2UUBE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uubE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubE02
1UHZA 1ZXNA 4MYUA 4LF6E 2J7KA 4DV2E 2X36A 1Z0CA 4GKJI 2ZM6E 4DR3E 4KHPI 2UUAE 1HNZI 3J7AM 4DR7I 1KVKA 3ZKBA 2JVAA 1MU5A 3LNUA 3J80Q 1UEKA 2L33A 4B3TI 1N33E 3T1HE 4B3ME 5A2QC 4JI1I 3F0NA 3PYGA 2YT4A 4DPXA 2UUBE 3T1HI 4XTJA 4JV5E 4M2ZA 3K1JA 4NXME 1Z5AA 4OOGC 1J26A 2V2ZA 5CFFE 5IWAE 1Z0EA 5FLXQ 2NA2A 1XNRI 2LTSA 5FLXC 2KHXA 4KHPE 1X49A 4B3RE 4ED4A 1H73A 4X64I 4JI3E 1PIEA 3WU5A 4JI8E 2A2DA 4LF7I 3VYYA 2LUPB 2HFSA 2NPFA 4GKKE 3T1YI 4ZVIA 4LF9E 1DARA 4JYAI 2L3CA 2LBSB 1J5EE 4LF8I 1HNZE 1OJ4A 2UUAI 2CPNA 4B3SI 4DR3I 1NHJA 4JI2I 2X7IA 1H74A 2LRSA 3J80C 4DXLA 1XMQI 3J7Yp 2VQEE 2V34A 1NHIA 1NHHA 4DR5E 4K0KE 1YYWA 2B3TB 4DV1I 1T4NA 1HR0E 5LMUE 4R1FA 5LMNI 4WUDA 4USMA 3PYFA 1XNQE 3QT6A 4DV3E 4DR7E 5BR8I 2HFUA 4DPUA 1O0WA 1N36E 4JI6E 4DR2E 1XMOI 1ZXMA 4LFCE 2UXBI 1EI1A 2VF3A 4WUCA 4FWHA 4LFAI 5BR8E 2E1RA 4UTGA 1YYOA 4LF9I 4NXNE 4X65E 1S16A 1B62A 1WUUA 5LMNE 1EKZA 1ZM4A 2XEXA 3LPSA 1KTVA 1ZM9A 3WU3A 4YHHE 4DV6E 2JY9A 4DR5I 2VQEI 4JI5I 1N36I 2IHR1 2NUEA 3V5RA 2R3VA 3PYDA 4DUZI 4RPFA 3ZM7A 1NZ0A 4DV7E 3ZZTA 1N32I 2UXDE 1KIJA 1XNQI 3T1YE 4HYMA 5LMUI 2DIXA 4WFTA 3LTOA 4LF5E 4K0KI 4JI1E 4JI3I 3ZKDA 1BKNA 4LF7E 1WHQA 1FWLA 3GONA 4DU8A 2B7TA 4Z7YA 3JAMC 4FWDA 3H4LA 2UUCE 1S4EA 1MX0A 3B78A 4X8WA 1ELOA 4JV5I 2LJHA 4M30A 4FWGA 2MDRA 4JI8I 4DV6I 4GKJE 4LF6I 1IBLI 5LL6R 3J81C 1N33I 2L2NA 4EMDA 3J7AG 3C4BA 2ZBKB 2VQFE 2DMYA 1WHNA 1XNRE 1YYKA 3OTOI 2BV3A 2AJ4A 1HNXE 2F4VI 1X48A 2V8PA 4DV7I 1Z0TA 4M1KA 1A6FA 2EZ6A 2V2VA 4JG4A 2HKEA 2HK3A 4AQYI 1IBKE 4OX9E 4WUBA 1ZM3A 3PYEA 1PKPA 3K17A 3M6AA 4LF5I 1Z0WA 4DR1I 2RSMA 1T4LB 1FWKA 4DV5I 1GQEA 4KQVA 5L3JA 3QT8A 1XMQE 2WW4A 3B8HA 4DV4E 2DB2A 2CZ9A 2UXCI 4LFBI 4DUYE 4JI0I 2NUFA 1KKHA 2N3HA 2L2KB 4DR1E 1IBME 4DV3I 4USKA 1HR0I 4X66E 1VISA 3V2UC 4NXNI 4LFAE 2BM0A 1I94I 2UU9E 2DEIA 3B82A 2UXBE 4DU7A 1XMOE 4FN5A 2RS7A 3ZZUA 4DPYA 2HHHE 1XHKA 4HACA 4DR2I 4LF8E 4AQYE 5IWAI 3WU6A 1H7UA 4JI7I 2L3JA 1EA6A 3VYXA 1N0VC 1QZRA 4HACB 4X66I 3OTOE 3C4TA 1RREA 4X62I 3Q1QA 4MYTA 4DR4E 1IBMI 2HKJA 2NUGA 5IT9Q 4DKKA 4Z7CA 4URLA 2V2QA 4X64E 2LJPA 2UXCE 1N0UA 1IBKI 3JAMQ 4OX9I 1Z0BA 4P7AA 4JI2E 2E5LI 3CWVA 4NXMI 2UXDI 4DR6E 1N34I 2A2CA 4DUZE 2UUBI 4JYAE 1HNWI 5IT9C 4FW9A 1ZM2A 1Z0VA 4YHHI 4LF4I 1X47A 1K47A 4B3RI 3HTXA 2RTXA 4B3MI 1Z0GA 5GMEA 1FNMA 4JI4I 4YY3I 2UUCI 4PU9A 3ADGA 1N34E 4DPTA 4DR6I 3ADJA 3ADIA 1DI2A 3D4JA 2E5LE 4JI4E 1RR9A 1PVGA 2VQFI 1YZ9A 2UU9I 2ZITA 1IBLE 3ADLA 4LF4E 1I94E 1H72C 4DR4I 1FJGI 4B3TE 2Q2EB 1HNWE 1FKAE 4PRVA 3HULA 3P1XA 1Z5CA 5A2QQ 4DV1E 4JI7E 2R42A 4JI5E 2BM1A 2LTRA 2ZM6I 3QT5A 4LFBE 1D6TA 1U2RA 4DV4I 1FI4A 4B3SE 2GS8A 4HXZA 4DV2I 4DV5E 2L2MA 1STUA 2EFGA 4DPWA 4HY1A 3QT7A 3WU4A 4X62E 4X65I 1H7SA 2OI2A 4DV0I 1Z59A 1FJGE 4UT4A 1N32E 4JI0E 1RQ0A 2HK2A 2HHHI 3ZZ0A 4JI6I 2N3GA 1B63A 4LFCI 1ZBTA 4P52A 4PRXA 1T4OA 1UILA 4I3HA 1MG7A 2B7VA 3J81Q 2RS6A 2DEJA 1J5EI 5GMDA 4YY3E 2LUQA 4WYQB 1QU6A 2F4VE 1HNXI 4GKKI 4DV0E 1Z5BA 3LLHA 1RC7A 4DUYI
chains in the Genus database with same CATH superfamily
5JEAC 1UHZA 1HK7A 1ZXNA 4MYUA 1ZR9A 4LF6E 2J7KA 4DV2E 2X36A 1Z0CA 2YTJA 4GKJI 2JR1A 2ZM6E 2ODRC 4DR3E 2NN6E 2HGHA 4KHPI 3L00A 1T38A 2UUAE 3F6GA 1HNZI 4OO1B 5KL6A 4R2AA 3J7AM 2E1MA 2JWOA 2ELZA 1USVA 4DR7I 1AH5A 1MGTA 1KVKA 2DLKA 5JEAD 2WZOA 3ZKBA 2JVAA 1MU5A 3LNUA 3J80Q 2LVHA 1UEKA 1PJQA 3MHSC 4OO1A 1E3PA 2JOBA 2L33A 3RMPA 4BHBA 4B3TI 2YRHA 3JTZA 2ODRD 1N33E 2V87A 3T1HE 4B3ME 2PNZA 2EPAA 5K36C 5A2QC 4JI1I 3THOB 3F0NA 5DRQA 4N4RB 3PYGA 2EE8A 4NHRA 1PJSA 4BS9A 2YT4A 1ZU1A 2O3ZA 1UDSA 4HEIA 2LT7A 4DPXA 2M1SA 4R2SA 2EOYA 2UUBE 3T1HI 4XTJA 4JV5E 4M2ZA 4WSGA 3K1JA 2L6MA 1SR9A 4NXME 1EH6A 2EOZA 3IWBA 1WXRA 1Z5AA 4MU1A 5F3WA 4OOGC 3P3CA 4IFDC 1J26A 2V2ZA 5CFFE 5IWAE 1BB8A 1Z0EA 5FLXQ 2NA2A 1XNRI 2LTSA 5FLXC 2KHXA 2EMZA 4KHPE 2WBSA 1X49A 4B3RE 4ED4A 1H73A 5KL4A 2WCC3 2YTPA 4JI3E 4X64I 1PIEA 3WU5A 4JI8E 2A2DA 4LF7I 3VYYA 2EPRA 4MU3A 2LUPB 2HFSA 2JOXA 4R2CA 2NPFA 4GKKE 5KL5A 3T1YI 3HQ1A 4ZVIA 2EQ1A 3GMEA 3PRYA 2R76A 4LF9E 1DARA 4JYAI 1EH8A 2KONA 4Q35B 2YTDA 2L3CA 5C0XE 2LBSB 2MDGA 4IFDE 1J5EE 2EPOA 4LF8I 5K36B 2V89A 1HNZE 1OJ4A 2ADRA 1PJTA 3FIGA 2MKDA 5KL3A 2F1DA 2UUAI 3AUZA 2YRMA 