2UUBE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uubE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubE02
1B62A 4UT4A 1IBME 2V34A 4OX9I 4DV2E 2JVAA 4JI0I 4DR2E 2EZ6A 4NXNI 1XMQI 1QZRA 1Z0WA 4LF5E 4B3TI 4DV5E 4DR1E 4DUZE 1IBKE 4M1KA 2E5LI 1Z0TA 2RSMA 4NXMI 5BR8E 1EA6A 1RQ0A 2L33A 1ZM4A 4FWHA 3T1HI 2NPFA 4URLA 3J80C 1NHJA 2V2VA 3J7AM 3ZM7A 4GKKI 3D4JA 2HKJA 1WHQA 1N34E 1HR0E 1XMOE 2E1RA 2HFSA 3P1XA 5IT9C 2NUEA 3J7AG 3JAMC 4GKJI 1ELOA 1XNRE 3V2UC 4K0KI 1IBMI 2RS6A 2LJHA 3ZZ0A 1KKHA 2LBSB 2UUCI 4DR2I 1NZ0A 3ADIA 4JI3E 1ZXMA 4LF5I 1Z5CA 4DV5I 4DR1I 2A2DA 4DUZI 2ZBKB 1IBKI 1DARA 1XNQI 4DR7E 1J5EE 4DR4E 4FWGA 5FLXC 2LJPA 4FN5A 4P7AA 1S16A 1N0UA 3PYFA 2HKEA 5LMNE 1XHKA 4XTJA 4YY3E 1N36E 1RREA 4DPYA 4B3ME 1WUUA 1BKNA 4X65I 1MG7A 1X49A 5GMEA 1N34I 1HR0I 2VF3A 1QU6A 4JI7E 1XMOI 4JYAE 3M6AA 2AJ4A 1FKAE 1OJ4A 2IHR1 2HFUA 1XNRI 1YYKA 4WFTA 3WU3A 3PYGA 3ADGA 1WHNA 3CWVA 4JI3I 3J81C 4JI6E 1Z5AA 2UU9E 1S4EA 1J5EI 4DR4I 2F4VE 2DEIA 5IWAI 3LTOA 3PYEA 4DXLA 1N0VC 4DKKA 1HNXE 3HULA 2UUBE 4DPTA 3J80Q 4JI1I 1HNZE 4YY3I 1N36I 4JG4A 4YHHE 5A2QC 1VISA 4B3MI 3Q1QA 4ZVIA 4X64E 2HK3A 1FWKA 3ADJA 2BM1A 4UTGA 1FWLA 1UEKA 5IT9Q 2N3GA 3JAMQ 2R42A 1EKZA 4DV6E 3LPSA 4LF7E 1H72C 4X62E 2X36A 4JI5E 3B8HA 2DEJA 3LNUA 4JI6I 4DR6I 3VYXA 4LFAE 4X66E 3C4TA 1MX0A 2LUPB 4WUCA 2B7TA 2V2ZA 3K1JA 4LF9E 2N3HA 4HY1A 2L2MA 4DUYE 4LF4E 1H7SA 2UXBE 2ZM6E 1T4LB 4DV2I 2RS7A 4Z7YA 4FW9A 1YZ9A 4KHPE 1T4NA 4DV7E 1Z0BA 2UUBI 1A6FA 3QT6A 1T4OA 1HNZI 2A2CA 4WYQB 3WU5A 4X64I 4PRXA 2LTSA 2ZITA 1RC7A 2JY9A 5BR8I 3H4LA 2VQEE 3QT8A 3QT5A 2XEXA 1ZBTA 2L3JA 4DV6I 2Q2EB 4EMDA 5LMUE 1ZM9A 4LF7I 4X62I 1NHIA 1RR9A 5LL6R 4LFCE 2OI2A 4JI5I 2DIXA 2NA2A 1FNMA 4R1FA 2UXDE 3J81Q 2UUAE 1YYWA 4HACA 1STUA 4JI0E 4B3RE 4LFAI 4X66I 4NXNE 2BM0A 2DMYA 2HHHE 4LF9I 1FJGE 3ZKBA 2UXBI 2LTRA 1KVKA 4DV0E 2ZM6I 1H73A 4JV5E 2HK2A 4KHPI 4DV7I 4LF6E 2KHXA 2NUGA 4DR7I 2LRSA 2NUFA 3T1HE 5A2QQ 4DU7A 1ZXNA 2CZ9A 2LUQA 3C4BA 2VQEI 2J7KA 1J26A 1IBLE 1O0WA 5LMNI 4DPWA 4DV1E 1Z5BA 4PRVA 1KIJA 4MYUA 4LFCI 2CPNA 4GKJE 3OTOE 4K0KE 2UXDI 2V2QA 1B63A 4DPXA 2UUAI 1GQEA 2UUCE 4LFBE 2EFGA 2GS8A 3PYDA 4JI7I 3B82A 4JYAI 4B3RI 2L3CA 1ZM2A 4DV4E 3F0NA 2HHHI 1MU5A 2VQFE 1FJGI 4DV0I 3T1YE 3ZZTA 1XNQE 2B7VA 4JV5I 1Z0GA 3VYYA 3QT7A 4LF6I 4JI4E 2UU9I 2L2NA 1PVGA 1N32E 1UHZA 4DR3E 2F4VI 1ZM3A 3LLHA 4USMA 5FLXQ 4DR5E 3ZKDA 3WU6A 2B3TB 4JI2E 4X65E 1IBLI 1HNXI 2UXCE 1N33E 4PU9A 3GONA 1D6TA 4DV1I 4AQYE 3V5RA 3J7Yp 4DV3E 3ADLA 1Z0VA 2DB2A 1HNWE 1FI4A 4YHHI 3OTOI 1Z0CA 4LF8E 4HXZA 1Z59A 4JI8E 4LFBI 4MYTA 4DPUA 1YYOA 4DV4I 1H7UA 2VQFI 1EI1A 1UILA 4M2ZA 5CFFE 1I94E 4WUDA 4B3SE 3T1YI 2WW4A 1PKPA 4X8WA 5IWAE 4OOGC 4JI4I 4OX9E 2YT4A 1DI2A 3WU4A 1X48A 1PIEA 4FWDA 1XMQE 1N32I 3B78A 4DR3I 2V8PA 4HYMA 4DUYI 4B3TE 4JI1E 4USKA 4Z7CA 4LF4I 3HTXA 3K17A 4DR5I 2E5LE 4P52A 4JI2I 3ZZUA 2UXCI 1N33I 2BV3A 1KTVA 5L3JA 2R3VA 2MDRA 4ED4A 4AQYI 1K47A 4NXME 4DV3I 1Z0EA 1HNWI 1NHHA 4HACB 1H74A 4M30A 4LF8I 4RPFA 4JI8I 4GKKE 4KQVA 2X7IA 2RTXA 4DU8A 1U2RA 4I3HA 4DR6E 5LMUI 1I94I 4WUBA 4B3SI 1X47A 5GMDA 2L2KB
chains in the Genus database with same CATH superfamily
2J7JA 2YU8A 2YWQA 1B62A 4UT4A 5C0XB 1IBME 3OMLA 1IQOA 2V34A 4OX9I 2K4VA 3F6GA 4DV2E 2EJ4A 2JVAA 4IFDE 4JI0I 4DR2E 2EZ6A 4NXNI 2EE8A 5IXMB 3M85D 1XMQI 1QZRA 2JE6B 3P3EA 1DQ3A 1Z0WA 4LF5E 4B3TI 4DV5E 4DR1E 2EN6A 4DUZE 1T38A 1IBKE 4M1KA 1RMDA 1P47A 2E5LI 1Z0TA 2WNRA 1UBDC 4IFDD 2EMXA 3BF2A 2CG9A 1A1IA 1UDSA 2RSMA 4IFDC 1VI7A 5A6KA 4NXMI 5BR8E 3CDIA 1EA6A 1RQ0A 2L33A 1ZM4A 1NCSA 4FWHA 2O1VA 2YRMA 2ADRA 3T1HI 2AE8A 2EM6A 2EQ0A 2NPFA 4I8OA 5A6AA 4URLA 1EH6A 2HC5A 3J80C 1NHJA 2V2VA 3J7AM 2ODRC 2EM3A 4WX9A 2EPCA 3ZM7A 1JK2A 2M7QA 5KL4A 1YUIA 4GKKI 3D4JA 2E1MA 4AIMA 2HKJA 3EQ1A 1WHQA 1A1KA 1N34E 1EH8A 1AAYA 2V87A 2YTOA 1HR0E 2WNRB 2C39A 1XMOE 2E1RA 2J65A 2HFSA 3P1XA 2NABA 5AE2A 5IT9C 5KL3A 2NUEA 3J7AG 2EMZA 3JAMC 4IZKA 4LOMA 2JP9A 1R6MA 4BBYA 4GKJI 1ELOA 5DRPA 1XNRE 5AE1A 3V2UC 4OO1E 4K0KI 1IBMI 3BBGA 1UDOA 4IZJB 2RS6A 2LJHA 2O1WA 2ODRD 1YH8A 1ZU1A 2LBSB 1KKHA 2YTFA 4R8OA 2NN6E 4MQYA 3ZZ0A 5AASA 4DR2I 2UUCI 1NZ0A 3ADIA 4ISAA 3RMPA 3PRYA 2Z5BA 2EM4A 4JI3E 2JWOA 5KL5A 2V8QB 4O24A 2VF1A 1ZXMA 4LF5I 1Z5CA 2IOPA 4DV5I 4DR1I 2A2DA 4DUZI 2ZBKB 1X6HA 1IBKI 1DARA 1XNQI 4DR7E 2EN1A 1J5EE 