2UUBE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uubE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubE02
4LFAE 1VISA 4FW9A 2VQEI 4DV7E 5GMDA 4DR1I 1NHHA 3ADLA 4UTGA 2UXCE 2ZITA 4DR3I 1FJGE 2UXCI 2ZM6E 4DV2E 3J81Q 2E1RA 2ZBKB 1DI2A 1Z5AA 3P1XA 4X62I 2DMYA 1MX0A 5LMNI 3J80Q 5LL6R 4JI8I 1NZ0A 2RS7A 1N0UA 2UXDE 4MYTA 3WU3A 1U2RA 5IWAE 1ZBTA 1Z0GA 3GONA 1IBLI 1FNMA 4HXZA 1Z0TA 1IBLE 1D6TA 3VYXA 2R42A 4JI8E 2V2QA 4PRXA 1FJGI 2LUQA 2EZ6A 1RREA 2UXDI 4LF9I 3B82A 4WUDA 1B63A 2DB2A 4DV4E 2N3HA 4LF6E 1IBMI 2DEJA 2IHR1 1H7UA 3ADGA 4Z7CA 5BR8I 1XMQI 1YYKA 3ADIA 3Q1QA 2V34A 2L2MA 2NA2A 2B7TA 3K1JA 1FKAE 3F0NA 1Z0VA 1EI1A 1PIEA 2MDRA 4LF6I 1XNRE 1X47A 4JV5I 2V2VA 4I3HA 3WU4A 5FLXC 2LUPB 3JAMC 4JI1E 4HACB 3QT5A 4X64I 1O0WA 4B3SE 1A6FA 1J5EE 1H73A 3JAMQ 1XMOI 1S4EA 4AQYI 1N0VC 4DV7I 2KHXA 3J7AM 4NXNI 2E5LI 4DPYA 4DR3E 2Q2EB 1XNQI 4FN5A 4YHHE 4DV1I 2UXBI 1Z0BA 4DV6E 1ZM2A 4RPFA 4WFTA 2VQFI 1H7SA 3LNUA 4LFCI 4NXNE 1KIJA 3C4BA 3LTOA 3J80C 4DPTA 4UT4A 3K17A 3ZM7A 1RR9A 1IBKI 2LJHA 3ZKDA 4DR4E 1ZM9A 2X36A 2VQFE 1DARA 2DIXA 3J81C 4DR6I 4JI0E 4FWDA 4USKA 4KHPI 2L2NA 4B3MI 4DR7E 1EKZA 4LF7I 2HKEA 2LTSA 4LF7E 4JYAE 2RSMA 4KQVA 1HNZI 3C4TA 2UU9E 2N3GA 4X65E 4GKKE 4B3ME 3ZZTA 2UUBI 4GKKI 1HNXI 2E5LE 3PYGA 1NHJA 1X49A 4LF5I 2UU9I 2HK2A 1KVKA 4DV2I 1J5EI 1ZM4A 1HNXE 2AJ4A 1ELOA 1N32I 1WHQA 3OTOI 4NXME 3WU5A 4OX9I 1HR0I 1S16A 1N33I 4B3SI 1STUA 1ZXMA 2DEIA 2L2KB 3LLHA 4DPXA 2NPFA 4USMA 4LF5E 2NUFA 1B62A 4LFCE 4FWHA 5LMNE 1HNZE 3ZZUA 4URLA 1Z0WA 1J26A 4NXMI 4X65I 4P7AA 4DV1E 4YHHI 3T1HI 4DR2E 4LF9E 5L3JA 4JI2E 2HHHE 4P52A 2HHHI 4PRVA 4Z7YA 1NHIA 1EA6A 2NUEA 4LF8E 4DPWA 2YT4A 2UUAE 4B3TE 4GKJI 2OI2A 1N32E 1UEKA 2L3JA 1I94I 4JI7I 5LMUE 1BKNA 4JI4I 4FWGA 1YZ9A 1XNRI 1MU5A 1UILA 1KTVA 4DV3I 2WW4A 4DR2I 2HFUA 1QZRA 4DR7I 2B7VA 4DXLA 3ADJA 4LFBE 1RC7A 5A2QQ 1I94E 1HNWE 1T4LB 4LFBI 1FWLA 1T4NA 4DV3E 4LF4E 3M6AA 1WUUA 4HY1A 2JVAA 4EMDA 3QT6A 3ZZ0A 2RS6A 2HKJA 4JI5E 5GMEA 4X66E 5LMUI 3B78A 4JI1I 3HULA 1K47A 2VQEE 2V8PA 3OTOE 1Z0EA 4OOGC 2L3CA 4JI5I 2NUGA 4DR5E 2HFSA 1XMOE 1UHZA 1QU6A 1X48A 3WU6A 5IT9Q 1YYWA 4B3RI 1KKHA 5A2QC 3LPSA 3T1HE 4X64E 3J7Yp 4HACA 2A2CA 4OX9E 1PVGA 1Z59A 2F4VE 2RTXA 1OJ4A 4DPUA 2HK3A 3PYDA 2X7IA 1RQ0A 4HYMA 2ZM6I 4R1FA 2UUAI 2B3TB 4JI6I 3T1YE 2GS8A 2LJPA 4JI0I 1FWKA 2R3VA 4DV0I 2XEXA 1N34E 4LF8I 2CZ9A 2UUCI 4JI4E 2BV3A 5IWAI 1IBKE 4LF4I 1FI4A 1H74A 4JG4A 4YY3E 1ZM3A 4JYAI 4DV5E 4PU9A 4JI7E 3CWVA 1HR0E 1Z5BA 2UUBE 4MYUA 2VF3A 4ED4A 3B8HA 4YY3I 3VYYA 1WHNA 5IT9C 3PYFA 4DU8A 4LFAI 2UUCE 1Z0CA 4ZVIA 2LTRA 1YYOA 1HNWI 4M1KA 4M30A 1N36E 2BM1A 4JI3E 4DUZI 4AQYE 1XHKA 3PYEA 5CFFE 2F4VI 4DV6I 2JY9A 4B3TI 3J7AG 4X62E 4B3RE 1PKPA 4XTJA 3ZKBA 4DU7A 1XNQE 2UXBE 2CPNA 4DR4I 4JI2I 4DUZE 4JI3I 4JI6E 1T4OA 2LBSB 4KHPE 4WYQB 4X8WA 4DKKA 4DV0E 1GQEA 4WUBA 5FLXQ 3D4JA 3H4LA 4M2ZA 5BR8E 1IBME 4JV5E 2EFGA 1N34I 4DR1E 3V5RA 1MG7A 4DR6E 4GKJE 1Z5CA 1H72C 3QT8A 2J7KA 4DV5I 3T1YI 4X66I 4DUYE 3HTXA 1XMQE 3QT7A 4DR5I 1ZXNA 1N36I 4K0KE 4K0KI 2LRSA 2V2ZA 2L33A 2A2DA 4DV4I 4DUYI 1N33E 2BM0A 4WUCA 3V2UC
chains in the Genus database with same CATH superfamily
4LFAE 4IJDA 1VISA 4FW9A 2ODRC 1VI7A 2VQEI 4DV7E 3BF2A 2EPOA 5GMDA 4DR1I 1NHHA 1EH7A 3M85D 3OMLA 3ADLA 4UTGA 2DLQA 5EL9A 2UXCE 2ZITA 4DR3I 1FJGE 5A69A 2H36X 2JE6A 2WBSA 2ZM6E 4DV2E 5KL6A 3RMPA 2E1RA 2ZBKB 4IZKB 5JEAD 5LLQA 3J81Q 4HTGA 1DI2A 2ADRA 1Z5AA 3P1XA 2C39A 2C37B 4X62I 2NN6E 2EOQA 2DMYA 3P3CA 1MX0A 5LMNI 4IFDA 3J80Q 4R03A 5DRPA 5LL6R 4JI8I 5A6KA 4MU4A 2N8XA 2RS7A 1NZ0A 1N0UA 2EPMX 2UXDE 2EM4A 4MYTA 3WU3A 2EMYA 1U2RA 5IWAE 2NN6B 1YSAC 1ZBTA 3MHHC 1Z0GA 3GONA 1ZU1A 4U3BA 2EMCA 4FW4A 3EPJA 1Y4UA 1IBLI 2EJ4A 1FNMA 2BR2B 2J7JA 2EOOA 4HXZA 1PJTA 1IBLE 1X6HA 1Z0TA 3Q6NA 3VYXA 1D6TA 2DSYA 3F6GA 4WXCA 4JI8E 2R42A 2V2QA 2WNRA 4F9CB 4PRXA 2LUQA 2EZ6A 1RREA 4IFDD 1N3GA 2O1VA 1GZ6A 2UXDI 1TN9A 1T38A 4LF9I 3B82A 2MKDA 4WUDA 1B63A 2DB2A 4DV4E 2N3HA 4LCGA 5K36E 4LF6E 5KL2A 2EOIA 4I8OA 4F2JC 2JEBA 3IWDA 1OYSA 5C0XC 1IBMI 3PRYA 2DEJA 2YTPA 2ENCA 4IZJD 2IHR1 1YH8A 2A25A 2EM2A 4KWYA 1H7UA 3ADGA 4Z7CA 3CWVA 2EPPA 2PO2B 2EMGA 5BR8I 2NN6F 3KZZA 4R8OA 1XMQI 1YYKA 3ADIA 5ADZA 1BBOA 3Q1QA 5DNYA 5JEAC 2V34A 2EPZA 2L2MA 2PNMA 1FJGI 2NA2A 3HQ1A 2EPLX 2B7TA 3GLLA 3K1JA 1FKAE 2WP8B 2EPNA 1A1KA 