4B3TE

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3tE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3tE02
4DR6E 4X62E 4DV3E 1S16A 3H4LA 4LF8I 1I94I 5IT9C 1MU5A 4WYQB 4EMDA 4UTGA 3ZKBA 3CWVA 1H74A 4ZVIA 1XMQI 2A2DA 1DI2A 2OI2A 1KTVA 2LBSB 4DXLA 2DIXA 2HFSA 1FI4A 1N0VC 2UXBI 3B78A 4NXMI 4DPXA 4LF8E 2R42A 4LFCI 1HNWE 4DR4E 4DPYA 1RR9A 4JYAI 1Z5CA 5LL6R 1X49A 3V5RA 4DV5I 1XMQE 1EI1A 3B82A 1KKHA 3ZM7A 4DV6I 3ADLA 3K17A 4AQYE 1XNRE 5IT9Q 4FN5A 1KIJA 3VYXA 4B3TI 4FWDA 3QT8A 3LLHA 4DR7I 4KHPE 4X8WA 5L3JA 1GQEA 1X47A 1ZM2A 3OTOI 3ADGA 4DV5E 4DUYI 2ZM6I 5IWAE 4JI3I 5CFFE 5BR8E 2NUFA 2AJ4A 4DPTA 1N33I 1YYWA 1N32I 2BM1A 5FLXC 2UXCE 4JI1I 1YYOA 2HKJA 3PYDA 1NHJA 4DR3I 4DR7E 2HK3A 3C4BA 2N3GA 1B63A 4PRVA 1Z59A 3OTOE 4URLA 3QT6A 4B3MI 4B3SE 4KQVA 2UUCI 2UXDI 4LF4I 2ZM6E 3HULA 1IBME 1Z5AA 1VISA 1XHKA 4HACB 1S4EA 2E5LI 1H7UA 2VQEE 2UU9E 3LTOA 4JV5I 4DR3E 4DV7I 1MX0A 4YHHI 1ZM3A 1FJGE 5GMEA 2V8PA 2LJHA 1QZRA 4LFAE 2UUCE 2UXDE 2R3VA 2HKEA 2XEXA 1T4LB 3PYGA 2ZITA 4DV0I 1X48A 4WUCA 2E5LE 4DR5I 4JI8I 5LMNI 1EA6A 4X66I 3F0NA 4DV7E 2B7VA 4X64I 2L33A 3QT7A 2BV3A 1PVGA 2L3JA 1UEKA 4DV1I 1Z0EA 3M6AA 4DU7A 4USKA 4JI0I 1IBKI 4DR1E 1WUUA 4LFBI 4DU8A 1FWLA 2B3TB 4OX9I 2Q2EB 1IBLI 2HHHI 2GS8A 4DV0E 1OJ4A 1NHHA 4JG4A 3QT5A 4JI8E 1I94E 3WU6A 4DPUA 4GKJI 3P1XA 2UUAI 3ADIA 4NXNI 2UUBI 2KHXA 1XNQI 4DV1E 1ZM4A 4FWHA 2NPFA 2NA2A 2RTXA 4WFTA 4Z7YA 1IBLE 1WHNA 1PKPA 2UXBE 2LJPA 4M30A 4B3RI 4NXME 3GONA 3K1JA 1UHZA 4LFCE 4GKJE 2UUAE 4JYAE 2LTRA 2E1RA 4FWGA 1XMOI 1Z0GA 1ZXNA 3T1YI 1B62A 2HK2A 2DB2A 4DV6E 1Z0CA 4JI2I 2A2CA 2LUPB 4R1FA 4LF9I 4B3TE 2ZBKB 3T1HI 2X36A 4X65I 4DV4I 1PIEA 2NUEA 1YYKA 4DUYE 1QU6A 1FWKA 2J7KA 4JI3E 4YY3I 2V2ZA 1N33E 4FW9A 1N32E 3T1YE 3J81C 1J5EI 1HNXI 3ZKDA 1HR0I 2L2NA 4JI2E 3WU5A 4JI1E 2IHR1 1Z0WA 3ZZ0A 3C4TA 4DV2I 4JI7I 3LPSA 1STUA 3J7AG 3Q1QA 4DUZI 3T1HE 4X65E 2RS6A 4DV4E 3HTXA 4K0KI 4HY1A 4B3ME 4LF4E 3PYFA 4YY3E 2F4VI 4M2ZA 2L2MA 4DR2I 2VF3A 4DR6I 4DKKA 4DV3I 1J5EE 1HR0E 4RPFA 4LF7I 2EFGA 4JV5E 1T4NA 4YHHE 4DUZE 1FNMA 1BKNA 1RC7A 1Z5BA 2BM0A 1D6TA 3J7Yp 4LF6I 2F4VE 1Z0TA 2MDRA 3J81Q 1ZM9A 5LMUI 1HNWI 1UILA 4DR4I 2RSMA 4DR5E 4OOGC 5LMNE 4LF7E 4DPWA 1KVKA 4X66E 1YZ9A 4X64E 4PU9A 4PRXA 2LTSA 1A6FA 1N36I 4JI4I 3JAMC 1IBKE 4JI0E 4LF6E 2HFUA 4P52A 1T4OA 3VYYA 4P7AA 2V34A 4LFBE 4AQYI 1XNRI 5LMUE 4OX9E 2HHHE 1K47A 4MYTA 4KHPI 1H7SA 1ZXMA 1HNZI 4HYMA 4NXNE 5A2QC 4GKKI 3ADJA 1N36E 2UUBE 5IWAI 1EKZA 5BR8I 4JI5I 4LF5I 3ZZTA 1XNQE 2LRSA 4JI4E 3WU3A 4UT4A 4M1KA 4JI6I 2V2VA 2UXCI 2DEJA 1Z0BA 1DARA 1H73A 2N3HA 4B3RE 1RREA 2DMYA 4WUDA 5GMDA 4I3HA 2CZ9A 1HNZE 2L3CA 2EZ6A 4XTJA 3J80C 4B3SI 1NZ0A 4GKKE 4Z7CA 3V2UC 4HXZA 4JI5E 1IBMI 4LF5E 3JAMQ 1N34I 2B7TA 2V2QA 2DEIA 1FKAE 2VQFI 4JI6E 1XMOE 2VQEI 2UU9I 1U2RA 1NHIA 4LF9E 1ZBTA 1FJGI 4USMA 5A2QQ 4LFAI 3LNUA 4WUBA 1RQ0A 2JY9A 2WW4A 1N34E 1J26A 2NUGA 2VQFE 4ED4A 2L2KB 4X62I 1H72C 2JVAA 1HNXE 1O0WA 1MG7A 4JI7E 4DV2E 1N0UA 3PYEA 1ELOA 3J7AM 3B8HA 4MYUA 3J80Q 2CPNA 3D4JA 4HACA 4K0KE 2LUQA 4DR1I 3ZZUA 2X7IA 3WU4A 5FLXQ 1Z0VA 2RS7A 1WHQA 2YT4A 4DR2E
chains in the Genus database with same CATH superfamily
4F54A 4DR6E 2JOBA 4X62E 4FW4A 4DV3E 1S16A 3H4LA 4LF8I 3VK6A 1I94I 5IT9C 1MU5A 4WYQB 5F3WA 4EMDA 4F6NA 2YTQA 2J7JA 4MU3A 1NCSA 4UTGA 5JEAE 3ZKBA 3MHSC 4O4KA 4GZNC 1H74A 3CWVA 1PDAA 4ZVIA 2EMKA 1XMQI 2G7HA 1A1KA 1DI2A 2A2DA 2OI2A 1KYQA 1KTVA 2KOUA 2LBSB 2DIXA 4DXLA 2EOJA 2HFSA 1FI4A 1N0VC 1MGTA 2ADRA 1F2IG 2NABA 2YSPA 4WSPA 2EN2A 2UXBI 2O1TA 2RSIA 3B78A 4R2AA 2C39B 3DD6A 3WU5A 2JEBA 4NXMI 4J8ZA 1E3HA 4LF8E 4DPXA 2R42A 4LFCI 1HNWE 2PRTA 4DR4E 2V8QB 2JE6B 2O1WA 4DPYA 2K7IA 3C6MA 1RR9A 3PS2A 5EL9A 4GQUA 1Z5CA 4JYAI 3HQ1A 1Z1BA 1VI7A 5LL6R 2PO2B 1X49A 3V5RA 4BA1A 1XMQE 4DV5I 2YU5A 4IS9A 3P3EA 2EOEA 3K6QA 4TUGA 2C39A 1EI1A 2EP3A 4BC7A 3Q6MA 4R2QA 3B82A 4LOMA 1KKHA 2EMXA 2EOYA 3ZM7A 4DV6I 2IESA 3ADLA 1RMDA 3GLLA 5KL6A 2LCEA 4AQYE 3CDIA 4LTYA 4R2DA 3K17A 3M7ND 1XNRE 4MU0A 1AH5A 2ENCA 3M7NG 5IT9Q 4FN5A 2MKDA 1KIJA 3VYXA 2F1DA 4B3TI 4O5GA 3QT8A 3LLHA 4FWDA 4DR7I 4WPYA 4KHPE 4X8WA 2V89A 5L3JA 3THNA 2EOMA 4IZJD 1GQEA 3M99B 1X47A 2V87A 4F2JC 1YPNA 5AC4A 5IV8B 1ZM2A 3OTOI 3P3CA 3ADGA 4DV5E 4DUYI 2ZM6I 4R2PA 5IWAE 4JI3I 5CFFE 2YRMA 2Z5CA 5BR8E 2EMHA 2NUFA 2C38A 4LCHA 2AJ4A 4DPTA 1N33I 