4DR4E 2YRHA 2K7IA 2YTQA 1XMOI 4OO1C 3C6MA 4FWGA 5FLXC 4MU3A 2LJPA 2PO0A 2HJJA 2NN6C 4FN5A 1YFHA 4P7AA 1BBOA 1S16A 1N0UA 1NEIA 2WBUA 2HKEA 3PYFA 2FV4B 5LMNE 2ELZA 1XHKA 4XTJA 4BC9A 2Q8UA 2PO2A 4GQUA 3UHMA 2V88A 4YY3E 1N36E 2Z5BB 3KZYA 2M4IA 1RREA 4DPYA 4B3ME 3L7ZA 1WUUA 4IFDA 1BKNA 4X65I 2BBGA 4F9CB 4ZYDA 1MG7A 4OO1D 1X49A 5GMEA 5FWKA 1BB8A 1N34I 2EN2A 4RH8A 1HR0I 2GHFA 1QU6A 4JI7E 2NN6D 2VF3A 4F6NA 4JYAE 1XXEA 4OKGA 4HEIA 5JEAE 2YRKA 3M6AA 2YTPA 2AJ4A 5K36E 4P7DA 1FKAE 1OJ4A 2IHR1 1EH7A 2YTEA 2HFUA 1XNRI 1T39A 1YYKA 2MC6A 5DNLA 2WP8B 2MKDA 1UN6B 4QNJA 2EWLA 2EQ3A 2EPOA 2FTXB 4WFTA 3WU3A 3PS1A 3HXLA 1IMUA 3PYGA 1X5WA 3ADGA 2ENHA 1WHNA 2YTJA 3THOB 3CWVA 1RHYA 2EMIA 4JI3I 2N8XA 5KL2A 3J81C 1TF6A 4F2JC 3F6HA 4JI6E 1Z5AA 2UU9E 5JEAC 2VE7C 1L4SA 1S4EA 2EOFA 3AV0A 5K36C 5EKWA 1PJQA 1J5EI 4DR4I 2C37A 3H09A 2F4VE 3M7NG 2EL5A 2DEIA 5IWAI 3LTOA 4BA2A 2EM5A 5A6JA 3ZOQB 3PYEA 1IQSA 3ECRA 4DXLA 1N0VC 4RHBB 4TUIA 2F1DA 3P06A 3BIDA 4DKKA 1HNXE 2EORA 2ELYA 2UUBE 3HULA 3M85G 2L8TA 4DPTA 2BA0G 2EL4A 4IJDA 3J80Q 1ZR9A 5JEAD 4JI1I 2WZOA 2BA1G 1HNZE 4OO1A 4YY3I 1N36I 4JG4A 1ZBQA 2LCEA 2YPNA 4L5NC 1KJKA 4AM3A 5K36D 4YHHE 5A2QC 1VISA 2NN6A 4B3MI 3Q1QA 4ZVIA 4X64E 1Y6ZA 2HK3A 1FWKA 3EPKA 4ZYHA 3ADJA 2WBTA 4KWYA 2BM1A 2JEBA 4FW6A 2EMWA 4UTGA 1FWLA 5KL6A 1UEKA 3HKMA 3K85A 5IT9Q 2N3GA 1PJTA 3JAMQ 2R42A 1A1FA 4O43A 1WJPA 3MHSC 1EKZA 2EL6A 4DV6E 2JYAA 5C0XE 2EMCA 3LPSA 2EN4A 2EN7A 4LF7E 1H72C 4X62E 4IS1C 3Q6NA 2X36A 2EOQA 1KYQA 4JI5E 3B8HA 5A69A 5AC5A 2DEJA 3LNUA 2PO1A 2YTIA 1A1JA 4M9VC 3GCMA 2NN6B 4JI6I 4DR6I 3VYXA 1Y4SA 4LFAE 4X66E 3C4TA 4LCGA 2GQ0A 3PS3A 1MX0A 2LUPB 4WUCA 2IESA 2B7TA 4U3BA 4R2CA 2V2ZA 3K1JA 2JEAA 4LF9E 2EMLA 4AIDA 2N3HA 4HY1A 2L2MA 3MHHC 4DUYE 1P42A 2Z5CA 4LF4E 1H7SA 2EOJA 2UXBE 2LE2A 2ZM6E 5C0XC 2Z5EA 1MGTA 2EMYA 2RS7A 1T4LB 4DV2I 2F8BA 4Z7YA 2DRPA 5JEAA 4FW9A 2LJUA 4ZYEA 1BBGA 1JK1A 1TN9A 2I13A 1YZ9A 1T4NA 4DV7E 4KHPE 1Z0BA 1A6FA 2BR2A 3QT6A 2UUBI 5K36A 1YPNA 1T4OA 2D9HA 2EPMX 2CGEA 1AH5A 3GLLA 2IOQA 4R2RA 1Z1BA 2IERA 1HNZI 4L8NA 3Q6MA 2A2CA 4U3DA 2EPPA 4WYQB 2C39B 2EPUA 3WU5A 4X64I 2LVHA 4PRXA 4IZKB 4BS9A 4IFDF 5C0XD 2LTSA 2ZITA 2EPRA 4O5GA 4Q35B 5F3WA 4O4KA 1RC7A 2JY9A 5BR8I 2FGGA 2VQEE 3H4LA 3QT8A 4Q28A 2XEXA 3QT5A 4IS9A 2Z5CB 2EOZA 1PDAA 1ZBTA 3VHTB 3BGHA 2L3JA 4DV6I 1USUA 2Q2EB 4EMDA 1GZ6A 5LMUE 3GMEA 1ZM9A 2O1UA 2L6MA 2RSIA 2YTGA 4LF7I 4X62I 1NHIA 3JU0A 4LCHA 5LL6R 1RR9A 2GO4A 4LFCE 1USVA 2OI2A 4WSGA 5EL9A 4JI5I 2C38A 2DIXA 2NA2A 2YTNA 1FNMA 4R1FA 2BB8A 2UXDE 2EOIA 3MSWA 1SR9A 2UUAE 3J81Q 2JOXA 1YYWA 3HPSA 4HACA 1STUA 4JI0E 1YHCA 4B3RE 4LFAI 4X66I 2EOXA 4NXNE 2BM0A 2DMYA 4MLVA 2G7HA 2HHHE 4NZVA 2WBSA 2PO0B 4LF9I 1FJGE 2GO3A 3DF6A 2EMGA 2JOBA 3ZKBA 4R2EA 2UXBI 2LTRA 1KVKA 4DV0E 2ZM6I 1YUJA 1H73A 3QG5C 3HQ1A 4FW4A 4JV5E 2PO2B 2ENAA 2EOOA 4BA1A 2HK2A 1OYPA 4DV7I 4BCAA 4KHPI 4QNKA 2MC5A 4LF6E 2KHXA 5DNXA 4IFDB 2NUGA 3L7ZB 3LMLA 3KZZA 5C0XA 5A6BD 4DR7I 2LRSA 2NUFA 3T1HE 5A2QQ 4DU7A 4OO1F 1ZXNA 2M1SA 2EPLX 2CZ9A 2NN6F 2LUQA 2H36X 4IZJD 2EM0A 2JE6A 3C4BA 2VQEI 2VESA 2J7KA 1J26A 1IBLE 5AE3A 1O0WA 5LMNI 2EMAA 4DPWA 1G2DC 3B4TA 4M0VA 4DV1E 3P3GA 4WXCA 4R2DA 3HPZA 4J8ZA 3AUZA 2KOUA 1Z5BA 4PRVA 2DMIA 1KIJA 1WRJA 1HK7A 2PNZA 3HJCA 4MYUA 3EPJA 4LFCI 2CPNA 4GKJE 2DLQA 3OTOE 1QNTA 2EP3A 3M7ND 1F2IG 2M9AA 3KWRA 4K0KE 2UXDI 2V2QA 3EPLA 5DRRA 1B63A 4DPXA 2UUAI 2LO3A 1GQEA 2UUCE 4LFBE 1PJSA 2EFGA 2C37B 2GS8A 3B82A 3PYDA 2DSYA 4JI7I 2L3CA 4JYAI 4B3RI 3L00A 1ZM2A 2EMHA 4DV4E 3F0NA 2YTDA 2HHHI 1MU5A 4BA2B 2VQFE 2BA0D 1FJGI 2EM9A 1LLMC 1OYRA 4LPFA 2EOHA 4KZSA 3IWBA 1UDQA 2BA1D 2MDGA 4HTGA 1UDNA 3IWDA 3T1YE 4DV0I 3ZZTA 1XNQE 2HGHA 1N3GA 2B7VA 4JV5I 2PNLA 1Z0GA 5AC4A 3JTZA 5A6BA 2CT1A 3VYYA 3PS2A 4OO1B 3EPHA 1G2FC 5JEAF 2JPAA 3QT7A 4LF6I 4JI4E 4J3DA 2PNZB 2GLIA 2UU9I 3VK6A 5K36F 4DMIA 4R2PA 2L2NA 3UK3C 1PVGA 1WXRA 4IZJA 1N32E 2DGCA 1UHZA 3TQMA 2YU5A 2JEBB 4DR3E 4R2AA 2F4VI 2EPXA 2MKNA 1ZM3A 3LLHA 4R2QA 4USMA 1Y5YA 2JR1A 5ELWA 5FLXQ 4DR5E 4MU0A 2E72A 3ZKDA 1X6FA 3WU6A 2B3TB 4JI2E 4MU4A 2EQ1A 1A1HA 2A25A 2R76A 2O3ZA 4X65E 1IBLI 1E3HA 1HNXI 5ADZA 1N33E 2UXCE 4PU9A 2EOMA 3GONA 1D6TA 2O1TA 3P76A 4DV1I 4AQYE 3V5RA 3K6QA 3J7Yp 4DV3E 2VRDA 4FK5C 3ADLA 1R6LA 4FW7A 1Z0VA 4MDTA 2YZTA 2DB2A 2V83A 2EMFA 2EMKA 4X9JA 3KRNA 2PO1B 2YSPA 