2UUBE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uubE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubE02
1U2RA 3VYXA 1YZ9A 2ZM6I 1Z0EA 1T4NA 4X8WA 4LF5I 2VQEE 3T1HI 1HR0E 2L33A 1N32E 1D6TA 1YYWA 4KQVA 5BR8E 2HK3A 3F0NA 2RSMA 4P7AA 2VQEI 3ZKDA 3ADGA 1Z0TA 1NHHA 1N0UA 1HR0I 3ADJA 1N32I 4NXNE 2R3VA 3V5RA 2UUCE 3VYYA 1XNQE 4EMDA 4R1FA 4JI2I 3J7Yp 4K0KE 4NXNI 4JI5E 4JV5I 3K1JA 2UUCI 1XNQI 4LF9E 4AQYE 2YT4A 2A2CA 1ZM9A 4DPWA 1N0VC 3M6AA 4LF7E 3WU3A 4B3ME 2L3CA 4AQYI 4B3SE 2X7IA 1N36E 2HHHE 1ZBTA 3C4TA 1S16A 2BV3A 5FLXQ 4LF7I 4B3MI 4DV0E 4HY1A 2DB2A 4GKJE 4B3SI 1FNMA 2HHHI 2HK2A 1NZ0A 1H7UA 1H73A 4JI3E 1FWKA 1H7SA 4MYTA 3J7AM 4DV0I 1IBLE 1WHQA 4GKJI 3QT6A 3LTOA 2UUBE 2E1RA 4MYUA 4GKKE 4KHPI 2UXDE 5A2QQ 4DPUA 4JI3I 1BKNA 1IBLI 2V2ZA 3LPSA 1EA6A 1QZRA 2UUAE 3GONA 4DR5E 1XMOE 4JI4E 3WU5A 3J81C 4GKKI 1IBME 5GMDA 4JI0E 3J81Q 3PYFA 2UUAI 3QT7A 4JI4I 2RS7A 4WUCA 2NUEA 2UXCE 1N33I 4LF6I 1EKZA 4DUZE 2LTRA 1X47A 3ADLA 1X48A 2UXCI 1I94E 1J26A 2XEXA 2HKEA 2HFUA 1FI4A 4DUZI 3WU4A 2DEJA 3H4LA 3PYDA 2DIXA 2HFSA 1K47A 4DV7I 4LF4E 1I94I 1RR9A 1O0WA 4X64E 1MU5A 2ZITA 2RTXA 4LFCE 2IHR1 4LFBE 4DR3E 1A6FA 4LF4I 2UXBE 4DV2E 2LTSA 4PU9A 1HNZE 4HACB 4LFCI 4LFBI 4DR3I 5BR8I 4UT4A 2OI2A 1VISA 2UXBI 4X65E 4DV2I 4B3RE 1MG7A 4DR6E 4HACA 1HNZI 1FKAE 2J7KA 4WFTA 2Q2EB 4ED4A 1NHIA 4URLA 2RS6A 4X65I 1OJ4A 1RQ0A 4YY3E 4B3RI 4DR6I 4K0KI 4JI6E 4JI5I 2A2DA 3PYEA 4PRVA 2HKJA 4LF9I 4NXME 5LL6R 4DV5E 2BM0A 2X36A 4YY3I 4Z7YA 5FLXC 4WUBA 1Z0GA 4DV6E 2LRSA 4HXZA 4ZVIA 4DV1E 4FW9A 4NXMI 1YYKA 4FWDA 4DV5I 4DKKA 1KVKA 1EI1A 1N36I 1RREA 4LFAE 4DU8A 4DV6I 1WUUA 1ELOA 4DV1I 2UU9E 2MDRA 4DPXA 1Z0VA 3ZZUA 4X66E 1ZXNA 5A2QC 2LBSB 4LFAI 4UTGA 2DMYA 1NHJA 3J7AG 2UU9I 4X66I 4I3HA 2UUBI 4B3TE 4JG4A 2UXDI 2V8PA 4USKA 1ZM3A 3ZZ0A 1FWLA 4DR5I 1XMOI 5IWAE 3ZKBA 4YHHE 3V2UC 4B3TI 1IBMI 1KIJA 3LNUA 4JI0I 4WUDA 1N34E 1IBKE 1Z0BA 1STUA 4DPTA 2L2MA 2B7VA 2LUPB 2NUGA 4WYQB 5L3JA 5IWAI 4YHHI 2F4VE 4DV3E 1N34I 1KTVA 3OTOE 2EFGA 1HNXE 2B7TA 1X49A 4HYMA 2N3HA 4JI1E 1WHNA 2DEIA 4XTJA 2F4VI 4JI7E 4DV3I 1ZXMA 3OTOI 1HNXI 4P52A 4OX9E 4JI1I 5CFFE 2EZ6A 3D4JA 3JAMC 3B82A 4JI7I 2JVAA 3JAMQ 4X64I 1Z5CA 2NPFA 2WW4A 1J5EE 1XMQE 4OX9I 2ZBKB 4M30A 1DARA 1KKHA 1PIEA 2LJPA 3CWVA 1PKPA 4JYAE 2CPNA 1J5EI 1XMQI 3B78A 4JI2E 1T4LB 1YYOA 1S4EA 4JYAI 4JV5E 1QU6A 2BM1A 2NA2A 2B3TB 2L2KB 3T1YE 1H74A 3ZZTA 4RPFA 4FWHA 2NUFA 4DU7A 1UHZA 2JY9A 5LMUE 4JI6I 1DI2A 5GMEA 3T1YI 1T4OA 1FJGE 3K17A 3PYGA 2V34A 2LJHA 2V2VA 4DV4E 4M2ZA 2VF3A 1ZM2A 5LMUI 1Z0CA 3WU6A 1GQEA 1UEKA 4OOGC 2AJ4A 3HULA 1FJGI 3C4BA 2N3GA 4DV4I 4DR7E 4FWGA 1UILA 3LLHA 3ZM7A 1Z5BA 3QT5A 1XHKA 4KHPE 4DR2E 4DPYA 4DR7I 1PVGA 1Z0WA 1Z5AA 1B62A 3QT8A 2L3JA 1Z59A 3J80C 4USMA 4JI8E 5LMNE 3ADIA 4DXLA 4DR2I 2GS8A 3J80Q 1ZM4A 1RC7A 1HNWE 2V2QA 4DUYE 4LF8E 2CZ9A 1N33E 1H72C 4JI8I 2E5LE 4PRXA 5LMNI 2KHXA 1MX0A 4Z7CA 4LF6E 3Q1QA 1XNRE 4X62E 2LUQA 2R42A 2L2NA 4M1KA 1HNWI 4DUYI 4LF8I 1IBKI 2VQFE 2E5LI 1B63A 4DR1E 3P1XA 3B8HA 4DR4E 1XNRI 5IT9C 4X62I 2ZM6E 5IT9Q 4FN5A 4DV7E 4LF5E 2VQFI 3T1HE 4DR1I 3HTXA 4DR4I
chains in the Genus database with same CATH superfamily
1U2RA 1YSAC 2WBSA 1IMUA 3VYXA 1YZ9A 2ZM6I 1Z0EA 1T4NA 2CGEA 5A6KA 4IFDD 4X8WA 2JWOA 4LF5I 2VQEE 3RMPA 3DD6A 3T1HI 4R2PA 3Q6NA 2IESA 2FV4B 2M4IA 1HR0E 2L33A 1N32E 2LV2A 1USVA 1D6TA 2DMIA 1YYWA 1G2FC 2E1MA 1N3GA 4WX9A 3GLLA 4KQVA 5BR8E 2HK3A 2EOZA 3F0NA 2RSMA 4DMIA 3M85D 2EPKX 1OYSA 3KZZA 1F2IG 4P7AA 3ZKDA 4R2AA 3ADGA 2VQEI 1Z0TA 1NHHA 2EMAA 1N0UA 1HR0I 3ADJA 1YPNA 2EMCA 2PNMA 1N32I 2BB8A 4NXNE 2EMFA 2M1SA 2R3VA 3V5RA 2UUCE 2GO4A 2EOEA 3VYYA 2GO3A 3JU0A 2PO2B 1XNQE 1Y60A 2EN7A 2ODRC 4EMDA 4FW4A 3U1KA 2EN8A 4O5GA 4R1FA 5A6AA 1L4SA 4JI2I 4NBQA 1GZ6A 3J7Yp 4K0KE 4NXNI 4JI5E 4JV5I 2NN6E 4OO1E 2EPNA 3DF6A 3HPSA 2EMYA 4BHBA 2PO2A 3K1JA 5JEAC 4MU1A 2UUCI 1XNQI 4LF9E 3EPHA 3EQ1A 4AQYE 2Q8UA 1YUJA 1SR9A 2YT4A 2A2CA 1JK1A 2O1WA 3NZKA 2FGGA 1ZM9A 2R76A 4F2JC 4DPWA 1N0VC 3MSWA 1Y4UA 3M6AA 2PNZB 4LF7E 3WU3A 1PJQA 4B3ME 2EOFA 3AV0A 2EPAA 2L3CA 5DRRA 4AQYI 2YTQA 1T38A 5AE3A 4B3SE 4RH8A 2JEBA 2V87A 2VE7C 2X7IA 1N36E 1A1JA 4BCAA 2HHHE 2EM6A 1KJKA 5K36D 4BC7A 1ZBTA 3C4TA 1JK2A 1S16A 2BV3A 3C6KA 2PNZA 4L5NC 5FLXQ 4LF7I 2EOQA 3THNA 4B3MI 1E3PA 1AH5A 4DV0E 2GLIA 4HY1A 2J65A 5A6JA 5C0XE 2DB2A 