2CPNA 4B3SI 4DR3I 1NHJA 2EM8A 3U1YA 4JI2I 5DRRA 2X7IA 1H74A 4TUGA 4KZSA 1JK1A 2VESA 2LRSA 4WXDA 3J80C 4DXLA 1XMQI 1X6FA 5A6BD 3J7Yp 2VQEE 2V34A 1NHIA 2BA0G 1NHHA 4DR5E 2DMIA 1BBGA 4MU0A 1UDOA 4K0KE 1XXEA 1YYWA 1OYPA 4O5GA 2B3TB 1TF3A 2YSOA 4DV1I 1T4NA 1HR0E 2EMLA 1NEIA 2EL4A 5LMUE 3OMLA 3EPJA 4R1FA 5LMNI 2EQ3A 1A1FA 4NZVA 1P42A 4WUDA 4USMA 3PYFA 1XNQE 3QT6A 4O4KA 5DNXA 4DV3E 4F6NA 2EN8A 2NABA 4DR7E 5BR8I 3P3EA 2HFUA 4DPUA 4DMIA 2WNRB 1O0WA 1N36E 4JI6E 4P7DA 2ENAA 3BF2A 3F6HA 4DR2E 1ZXMA 1GTKA 1P47A 1ZBQA 2FV4B 4LFCE 2CG9A 5IXMB 1XMOI 2UXBI 1EI1A 3L7ZA 2VF3A 4WUCA 2EN4A 2G7HA 3P76A 4FWHA 3EPLA 4BMJA 4IZKA 5JEAB 2YSPA 4LFAI 2JE6A 2RSIA 5BR8E 2E1RA 4R8OA 2N8XA 2CVEA 2E72A 4UTGA 1IQSA 2EOHA 1YYOA 4X65E 5AE2A 4NXNE 2PO0B 4LF9I 3M7NG 2EMAA 1S16A 2DRPA 1B62A 3UK3C 4F9BB 4BA1A 4LPFA 2JP9A 3B4TA 2YPNA 5LMNE 1EKZA 1WUUA 1ZM4A 2NN6F 2XEXA 3LPSA 2EOEA 1KTVA 1DGCA 1ZM9A 1TF6A 1BBOA 4BBYA 2EPMX 4BCAA 1R6MA 3WU3A 2LV2A 2DSYA 4YHHE 2JY9A 4DV6E 2EM7A 4DR5I 4IJDA 4F6MA 2VQEI 2EMCA 3K6QA 4JI5I 2M7QA 1N36I 2EN3A 2IHR1 2NUEA 3V5RA 2R3VA 3PYDA 4DUZI 5K36A 4RPFA 2EQ0A 3ZM7A 5JEAF 1NZ0A 2ELYA 2IESA 4DV7E 2LJUA 3ZZTA 1N32I 2UXDE 1A1HA 1KIJA 2EJ4A 1XNQI 5ELWA 3T1YE 5C0XD 1SFEA 2C38A 4HYMA 2V8QB 5LMUI 4R2QA 2CGEA 3THNA 2EOIA 1TN9A 2DIXA 4FW7A 2DGCA 4WFTA 3LTOA 4LF5E 2PO2B 4K0KI 4JI1E 3KZYA 4JI3I 3ZKDA 2PO1A 5EL9A 1BKNA 4P78A 4LF7E 1WHQA 1FWLA 4M0VA 2JYAA 2Z5CB 3DD6A 3GONA 4DU8A 2F8BA 4OO1C 4M9VC 2EM9A 2Z5BB 1USUA 5C0XC 2B7TA 4Z7YA 1B69A 3JAMC 3KRNA 2LCEA 4FWDA 3H4LA 2LO3A 4AIDA 2IOQA 2UUCE 4IZJB 1S4EA 3QG5C 2EOFA 3ECRA 2JPAA 1MX0A 3B78A 1L4SA 3BIDA 4X8WA 1ELOA 3PS1A 4JV5I 2LJHA 4M30A 3L7ZB 4FWGA 3H1CA 2MDRA 4ISAA 2O1TA 1AAYA 5TSEA 5K36F 4IZKB 4JI8I 4GQUA 4DV6I 1KYQA 4GKJE 2EN2A 2CSHA 2EOSA 2IOPA 2V83A 5C0XF 4LF6I 1A1IA 2PO0A 1IBLI 5LL6R 3J81C 3Q6NA 1N33I 2L2NA 3J7AG 4EMDA 3C4BA 4ZYHA 2ZBKB 2EM2A 2EWLA 4IFDD 2VQFE 2DMYA 3LMLA 2ENCA 1WHNA 2YWQA 4FK5C 1XNRE 4MU4A 1YYKA 3HXLA 2YU5A 3OTOI 4LU9A 2PNMA 2BB8A 2BV3A 2AJ4A 1HNXE 2F4VI 1X48A 4F54A 2V8PA 4TUIA 2EPXA 4DV7I 1Z0TA 4M1KA 5JEAA 1A6FA 3BBGA 2EZ6A 2MKNA 1YHCA 2EP3A 1UDQA 1UDNA 2V2VA 2EM0A 5AASA 2C37B 2L8TA 4JG4A 1WJPA 2EMWA 2HKEA 2HK3A 4WPYA 4AQYI 1IBKE 4OX9E 4BA1B 3MHHC 4MLQA 1GZ6A 4WUBA 3JU0A 1ZM3A 3PYEA 1PKPA 2EPNA 1A1LA 4J8ZA 2EL5A 4AM3A 1VI7A 3K17A 1Y4UA 3M6AA 2K4VA 4LF5I 3M7ND 2C38B 5K36E 1E3HA 5A6JA 3ZOQB 1Z0WA 2K7IA 2JEAB 4DR1I 5IV8B 3P06A 4FW3A 2RSMA 2O1UA 1A1GA 1T4LB 5FWKA 1FWKA 2ENHA 4OKGA 4DV5I 1GQEA 3TQMA 2EL6A 4KQVA 4LCGA 5L3JA 3QT8A 1LLMC 4RH8A 2YU8A 1YPNA 1XMQE 1YUJA 2WW4A 3B8HA 4DV4E 1A1JA 1Y4SA 2DB2A 2CZ9A 2FGGA 2UXCI 2EPLX 4F2JC 4LFBI 2PO2A 4DUYE 1EH7A 2C39A 2GO3A 3Q6MA 4IZJA 4JI0I 2V85A 4IFDA 2NUFA 1KKHA 2NN6B 5KL2A 1UBDC 3PS2A 2N3HA 2JXPA 2Z5CA 2FTXB 2L2KB 4DR1E 1NCSA 1IBME 4DV3I 4IFDB 4USKA 1YUIA 3UHMA 1HR0I 4X66E 2NN6A 1VISA 3EPHA 3V2UC 3KZZA 4R2PA 2YTQA 1N3GA 4LFAE 4MLVA 4NXNI 4F9CB 2LE2A 3C6MA 3VK6A 2BM0A 2UU9E 1I94I 2JEBA 5JEAE 4IS9A 4KWYA 3DJWA 4GEQB 2DEIA 4U3DA 3B82A 2UXBE 4DU7A 2EM5A 1XMOE 2B9DA 4FN5A 3M85G 2EM6A 2RS7A 3ZZUA 4DPYA 5DROA 5KL7A 2HHHE 1XHKA 2WNRA 4BC7A 4MDTA 1R6LA 1X5WA 4HACA 4DR2I 4LF8E 4AQYE 5IWAI 3WU6A 1H7UA 2EPUA 2MC5A 3EQ1A 3H09A 1ZAAC 4FW4A 4L5NC 2L3JA 1Z1BA 4R03A 1F2IG 1EA6A 2YTIA 4NBQA 4FW5A 2C37A 2EMXA 3VYXA 4BA2B 2YTEA 5T6JA 1PDAA 1N0VC 1QZRA 4HACB 2O1WA 2JE6B 4X66I 4R2EA 3OTOE 3C4TA 1IMUA 1RREA 2PNZB 4O24A 4MYTA 4DR4E 4X62I 5C0XA 1IBMI 3Q1QA 4ZYEA 2IERA 4OO1E 5A6KA 3EPKA 2HKJA 1DQ3A 4N3OA 4U3BA 2NUGA 1OYSA 2EMKA 5IT9Q 4ZYGA 2EN1A 4DKKA 4Z7CA 4URLA 2V2QA 5ADZA 4X64E 2NN6C 2LJPA 2UXCE 3CDJA 2CT1A 2Q8UA 3NZKA 2DLQA 2EMGA 1N0UA 1IBKI 3JAMQ 4OX9I 4X9JA 1Z0BA 4P7AA 4IZJD 4JI2E 2YTNA 2BR2A 2E5LI 2EMBA 3CWVA 5K36D 4NXMI 2D9HA 2UXDI 2GQ0A 4DR6E 1N34I 2A2CA 4DUZE 3HKMA 2EMYA 2UUBI 1IQOA 4OO1D 4JYAE 2NN6D 2V88A 2KOUA 1HNWI 5IT9C 4BC9A 4FW9A 1ZM2A 2EPZA 1G2DC 1Z0VA 2JEAA 4YHHI 2RPCA 4LF4I 2EMFA 3P3GA 3DF6A 1X47A 2EPCA 2L92A 3BGHA 2EM4A 1K47A 4J3DA 4B3RI 2M4IA 2BA1G 2AE8A 4WXCA 3HTXA 2RTXA 4B3MI 4GZNC 5AE3A 1Z0GA 5GMEA 4ZYDA 2BA0D 3CDIA 3IWDA 5AE1A 1JK2A 3K85A 3HPZA 2PO1B 1FNMA 4JI4I 2HJJA 4YY3I 2EPPA 2V86A 2UUCI 4F9AB 4PU9A 3ADGA 1N34E 1UN6B 4DPTA 4DR6I 1G2FC 3ADJA 3ADIA 4AIMA 2EMHA 5DNYA 4R2RA 2E5LE 1DI2A 3D4JA 1A1KA 4I8OA 4JI4E 