1HNWE 4NHRA 1FI4A 4YHHI 4ZYGA 3OTOI 2JT2A 4BMJA 1Z0CA 4GZNC 4LF8E 4FW5A 1X6EA 4R2SA 2EN3A 2EM8A 1Y60A 4HXZA 1Z59A 2JEAB 3C6KA 4JI8E 3CDJA 4MYTA 4LFBI 4MU1A 5T6JA 4N3OA 4DPUA 4BC7A 2CSHA 4MLQA 2CVEA 5LLQA 1YYOA 2PRTA 4DV4I 2V85A 1H7UA 2VQFI 1EI1A 1UILA 2EM2A 5JEAB 1E3PA 4M2ZA 5CFFE 1I94E 4LTYA 4WUDA 4B3SE 2EOSA 3DJWA 3T1YI 4FW3A 2BR2B 5IV8B 5K36B 2WW4A 1PKPA 4X8WA 1TF3A 2RPCA 2WCC3 4WXDA 5IWAE 3H1CA 4OOGC 3FIGA 4BHBA 2EPNA 4JI4I 4OX9E 1Y4UA 2YT4A 2EM7A 1DI2A 3M99B 2YSOA 3WU4A 1X48A 1PIEA 3THNA 2WP8A 4FWDA 1XMQE 1N32I 2JXPA 4N4RB 2LT7A 3B78A 4DR3I 5C0XF 4WPYA 2V8PA 4HYMA 4DUYI 4B3TE 4LU9A 4JI1E 4USKA 1B69A 4P78A 4Z7CA 4LF4I 2LV2A 3HTXA 1OYSA 2EPZA 3K17A 4BHCA 5TSEA 4DR5I 2E5LE 4P52A 4JI2I 4R03A 5DNYA 3ZZUA 4GEQB 2UXCI 1N33I 2BV3A 1KTVA 2EPKX 5L3JA 4F9BB 1ZAAC 2MDRA 2R3VA 2V89A 4ED4A 4AQYI 1K47A 4NXME 1GTKA 3IWCA 3NZKA 4DV3I 2EOYA 2DLKA 2GPIA 4TUGA 1MEYC 2C38B 1A1LA 2EOEA 1Z0EA 2R1FA 5KL7A 1NHHA 1HNWI 2L92A 2CTDA 3U1YA 2ENCA 4HACB 1H74A 2EN8A 4F9AB 5DROA 1X3CA 2I9IA 4M30A 4LF8I 1SFEA 4F6MA 2PNMA 2LMZA 4RPFA 4JI8I 2EPAA 2V86A 4OZEA 4NBQA 4GKKE 1DGCA 4KQVA 2X7IA 2KONA 2RTXA 5DRQA 4LCFA 4DU8A 2RQLA 1U2RA 4I3HA 2EMBA 2B9DA 4DR6E 1YSAC 5LMUI 4BA1B 1I94I 4WUBA 4B3SI 3U1KA 3DD6A 1X47A 4F54A 5GMDA 2L2KB 1A1GA 3P3CA 4WSPA
chains in the Genus database with same CATH topology
1B62A 4UT4A 1IBME 3OMLA 2V34A 4OX9I 2K4VA 3F6GA 4DV2E 2JVAA 4JI0I 4DR2E 2EZ6A 4NXNI 1XMQI 1QZRA 1DQ3A 1Z0WA 4LF5E 4B3TI 4DV5E 4DR1E 4DUZE 1IBKE 4M1KA 2E5LI 1Z0TA 2CG9A 2RSMA 4NXMI 5BR8E 1EA6A 1RQ0A 2L33A 1ZM4A 4FWHA 2O1VA 3T1HI 2NPFA 4I8OA 4URLA 3J80C 1NHJA 2V2VA 3J7AM 2ODRC 3ZM7A 2M7QA 4GKKI 3D4JA 2E1MA 2HKJA 1WHQA 1N34E 2V87A 1HR0E 1XMOE 2E1RA 2HFSA 3P1XA 5AE2A 5IT9C 2NUEA 3J7AG 4IZKA 3JAMC 4BBYA 4GKJI 1ELOA 1XNRE 5AE1A 3V2UC 4K0KI 1IBMI 4IZJB 2RS6A 2LJHA 2O1WA 2ODRD 3ZZ0A 1KKHA 2LBSB 2UUCI 4R8OA 5AASA 4DR2I 1NZ0A 3ADIA 3RMPA 3PRYA 2Z5BA 4JI3E 2JWOA 2V8QB 1ZXMA 2VF1A 4LF5I 1Z5CA 2IOPA 4DV5I 4DR1I 2A2DA 4DUZI 2ZBKB 1IBKI 1DARA 1XNQI 4DR7E 1J5EE 4DR4E 4FWGA 5FLXC 2LJPA 4FN5A 4P7AA 1S16A 1N0UA 3PYFA 2HKEA 2FV4B 5LMNE 1XHKA 4XTJA 4BC9A 2V88A 4YY3E 1N36E 2Z5BB 2M4IA 1RREA 4DPYA 4B3ME 1WUUA 1BKNA 4X65I 4F9CB 1MG7A 1X49A 5GMEA 5FWKA 1N34I 1HR0I 1QU6A 4JI7E 2VF3A 1XMOI 4JYAE 3M6AA 2AJ4A 4P7DA 1FKAE 1OJ4A 2IHR1 2HFUA 1XNRI 1YYKA 2MC6A 2EWLA 2FTXB 4WFTA 3WU3A 3HXLA 3PYGA 3ADGA 1WHNA 3CWVA 4JI3I 3J81C 3F6HA 4JI6E 1Z5AA 2UU9E 2VE7C 1S4EA 3AV0A 1J5EI 4DR4I 3H09A 2F4VE 2DEIA 5IWAI 3LTOA 3ZOQB 3PYEA 4DXLA 1N0VC 4TUIA 3P06A 4DKKA 1HNXE 3HULA 2UUBE 2L8TA 4DPTA 3J80Q 4JI1I 2WZOA 1HNZE 4YY3I 1N36I 4JG4A 1ZBQA 4L5NC 4YHHE 5A2QC 1VISA 4B3MI 3Q1QA 4ZVIA 4X64E 1Y6ZA 2HK3A 1FWKA 3ADJA 2BM1A 4UTGA 1FWLA 1UEKA 3K85A 5IT9Q 2N3GA 3JAMQ 2R42A 1EKZA 4DV6E 3LPSA 4LF7E 1H72C 4X62E 3Q6NA 2X36A 4JI5E 3B8HA 2DEJA 3LNUA 4JI6I 4DR6I 3VYXA 1Y4SA 4LFAE 4X66E 3C4TA 2GQ0A 1MX0A 2LUPB 4WUCA 2B7TA 2V2ZA 3K1JA 4LF9E 2N3HA 4HY1A 2L2MA 4DUYE 2Z5CA 4LF4E 1H7SA 2UXBE 2LE2A 2ZM6E 2Z5EA 1T4LB 4DV2I 2RS7A 2F8BA 4Z7YA 4FW9A 1YZ9A 4KHPE 1T4NA 4DV7E 1Z0BA 2UUBI 1A6FA 3QT6A 1T4OA 2CGEA 2IOQA 1HNZI 4L8NA 3Q6MA 2A2CA 4WYQB 3WU5A 4X64I 4PRXA 4IZKB 4BS9A 2LTSA 2ZITA 5F3WA 1RC7A 2JY9A 5BR8I 2FGGA 2VQEE 3H4LA 3QT8A 4Q28A 2XEXA 3QT5A 2Z5CB 1ZBTA 2L3JA 4DV6I 1USUA 2Q2EB 4EMDA 1GZ6A 5LMUE 1ZM9A 2O1UA 2L6MA 4LF7I 4X62I 1NHIA 3JU0A 5LL6R 1RR9A 4LFCE 1USVA 2OI2A 4JI5I 2DIXA 2NA2A 1FNMA 4R1FA 2UXDE 3MSWA 1SR9A 2UUAE 3J81Q 2JOXA 1YYWA 3HPSA 4HACA 1STUA 4JI0E 4B3RE 4LFAI 4X66I 4NXNE 2BM0A 2DMYA 2HHHE 2G7HA 4LF9I 1FJGE 3DF6A 2JOBA 3ZKBA 2UXBI 2LTRA 1KVKA 4DV0E 2ZM6I 1H73A 3HQ1A 4JV5E 2HK2A 4KHPI 4DV7I 4BCAA 2MC5A 4LF6E 2KHXA 2NUGA 3LMLA 4DR7I 2LRSA 2NUFA 3T1HE 5A2QQ 4DU7A 1ZXNA 2M1SA 2CZ9A 2LUQA 2H36X 4IZJD 3C4BA 2VQEI 2J7KA 1J26A 1IBLE 5AE3A 1O0WA 5LMNI 4DPWA 4M0VA 4DV1E 3HPZA 4J8ZA 3AUZA 2KOUA 1Z5BA 4PRVA 1KIJA 1HK7A 3HJCA 4MYUA 4LFCI 2CPNA 4GKJE 3OTOE 3KWRA 4K0KE 2UXDI 2V2QA 1B63A 4DPXA 2UUAI 1GQEA 2UUCE 4LFBE 2EFGA 2GS8A 3PYDA 4JI7I 3B82A 4JYAI 2DSYA 4B3RI 2L3CA 1ZM2A 4DV4E 3F0NA 2HHHI 1MU5A 2VQFE 1FJGI 4KZSA 3IWBA 4DV0I 3IWDA 3T1YE 3ZZTA 1XNQE 2B7VA 4JV5I 2PNLA 1Z0GA 3JTZA 3VYYA 3QT7A 4LF6I 4JI4E 2UU9I 3VK6A 4DMIA 2L2NA 1PVGA 1WXRA 4IZJA 1N32E 1UHZA 4DR3E 2F4VI 1ZM3A 3LLHA 4USMA 2JR1A 5FLXQ 4DR5E 