1YYWA 5KL4A 1N32I 2BM1A 2WNRB 4OO1F 5FLXC 5DRRA 2UXCE 3P3GA 3P76A 4JI1I 2DSYA 1YYOA 2HKJA 5KL7A 3IWDA 2A25A 2E1MA 5K36B 3PYDA 4P52A 1DQ3A 1NHJA 4JI7I 4DR3I 2M9AA 5DNYA 4DR7E 4IFDF 4L8NA 2YPNA 4F9CB 2GPIA 2V88A 3DJWA 2HK3A 3C4BA 2N3GA 1B63A 5AASA 2EM9A 4OZEA 4PRVA 5JEAF 1Z59A 3OTOE 4URLA 3QT6A 4B3MI 1IQSA 4P78A 4B3SE 4MU4A 4KQVA 2UUCI 2UXDI 1HK7A 4LF4I 2EPRA 2ZM6E 3JU0A 3HULA 4OO1B 1RHYA 4IZKA 1EH7A 1IBME 3HPZA 2PNMA 1Z5AA 3U1KA 2D9HA 2BA1D 3P06A 2EL4A 1VISA 1XHKA 1Y4UA 4Q28A 4HACB 1S4EA 5ADZA 2PNLA 1DGCA 2E5LI 2FV4B 4R8OA 1H7UA 4IFDB 2VQEE 1PJTA 2C37A 2EPMX 2UU9E 2WCC3 1JK2A 3U1YA 3LTOA 4Q35B 2JWOA 2PNZB 4DR3E 1XXEA 4JV5I 2CTDA 4DV7I 5K36C 1MX0A 4YHHI 3KWRA 2V86A 1ZM3A 4OO1A 1FJGE 5GMEA 2V8PA 2LJHA 4O24A 1OYPA 2V85A 1QZRA 4WSGA 4LFAE 1BBOA 2UUCE 2UXDE 3L7ZA 2R3VA 3HKMA 2VE7C 4WX9A 2HKEA 4IFDA 2XEXA 1T4LB 3RMPA 3PYGA 1A1LA 2L6MA 2ZITA 4LPFA 4OO1C 5JEAA 1G2FC 4DV0I 2L92A 4U3BA 1X48A 4WUCA 2E5LE 5A6KA 4DR5I 4JI8I 5LMNI 1T38A 1EA6A 1JK1A 4IFDC 4ZYHA 4X66I 3F0NA 4DV7E 2EPAA 2B7VA 3EPHA 2NN6E 4X64I 2PO1A 2PO0A 2HJJA 2M4IA 2L33A 2EN7A 4X9JA 3QT7A 2BV3A 2JEBB 5IXMB 1PVGA 2L3JA 1UEKA 2F8BA 2BBGA 4DV1I 1Z0EA 3M6AA 4DU7A 2EOXA 4USKA 4JI0I 4RHBB 4DR1E 2WBSA 1UDQA 1IBKI 1WUUA 4AIMA 4LFBI 2EQ3A 3HPSA 3ZOQB 4DU8A 1FWLA 4BA1B 2B3TB 4OX9I 5K36D 2Q2EB 1IBLI 2HHHI 4DMIA 2GS8A 4DV0E 1OJ4A 1NHHA 2FGGA 4JG4A 4ZYDA 1KJKA 3QT5A 2H36X 4JI8E 1UN6B 1I94E 2NN6D 3WU6A 2EPPA 4DPUA 2WP8B 5C0XF 4GKJI 1PJQA 3P1XA 2UUAI 3ADIA 1BBGA 4NXNI 2UUBI 5A6BA 1YUJA 1YH8A 2KHXA 4M9VC 3FIGA 4U3DA 1E3PA 4R2CA 1XNQI 4DV1E 1ZM4A 4FWHA 2NPFA 1X6FA 2NA2A 2RTXA 2EPXA 4WFTA 1IQOA 3EPKA 2EL6A 2WP8A 4Z7YA 3DF6A 1USVA 2YTJA 3BGHA 4MLQA 1WHNA 1IBLE 1USUA 1PKPA 3AUZA 1GTKA 2UXBE 4I8OA 2LJPA 5C0XB 1UDSA 4M30A 2Z5CB 4B3RI 4BA2A 2ODRC 1YUIA 4NXME 2C38B 3B4TA 2EN8A 2LV2A 4R2SA 4ISAA 3M85D 3GONA 4BCAA 3K1JA 1UHZA 2LE2A 4LFCE 4NBQA 2JP9A 3M85G 4GKJE 1TF6A 5DRPA 2EMLA 2YZTA 2UUAE 2EMAA 2VRDA 1B69A 1R6LA 4FK5C 2EQ0A 4JYAE 1IMUA 4P7DA 2LTRA 2E1RA 4BMJA 3KZYA 3VHTB 4NHRA 1G2DC 1YHCA 4FWGA 5C0XA 4MU1A 2EN3A 5DNXA 2DRPA 3TQMA 1R6MA 2JR1A 4N3OA 1A1IA 3NZKA 1XMOI 2L8TA 2EOOA 1Z0GA 1ZXNA 3T1YI 2RQLA 2LVHA 1B62A 2HK2A 2DB2A 4DV6E 1A1GA 1Z0CA 4JI2I 2A2CA 2EM8A 2LUPB 1UBDC 2IOPA 4FW5A 2EOHA 4R1FA 2N8XA 4IZKB 4AM3A 2EPOA 4LF9I 4B3TE 5C0XC 5KL3A 2ZBKB 3T1HI 4BHBA 3KRNA 2X36A 4X65I 1EH6A 2DGCA 4DV4I 2EM5A 2EOIA 4F9BB 2BA0D 3MSWA 4KWYA 1PIEA 2C37B 2EMIA 2BA0G 2NUEA 3HXLA 4QNKA 4LCFA 3UK3C 2YRKA 1YYKA 4DUYE 1QU6A 4IJDA 5AE2A 2EN6A 1FWKA 4JI3E 2J7KA 4YY3I 2YWQA 1X5WA 2EN4A 2ENHA 2ODRD 2V2ZA 3H1CA 1N33E 4FW9A 1N32E 4LU9A 3T1YE 1X6EA 3J81C 1X6HA 1J5EI 3ZKDA 1EH8A 2BA1G 1HNXI 2L2NA 4TUIA 4JI2E 2LJUA 3C6KA 2IHR1 4JI1E 2WZOA 3C4TA 1Z0WA 2EMCA 4F9AB 3ZZ0A 3GMEA 3LPSA 2EOSA 1STUA 2BR2B 1N3GA 3J7AG 5JEAB 2O1UA 2M1SA 3PS1A 3T1HE 4DUZI 3Q1QA 2YTOA 4X65E 1UDNA 2RS6A 4L5NC 5LLQA 4DV4E 1AAYA 2EM6A 2EMGA 3HTXA 4K0KI 4HY1A 4B3ME 2AE8A 4LF4E 4DV2I 3PYFA 2M7QA 2PO1B 4YY3E 3EPLA 2F4VI 5KL5A 2PO0B 4M2ZA 2L2MA 2BR2A 2LT7A 1OYRA 2MDGA 2EM7A 2VF3A 2DMIA 4DKKA 4DR2I 2DLQA 2GHFA 4DV3I 1J5EE 4DR6I 1A1FA 1HR0E 1PJSA 3JTZA 5K36E 2EM0A 2CGEA 4RPFA 1LLMC 2Z5BB 2BB8A 5A6AA 3OMLA 4LF7I 2GLIA 2YSOA 2EFGA 4JV5E 1T4NA 3THOB 4YHHE 4DUZE 1FNMA 1HR0I 2EMYA 1BKNA 3L00A 1RC7A 5JEAC 2EMFA 3L7ZB 1YSAC 1Z5BA 2EN1A 1GZ6A 3Q6NA 1TN9A 2BM0A 2VESA 3K85A 4OO1E 4FW6A 3J7Yp 1D6TA 5DNLA 4LF6I 4RH8A 2Z5BA 2F4VE 1Z0TA 4GEQB 4ZYGA 2MDRA 3J81Q 1Y60A 2JEAA 2CSHA 5EKWA 4F6MA 2EPLX 2ELZA 1ZM9A 4QNJA 5LMUI 4IZJA 4IFDE 1HNWI 1UILA 4DR4I 3EPJA 1Y4SA 2RSMA 2R1FA 2KONA 4DR5E 1SR9A 4OOGC 2EQ1A 2YTNA 5LMNE 2HGHA 4LF7E 4DPWA 4WXCA 1KVKA 4X66E 2DLKA 1YZ9A 4X64E 1NEIA 4PU9A 4PRXA 2IERA 2LTSA 1A6FA 1N36I 2EMZA 4BA2B 3IWCA 2EM2A 3BBGA 2GO4A 4LCGA 1UDOA 4OO1D 5AE3A 2EPCA 1P47A 4BS9A 4JI4I 3JAMC 1TF3A 1IBKE 4JI0E 4MLVA 4LF6E 1Y5YA 2HFUA 2EORA 1T4OA 2MC6A 3VYYA 2CG9A 4LFBE 2IOQA 2V34A 2EPKX 4P7AA 2EOQA 4AQYI 1XNRI 4IFDD 2JYAA 5LMUE 4OX9E 2HHHE 2EMBA 3CDJA 1K47A 4IS1C 4FW7A 2VF1A 4J3DA 4MYTA 1SFEA 5JEAD 4WXDA 4KHPI 1ZU1A 3LMLA 5A69A 1H7SA 1MEYC 1ZXMA 2ELYA 2RPCA 1Y6ZA 3GCMA 4HYMA 1HNZI 1A1HA 4NXNE 5A2QC 4GKKI 3ADJA 1N36E 2E72A 3MHHC 3IWBA 2UUBE 5IWAI 1EKZA 5BR8I 4JI5I 2O1VA 1T39A 2WBUA 3ZZTA 1XNQE 4LF5I 2LRSA 2YTPA 4JI4E 3WU3A 4UT4A 5AE1A 2JE6A 