2UUBE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uubE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uubE02
1Z0GA 2LBSB 1Z5BA 4B3SE 4GKJI 1FI4A 1ZM4A 3LPSA 1HR0I 1Z0WA 1Z0TA 4OOGC 4JI0I 4FN5A 2R3VA 4USKA 2L3JA 4DV1E 1T4NA 1XMQI 1H73A 3T1HE 1DI2A 1J5EE 2UXCI 3PYDA 4B3TI 3T1YE 5FLXQ 4B3RI 2A2DA 1GQEA 2A2CA 4GKKE 2E5LI 5A2QQ 4WUCA 2R42A 4X64E 1UILA 2UUCI 1MU5A 4DR3E 3WU4A 4DPUA 4JV5I 3M6AA 2MDRA 4YHHE 4LF9I 4JI2E 1IBLI 2XEXA 2N3GA 5IWAE 1B62A 3WU5A 1YYKA 4PRXA 4EMDA 4DV5E 5FLXC 3ADJA 1Z0EA 4KHPE 4DR5I 1FNMA 3GONA 4JI5I 1D6TA 3ZM7A 3VYXA 4OX9I 1EI1A 3ADGA 1IBKI 2L2MA 2E1RA 5IT9C 1N0UA 2HFSA 4DV3I 2NUGA 4X65E 2RSMA 4NXMI 4DPTA 4DU7A 4NXNE 4LF8I 1K47A 2IHR1 4B3ME 4XTJA 2DIXA 4LF6I 1HNWI 1HNXE 1Z0BA 2UUAI 2UU9I 4HY1A 3B8HA 1U2RA 2LJHA 4GKJE 2VQEI 1ZM9A 5LL6R 1T4OA 1HNZI 4DV4I 3B78A 4DR7I 4JI0E 3ZZUA 4JI7I 2HK2A 1ZXMA 1XMQE 4FWDA 5L3JA 1N36E 2UXCE 4DPYA 1I94I 4B3TE 2ZITA 4WUDA 2RS7A 5LMNE 1QZRA 2LJPA 4B3RE 4DPXA 3QT5A 2CPNA 2CZ9A 1NZ0A 2E5LE 2UXBI 1KIJA 2LUPB 4PU9A 3J7Yp 2L2NA 3C4TA 2UUCE 4DUZI 4DV7E 1XNRI 2LRSA 4DUYE 1N34E 1NHJA 1RC7A 2BM0A 4LF9E 1IBLE 3B82A 1FJGI 3P1XA 2BM1A 4LF5I 4LF4I 3OTOI 1N32I 3ZZ0A 3ADIA 4JI1I 1H72C 2ZM6I 4DR4I 4JI4I 5CFFE 1WUUA 2B7TA 4JI5E 3Q1QA 1ZM3A 1N33E 1Z0VA 2AJ4A 1X49A 4YY3E 5IT9Q 4JI3I 1IBKE 2DMYA 1EKZA 1ZBTA 5BR8I 1PVGA 4M2ZA 3WU6A 2UUBI 4LFCI 1UEKA 1YYOA 4MYTA 2V2VA 4UTGA 4JG4A 4DV3E 2OI2A 1IBME 4LFAI 4URLA 2VQFE 3QT6A 4X8WA 3C4BA 1RR9A 1PIEA 2WW4A 4DV2I 2UUAE 4DU8A 3T1HI 1VISA 4ED4A 1J5EI 3J80Q 3PYGA 1NHIA 1Z59A 4DR2E 1J26A 1Z0CA 1KTVA 2GS8A 4JI6I 1WHQA 4LFBI 2VF3A 4USMA 3J7AM 4DR7E 4JI7E 5GMDA 4M30A 2RTXA 4DPWA 2L2KB 3PYFA 2HHHI 2V2QA 3WU3A 4DR3I 4JYAI 3JAMQ 1T4LB 1MG7A 4AQYI 3H4LA 2HK3A 1UHZA 1MX0A 4K0KI 4DV6I 3J80C 3F0NA 2UXBE 4HACB 2DB2A 1HR0E 4WFTA 2YT4A 1FWKA 4M1KA 4DR6I 