2N8XA 2JPAA 2V89A 1GTKA 4GKJE 2YSPA 1YH8A 1WRJA 2IOPA 3Q6MA 4B3SI 3FIGA 2EN3A 1FNMA 2PNLA 2LMZA 2HK2A 1ZR9A 3EPJA 1NZ0A 4U3DA 2HHHI 1H7UA 2V88A 1H73A 4NHRA 4JI3E 1FWKA 2DSYA 1H7SA 4MYTA 5EKWA 3J7AM 4F9BB 2NN6C 4OO1C 4DV0I 1AAYA 1IBLE 2LE2A 1WHQA 4GKJI 3QT6A 2CVEA 3LTOA 2BA1G 2UUBE 2E1RA 1DGCA 4MYUA 2YRKA 4GKKE 4KHPI 4BC9A 2UXDE 5A2QQ 2GQ0A 4IZJB 1BBGA 4DPUA 4JI3I 2LT7A 1BKNA 5C0XB 2ENAA 1NEIA 2B9DA 4LCHA 2V2ZA 1IBLI 3LPSA 1WJPA 2EM4A 2EN2A 1EA6A 2VF1A 2YRHA 2UUAE 1QZRA 3GONA 4DR5E 4LCFA 1XMOE 1TF3A 4JI4E 2JT2A 3WU5A 3J81C 4GKKI 2PRTA 2EM0A 1IBME 1RMDA 4IZJA 3CDJA 4JI0E 1Y6ZA 5GMDA 5C0XA 3J81Q 2WZOA 3IWCA 2MKNA 1ZBQA 2KONA 1YUIA 5C0XC 3PYFA 2UUAI 4AIMA 2F1DA 2EMWA 2EORA 1BBOA 3QT7A 4JI4I 2RS7A 4WUCA 2YPNA 2NUEA 2UXCE 5AC5A 3VK6A 1N33I 4HTGA 4BBYA 3M85G 2RSIA 4WXCA 4MU4A 4LF6I 1EKZA 2VRDA 4DUZE 1NCSA 1A1KA 2BA1D 2EOIA 2LTRA 1X47A 3OMLA 3ADLA 3EPLA 1X48A 2UXCI 1I94E 4WXDA 3M7NG 1J26A 2DRPA 5F3WA 2C39B 2XEXA 2HKEA 2JOXA 4F9CB 5K36F 2EPXA 2HFUA 2EMGA 2EOYA 2V85A 1FI4A 3PS3A 3WU4A 5JEAE 2DEJA 3H4LA 3PYDA 1UDOA 4DUZI 2DIXA 2HFSA 4IS1C 3PS1A 1K47A 4DV7I 4LF4E 1I94I 4MU0A 4QNKA 1Y4SA 5KL2A 1RR9A 2C39A 1O0WA 1Y5YA 2A25A 4X64E 1X3CA 3P3GA 3QG5C 2ELZA 1MU5A 2ZITA 1R6LA 4MDTA 2RTXA 1USUA 2GHFA 2EQ0A 2YRMA 4LFCE 2IHR1 2EMKA 4LFBE 4DR3E 2HJJA 1A6FA 1UDQA 2Z5BB 4LF4I 4BMJA 2UXBE 4ZYDA 4WSPA 2MC6A 4FK5C 4TUGA 4DV2E 4BS9A 1IQOA 2LTSA 4PU9A 2PO0B 1RHYA 4X9JA 5JEAB 1HNZE 2JE6B 4HACB 1Z1BA 4LFCI 2H36X 2Z5BA 2EOHA 1TN9A 4DR3I 5BR8I 2EL5A 4LFBI 4UT4A 3M7ND 2OI2A 4R2DA 1VISA 2O1VA 2PO0A 2CG9A 4X65E 5DNYA 4M9VC 5DRQA 1OYPA 4DV2I 1EH6A 2PO1B 4IJDA 4B3RE 1E3HA 1MG7A 5JEAA 2D9HA 4DR6E 2YTPA 2JE6A 4HACA 5KL4A 1FKAE 1HNZI 2J7KA 2I13A 4WFTA 3IWBA 2Q2EB 2EL6A 3M99B 1NHIA 4ED4A 2V83A 3THOB 1BB8A 3UHMA 2RS6A 4URLA 2E72A 2BBGA 4R2QA 4X65I 2PO1A 1OJ4A 1RQ0A 4YY3E 4B3RI 4HEIA 2GPIA 4DR6I 2YTFA 3PS2A 1WXRA 1X6HA 4K0KI 4JI6E 1UDNA 1A1FA 2A2DA 4QNJA 4JI5I 2EN1A 3PYEA 3LMLA 4PRVA 2HKJA 5DROA 4LF9I 4P78A 2LJUA 5AE1A 4NXME 2IOQA 5LL6R 4DV5E 2YTJA 2BM0A 2X36A 4NZVA 2RQLA 1UBDC 4YY3I 5FLXC 4Z7YA 4WUBA 1Z0GA 4IZJD 5EL9A 4OO1B 2NN6B 2EP3A 4DV6E 5C0XD 2LRSA 4N3OA 4HXZA 3P76A 2ADRA 2EM3A 4ZVIA 4AIDA 4DV1E 3BBGA 1PJSA 3F6GA 5ADZA 1DQ3A 1MGTA 2EOMA 4FW9A 4NXMI 1YYKA 2V86A 4FWDA 4DV5I 4DKKA 1KVKA 1EI1A 1N36I 1RREA 4LFAE 4IFDF 4ISAA 4OO1A 2NN6A 4DU8A 1EH7A 5TSEA 1TF6A 3H09A 2EPRA 3L7ZB 4DV6I 1WUUA 3F6HA 1ELOA 2Z5CB 4F6NA 5DNXA 5DRPA 1YHCA 4DV1I 2FTXB 2UU9E 2MDRA 4DPXA 2NABA 1Z0VA 3ZZUA 2EM2A 4X66E 3HKMA 1ZXNA 2WBTA 4GEQB 3DJWA 5A2QC 2LBSB 4LFAI 4KWYA 4AM3A 4UTGA 5K36E 3L7ZA 2DMYA 5KL3A 1NHJA 2EPZA 2Z5CA 5KL7A 3J7AG 3ECRA 2UU9I 4F54A 3BGHA 4BA2B 4X66I 2V8QB 1X5WA 4I3HA 1R6MA 2UUBI 2EWLA 5AE2A 2M7QA 4B3TE 4JG4A 2UXDI 2V8PA 4USKA 2O3ZA 2EPUA 2EM9A 1ZM3A 2WNRB 2K4VA 2J7JA 2CSHA 4BA2A 4GQUA 2AE8A 3ZZ0A 1FWLA 4DR5I 4ZYHA 3VHTB 5FWKA 1XMOI 5IWAE 2WP8B 4YHHE 2HGHA 3ZKBA 3V2UC 4B3TI 1IBMI 1KIJA 3LNUA 4JI0I 4N4RB 4WUDA 1N34E 3JTZA 2ENCA 2YTEA 2ODRD 4ZYGA 1IBKE 2Z5EA 4FW6A 1Z0BA 1STUA 4DPTA 2L2MA 2EE8A 2JEAB 2B7VA 2LUPB 1A1GA 2NUGA 3ZOQB 2YWQA 2L8TA 2WP8A 4WYQB 5L3JA 5IWAI 4YHHI 2F4VE 3HPZA 4Q28A 4DV3E 3CDIA 5JEAD 5K36C 2I9IA 1N34I 3B4TA 3P3EA 1KTVA 2MKDA 3OTOE 2EFGA 4F9AB 3GCMA 1HNXE 2B7TA 1X49A 1ZU1A 3L00A 4HYMA 2N3HA 4U3BA 2JEAA 4JI1E 1WHNA 2DEIA 4XTJA 2YTOA 2EL4A 5ELWA 1LLMC 2F4VI 4JI7E 4DV3I 2EN6A 1IQSA 2EPCA 2JP9A 1MEYC 1ZXMA 2YTNA 1SFEA 2DLKA 3K6QA 2WBUA 2EOXA 3OTOI 2UXBI 1X6FA 1HNXI 4LTYA 4P52A 4OX9E 4JI1I 5CFFE 2EZ6A 3PRYA 4R2SA 3D4JA 1A1IA 2EPOA 3JAMC 1ZAAC 3B82A 4JI7I 2LVHA 2JVAA 4LPFA 3JAMQ 2LCEA 4X64I 1Z5CA 2EQ1A 4P7DA 4WSGA 2BA0D 2NPFA 4MLVA 2WW4A 3P3CA 1J5EE 1XMQE 3H1CA 4OX9I 2ZBKB 4M30A 2EOOA 3AUZA 2F8BA 4IFDE 1DARA 1KKHA 2HC5A 1PIEA 2LJPA 4BHCA 1PJTA 3CWVA 1PKPA 4JYAE 4OO1D 2NN6D 4R8OA 2MC5A 4MLQA 4IS9A 2CPNA 4R2CA 3P06A 1J5EI 2EM7A 1XMQI 5IV8B 3B78A 4JI2E 4KZSA 1T4LB 1YYOA 1S4EA 5A69A 3HQ1A 1T39A 4JYAI 2WCC3 2BR2B 4JV5E 2IERA 1QU6A 4GZNC 2L92A 2BM1A 2NA2A 2EN4A 2B3TB 5A6BA 3U1YA 4MQYA 2L2KB 2EOSA 3HXLA 3T1YE 2YTDA 3MHHC 1H74A 1A1LA 3ZZTA 4IFDB 4LOMA 2LO3A 4RPFA 3KWRA 1HK7A 4R03A 4FWHA 2NUFA 1KYQA 3EPKA 2BR2A 2KOUA 5AC4A 3KRNA 2ENHA 4DU7A 1XXEA 2CTDA 1UHZA 2MDGA 5KL6A 2EMXA 2JY9A 5LMUE 3BF2A 4WPYA 1P42A 4TUIA 1DI2A 4FW7A 5GMEA 5JEAF 4JI6I 