4M1KA 4JI6I 2V2VA 2UXCI 2DEJA 2B9DA 1Z0BA 2PO2A 3PS3A 2YU8A 2EPNA 1DARA 3BIDA 2EE8A 1H73A 2N3HA 4B3RE 1RREA 2DMYA 2JXPA 1YFHA 4NZVA 4WUDA 5GMDA 1WJPA 5K36F 2YTEA 4I3HA 2CZ9A 2YTGA 1HNZE 2L3CA 3J80C 2EZ6A 4XTJA 4B3SI 4BC9A 3KZZA 1NZ0A 2NN6F 4R2RA 1ZAAC 4GKKE 2EJ4A 4HEIA 4Z7CA 3V2UC 4HXZA 1OYSA 4JI5E 2EWLA 1IBMI 4LF5E 3JAMQ 5A6BD 1A1JA 1N34I 2B7TA 2V2QA 4R2EA 2DEIA 3F6GA 1FKAE 2VQFI 2K4VA 2LMZA 3BF2A 4OKGA 2MC5A 2WBTA 4R03A 4JI6E 5ELWA 1WXRA 1XMOE 2YTDA 2VQEI 2YRHA 2YTIA 2EMWA 4M0VA 2UU9I 5C0XE 2ENAA 1U2RA 1L4SA 2YTFA 1NHIA 3UHMA 3F6HA 3H09A 5T6JA 5A6JA 4LF9E 1ZBTA 2NN6B 2EOZA 2GQ0A 1FJGI 2EL5A 2I13A 4USMA 1ZBQA 5A2QQ 2Z5EA 2EM3A 1P42A 4LFAI 1QNTA 2CT1A 2JOXA 5AC5A 2WNRA 3LNUA 4WUBA 1RQ0A 2Q8UA 3ECRA 2JY9A 5K36A 4FW3A 2WW4A 1N34E 4BHCA 1J26A 2EOFA 2NUGA 2VQFE 3EQ1A 2V83A 4ED4A 2MKNA 2NN6A 2JPAA 2GO3A 5C0XD 2L2KB 1BB8A 1WRJA 4X62I 1H72C 3AV0A 2JVAA 1HNXE 1O0WA 2I9IA 4KZSA 1MG7A 4JI7E 4DV2E 2CVEA 1N0UA 3PRYA 3PYEA 5FWKA 4HTGA 4O43A 1ELOA 2JEAB 3J7AM 4MDTA 3B8HA 4MYUA 2EPZA 3J80Q 2FTXB 2CPNA 2NN6C 5DRQA 4BBYA 4IZJB 3D4JA 3QG5C 4HACA 4ZYEA 3HJCA 4MQYA 4AIDA 2HC5A 1ZR9A 2EPUA 4K0KE 2LUQA 4DR1I 2J65A 3ZZUA 1X3CA 2X7IA 5KL2A 3WU4A 2EM4A 5TSEA 5FLXQ 4N4RB 2PNZA 5DROA 2LO3A 1Z0VA 2JT2A 2RS7A 1WHQA 2R76A 2YT4A 2O3ZA 4DR2E
chains in the Genus database with same CATH topology
4F54A 4DR6E 2JOBA 4X62E 4DV3E 1S16A 3H4LA 4LF8I 3VK6A 1I94I 5IT9C 1MU5A 4WYQB 5F3WA 4EMDA 4UTGA 3ZKBA 3CWVA 1H74A 4ZVIA 1XMQI 2G7HA 2A2DA 1DI2A 2OI2A 1KTVA 2KOUA 2LBSB 2DIXA 4DXLA 2HFSA 1FI4A 1N0VC 4WSPA 2UXBI 2O1TA 3B78A 4NXMI 4J8ZA 4DPXA 4LF8E 2R42A 4LFCI 1HNWE 4DR4E 2V8QB 2O1WA 4DPYA 1RR9A 4JYAI 1Z5CA 3HQ1A 5LL6R 1X49A 3V5RA 4DV5I 1XMQE 3K6QA 4TUGA 1EI1A 4BC7A 3Q6MA 3B82A 1KKHA 3ZM7A 4DV6I 3ADLA 3K17A 4AQYE 4LTYA 1XNRE 5IT9Q 4FN5A 1KIJA 3VYXA 4B3TI 4FWDA 3QT8A 3LLHA 4DR7I 4WPYA 4KHPE 4X8WA 2V89A 5L3JA 4IZJD 1GQEA 1X47A 2V87A 1ZM2A 3OTOI 3ADGA 4DV5E 4DUYI 2ZM6I 5IWAE 4JI3I 5CFFE 2Z5CA 5BR8E 2NUFA 2AJ4A 4DPTA 1N33I 1YYWA 1N32I 2BM1A 5FLXC 2UXCE 4JI1I 2DSYA 1YYOA 2HKJA 3IWDA 2E1MA 3PYDA 1DQ3A 1NHJA 4DR3I 5DNYA 4DR7E 4L8NA 4F9CB 2V88A 3DJWA 2HK3A 3C4BA 2N3GA 1B63A 5AASA 4PRVA 1Z59A 3OTOE 4URLA 3QT6A 4B3MI 4P78A 4B3SE 4KQVA 2UUCI 2UXDI 1HK7A 4LF4I 2ZM6E 3JU0A 3HULA 4IZKA 1IBME 3HPZA 2PNMA 1Z5AA 3P06A 1VISA 1XHKA 1Y4UA 4Q28A 4HACB 1S4EA 5ADZA 2PNLA 2E5LI 2FV4B 4R8OA 1H7UA 2VQEE 2UU9E 3LTOA 2JWOA 4JV5I 4DR3E 4DV7I 1MX0A 4YHHI 3KWRA 2V86A 1ZM3A 1FJGE 5GMEA 2V8PA 2LJHA 2V85A 1QZRA 4LFAE 2UUCE 2UXDE 2R3VA 2VE7C 2HKEA 2XEXA 1T4LB 3RMPA 3PYGA 2ZITA 2L6MA 4DV0I 2L92A 1X48A 4WUCA 2E5LE 4DR5I 4JI8I 5LMNI 1EA6A 4X66I 3F0NA 4DV7E 2B7VA 4X64I 2M4IA 2L33A 3QT7A 2BV3A 1PVGA 2L3JA 1UEKA 2F8BA 4DV1I 1Z0EA 3M6AA 4DU7A 4USKA 4JI0I 1IBKI 4DR1E 1WUUA 4LFBI 3HPSA 3ZOQB 4DU8A 1FWLA 2B3TB 4OX9I 2Q2EB 1IBLI 2HHHI 4DMIA 2GS8A 4DV0E 1OJ4A 1NHHA 2FGGA 4JG4A 3QT5A 2H36X 4JI8E 1I94E 3WU6A 4DPUA 4GKJI 3P1XA 2UUAI 3ADIA 4NXNI 2UUBI 2KHXA 1XNQI 3FIGA 4DV1E 1ZM4A 4FWHA 2NPFA 2NA2A 2RTXA 4WFTA 4Z7YA 3DF6A 1USVA 1IBLE 1WHNA 1USUA 1PKPA 3AUZA 2UXBE 4I8OA 2LJPA 4M30A 2Z5CB 4B3RI 2ODRC 4NXME 3GONA 4BCAA 3K1JA 1UHZA 2LE2A 4LFCE 4GKJE 2YZTA 2UUAE 4JYAE 4P7DA 2LTRA 2E1RA 4BMJA 4FWGA 2JR1A 4N3OA 1XMOI 2L8TA 1Z0GA 1ZXNA 3T1YI 1B62A 2HK2A 2DB2A 4DV6E 1Z0CA 4JI2I 2A2CA 2LUPB 2IOPA 4R1FA 4IZKB 4LF9I 4B3TE 2ZBKB 3T1HI 2X36A 4X65I 4DV4I 4F9BB 3MSWA 1PIEA 2NUEA 3HXLA 1YYKA 4DUYE 1QU6A 5AE2A 1FWKA 2J7KA 4JI3E 4YY3I 2ODRD 2V2ZA 1N33E 4FW9A 1N32E 4LU9A 3T1YE 3J81C 1J5EI 1HNXI 3ZKDA 1HR0I 2L2NA 4TUIA 4JI2E 3WU5A 4JI1E 2IHR1 1Z0WA 2WZOA 3C4TA 3ZZ0A 4DV2I 4F9AB 4JI7I 3LPSA 1STUA 3J7AG 2O1UA 2M1SA 4DUZI 3T1HE 3Q1QA 4X65E 2RS6A 4L5NC 4DV4E 3HTXA 4K0KI 4HY1A 4B3ME 4LF4E 3PYFA 2M7QA 4YY3E 2F4VI 4M2ZA 2L2MA 4DR2I 2VF3A 4DR6I 4DKKA 4DV3I 1J5EE 1HR0E 3JTZA 2CGEA 4RPFA 2Z5BB 3OMLA 4LF7I 2EFGA 4JV5E 1T4NA 4YHHE 4DUZE 1FNMA 1BKNA 1RC7A 1Z5BA 1GZ6A 3Q6NA 2BM0A 3K85A 1D6TA 3J7Yp 4LF6I 2Z5BA 2F4VE 1Z0TA 4GEQB 2MDRA 3J81Q 1ZM9A 5LMUI 4IZJA 1HNWI 1UILA 4DR4I 1Y4SA 2RSMA 2KONA 4DR5E 1SR9A 4OOGC 5LMNE 4LF7E 4DPWA 1KVKA 4X66E 1YZ9A 4X64E 4PU9A 4PRXA 2LTSA 1A6FA 1N36I 3IWCA 5AE3A 4JI4I 4BS9A 3JAMC 1IBKE 4JI0E 4LF6E 2IOQA 2HFUA 4P52A 2CG9A 1T4OA 2MC6A 3VYYA 2V34A 4LFBE 4P7AA 4AQYI 1XNRI 5LMUE 4OX9E 2HHHE 1K47A 