3ZKDA 3WU6A 2B3TB 4JI2E 4X65E 1IBLI 1HNXI 5ADZA 1N33E 2UXCE 4PU9A 3GONA 1D6TA 2O1TA 4DV1I 4AQYE 3V5RA 3K6QA 3J7Yp 4DV3E 3ADLA 1Z0VA 2YZTA 2DB2A 2V83A 1HNWE 1FI4A 4YHHI 3OTOI 4BMJA 1Z0CA 4LF8E 4HXZA 1Z59A 4JI8E 4LFBI 4MYTA 5T6JA 4N3OA 4DPUA 4BC7A 1YYOA 4DV4I 2V85A 1H7UA 2VQFI 1EI1A 1UILA 4M2ZA 5CFFE 1I94E 4LTYA 4WUDA 4B3SE 3DJWA 3T1YI 2WW4A 1PKPA 4X8WA 5IWAE 4OOGC 3FIGA 4JI4I 4OX9E 1Y4UA 2YT4A 1DI2A 3WU4A 1X48A 1PIEA 4FWDA 1XMQE 1N32I 3B78A 4DR3I 4WPYA 2V8PA 4HYMA 4DUYI 4B3TE 4LU9A 4JI1E 4USKA 4Z7CA 4P78A 4LF4I 3HTXA 3K17A 4DR5I 2E5LE 4P52A 4JI2I 4R03A 5DNYA 3ZZUA 4GEQB 2UXCI 1N33I 2BV3A 1KTVA 5L3JA 4F9BB 2R3VA 2MDRA 2V89A 4ED4A 4AQYI 1K47A 4NXME 3IWCA 4DV3I 4TUGA 1Z0EA 1HNWI 1NHHA 2L92A 4HACB 1H74A 4F9AB 4M30A 4LF8I 2PNMA 2LMZA 4RPFA 4JI8I 2V86A 4GKKE 4KQVA 2X7IA 2KONA 2RTXA 4DU8A 1U2RA 4I3HA 2B9DA 4DR6E 5LMUI 1I94I 4WUBA 4B3SI 1X47A 4F54A 5GMDA 2L2KB 4WSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B62 A;  4UT4 A;  1IBM E;  2V34 A;  4OX9 I;  4DV2 E;  2JVA A;  4JI0 I;  4DR2 E;  2EZ6 A;  4NXN I;  1XMQ I;  1QZR A;  1Z0W A;  4LF5 E;  4B3T I;  4DV5 E;  4DR1 E;  4DUZ E;  1IBK E;  4M1K A;  2E5L I;  1Z0T A;  2RSM A;  4NXM I;  5BR8 E;  1EA6 A;  1RQ0 A;  2L33 A;  1ZM4 A;  4FWH A;  3T1H I;  2NPF A;  4URL A;  3J80 C;  1NHJ A;  2V2V A;  3J7A M;  3ZM7 A;  4GKK I;  3D4J A;  2HKJ A;  1WHQ A;  1N34 E;  1HR0 E;  1XMO E;  2E1R A;  2HFS A;  3P1X A;  5IT9 C;  2NUE A;  3J7A G;  3JAM C;  4GKJ I;  1ELO A;  1XNR E;  3V2U C;  4K0K I;  1IBM I;  2RS6 A;  2LJH A;  3ZZ0 A;  1KKH A;  2LBS B;  2UUC I;  4DR2 I;  1NZ0 A;  3ADI A;  4JI3 E;  1ZXM A;  4LF5 I;  1Z5C A;  4DV5 I;  4DR1 I;  2A2D A;  4DUZ I;  2ZBK B;  1IBK I;  1DAR A;  1XNQ I;  4DR7 E;  1J5E E;  4DR4 E;  4FWG A;  5FLX C;  2LJP A;  4FN5 A;  4P7A A;  1S16 A;  1N0U A;  3PYF A;  2HKE A;  5LMN E;  1XHK A;  4XTJ A;  4YY3 E;  1N36 E;  1RRE A;  4DPY A;  4B3M E;  1WUU A;  1BKN A;  4X65 I;  1MG7 A;  1X49 A;  5GME A;  1N34 I;  1HR0 I;  2VF3 A;  1QU6 A;  4JI7 E;  1XMO I;  4JYA E;  3M6A A;  2AJ4 A;  1FKA E;  1OJ4 A;  2IHR 1;  2HFU A;  1XNR I;  1YYK A;  4WFT A;  3WU3 A;  3PYG A;  3ADG A;  1WHN A;  3CWV A;  4JI3 I;  3J81 C;  4JI6 E;  1Z5A A;  2UU9 E;  1S4E A;  1J5E I;  4DR4 I;  2F4V E;  2DEI A;  5IWA I;  3LTO A;  3PYE A;  4DXL A;  1N0V C;  4DKK A;  1HNX E;  3HUL A;  2UUB E;  4DPT A;  3J80 Q;  4JI1 I;  1HNZ E;  4YY3 I;  1N36 I;  4JG4 A;  4YHH E;  5A2Q C;  1VIS A;  4B3M I;  3Q1Q A;  4ZVI A;  4X64 E;  2HK3 A;  1FWK A;  3ADJ A;  2BM1 A;  4UTG A;  1FWL A;  1UEK A;  5IT9 Q;  2N3G A;  3JAM Q;  2R42 A;  1EKZ A;  4DV6 E;  3LPS A;  4LF7 E;  1H72 C;  4X62 E;  2X36 A;  4JI5 E;  3B8H A;  2DEJ A;  3LNU A;  4JI6 I;  4DR6 I;  3VYX A;  4LFA E;  4X66 E;  3C4T A;  1MX0 A;  2LUP B;  4WUC A;  2B7T A;  2V2Z A;  3K1J A;  4LF9 E;  2N3H A;  4HY1 A;  2L2M A;  4DUY E;  4LF4 E;  1H7S A;  2UXB E;  2ZM6 E;  1T4L B;  4DV2 I;  2RS7 A;  4Z7Y A;  4FW9 A;  1YZ9 A;  4KHP E;  1T4N A;  4DV7 E;  1Z0B A;  2UUB I;  1A6F A;  3QT6 A;  1T4O A;  1HNZ I;  2A2C A;  4WYQ B;  3WU5 A;  4X64 I;  4PRX A;  2LTS A;  2ZIT A;  1RC7 A;  2JY9 A;  5BR8 I;  3H4L A;  2VQE E;  3QT8 A;  3QT5 A;  2XEX A;  1ZBT A;  2L3J A;  4DV6 I;  2Q2E B;  4EMD A;  5LMU E;  1ZM9 A;  4LF7 I;  4X62 I;  1NHI A;  1RR9 A;  5LL6 R;  4LFC E;  2OI2 A;  4JI5 I;  2DIX A;  2NA2 A;  1FNM A;  4R1F A;  2UXD E;  3J81 Q;  2UUA E;  1YYW A;  4HAC A;  1STU A;  4JI0 E;  4B3R E;  4LFA I;  4X66 I;  4NXN E;  2BM0 A;  2DMY A;  2HHH E;  4LF9 I;  1FJG E;  3ZKB A;  2UXB I;  2LTR A;  1KVK A;  4DV0 E;  2ZM6 I;  1H73 A;  4JV5 E;  2HK2 A;  4KHP I;  4DV7 I;  4LF6 E;  2KHX A;  2NUG A;  4DR7 I;  2LRS A;  2NUF A;  3T1H E;  5A2Q Q;  4DU7 A;  1ZXN A;  2CZ9 A;  2LUQ A;  3C4B A;  2VQE I;  2J7K A;  1J26 A;  1IBL E;  1O0W A;  5LMN I;  4DPW A;  4DV1 E;  1Z5B A;  4PRV A;  1KIJ A;  4MYU A;  4LFC I;  2CPN A;  4GKJ E;  3OTO E;  4K0K E;  2UXD I;  2V2Q A;  1B63 A;  4DPX A;  2UUA I;  1GQE A;  2UUC E;  4LFB E;  2EFG A;  2GS8 A;  3PYD A;  4JI7 I;  3B82 A;  4JYA I;  4B3R I;  2L3C A;  1ZM2 A;  4DV4 E;  3F0N A;  2HHH I;  1MU5 A;  2VQF E;  1FJG I;  4DV0 I;  3T1Y E;  3ZZT A;  1XNQ E;  2B7V A;  4JV5 I;  1Z0G A;  3VYY A;  3QT7 A;  4LF6 I;  4JI4 E;  2UU9 I;  2L2N A;  1PVG A;  1N32 E;  1UHZ A;  4DR3 E;  2F4V I;  