2EMZA 2YZTA 5AASA 3BIDA 3T1YI 1X6EA 4IFDA 1T4OA 5T6JA 4BA1B 2YTGA 2VESA 1FJGE 3K17A 3PYGA 2V34A 2G7HA 4IFDC 2LJHA 2V2VA 2ELYA 2EMLA 4R2EA 4DV4E 4M2ZA 2EPPA 4Q35B 5KL5A 1P47A 2VF3A 1ZM2A 5LMUI 1B69A 1Z0CA 3WU6A 1GQEA 2YU5A 4OZEA 1UEKA 4BA1A 4OOGC 2EPMX 2AJ4A 3HULA 2EMIA 3C4BA 1A1HA 4F6MA 4O43A 1FJGI 2N3GA 4ZYEA 2JR1A 4IZKB 2EM5A 4R2RA 3KZYA 2C38B 4DV4I 2EQ3A 1PDAA 4DR7E 4FWGA 1UILA 2K7IA 2JXPA 3LLHA 2L6MA 2DLQA 3ZM7A 1QNTA 1Z5BA 3QT5A 2RPCA 2O1UA 1XHKA 4IZKA 4KHPE 2C38A 4J8ZA 4DR2E 4DPYA 4DR7I 4L8NA 1G2DC 2EM8A 1PVGA 3GMEA 2YTIA 2JOBA 5IXMB 4OO1F 2NN6F 2M9AA 1UN6B 4M0VA 1UDSA 1Z0WA 1Z5AA 1B62A 3UK3C 4RHBB 2YU8A 1OYRA 3QT8A 2L3JA 1Z59A 4LU9A 3J80C 4USMA 4JI8E 5LMNE 3ADIA 5K36B 3MHSC 4DXLA 2GS8A 4DR2I 2EMBA 1YFHA 2YSOA 2C37B 3J80Q 1ZM4A 2WNRA 4LCGA 1RC7A 4O24A 3C6MA 1HNWE 2V2QA 2JYAA 4DUYE 4LF8E 3K85A 2BA0G 2CZ9A 1N33E 3HJCA 1H72C 4JI8I 2E5LE 4PRXA 5LMNI 5K36A 2KHXA 2DGCA 1MX0A 2EOJA 2C37A 4Z7CA 4LF6E 3Q1QA 1XNRE 2O1TA 2EPLX 4X62E 2LUQA 2R42A 2L2NA 1VI7A 4M1KA 1HNWI 5LLQA 4DUYI 4LF8I 1IBKI 5DNLA 5C0XF 2VQFE 4FW5A 2E5LI 2CT1A 4O4KA 1B63A 4MU3A 4DR1E 3P1XA 3B8HA 4DR4E 1EH8A 3TQMA 5IT9C 2JEBB 3IWDA 4X62I 1XNRI 4I8OA 4OKGA 2ZM6E 5IT9Q 5A6BD 4FN5A 4DV7E 4LF5E 2VQFI 2R1FA 3T1HE 4FW3A 4DR1I 2EMHA 4J3DA 3HTXA 4DR4I 2EJ4A
chains in the Genus database with same CATH topology
1U2RA 3VYXA 1YZ9A 2ZM6I 1Z0EA 1T4NA 2CGEA 4X8WA 2JWOA 4LF5I 2VQEE 3RMPA 3T1HI 3Q6NA 2FV4B 2M4IA 1HR0E 2L33A 1N32E 1USVA 1D6TA 1YYWA 2E1MA 4KQVA 5BR8E 2HK3A 3F0NA 2RSMA 4DMIA 4P7AA 2VQEI 3ZKDA 3ADGA 1Z0TA 1NHHA 1N0UA 1HR0I 3ADJA 2PNMA 1N32I 4NXNE 2M1SA 2R3VA 3V5RA 2UUCE 3VYYA 3JU0A 1XNQE 2ODRC 4EMDA 4R1FA 4JI2I 1GZ6A 3J7Yp 4K0KE 4NXNI 4JI5E 4JV5I 3K1JA 3DF6A 3HPSA 2UUCI 1XNQI 4LF9E 4AQYE 1SR9A 2YT4A 2A2CA 2O1WA 2FGGA 1ZM9A 4DPWA 1N0VC 3MSWA 1Y4UA 3M6AA 4LF7E 3WU3A 4B3ME 3AV0A 2L3CA 4AQYI 5AE3A 4B3SE 2V87A 2VE7C 2X7IA 1N36E 4BCAA 2HHHE 4BC7A 1ZBTA 3C4TA 1S16A 2BV3A 4L5NC 5FLXQ 4LF7I 4B3MI 4DV0E 4HY1A 2DB2A 2V89A 4GKJE 2IOPA 4B3SI 3Q6MA 3FIGA 1FNMA 2PNLA 2LMZA 2HK2A 2HHHI 1NZ0A 1H7UA 2V88A 1H73A 4JI3E 1FWKA 1H7SA 2DSYA 4MYTA 3J7AM 4F9BB 4DV0I 1IBLE 2LE2A 1WHQA 4GKJI 3QT6A 3LTOA 2UUBE 2E1RA 4MYUA 4GKKE 4KHPI 4BC9A 2UXDE 5A2QQ 2GQ0A 4IZJB 4DPUA 4JI3I 1BKNA 2B9DA 1IBLI 2V2ZA 3LPSA 1EA6A 2VF1A 1QZRA 2UUAE 3GONA 4DR5E 1XMOE 4JI4E 3WU5A 3J81C 4GKKI 1IBME 4IZJA 5GMDA 4JI0E 1Y6ZA 3J81Q 2WZOA 3IWCA 1ZBQA 2KONA 3PYFA 2UUAI 3QT7A 4JI4I 2RS7A 4WUCA 2NUEA 2UXCE 1N33I 3VK6A 4BBYA 4LF6I 1EKZA 4DUZE 2LTRA 3OMLA 1X47A 3ADLA 1X48A 2UXCI 1I94E 1J26A 5F3WA 2XEXA 2HKEA 2JOXA 4F9CB 2HFUA 2V85A 1FI4A 4DUZI 3WU4A 2DEJA 3H4LA 3PYDA 2DIXA 2HFSA 1K47A 4DV7I 4LF4E 1I94I 1Y4SA 1RR9A 1O0WA 4X64E 1MU5A 2ZITA 2RTXA 1USUA 3PRYA 4LFCE 2IHR1 4LFBE 4DR3E 1A6FA 2Z5BB 4LF4I 4BMJA 2UXBE 4WSPA 2MC6A 4DV2E 4TUGA 4BS9A 2LTSA 4PU9A 1HNZE 4HACB 4LFCI 2H36X 2Z5BA 4DR3I 4LFBI 5BR8I 4UT4A 2OI2A 1VISA 2O1VA 2UXBI 2CG9A 4X65E 5DNYA 4DV2I 4B3RE 1MG7A 4DR6E 4HACA 1HNZI 1FKAE 2J7KA 4WFTA 3IWBA 2Q2EB 4ED4A 1NHIA 2V83A 4URLA 2RS6A 4X65I 1OJ4A 1RQ0A 4YY3E 4B3RI 4DR6I 1WXRA 4K0KI 4JI6E 4JI5I 2A2DA 3PYEA 3LMLA 4PRVA 2HKJA 4LF9I 4P78A 5AE1A 4NXME 2IOQA 5LL6R 4DV5E 2BM0A 2X36A 4YY3I 5FLXC 4Z7YA 4WUBA 1Z0GA 4IZJD 4DV6E 2LRSA 4N3OA 4HXZA 4ZVIA 4DV1E 3F6GA 5ADZA 1DQ3A 4FW9A 4NXMI 1YYKA 2V86A 4FWDA 4DV5I 4DKKA 1KVKA 1EI1A 1N36I 1RREA 4LFAE 4DU8A 3H09A 4DV6I 1WUUA 3F6HA 1ELOA 2Z5CB 4DV1I 2FTXB 2UU9E 2MDRA 4DPXA 1Z0VA 3ZZUA 4X66E 1ZXNA 4GEQB 3DJWA 5A2QC 2LBSB 4LFAI 4UTGA 2DMYA 1NHJA 2Z5CA 3J7AG 2UU9I 4F54A 4X66I 2V8QB 4I3HA 2UUBI 2EWLA 5AE2A 2M7QA 4B3TE 4JG4A 2UXDI 2V8PA 4USKA 1ZM3A 2K4VA 3ZZ0A 1FWLA 4DR5I 1XMOI 5FWKA 5IWAE 3ZKBA 4YHHE 3V2UC 4B3TI 1IBMI 1KIJA 3LNUA 4JI0I 4WUDA 1N34E 3JTZA 2ODRD 1IBKE 2Z5EA 1Z0BA 1STUA 4DPTA 2L2MA 2B7VA 2LUPB 2NUGA 3ZOQB 2L8TA 4WYQB 5L3JA 5IWAI 4YHHI 2F4VE 3HPZA 4Q28A 4DV3E 1N34I 1KTVA 3OTOE 2EFGA 4F9AB 1HNXE 2B7TA 1X49A 4HYMA 2N3HA 4JI1E 1WHNA 2DEIA 4XTJA 2F4VI 4JI7E 4DV3I 1ZXMA 3OTOI 3K6QA 1HNXI 4LTYA 4P52A 4OX9E 4JI1I 5CFFE 2EZ6A 3D4JA 3JAMC 3B82A 4JI7I 2JVAA 3JAMQ 4X64I 1Z5CA 4P7DA 2NPFA 2WW4A 1J5EE 1XMQE 4OX9I 2ZBKB 4M30A 3AUZA 2F8BA 1DARA 1KKHA 1PIEA 2LJPA 3CWVA 1PKPA 4JYAE 4R8OA 2MC5A 2CPNA 3P06A 1J5EI 1XMQI 3B78A 4JI2E 4KZSA 1T4LB 1YYOA 1S4EA 3HQ1A 4JYAI 4JV5E 