1RR9A 2YTGA 5AC4A 4LCHA 1PVGA 4QNJA 2JT2A 2VQFI 5DNLA 1YZ9A 2YTOA 2UU9I 2ZITA 1IBLE 2YZTA 1KJKA 4BA2A 3ADLA 2JEBB 4LF4E 2EOJA 1I94E 1H72C 3GCMA 2WP8A 3M85D 4DR4I 1FJGI 4B3TE 2Q2EB 1HNWE 3M99B 1FKAE 3HULA 3P1XA 4PRVA 2EPKX 3PS3A 2HC5A 4Q28A 2WBTA 1Z5CA 5A2QQ 1YH8A 2EN6A 2EOQA 4FW6A 1RHYA 4BHCA 4WX9A 2GO4A 2WP8B 2EORA 4DV1E 1YSAC 1QNTA 2VRDA 4JI7E 2EOMA 5AC5A 2VE7C 4JI5E 2I9IA 2R42A 2BM1A 1Y6ZA 2LTRA 2J7JA 2ZM6I 1Y5YA 2EMIA 3QT5A 2GLIA 2YRKA 4L8NA 2EM3A 5A6AA 5LLQA 4LFBE 5C0XB 1D6TA 5A6BA 1U2RA 3KWRA 4DV4I 1FI4A 4QNKA 2VF1A 4B3SE 1MEYC 4WSPA 2GS8A 4HXZA 4DV2I 4IFDF 5EKWA 3MSWA 1OYRA 4LCFA 2J65A 2BBGA 2H36X 4O43A 4R2DA 4DV5E 2L2MA 1STUA 2EFGA 4RHBB 2LMZA 4DPWA 3IWCA 3GLLA 2Z5EA 4HY1A 1X6HA 2MC6A 3QT7A 3WU4A 4X62E 2I13A 4X65I 1H7SA 1X6EA 2OI2A 4DV0I 4LOMA 1Z59A 2A25A 1WRJA 4JI7I 3HPSA 1FJGE 2BR2B 4UT4A 2EN7A 4MQYA 1N32E 4OZEA 4JI0E 2GHFA 3C6KA 3VHTB 1YFHA 1RQ0A 4HTGA 2HK2A 2HHHI 2O1VA 1RMDA 3ZZ0A 3AV0A 2N3GA 1B63A 4JI6I 4LTYA 4LFCI 1ZBTA 4P52A 2CTDA 1Y60A 3HJCA 4PRXA 1T4OA 4OO1F 2BA1D 2RQLA 1UILA 4I3HA 2WBUA 1MG7A 2EOXA 1T39A 5DRPA 2B7VA 2R1FA 3J81Q 2YTFA 5A69A 2RS6A 2C39B 2DEJA 3U1KA 1J5EI 5GMDA 4YY3E 2LUQA 4WYQB 1QU6A 2F4VE 1HNXI 4GKKI 4DV0E 2EOOA 1Z5BA 2PNLA 4IS1C 2GPIA 2M9AA 1X3CA 3LLHA 2Z5BA 1RC7A 4DUYI 2PRTA
chains in the Genus database with same CATH topology
1UHZA 1HK7A 1ZXNA 4MYUA 4LF6E 2J7KA 4DV2E 2X36A 1Z0CA 4GKJI 2JR1A 2ZM6E 2ODRC 4DR3E 4KHPI 2UUAE 3F6GA 1HNZI 3J7AM 2E1MA 2JWOA 1USVA 4DR7I 1KVKA 2WZOA 3ZKBA 2JVAA 1MU5A 3LNUA 3J80Q 1UEKA 2JOBA 2L33A 3RMPA 4B3TI 3JTZA 2ODRD 1N33E 2V87A 3T1HE 4B3ME 5A2QC 4JI1I 3F0NA 3PYGA 4BS9A 2YT4A 4DPXA 2M1SA 2UUBE 3T1HI 4XTJA 4JV5E 4M2ZA 3K1JA 2L6MA 1SR9A 4NXME 3IWBA 1WXRA 1Z5AA 5F3WA 4OOGC 1J26A 2V2ZA 5CFFE 5IWAE 1Z0EA 5FLXQ 2NA2A 1XNRI 2LTSA 5FLXC 2KHXA 4KHPE 1X49A 4B3RE 4ED4A 1H73A 4X64I 4JI3E 1PIEA 3WU5A 4JI8E 2A2DA 4LF7I 3VYYA 2LUPB 2HFSA 2JOXA 2NPFA 4GKKE 3T1YI 3HQ1A 4ZVIA 3PRYA 4LF9E 1DARA 4JYAI 2KONA 2L3CA 2LBSB 1J5EE 4LF8I 2V89A 1HNZE 1OJ4A 3FIGA 2UUAI 3AUZA 2CPNA 4B3SI 4DR3I 1NHJA 4JI2I 2X7IA 1H74A 4TUGA 4KZSA 2LRSA 3J80C 4DXLA 1XMQI 3J7Yp 2VQEE 2V34A 1NHIA 1NHHA 4DR5E 4K0KE 1YYWA 2B3TB 4DV1I 1T4NA 1HR0E 5LMUE 3OMLA 4R1FA 5LMNI 4WUDA 4USMA 3PYFA 1XNQE 3QT6A 4DV3E 4DR7E 5BR8I 2HFUA 4DPUA 4DMIA 1O0WA 1N36E 4JI6E 4P7DA 3F6HA 4DR2E 1XMOI 1ZXMA 1ZBQA 2FV4B 4LFCE 2CG9A 2UXBI 1EI1A 2VF3A 4WUCA 2G7HA 4FWHA 4BMJA 4IZKA 4LFAI 5BR8E 2E1RA 4R8OA 4UTGA 1YYOA 4LF9I 4NXNE 4X65E 5AE2A 1S16A 1B62A 4F9BB 1WUUA 5LMNE 1EKZA 1ZM4A 2XEXA 3LPSA 1KTVA 1ZM9A 4BBYA 4BCAA 3WU3A 2DSYA 4YHHE 2JY9A 4DV6E 4DR5I 2VQEI 3K6QA 4JI5I 2M7QA 1N36I 2IHR1 2NUEA 3V5RA 2R3VA 3PYDA 4DUZI 4RPFA 3ZM7A 1NZ0A 4DV7E 3ZZTA 1N32I 2UXDE 1KIJA 1XNQI 3T1YE 4HYMA 2V8QB 5LMUI 2CGEA 2DIXA 4WFTA 3LTOA 4LF5E 4K0KI 4JI1E 4JI3I 3ZKDA 1BKNA 4P78A 4LF7E 1WHQA 1FWLA 4M0VA 3GONA 2Z5CB 4DU8A 2F8BA 2Z5BB 1USUA 2B7TA 4Z7YA 3JAMC 4FWDA 3H4LA 2IOQA 2UUCE 4IZJB 1S4EA 1MX0A 3B78A 4X8WA 1ELOA 4JV5I 2LJHA 4M30A 4FWGA 2MDRA 2O1TA 4IZKB 4JI8I 4DV6I 4GKJE 2IOPA 2V83A 4LF6I 1IBLI 5LL6R 3J81C 3Q6NA 1N33I 2L2NA 3J7AG 4EMDA 3C4BA 2ZBKB 2EWLA 2VQFE 2DMYA 3LMLA 1WHNA 1XNRE 1YYKA 3HXLA 3OTOI 4LU9A 2PNMA 2BV3A 2AJ4A 1HNXE 2F4VI 1X48A 4F54A 2V8PA 4TUIA 4DV7I 1Z0TA 4M1KA 1A6FA 2EZ6A 2V2VA 5AASA 2L8TA 4JG4A 2HKEA 2HK3A 4WPYA 4AQYI 1IBKE 4OX9E 1GZ6A 4WUBA 3JU0A 1ZM3A 3PYEA 1PKPA 4J8ZA 3K17A 1Y4UA 3M6AA 2K4VA 4LF5I 3ZOQB 1Z0WA 4DR1I 3P06A 2RSMA 2O1UA 1T4LB 5FWKA 1FWKA 4DV5I 1GQEA 4KQVA 5L3JA 3QT8A 1XMQE 2WW4A 3B8HA 4DV4E 1Y4SA 2DB2A 2CZ9A 2FGGA 2UXCI 4LFBI 4DUYE 3Q6MA 4IZJA 4JI0I 2V85A 2NUFA 1KKHA 2N3HA 2Z5CA 2FTXB 2L2KB 4DR1E 1IBME 4DV3I 4USKA 1HR0I 4X66E 1VISA 3V2UC 4NXNI 4LFAE 4F9CB 2LE2A 3VK6A 2BM0A 1I94I 2UU9E 2DEIA 3DJWA 4GEQB 3B82A 2UXBE 4DU7A 1XMOE 2B9DA 4FN5A 2RS7A 3ZZUA 4DPYA 2HHHE 1XHKA 4BC7A 4HACA 4DR2I 4LF8E 4AQYE 5IWAI 3WU6A 1H7UA 4JI7I 2MC5A 3H09A 4L5NC 2L3JA 1EA6A 4R03A 3VYXA 5T6JA 1N0VC 1QZRA 4HACB 2O1WA 4X66I 3OTOE 3C4TA 1RREA 4X62I 3Q1QA 4MYTA 4DR4E 1IBMI 2HKJA 1DQ3A 4N3OA 2NUGA 5IT9Q 4DKKA 4Z7CA 4URLA 2V2QA 5ADZA 4X64E 2LJPA 2UXCE 1N0UA 1IBKI 3JAMQ 4OX9I 1Z0BA 4P7AA 4IZJD 4JI2E 2E5LI 3CWVA 4NXMI 2UXDI 2GQ0A 4DR6E 1N34I 2A2CA 4DUZE 2UUBI 4JYAE 2V88A 2KOUA 1HNWI 5IT9C 4BC9A 4FW9A 1ZM2A 1Z0VA 4YHHI 4LF4I 3DF6A 