4R2CA 1EI1A 1Z0VA 3F0NA 2EOXA 2JYAA 2IESA 4Q28A 1PIEA 2Z5EA 2EL5A 1A1JA 2JEAB 2EM5A 2EQ1A 2MDRA 4LF6I 3Q6MA 1XNRE 5JEAA 1X47A 4OO1E 2V86A 2EOYA 2R76A 2YTOA 5FLXC 2V2VA 4I3HA 2LUPB 3WU4A 4JV5I 3JU0A 3MSWA 2ENAA 3JAMC 4JI1E 1Y60A 2C38A 3MHSC 4HACB 2JWOA 2FV4B 2VRDA 2V89A 3QT5A 1PJSA 4MU1A 4J3DA 4X64I 4LPFA 3HKMA 4IS9A 1O0WA 1YUIA 4B3SE 1A6FA 1J5EE 1H73A 2EM6A 4IFDC 3M7ND 4LU9A 3JAMQ 2JOXA 1XMOI 1S4EA 4AQYI 2EP3A 2BA0G 2O1WA 2YU5A 3EPLA 4MLQA 1N0VC 5KL7A 4DV7I 1AAYA 4OO1F 2KHXA 3J7AM 4NXNI 2E5LI 4DPYA 4DR3E 2PNLA 2Q2EB 1XNQI 4FN5A 4YHHE 1X6EA 4DV1I 2UXBI 5C0XD 2EN8A 5A6AA 1Z0BA 5TSEA 4DV6E 2EN6A 1DGCA 1ZM2A 4IS1C 4ZYDA 4RPFA 5DNLA 3U1YA 4WFTA 2LT7A 4MU0A 2VQFI 1H7SA 4WSPA 3LNUA 3QG5C 4LFCI 2KOUA 4NXNE 1KIJA 3C4BA 4R2AA 4FW7A 3J80C 3LTOA 4DPTA 2UXCI 2Z5BA 5AE2A 4UT4A 5C0XA 2M1SA 2VE7C 3K17A 3ZM7A 1RR9A 4LTYA 1IBKI 2LJHA 3ZKDA 3HJCA 1EH6A 2MDGA 4DR4E 2EM7A 1ZM9A 1TF6A 2X36A 4R2PA 2VQFE 5A6JA 5C0XB 3J81C 2DIXA 1DARA 4DR6I 4JI0E 3FIGA 2EMKA 4HEIA 2PO2A 4FWDA 2EN1A 4USKA 3M99B 4KHPI 1X5WA 4R2EA 4TUGA 2L2NA 2LMZA 4OO1B 4O4KA 1R6LA 5C0XE 4DR7E 4B3MI 2ELYA 1EKZA 2DGCA 4LF7I 1JK2A 2HKEA 2LTSA 4LF7E 2YTIA 4JYAE 1YPNA 2JEBB 2AE8A 1P47A 2RSMA 4KQVA 1HNZI 3C4TA 2EMZA 4WX9A 2UU9E 4BC7A 2O1UA 2YRKA 2N3GA 4X65E 2G7HA 4B3ME 4GKKE 3ZZTA 2UUBI 2YSOA 3ECRA 2JP9A 2EQ3A 4GKKI 2YTFA 2EQ0A 1HNXI 2E5LE 3PYGA 1NHJA 1X49A 5AC5A 4U3DA 4LF5I 4J8ZA 1UDQA 2HK2A 2UU9I 1KVKA 4DV2I 3K85A 2EPRA 1J5EI 4AM3A 1UDSA 2WBTA 2WBUA 1ZM4A 2EM0A 1HNXE 2AJ4A 2V88A 1ELOA 3L00A 1N32I 4X9JA 5F3WA 1WHQA 3P3GA 4NXME 3PS3A 3OTOI 2EMXA 3WU5A 2JEAA 4OX9I 3THOB 1HR0I 1S16A 1N33I 5DROA 4B3SI 1OYRA 3C6MA 2ELZA 1STUA 1GTKA 1ZR9A 2EL4A 1ZXMA 1PJQA 4M9VC 2DEIA 2JE6B 4P7DA 2YRMA 4O24A 2L2KB 2FTXB 3JTZA 1USUA 1B69A 3LLHA 1AH5A 1UN6B 4DPXA 2NPFA 2JXPA 1DQ3A 4AIMA 3VK6A 4USMA 4LF5E 1BB8A 2M7QA 2NUFA 1B62A 4LFCE 4LOMA 2CTDA 2YTJA 2EN3A 4FWHA 3EPKA 5LMNE 3LMLA 1HNZE 3ZZUA 1LLMC 3H09A 2PO0A 2J65A 2GLIA 1Z0WA 1J26A 4URLA 4NXMI 2PO1B 2HJJA 4P7AA 4DV1E 2BA0D 2IOQA 4ZYGA 4DR2E 4X65I 4YHHI 3T1HI 4LF9E 2BA1G 5L3JA 2EN2A 4BA1A 4JI2E 3VHTB 2JPAA 2HHHE 1IQOA 1UDNA 4P52A 2FGGA 2HHHI 2WCC3 2EWLA 4WXDA 3P3EA 2BR2A 4PRVA 3BGHA 4Z7YA 1NHIA 4Q35B 4OKGA 2BBGA 1EA6A 2NUEA 2IOPA 4LF8E 3IWBA 2WP8A 4DPWA 2CT1A 2YT4A 3AV0A 2YRHA 1RMDA 2UUAE 2V85A 1Z1BA 2LJUA 4B3TE 4GKJI 2LCEA 2OI2A 2EMLA 1N32E 2CSHA 1YFHA 2R1FA 3EPHA 1UEKA 5JEAB 2PNZB 1SFEA 2WZOA 2L3JA 2EOJA 1OYPA 1I94I 4JI7I 2I9IA 3KZYA 5EKWA 2EMHA 2M9AA 5LMUE 1BKNA 4JI4I 1G2FC 5K36C 4FWGA 1YZ9A 1XNRI 5A6BA 1MU5A 1UILA 4BA1B 5FWKA 2YSPA 1KTVA 4DV3I 2WW4A 4DR2I 4R2SA 2HFUA 1QZRA 4DR7I 2B7VA 4DXLA 3ADJA 1NEIA 4LFBE 1RC7A 3GMEA 5A2QQ 1I94E 1EH8A 1HNWE 1T4LB 4LFBI 4GZNC 3ZOQB 2EMFA 2EM8A 2DRPA 1FWLA 2HGHA 1T4NA 4DV3E 2EE8A 5K36A 4LF4E 3M6AA 5DRQA 1USVA 1WUUA 4HY1A 2JVAA 4QNJA 2O1TA 4LCFA 4EMDA 3QT6A 3ZZ0A 2RS6A 1MEYC 4QNKA 2HKJA 2L6MA 4JI5E 2PNZA 1T39A 5GMEA 5JEAE 2EPXA 4RHBB 4N4RB 4X66E 3NZKA 3P06A 2JOBA 5LMUI 4FW6A 2JT2A 3B78A 3L7ZA 5JEAF 4JI1I 3PS2A 3P76A 2ENHA 3HULA 1K47A 2L92A 2VQEE 2VF1A 2V8PA 3OTOE 1Z0EA 3M85G 4KZSA 4OOGC 2NN6C 2L3CA 4JI5I 1KYQA 2EOMA 2NUGA 2CGEA 3UHMA 1E3PA 4DR5E 5AASA 2EN4A 2HFSA 2YZTA 1XMOE 2EM3A 1UHZA 1QU6A 2HC5A 2LE2A 2PO1A 2LVHA 2EMBA 4R2RA 1E3HA 1X48A 3UK3C 1IMUA 1TF3A 1YYWA 3WU6A 4B3RI 1KKHA 5A2QC 1UBDC 1G2DC 2Z5CB 3LPSA 3T1HE 4X64E 3J7Yp 4HACA 5K36D 3DF6A 4OX9E 2A2CA 1PVGA 2RQLA 4NBQA 1WRJA 1Z59A 5IT9Q 2F4VE 2RTXA 1OJ4A 5DNXA 4AIDA 2HK3A 4N3OA 4DPUA 4NHRA 3PYDA 2X7IA 3HPZA 3B4TA 4F9BB 1RQ0A 1PDAA 4FW3A 4HYMA 2ZM6I 4F54A 2BA1D 4IFDF 4R2QA 1IQSA 2EOFA 3F6HA 1F2IG 4BBYA 3PS1A 4R1FA 2UUAI 5K36B 2B3TB 1A1HA 3CDIA 4JI6I 3T1YE 4O43A 1XXEA 2GS8A 2LJPA 4JI0I 2DMIA 2YTDA 1FWKA 5AE1A 2R3VA 4IZJA 4DV0I 2O3ZA 2XEXA 1N34E 4LF8I 2CZ9A 2UUCI 4JI4E 2BV3A 1ZBQA 2GQ0A 5IWAI 1IBKE 4LF4I 1FI4A 1YUJA 2GO4A 1H74A 4BA2A 4DMIA 4JG4A 4ZYHA 4YY3E 2GO3A 4MLVA 2EL6A 1ZM3A 2NN6D 4DV5E 1UDOA 4PU9A 1X6FA 4WPYA 4JI7E 4JYAI 3IWCA 2JR1A 4L5NC 4M0VA 4BMJA 1HR0E 2PRTA 1RHYA 2K7IA 2UUBE 1Z5BA 2F1DA 4MYUA 2EMAA 4MU3A 1A1GA 2VF3A 4P78A 2B9DA 2LV2A 2DLKA 3H1CA 4ED4A 3B8HA 4YY3I 4IFDB 4OO1C 3VYYA 2M4IA 4FK5C 2YWQA 1WHNA 5K36F 5IT9C 4BA2B 3AUZA 2KONA 3PYFA 3M7NG 2NN6A 5DRRA 5ELWA 3C6KA 3HXLA 2K4VA 4DU8A 4LFAI 2UUCE 2EOZA 1KJKA 4GEQB 4IFDE 2EPCA 