2VF1A 4MYTA 4KHPI 3LMLA 1H7SA 1ZXMA 1Y6ZA 1HNZI 4HYMA 4NXNE 5A2QC 4GKKI 3ADJA 1N36E 2UUBE 3IWBA 5IWAI 1EKZA 5BR8I 4JI5I 2O1VA 4LF5I 3ZZTA 1XNQE 2LRSA 4JI4E 3WU3A 4UT4A 5AE1A 4M1KA 4JI6I 2V2VA 2UXCI 2DEJA 2B9DA 1Z0BA 1DARA 1H73A 2N3HA 4B3RE 1RREA 2DMYA 4WUDA 5GMDA 4I3HA 2CZ9A 1HNZE 2L3CA 3J80C 2EZ6A 4XTJA 4B3SI 4BC9A 1NZ0A 4GKKE 4Z7CA 3V2UC 4HXZA 4JI5E 2EWLA 1IBMI 4LF5E 3JAMQ 1N34I 2B7TA 2V2QA 2DEIA 3F6GA 1FKAE 2VQFI 2K4VA 2LMZA 2MC5A 4JI6E 4R03A 1WXRA 1XMOE 2VQEI 4M0VA 2UU9I 1U2RA 1NHIA 3F6HA 3H09A 5T6JA 4LF9E 1ZBTA 2GQ0A 1FJGI 4USMA 1ZBQA 5A2QQ 2Z5EA 4LFAI 2JOXA 3LNUA 4WUBA 1RQ0A 2JY9A 2WW4A 1N34E 1J26A 2NUGA 2VQFE 2V83A 4ED4A 2L2KB 4X62I 1H72C 3AV0A 2JVAA 1HNXE 1O0WA 4KZSA 1MG7A 4JI7E 4DV2E 1N0UA 3PRYA 3PYEA 5FWKA 1ELOA 3J7AM 3B8HA 4MYUA 3J80Q 2FTXB 2CPNA 4BBYA 4IZJB 3D4JA 4HACA 3HJCA 4K0KE 2LUQA 4DR1I 3ZZUA 2X7IA 3WU4A 5FLXQ 1Z0VA 2RS7A 1WHQA 2YT4A 4DR2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 E;  4X62 E;  4DV3 E;  1S16 A;  3H4L A;  4LF8 I;  1I94 I;  5IT9 C;  1MU5 A;  4WYQ B;  4EMD A;  4UTG A;  3ZKB A;  3CWV A;  1H74 A;  4ZVI A;  1XMQ I;  2A2D A;  1DI2 A;  2OI2 A;  1KTV A;  2LBS B;  4DXL A;  2DIX A;  2HFS A;  1FI4 A;  1N0V C;  2UXB I;  3B78 A;  4NXM I;  4DPX A;  4LF8 E;  2R42 A;  4LFC I;  1HNW E;  4DR4 E;  4DPY A;  1RR9 A;  4JYA I;  1Z5C A;  5LL6 R;  1X49 A;  3V5R A;  4DV5 I;  1XMQ E;  1EI1 A;  3B82 A;  1KKH A;  3ZM7 A;  4DV6 I;  3ADL A;  3K17 A;  4AQY E;  1XNR E;  5IT9 Q;  4FN5 A;  1KIJ A;  3VYX A;  4B3T I;  4FWD A;  3QT8 A;  3LLH A;  4DR7 I;  4KHP E;  4X8W A;  5L3J A;  1GQE A;  1X47 A;  1ZM2 A;  3OTO I;  3ADG A;  4DV5 E;  4DUY I;  2ZM6 I;  5IWA E;  4JI3 I;  5CFF E;  5BR8 E;  2NUF A;  2AJ4 A;  4DPT A;  1N33 I;  1YYW A;  1N32 I;  2BM1 A;  5FLX C;  2UXC E;  4JI1 I;  1YYO A;  2HKJ A;  3PYD A;  1NHJ A;  4DR3 I;  4DR7 E;  2HK3 A;  3C4B A;  2N3G A;  1B63 A;  4PRV A;  1Z59 A;  3OTO E;  4URL A;  3QT6 A;  4B3M I;  4B3S E;  4KQV A;  2UUC I;  2UXD I;  4LF4 I;  2ZM6 E;  3HUL A;  1IBM E;  1Z5A A;  1VIS A;  1XHK A;  4HAC B;  1S4E A;  2E5L I;  1H7U A;  2VQE E;  2UU9 E;  3LTO A;  4JV5 I;  4DR3 E;  4DV7 I;  1MX0 A;  4YHH I;  1ZM3 A;  1FJG E;  5GME A;  2V8P A;  2LJH A;  1QZR A;  4LFA E;  2UUC E;  2UXD E;  2R3V A;  2HKE A;  2XEX A;  1T4L B;  3PYG A;  2ZIT A;  4DV0 I;  1X48 A;  4WUC A;  2E5L E;  4DR5 I;  4JI8 I;  5LMN I;  1EA6 A;  4X66 I;  3F0N A;  4DV7 E;  2B7V A;  4X64 I;  2L33 A;  3QT7 A;  2BV3 A;  1PVG A;  2L3J A;  1UEK A;  4DV1 I;  1Z0E A;  3M6A A;  4DU7 A;  4USK A;  4JI0 I;  1IBK I;  4DR1 E;  1WUU A;  4LFB I;  4DU8 A;  1FWL A;  2B3T B;  4OX9 I;  2Q2E B;  1IBL I;  2HHH I;  2GS8 A;  4DV0 E;  1OJ4 A;  1NHH A;  4JG4 A;  3QT5 A;  4JI8 E;  1I94 E;  3WU6 A;  4DPU A;  4GKJ I;  3P1X A;  2UUA I;  3ADI A;  4NXN I;  2UUB I;  2KHX A;  1XNQ I;  4DV1 E;  1ZM4 A;  4FWH A;  2NPF A;  2NA2 A;  2RTX A;  4WFT A;  4Z7Y A;  1IBL E;  1WHN A;  1PKP A;  2UXB E;  2LJP A;  4M30 A;  4B3R I;  4NXM E;  3GON A;  3K1J A;  1UHZ A;  4LFC E;  4GKJ E;  2UUA E;  4JYA E;  2LTR A;  2E1R A;  4FWG A;  1XMO I;  1Z0G A;  1ZXN A;  3T1Y I;  1B62 A;  2HK2 A;  2DB2 A;  4DV6 E;  1Z0C A;  4JI2 I;  2A2C A;  2LUP B;  4R1F A;  4LF9 I;  4B3T E;  2ZBK B;  3T1H I;  2X36 A;  4X65 I;  4DV4 I;  1PIE A;  2NUE A;  1YYK A;  4DUY E;  1QU6 A;  1FWK A;  2J7K A;  4JI3 E;  4YY3 I;  2V2Z A;  1N33 E;  4FW9 A;  1N32 E;  3T1Y E;  3J81 C;  1J5E I;  1HNX I;  3ZKD A;  1HR0 I;  2L2N A;  4JI2 E;  3WU5 A;  4JI1 E;  2IHR 1;  1Z0W A;  3ZZ0 A;  3C4T A;  4DV2 I;  4JI7 I;  3LPS A;  1STU A;  3J7A G;  3Q1Q A;  4DUZ I;  3T1H E;  4X65 E;  2RS6 A;  4DV4 E;  3HTX A;  4K0K I;  4HY1 A;  4B3M E;  4LF4 E;  3PYF A;  4YY3 E;  2F4V I;  4M2Z A;  2L2M A;  4DR2 I;  2VF3 A;  4DR6 I;  4DKK A;  4DV3 I;  1J5E E;  1HR0 E;  4RPF A;  4LF7 I;  2EFG A;  4JV5 E;  1T4N A;  4YHH E;  4DUZ E;  1FNM A;  1BKN A;  1RC7 A;  1Z5B A;  2BM0 A;  1D6T A;  3J7Y p;  4LF6 I;  2F4V E;  1Z0T A;  2MDR A;  3J81 Q;  1ZM9 A;  5LMU I;  1HNW I;  1UIL A;  4DR4 I;  2RSM A;  4DR5 E;  4OOG C;  5LMN E;  4LF7 E;  4DPW A;  1KVK A;  4X66 E;  1YZ9 A;  4X64 E;  4PU9 A;  4PRX A;  2LTS A;  1A6F A;  1N36 I;  4JI4 I;  3JAM C;  1IBK E;  4JI0 E;  4LF6 E;  2HFU A;  4P52 A;  1T4O A;  3VYY A;  4P7A A;  2V34 A;  4LFB E;  4AQY I;  1XNR I;  