1X47A 1K47A 2L92A 4B3RI 2M4IA 3HTXA 2RTXA 4B3MI 5AE3A 1Z0GA 5GMEA 3K85A 3IWDA 5AE1A 3HPZA 1FNMA 4JI4I 4YY3I 2V86A 2UUCI 4F9AB 4PU9A 3ADGA 1N34E 4DPTA 4DR6I 3ADJA 3ADIA 5DNYA 1DI2A 3D4JA 2E5LE 4I8OA 4JI4E 1RR9A 1PVGA 2VQFI 1YZ9A 2UU9I 2ZITA 1IBLE 2YZTA 3ADLA 4LF4E 1I94E 1H72C 4DR4I 1FJGI 4B3TE 2Q2EB 1HNWE 1FKAE 4PRVA 3HULA 3P1XA 4Q28A 1Z5CA 5A2QQ 4DV1E 4JI7E 2R42A 4JI5E 2VE7C 2BM1A 1Y6ZA 2LTRA 2ZM6I 3QT5A 4L8NA 4LFBE 1D6TA 1U2RA 3KWRA 4DV4I 1FI4A 2VF1A 4B3SE 4WSPA 2GS8A 4HXZA 4DV2I 3MSWA 2H36X 4DV5E 2L2MA 1STUA 2EFGA 2LMZA 4DPWA 3IWCA 2Z5EA 4HY1A 2MC6A 3QT7A 3WU4A 4X62E 4X65I 1H7SA 2OI2A 4DV0I 1Z59A 3HPSA 1FJGE 4UT4A 1N32E 4JI0E 1RQ0A 2HK2A 2HHHI 2O1VA 3ZZ0A 3AV0A 1B63A 2N3GA 4JI6I 4LTYA 4LFCI 1ZBTA 4P52A 3HJCA 4PRXA 1T4OA 1UILA 4I3HA 1MG7A 2B7VA 3J81Q 2RS6A 2DEJA 1J5EI 5GMDA 4YY3E 2LUQA 4WYQB 1QU6A 2F4VE 1HNXI 4GKKI 4DV0E 1Z5BA 2PNLA 3LLHA 2Z5BA 1RC7A 4DUYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHZ A;  1ZXN A;  4MYU A;  4LF6 E;  2J7K A;  4DV2 E;  2X36 A;  1Z0C A;  4GKJ I;  2ZM6 E;  4DR3 E;  4KHP I;  2UUA E;  1HNZ I;  3J7A M;  4DR7 I;  1KVK A;  3ZKB A;  2JVA A;  1MU5 A;  3LNU A;  3J80 Q;  1UEK A;  2L33 A;  4B3T I;  1N33 E;  3T1H E;  4B3M E;  5A2Q C;  4JI1 I;  3F0N A;  3PYG A;  2YT4 A;  4DPX A;  2UUB E;  3T1H I;  4XTJ A;  4JV5 E;  4M2Z A;  3K1J A;  4NXM E;  1Z5A A;  4OOG C;  1J26 A;  2V2Z A;  5CFF E;  5IWA E;  1Z0E A;  5FLX Q;  2NA2 A;  1XNR I;  2LTS A;  5FLX C;  2KHX A;  4KHP E;  1X49 A;  4B3R E;  4ED4 A;  1H73 A;  4X64 I;  4JI3 E;  1PIE A;  3WU5 A;  4JI8 E;  2A2D A;  4LF7 I;  3VYY A;  2LUP B;  2HFS A;  2NPF A;  4GKK E;  3T1Y I;  4ZVI A;  4LF9 E;  1DAR A;  4JYA I;  2L3C A;  2LBS B;  1J5E E;  4LF8 I;  1HNZ E;  1OJ4 A;  2UUA I;  2CPN A;  4B3S I;  4DR3 I;  1NHJ A;  4JI2 I;  2X7I A;  1H74 A;  2LRS A;  3J80 C;  4DXL A;  1XMQ I;  3J7Y p;  2VQE E;  2V34 A;  1NHI A;  1NHH A;  4DR5 E;  4K0K E;  1YYW A;  2B3T B;  4DV1 I;  1T4N A;  1HR0 E;  5LMU E;  4R1F A;  5LMN I;  4WUD A;  4USM A;  3PYF A;  1XNQ E;  3QT6 A;  4DV3 E;  4DR7 E;  5BR8 I;  2HFU A;  4DPU A;  1O0W A;  1N36 E;  4JI6 E;  4DR2 E;  1XMO I;  1ZXM A;  4LFC E;  2UXB I;  1EI1 A;  2VF3 A;  4WUC A;  4FWH A;  4LFA I;  5BR8 E;  2E1R A;  4UTG A;  1YYO A;  4LF9 I;  4NXN E;  4X65 E;  1S16 A;  1B62 A;  1WUU A;  5LMN E;  1EKZ A;  1ZM4 A;  2XEX A;  3LPS A;  1KTV A;  1ZM9 A;  3WU3 A;  4YHH E;  4DV6 E;  2JY9 A;  4DR5 I;  2VQE I;  4JI5 I;  1N36 I;  2IHR 1;  2NUE A;  3V5R A;  2R3V A;  3PYD A;  4DUZ I;  4RPF A;  3ZM7 A;  1NZ0 A;  4DV7 E;  3ZZT A;  1N32 I;  2UXD E;  1KIJ A;  1XNQ I;  3T1Y E;  4HYM A;  5LMU I;  2DIX A;  4WFT A;  3LTO A;  4LF5 E;  4K0K I;  4JI1 E;  4JI3 I;  3ZKD A;  1BKN A;  4LF7 E;  1WHQ A;  1FWL A;  3GON A;  4DU8 A;  2B7T A;  4Z7Y A;  3JAM C;  4FWD A;  3H4L A;  2UUC E;  1S4E A;  1MX0 A;  3B78 A;  4X8W A;  1ELO A;  4JV5 I;  2LJH A;  4M30 A;  4FWG A;  2MDR A;  4JI8 I;  4DV6 I;  4GKJ E;  4LF6 I;  1IBL I;  5LL6 R;  3J81 C;  1N33 I;  2L2N A;  4EMD A;  3J7A G;  3C4B A;  2ZBK B;  2VQF E;  2DMY A;  1WHN A;  1XNR E;  1YYK A;  3OTO I;  2BV3 A;  2AJ4 A;  1HNX E;  2F4V I;  1X48 A;  2V8P A;  4DV7 I;  1Z0T A;  4M1K A;  1A6F A;  2EZ6 A;  2V2V A;  4JG4 A;  2HKE A;  2HK3 A;  4AQY I;  1IBK E;  4OX9 E;  4WUB A;  1ZM3 A;  3PYE A;  1PKP A;  3K17 A;  3M6A A;  4LF5 I;  1Z0W A;  4DR1 I;  2RSM A;  1T4L B;  1FWK A;  4DV5 I;  1GQE A;  4KQV A;  5L3J A;  3QT8 A;  1XMQ E;  2WW4 A;  3B8H A;  4DV4 E;  2DB2 A;  2CZ9 A;  2UXC I;  4LFB I;  4DUY E;  4JI0 I;  2NUF A;  1KKH A;  2N3H A;  2L2K B;  4DR1 E;  1IBM E;  4DV3 I;  4USK A;  1HR0 I;  4X66 E;  1VIS A;  3V2U C;  4NXN I;  4LFA E;  2BM0 A;  1I94 I;  2UU9 E;  2DEI A;  3B82 A;  2UXB E;  4DU7 A;  1XMO E;  4FN5 A;  2RS7 A;  3ZZU A;  4DPY A;  2HHH E;  1XHK A;  4HAC A;  4DR2 I;  4LF8 E;  4AQY E;  5IWA I;  3WU6 A;  1H7U A;  4JI7 I;  2L3J A;  1EA6 A;  3VYX A;  1N0V C;  1QZR A;  4HAC B;  4X66 I;  3OTO E;  3C4T A;  1RRE A;  4X62 I;  3Q1Q A;  4MYT A;  4DR4 E;  1IBM I;  2HKJ A;  2NUG A;  5IT9 Q;  4DKK A;  4Z7C A;  4URL A;  2V2Q A;  4X64 E;  2LJP A;  2UXC E;  1N0U A;  1IBK I;  3JAM Q;  4OX9 I;  1Z0B A;  4P7A A;  4JI2 E;  2E5L I;  3CWV A;  4NXM I;  2UXD I;  4DR6 E;  1N34 I;  2A2C A;  4DUZ E;  2UUB I;  4JYA E;  1HNW I;  5IT9 C;  4FW9 A;  