1Z0CA 4ZVIA 2I13A 1BBGA 1JK1A 2LTRA 2PO0B 1YYOA 2L8TA 1HNWI 2YTQA 3HPSA 5KL3A 4M1KA 2EPAA 4M30A 3U1KA 2IERA 2MC5A 1N36E 2BM1A 3BIDA 2EORA 3DD6A 1WXRA 4JI3E 1NCSA 4F6NA 4DUZI 4AQYE 4ISAA 2YTGA 1XHKA 2YTNA 3PYEA 5CFFE 3EQ1A 1A1IA 1MGTA 2V8QB 3BBGA 1YHCA 2VESA 2F4VI 2GPIA 4ZYEA 4DV6I 2EOSA 2V87A 2JY9A 1P42A 4WSGA 4B3TI 1SR9A 3J7AG 2CG9A 5IXMB 4X62E 1HK7A 4F6MA 1QNTA 4B3RE 1PKPA 4XTJA 4LCHA 2Z5CA 2YU8A 3ZKBA 4DU7A 2C39B 2C37A 1XNQE 1ZAAC 2UXBE 4BC9A 2CPNA 4DR4I 1X3CA 1Y5YA 4GQUA 4JI2I 2ODRD 3KRNA 4DUZE 4JI3I 4MDTA 1WJPA 2BM0A 4OO1D 4JI6E 1T4OA 2NABA 5KL5A 2EMIA 3DJWA 2LBSB 2GHFA 4KHPE 4WYQB 4X8WA 2C38B 2EPKX 4DKKA 2EM9A 4DV0E 1GQEA 1L4SA 4BS9A 4WUBA 5FLXQ 5T6JA 3D4JA 2WNRB 2BB8A 3L7ZB 4MQYA 2YPNA 3H4LA 4M2ZA 5BR8E 1IBME 4JV5E 2EFGA 4F9AB 1N34I 3CDJA 5KL4A 2EN7A 2EOHA 4DR1E 3V5RA 4OZEA 4OO1A 2MKNA 4BHBA 1MG7A 4DR6E 2EMWA 4GKJE 1Z5CA 1H72C 1Y6ZA 3QT8A 4R2DA 2J7KA 4DV5I 1Y4SA 4BHCA 1R6MA 4X66I 3T1YI 4BCAA 2CVEA 2E1MA 4DUYE 1A1FA 3HTXA 1A1LA 2MC6A 2F8BA 1XMQE 2V83A 3QT7A 4FW5A 4DR5I 3KWRA 2LO3A 2RSIA 1ZXNA 4K0KE 2D9HA 4NZVA 3GCMA 4IZKA 1N36I 3K6QA 2YTEA 2EPUA 4L8NA 5IV8B 4K0KI 2LRSA 2V2ZA 2L33A 4TUIA 5C0XF 2A2DA 2Z5BB 3THNA 4DV4I 4IZJB 5AC4A 3TQMA 5A6BD 4DUYI 2EOEA 2Q8UA 5AE3A 4O5GA 2RPCA 2E72A 1N33E 4RH8A 4WUCA 3V2UC
chains in the Genus database with same CATH topology
4LFAE 1VISA 4FW9A 2ODRC 2VQEI 4DV7E 5GMDA 4DR1I 1NHHA 3OMLA 3ADLA 4UTGA 2UXCE 2ZITA 4DR3I 1FJGE 2H36X 2UXCI 2ZM6E 4DV2E 3RMPA 2E1RA 2ZBKB 4IZKB 3J81Q 1DI2A 1Z5AA 3P1XA 4X62I 2DMYA 1MX0A 5LMNI 3J80Q 4R03A 5LL6R 4JI8I 1NZ0A 2RS7A 1N0UA 2UXDE 4MYTA 3WU3A 1U2RA 5IWAE 1ZBTA 1Z0GA 3GONA 1Y4UA 1IBLI 1FNMA 4HXZA 1Z0TA 1IBLE 1D6TA 3Q6NA 3VYXA 2DSYA 3F6GA 2R42A 4JI8E 2V2QA 4PRXA 1FJGI 4F9CB 2LUQA 2EZ6A 1RREA 2O1VA 1GZ6A 2UXDI 4LF9I 3B82A 4WUDA 1B63A 2DB2A 4DV4E 2N3HA 4LF6E 4I8OA 3IWDA 1IBMI 3PRYA 2DEJA 4IZJD 2IHR1 1H7UA 3ADGA 4Z7CA 5BR8I 4R8OA 1XMQI 1YYKA 3ADIA 5ADZA 3Q1QA 5DNYA 2V34A 2L2MA 2PNMA 2NA2A 3HQ1A 2B7TA 3K1JA 1FKAE 3F0NA 1Z0VA 1EI1A 4Q28A 1PIEA 2Z5EA 2MDRA 4LF6I 3Q6MA 1XNRE 1X47A 2V86A 5FLXC 2V2VA 4I3HA 3WU4A 4JV5I 2LUPB 3JU0A 3MSWA 3JAMC 4JI1E 4HACB 2JWOA 2FV4B 2V89A 3QT5A 4X64I 1O0WA 4B3SE 1A6FA 1J5EE 1H73A 4LU9A 3JAMQ 2JOXA 1XMOI 1S4EA 4AQYI 2O1WA 1N0VC 4DV7I 2KHXA 3J7AM 4NXNI 2E5LI 4DPYA 4DR3E 2PNLA 2Q2EB 1XNQI 4FN5A 4YHHE 4DV1I 2UXBI 1Z0BA 4DV6E 1ZM2A 4RPFA 4WFTA 2VQFI 1H7SA 4WSPA 3LNUA 4LFCI 2KOUA 4NXNE 1KIJA 3C4BA 3J80C 3LTOA 4DPTA 2Z5BA 5AE2A 4UT4A 2M1SA 2VE7C 3K17A 3ZM7A 1RR9A 4LTYA 1IBKI 2LJHA 3ZKDA 3HJCA 4DR4E 1ZM9A 2X36A 2VQFE 3J81C 2DIXA 1DARA 4DR6I 4JI0E 3FIGA 4FWDA 4USKA 4KHPI 4TUGA 2L2NA 2LMZA 4B3MI 4DR7E 1EKZA 4LF7I 2HKEA 2LTSA 4LF7E 4JYAE 2RSMA 4KQVA 1HNZI 3C4TA 2UU9E 4BC7A 2O1UA 2N3GA 4X65E 2G7HA 4B3ME 4GKKE 3ZZTA 2UUBI 4GKKI 1HNXI 2E5LE 3PYGA 1NHJA 1X49A 4LF5I 4J8ZA 2HK2A 2UU9I 1KVKA 4DV2I 3K85A 1J5EI 1ZM4A 1HNXE 2AJ4A 2V88A 1ELOA 1N32I 5F3WA 1WHQA 3OTOI 4NXME 3WU5A 4OX9I 1HR0I 1S16A 1N33I 4B3SI 1STUA 1ZXMA 2DEIA 4P7DA 2L2KB 2FTXB 3JTZA 1USUA 3LLHA 4DPXA 2NPFA 1DQ3A 3VK6A 4USMA 4LF5E 2M7QA 2NUFA 1B62A 4LFCE 4FWHA 5LMNE 3LMLA 1HNZE 3ZZUA 3H09A 4URLA 1Z0WA 1J26A 4NXMI 4X65I 4P7AA 4DV1E 2IOQA 4YHHI 3T1HI 4DR2E 4LF9E 5L3JA 4JI2E 2HHHE 4P52A 2FGGA 2HHHI 2EWLA 4PRVA 4Z7YA 1NHIA 1EA6A 2NUEA 2IOPA 4LF8E 3IWBA 4DPWA 2YT4A 3AV0A 2UUAE 2V85A 4B3TE 4GKJI 2OI2A 1N32E 1UEKA 2WZOA 2L3JA 1I94I 4JI7I 5LMUE 1BKNA 4JI4I 4FWGA 1YZ9A 1XNRI 1MU5A 1UILA 5FWKA 1KTVA 4DV3I 2WW4A 4DR2I 2HFUA 1QZRA 4DR7I 2B7VA 4DXLA 3ADJA 4LFBE 1RC7A 5A2QQ 1I94E 1HNWE 1T4LB 4LFBI 3ZOQB 1FWLA 1T4NA 4DV3E 4LF4E 3M6AA 1USVA 1WUUA 4HY1A 2JVAA 2O1TA 4EMDA 3QT6A 3ZZ0A 2RS6A 2HKJA 2L6MA 4JI5E 5GMEA 4X66E 3P06A 2JOBA 5LMUI 3B78A 4JI1I 3HULA 1K47A 2L92A 2VQEE 2VF1A 2V8PA 3OTOE 1Z0EA 4KZSA 4OOGC 2L3CA 4JI5I 2NUGA 2CGEA 4DR5E 5AASA 2HFSA 2YZTA 1XMOE 1UHZA 1QU6A 2LE2A 1X48A 3WU6A 5IT9Q 1YYWA 4B3RI 1KKHA 5A2QC 2Z5CB 3LPSA 3T1HE 4X64E 3J7Yp 4HACA 3DF6A 4OX9E 2A2CA 1PVGA 1Z59A 2F4VE 2RTXA 1OJ4A 4DPUA 2HK3A 4N3OA 3PYDA 2X7IA 3HPZA 4F9BB 1RQ0A 4HYMA 2ZM6I 4F54A 3F6HA 4BBYA 4R1FA 2UUAI 2B3TB 4JI6I 3T1YE 2GS8A 2LJPA 4JI0I 1FWKA 5AE1A 2R3VA 4IZJA 4DV0I 2XEXA 1N34E 4LF8I 2CZ9A 2UUCI 4JI4E 2BV3A 1ZBQA 2GQ0A 5IWAI 1IBKE 4LF4I 1FI4A 1H74A 4DMIA 4JG4A 4YY3E 1ZM3A 4JYAI 4DV5E 4PU9A 