5LMU E;  4OX9 E;  2HHH E;  1K47 A;  4MYT A;  4KHP I;  1H7S A;  1ZXM A;  1HNZ I;  4HYM A;  4NXN E;  5A2Q C;  4GKK I;  3ADJ A;  1N36 E;  2UUB E;  5IWA I;  1EKZ A;  5BR8 I;  4JI5 I;  4LF5 I;  3ZZT A;  1XNQ E;  2LRS A;  4JI4 E;  3WU3 A;  4UT4 A;  4M1K A;  4JI6 I;  2V2V A;  2UXC I;  2DEJ A;  1Z0B A;  1DAR A;  1H73 A;  2N3H A;  4B3R E;  1RRE A;  2DMY A;  4WUD A;  5GMD A;  4I3H A;  2CZ9 A;  1HNZ E;  2L3C A;  2EZ6 A;  4XTJ A;  3J80 C;  4B3S I;  1NZ0 A;  4GKK E;  4Z7C A;  3V2U C;  4HXZ A;  4JI5 E;  1IBM I;  4LF5 E;  3JAM Q;  1N34 I;  2B7T A;  2V2Q A;  2DEI A;  1FKA E;  2VQF I;  4JI6 E;  1XMO E;  2VQE I;  2UU9 I;  1U2R A;  1NHI A;  4LF9 E;  1ZBT A;  1FJG I;  4USM A;  5A2Q Q;  4LFA I;  3LNU A;  4WUB A;  1RQ0 A;  2JY9 A;  2WW4 A;  1N34 E;  1J26 A;  2NUG A;  2VQF E;  4ED4 A;  2L2K B;  4X62 I;  1H72 C;  2JVA A;  1HNX E;  1O0W A;  1MG7 A;  4JI7 E;  4DV2 E;  1N0U A;  3PYE A;  1ELO A;  3J7A M;  3B8H A;  4MYU A;  3J80 Q;  2CPN A;  3D4J A;  4HAC A;  4K0K E;  2LUQ A;  4DR1 I;  3ZZU A;  2X7I A;  3WU4 A;  5FLX Q;  1Z0V A;  2RS7 A;  1WHQ A;  2YT4 A;  4DR2 E; 
#chains in the Genus database with same CATH topology
 4F54 A;  4DR6 E;  2JOB A;  4X62 E;  4FW4 A;  4DV3 E;  1S16 A;  3H4L A;  4LF8 I;  3VK6 A;  1I94 I;  5IT9 C;  1MU5 A;  4WYQ B;  5F3W A;  4EMD A;  4F6N A;  2YTQ A;  2J7J A;  4MU3 A;  1NCS A;  4UTG A;  5JEA E;  3ZKB A;  3MHS C;  4O4K A;  4GZN C;  1H74 A;  3CWV A;  1PDA A;  4ZVI A;  2EMK A;  1XMQ I;  2G7H A;  1A1K A;  1DI2 A;  2A2D A;  2OI2 A;  1KYQ A;  1KTV A;  2KOU A;  2LBS B;  2DIX A;  4DXL A;  2EOJ A;  2HFS A;  1FI4 A;  1N0V C;  1MGT A;  2ADR A;  1F2I G;  2NAB A;  2YSP A;  4WSP A;  2EN2 A;  2UXB I;  2O1T A;  2RSI A;  3B78 A;  4R2A A;  2C39 B;  3DD6 A;  3WU5 A;  2JEB A;  4NXM I;  4J8Z A;  1E3H A;  4LF8 E;  4DPX A;  2R42 A;  4LFC I;  1HNW E;  2PRT A;  4DR4 E;  2V8Q B;  2JE6 B;  2O1W A;  4DPY A;  2K7I A;  3C6M A;  1RR9 A;  3PS2 A;  5EL9 A;  4GQU A;  1Z5C A;  4JYA I;  3HQ1 A;  1Z1B A;  1VI7 A;  5LL6 R;  2PO2 B;  1X49 A;  3V5R A;  4BA1 A;  1XMQ E;  4DV5 I;  2YU5 A;  4IS9 A;  3P3E A;  2EOE A;  3K6Q A;  4TUG A;  2C39 A;  1EI1 A;  2EP3 A;  4BC7 A;  3Q6M A;  4R2Q A;  3B82 A;  4LOM A;  1KKH A;  2EMX A;  2EOY A;  3ZM7 A;  4DV6 I;  2IES A;  3ADL A;  1RMD A;  3GLL A;  5KL6 A;  2LCE A;  4AQY E;  3CDI A;  4LTY A;  4R2D A;  3K17 A;  3M7N D;  1XNR E;  4MU0 A;  1AH5 A;  2ENC A;  3M7N G;  5IT9 Q;  4FN5 A;  2MKD A;  1KIJ A;  3VYX A;  2F1D A;  4B3T I;  4O5G A;  3QT8 A;  3LLH A;  4FWD A;  4DR7 I;  4WPY A;  4KHP E;  4X8W A;  2V89 A;  5L3J A;  3THN A;  2EOM A;  4IZJ D;  1GQE A;  3M99 B;  1X47 A;  2V87 A;  4F2J C;  1YPN A;  5AC4 A;  5IV8 B;  1ZM2 A;  3OTO I;  3P3C A;  3ADG A;  4DV5 E;  4DUY I;  2ZM6 I;  4R2P A;  5IWA E;  4JI3 I;  5CFF E;  2YRM A;  2Z5C A;  5BR8 E;  2EMH A;  2NUF A;  2C38 A;  4LCH A;  2AJ4 A;  4DPT A;  1N33 I;  1YYW A;  5KL4 A;  1N32 I;  2BM1 A;  2WNR B;  4OO1 F;  5FLX C;  5DRR A;  2UXC E;  3P3G A;  3P76 A;  4JI1 I;  2DSY A;  1YYO A;  2HKJ A;  5KL7 A;  3IWD A;  2A25 A;  2E1M A;  5K36 B;  3PYD A;  4P52 A;  1DQ3 A;  1NHJ A;  4JI7 I;  4DR3 I;  2M9A A;  5DNY A;  4DR7 E;  4IFD F;  4L8N A;  2YPN A;  4F9C B;  2GPI A;  2V88 A;  3DJW A;  2HK3 A;  3C4B A;  2N3G A;  1B63 A;  5AAS A;  2EM9 A;  4OZE A;  4PRV A;  5JEA F;  1Z59 A;  3OTO E;  4URL A;  3QT6 A;  4B3M I;  1IQS A;  4P78 A;  4B3S E;  4MU4 A;  4KQV A;  2UUC I;  2UXD I;  1HK7 A;  4LF4 I;  2EPR A;  2ZM6 E;  3JU0 A;  3HUL A;  4OO1 B;  1RHY A;  4IZK A;  1EH7 A;  1IBM E;  3HPZ A;  2PNM A;  1Z5A A;  3U1K A;  2D9H A;  2BA1 D;  3P06 A;  2EL4 A;  1VIS A;  1XHK A;  1Y4U A;  4Q28 A;  4HAC B;  1S4E A;  5ADZ A;  2PNL A;  1DGC A;  2E5L I;  2FV4 B;  4R8O A;  1H7U A;  4IFD B;  2VQE E;  1PJT A;  2C37 A;  2EPM X;  2UU9 E;  2WCC 3;  1JK2 A;  3U1Y A;  3LTO A;  4Q35 B;  2JWO A;  2PNZ B;  4DR3 E;  1XXE A;  4JV5 I;  2CTD A;  4DV7 I;  5K36 C;  1MX0 A;  4YHH I;  3KWR A;  2V86 A;  1ZM3 A;  4OO1 A;  1FJG E;  5GME A;  2V8P A;  2LJH A;  4O24 A;  1OYP A;  2V85 A;  1QZR A;  4WSG A;  4LFA E;  1BBO A;  2UUC E;  2UXD E;  3L7Z A;  2R3V A;  3HKM A;  2VE7 C;  4WX9 A;  2HKE A;  4IFD A;  2XEX A;  1T4L B;  3RMP A;  3PYG A;  1A1L A;  2L6M A;  2ZIT A;  4LPF A;  4OO1 C;  5JEA A;  1G2F C;  4DV0 I;  2L92 A;  4U3B A;  