1ZM2 A;  1Z0V A;  4YHH I;  4LF4 I;  1X47 A;  1K47 A;  4B3R I;  3HTX A;  2RTX A;  4B3M I;  1Z0G A;  5GME A;  1FNM A;  4JI4 I;  4YY3 I;  2UUC I;  4PU9 A;  3ADG A;  1N34 E;  4DPT A;  4DR6 I;  3ADJ A;  3ADI A;  1DI2 A;  3D4J A;  2E5L E;  4JI4 E;  1RR9 A;  1PVG A;  2VQF I;  1YZ9 A;  2UU9 I;  2ZIT A;  1IBL E;  3ADL A;  4LF4 E;  1I94 E;  1H72 C;  4DR4 I;  1FJG I;  4B3T E;  2Q2E B;  1HNW E;  1FKA E;  4PRV A;  3HUL A;  3P1X A;  1Z5C A;  5A2Q Q;  4DV1 E;  4JI7 E;  2R42 A;  4JI5 E;  2BM1 A;  2LTR A;  2ZM6 I;  3QT5 A;  4LFB E;  1D6T A;  1U2R A;  4DV4 I;  1FI4 A;  4B3S E;  2GS8 A;  4HXZ A;  4DV2 I;  4DV5 E;  2L2M A;  1STU A;  2EFG A;  4DPW A;  4HY1 A;  3QT7 A;  3WU4 A;  4X62 E;  4X65 I;  1H7S A;  2OI2 A;  4DV0 I;  1Z59 A;  1FJG E;  4UT4 A;  1N32 E;  4JI0 E;  1RQ0 A;  2HK2 A;  2HHH I;  3ZZ0 A;  4JI6 I;  2N3G A;  1B63 A;  4LFC I;  1ZBT A;  4P52 A;  4PRX A;  1T4O A;  1UIL A;  4I3H A;  1MG7 A;  2B7V A;  3J81 Q;  2RS6 A;  2DEJ A;  1J5E I;  5GMD A;  4YY3 E;  2LUQ A;  4WYQ B;  1QU6 A;  2F4V E;  1HNX I;  4GKK I;  4DV0 E;  1Z5B A;  3LLH A;  1RC7 A;  4DUY I; 
#chains in the Genus database with same CATH topology
 5JEA C;  1UHZ A;  1HK7 A;  1ZXN A;  4MYU A;  1ZR9 A;  4LF6 E;  2J7K A;  4DV2 E;  2X36 A;  1Z0C A;  2YTJ A;  4GKJ I;  2JR1 A;  2ZM6 E;  2ODR C;  4DR3 E;  2NN6 E;  2HGH A;  4KHP I;  3L00 A;  1T38 A;  2UUA E;  3F6G A;  1HNZ I;  4OO1 B;  5KL6 A;  4R2A A;  3J7A M;  2E1M A;  2JWO A;  2ELZ A;  1USV A;  4DR7 I;  1AH5 A;  1MGT A;  1KVK A;  2DLK A;  5JEA D;  2WZO A;  3ZKB A;  2JVA A;  1MU5 A;  3LNU A;  3J80 Q;  2LVH A;  1UEK A;  1PJQ A;  3MHS C;  4OO1 A;  1E3P A;  2JOB A;  2L33 A;  3RMP A;  4BHB A;  4B3T I;  2YRH A;  3JTZ A;  2ODR D;  1N33 E;  2V87 A;  3T1H E;  4B3M E;  2PNZ A;  2EPA A;  5K36 C;  5A2Q C;  4JI1 I;  3THO B;  3F0N A;  5DRQ A;  4N4R B;  3PYG A;  2EE8 A;  4NHR A;  1PJS A;  4BS9 A;  2YT4 A;  1ZU1 A;  2O3Z A;  1UDS A;  4HEI A;  2LT7 A;  4DPX A;  2M1S A;  4R2S A;  2EOY A;  2UUB E;  3T1H I;  4XTJ A;  4JV5 E;  4M2Z A;  4WSG A;  3K1J A;  2L6M A;  1SR9 A;  4NXM E;  1EH6 A;  2EOZ A;  3IWB A;  1WXR A;  1Z5A A;  4MU1 A;  5F3W A;  4OOG C;  3P3C A;  4IFD C;  1J26 A;  2V2Z A;  5CFF E;  5IWA E;  1BB8 A;  1Z0E A;  5FLX Q;  2NA2 A;  1XNR I;  2LTS A;  5FLX C;  2KHX A;  2EMZ A;  4KHP E;  2WBS A;  1X49 A;  4B3R E;  4ED4 A;  1H73 A;  5KL4 A;  2WCC 3;  2YTP A;  4JI3 E;  4X64 I;  1PIE A;  3WU5 A;  4JI8 E;  2A2D A;  4LF7 I;  3VYY A;  2EPR A;  4MU3 A;  2LUP B;  2HFS A;  2JOX A;  4R2C A;  2NPF A;  4GKK E;  5KL5 A;  3T1Y I;  3HQ1 A;  4ZVI A;  2EQ1 A;  3GME A;  3PRY A;  2R76 A;  4LF9 E;  1DAR A;  4JYA I;  1EH8 A;  2KON A;  4Q35 B;  2YTD A;  2L3C A;  5C0X E;  2LBS B;  2MDG A;  4IFD E;  1J5E E;  2EPO A;  4LF8 I;  5K36 B;  2V89 A;  1HNZ E;  1OJ4 A;  2ADR A;  1PJT A;  3FIG A;  2MKD A;  5KL3 A;  2F1D A;  2UUA I;  3AUZ A;  2YRM A;  2CPN A;  4B3S I;  4DR3 I;  1NHJ A;  2EM8 A;  3U1Y A;  4JI2 I;  5DRR A;  2X7I A;  1H74 A;  4TUG A;  4KZS A;  1JK1 A;  2VES A;  2LRS A;  4WXD A;  3J80 C;  4DXL A;  1XMQ I;  1X6F A;  5A6B D;  3J7Y p;  2VQE E;  2V34 A;  1NHI A;  2BA0 G;  1NHH A;  4DR5 E;  2DMI A;  1BBG A;  4MU0 A;  1UDO A;  4K0K E;  1XXE A;  1YYW A;  1OYP A;  4O5G A;  2B3T B;  1TF3 A;  2YSO A;  4DV1 I;  1T4N A;  1HR0 E;  2EML A;  1NEI A;  2EL4 A;  5LMU E;  3OML A;  3EPJ A;  4R1F A;  5LMN I;  2EQ3 A;  1A1F A;  4NZV A;  1P42 A;  4WUD A;  4USM A;  3PYF A;  1XNQ E;  3QT6 A;  4O4K A;  5DNX A;  4DV3 E;  4F6N A;  2EN8 A;  2NAB A;  4DR7 E;  5BR8 I;  3P3E A;  2HFU A;  4DPU A;  4DMI A;  2WNR B;  1O0W A;  1N36 E;  4JI6 E;  4P7D A;  2ENA A;  3BF2 A;  3F6H A;  4DR2 E;  1ZXM A;  1GTK A;  1P47 A;  1ZBQ A;  2FV4 B;  4LFC E;  2CG9 A;  5IXM B;  1XMO I;  2UXB I;  1EI1 A;  3L7Z A;  2VF3 A;  4WUC A;  2EN4 A;  2G7H A;  3P76 A;  4FWH A;  3EPL A;  4BMJ A;  4IZK A;  5JEA B;  2YSP A;  4LFA I;  2JE6 A;  2RSI A;  5BR8 E;  2E1R A;  4R8O A;  2N8X A;  2CVE A;  2E72 A;  4UTG A;  1IQS A;  2EOH A;  1YYO A;  4X65 E;  5AE2 A;  4NXN E;  2PO0 B;  4LF9 I;  3M7N G;  2EMA A;  1S16 A;  2DRP A;  1B62 A;  3UK3 C;  4F9B B;  4BA1 A;  4LPF A;  2JP9 A;  3B4T A;  2YPN A;  5LMN E;  1EKZ A;  1WUU A;  1ZM4 A;  2NN6 F;  2XEX A;  3LPS A;  2EOE A;  1KTV A;  1DGC A;  1ZM9 A;  1TF6 A;  1BBO A;  4BBY A;  