4WPYA 4JI7E 3IWCA 2JR1A 4L5NC 4M0VA 4BMJA 1HR0E 3CWVA 1Z5BA 2UUBE 4MYUA 2VF3A 4P78A 2B9DA 4ED4A 3B8HA 4YY3I 3VYYA 2M4IA 1WHNA 5IT9C 3AUZA 2KONA 3PYFA 3HXLA 2K4VA 4DU8A 4LFAI 2UUCE 4GEQB 1Z0CA 4ZVIA 2LTRA 1YYOA 2L8TA 1HNWI 3HPSA 4M1KA 4M30A 2MC5A 1N36E 2BM1A 1WXRA 4JI3E 4DUZI 4AQYE 1XHKA 3PYEA 5CFFE 2V8QB 2F4VI 4DV6I 2V87A 2JY9A 4B3TI 1SR9A 3J7AG 2CG9A 4X62E 1HK7A 4B3RE 1PKPA 4XTJA 2Z5CA 3ZKBA 4DU7A 1XNQE 2UXBE 4BC9A 2CPNA 4DR4I 4JI2I 2ODRD 4DUZE 4JI3I 4JI6E 1T4OA 3DJWA 2LBSB 4KHPE 4WYQB 4X8WA 4DKKA 4DV0E 1GQEA 4BS9A 4WUBA 5FLXQ 5T6JA 3D4JA 3H4LA 4M2ZA 5BR8E 1IBME 4JV5E 2EFGA 4F9AB 1N34I 4DR1E 3V5RA 1MG7A 4DR6E 4GKJE 1Z5CA 1H72C 1Y6ZA 3QT8A 2J7KA 4DV5I 1Y4SA 3T1YI 4X66I 4BCAA 2E1MA 4DUYE 3HTXA 2MC6A 2F8BA 1XMQE 2V83A 3QT7A 4DR5I 3KWRA 1ZXNA 1N36I 4K0KE 4IZKA 3K6QA 4K0KI 4L8NA 2LRSA 2V2ZA 2L33A 4TUIA 2A2DA 2Z5BB 4DV4I 4IZJB 4DUYI 5AE3A 1N33E 2BM0A 4WUCA 3V2UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA E;  1VIS A;  4FW9 A;  2VQE I;  4DV7 E;  5GMD A;  4DR1 I;  1NHH A;  3ADL A;  4UTG A;  2UXC E;  2ZIT A;  4DR3 I;  1FJG E;  2UXC I;  2ZM6 E;  4DV2 E;  3J81 Q;  2E1R A;  2ZBK B;  1DI2 A;  1Z5A A;  3P1X A;  4X62 I;  2DMY A;  1MX0 A;  5LMN I;  3J80 Q;  5LL6 R;  4JI8 I;  1NZ0 A;  2RS7 A;  1N0U A;  2UXD E;  4MYT A;  3WU3 A;  1U2R A;  5IWA E;  1ZBT A;  1Z0G A;  3GON A;  1IBL I;  1FNM A;  4HXZ A;  1Z0T A;  1IBL E;  1D6T A;  3VYX A;  2R42 A;  4JI8 E;  2V2Q A;  4PRX A;  1FJG I;  2LUQ A;  2EZ6 A;  1RRE A;  2UXD I;  4LF9 I;  3B82 A;  4WUD A;  1B63 A;  2DB2 A;  4DV4 E;  2N3H A;  4LF6 E;  1IBM I;  2DEJ A;  2IHR 1;  1H7U A;  3ADG A;  4Z7C A;  5BR8 I;  1XMQ I;  1YYK A;  3ADI A;  3Q1Q A;  2V34 A;  2L2M A;  2NA2 A;  2B7T A;  3K1J A;  1FKA E;  3F0N A;  1Z0V A;  1EI1 A;  1PIE A;  2MDR A;  4LF6 I;  1XNR E;  1X47 A;  4JV5 I;  2V2V A;  4I3H A;  3WU4 A;  5FLX C;  2LUP B;  3JAM C;  4JI1 E;  4HAC B;  3QT5 A;  4X64 I;  1O0W A;  4B3S E;  1A6F A;  1J5E E;  1H73 A;  3JAM Q;  1XMO I;  1S4E A;  4AQY I;  1N0V C;  4DV7 I;  2KHX A;  3J7A M;  4NXN I;  2E5L I;  4DPY A;  4DR3 E;  2Q2E B;  1XNQ I;  4FN5 A;  4YHH E;  4DV1 I;  2UXB I;  1Z0B A;  4DV6 E;  1ZM2 A;  4RPF A;  4WFT A;  2VQF I;  1H7S A;  3LNU A;  4LFC I;  4NXN E;  1KIJ A;  3C4B A;  3LTO A;  3J80 C;  4DPT A;  4UT4 A;  3K17 A;  3ZM7 A;  1RR9 A;  1IBK I;  2LJH A;  3ZKD A;  4DR4 E;  1ZM9 A;  2X36 A;  2VQF E;  1DAR A;  2DIX A;  3J81 C;  4DR6 I;  4JI0 E;  4FWD A;  4USK A;  4KHP I;  2L2N A;  4B3M I;  4DR7 E;  1EKZ A;  4LF7 I;  2HKE A;  2LTS A;  4LF7 E;  4JYA E;  2RSM A;  4KQV A;  1HNZ I;  3C4T A;  2UU9 E;  2N3G A;  4X65 E;  4GKK E;  4B3M E;  3ZZT A;  2UUB I;  4GKK I;  1HNX I;  2E5L E;  3PYG A;  1NHJ A;  1X49 A;  4LF5 I;  2UU9 I;  2HK2 A;  1KVK A;  4DV2 I;  1J5E I;  1ZM4 A;  1HNX E;  2AJ4 A;  1ELO A;  1N32 I;  1WHQ A;  3OTO I;  4NXM E;  3WU5 A;  4OX9 I;  1HR0 I;  1S16 A;  1N33 I;  4B3S I;  1STU A;  1ZXM A;  2DEI A;  2L2K B;  3LLH A;  4DPX A;  2NPF A;  4USM A;  4LF5 E;  2NUF A;  1B62 A;  4LFC E;  4FWH A;  5LMN E;  1HNZ E;  3ZZU A;  4URL A;  1Z0W A;  1J26 A;  4NXM I;  4X65 I;  4P7A A;  4DV1 E;  4YHH I;  3T1H I;  4DR2 E;  4LF9 E;  5L3J A;  4JI2 E;  2HHH E;  4P52 A;  2HHH I;  4PRV A;  4Z7Y A;  1NHI A;  1EA6 A;  2NUE A;  4LF8 E;  4DPW A;  2YT4 A;  2UUA E;  4B3T E;  4GKJ I;  2OI2 A;  1N32 E;  1UEK A;  2L3J A;  1I94 I;  4JI7 I;  5LMU E;  1BKN A;  4JI4 I;  4FWG A;  1YZ9 A;  1XNR I;  1MU5 A;  1UIL A;  1KTV A;  4DV3 I;  2WW4 A;  4DR2 I;  2HFU A;  1QZR A;  4DR7 I;  2B7V A;  4DXL A;  3ADJ A;  4LFB E;  1RC7 A;  5A2Q Q;  1I94 E;  1HNW E;  1T4L B;  4LFB I;  1FWL A;  1T4N A;  4DV3 E;  4LF4 E;  3M6A A;  1WUU A;  4HY1 A;  2JVA A;  4EMD A;  3QT6 A;  3ZZ0 A;  2RS6 A;  2HKJ A;  4JI5 E;  5GME A;  4X66 E;  5LMU I;  3B78 A;  4JI1 I;  3HUL A;  1K47 A;  2VQE E;  2V8P A;  3OTO E;  1Z0E A;  4OOG C;  2L3C A;  4JI5 I;  2NUG A;  4DR5 E;  2HFS A;  1XMO E;  1UHZ A;  1QU6 A;  1X48 A;  3WU6 A;  5IT9 Q;  1YYW A;  4B3R I;  1KKH A;  5A2Q C;  3LPS A;  3T1H E;  4X64 E;  3J7Y p;  4HAC A;  2A2C A;  4OX9 E;  1PVG A;  1Z59 A;  2F4V E;  2RTX A;  1OJ4 A;  4DPU A;  2HK3 A;  3PYD A;  2X7I A;  1RQ0 A;  4HYM A;  2ZM6 I;  4R1F A;  2UUA I;  2B3T B;  4JI6 I;  3T1Y E;  2GS8 A;  2LJP A;  4JI0 I;  1FWK A;  2R3V A;  4DV0 I;  2XEX A;  