1QU6A 2L92A 2BM1A 2NA2A 2B3TB 2L2KB 3HXLA 3T1YE 1H74A 3ZZTA 4RPFA 3KWRA 1HK7A 4R03A 4FWHA 2NUFA 2KOUA 4DU7A 1UHZA 2JY9A 5LMUE 4JI6I 4WPYA 4TUIA 1DI2A 5GMEA 2YZTA 5AASA 3T1YI 1T4OA 5T6JA 1FJGE 3K17A 3PYGA 2V34A 2G7HA 2LJHA 2V2VA 4DV4E 4M2ZA 2VF3A 1ZM2A 5LMUI 1Z0CA 3WU6A 1GQEA 1UEKA 4OOGC 2AJ4A 3HULA 1FJGI 3C4BA 2N3GA 4IZKB 2JR1A 4DV4I 4DR7E 4FWGA 1UILA 3LLHA 2L6MA 3ZM7A 1Z5BA 3QT5A 2O1UA 1XHKA 4IZKA 4KHPE 4J8ZA 4DR2E 4DPYA 4DR7I 4L8NA 1PVGA 2JOBA 4M0VA 1Z0WA 1Z5AA 1B62A 3QT8A 2L3JA 1Z59A 4LU9A 3J80C 4USMA 4JI8E 5LMNE 3ADIA 4DXLA 4DR2I 2GS8A 3J80Q 1ZM4A 1RC7A 1HNWE 2V2QA 4DUYE 4LF8E 3K85A 2CZ9A 1N33E 3HJCA 1H72C 4JI8I 2E5LE 4PRXA 5LMNI 2KHXA 1MX0A 4Z7CA 4LF6E 3Q1QA 1XNRE 2O1TA 4X62E 2LUQA 2R42A 2L2NA 4M1KA 1HNWI 4DUYI 4LF8I 1IBKI 2VQFE 2E5LI 1B63A 4DR1E 3P1XA 3B8HA 4DR4E 1XNRI 5IT9C 3IWDA 4X62I 4I8OA 2ZM6E 5IT9Q 4FN5A 4DV7E 4LF5E 2VQFI 3T1HE 4DR1I 3HTXA 4DR4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2R A;  3VYX A;  1YZ9 A;  2ZM6 I;  1Z0E A;  1T4N A;  4X8W A;  4LF5 I;  2VQE E;  3T1H I;  1HR0 E;  2L33 A;  1N32 E;  1D6T A;  1YYW A;  4KQV A;  5BR8 E;  2HK3 A;  3F0N A;  2RSM A;  4P7A A;  2VQE I;  3ZKD A;  3ADG A;  1Z0T A;  1NHH A;  1N0U A;  1HR0 I;  3ADJ A;  1N32 I;  4NXN E;  2R3V A;  3V5R A;  2UUC E;  3VYY A;  1XNQ E;  4EMD A;  4R1F A;  4JI2 I;  3J7Y p;  4K0K E;  4NXN I;  4JI5 E;  4JV5 I;  3K1J A;  2UUC I;  1XNQ I;  4LF9 E;  4AQY E;  2YT4 A;  2A2C A;  1ZM9 A;  4DPW A;  1N0V C;  3M6A A;  4LF7 E;  3WU3 A;  4B3M E;  2L3C A;  4AQY I;  4B3S E;  2X7I A;  1N36 E;  2HHH E;  1ZBT A;  3C4T A;  1S16 A;  2BV3 A;  5FLX Q;  4LF7 I;  4B3M I;  4DV0 E;  4HY1 A;  2DB2 A;  4GKJ E;  4B3S I;  1FNM A;  2HHH I;  2HK2 A;  1NZ0 A;  1H7U A;  1H73 A;  4JI3 E;  1FWK A;  1H7S A;  4MYT A;  3J7A M;  4DV0 I;  1IBL E;  1WHQ A;  4GKJ I;  3QT6 A;  3LTO A;  2UUB E;  2E1R A;  4MYU A;  4GKK E;  4KHP I;  2UXD E;  5A2Q Q;  4DPU A;  4JI3 I;  1BKN A;  1IBL I;  2V2Z A;  3LPS A;  1EA6 A;  1QZR A;  2UUA E;  3GON A;  4DR5 E;  1XMO E;  4JI4 E;  3WU5 A;  3J81 C;  4GKK I;  1IBM E;  5GMD A;  4JI0 E;  3J81 Q;  3PYF A;  2UUA I;  3QT7 A;  4JI4 I;  2RS7 A;  4WUC A;  2NUE A;  2UXC E;  1N33 I;  4LF6 I;  1EKZ A;  4DUZ E;  2LTR A;  1X47 A;  3ADL A;  1X48 A;  2UXC I;  1I94 E;  1J26 A;  2XEX A;  2HKE A;  2HFU A;  1FI4 A;  4DUZ I;  3WU4 A;  2DEJ A;  3H4L A;  3PYD A;  2DIX A;  2HFS A;  1K47 A;  4DV7 I;  4LF4 E;  1I94 I;  1RR9 A;  1O0W A;  4X64 E;  1MU5 A;  2ZIT A;  2RTX A;  4LFC E;  2IHR 1;  4LFB E;  4DR3 E;  1A6F A;  4LF4 I;  2UXB E;  4DV2 E;  2LTS A;  4PU9 A;  1HNZ E;  4HAC B;  4LFC I;  4LFB I;  4DR3 I;  5BR8 I;  4UT4 A;  2OI2 A;  1VIS A;  2UXB I;  4X65 E;  4DV2 I;  4B3R E;  1MG7 A;  4DR6 E;  4HAC A;  1HNZ I;  1FKA E;  2J7K A;  4WFT A;  2Q2E B;  4ED4 A;  1NHI A;  4URL A;  2RS6 A;  4X65 I;  1OJ4 A;  1RQ0 A;  4YY3 E;  4B3R I;  4DR6 I;  4K0K I;  4JI6 E;  4JI5 I;  2A2D A;  3PYE A;  4PRV A;  2HKJ A;  4LF9 I;  4NXM E;  5LL6 R;  4DV5 E;  2BM0 A;  2X36 A;  4YY3 I;  4Z7Y A;  5FLX C;  4WUB A;  1Z0G A;  4DV6 E;  2LRS A;  4HXZ A;  4ZVI A;  4DV1 E;  4FW9 A;  4NXM I;  1YYK A;  4FWD A;  4DV5 I;  4DKK A;  1KVK A;  1EI1 A;  1N36 I;  1RRE A;  4LFA E;  4DU8 A;  4DV6 I;  1WUU A;  1ELO A;  4DV1 I;  2UU9 E;  2MDR A;  4DPX A;  1Z0V A;  3ZZU A;  4X66 E;  1ZXN A;  5A2Q C;  2LBS B;  4LFA I;  4UTG A;  2DMY A;  1NHJ A;  3J7A G;  2UU9 I;  4X66 I;  4I3H A;  2UUB I;  4B3T E;  4JG4 A;  2UXD I;  2V8P A;  4USK A;  1ZM3 A;  3ZZ0 A;  1FWL A;  4DR5 I;  1XMO I;  5IWA E;  3ZKB A;  4YHH E;  3V2U C;  4B3T I;  1IBM I;  1KIJ A;  3LNU A;  4JI0 I;  4WUD A;  1N34 E;  1IBK E;  1Z0B A;  1STU A;  4DPT A;  2L2M A;  2B7V A;  2LUP B;  2NUG A;  4WYQ B;  5L3J A;  5IWA I;  4YHH I;  2F4V E;  4DV3 E;  1N34 I;  1KTV A;  3OTO E;  2EFG A;  1HNX E;  2B7T A;  1X49 A;  4HYM A;  2N3H A;  4JI1 E;  1WHN A;  2DEI A;  4XTJ A;  2F4V I;  4JI7 E;  4DV3 I;  1ZXM A;  3OTO I;  1HNX I;  4P52 A;  4OX9 E;  4JI1 I;  5CFF E;  2EZ6 A;  3D4J A;  3JAM C;  3B82 A;  4JI7 I;  2JVA A;  3JAM Q;  4X64 I;  1Z5C A;  2NPF A;  2WW4 A;  1J5E E;  1XMQ E;  4OX9 I;  2ZBK B;  4M30 A;  1DAR A;  1KKH A;  1PIE A;  2LJP A;  3CWV A;  1PKP A;  4JYA E;  2CPN A;  1J5E I;  1XMQ I;  3B78 A;  4JI2 E;  1T4L B;  1YYO A;  1S4E A;  4JYA I;  4JV5 E;  1QU6 A;  