1ZM3 A;  3LLH A;  4USM A;  5FLX Q;  4DR5 E;  3ZKD A;  3WU6 A;  2B3T B;  4JI2 E;  4X65 E;  1IBL I;  1HNX I;  2UXC E;  1N33 E;  4PU9 A;  3GON A;  1D6T A;  4DV1 I;  4AQY E;  3V5R A;  3J7Y p;  4DV3 E;  3ADL A;  1Z0V A;  2DB2 A;  1HNW E;  1FI4 A;  4YHH I;  3OTO I;  1Z0C A;  4LF8 E;  4HXZ A;  1Z59 A;  4JI8 E;  4LFB I;  4MYT A;  4DPU A;  1YYO A;  4DV4 I;  1H7U A;  2VQF I;  1EI1 A;  1UIL A;  4M2Z A;  5CFF E;  1I94 E;  4WUD A;  4B3S E;  3T1Y I;  2WW4 A;  1PKP A;  4X8W A;  5IWA E;  4OOG C;  4JI4 I;  4OX9 E;  2YT4 A;  1DI2 A;  3WU4 A;  1X48 A;  1PIE A;  4FWD A;  1XMQ E;  1N32 I;  3B78 A;  4DR3 I;  2V8P A;  4HYM A;  4DUY I;  4B3T E;  4JI1 E;  4USK A;  4Z7C A;  4LF4 I;  3HTX A;  3K17 A;  4DR5 I;  2E5L E;  4P52 A;  4JI2 I;  3ZZU A;  2UXC I;  1N33 I;  2BV3 A;  1KTV A;  5L3J A;  2R3V A;  2MDR A;  4ED4 A;  4AQY I;  1K47 A;  4NXM E;  4DV3 I;  1Z0E A;  1HNW I;  1NHH A;  4HAC B;  1H74 A;  4M30 A;  4LF8 I;  4RPF A;  4JI8 I;  4GKK E;  4KQV A;  2X7I A;  2RTX A;  4DU8 A;  1U2R A;  4I3H A;  4DR6 E;  5LMU I;  1I94 I;  4WUB A;  4B3S I;  1X47 A;  5GMD A;  2L2K B; 
#chains in the Genus database with same CATH topology
 2J7J A;  2YU8 A;  2YWQ A;  1B62 A;  4UT4 A;  5C0X B;  1IBM E;  3OML A;  1IQO A;  2V34 A;  4OX9 I;  2K4V A;  3F6G A;  4DV2 E;  2EJ4 A;  2JVA A;  4IFD E;  4JI0 I;  4DR2 E;  2EZ6 A;  4NXN I;  2EE8 A;  5IXM B;  3M85 D;  1XMQ I;  1QZR A;  2JE6 B;  3P3E A;  1DQ3 A;  1Z0W A;  4LF5 E;  4B3T I;  4DV5 E;  4DR1 E;  2EN6 A;  4DUZ E;  1T38 A;  1IBK E;  4M1K A;  1RMD A;  1P47 A;  2E5L I;  1Z0T A;  2WNR A;  1UBD C;  4IFD D;  2EMX A;  3BF2 A;  2CG9 A;  1A1I A;  1UDS A;  2RSM A;  4IFD C;  1VI7 A;  5A6K A;  4NXM I;  5BR8 E;  3CDI A;  1EA6 A;  1RQ0 A;  2L33 A;  1ZM4 A;  1NCS A;  4FWH A;  2O1V A;  2YRM A;  2ADR A;  3T1H I;  2AE8 A;  2EM6 A;  2EQ0 A;  2NPF A;  4I8O A;  5A6A A;  4URL A;  1EH6 A;  2HC5 A;  3J80 C;  1NHJ A;  2V2V A;  3J7A M;  2ODR C;  2EM3 A;  4WX9 A;  2EPC A;  3ZM7 A;  1JK2 A;  2M7Q A;  5KL4 A;  1YUI A;  4GKK I;  3D4J A;  2E1M A;  4AIM A;  2HKJ A;  3EQ1 A;  1WHQ A;  1A1K A;  1N34 E;  1EH8 A;  1AAY A;  2V87 A;  2YTO A;  1HR0 E;  2WNR B;  2C39 A;  1XMO E;  2E1R A;  2J65 A;  2HFS A;  3P1X A;  2NAB A;  5AE2 A;  5IT9 C;  5KL3 A;  2NUE A;  3J7A G;  2EMZ A;  3JAM C;  4IZK A;  4LOM A;  2JP9 A;  1R6M A;  4BBY A;  4GKJ I;  1ELO A;  5DRP A;  1XNR E;  5AE1 A;  3V2U C;  4OO1 E;  4K0K I;  1IBM I;  3BBG A;  1UDO A;  4IZJ B;  2RS6 A;  2LJH A;  2O1W A;  2ODR D;  1YH8 A;  1ZU1 A;  2LBS B;  1KKH A;  2YTF A;  4R8O A;  2NN6 E;  4MQY A;  3ZZ0 A;  5AAS A;  4DR2 I;  2UUC I;  1NZ0 A;  3ADI A;  4ISA A;  3RMP A;  3PRY A;  2Z5B A;  2EM4 A;  4JI3 E;  2JWO A;  5KL5 A;  2V8Q B;  4O24 A;  2VF1 A;  1ZXM A;  4LF5 I;  1Z5C A;  2IOP A;  4DV5 I;  4DR1 I;  2A2D A;  4DUZ I;  2ZBK B;  1X6H A;  1IBK I;  1DAR A;  1XNQ I;  4DR7 E;  2EN1 A;  1J5E E;  4DR4 E;  2YRH A;  2K7I A;  2YTQ A;  1XMO I;  4OO1 C;  3C6M A;  4FWG A;  5FLX C;  4MU3 A;  2LJP A;  2PO0 A;  2HJJ A;  2NN6 C;  4FN5 A;  1YFH A;  4P7A A;  1BBO A;  1S16 A;  1N0U A;  1NEI A;  2WBU A;  2HKE A;  3PYF A;  2FV4 B;  5LMN E;  2ELZ A;  1XHK A;  4XTJ A;  4BC9 A;  2Q8U A;  2PO2 A;  4GQU A;  3UHM A;  2V88 A;  4YY3 E;  1N36 E;  2Z5B B;  3KZY A;  2M4I A;  1RRE A;  4DPY A;  4B3M E;  3L7Z A;  1WUU A;  4IFD A;  1BKN A;  4X65 I;  2BBG A;  4F9C B;  4ZYD A;  1MG7 A;  4OO1 D;  1X49 A;  5GME A;  5FWK A;  1BB8 A;  1N34 I;  2EN2 A;  4RH8 A;  1HR0 I;  2GHF A;  1QU6 A;  4JI7 E;  2NN6 D;  2VF3 A;  4F6N A;  4JYA E;  1XXE A;  4OKG A;  4HEI A;  5JEA E;  2YRK A;  3M6A A;  2YTP A;  2AJ4 A;  5K36 E;  4P7D A;  1FKA E;  1OJ4 A;  2IHR 1;  1EH7 A;  2YTE A;  2HFU A;  1XNR I;  1T39 A;  1YYK A;  2MC6 A;  5DNL A;  2WP8 B;  2MKD A;  1UN6 B;  4QNJ A;  2EWL A;  2EQ3 A;  2EPO A;  2FTX B;  4WFT A;  3WU3 A;  3PS1 A;  3HXL A;  1IMU A;  3PYG A;  1X5W A;  3ADG A;  2ENH A;  1WHN A;  2YTJ A;  3THO B;  3CWV A;  1RHY A;  2EMI A;  4JI3 I;  2N8X A;  5KL2 A;  3J81 C;  1TF6 A;  4F2J C;  3F6H A;  4JI6 E;  1Z5A A;  2UU9 E;  5JEA C;  2VE7 C;  1L4S A;  1S4E A;  2EOF A;  3AV0 A;  5K36 C;  5EKW A;  1PJQ A;  1J5E I;  4DR4 I;  2C37 A;  3H09 A;  2F4V E;  3M7N G;  2EL5 A;  2DEI A;  5IWA I;  3LTO A;  4BA2 A;  2EM5 A;  5A6J A;  3ZOQ B;  3PYE A;  1IQS A;  3ECR A;  