1N34 E;  4LF8 I;  2CZ9 A;  2UUC I;  4JI4 E;  2BV3 A;  5IWA I;  1IBK E;  4LF4 I;  1FI4 A;  1H74 A;  4JG4 A;  4YY3 E;  1ZM3 A;  4JYA I;  4DV5 E;  4PU9 A;  4JI7 E;  3CWV A;  1HR0 E;  1Z5B A;  2UUB E;  4MYU A;  2VF3 A;  4ED4 A;  3B8H A;  4YY3 I;  3VYY A;  1WHN A;  5IT9 C;  3PYF A;  4DU8 A;  4LFA I;  2UUC E;  1Z0C A;  4ZVI A;  2LTR A;  1YYO A;  1HNW I;  4M1K A;  4M30 A;  1N36 E;  2BM1 A;  4JI3 E;  4DUZ I;  4AQY E;  1XHK A;  3PYE A;  5CFF E;  2F4V I;  4DV6 I;  2JY9 A;  4B3T I;  3J7A G;  4X62 E;  4B3R E;  1PKP A;  4XTJ A;  3ZKB A;  4DU7 A;  1XNQ E;  2UXB E;  2CPN A;  4DR4 I;  4JI2 I;  4DUZ E;  4JI3 I;  4JI6 E;  1T4O A;  2LBS B;  4KHP E;  4WYQ B;  4X8W A;  4DKK A;  4DV0 E;  1GQE A;  4WUB A;  5FLX Q;  3D4J A;  3H4L A;  4M2Z A;  5BR8 E;  1IBM E;  4JV5 E;  2EFG A;  1N34 I;  4DR1 E;  3V5R A;  1MG7 A;  4DR6 E;  4GKJ E;  1Z5C A;  1H72 C;  3QT8 A;  2J7K A;  4DV5 I;  3T1Y I;  4X66 I;  4DUY E;  3HTX A;  1XMQ E;  3QT7 A;  4DR5 I;  1ZXN A;  1N36 I;  4K0K E;  4K0K I;  2LRS A;  2V2Z A;  2L33 A;  2A2D A;  4DV4 I;  4DUY I;  1N33 E;  2BM0 A;  4WUC A;  3V2U C; 
#chains in the Genus database with same CATH topology
 4LFA E;  4IJD A;  1VIS A;  4FW9 A;  2ODR C;  1VI7 A;  2VQE I;  4DV7 E;  3BF2 A;  2EPO A;  5GMD A;  4DR1 I;  1NHH A;  1EH7 A;  3M85 D;  3OML A;  3ADL A;  4UTG A;  2DLQ A;  5EL9 A;  2UXC E;  2ZIT A;  4DR3 I;  1FJG E;  5A69 A;  2H36 X;  2JE6 A;  2WBS A;  2ZM6 E;  4DV2 E;  5KL6 A;  3RMP A;  2E1R A;  2ZBK B;  4IZK B;  5JEA D;  5LLQ A;  3J81 Q;  4HTG A;  1DI2 A;  2ADR A;  1Z5A A;  3P1X A;  2C39 A;  2C37 B;  4X62 I;  2NN6 E;  2EOQ A;  2DMY A;  3P3C A;  1MX0 A;  5LMN I;  4IFD A;  3J80 Q;  4R03 A;  5DRP A;  5LL6 R;  4JI8 I;  5A6K A;  4MU4 A;  2N8X A;  2RS7 A;  1NZ0 A;  1N0U A;  2EPM X;  2UXD E;  2EM4 A;  4MYT A;  3WU3 A;  2EMY A;  1U2R A;  5IWA E;  2NN6 B;  1YSA C;  1ZBT A;  3MHH C;  1Z0G A;  3GON A;  1ZU1 A;  4U3B A;  2EMC A;  4FW4 A;  3EPJ A;  1Y4U A;  1IBL I;  2EJ4 A;  1FNM A;  2BR2 B;  2J7J A;  2EOO A;  4HXZ A;  1PJT A;  1IBL E;  1X6H A;  1Z0T A;  3Q6N A;  3VYX A;  1D6T A;  2DSY A;  3F6G A;  4WXC A;  4JI8 E;  2R42 A;  2V2Q A;  2WNR A;  4F9C B;  4PRX A;  2LUQ A;  2EZ6 A;  1RRE A;  4IFD D;  1N3G A;  2O1V A;  1GZ6 A;  2UXD I;  1TN9 A;  1T38 A;  4LF9 I;  3B82 A;  2MKD A;  4WUD A;  1B63 A;  2DB2 A;  4DV4 E;  2N3H A;  4LCG A;  5K36 E;  4LF6 E;  5KL2 A;  2EOI A;  4I8O A;  4F2J C;  2JEB A;  3IWD A;  1OYS A;  5C0X C;  1IBM I;  3PRY A;  2DEJ A;  2YTP A;  2ENC A;  4IZJ D;  2IHR 1;  1YH8 A;  2A25 A;  2EM2 A;  4KWY A;  1H7U A;  3ADG A;  4Z7C A;  3CWV A;  2EPP A;  2PO2 B;  2EMG A;  5BR8 I;  2NN6 F;  3KZZ A;  4R8O A;  1XMQ I;  1YYK A;  3ADI A;  5ADZ A;  1BBO A;  3Q1Q A;  5DNY A;  5JEA C;  2V34 A;  2EPZ A;  2L2M A;  2PNM A;  1FJG I;  2NA2 A;  3HQ1 A;  2EPL X;  2B7T A;  3GLL A;  3K1J A;  1FKA E;  2WP8 B;  2EPN A;  1A1K A;  4R2C A;  1EI1 A;  1Z0V A;  3F0N A;  2EOX A;  2JYA A;  2IES A;  4Q28 A;  1PIE A;  2Z5E A;  2EL5 A;  1A1J A;  2JEA B;  2EM5 A;  2EQ1 A;  2MDR A;  4LF6 I;  3Q6M A;  1XNR E;  5JEA A;  1X47 A;  4OO1 E;  2V86 A;  2EOY A;  2R76 A;  2YTO A;  5FLX C;  2V2V A;  4I3H A;  2LUP B;  3WU4 A;  4JV5 I;  3JU0 A;  3MSW A;  2ENA A;  3JAM C;  4JI1 E;  1Y60 A;  2C38 A;  3MHS C;  4HAC B;  2JWO A;  2FV4 B;  2VRD A;  2V89 A;  3QT5 A;  1PJS A;  4MU1 A;  4J3D A;  4X64 I;  4LPF A;  3HKM A;  4IS9 A;  1O0W A;  1YUI A;  4B3S E;  1A6F A;  1J5E E;  1H73 A;  2EM6 A;  4IFD C;  3M7N D;  4LU9 A;  3JAM Q;  2JOX A;  1XMO I;  1S4E A;  4AQY I;  2EP3 A;  2BA0 G;  2O1W A;  2YU5 A;  3EPL A;  4MLQ A;  1N0V C;  5KL7 A;  4DV7 I;  1AAY A;  4OO1 F;  2KHX A;  3J7A M;  4NXN I;  2E5L I;  4DPY A;  4DR3 E;  2PNL A;  2Q2E B;  1XNQ I;  4FN5 A;  4YHH E;  1X6E A;  4DV1 I;  2UXB I;  5C0X D;  2EN8 A;  5A6A A;  1Z0B A;  5TSE A;  4DV6 E;  2EN6 A;  1DGC A;  1ZM2 A;  4IS1 C;  4ZYD A;  4RPF A;  5DNL A;  3U1Y A;  4WFT A;  2LT7 A;  4MU0 A;  2VQF I;  1H7S A;  4WSP A;  3LNU A;  3QG5 C;  4LFC I;  2KOU A;  4NXN E;  1KIJ A;  3C4B A;  4R2A A;  4FW7 A;  3J80 C;  3LTO A;  4DPT A;  2UXC I;  2Z5B A;  5AE2 A;  4UT4 A;  5C0X A;  2M1S A;  2VE7 C;  3K17 A;  3ZM7 A;  1RR9 A;  4LTY A;  1IBK I;  2LJH A;  3ZKD A;  3HJC A;  1EH6 A;  2MDG A;  4DR4 E;  2EM7 A;  1ZM9 A;  1TF6 A;  2X36 A;  4R2P A;  