2BM1 A;  2NA2 A;  2B3T B;  2L2K B;  3T1Y E;  1H74 A;  3ZZT A;  4RPF A;  4FWH A;  2NUF A;  4DU7 A;  1UHZ A;  2JY9 A;  5LMU E;  4JI6 I;  1DI2 A;  5GME A;  3T1Y I;  1T4O A;  1FJG E;  3K17 A;  3PYG A;  2V34 A;  2LJH A;  2V2V A;  4DV4 E;  4M2Z A;  2VF3 A;  1ZM2 A;  5LMU I;  1Z0C A;  3WU6 A;  1GQE A;  1UEK A;  4OOG C;  2AJ4 A;  3HUL A;  1FJG I;  3C4B A;  2N3G A;  4DV4 I;  4DR7 E;  4FWG A;  1UIL A;  3LLH A;  3ZM7 A;  1Z5B A;  3QT5 A;  1XHK A;  4KHP E;  4DR2 E;  4DPY A;  4DR7 I;  1PVG A;  1Z0W A;  1Z5A A;  1B62 A;  3QT8 A;  2L3J A;  1Z59 A;  3J80 C;  4USM A;  4JI8 E;  5LMN E;  3ADI A;  4DXL A;  4DR2 I;  2GS8 A;  3J80 Q;  1ZM4 A;  1RC7 A;  1HNW E;  2V2Q A;  4DUY E;  4LF8 E;  2CZ9 A;  1N33 E;  1H72 C;  4JI8 I;  2E5L E;  4PRX A;  5LMN I;  2KHX A;  1MX0 A;  4Z7C A;  4LF6 E;  3Q1Q A;  1XNR E;  4X62 E;  2LUQ A;  2R42 A;  2L2N A;  4M1K A;  1HNW I;  4DUY I;  4LF8 I;  1IBK I;  2VQF E;  2E5L I;  1B63 A;  4DR1 E;  3P1X A;  3B8H A;  4DR4 E;  1XNR I;  5IT9 C;  4X62 I;  2ZM6 E;  5IT9 Q;  4FN5 A;  4DV7 E;  4LF5 E;  2VQF I;  3T1H E;  4DR1 I;  3HTX A;  4DR4 I; 
#chains in the Genus database with same CATH topology
 1U2R A;  1YSA C;  2WBS A;  1IMU A;  3VYX A;  1YZ9 A;  2ZM6 I;  1Z0E A;  1T4N A;  2CGE A;  5A6K A;  4IFD D;  4X8W A;  2JWO A;  4LF5 I;  2VQE E;  3RMP A;  3DD6 A;  3T1H I;  4R2P A;  3Q6N A;  2IES A;  2FV4 B;  2M4I A;  1HR0 E;  2L33 A;  1N32 E;  2LV2 A;  1USV A;  1D6T A;  2DMI A;  1YYW A;  1G2F C;  2E1M A;  1N3G A;  4WX9 A;  3GLL A;  4KQV A;  5BR8 E;  2HK3 A;  2EOZ A;  3F0N A;  2RSM A;  4DMI A;  3M85 D;  2EPK X;  1OYS A;  3KZZ A;  1F2I G;  4P7A A;  3ZKD A;  4R2A A;  3ADG A;  2VQE I;  1Z0T A;  1NHH A;  2EMA A;  1N0U A;  1HR0 I;  3ADJ A;  1YPN A;  2EMC A;  2PNM A;  1N32 I;  2BB8 A;  4NXN E;  2EMF A;  2M1S A;  2R3V A;  3V5R A;  2UUC E;  2GO4 A;  2EOE A;  3VYY A;  2GO3 A;  3JU0 A;  2PO2 B;  1XNQ E;  1Y60 A;  2EN7 A;  2ODR C;  4EMD A;  4FW4 A;  3U1K A;  2EN8 A;  4O5G A;  4R1F A;  5A6A A;  1L4S A;  4JI2 I;  4NBQ A;  1GZ6 A;  3J7Y p;  4K0K E;  4NXN I;  4JI5 E;  4JV5 I;  2NN6 E;  4OO1 E;  2EPN A;  3DF6 A;  3HPS A;  2EMY A;  4BHB A;  2PO2 A;  3K1J A;  5JEA C;  4MU1 A;  2UUC I;  1XNQ I;  4LF9 E;  3EPH A;  3EQ1 A;  4AQY E;  2Q8U A;  1YUJ A;  1SR9 A;  2YT4 A;  2A2C A;  1JK1 A;  2O1W A;  3NZK A;  2FGG A;  1ZM9 A;  2R76 A;  4F2J C;  4DPW A;  1N0V C;  3MSW A;  1Y4U A;  3M6A A;  2PNZ B;  4LF7 E;  3WU3 A;  1PJQ A;  4B3M E;  2EOF A;  3AV0 A;  2EPA A;  2L3C A;  5DRR A;  4AQY I;  2YTQ A;  1T38 A;  5AE3 A;  4B3S E;  4RH8 A;  2JEB A;  2V87 A;  2VE7 C;  2X7I A;  1N36 E;  1A1J A;  4BCA A;  2HHH E;  2EM6 A;  1KJK A;  5K36 D;  4BC7 A;  1ZBT A;  3C4T A;  1JK2 A;  1S16 A;  2BV3 A;  3C6K A;  2PNZ A;  4L5N C;  5FLX Q;  4LF7 I;  2EOQ A;  3THN A;  4B3M I;  1E3P A;  1AH5 A;  4DV0 E;  2GLI A;  4HY1 A;  2J65 A;  5A6J A;  5C0X E;  2DB2 A;  2N8X A;  2JPA A;  2V89 A;  1GTK A;  4GKJ E;  2YSP A;  1YH8 A;  1WRJ A;  2IOP A;  3Q6M A;  4B3S I;  3FIG A;  2EN3 A;  1FNM A;  2PNL A;  2LMZ A;  2HK2 A;  1ZR9 A;  3EPJ A;  1NZ0 A;  4U3D A;  2HHH I;  1H7U A;  2V88 A;  1H73 A;  4NHR A;  4JI3 E;  1FWK A;  2DSY A;  1H7S A;  4MYT A;  5EKW A;  3J7A M;  4F9B B;  2NN6 C;  4OO1 C;  4DV0 I;  1AAY A;  1IBL E;  2LE2 A;  1WHQ A;  4GKJ I;  3QT6 A;  2CVE A;  3LTO A;  2BA1 G;  2UUB E;  2E1R A;  1DGC A;  4MYU A;  2YRK A;  4GKK E;  4KHP I;  4BC9 A;  2UXD E;  5A2Q Q;  2GQ0 A;  4IZJ B;  1BBG A;  4DPU A;  4JI3 I;  2LT7 A;  1BKN A;  5C0X B;  2ENA A;  1NEI A;  2B9D A;  4LCH A;  2V2Z A;  1IBL I;  3LPS A;  1WJP A;  2EM4 A;  2EN2 A;  1EA6 A;  2VF1 A;  2YRH A;  2UUA E;  1QZR A;  3GON A;  4DR5 E;  4LCF A;  1XMO E;  1TF3 A;  4JI4 E;  2JT2 A;  3WU5 A;  3J81 C;  4GKK I;  2PRT A;  2EM0 A;  1IBM E;  1RMD A;  4IZJ A;  3CDJ A;  4JI0 E;  1Y6Z A;  5GMD A;  5C0X A;  3J81 Q;  2WZO A;  3IWC A;  2MKN A;  1ZBQ A;  2KON A;  1YUI A;  5C0X C;  3PYF A;  2UUA I;  4AIM A;  2F1D A;  2EMW A;  2EOR A;  1BBO A;  3QT7 A;  4JI4 I;  2RS7 A;  4WUC A;  2YPN A;  2NUE A;  2UXC E;  5AC5 A;  3VK6 A;  1N33 I;  4HTG A;  4BBY A;  3M85 G;  2RSI A;  4WXC A;  4MU4 A;  4LF6 I;  1EKZ A;  2VRD A;  4DUZ E;  1NCS A;  1A1K A;  2BA1 D;  2EOI A;  2LTR A;  1X47 A;  3OML A;  3ADL A;  3EPL A;  1X48 A;  2UXC I;  1I94 E;  4WXD A;  3M7N G;  