1X48 A;  4WUC A;  2E5L E;  5A6K A;  4DR5 I;  4JI8 I;  5LMN I;  1T38 A;  1EA6 A;  1JK1 A;  4IFD C;  4ZYH A;  4X66 I;  3F0N A;  4DV7 E;  2EPA A;  2B7V A;  3EPH A;  2NN6 E;  4X64 I;  2PO1 A;  2PO0 A;  2HJJ A;  2M4I A;  2L33 A;  2EN7 A;  4X9J A;  3QT7 A;  2BV3 A;  2JEB B;  5IXM B;  1PVG A;  2L3J A;  1UEK A;  2F8B A;  2BBG A;  4DV1 I;  1Z0E A;  3M6A A;  4DU7 A;  2EOX A;  4USK A;  4JI0 I;  4RHB B;  4DR1 E;  2WBS A;  1UDQ A;  1IBK I;  1WUU A;  4AIM A;  4LFB I;  2EQ3 A;  3HPS A;  3ZOQ B;  4DU8 A;  1FWL A;  4BA1 B;  2B3T B;  4OX9 I;  5K36 D;  2Q2E B;  1IBL I;  2HHH I;  4DMI A;  2GS8 A;  4DV0 E;  1OJ4 A;  1NHH A;  2FGG A;  4JG4 A;  4ZYD A;  1KJK A;  3QT5 A;  2H36 X;  4JI8 E;  1UN6 B;  1I94 E;  2NN6 D;  3WU6 A;  2EPP A;  4DPU A;  2WP8 B;  5C0X F;  4GKJ I;  1PJQ A;  3P1X A;  2UUA I;  3ADI A;  1BBG A;  4NXN I;  2UUB I;  5A6B A;  1YUJ A;  1YH8 A;  2KHX A;  4M9V C;  3FIG A;  4U3D A;  1E3P A;  4R2C A;  1XNQ I;  4DV1 E;  1ZM4 A;  4FWH A;  2NPF A;  1X6F A;  2NA2 A;  2RTX A;  2EPX A;  4WFT A;  1IQO A;  3EPK A;  2EL6 A;  2WP8 A;  4Z7Y A;  3DF6 A;  1USV A;  2YTJ A;  3BGH A;  4MLQ A;  1WHN A;  1IBL E;  1USU A;  1PKP A;  3AUZ A;  1GTK A;  2UXB E;  4I8O A;  2LJP A;  5C0X B;  1UDS A;  4M30 A;  2Z5C B;  4B3R I;  4BA2 A;  2ODR C;  1YUI A;  4NXM E;  2C38 B;  3B4T A;  2EN8 A;  2LV2 A;  4R2S A;  4ISA A;  3M85 D;  3GON A;  4BCA A;  3K1J A;  1UHZ A;  2LE2 A;  4LFC E;  4NBQ A;  2JP9 A;  3M85 G;  4GKJ E;  1TF6 A;  5DRP A;  2EML A;  2YZT A;  2UUA E;  2EMA A;  2VRD A;  1B69 A;  1R6L A;  4FK5 C;  2EQ0 A;  4JYA E;  1IMU A;  4P7D A;  2LTR A;  2E1R A;  4BMJ A;  3KZY A;  3VHT B;  4NHR A;  1G2D C;  1YHC A;  4FWG A;  5C0X A;  4MU1 A;  2EN3 A;  5DNX A;  2DRP A;  3TQM A;  1R6M A;  2JR1 A;  4N3O A;  1A1I A;  3NZK A;  1XMO I;  2L8T A;  2EOO A;  1Z0G A;  1ZXN A;  3T1Y I;  2RQL A;  2LVH A;  1B62 A;  2HK2 A;  2DB2 A;  4DV6 E;  1A1G A;  1Z0C A;  4JI2 I;  2A2C A;  2EM8 A;  2LUP B;  1UBD C;  2IOP A;  4FW5 A;  2EOH A;  4R1F A;  2N8X A;  4IZK B;  4AM3 A;  2EPO A;  4LF9 I;  4B3T E;  5C0X C;  5KL3 A;  2ZBK B;  3T1H I;  4BHB A;  3KRN A;  2X36 A;  4X65 I;  1EH6 A;  2DGC A;  4DV4 I;  2EM5 A;  2EOI A;  4F9B B;  2BA0 D;  3MSW A;  4KWY A;  1PIE A;  2C37 B;  2EMI A;  2BA0 G;  2NUE A;  3HXL A;  4QNK A;  4LCF A;  3UK3 C;  2YRK A;  1YYK A;  4DUY E;  1QU6 A;  4IJD A;  5AE2 A;  2EN6 A;  1FWK A;  4JI3 E;  2J7K A;  4YY3 I;  2YWQ A;  1X5W A;  2EN4 A;  2ENH A;  2ODR D;  2V2Z A;  3H1C A;  1N33 E;  4FW9 A;  1N32 E;  4LU9 A;  3T1Y E;  1X6E A;  3J81 C;  1X6H A;  1J5E I;  3ZKD A;  1EH8 A;  2BA1 G;  1HNX I;  2L2N A;  4TUI A;  4JI2 E;  2LJU A;  3C6K A;  2IHR 1;  4JI1 E;  2WZO A;  3C4T A;  1Z0W A;  2EMC A;  4F9A B;  3ZZ0 A;  3GME A;  3LPS A;  2EOS A;  1STU A;  2BR2 B;  1N3G A;  3J7A G;  5JEA B;  2O1U A;  2M1S A;  3PS1 A;  3T1H E;  4DUZ I;  3Q1Q A;  2YTO A;  4X65 E;  1UDN A;  2RS6 A;  4L5N C;  5LLQ A;  4DV4 E;  1AAY A;  2EM6 A;  2EMG A;  3HTX A;  4K0K I;  4HY1 A;  4B3M E;  2AE8 A;  4LF4 E;  4DV2 I;  3PYF A;  2M7Q A;  2PO1 B;  4YY3 E;  3EPL A;  2F4V I;  5KL5 A;  2PO0 B;  4M2Z A;  2L2M A;  2BR2 A;  2LT7 A;  1OYR A;  2MDG A;  2EM7 A;  2VF3 A;  2DMI A;  4DKK A;  4DR2 I;  2DLQ A;  2GHF A;  4DV3 I;  1J5E E;  4DR6 I;  1A1F A;  1HR0 E;  1PJS A;  3JTZ A;  5K36 E;  2EM0 A;  2CGE A;  4RPF A;  1LLM C;  2Z5B B;  2BB8 A;  5A6A A;  3OML A;  4LF7 I;  2GLI A;  2YSO A;  2EFG A;  4JV5 E;  1T4N A;  3THO B;  4YHH E;  4DUZ E;  1FNM A;  1HR0 I;  2EMY A;  1BKN A;  3L00 A;  1RC7 A;  5JEA C;  2EMF A;  3L7Z B;  1YSA C;  1Z5B A;  2EN1 A;  1GZ6 A;  3Q6N A;  1TN9 A;  2BM0 A;  2VES A;  3K85 A;  4OO1 E;  4FW6 A;  3J7Y p;  1D6T A;  5DNL A;  4LF6 I;  4RH8 A;  2Z5B A;  2F4V E;  1Z0T A;  4GEQ B;  4ZYG A;  2MDR A;  3J81 Q;  1Y60 A;  2JEA A;  2CSH A;  5EKW A;  4F6M A;  2EPL X;  2ELZ A;  1ZM9 A;  4QNJ A;  5LMU I;  4IZJ A;  4IFD E;  1HNW I;  1UIL A;  4DR4 I;  3EPJ A;  1Y4S A;  2RSM A;  2R1F A;  2KON A;  4DR5 E;  1SR9 A;  4OOG C;  2EQ1 A;  2YTN A;  5LMN E;  2HGH A;  4LF7 E;  4DPW A;  4WXC A;  1KVK A;  4X66 E;  2DLK A;  1YZ9 A;  4X64 E;  1NEI A;  4PU9 A;  4PRX A;  2IER A;  2LTS A;  1A6F A;  1N36 I;  2EMZ A;  4BA2 B;  3IWC A;  2EM2 A;  3BBG A;  2GO4 A;  4LCG A;  1UDO A;  4OO1 D;  5AE3 A;  2EPC A;  1P47 A;  4BS9 A;  