2EPM X;  4BCA A;  1R6M A;  3WU3 A;  2LV2 A;  2DSY A;  4YHH E;  2JY9 A;  4DV6 E;  2EM7 A;  4DR5 I;  4IJD A;  4F6M A;  2VQE I;  2EMC A;  3K6Q A;  4JI5 I;  2M7Q A;  1N36 I;  2EN3 A;  2IHR 1;  2NUE A;  3V5R A;  2R3V A;  3PYD A;  4DUZ I;  5K36 A;  4RPF A;  2EQ0 A;  3ZM7 A;  5JEA F;  1NZ0 A;  2ELY A;  2IES A;  4DV7 E;  2LJU A;  3ZZT A;  1N32 I;  2UXD E;  1A1H A;  1KIJ A;  2EJ4 A;  1XNQ I;  5ELW A;  3T1Y E;  5C0X D;  1SFE A;  2C38 A;  4HYM A;  2V8Q B;  5LMU I;  4R2Q A;  2CGE A;  3THN A;  2EOI A;  1TN9 A;  2DIX A;  4FW7 A;  2DGC A;  4WFT A;  3LTO A;  4LF5 E;  2PO2 B;  4K0K I;  4JI1 E;  3KZY A;  4JI3 I;  3ZKD A;  2PO1 A;  5EL9 A;  1BKN A;  4P78 A;  4LF7 E;  1WHQ A;  1FWL A;  4M0V A;  2JYA A;  2Z5C B;  3DD6 A;  3GON A;  4DU8 A;  2F8B A;  4OO1 C;  4M9V C;  2EM9 A;  2Z5B B;  1USU A;  5C0X C;  2B7T A;  4Z7Y A;  1B69 A;  3JAM C;  3KRN A;  2LCE A;  4FWD A;  3H4L A;  2LO3 A;  4AID A;  2IOQ A;  2UUC E;  4IZJ B;  1S4E A;  3QG5 C;  2EOF A;  3ECR A;  2JPA A;  1MX0 A;  3B78 A;  1L4S A;  3BID A;  4X8W A;  1ELO A;  3PS1 A;  4JV5 I;  2LJH A;  4M30 A;  3L7Z B;  4FWG A;  3H1C A;  2MDR A;  4ISA A;  2O1T A;  1AAY A;  5TSE A;  5K36 F;  4IZK B;  4JI8 I;  4GQU A;  4DV6 I;  1KYQ A;  4GKJ E;  2EN2 A;  2CSH A;  2EOS A;  2IOP A;  2V83 A;  5C0X F;  4LF6 I;  1A1I A;  2PO0 A;  1IBL I;  5LL6 R;  3J81 C;  3Q6N A;  1N33 I;  2L2N A;  3J7A G;  4EMD A;  3C4B A;  4ZYH A;  2ZBK B;  2EM2 A;  2EWL A;  4IFD D;  2VQF E;  2DMY A;  3LML A;  2ENC A;  1WHN A;  2YWQ A;  4FK5 C;  1XNR E;  4MU4 A;  1YYK A;  3HXL A;  2YU5 A;  3OTO I;  4LU9 A;  2PNM A;  2BB8 A;  2BV3 A;  2AJ4 A;  1HNX E;  2F4V I;  1X48 A;  4F54 A;  2V8P A;  4TUI A;  2EPX A;  4DV7 I;  1Z0T A;  4M1K A;  5JEA A;  1A6F A;  3BBG A;  2EZ6 A;  2MKN A;  1YHC A;  2EP3 A;  1UDQ A;  1UDN A;  2V2V A;  2EM0 A;  5AAS A;  2C37 B;  2L8T A;  4JG4 A;  1WJP A;  2EMW A;  2HKE A;  2HK3 A;  4WPY A;  4AQY I;  1IBK E;  4OX9 E;  4BA1 B;  3MHH C;  4MLQ A;  1GZ6 A;  4WUB A;  3JU0 A;  1ZM3 A;  3PYE A;  1PKP A;  2EPN A;  1A1L A;  4J8Z A;  2EL5 A;  4AM3 A;  1VI7 A;  3K17 A;  1Y4U A;  3M6A A;  2K4V A;  4LF5 I;  3M7N D;  2C38 B;  5K36 E;  1E3H A;  5A6J A;  3ZOQ B;  1Z0W A;  2K7I A;  2JEA B;  4DR1 I;  5IV8 B;  3P06 A;  4FW3 A;  2RSM A;  2O1U A;  1A1G A;  1T4L B;  5FWK A;  1FWK A;  2ENH A;  4OKG A;  4DV5 I;  1GQE A;  3TQM A;  2EL6 A;  4KQV A;  4LCG A;  5L3J A;  3QT8 A;  1LLM C;  4RH8 A;  2YU8 A;  1YPN A;  1XMQ E;  1YUJ A;  2WW4 A;  3B8H A;  4DV4 E;  1A1J A;  1Y4S A;  2DB2 A;  2CZ9 A;  2FGG A;  2UXC I;  2EPL X;  4F2J C;  4LFB I;  2PO2 A;  4DUY E;  1EH7 A;  2C39 A;  2GO3 A;  3Q6M A;  4IZJ A;  4JI0 I;  2V85 A;  4IFD A;  2NUF A;  1KKH A;  2NN6 B;  5KL2 A;  1UBD C;  3PS2 A;  2N3H A;  2JXP A;  2Z5C A;  2FTX B;  2L2K B;  4DR1 E;  1NCS A;  1IBM E;  4DV3 I;  4IFD B;  4USK A;  1YUI A;  3UHM A;  1HR0 I;  4X66 E;  2NN6 A;  1VIS A;  3EPH A;  3V2U C;  3KZZ A;  4R2P A;  2YTQ A;  1N3G A;  4LFA E;  4MLV A;  4NXN I;  4F9C B;  2LE2 A;  3C6M A;  3VK6 A;  2BM0 A;  2UU9 E;  1I94 I;  2JEB A;  5JEA E;  4IS9 A;  4KWY A;  3DJW A;  4GEQ B;  2DEI A;  4U3D A;  3B82 A;  2UXB E;  4DU7 A;  2EM5 A;  1XMO E;  2B9D A;  4FN5 A;  3M85 G;  2EM6 A;  2RS7 A;  3ZZU A;  4DPY A;  5DRO A;  5KL7 A;  2HHH E;  1XHK A;  2WNR A;  4BC7 A;  4MDT A;  1R6L A;  1X5W A;  4HAC A;  4DR2 I;  4LF8 E;  4AQY E;  5IWA I;  3WU6 A;  1H7U A;  2EPU A;  2MC5 A;  3EQ1 A;  3H09 A;  1ZAA C;  4FW4 A;  4L5N C;  2L3J A;  1Z1B A;  4R03 A;  1F2I G;  1EA6 A;  2YTI A;  4NBQ A;  4FW5 A;  2C37 A;  2EMX A;  3VYX A;  4BA2 B;  2YTE A;  5T6J A;  1PDA A;  1N0V C;  1QZR A;  4HAC B;  2O1W A;  2JE6 B;  4X66 I;  4R2E A;  3OTO E;  3C4T A;  1IMU A;  1RRE A;  2PNZ B;  4O24 A;  4MYT A;  4DR4 E;  4X62 I;  5C0X A;  1IBM I;  3Q1Q A;  4ZYE A;  2IER A;  4OO1 E;  5A6K A;  3EPK A;  2HKJ A;  1DQ3 A;  4N3O A;  4U3B A;  2NUG A;  1OYS A;  2EMK A;  5IT9 Q;  4ZYG A;  2EN1 A;  4DKK A;  4Z7C A;  4URL A;  2V2Q A;  5ADZ A;  4X64 E;  2NN6 C;  2LJP A;  2UXC E;  3CDJ A;  2CT1 A;  2Q8U A;  3NZK A;  2DLQ A;  2EMG A;  1N0U A;  1IBK I;  3JAM Q;  4OX9 I;  4X9J A;  1Z0B A;  4P7A A;  4IZJ D;  4JI2 E;  2YTN A;  2BR2 A;  2E5L I;  2EMB A;  3CWV A;  5K36 D;  4NXM I;  2D9H A;  2UXD I;  2GQ0 A;  4DR6 E;  1N34 I;  2A2C A;  4DUZ E;  3HKM A;  