2VQF E;  5A6J A;  5C0X B;  3J81 C;  2DIX A;  1DAR A;  4DR6 I;  4JI0 E;  3FIG A;  2EMK A;  4HEI A;  2PO2 A;  4FWD A;  2EN1 A;  4USK A;  3M99 B;  4KHP I;  1X5W A;  4R2E A;  4TUG A;  2L2N A;  2LMZ A;  4OO1 B;  4O4K A;  1R6L A;  5C0X E;  4DR7 E;  4B3M I;  2ELY A;  1EKZ A;  2DGC A;  4LF7 I;  1JK2 A;  2HKE A;  2LTS A;  4LF7 E;  2YTI A;  4JYA E;  1YPN A;  2JEB B;  2AE8 A;  1P47 A;  2RSM A;  4KQV A;  1HNZ I;  3C4T A;  2EMZ A;  4WX9 A;  2UU9 E;  4BC7 A;  2O1U A;  2YRK A;  2N3G A;  4X65 E;  2G7H A;  4B3M E;  4GKK E;  3ZZT A;  2UUB I;  2YSO A;  3ECR A;  2JP9 A;  2EQ3 A;  4GKK I;  2YTF A;  2EQ0 A;  1HNX I;  2E5L E;  3PYG A;  1NHJ A;  1X49 A;  5AC5 A;  4U3D A;  4LF5 I;  4J8Z A;  1UDQ A;  2HK2 A;  2UU9 I;  1KVK A;  4DV2 I;  3K85 A;  2EPR A;  1J5E I;  4AM3 A;  1UDS A;  2WBT A;  2WBU A;  1ZM4 A;  2EM0 A;  1HNX E;  2AJ4 A;  2V88 A;  1ELO A;  3L00 A;  1N32 I;  4X9J A;  5F3W A;  1WHQ A;  3P3G A;  4NXM E;  3PS3 A;  3OTO I;  2EMX A;  3WU5 A;  2JEA A;  4OX9 I;  3THO B;  1HR0 I;  1S16 A;  1N33 I;  5DRO A;  4B3S I;  1OYR A;  3C6M A;  2ELZ A;  1STU A;  1GTK A;  1ZR9 A;  2EL4 A;  1ZXM A;  1PJQ A;  4M9V C;  2DEI A;  2JE6 B;  4P7D A;  2YRM A;  4O24 A;  2L2K B;  2FTX B;  3JTZ A;  1USU A;  1B69 A;  3LLH A;  1AH5 A;  1UN6 B;  4DPX A;  2NPF A;  2JXP A;  1DQ3 A;  4AIM A;  3VK6 A;  4USM A;  4LF5 E;  1BB8 A;  2M7Q A;  2NUF A;  1B62 A;  4LFC E;  4LOM A;  2CTD A;  2YTJ A;  2EN3 A;  4FWH A;  3EPK A;  5LMN E;  3LML A;  1HNZ E;  3ZZU A;  1LLM C;  3H09 A;  2PO0 A;  2J65 A;  2GLI A;  1Z0W A;  1J26 A;  4URL A;  4NXM I;  2PO1 B;  2HJJ A;  4P7A A;  4DV1 E;  2BA0 D;  2IOQ A;  4ZYG A;  4DR2 E;  4X65 I;  4YHH I;  3T1H I;  4LF9 E;  2BA1 G;  5L3J A;  2EN2 A;  4BA1 A;  4JI2 E;  3VHT B;  2JPA A;  2HHH E;  1IQO A;  1UDN A;  4P52 A;  2FGG A;  2HHH I;  2WCC 3;  2EWL A;  4WXD A;  3P3E A;  2BR2 A;  4PRV A;  3BGH A;  4Z7Y A;  1NHI A;  4Q35 B;  4OKG A;  2BBG A;  1EA6 A;  2NUE A;  2IOP A;  4LF8 E;  3IWB A;  2WP8 A;  4DPW A;  2CT1 A;  2YT4 A;  3AV0 A;  2YRH A;  1RMD A;  2UUA E;  2V85 A;  1Z1B A;  2LJU A;  4B3T E;  4GKJ I;  2LCE A;  2OI2 A;  2EML A;  1N32 E;  2CSH A;  1YFH A;  2R1F A;  3EPH A;  1UEK A;  5JEA B;  2PNZ B;  1SFE A;  2WZO A;  2L3J A;  2EOJ A;  1OYP A;  1I94 I;  4JI7 I;  2I9I A;  3KZY A;  5EKW A;  2EMH A;  2M9A A;  5LMU E;  1BKN A;  4JI4 I;  1G2F C;  5K36 C;  4FWG A;  1YZ9 A;  1XNR I;  5A6B A;  1MU5 A;  1UIL A;  4BA1 B;  5FWK A;  2YSP A;  1KTV A;  4DV3 I;  2WW4 A;  4DR2 I;  4R2S A;  2HFU A;  1QZR A;  4DR7 I;  2B7V A;  4DXL A;  3ADJ A;  1NEI A;  4LFB E;  1RC7 A;  3GME A;  5A2Q Q;  1I94 E;  1EH8 A;  1HNW E;  1T4L B;  4LFB I;  4GZN C;  3ZOQ B;  2EMF A;  2EM8 A;  2DRP A;  1FWL A;  2HGH A;  1T4N A;  4DV3 E;  2EE8 A;  5K36 A;  4LF4 E;  3M6A A;  5DRQ A;  1USV A;  1WUU A;  4HY1 A;  2JVA A;  4QNJ A;  2O1T A;  4LCF A;  4EMD A;  3QT6 A;  3ZZ0 A;  2RS6 A;  1MEY C;  4QNK A;  2HKJ A;  2L6M A;  4JI5 E;  2PNZ A;  1T39 A;  5GME A;  5JEA E;  2EPX A;  4RHB B;  4N4R B;  4X66 E;  3NZK A;  3P06 A;  2JOB A;  5LMU I;  4FW6 A;  2JT2 A;  3B78 A;  3L7Z A;  5JEA F;  4JI1 I;  3PS2 A;  3P76 A;  2ENH A;  3HUL A;  1K47 A;  2L92 A;  2VQE E;  2VF1 A;  2V8P A;  3OTO E;  1Z0E A;  3M85 G;  4KZS A;  4OOG C;  2NN6 C;  2L3C A;  4JI5 I;  1KYQ A;  2EOM A;  2NUG A;  2CGE A;  3UHM A;  1E3P A;  4DR5 E;  5AAS A;  2EN4 A;  2HFS A;  2YZT A;  1XMO E;  2EM3 A;  1UHZ A;  1QU6 A;  2HC5 A;  2LE2 A;  2PO1 A;  2LVH A;  2EMB A;  4R2R A;  1E3H A;  1X48 A;  3UK3 C;  1IMU A;  1TF3 A;  1YYW A;  3WU6 A;  4B3R I;  1KKH A;  5A2Q C;  1UBD C;  1G2D C;  2Z5C B;  3LPS A;  3T1H E;  4X64 E;  3J7Y p;  4HAC A;  5K36 D;  3DF6 A;  4OX9 E;  2A2C A;  1PVG A;  2RQL A;  4NBQ A;  1WRJ A;  1Z59 A;  5IT9 Q;  2F4V E;  2RTX A;  1OJ4 A;  5DNX A;  4AID A;  2HK3 A;  4N3O A;  4DPU A;  4NHR A;  3PYD A;  2X7I A;  3HPZ A;  3B4T A;  4F9B B;  1RQ0 A;  1PDA A;  4FW3 A;  4HYM A;  2ZM6 I;  4F54 A;  2BA1 D;  4IFD F;  4R2Q A;  1IQS A;  2EOF A;  3F6H A;  1F2I G;  4BBY A;  3PS1 A;  4R1F A;  2UUA I;  5K36 B;  2B3T B;  1A1H A;  3CDI A;  4JI6 I;  3T1Y E;  4O43 A;  1XXE A;  2GS8 A;  2LJP A;  4JI0 I;  2DMI A;  2YTD A;  1FWK A;  5AE1 A;  2R3V A;  4IZJ A;  4DV0 I;  2O3Z A;  2XEX A;  1N34 E;  4LF8 I;  2CZ9 A;  2UUC I;  4JI4 E;  2BV3 A;  1ZBQ A;  