1J26 A;  2DRP A;  5F3W A;  2C39 B;  2XEX A;  2HKE A;  2JOX A;  4F9C B;  5K36 F;  2EPX A;  2HFU A;  2EMG A;  2EOY A;  2V85 A;  1FI4 A;  3PS3 A;  3WU4 A;  5JEA E;  2DEJ A;  3H4L A;  3PYD A;  1UDO A;  4DUZ I;  2DIX A;  2HFS A;  4IS1 C;  3PS1 A;  1K47 A;  4DV7 I;  4LF4 E;  1I94 I;  4MU0 A;  4QNK A;  1Y4S A;  5KL2 A;  1RR9 A;  2C39 A;  1O0W A;  1Y5Y A;  2A25 A;  4X64 E;  1X3C A;  3P3G A;  3QG5 C;  2ELZ A;  1MU5 A;  2ZIT A;  1R6L A;  4MDT A;  2RTX A;  1USU A;  2GHF A;  2EQ0 A;  2YRM A;  4LFC E;  2IHR 1;  2EMK A;  4LFB E;  4DR3 E;  2HJJ A;  1A6F A;  1UDQ A;  2Z5B B;  4LF4 I;  4BMJ A;  2UXB E;  4ZYD A;  4WSP A;  2MC6 A;  4FK5 C;  4TUG A;  4DV2 E;  4BS9 A;  1IQO A;  2LTS A;  4PU9 A;  2PO0 B;  1RHY A;  4X9J A;  5JEA B;  1HNZ E;  2JE6 B;  4HAC B;  1Z1B A;  4LFC I;  2H36 X;  2Z5B A;  2EOH A;  1TN9 A;  4DR3 I;  5BR8 I;  2EL5 A;  4LFB I;  4UT4 A;  3M7N D;  2OI2 A;  4R2D A;  1VIS A;  2O1V A;  2PO0 A;  2CG9 A;  4X65 E;  5DNY A;  4M9V C;  5DRQ A;  1OYP A;  4DV2 I;  1EH6 A;  2PO1 B;  4IJD A;  4B3R E;  1E3H A;  1MG7 A;  5JEA A;  2D9H A;  4DR6 E;  2YTP A;  2JE6 A;  4HAC A;  5KL4 A;  1FKA E;  1HNZ I;  2J7K A;  2I13 A;  4WFT A;  3IWB A;  2Q2E B;  2EL6 A;  3M99 B;  1NHI A;  4ED4 A;  2V83 A;  3THO B;  1BB8 A;  3UHM A;  2RS6 A;  4URL A;  2E72 A;  2BBG A;  4R2Q A;  4X65 I;  2PO1 A;  1OJ4 A;  1RQ0 A;  4YY3 E;  4B3R I;  4HEI A;  2GPI A;  4DR6 I;  2YTF A;  3PS2 A;  1WXR A;  1X6H A;  4K0K I;  4JI6 E;  1UDN A;  1A1F A;  2A2D A;  4QNJ A;  4JI5 I;  2EN1 A;  3PYE A;  3LML A;  4PRV A;  2HKJ A;  5DRO A;  4LF9 I;  4P78 A;  2LJU A;  5AE1 A;  4NXM E;  2IOQ A;  5LL6 R;  4DV5 E;  2YTJ A;  2BM0 A;  2X36 A;  4NZV A;  2RQL A;  1UBD C;  4YY3 I;  5FLX C;  4Z7Y A;  4WUB A;  1Z0G A;  4IZJ D;  5EL9 A;  4OO1 B;  2NN6 B;  2EP3 A;  4DV6 E;  5C0X D;  2LRS A;  4N3O A;  4HXZ A;  3P76 A;  2ADR A;  2EM3 A;  4ZVI A;  4AID A;  4DV1 E;  3BBG A;  1PJS A;  3F6G A;  5ADZ A;  1DQ3 A;  1MGT A;  2EOM A;  4FW9 A;  4NXM I;  1YYK A;  2V86 A;  4FWD A;  4DV5 I;  4DKK A;  1KVK A;  1EI1 A;  1N36 I;  1RRE A;  4LFA E;  4IFD F;  4ISA A;  4OO1 A;  2NN6 A;  4DU8 A;  1EH7 A;  5TSE A;  1TF6 A;  3H09 A;  2EPR A;  3L7Z B;  4DV6 I;  1WUU A;  3F6H A;  1ELO A;  2Z5C B;  4F6N A;  5DNX A;  5DRP A;  1YHC A;  4DV1 I;  2FTX B;  2UU9 E;  2MDR A;  4DPX A;  2NAB A;  1Z0V A;  3ZZU A;  2EM2 A;  4X66 E;  3HKM A;  1ZXN A;  2WBT A;  4GEQ B;  3DJW A;  5A2Q C;  2LBS B;  4LFA I;  4KWY A;  4AM3 A;  4UTG A;  5K36 E;  3L7Z A;  2DMY A;  5KL3 A;  1NHJ A;  2EPZ A;  2Z5C A;  5KL7 A;  3J7A G;  3ECR A;  2UU9 I;  4F54 A;  3BGH A;  4BA2 B;  4X66 I;  2V8Q B;  1X5W A;  4I3H A;  1R6M A;  2UUB I;  2EWL A;  5AE2 A;  2M7Q A;  4B3T E;  4JG4 A;  2UXD I;  2V8P A;  4USK A;  2O3Z A;  2EPU A;  2EM9 A;  1ZM3 A;  2WNR B;  2K4V A;  2J7J A;  2CSH A;  4BA2 A;  4GQU A;  2AE8 A;  3ZZ0 A;  1FWL A;  4DR5 I;  4ZYH A;  3VHT B;  5FWK A;  1XMO I;  5IWA E;  2WP8 B;  4YHH E;  2HGH A;  3ZKB A;  3V2U C;  4B3T I;  1IBM I;  1KIJ A;  3LNU A;  4JI0 I;  4N4R B;  4WUD A;  1N34 E;  3JTZ A;  2ENC A;  2YTE A;  2ODR D;  4ZYG A;  1IBK E;  2Z5E A;  4FW6 A;  1Z0B A;  1STU A;  4DPT A;  2L2M A;  2EE8 A;  2JEA B;  2B7V A;  2LUP B;  1A1G A;  2NUG A;  3ZOQ B;  2YWQ A;  2L8T A;  2WP8 A;  4WYQ B;  5L3J A;  5IWA I;  4YHH I;  2F4V E;  3HPZ A;  4Q28 A;  4DV3 E;  3CDI A;  5JEA D;  5K36 C;  2I9I A;  1N34 I;  3B4T A;  3P3E A;  1KTV A;  2MKD A;  3OTO E;  2EFG A;  4F9A B;  3GCM A;  1HNX E;  2B7T A;  1X49 A;  1ZU1 A;  3L00 A;  4HYM A;  2N3H A;  4U3B A;  2JEA A;  4JI1 E;  1WHN A;  2DEI A;  4XTJ A;  2YTO A;  2EL4 A;  5ELW A;  1LLM C;  2F4V I;  4JI7 E;  4DV3 I;  2EN6 A;  1IQS A;  2EPC A;  2JP9 A;  1MEY C;  1ZXM A;  2YTN A;  1SFE A;  2DLK A;  3K6Q A;  2WBU A;  2EOX A;  3OTO I;  2UXB I;  1X6F A;  1HNX I;  4LTY A;  4P52 A;  4OX9 E;  4JI1 I;  5CFF E;  2EZ6 A;  3PRY A;  4R2S A;  3D4J A;  1A1I A;  2EPO A;  3JAM C;  1ZAA C;  3B82 A;  4JI7 I;  2LVH A;  2JVA A;  4LPF A;  3JAM Q;  2LCE A;  4X64 I;  1Z5C A;  2EQ1 A;  4P7D A;  4WSG A;  2BA0 D;  2NPF A;  4MLV A;  2WW4 A;  3P3C A;  1J5E E;  1XMQ E;  3H1C A;  4OX9 I;  2ZBK B;  4M30 A;  2EOO A;  3AUZ A;  2F8B A;  4IFD E;  1DAR A;  1KKH A;  2HC5 A;  1PIE A;  2LJP A;  4BHC A;  1PJT A;  3CWV A;  1PKP A;  4JYA E;  4OO1 D;  2NN6 D;  