2EMY A;  2UUB I;  1IQO A;  4OO1 D;  4JYA E;  2NN6 D;  2V88 A;  2KOU A;  1HNW I;  5IT9 C;  4BC9 A;  4FW9 A;  1ZM2 A;  2EPZ A;  1G2D C;  1Z0V A;  2JEA A;  4YHH I;  2RPC A;  4LF4 I;  2EMF A;  3P3G A;  3DF6 A;  1X47 A;  2EPC A;  2L92 A;  3BGH A;  2EM4 A;  1K47 A;  4J3D A;  4B3R I;  2M4I A;  2BA1 G;  2AE8 A;  4WXC A;  3HTX A;  2RTX A;  4B3M I;  4GZN C;  5AE3 A;  1Z0G A;  5GME A;  4ZYD A;  2BA0 D;  3CDI A;  3IWD A;  5AE1 A;  1JK2 A;  3K85 A;  3HPZ A;  2PO1 B;  1FNM A;  4JI4 I;  2HJJ A;  4YY3 I;  2EPP A;  2V86 A;  2UUC I;  4F9A B;  4PU9 A;  3ADG A;  1N34 E;  1UN6 B;  4DPT A;  4DR6 I;  1G2F C;  3ADJ A;  3ADI A;  4AIM A;  2EMH A;  5DNY A;  4R2R A;  2E5L E;  1DI2 A;  3D4J A;  1A1K A;  4I8O A;  4JI4 E;  1RR9 A;  2YTG A;  5AC4 A;  4LCH A;  1PVG A;  4QNJ A;  2JT2 A;  2VQF I;  5DNL A;  1YZ9 A;  2YTO A;  2UU9 I;  2ZIT A;  1IBL E;  2YZT A;  1KJK A;  4BA2 A;  3ADL A;  2JEB B;  4LF4 E;  2EOJ A;  1I94 E;  1H72 C;  3GCM A;  2WP8 A;  3M85 D;  4DR4 I;  1FJG I;  4B3T E;  2Q2E B;  1HNW E;  3M99 B;  1FKA E;  3HUL A;  3P1X A;  4PRV A;  2EPK X;  3PS3 A;  2HC5 A;  4Q28 A;  2WBT A;  1Z5C A;  5A2Q Q;  1YH8 A;  2EN6 A;  2EOQ A;  4FW6 A;  1RHY A;  4BHC A;  4WX9 A;  2GO4 A;  2WP8 B;  2EOR A;  4DV1 E;  1YSA C;  1QNT A;  2VRD A;  4JI7 E;  2EOM A;  5AC5 A;  2VE7 C;  4JI5 E;  2I9I A;  2R42 A;  2BM1 A;  1Y6Z A;  2LTR A;  2J7J A;  2ZM6 I;  1Y5Y A;  2EMI A;  3QT5 A;  2GLI A;  2YRK A;  4L8N A;  2EM3 A;  5A6A A;  5LLQ A;  4LFB E;  5C0X B;  1D6T A;  5A6B A;  1U2R A;  3KWR A;  4DV4 I;  1FI4 A;  4QNK A;  2VF1 A;  4B3S E;  1MEY C;  4WSP A;  2GS8 A;  4HXZ A;  4DV2 I;  4IFD F;  5EKW A;  3MSW A;  1OYR A;  4LCF A;  2J65 A;  2BBG A;  2H36 X;  4O43 A;  4R2D A;  4DV5 E;  2L2M A;  1STU A;  2EFG A;  4RHB B;  2LMZ A;  4DPW A;  3IWC A;  3GLL A;  2Z5E A;  4HY1 A;  1X6H A;  2MC6 A;  3QT7 A;  3WU4 A;  4X62 E;  2I13 A;  4X65 I;  1H7S A;  1X6E A;  2OI2 A;  4DV0 I;  4LOM A;  1Z59 A;  2A25 A;  1WRJ A;  4JI7 I;  3HPS A;  1FJG E;  2BR2 B;  4UT4 A;  2EN7 A;  4MQY A;  1N32 E;  4OZE A;  4JI0 E;  2GHF A;  3C6K A;  3VHT B;  1YFH A;  1RQ0 A;  4HTG A;  2HK2 A;  2HHH I;  2O1V A;  1RMD A;  3ZZ0 A;  3AV0 A;  2N3G A;  1B63 A;  4JI6 I;  4LTY A;  4LFC I;  1ZBT A;  4P52 A;  2CTD A;  1Y60 A;  3HJC A;  4PRX A;  1T4O A;  4OO1 F;  2BA1 D;  2RQL A;  1UIL A;  4I3H A;  2WBU A;  1MG7 A;  2EOX A;  1T39 A;  5DRP A;  2B7V A;  2R1F A;  3J81 Q;  2YTF A;  5A69 A;  2RS6 A;  2C39 B;  2DEJ A;  3U1K A;  1J5E I;  5GMD A;  4YY3 E;  2LUQ A;  4WYQ B;  1QU6 A;  2F4V E;  1HNX I;  4GKK I;  4DV0 E;  2EOO A;  1Z5B A;  2PNL A;  4IS1 C;  2GPI A;  2M9A A;  1X3C A;  3LLH A;  2Z5B A;  1RC7 A;  4DUY I;  2PRT A; 
#chains in the Genus database with same CATH homology
 1UHZ A;  1HK7 A;  1ZXN A;  4MYU A;  4LF6 E;  2J7K A;  4DV2 E;  2X36 A;  1Z0C A;  4GKJ I;  2JR1 A;  2ZM6 E;  2ODR C;  4DR3 E;  4KHP I;  2UUA E;  3F6G A;  1HNZ I;  3J7A M;  2E1M A;  2JWO A;  1USV A;  4DR7 I;  1KVK A;  2WZO A;  3ZKB A;  2JVA A;  1MU5 A;  3LNU A;  3J80 Q;  1UEK A;  2JOB A;  2L33 A;  3RMP A;  4B3T I;  3JTZ A;  2ODR D;  1N33 E;  2V87 A;  3T1H E;  4B3M E;  5A2Q C;  4JI1 I;  3F0N A;  3PYG A;  4BS9 A;  2YT4 A;  4DPX A;  2M1S A;  2UUB E;  3T1H I;  4XTJ A;  4JV5 E;  4M2Z A;  3K1J A;  2L6M A;  1SR9 A;  4NXM E;  3IWB A;  1WXR A;  1Z5A A;  5F3W A;  4OOG C;  1J26 A;  2V2Z A;  5CFF E;  5IWA E;  1Z0E A;  5FLX Q;  2NA2 A;  1XNR I;  2LTS A;  5FLX C;  2KHX A;  4KHP E;  1X49 A;  4B3R E;  4ED4 A;  1H73 A;  4X64 I;  4JI3 E;  1PIE A;  3WU5 A;  4JI8 E;  2A2D A;  4LF7 I;  3VYY A;  2LUP B;  2HFS A;  2JOX A;  2NPF A;  4GKK E;  3T1Y I;  3HQ1 A;  4ZVI A;  3PRY A;  4LF9 E;  1DAR A;  4JYA I;  2KON A;  2L3C A;  2LBS B;  1J5E E;  4LF8 I;  2V89 A;  1HNZ E;  1OJ4 A;  3FIG A;  2UUA I;  3AUZ A;  2CPN A;  4B3S I;  4DR3 I;  1NHJ A;  4JI2 I;  2X7I A;  1H74 A;  4TUG A;  4KZS A;  2LRS A;  3J80 C;  4DXL A;  1XMQ I;  3J7Y p;  2VQE E;  2V34 A;  1NHI A;  1NHH A;  4DR5 E;  4K0K E;  1YYW A;  2B3T B;  4DV1 I;  1T4N A;  1HR0 E;  5LMU E;  3OML A;  4R1F A;  5LMN I;  4WUD A;  4USM A;  3PYF A;  1XNQ E;  3QT6 A;  4DV3 E;  4DR7 E;  5BR8 I;  2HFU A;  4DPU A;  4DMI A;  1O0W A;  1N36 E;  4JI6 E;  4P7D A;  3F6H A;  4DR2 E;  1XMO I;  1ZXM A;  1ZBQ A;  2FV4 B;  4LFC E;  2CG9 A;  2UXB