4JI4 I;  3JAM C;  1TF3 A;  1IBK E;  4JI0 E;  4MLV A;  4LF6 E;  1Y5Y A;  2HFU A;  2EOR A;  1T4O A;  2MC6 A;  3VYY A;  2CG9 A;  4LFB E;  2IOQ A;  2V34 A;  2EPK X;  4P7A A;  2EOQ A;  4AQY I;  1XNR I;  4IFD D;  2JYA A;  5LMU E;  4OX9 E;  2HHH E;  2EMB A;  3CDJ A;  1K47 A;  4IS1 C;  4FW7 A;  2VF1 A;  4J3D A;  4MYT A;  1SFE A;  5JEA D;  4WXD A;  4KHP I;  1ZU1 A;  3LML A;  5A69 A;  1H7S A;  1MEY C;  1ZXM A;  2ELY A;  2RPC A;  1Y6Z A;  3GCM A;  4HYM A;  1HNZ I;  1A1H A;  4NXN E;  5A2Q C;  4GKK I;  3ADJ A;  1N36 E;  2E72 A;  3MHH C;  3IWB A;  2UUB E;  5IWA I;  1EKZ A;  5BR8 I;  4JI5 I;  2O1V A;  1T39 A;  2WBU A;  3ZZT A;  1XNQ E;  4LF5 I;  2LRS A;  2YTP A;  4JI4 E;  3WU3 A;  4UT4 A;  5AE1 A;  2JE6 A;  4M1K A;  4JI6 I;  2V2V A;  2UXC I;  2DEJ A;  2B9D A;  1Z0B A;  2PO2 A;  3PS3 A;  2YU8 A;  2EPN A;  1DAR A;  3BID A;  2EE8 A;  1H73 A;  2N3H A;  4B3R E;  1RRE A;  2DMY A;  2JXP A;  1YFH A;  4NZV A;  4WUD A;  5GMD A;  1WJP A;  5K36 F;  2YTE A;  4I3H A;  2CZ9 A;  2YTG A;  1HNZ E;  2L3C A;  3J80 C;  2EZ6 A;  4XTJ A;  4B3S I;  4BC9 A;  3KZZ A;  1NZ0 A;  2NN6 F;  4R2R A;  1ZAA C;  4GKK E;  2EJ4 A;  4HEI A;  4Z7C A;  3V2U C;  4HXZ A;  1OYS A;  4JI5 E;  2EWL A;  1IBM I;  4LF5 E;  3JAM Q;  5A6B D;  1A1J A;  1N34 I;  2B7T A;  2V2Q A;  4R2E A;  2DEI A;  3F6G A;  1FKA E;  2VQF I;  2K4V A;  2LMZ A;  3BF2 A;  4OKG A;  2MC5 A;  2WBT A;  4R03 A;  4JI6 E;  5ELW A;  1WXR A;  1XMO E;  2YTD A;  2VQE I;  2YRH A;  2YTI A;  2EMW A;  4M0V A;  2UU9 I;  5C0X E;  2ENA A;  1U2R A;  1L4S A;  2YTF A;  1NHI A;  3UHM A;  3F6H A;  3H09 A;  5T6J A;  5A6J A;  4LF9 E;  1ZBT A;  2NN6 B;  2EOZ A;  2GQ0 A;  1FJG I;  2EL5 A;  2I13 A;  4USM A;  1ZBQ A;  5A2Q Q;  2Z5E A;  2EM3 A;  1P42 A;  4LFA I;  1QNT A;  2CT1 A;  2JOX A;  5AC5 A;  2WNR A;  3LNU A;  4WUB A;  1RQ0 A;  2Q8U A;  3ECR A;  2JY9 A;  5K36 A;  4FW3 A;  2WW4 A;  1N34 E;  4BHC A;  1J26 A;  2EOF A;  2NUG A;  2VQF E;  3EQ1 A;  2V83 A;  4ED4 A;  2MKN A;  2NN6 A;  2JPA A;  2GO3 A;  5C0X D;  2L2K B;  1BB8 A;  1WRJ A;  4X62 I;  1H72 C;  3AV0 A;  2JVA A;  1HNX E;  1O0W A;  2I9I A;  4KZS A;  1MG7 A;  4JI7 E;  4DV2 E;  2CVE A;  1N0U A;  3PRY A;  3PYE A;  5FWK A;  4HTG A;  4O43 A;  1ELO A;  2JEA B;  3J7A M;  4MDT A;  3B8H A;  4MYU A;  2EPZ A;  3J80 Q;  2FTX B;  2CPN A;  2NN6 C;  5DRQ A;  4BBY A;  4IZJ B;  3D4J A;  3QG5 C;  4HAC A;  4ZYE A;  3HJC A;  4MQY A;  4AID A;  2HC5 A;  1ZR9 A;  2EPU A;  4K0K E;  2LUQ A;  4DR1 I;  2J65 A;  3ZZU A;  1X3C A;  2X7I A;  5KL2 A;  3WU4 A;  2EM4 A;  5TSE A;  5FLX Q;  4N4R B;  2PNZ A;  5DRO A;  2LO3 A;  1Z0V A;  2JT2 A;  2RS7 A;  1WHQ A;  2R76 A;  2YT4 A;  2O3Z A;  4DR2 E; 
#chains in the Genus database with same CATH homology
 4F54 A;  4DR6 E;  2JOB A;  4X62 E;  4DV3 E;  1S16 A;  3H4L A;  4LF8 I;  3VK6 A;  1I94 I;  5IT9 C;  1MU5 A;  4WYQ B;  5F3W A;  4EMD A;  4UTG A;  3ZKB A;  3CWV A;  1H74 A;  4ZVI A;  1XMQ I;  2G7H A;  2A2D A;  1DI2 A;  2OI2 A;  1KTV A;  2KOU A;  2LBS B;  2DIX A;  4DXL A;  2HFS A;  1FI4 A;  1N0V C;  4WSP A;  2UXB I;  2O1T A;  3B78 A;  4NXM I;  4J8Z A;  4DPX A;  4LF8 E;  2R42 A;  4LFC I;  1HNW E;  4DR4 E;  2V8Q B;  2O1W A;  4DPY A;  1RR9 A;  4JYA I;  1Z5C A;  3HQ1 A;  5LL6 R;  1X49 A;  3V5R A;  4DV5 I;  1XMQ E;  3K6Q A;  4TUG A;  1EI1 A;  4BC7 A;  3Q6M A;  3B82 A;  1KKH A;  3ZM7 A;  4DV6 I;  3ADL A;  3K17 A;  4AQY E;  4LTY A;  1XNR E;  5IT9 Q;  4FN5 A;  1KIJ A;  3VYX A;  4B3T I;  4FWD A;  3QT8 A;  3LLH A;  4DR7 I;  4WPY A;  4KHP E;  4X8W A;  2V89 A;  5L3J A;  4IZJ D;  1GQE A;  1X47 A;  2V87 A;  1ZM2 A;  3OTO I;  3ADG A;  4DV5 E;  4DUY I;  2ZM6 I;  5IWA E;  4JI3 I;  5CFF E;  2Z5C A;  5BR8 E;  2NUF A;  2AJ4 A;  4DPT A;  1N33 I;  1YYW A;  1N32 I;  2BM1 A;  5FLX C;  2UXC E;  4JI1 I;  2DSY A;  1YYO A;  2HKJ A;  3IWD A;  2E1M A;  3PYD A;  1DQ3 A;  1NHJ A;  4DR3 I;  5DNY A;  4DR7 E;  4L8N A;  4F9C B;  2V88 A;  3DJW A;  2HK3 A;  3C4B A;  2N3G A;  1B63 A;  5AAS A;  4PRV A;  1Z59 A;  3OTO E;  4URL A;  3QT6 A;  4B3M I;  4P78 A;  4B3S E;  4KQV A;  2UUC I;  2UXD I;  1HK7 A;  4LF4 I;  2ZM6 E;  3JU0 A;  3HUL A;  4IZK A;  1IBM E;  3HPZ A;  2PNM A;  1Z5A A;  3P06 A;  1VIS A;  1XHK A;  1Y4U A;  4Q28 A;  4HAC B;  1S4E A;  5ADZ A;  2PNL A;  2E5L I;  2FV4 B;  4R8O