXD I;  4I8O A;  4GKK E;  4IZJ B;  2CGE A;  1HNW E;  3F6G A;  3K85 A;  3Q6N A;  1XMQ I;  3ADL A;  4YY3 I;  3MSW A;  2RSM A;  1A6F A;  3JU0 A;  4M30 A;  2L2M A;  4X62 E;  4P7A A;  1J5E E;  3AUZ A;  4DR7 E;  4R03 A;  2F4V I;  4HAC A;  4LU9 A;  4DR4 I;  2UXB I;  2L3C A;  2E1R A;  1J5E I;  4JI1 I;  4ED4 A;  4OX9 E;  1HNX E;  4DR7 I;  4N3O A;  4TUI A;  2V2Z A;  2X7I A;  1T4N A;  3JTZ A;  4GKJ E;  2RS7 A;  4GEQ B;  4JV5 E;  4WSP A;  1KTV A;  1MG7 A;  3K17 A;  5AAS A;  4JG4 A;  5A2Q Q;  1EKZ A;  5GMD A;  3HPS A;  4JI2 I;  2V85 A;  4USK A;  4JYA E;  3QT7 A;  4DPW A;  4DR2 E;  4F9A B;  2JOB A;  5IWA E;  4IZK B;  4B3T I;  3ZM7 A;  1ZBT A;  4LFB I;  2RS6 A;  2Z5E A;  4Z7Y A;  1IBM I;  1HK7 A;  3J7A G;  4J8Z A;  1D6T A;  1N33 E;  1NHI A;  4DV1 I;  2B3T B;  2ZM6 I;  1HNZ I;  5LL6 R;  2UUC I;  1IBM E;  3QT6 A;  4LF5 I;  4NXN I;  4BC9 A;  1RR9 A;  2LE2 A;  4FW9 A;  1ZM9 A;  1OJ4 A;  2F4V E;  1X48 A;  4KHP E;  4R8O A;  1XMQ E;  4PRV A;  2UUA E;  1Z0G A;  1J26 A;  1NHJ A;  4LFA I;  4LF9 I;  2DSY A;  2IOP A;  2Z5C B;  1T4L B;  2ZIT A;  3ZZT A;  2BM0 A;  4DR1 I;  4P7D A;  1XMO E;  1HR0 I;  4LFA E;  1UEK A;  2UXC I;  3T1Y E;  2PNM A;  2BV3 A;  3QT5 A;  2UXD E;  4JI5 E;  2O1W A;  1WHN A;  4LFC E;  2E1M A;  4LTY A;  2M7Q A;  4DR5 I;  1N36 E;  2HHH I;  2HFU A;  4WYQ B;  4DU7 A;  4JI7 E;  4YHH I;  4DXL A;  1H74 A;  2UUB E;  4HY1 A;  2OI2 A;  1K47 A;  2K4V A;  4B3M E;  3J81 Q;  3Q6M A;  2O1T A;  4JI7 I;  1XHK A;  1DQ3 A;  2L33 A;  4JI4 E;  3J7Y p;  1Y6Z A;  3T1H I;  3OTO E;  4FWG A;  4I3H A;  2L6M A;  4LFB E;  3LPS A;  1N32 E;  1FWL A;  2ZBK B;  2L8T A;  3LTO A;  1O0W A;  1DI2 A;  1FI4 A;  1N33 I;  2N3H A;  3PYD A;  2JOX A;  1SR9 A;  3IWD A;  5BR8 E;  4JI6 E;  3DF6 A;  3P06 A;  5CFF E;  5IT9 Q;  1EI1 A;  2NUG A;  1S4E A;  2KON A;  3D4J A;  3GON A;  4L5N C;  2NPF A;  1Z5B A;  1QZR A;  1STU A;  4UT4 A;  4X62 I;  4DR3 I;  1RQ0 A;  4NXM E;  2V2Q A;  2NUE A;  4URL A;  5LMN I;  4UTG A;  2V87 A;  1N36 I;  2N3G A;  2V34 A;  4DV1 E;  2VQF E;  1YYO A;  2LMZ A;  1I94 I;  1GQE A;  2CZ9 A;  4LF8 I;  2L2K B;  4DR6 E;  2BM1 A;  2JR1 A;  2G7H A;  3ZKB A;  4GKK I;  1USV A;  3F6H A;  5LMN E;  4DV7 I;  1IBK I;  1B63 A;  1Z0V A;  2VQE E;  1PVG A;  4WFT A;  4F9C B;  4ZVI A;  2LJP A;  2IOQ A;  2HFS A;  3K1J A;  4MYU A;  2V83 A;  4DUY E;  3IWB A;  1Z5C A;  1NHH A;  1ZM2 A;  1Z0C A;  2VE7 C;  1HNW I;  4DV5 I;  1N32 I;  1XNQ E;  2L2N A;  1Z0W A;  4JYA I;  2ODR C;  4DV2 I;  2MC5 A;  2YT4 A;  3H09 A;  5DNY A;  1XMO I;  1S16 A;  4DV4 E;  3WU4 A;  3M6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...