I;  1EI1 A;  2VF3 A;  4WUC A;  2G7H A;  4FWH A;  4BMJ A;  4IZK A;  4LFA I;  5BR8 E;  2E1R A;  4R8O A;  4UTG A;  1YYO A;  4LF9 I;  4NXN E;  4X65 E;  5AE2 A;  1S16 A;  1B62 A;  4F9B B;  1WUU A;  5LMN E;  1EKZ A;  1ZM4 A;  2XEX A;  3LPS A;  1KTV A;  1ZM9 A;  4BBY A;  4BCA A;  3WU3 A;  2DSY A;  4YHH E;  2JY9 A;  4DV6 E;  4DR5 I;  2VQE I;  3K6Q A;  4JI5 I;  2M7Q A;  1N36 I;  2IHR 1;  2NUE A;  3V5R A;  2R3V A;  3PYD A;  4DUZ I;  4RPF A;  3ZM7 A;  1NZ0 A;  4DV7 E;  3ZZT A;  1N32 I;  2UXD E;  1KIJ A;  1XNQ I;  3T1Y E;  4HYM A;  2V8Q B;  5LMU I;  2CGE A;  2DIX A;  4WFT A;  3LTO A;  4LF5 E;  4K0K I;  4JI1 E;  4JI3 I;  3ZKD A;  1BKN A;  4P78 A;  4LF7 E;  1WHQ A;  1FWL A;  4M0V A;  3GON A;  2Z5C B;  4DU8 A;  2F8B A;  2Z5B B;  1USU A;  2B7T A;  4Z7Y A;  3JAM C;  4FWD A;  3H4L A;  2IOQ A;  2UUC E;  4IZJ B;  1S4E A;  1MX0 A;  3B78 A;  4X8W A;  1ELO A;  4JV5 I;  2LJH A;  4M30 A;  4FWG A;  2MDR A;  2O1T A;  4IZK B;  4JI8 I;  4DV6 I;  4GKJ E;  2IOP A;  2V83 A;  4LF6 I;  1IBL I;  5LL6 R;  3J81 C;  3Q6N A;  1N33 I;  2L2N A;  3J7A G;  4EMD A;  3C4B A;  2ZBK B;  2EWL A;  2VQF E;  2DMY A;  3LML A;  1WHN A;  1XNR E;  1YYK A;  3HXL A;  3OTO I;  4LU9 A;  2PNM A;  2BV3 A;  2AJ4 A;  1HNX E;  2F4V I;  1X48 A;  4F54 A;  2V8P A;  4TUI A;  4DV7 I;  1Z0T A;  4M1K A;  1A6F A;  2EZ6 A;  2V2V A;  5AAS A;  2L8T A;  4JG4 A;  2HKE A;  2HK3 A;  4WPY A;  4AQY I;  1IBK E;  4OX9 E;  1GZ6 A;  4WUB A;  3JU0 A;  1ZM3 A;  3PYE A;  1PKP A;  4J8Z A;  3K17 A;  1Y4U A;  3M6A A;  2K4V A;  4LF5 I;  3ZOQ B;  1Z0W A;  4DR1 I;  3P06 A;  2RSM A;  2O1U A;  1T4L B;  5FWK A;  1FWK A;  4DV5 I;  1GQE A;  4KQV A;  5L3J A;  3QT8 A;  1XMQ E;  2WW4 A;  3B8H A;  4DV4 E;  1Y4S A;  2DB2 A;  2CZ9 A;  2FGG A;  2UXC I;  4LFB I;  4DUY E;  3Q6M A;  4IZJ A;  4JI0 I;  2V85 A;  2NUF A;  1KKH A;  2N3H A;  2Z5C A;  2FTX B;  2L2K B;  4DR1 E;  1IBM E;  4DV3 I;  4USK A;  1HR0 I;  4X66 E;  1VIS A;  3V2U C;  4NXN I;  4LFA E;  4F9C B;  2LE2 A;  3VK6 A;  2BM0 A;  1I94 I;  2UU9 E;  2DEI A;  3DJW A;  4GEQ B;  3B82 A;  2UXB E;  4DU7 A;  1XMO E;  2B9D A;  4FN5 A;  2RS7 A;  3ZZU A;  4DPY A;  2HHH E;  1XHK A;  4BC7 A;  4HAC A;  4DR2 I;  4LF8 E;  4AQY E;  5IWA I;  3WU6 A;  1H7U A;  4JI7 I;  2MC5 A;  3H09 A;  4L5N C;  2L3J A;  1EA6 A;  4R03 A;  3VYX A;  5T6J A;  1N0V C;  1QZR A;  4HAC B;  2O1W A;  4X66 I;  3OTO E;  3C4T A;  1RRE A;  4X62 I;  3Q1Q A;  4MYT A;  4DR4 E;  1IBM I;  2HKJ A;  1DQ3 A;  4N3O A;  2NUG A;  5IT9 Q;  4DKK A;  4Z7C A;  4URL A;  2V2Q A;  5ADZ A;  4X64 E;  2LJP A;  2UXC E;  1N0U A;  1IBK I;  3JAM Q;  4OX9 I;  1Z0B A;  4P7A A;  4IZJ D;  4JI2 E;  2E5L I;  3CWV A;  4NXM I;  2UXD I;  2GQ0 A;  4DR6 E;  1N34 I;  2A2C A;  4DUZ E;  2UUB I;  4JYA E;  2V88 A;  2KOU A;  1HNW I;  5IT9 C;  4BC9 A;  4FW9 A;  1ZM2 A;  1Z0V A;  4YHH I;  4LF4 I;  3DF6 A;  1X47 A;  1K47 A;  2L92 A;  4B3R I;  2M4I A;  3HTX A;  2RTX A;  4B3M I;  5AE3 A;  1Z0G A;  5GME A;  3K85 A;  3IWD A;  5AE1 A;  3HPZ A;  1FNM A;  4JI4 I;  4YY3 I;  2V86 A;  2UUC I;  4F9A B;  4PU9 A;  3ADG A;  1N34 E;  4DPT A;  4DR6 I;  3ADJ A;  3ADI A;  5DNY A;  1DI2 A;  3D4J A;  2E5L E;  4I8O A;  4JI4 E;  1RR9 A;  1PVG A;  2VQF I;  1YZ9 A;  2UU9 I;  2ZIT A;  1IBL E;  2YZT A;  3ADL A;  4LF4 E;  1I94 E;  1H72 C;  4DR4 I;  1FJG I;  4B3T E;  2Q2E B;  1HNW E;  1FKA E;  4PRV A;  3HUL A;  3P1X A;  4Q28 A;  1Z5C A;  5A2Q Q;  4DV1 E;  4JI7 E;  2R42 A;  4JI5 E;  2VE7 C;  2BM1 A;  1Y6Z A;  2LTR A;  2ZM6 I;  3QT5 A;  4L8N A;  4LFB E;  1D6T A;  1U2R A;  3KWR A;  4DV4 I;  1FI4 A;  2VF1 A;  4B3S E;  4WSP A;  2GS8 A;  4HXZ A;  4DV2 I;  3MSW A;  2H36 X;  4DV5 E;  2L2M A;  1STU A;  2EFG A;  2LMZ A;  4DPW A;  3IWC A;  2Z5E A;  4HY1 A;  2MC6 A;  3QT7 A;  3WU4 A;  4X62 E;  4X65 I;  1H7S A;  2OI2 A;  4DV0 I;  1Z59 A;  3HPS A;  1FJG E;  4UT4 A;  1N32 E;  4JI0 E;  1RQ0 A;  2HK2 A;  2HHH I;  2O1V A;  3ZZ0 A;  3AV0 A;  1B63 A;  2N3G A;  4JI6 I;  4LTY A;  4LFC I;  1ZBT A;  4P52 A;  3HJC A;  4PRX A;  1T4O A;  1UIL A;  4I3H A;  1MG7 A;  2B7V A;  3J81 Q;  2RS6 A;  2DEJ A;  1J5E I;  5GMD A;  4YY3 E;  2LUQ A;  4WYQ B;  1QU6 A;  2F4V E;  1HNX I;  4GKK I;  4DV0 E;  1Z5B A;  2PNL A;  3LLH A;  2Z5B A;  1RC7 A;  4DUY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...