4DXL A;  1N0V C;  4RHB B;  4TUI A;  2F1D A;  3P06 A;  3BID A;  4DKK A;  1HNX E;  2EOR A;  2ELY A;  2UUB E;  3HUL A;  3M85 G;  2L8T A;  4DPT A;  2BA0 G;  2EL4 A;  4IJD A;  3J80 Q;  1ZR9 A;  5JEA D;  4JI1 I;  2WZO A;  2BA1 G;  1HNZ E;  4OO1 A;  4YY3 I;  1N36 I;  4JG4 A;  1ZBQ A;  2LCE A;  2YPN A;  4L5N C;  1KJK A;  4AM3 A;  5K36 D;  4YHH E;  5A2Q C;  1VIS A;  2NN6 A;  4B3M I;  3Q1Q A;  4ZVI A;  4X64 E;  1Y6Z A;  2HK3 A;  1FWK A;  3EPK A;  4ZYH A;  3ADJ A;  2WBT A;  4KWY A;  2BM1 A;  2JEB A;  4FW6 A;  2EMW A;  4UTG A;  1FWL A;  5KL6 A;  1UEK A;  3HKM A;  3K85 A;  5IT9 Q;  2N3G A;  1PJT A;  3JAM Q;  2R42 A;  1A1F A;  4O43 A;  1WJP A;  3MHS C;  1EKZ A;  2EL6 A;  4DV6 E;  2JYA A;  5C0X E;  2EMC A;  3LPS A;  2EN4 A;  2EN7 A;  4LF7 E;  1H72 C;  4X62 E;  4IS1 C;  3Q6N A;  2X36 A;  2EOQ A;  1KYQ A;  4JI5 E;  3B8H A;  5A69 A;  5AC5 A;  2DEJ A;  3LNU A;  2PO1 A;  2YTI A;  1A1J A;  4M9V C;  3GCM A;  2NN6 B;  4JI6 I;  4DR6 I;  3VYX A;  1Y4S A;  4LFA E;  4X66 E;  3C4T A;  4LCG A;  2GQ0 A;  3PS3 A;  1MX0 A;  2LUP B;  4WUC A;  2IES A;  2B7T A;  4U3B A;  4R2C A;  2V2Z A;  3K1J A;  2JEA A;  4LF9 E;  2EML A;  4AID A;  2N3H A;  4HY1 A;  2L2M A;  3MHH C;  4DUY E;  1P42 A;  2Z5C A;  4LF4 E;  1H7S A;  2EOJ A;  2UXB E;  2LE2 A;  2ZM6 E;  5C0X C;  2Z5E A;  1MGT A;  2EMY A;  2RS7 A;  1T4L B;  4DV2 I;  2F8B A;  4Z7Y A;  2DRP A;  5JEA A;  4FW9 A;  2LJU A;  4ZYE A;  1BBG A;  1JK1 A;  1TN9 A;  2I13 A;  1YZ9 A;  1T4N A;  4DV7 E;  4KHP E;  1Z0B A;  1A6F A;  2BR2 A;  3QT6 A;  2UUB I;  5K36 A;  1YPN A;  1T4O A;  2D9H A;  2EPM X;  2CGE A;  1AH5 A;  3GLL A;  2IOQ A;  4R2R A;  1Z1B A;  2IER A;  1HNZ I;  4L8N A;  3Q6M A;  2A2C A;  4U3D A;  2EPP A;  4WYQ B;  2C39 B;  2EPU A;  3WU5 A;  4X64 I;  2LVH A;  4PRX A;  4IZK B;  4BS9 A;  4IFD F;  5C0X D;  2LTS A;  2ZIT A;  2EPR A;  4O5G A;  4Q35 B;  5F3W A;  4O4K A;  1RC7 A;  2JY9 A;  5BR8 I;  2FGG A;  2VQE E;  3H4L A;  3QT8 A;  4Q28 A;  2XEX A;  3QT5 A;  4IS9 A;  2Z5C B;  2EOZ A;  1PDA A;  1ZBT A;  3VHT B;  3BGH A;  2L3J A;  4DV6 I;  1USU A;  2Q2E B;  4EMD A;  1GZ6 A;  5LMU E;  3GME A;  1ZM9 A;  2O1U A;  2L6M A;  2RSI A;  2YTG A;  4LF7 I;  4X62 I;  1NHI A;  3JU0 A;  4LCH A;  5LL6 R;  1RR9 A;  2GO4 A;  4LFC E;  1USV A;  2OI2 A;  4WSG A;  5EL9 A;  4JI5 I;  2C38 A;  2DIX A;  2NA2 A;  2YTN A;  1FNM A;  4R1F A;  2BB8 A;  2UXD E;  2EOI A;  3MSW A;  1SR9 A;  2UUA E;  3J81 Q;  2JOX A;  1YYW A;  3HPS A;  4HAC A;  1STU A;  4JI0 E;  1YHC A;  4B3R E;  4LFA I;  4X66 I;  2EOX A;  4NXN E;  2BM0 A;  2DMY A;  4MLV A;  2G7H A;  2HHH E;  4NZV A;  2WBS A;  2PO0 B;  4LF9 I;  1FJG E;  2GO3 A;  3DF6 A;  2EMG A;  2JOB A;  3ZKB A;  4R2E A;  2UXB I;  2LTR A;  1KVK A;  4DV0 E;  2ZM6 I;  1YUJ A;  1H73 A;  3QG5 C;  3HQ1 A;  4FW4 A;  4JV5 E;  2PO2 B;  2ENA A;  2EOO A;  4BA1 A;  2HK2 A;  1OYP A;  4DV7 I;  4BCA A;  4KHP I;  4QNK A;  2MC5 A;  4LF6 E;  2KHX A;  5DNX A;  4IFD B;  2NUG A;  3L7Z B;  3LML A;  3KZZ A;  5C0X A;  5A6B D;  4DR7 I;  2LRS A;  2NUF A;  3T1H E;  5A2Q Q;  4DU7 A;  4OO1 F;  1ZXN A;  2M1S A;  2EPL X;  2CZ9 A;  2NN6 F;  2LUQ A;  2H36 X;  4IZJ D;  2EM0 A;  2JE6 A;  3C4B A;  2VQE I;  2VES A;  2J7K A;  1J26 A;  1IBL E;  5AE3 A;  1O0W A;  5LMN I;  2EMA A;  4DPW A;  1G2D C;  3B4T A;  4M0V A;  4DV1 E;  3P3G A;  4WXC A;  4R2D A;  3HPZ A;  4J8Z A;  3AUZ A;  2KOU A;  1Z5B A;  4PRV A;  2DMI A;  1KIJ A;  1WRJ A;  1HK7 A;  2PNZ A;  3HJC A;  4MYU A;  3EPJ A;  4LFC I;  2CPN A;  4GKJ E;  2DLQ A;  3OTO E;  1QNT A;  2EP3 A;  3M7N D;  1F2I G;  2M9A A;  3KWR A;  4K0K E;  2UXD I;  2V2Q A;  3EPL A;  5DRR A;  1B63 A;  4DPX A;  2UUA I;  2LO3 A;  1GQE A;  2UUC E;  4LFB E;  1PJS A;  2EFG A;  2C37 B;  2GS8 A;  3B82 A;  3PYD A;  2DSY A;  4JI7 I;  2L3C A;  4JYA I;  4B3R I;  3L00 A;  1ZM2 A;  2EMH A;  4DV4 E;  3F0N A;  2YTD A;  2HHH I;  1MU5 A;  4BA2 B;  2VQF E;  2BA0 D;  1FJG I;  2EM9 A;  1LLM C;  1OYR A;  4LPF A;  2EOH A;  4KZS A;  3IWB A;  1UDQ A;  2BA1 D;  2MDG A;  4HTG A;  1UDN A;  3IWD A;  3T1Y E;  4DV0 I;  3ZZT A;  1XNQ E;  2HGH A;  1N3G A;  2B7V A;  4JV5 I;  2PNL A;  1Z0G A;  5AC4 A;  3JTZ A;  5A6B A;  2CT1 A;  3VYY A;  3PS2 A;  4OO1 B;  3EPH A;  1G2F C;  5JEA F;  2JPA A;  3QT7 A;  4LF6 I;  4JI4 E;  4J3D A;  2PNZ B;  2GLI A;  