A;  1H7U A;  2VQE E;  2UU9 E;  3LTO A;  2JWO A;  4JV5 I;  4DR3 E;  4DV7 I;  1MX0 A;  4YHH I;  3KWR A;  2V86 A;  1ZM3 A;  1FJG E;  5GME A;  2V8P A;  2LJH A;  2V85 A;  1QZR A;  4LFA E;  2UUC E;  2UXD E;  2R3V A;  2VE7 C;  2HKE A;  2XEX A;  1T4L B;  3RMP A;  3PYG A;  2ZIT A;  2L6M A;  4DV0 I;  2L92 A;  1X48 A;  4WUC A;  2E5L E;  4DR5 I;  4JI8 I;  5LMN I;  1EA6 A;  4X66 I;  3F0N A;  4DV7 E;  2B7V A;  4X64 I;  2M4I A;  2L33 A;  3QT7 A;  2BV3 A;  1PVG A;  2L3J A;  1UEK A;  2F8B A;  4DV1 I;  1Z0E A;  3M6A A;  4DU7 A;  4USK A;  4JI0 I;  1IBK I;  4DR1 E;  1WUU A;  4LFB I;  3HPS A;  3ZOQ B;  4DU8 A;  1FWL A;  2B3T B;  4OX9 I;  2Q2E B;  1IBL I;  2HHH I;  4DMI A;  2GS8 A;  4DV0 E;  1OJ4 A;  1NHH A;  2FGG A;  4JG4 A;  3QT5 A;  2H36 X;  4JI8 E;  1I94 E;  3WU6 A;  4DPU A;  4GKJ I;  3P1X A;  2UUA I;  3ADI A;  4NXN I;  2UUB I;  2KHX A;  1XNQ I;  3FIG A;  4DV1 E;  1ZM4 A;  4FWH A;  2NPF A;  2NA2 A;  2RTX A;  4WFT A;  4Z7Y A;  3DF6 A;  1USV A;  1IBL E;  1WHN A;  1USU A;  1PKP A;  3AUZ A;  2UXB E;  4I8O A;  2LJP A;  4M30 A;  2Z5C B;  4B3R I;  2ODR C;  4NXM E;  3GON A;  4BCA A;  3K1J A;  1UHZ A;  2LE2 A;  4LFC E;  4GKJ E;  2YZT A;  2UUA E;  4JYA E;  4P7D A;  2LTR A;  2E1R A;  4BMJ A;  4FWG A;  2JR1 A;  4N3O A;  1XMO I;  2L8T A;  1Z0G A;  1ZXN A;  3T1Y I;  1B62 A;  2HK2 A;  2DB2 A;  4DV6 E;  1Z0C A;  4JI2 I;  2A2C A;  2LUP B;  2IOP A;  4R1F A;  4IZK B;  4LF9 I;  4B3T E;  2ZBK B;  3T1H I;  2X36 A;  4X65 I;  4DV4 I;  4F9B B;  3MSW A;  1PIE A;  2NUE A;  3HXL A;  1YYK A;  4DUY E;  1QU6 A;  5AE2 A;  1FWK A;  2J7K A;  4JI3 E;  4YY3 I;  2ODR D;  2V2Z A;  1N33 E;  4FW9 A;  1N32 E;  4LU9 A;  3T1Y E;  3J81 C;  1J5E I;  1HNX I;  3ZKD A;  1HR0 I;  2L2N A;  4TUI A;  4JI2 E;  3WU5 A;  4JI1 E;  2IHR 1;  1Z0W A;  2WZO A;  3C4T A;  3ZZ0 A;  4DV2 I;  4F9A B;  4JI7 I;  3LPS A;  1STU A;  3J7A G;  2O1U A;  2M1S A;  4DUZ I;  3T1H E;  3Q1Q A;  4X65 E;  2RS6 A;  4L5N C;  4DV4 E;  3HTX A;  4K0K I;  4HY1 A;  4B3M E;  4LF4 E;  3PYF A;  2M7Q A;  4YY3 E;  2F4V I;  4M2Z A;  2L2M A;  4DR2 I;  2VF3 A;  4DR6 I;  4DKK A;  4DV3 I;  1J5E E;  1HR0 E;  3JTZ A;  2CGE A;  4RPF A;  2Z5B B;  3OML A;  4LF7 I;  2EFG A;  4JV5 E;  1T4N A;  4YHH E;  4DUZ E;  1FNM A;  1BKN A;  1RC7 A;  1Z5B A;  1GZ6 A;  3Q6N A;  2BM0 A;  3K85 A;  1D6T A;  3J7Y p;  4LF6 I;  2Z5B A;  2F4V E;  1Z0T A;  4GEQ B;  2MDR A;  3J81 Q;  1ZM9 A;  5LMU I;  4IZJ A;  1HNW I;  1UIL A;  4DR4 I;  1Y4S A;  2RSM A;  2KON A;  4DR5 E;  1SR9 A;  4OOG C;  5LMN E;  4LF7 E;  4DPW A;  1KVK A;  4X66 E;  1YZ9 A;  4X64 E;  4PU9 A;  4PRX A;  2LTS A;  1A6F A;  1N36 I;  3IWC A;  5AE3 A;  4JI4 I;  4BS9 A;  3JAM C;  1IBK E;  4JI0 E;  4LF6 E;  2IOQ A;  2HFU A;  4P52 A;  2CG9 A;  1T4O A;  2MC6 A;  3VYY A;  2V34 A;  4LFB E;  4P7A A;  4AQY I;  1XNR I;  5LMU E;  4OX9 E;  2HHH E;  1K47 A;  2VF1 A;  4MYT A;  4KHP I;  3LML A;  1H7S A;  1ZXM A;  1Y6Z A;  1HNZ I;  4HYM A;  4NXN E;  5A2Q C;  4GKK I;  3ADJ A;  1N36 E;  2UUB E;  3IWB A;  5IWA I;  1EKZ A;  5BR8 I;  4JI5 I;  2O1V A;  4LF5 I;  3ZZT A;  1XNQ E;  2LRS A;  4JI4 E;  3WU3 A;  4UT4 A;  5AE1 A;  4M1K A;  4JI6 I;  2V2V A;  2UXC I;  2DEJ A;  2B9D A;  1Z0B A;  1DAR A;  1H73 A;  2N3H A;  4B3R E;  1RRE A;  2DMY A;  4WUD A;  5GMD A;  4I3H A;  2CZ9 A;  1HNZ E;  2L3C A;  3J80 C;  2EZ6 A;  4XTJ A;  4B3S I;  4BC9 A;  1NZ0 A;  4GKK E;  4Z7C A;  3V2U C;  4HXZ A;  4JI5 E;  2EWL A;  1IBM I;  4LF5 E;  3JAM Q;  1N34 I;  2B7T A;  2V2Q A;  2DEI A;  3F6G A;  1FKA E;  2VQF I;  2K4V A;  2LMZ A;  2MC5 A;  4JI6 E;  4R03 A;  1WXR A;  1XMO E;  2VQE I;  4M0V A;  2UU9 I;  1U2R A;  1NHI A;  3F6H A;  3H09 A;  5T6J A;  4LF9 E;  1ZBT A;  2GQ0 A;  1FJG I;  4USM A;  1ZBQ A;  5A2Q Q;  2Z5E A;  4LFA I;  2JOX A;  3LNU A;  4WUB A;  1RQ0 A;  2JY9 A;  2WW4 A;  1N34 E;  1J26 A;  2NUG A;  2VQF E;  2V83 A;  4ED4 A;  2L2K B;  4X62 I;  1H72 C;  3AV0 A;  2JVA A;  1HNX E;  1O0W A;  4KZS A;  1MG7 A;  4JI7 E;  4DV2 E;  1N0U A;  3PRY A;  3PYE A;  5FWK A;  1ELO A;  3J7A M;  3B8H A;  4MYU A;  3J80 Q;  2FTX B;  2CPN A;  4BBY A;  4IZJ B;  3D4J A;  4HAC A;  3HJC A;  4K0K E;  2LUQ A;  4DR1 I;  3ZZU A;  2X7I A;  3WU4 A;  5FLX Q;  1Z0V A;  2RS7 A;  1WHQ A;  2YT4 A;  4DR2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...