2GQ0 A;  5IWA I;  1IBK E;  4LF4 I;  1FI4 A;  1YUJ A;  2GO4 A;  1H74 A;  4BA2 A;  4DMI A;  4JG4 A;  4ZYH A;  4YY3 E;  2GO3 A;  4MLV A;  2EL6 A;  1ZM3 A;  2NN6 D;  4DV5 E;  1UDO A;  4PU9 A;  1X6F A;  4WPY A;  4JI7 E;  4JYA I;  3IWC A;  2JR1 A;  4L5N C;  4M0V A;  4BMJ A;  1HR0 E;  2PRT A;  1RHY A;  2K7I A;  2UUB E;  1Z5B A;  2F1D A;  4MYU A;  2EMA A;  4MU3 A;  1A1G A;  2VF3 A;  4P78 A;  2B9D A;  2LV2 A;  2DLK A;  3H1C A;  4ED4 A;  3B8H A;  4YY3 I;  4IFD B;  4OO1 C;  3VYY A;  2M4I A;  4FK5 C;  2YWQ A;  1WHN A;  5K36 F;  5IT9 C;  4BA2 B;  3AUZ A;  2KON A;  3PYF A;  3M7N G;  2NN6 A;  5DRR A;  5ELW A;  3C6K A;  3HXL A;  2K4V A;  4DU8 A;  4LFA I;  2UUC E;  2EOZ A;  1KJK A;  4GEQ B;  4IFD E;  2EPC A;  1Z0C A;  4ZVI A;  2I13 A;  1BBG A;  1JK1 A;  2LTR A;  2PO0 B;  1YYO A;  2L8T A;  1HNW I;  2YTQ A;  3HPS A;  5KL3 A;  4M1K A;  2EPA A;  4M30 A;  3U1K A;  2IER A;  2MC5 A;  1N36 E;  2BM1 A;  3BID A;  2EOR A;  3DD6 A;  1WXR A;  4JI3 E;  1NCS A;  4F6N A;  4DUZ I;  4AQY E;  4ISA A;  2YTG A;  1XHK A;  2YTN A;  3PYE A;  5CFF E;  3EQ1 A;  1A1I A;  1MGT A;  2V8Q B;  3BBG A;  1YHC A;  2VES A;  2F4V I;  2GPI A;  4ZYE A;  4DV6 I;  2EOS A;  2V87 A;  2JY9 A;  1P42 A;  4WSG A;  4B3T I;  1SR9 A;  3J7A G;  2CG9 A;  5IXM B;  4X62 E;  1HK7 A;  4F6M A;  1QNT A;  4B3R E;  1PKP A;  4XTJ A;  4LCH A;  2Z5C A;  2YU8 A;  3ZKB A;  4DU7 A;  2C39 B;  2C37 A;  1XNQ E;  1ZAA C;  2UXB E;  4BC9 A;  2CPN A;  4DR4 I;  1X3C A;  1Y5Y A;  4GQU A;  4JI2 I;  2ODR D;  3KRN A;  4DUZ E;  4JI3 I;  4MDT A;  1WJP A;  2BM0 A;  4OO1 D;  4JI6 E;  1T4O A;  2NAB A;  5KL5 A;  2EMI A;  3DJW A;  2LBS B;  2GHF A;  4KHP E;  4WYQ B;  4X8W A;  2C38 B;  2EPK X;  4DKK A;  2EM9 A;  4DV0 E;  1GQE A;  1L4S A;  4BS9 A;  4WUB A;  5FLX Q;  5T6J A;  3D4J A;  2WNR B;  2BB8 A;  3L7Z B;  4MQY A;  2YPN A;  3H4L A;  4M2Z A;  5BR8 E;  1IBM E;  4JV5 E;  2EFG A;  4F9A B;  1N34 I;  3CDJ A;  5KL4 A;  2EN7 A;  2EOH A;  4DR1 E;  3V5R A;  4OZE A;  4OO1 A;  2MKN A;  4BHB A;  1MG7 A;  4DR6 E;  2EMW A;  4GKJ E;  1Z5C A;  1H72 C;  1Y6Z A;  3QT8 A;  4R2D A;  2J7K A;  4DV5 I;  1Y4S A;  4BHC A;  1R6M A;  4X66 I;  3T1Y I;  4BCA A;  2CVE A;  2E1M A;  4DUY E;  1A1F A;  3HTX A;  1A1L A;  2MC6 A;  2F8B A;  1XMQ E;  2V83 A;  3QT7 A;  4FW5 A;  4DR5 I;  3KWR A;  2LO3 A;  2RSI A;  1ZXN A;  4K0K E;  2D9H A;  4NZV A;  3GCM A;  4IZK A;  1N36 I;  3K6Q A;  2YTE A;  2EPU A;  4L8N A;  5IV8 B;  4K0K I;  2LRS A;  2V2Z A;  2L33 A;  4TUI A;  5C0X F;  2A2D A;  2Z5B B;  3THN A;  4DV4 I;  4IZJ B;  5AC4 A;  3TQM A;  5A6B D;  4DUY I;  2EOE A;  2Q8U A;  5AE3 A;  4O5G A;  2RPC A;  2E72 A;  1N33 E;  4RH8 A;  4WUC A;  3V2U C; 
#chains in the Genus database with same CATH homology
 4LFA E;  1VIS A;  4FW9 A;  2ODR C;  2VQE I;  4DV7 E;  5GMD A;  4DR1 I;  1NHH A;  3OML A;  3ADL A;  4UTG A;  2UXC E;  2ZIT A;  4DR3 I;  1FJG E;  2H36 X;  2UXC I;  2ZM6 E;  4DV2 E;  3RMP A;  2E1R A;  2ZBK B;  4IZK B;  3J81 Q;  1DI2 A;  1Z5A A;  3P1X A;  4X62 I;  2DMY A;  1MX0 A;  5LMN I;  3J80 Q;  4R03 A;  5LL6 R;  4JI8 I;  1NZ0 A;  2RS7 A;  1N0U A;  2UXD E;  4MYT A;  3WU3 A;  1U2R A;  5IWA E;  1ZBT A;  1Z0G A;  3GON A;  1Y4U A;  1IBL I;  1FNM A;  4HXZ A;  1Z0T A;  1IBL E;  1D6T A;  3Q6N A;  3VYX A;  2DSY A;  3F6G A;  2R42 A;  4JI8 E;  2V2Q A;  4PRX A;  1FJG I;  4F9C B;  2LUQ A;  2EZ6 A;  1RRE A;  2O1V A;  1GZ6 A;  2UXD I;  4LF9 I;  3B82 A;  4WUD A;  1B63 A;  2DB2 A;  4DV4 E;  2N3H A;  4LF6 E;  4I8O A;  3IWD A;  1IBM I;  3PRY A;  2DEJ A;  4IZJ D;  2IHR 1;  1H7U A;  3ADG A;  4Z7C A;  5BR8 I;  4R8O A;  1XMQ I;  1YYK A;  3ADI A;  5ADZ A;  3Q1Q A;  5DNY A;  2V34 A;  2L2M A;  2PNM A;  2NA2 A;  3HQ1 A;  2B7T A;  3K1J A;  1FKA E;  3F0N A;  1Z0V A;  1EI1 A;  4Q28 A;  1PIE A;  2Z5E A;  2MDR A;  4LF6 I;  3Q6M A;  1XNR E;  1X47 A;  2V86 A;  5FLX C;  2V2V A;  4I3H A;  3WU4 A;  4JV5 I;  2LUP B;  3JU0 A;  3MSW A;  3JAM C;  4JI1 E;  4HAC B;  2JWO A;  2FV4 B;  2V89 A;  3QT5 A;  4X64 I;  1O0W A;  4B3S E;  1A6F A;  1J5E E;  1H73 A;  4LU9 A;  3JAM Q;  2JOX A;  1XMO I;  1S4E A;  4AQY I;  2O1W A;  1N0V C;  4DV7 I;  2KHX A;  3J7A M;  4NXN I;  2E5L I;  4DPY A;  4DR3 E;  2PNL A;  2Q2E B;  1XNQ I;  4FN5 A;  4YHH E;  4DV1 I;  2UXB I;  1Z0B A;  4DV6 E;  1ZM2 A;  4RPF