2UU9 I;  3VK6 A;  5K36 F;  4DMI A;  4R2P A;  2L2N A;  3UK3 C;  1PVG A;  1WXR A;  4IZJ A;  1N32 E;  2DGC A;  1UHZ A;  3TQM A;  2YU5 A;  2JEB B;  4DR3 E;  4R2A A;  2F4V I;  2EPX A;  2MKN A;  1ZM3 A;  3LLH A;  4R2Q A;  4USM A;  1Y5Y A;  2JR1 A;  5ELW A;  5FLX Q;  4DR5 E;  4MU0 A;  2E72 A;  3ZKD A;  1X6F A;  3WU6 A;  2B3T B;  4JI2 E;  4MU4 A;  2EQ1 A;  1A1H A;  2A25 A;  2R76 A;  2O3Z A;  4X65 E;  1IBL I;  1E3H A;  1HNX I;  5ADZ A;  1N33 E;  2UXC E;  4PU9 A;  2EOM A;  3GON A;  1D6T A;  2O1T A;  3P76 A;  4DV1 I;  4AQY E;  3V5R A;  3K6Q A;  3J7Y p;  4DV3 E;  2VRD A;  4FK5 C;  3ADL A;  1R6L A;  4FW7 A;  1Z0V A;  4MDT A;  2YZT A;  2DB2 A;  2V83 A;  2EMF A;  2EMK A;  4X9J A;  3KRN A;  2PO1 B;  2YSP A;  1HNW E;  4NHR A;  1FI4 A;  4YHH I;  4ZYG A;  3OTO I;  2JT2 A;  4BMJ A;  1Z0C A;  4GZN C;  4LF8 E;  4FW5 A;  1X6E A;  4R2S A;  2EN3 A;  2EM8 A;  1Y60 A;  4HXZ A;  1Z59 A;  2JEA B;  3C6K A;  4JI8 E;  3CDJ A;  4MYT A;  4LFB I;  4MU1 A;  5T6J A;  4N3O A;  4DPU A;  4BC7 A;  2CSH A;  4MLQ A;  2CVE A;  5LLQ A;  1YYO A;  2PRT A;  4DV4 I;  2V85 A;  1H7U A;  2VQF I;  1EI1 A;  1UIL A;  2EM2 A;  5JEA B;  1E3P A;  4M2Z A;  5CFF E;  1I94 E;  4LTY A;  4WUD A;  4B3S E;  2EOS A;  3DJW A;  3T1Y I;  4FW3 A;  2BR2 B;  5IV8 B;  5K36 B;  2WW4 A;  1PKP A;  4X8W A;  1TF3 A;  2RPC A;  2WCC 3;  4WXD A;  5IWA E;  3H1C A;  4OOG C;  3FIG A;  4BHB A;  2EPN A;  4JI4 I;  4OX9 E;  1Y4U A;  2YT4 A;  2EM7 A;  1DI2 A;  3M99 B;  2YSO A;  3WU4 A;  1X48 A;  1PIE A;  3THN A;  2WP8 A;  4FWD A;  1XMQ E;  1N32 I;  2JXP A;  4N4R B;  2LT7 A;  3B78 A;  4DR3 I;  5C0X F;  4WPY A;  2V8P A;  4HYM A;  4DUY I;  4B3T E;  4LU9 A;  4JI1 E;  4USK A;  1B69 A;  4P78 A;  4Z7C A;  4LF4 I;  2LV2 A;  3HTX A;  1OYS A;  2EPZ A;  3K17 A;  4BHC A;  5TSE A;  4DR5 I;  2E5L E;  4P52 A;  4JI2 I;  4R03 A;  5DNY A;  3ZZU A;  4GEQ B;  2UXC I;  1N33 I;  2BV3 A;  1KTV A;  2EPK X;  5L3J A;  4F9B B;  1ZAA C;  2MDR A;  2R3V A;  2V89 A;  4ED4 A;  4AQY I;  1K47 A;  4NXM E;  1GTK A;  3IWC A;  3NZK A;  4DV3 I;  2EOY A;  2DLK A;  2GPI A;  4TUG A;  1MEY C;  2C38 B;  1A1L A;  2EOE A;  1Z0E A;  2R1F A;  5KL7 A;  1NHH A;  1HNW I;  2L92 A;  2CTD A;  3U1Y A;  2ENC A;  4HAC B;  1H74 A;  2EN8 A;  4F9A B;  5DRO A;  1X3C A;  2I9I A;  4M30 A;  4LF8 I;  1SFE A;  4F6M A;  2PNM A;  2LMZ A;  4RPF A;  4JI8 I;  2EPA A;  2V86 A;  4OZE A;  4NBQ A;  4GKK E;  1DGC A;  4KQV A;  2X7I A;  2KON A;  2RTX A;  5DRQ A;  4LCF A;  4DU8 A;  2RQL A;  1U2R A;  4I3H A;  2EMB A;  2B9D A;  4DR6 E;  1YSA C;  5LMU I;  4BA1 B;  1I94 I;  4WUB A;  4B3S I;  3U1K A;  3DD6 A;  1X47 A;  4F54 A;  5GMD A;  2L2K B;  1A1G A;  3P3C A;  4WSP A; 
#chains in the Genus database with same CATH homology
 1B62 A;  4UT4 A;  1IBM E;  3OML A;  2V34 A;  4OX9 I;  2K4V A;  3F6G A;  4DV2 E;  2JVA A;  4JI0 I;  4DR2 E;  2EZ6 A;  4NXN I;  1XMQ I;  1QZR A;  1DQ3 A;  1Z0W A;  4LF5 E;  4B3T I;  4DV5 E;  4DR1 E;  4DUZ E;  1IBK E;  4M1K A;  2E5L I;  1Z0T A;  2CG9 A;  2RSM A;  4NXM I;  5BR8 E;  1EA6 A;  1RQ0 A;  2L33 A;  1ZM4 A;  4FWH A;  2O1V A;  3T1H I;  2NPF A;  4I8O A;  4URL A;  3J80 C;  1NHJ A;  2V2V A;  3J7A M;  2ODR C;  3ZM7 A;  2M7Q A;  4GKK I;  3D4J A;  2E1M A;  2HKJ A;  1WHQ A;  1N34 E;  2V87 A;  1HR0 E;  1XMO E;  2E1R A;  2HFS A;  3P1X A;  5AE2 A;  5IT9 C;  2NUE A;  3J7A G;  4IZK A;  3JAM C;  4BBY A;  4GKJ I;  1ELO A;  1XNR E;  5AE1 A;  3V2U C;  4K0K I;  1IBM I;  4IZJ B;  2RS6 A;  2LJH A;  2O1W A;  2ODR D;  3ZZ0 A;  1KKH A;  2LBS B;  2UUC I;  4R8O A;  5AAS A;  4DR2 I;  1NZ0 A;  3ADI A;  3RMP A;  3PRY A;  2Z5B A;  4JI3 E;  2JWO A;  2V8Q B;  1ZXM A;  2VF1 A;  4LF5 I;  1Z5C A;  2IOP A;  4DV5 I;  4DR1 I;  2A2D A;  4DUZ I;  2ZBK B;  1IBK I;  1DAR A;  1XNQ I;  4DR7 E;  1J5E E;  4DR4 E;  4FWG A;  5FLX C;  2LJP A;  4FN5 A;  4P7A A;  1S16 A;  1N0U A;  3PYF A;  2HKE A;  2FV4 B;  5LMN E;  1XHK A;  4XTJ A;  4BC9 A;  2V88 A;  4YY3 E;  1N36 E;  2Z5B B;  2M4I A;  1RRE A;  4DPY A;  4B3M E;  1WUU A;  1BKN A;  4X65 I;  4F9C B;  1MG7 A;  1X49 A;  5GME A;  5FWK A;  1N34 I;  1HR0 I;  1QU6 A;  4JI7 E;  2VF3 A;  1XMO I;  4JYA E;  3M6A A;  2AJ4 A;  4P7D A;  1FKA E;  1OJ4 A;  2IHR 1;  2HFU A;  1XNR I;  1YYK A;  2MC6 A;  2EWL A;  2FTX B;  4WFT A;  3WU3 A;  3HXL A;  3PYG