4R8O A;  2MC5 A;  4MLQ A;  4IS9 A;  2CPN A;  4R2C A;  3P06 A;  1J5E I;  2EM7 A;  1XMQ I;  5IV8 B;  3B78 A;  4JI2 E;  4KZS A;  1T4L B;  1YYO A;  1S4E A;  5A69 A;  3HQ1 A;  1T39 A;  4JYA I;  2WCC 3;  2BR2 B;  4JV5 E;  2IER A;  1QU6 A;  4GZN C;  2L92 A;  2BM1 A;  2NA2 A;  2EN4 A;  2B3T B;  5A6B A;  3U1Y A;  4MQY A;  2L2K B;  2EOS A;  3HXL A;  3T1Y E;  2YTD A;  3MHH C;  1H74 A;  1A1L A;  3ZZT A;  4IFD B;  4LOM A;  2LO3 A;  4RPF A;  3KWR A;  1HK7 A;  4R03 A;  4FWH A;  2NUF A;  1KYQ A;  3EPK A;  2BR2 A;  2KOU A;  5AC4 A;  3KRN A;  2ENH A;  4DU7 A;  1XXE A;  2CTD A;  1UHZ A;  2MDG A;  5KL6 A;  2EMX A;  2JY9 A;  5LMU E;  3BF2 A;  4WPY A;  1P42 A;  4TUI A;  1DI2 A;  4FW7 A;  5GME A;  5JEA F;  4JI6 I;  2EMZ A;  2YZT A;  5AAS A;  3BID A;  3T1Y I;  1X6E A;  4IFD A;  1T4O A;  5T6J A;  4BA1 B;  2YTG A;  2VES A;  1FJG E;  3K17 A;  3PYG A;  2V34 A;  2G7H A;  4IFD C;  2LJH A;  2V2V A;  2ELY A;  2EML A;  4R2E A;  4DV4 E;  4M2Z A;  2EPP A;  4Q35 B;  5KL5 A;  1P47 A;  2VF3 A;  1ZM2 A;  5LMU I;  1B69 A;  1Z0C A;  3WU6 A;  1GQE A;  2YU5 A;  4OZE A;  1UEK A;  4BA1 A;  4OOG C;  2EPM X;  2AJ4 A;  3HUL A;  2EMI A;  3C4B A;  1A1H A;  4F6M A;  4O43 A;  1FJG I;  2N3G A;  4ZYE A;  2JR1 A;  4IZK B;  2EM5 A;  4R2R A;  3KZY A;  2C38 B;  4DV4 I;  2EQ3 A;  1PDA A;  4DR7 E;  4FWG A;  1UIL A;  2K7I A;  2JXP A;  3LLH A;  2L6M A;  2DLQ A;  3ZM7 A;  1QNT A;  1Z5B A;  3QT5 A;  2RPC A;  2O1U A;  1XHK A;  4IZK A;  4KHP E;  2C38 A;  4J8Z A;  4DR2 E;  4DPY A;  4DR7 I;  4L8N A;  1G2D C;  2EM8 A;  1PVG A;  3GME A;  2YTI A;  2JOB A;  5IXM B;  4OO1 F;  2NN6 F;  2M9A A;  1UN6 B;  4M0V A;  1UDS A;  1Z0W A;  1Z5A A;  1B62 A;  3UK3 C;  4RHB B;  2YU8 A;  1OYR A;  3QT8 A;  2L3J A;  1Z59 A;  4LU9 A;  3J80 C;  4USM A;  4JI8 E;  5LMN E;  3ADI A;  5K36 B;  3MHS C;  4DXL A;  2GS8 A;  4DR2 I;  2EMB A;  1YFH A;  2YSO A;  2C37 B;  3J80 Q;  1ZM4 A;  2WNR A;  4LCG A;  1RC7 A;  4O24 A;  3C6M A;  1HNW E;  2V2Q A;  2JYA A;  4DUY E;  4LF8 E;  3K85 A;  2BA0 G;  2CZ9 A;  1N33 E;  3HJC A;  1H72 C;  4JI8 I;  2E5L E;  4PRX A;  5LMN I;  5K36 A;  2KHX A;  2DGC A;  1MX0 A;  2EOJ A;  2C37 A;  4Z7C A;  4LF6 E;  3Q1Q A;  1XNR E;  2O1T A;  2EPL X;  4X62 E;  2LUQ A;  2R42 A;  2L2N A;  1VI7 A;  4M1K A;  1HNW I;  5LLQ A;  4DUY I;  4LF8 I;  1IBK I;  5DNL A;  5C0X F;  2VQF E;  4FW5 A;  2E5L I;  2CT1 A;  4O4K A;  1B63 A;  4MU3 A;  4DR1 E;  3P1X A;  3B8H A;  4DR4 E;  1EH8 A;  3TQM A;  5IT9 C;  2JEB B;  3IWD A;  4X62 I;  1XNR I;  4I8O A;  4OKG A;  2ZM6 E;  5IT9 Q;  5A6B D;  4FN5 A;  4DV7 E;  4LF5 E;  2VQF I;  2R1F A;  3T1H E;  4FW3 A;  4DR1 I;  2EMH A;  4J3D A;  3HTX A;  4DR4 I;  2EJ4 A; 
#chains in the Genus database with same CATH homology
 1U2R A;  3VYX A;  1YZ9 A;  2ZM6 I;  1Z0E A;  1T4N A;  2CGE A;  4X8W A;  2JWO A;  4LF5 I;  2VQE E;  3RMP A;  3T1H I;  3Q6N A;  2FV4 B;  2M4I A;  1HR0 E;  2L33 A;  1N32 E;  1USV A;  1D6T A;  1YYW A;  2E1M A;  4KQV A;  5BR8 E;  2HK3 A;  3F0N A;  2RSM A;  4DMI A;  4P7A A;  2VQE I;  3ZKD A;  3ADG A;  1Z0T A;  1NHH A;  1N0U A;  1HR0 I;  3ADJ A;  2PNM A;  1N32 I;  4NXN E;  2M1S A;  2R3V A;  3V5R A;  2UUC E;  3VYY A;  3JU0 A;  1XNQ E;  2ODR C;  4EMD A;  4R1F A;  4JI2 I;  1GZ6 A;  3J7Y p;  4K0K E;  4NXN I;  4JI5 E;  4JV5 I;  3K1J A;  3DF6 A;  3HPS A;  2UUC I;  1XNQ I;  4LF9 E;  4AQY E;  1SR9 A;  2YT4 A;  2A2C A;  2O1W A;  2FGG A;  1ZM9 A;  4DPW A;  1N0V C;  3MSW A;  1Y4U A;  3M6A A;  4LF7 E;  3WU3 A;  4B3M E;  3AV0 A;  2L3C A;  4AQY I;  5AE3 A;  4B3S E;  2V87 A;  2VE7 C;  2X7I A;  1N36 E;  4BCA A;  2HHH E;  4BC7 A;  1ZBT A;  3C4T A;  1S16 A;  2BV3 A;  4L5N C;  5FLX Q;  4LF7 I;  4B3M I;  4DV0 E;  4HY1 A;  2DB2 A;  2V89 A;  4GKJ E;  2IOP A;  4B3S I;  3Q6M A;  3FIG A;  1FNM A;  2PNL A;  2LMZ A;  2HK2 A;  2HHH I;  1NZ0 A;  1H7U A;  2V88 A;  1H73 A;  4JI3 E;  1FWK A;  1H7S A;  2DSY A;  4MYT A;  3J7A M;  4F9B B;  4DV0 I;  1IBL E;  2LE2 A;  1WHQ A;  4GKJ I;  3QT6 A;  3LTO A;  2UUB E;  2E1R A;  4MYU A;  4GKK E;  4KHP I;  4BC9 A;  2UXD E;  5A2Q Q;  2GQ0 A;  4IZJ B;  4DPU A;  4JI3 I;  1BKN A;  2B9D A;  1IBL I;  2V2Z A;  3LPS A;  1EA6 A;  2VF1 A;  1QZR A;  2UUA E;  3GON A;  4DR5 E;  1XMO E;  4JI4 E;  3WU5 A;  3J81 C;  4GKK I;  1IBM E;  4IZJ A;  5GMD A;  4JI0 