A;  4WFT A;  2VQF I;  1H7S A;  4WSP A;  3LNU A;  4LFC I;  2KOU A;  4NXN E;  1KIJ A;  3C4B A;  3J80 C;  3LTO A;  4DPT A;  2Z5B A;  5AE2 A;  4UT4 A;  2M1S A;  2VE7 C;  3K17 A;  3ZM7 A;  1RR9 A;  4LTY A;  1IBK I;  2LJH A;  3ZKD A;  3HJC A;  4DR4 E;  1ZM9 A;  2X36 A;  2VQF E;  3J81 C;  2DIX A;  1DAR A;  4DR6 I;  4JI0 E;  3FIG A;  4FWD A;  4USK A;  4KHP I;  4TUG A;  2L2N A;  2LMZ A;  4B3M I;  4DR7 E;  1EKZ A;  4LF7 I;  2HKE A;  2LTS A;  4LF7 E;  4JYA E;  2RSM A;  4KQV A;  1HNZ I;  3C4T A;  2UU9 E;  4BC7 A;  2O1U A;  2N3G A;  4X65 E;  2G7H A;  4B3M E;  4GKK E;  3ZZT A;  2UUB I;  4GKK I;  1HNX I;  2E5L E;  3PYG A;  1NHJ A;  1X49 A;  4LF5 I;  4J8Z A;  2HK2 A;  2UU9 I;  1KVK A;  4DV2 I;  3K85 A;  1J5E I;  1ZM4 A;  1HNX E;  2AJ4 A;  2V88 A;  1ELO A;  1N32 I;  5F3W A;  1WHQ A;  3OTO I;  4NXM E;  3WU5 A;  4OX9 I;  1HR0 I;  1S16 A;  1N33 I;  4B3S I;  1STU A;  1ZXM A;  2DEI A;  4P7D A;  2L2K B;  2FTX B;  3JTZ A;  1USU A;  3LLH A;  4DPX A;  2NPF A;  1DQ3 A;  3VK6 A;  4USM A;  4LF5 E;  2M7Q A;  2NUF A;  1B62 A;  4LFC E;  4FWH A;  5LMN E;  3LML A;  1HNZ E;  3ZZU A;  3H09 A;  4URL A;  1Z0W A;  1J26 A;  4NXM I;  4X65 I;  4P7A A;  4DV1 E;  2IOQ A;  4YHH I;  3T1H I;  4DR2 E;  4LF9 E;  5L3J A;  4JI2 E;  2HHH E;  4P52 A;  2FGG A;  2HHH I;  2EWL A;  4PRV A;  4Z7Y A;  1NHI A;  1EA6 A;  2NUE A;  2IOP A;  4LF8 E;  3IWB A;  4DPW A;  2YT4 A;  3AV0 A;  2UUA E;  2V85 A;  4B3T E;  4GKJ I;  2OI2 A;  1N32 E;  1UEK A;  2WZO A;  2L3J A;  1I94 I;  4JI7 I;  5LMU E;  1BKN A;  4JI4 I;  4FWG A;  1YZ9 A;  1XNR I;  1MU5 A;  1UIL A;  5FWK A;  1KTV A;  4DV3 I;  2WW4 A;  4DR2 I;  2HFU A;  1QZR A;  4DR7 I;  2B7V A;  4DXL A;  3ADJ A;  4LFB E;  1RC7 A;  5A2Q Q;  1I94 E;  1HNW E;  1T4L B;  4LFB I;  3ZOQ B;  1FWL A;  1T4N A;  4DV3 E;  4LF4 E;  3M6A A;  1USV A;  1WUU A;  4HY1 A;  2JVA A;  2O1T A;  4EMD A;  3QT6 A;  3ZZ0 A;  2RS6 A;  2HKJ A;  2L6M A;  4JI5 E;  5GME A;  4X66 E;  3P06 A;  2JOB A;  5LMU I;  3B78 A;  4JI1 I;  3HUL A;  1K47 A;  2L92 A;  2VQE E;  2VF1 A;  2V8P A;  3OTO E;  1Z0E A;  4KZS A;  4OOG C;  2L3C A;  4JI5 I;  2NUG A;  2CGE A;  4DR5 E;  5AAS A;  2HFS A;  2YZT A;  1XMO E;  1UHZ A;  1QU6 A;  2LE2 A;  1X48 A;  3WU6 A;  5IT9 Q;  1YYW A;  4B3R I;  1KKH A;  5A2Q C;  2Z5C B;  3LPS A;  3T1H E;  4X64 E;  3J7Y p;  4HAC A;  3DF6 A;  4OX9 E;  2A2C A;  1PVG A;  1Z59 A;  2F4V E;  2RTX A;  1OJ4 A;  4DPU A;  2HK3 A;  4N3O A;  3PYD A;  2X7I A;  3HPZ A;  4F9B B;  1RQ0 A;  4HYM A;  2ZM6 I;  4F54 A;  3F6H A;  4BBY A;  4R1F A;  2UUA I;  2B3T B;  4JI6 I;  3T1Y E;  2GS8 A;  2LJP A;  4JI0 I;  1FWK A;  5AE1 A;  2R3V A;  4IZJ A;  4DV0 I;  2XEX A;  1N34 E;  4LF8 I;  2CZ9 A;  2UUC I;  4JI4 E;  2BV3 A;  1ZBQ A;  2GQ0 A;  5IWA I;  1IBK E;  4LF4 I;  1FI4 A;  1H74 A;  4DMI A;  4JG4 A;  4YY3 E;  1ZM3 A;  4JYA I;  4DV5 E;  4PU9 A;  4WPY A;  4JI7 E;  3IWC A;  2JR1 A;  4L5N C;  4M0V A;  4BMJ A;  1HR0 E;  3CWV A;  1Z5B A;  2UUB E;  4MYU A;  2VF3 A;  4P78 A;  2B9D A;  4ED4 A;  3B8H A;  4YY3 I;  3VYY A;  2M4I A;  1WHN A;  5IT9 C;  3AUZ A;  2KON A;  3PYF A;  3HXL A;  2K4V A;  4DU8 A;  4LFA I;  2UUC E;  4GEQ B;  1Z0C A;  4ZVI A;  2LTR A;  1YYO A;  2L8T A;  1HNW I;  3HPS A;  4M1K A;  4M30 A;  2MC5 A;  1N36 E;  2BM1 A;  1WXR A;  4JI3 E;  4DUZ I;  4AQY E;  1XHK A;  3PYE A;  5CFF E;  2V8Q B;  2F4V I;  4DV6 I;  2V87 A;  2JY9 A;  4B3T I;  1SR9 A;  3J7A G;  2CG9 A;  4X62 E;  1HK7 A;  4B3R E;  1PKP A;  4XTJ A;  2Z5C A;  3ZKB A;  4DU7 A;  1XNQ E;  2UXB E;  4BC9 A;  2CPN A;  4DR4 I;  4JI2 I;  2ODR D;  4DUZ E;  4JI3 I;  4JI6 E;  1T4O A;  3DJW A;  2LBS B;  4KHP E;  4WYQ B;  4X8W A;  4DKK A;  4DV0 E;  1GQE A;  4BS9 A;  4WUB A;  5FLX Q;  5T6J A;  3D4J A;  3H4L A;  4M2Z A;  5BR8 E;  1IBM E;  4JV5 E;  2EFG A;  4F9A B;  1N34 I;  4DR1 E;  3V5R A;  1MG7 A;  4DR6 E;  4GKJ E;  1Z5C A;  1H72 C;  1Y6Z A;  3QT8 A;  2J7K A;  4DV5 I;  1Y4S A;  3T1Y I;  4X66 I;  4BCA A;  2E1M A;  4DUY E;  3HTX A;  2MC6 A;  2F8B A;  1XMQ E;  2V83 A;  3QT7 A;  4DR5 I;  3KWR A;  1ZXN A;  1N36 I;  4K0K E;  4IZK A;  3K6Q A;  4K0K I;  4L8N A;  2LRS A;  2V2Z A;  2L33 A;  4TUI A;  2A2D A;  2Z5B B;  4DV4 I;  4IZJ B;  4DUY I;  5AE3 A;  1N33 E;  2BM0 A;  4WUC A;  3V2U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...