A;  3ADG A;  1WHN A;  3CWV A;  4JI3 I;  3J81 C;  3F6H A;  4JI6 E;  1Z5A A;  2UU9 E;  2VE7 C;  1S4E A;  3AV0 A;  1J5E I;  4DR4 I;  3H09 A;  2F4V E;  2DEI A;  5IWA I;  3LTO A;  3ZOQ B;  3PYE A;  4DXL A;  1N0V C;  4TUI A;  3P06 A;  4DKK A;  1HNX E;  3HUL A;  2UUB E;  2L8T A;  4DPT A;  3J80 Q;  4JI1 I;  2WZO A;  1HNZ E;  4YY3 I;  1N36 I;  4JG4 A;  1ZBQ A;  4L5N C;  4YHH E;  5A2Q C;  1VIS A;  4B3M I;  3Q1Q A;  4ZVI A;  4X64 E;  1Y6Z A;  2HK3 A;  1FWK A;  3ADJ A;  2BM1 A;  4UTG A;  1FWL A;  1UEK A;  3K85 A;  5IT9 Q;  2N3G A;  3JAM Q;  2R42 A;  1EKZ A;  4DV6 E;  3LPS A;  4LF7 E;  1H72 C;  4X62 E;  3Q6N A;  2X36 A;  4JI5 E;  3B8H A;  2DEJ A;  3LNU A;  4JI6 I;  4DR6 I;  3VYX A;  1Y4S A;  4LFA E;  4X66 E;  3C4T A;  2GQ0 A;  1MX0 A;  2LUP B;  4WUC A;  2B7T A;  2V2Z A;  3K1J A;  4LF9 E;  2N3H A;  4HY1 A;  2L2M A;  4DUY E;  2Z5C A;  4LF4 E;  1H7S A;  2UXB E;  2LE2 A;  2ZM6 E;  2Z5E A;  1T4L B;  4DV2 I;  2RS7 A;  2F8B A;  4Z7Y A;  4FW9 A;  1YZ9 A;  4KHP E;  1T4N A;  4DV7 E;  1Z0B A;  2UUB I;  1A6F A;  3QT6 A;  1T4O A;  2CGE A;  2IOQ A;  1HNZ I;  4L8N A;  3Q6M A;  2A2C A;  4WYQ B;  3WU5 A;  4X64 I;  4PRX A;  4IZK B;  4BS9 A;  2LTS A;  2ZIT A;  5F3W A;  1RC7 A;  2JY9 A;  5BR8 I;  2FGG A;  2VQE E;  3H4L A;  3QT8 A;  4Q28 A;  2XEX A;  3QT5 A;  2Z5C B;  1ZBT A;  2L3J A;  4DV6 I;  1USU A;  2Q2E B;  4EMD A;  1GZ6 A;  5LMU E;  1ZM9 A;  2O1U A;  2L6M A;  4LF7 I;  4X62 I;  1NHI A;  3JU0 A;  5LL6 R;  1RR9 A;  4LFC E;  1USV A;  2OI2 A;  4JI5 I;  2DIX A;  2NA2 A;  1FNM A;  4R1F A;  2UXD E;  3MSW A;  1SR9 A;  2UUA E;  3J81 Q;  2JOX A;  1YYW A;  3HPS A;  4HAC A;  1STU A;  4JI0 E;  4B3R E;  4LFA I;  4X66 I;  4NXN E;  2BM0 A;  2DMY A;  2HHH E;  2G7H A;  4LF9 I;  1FJG E;  3DF6 A;  2JOB A;  3ZKB A;  2UXB I;  2LTR A;  1KVK A;  4DV0 E;  2ZM6 I;  1H73 A;  3HQ1 A;  4JV5 E;  2HK2 A;  4KHP I;  4DV7 I;  4BCA A;  2MC5 A;  4LF6 E;  2KHX A;  2NUG A;  3LML A;  4DR7 I;  2LRS A;  2NUF A;  3T1H E;  5A2Q Q;  4DU7 A;  1ZXN A;  2M1S A;  2CZ9 A;  2LUQ A;  2H36 X;  4IZJ D;  3C4B A;  2VQE I;  2J7K A;  1J26 A;  1IBL E;  5AE3 A;  1O0W A;  5LMN I;  4DPW A;  4M0V A;  4DV1 E;  3HPZ A;  4J8Z A;  3AUZ A;  2KOU A;  1Z5B A;  4PRV A;  1KIJ A;  1HK7 A;  3HJC A;  4MYU A;  4LFC I;  2CPN A;  4GKJ E;  3OTO E;  3KWR A;  4K0K E;  2UXD I;  2V2Q A;  1B63 A;  4DPX A;  2UUA I;  1GQE A;  2UUC E;  4LFB E;  2EFG A;  2GS8 A;  3PYD A;  4JI7 I;  3B82 A;  4JYA I;  2DSY A;  4B3R I;  2L3C A;  1ZM2 A;  4DV4 E;  3F0N A;  2HHH I;  1MU5 A;  2VQF E;  1FJG I;  4KZS A;  3IWB A;  4DV0 I;  3IWD A;  3T1Y E;  3ZZT A;  1XNQ E;  2B7V A;  4JV5 I;  2PNL A;  1Z0G A;  3JTZ A;  3VYY A;  3QT7 A;  4LF6 I;  4JI4 E;  2UU9 I;  3VK6 A;  4DMI A;  2L2N A;  1PVG A;  1WXR A;  4IZJ A;  1N32 E;  1UHZ A;  4DR3 E;  2F4V I;  1ZM3 A;  3LLH A;  4USM A;  2JR1 A;  5FLX Q;  4DR5 E;  3ZKD A;  3WU6 A;  2B3T B;  4JI2 E;  4X65 E;  1IBL I;  1HNX I;  5ADZ A;  1N33 E;  2UXC E;  4PU9 A;  3GON A;  1D6T A;  2O1T A;  4DV1 I;  4AQY E;  3V5R A;  3K6Q A;  3J7Y p;  4DV3 E;  3ADL A;  1Z0V A;  2YZT A;  2DB2 A;  2V83 A;  1HNW E;  1FI4 A;  4YHH I;  3OTO I;  4BMJ A;  1Z0C A;  4LF8 E;  4HXZ A;  1Z59 A;  4JI8 E;  4LFB I;  4MYT A;  5T6J A;  4N3O A;  4DPU A;  4BC7 A;  1YYO A;  4DV4 I;  2V85 A;  1H7U A;  2VQF I;  1EI1 A;  1UIL A;  4M2Z A;  5CFF E;  1I94 E;  4LTY A;  4WUD A;  4B3S E;  3DJW A;  3T1Y I;  2WW4 A;  1PKP A;  4X8W A;  5IWA E;  4OOG C;  3FIG A;  4JI4 I;  4OX9 E;  1Y4U A;  2YT4 A;  1DI2 A;  3WU4 A;  1X48 A;  1PIE A;  4FWD A;  1XMQ E;  1N32 I;  3B78 A;  4DR3 I;  4WPY A;  2V8P A;  4HYM A;  4DUY I;  4B3T E;  4LU9 A;  4JI1 E;  4USK A;  4Z7C A;  4P78 A;  4LF4 I;  3HTX A;  3K17 A;  4DR5 I;  2E5L E;  4P52 A;  4JI2 I;  4R03 A;  5DNY A;  3ZZU A;  4GEQ B;  2UXC I;  1N33 I;  2BV3 A;  1KTV A;  5L3J A;  4F9B B;  2R3V A;  2MDR A;  2V89 A;  4ED4 A;  4AQY I;  1K47 A;  4NXM E;  3IWC A;  4DV3 I;  4TUG A;  1Z0E A;  1HNW I;  1NHH A;  2L92 A;  4HAC B;  1H74 A;  4F9A B;  4M30 A;  4LF8 I;  2PNM A;  2LMZ A;  4RPF A;  4JI8 I;  2V86 A;  4GKK E;  4KQV A;  2X7I A;  2KON A;  2RTX A;  4DU8 A;  1U2R A;  4I3H A;  2B9D A;  4DR6 E;  5LMU I;  1I94 I;  4WUB A;  4B3S I;  1X47 A;  4F54 A;  5GMD A;  2L2K B;  4WSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...