E;  1Y6Z A;  3J81 Q;  2WZO A;  3IWC A;  1ZBQ A;  2KON A;  3PYF A;  2UUA I;  3QT7 A;  4JI4 I;  2RS7 A;  4WUC A;  2NUE A;  2UXC E;  1N33 I;  3VK6 A;  4BBY A;  4LF6 I;  1EKZ A;  4DUZ E;  2LTR A;  3OML A;  1X47 A;  3ADL A;  1X48 A;  2UXC I;  1I94 E;  1J26 A;  5F3W A;  2XEX A;  2HKE A;  2JOX A;  4F9C B;  2HFU A;  2V85 A;  1FI4 A;  4DUZ I;  3WU4 A;  2DEJ A;  3H4L A;  3PYD A;  2DIX A;  2HFS A;  1K47 A;  4DV7 I;  4LF4 E;  1I94 I;  1Y4S A;  1RR9 A;  1O0W A;  4X64 E;  1MU5 A;  2ZIT A;  2RTX A;  1USU A;  3PRY A;  4LFC E;  2IHR 1;  4LFB E;  4DR3 E;  1A6F A;  2Z5B B;  4LF4 I;  4BMJ A;  2UXB E;  4WSP A;  2MC6 A;  4DV2 E;  4TUG A;  4BS9 A;  2LTS A;  4PU9 A;  1HNZ E;  4HAC B;  4LFC I;  2H36 X;  2Z5B A;  4DR3 I;  4LFB I;  5BR8 I;  4UT4 A;  2OI2 A;  1VIS A;  2O1V A;  2UXB I;  2CG9 A;  4X65 E;  5DNY A;  4DV2 I;  4B3R E;  1MG7 A;  4DR6 E;  4HAC A;  1HNZ I;  1FKA E;  2J7K A;  4WFT A;  3IWB A;  2Q2E B;  4ED4 A;  1NHI A;  2V83 A;  4URL A;  2RS6 A;  4X65 I;  1OJ4 A;  1RQ0 A;  4YY3 E;  4B3R I;  4DR6 I;  1WXR A;  4K0K I;  4JI6 E;  4JI5 I;  2A2D A;  3PYE A;  3LML A;  4PRV A;  2HKJ A;  4LF9 I;  4P78 A;  5AE1 A;  4NXM E;  2IOQ A;  5LL6 R;  4DV5 E;  2BM0 A;  2X36 A;  4YY3 I;  5FLX C;  4Z7Y A;  4WUB A;  1Z0G A;  4IZJ D;  4DV6 E;  2LRS A;  4N3O A;  4HXZ A;  4ZVI A;  4DV1 E;  3F6G A;  5ADZ A;  1DQ3 A;  4FW9 A;  4NXM I;  1YYK A;  2V86 A;  4FWD A;  4DV5 I;  4DKK A;  1KVK A;  1EI1 A;  1N36 I;  1RRE A;  4LFA E;  4DU8 A;  3H09 A;  4DV6 I;  1WUU A;  3F6H A;  1ELO A;  2Z5C B;  4DV1 I;  2FTX B;  2UU9 E;  2MDR A;  4DPX A;  1Z0V A;  3ZZU A;  4X66 E;  1ZXN A;  4GEQ B;  3DJW A;  5A2Q C;  2LBS B;  4LFA I;  4UTG A;  2DMY A;  1NHJ A;  2Z5C A;  3J7A G;  2UU9 I;  4F54 A;  4X66 I;  2V8Q B;  4I3H A;  2UUB I;  2EWL A;  5AE2 A;  2M7Q A;  4B3T E;  4JG4 A;  2UXD I;  2V8P A;  4USK A;  1ZM3 A;  2K4V A;  3ZZ0 A;  1FWL A;  4DR5 I;  1XMO I;  5FWK A;  5IWA E;  3ZKB A;  4YHH E;  3V2U C;  4B3T I;  1IBM I;  1KIJ A;  3LNU A;  4JI0 I;  4WUD A;  1N34 E;  3JTZ A;  2ODR D;  1IBK E;  2Z5E A;  1Z0B A;  1STU A;  4DPT A;  2L2M A;  2B7V A;  2LUP B;  2NUG A;  3ZOQ B;  2L8T A;  4WYQ B;  5L3J A;  5IWA I;  4YHH I;  2F4V E;  3HPZ A;  4Q28 A;  4DV3 E;  1N34 I;  1KTV A;  3OTO E;  2EFG A;  4F9A B;  1HNX E;  2B7T A;  1X49 A;  4HYM A;  2N3H A;  4JI1 E;  1WHN A;  2DEI A;  4XTJ A;  2F4V I;  4JI7 E;  4DV3 I;  1ZXM A;  3OTO I;  3K6Q A;  1HNX I;  4LTY A;  4P52 A;  4OX9 E;  4JI1 I;  5CFF E;  2EZ6 A;  3D4J A;  3JAM C;  3B82 A;  4JI7 I;  2JVA A;  3JAM Q;  4X64 I;  1Z5C A;  4P7D A;  2NPF A;  2WW4 A;  1J5E E;  1XMQ E;  4OX9 I;  2ZBK B;  4M30 A;  3AUZ A;  2F8B A;  1DAR A;  1KKH A;  1PIE A;  2LJP A;  3CWV A;  1PKP A;  4JYA E;  4R8O A;  2MC5 A;  2CPN A;  3P06 A;  1J5E I;  1XMQ I;  3B78 A;  4JI2 E;  4KZS A;  1T4L B;  1YYO A;  1S4E A;  3HQ1 A;  4JYA I;  4JV5 E;  1QU6 A;  2L92 A;  2BM1 A;  2NA2 A;  2B3T B;  2L2K B;  3HXL A;  3T1Y E;  1H74 A;  3ZZT A;  4RPF A;  3KWR A;  1HK7 A;  4R03 A;  4FWH A;  2NUF A;  2KOU A;  4DU7 A;  1UHZ A;  2JY9 A;  5LMU E;  4JI6 I;  4WPY A;  4TUI A;  1DI2 A;  5GME A;  2YZT A;  5AAS A;  3T1Y I;  1T4O A;  5T6J A;  1FJG E;  3K17 A;  3PYG A;  2V34 A;  2G7H A;  2LJH A;  2V2V A;  4DV4 E;  4M2Z A;  2VF3 A;  1ZM2 A;  5LMU I;  1Z0C A;  3WU6 A;  1GQE A;  1UEK A;  4OOG C;  2AJ4 A;  3HUL A;  1FJG I;  3C4B A;  2N3G A;  4IZK B;  2JR1 A;  4DV4 I;  4DR7 E;  4FWG A;  1UIL A;  3LLH A;  2L6M A;  3ZM7 A;  1Z5B A;  3QT5 A;  2O1U A;  1XHK A;  4IZK A;  4KHP E;  4J8Z A;  4DR2 E;  4DPY A;  4DR7 I;  4L8N A;  1PVG A;  2JOB A;  4M0V A;  1Z0W A;  1Z5A A;  1B62 A;  3QT8 A;  2L3J A;  1Z59 A;  4LU9 A;  3J80 C;  4USM A;  4JI8 E;  5LMN E;  3ADI A;  4DXL A;  4DR2 I;  2GS8 A;  3J80 Q;  1ZM4 A;  1RC7 A;  1HNW E;  2V2Q A;  4DUY E;  4LF8 E;  3K85 A;  2CZ9 A;  1N33 E;  3HJC A;  1H72 C;  4JI8 I;  2E5L E;  4PRX A;  5LMN I;  2KHX A;  1MX0 A;  4Z7C A;  4LF6 E;  3Q1Q A;  1XNR E;  2O1T A;  4X62 E;  2LUQ A;  2R42 A;  2L2N A;  4M1K A;  1HNW I;  4DUY I;  4LF8 I;  1IBK I;  2VQF E;  2E5L I;  1B63 A;  4DR1 E;  3P1X A;  3B8H A;  4DR4 E;  1XNR I;  5IT9 C;  3IWD A;  4X62 I;  4I8O A;  2ZM6 E;  5IT9 Q;  4FN5 A;  4DV7 E;  4LF5 E;  2VQF I;  3T1H E;  4DR1 I;  3HTX A;  4DR4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...