4DUZE 1B63A 1KVKA 4MYUA 1A6FA 1XMOI 2J7KA 4R1FA 1H7UA 5LMUI 2UXDI 1FJGE 4WUBA 4LF5E 1DARA 4LF4E 1YYWA 3JAMC 4JI1E 1FWLA 4DXLA 4X62I 4DR4E 1H74A 4JI4E 2V8PA 2NUFA 4HACA 1BKNA 4PRVA 4JI3E 2V2ZA 3D4JA 4DR1I 1HNXI 4JV5E 4LF7I 2LTRA 2UUBE 4LFCE 2NA2A 2LUQA 2DEJA 2F4VI 3K17A 1KKHA 3QT7A 4LFAE 1XHKA 3ZKDA 4DR5E 4RPFA 3J81Q 4I3HA 4DV2E 4OX9E 4DV0I 1Z5CA 2V34A 1N36I 3VYYA 3LLHA 2B7VA 5GMEA 4JI8I 3LNUA 4X66I 1ZM2A 1XNQI 2ZBKB 5LMNI 3V5RA 1PKPA 4JI6E 2L33A 4LFBE 2EFGA 1WHNA 4B3SI 4P52A 4NXME 4KQVA 4LF8E 2X36A 2LTSA 2EZ6A 1QU6A 2HHHE 4LF6E 4JYAE 1HNWE 2HKJA 4DV7I 4Z7YA 4DV1I 4DUYI 4WYQB 1FKAE 1N34I 4ZVIA 1Z5AA 1S4EA 1H7SA 4AQYE 3J81C 2UU9E 4FW9A 2HFUA 4K0KE 3T1YI 4DV6E 3QT8A 3V2UC 2VQEE 1ZXNA 1X47A 1HNZE 4DV4E 1RQ0A 3HTXA 4DR6E 4GKKI 3ADLA 2X7IA 2JVAA 3ZKBA 3ZZTA 4Z7CA 1XMOE 4X64I 4FWHA 1N33I 1X48A 2L3CA 4YY3I 2Q2EB 4FWGA 5A2QC 3CWVA 2BV3A 5LMUE 2JY9A 2RS6A 2UXDE 1I94E 3K1JA 2N3HA 4YHHI 4JI2I 2NUEA 2DEIA 4X62E 1S16A 5IWAI 1IBMI 3PYEA 4DV5I 2VQFI 1EA6A 4KHPI 1XNRE 2B3TB 4DR1E 4LF7E 2HKEA 2KHXA 3HULA 4P7AA 3LTOA 2F4VE 1NHHA 3OTOE 1N32E 4DR2I 2ZM6E 4X65I 1YZ9A 1N0VC 1RREA 1O0WA 4HYMA 4NXNI 4DKKA 2NPFA 4DV0E 4B3MI 4HXZA 5BR8E 4UT4A 1ELOA 1STUA 4JI8E 4X66E 1XNQE 3J7AG 1OJ4A
chains in the Genus database with same CATH superfamily
1Z0GA 2LBSB 1PJSA 1OYRA 1Z5BA 5JEAE 4B3SE 1WJPA 2K7IA 2WNRA 3JU0A 2EN7A 4Q28A 4GKJI 4FW5A 2ELYA 1FI4A 4R2AA 1T38A 1ZM4A 3LPSA 2Z5CA 1HR0I 1Z0WA 1Z0TA 4OOGC 5C0XA 4M9VC 4OO1D 4JI0I 4BA2B 1WXRA 2R3VA 4FN5A 4USKA 2L3JA 4DV1E 5JEAC 1T4NA 4P7DA 1XMQI 1H73A 4R8OA 3T1HE 1DI2A 1J5EE 1YUIA 2EE8A 1A1GA 2JEBB 2UXCI 3PYDA 4F9CB 4B3TI 5AASA 2F8BA 3T1YE 3UHMA 5FLXQ 1TF3A 1A1KA 2YTIA 4FW3A 4F6MA 4B3RI 2EOQA 4WXCA 2A2DA 4ZYDA 2EMWA 1A1HA 1GQEA 3IWBA 2A2CA 4GKKE 2E5LI 3F6GA 5A2QQ 3VHTB 4WUCA 2R42A 3U1YA 4X64E 1ZAAC 1UILA 2BA0D 2UUCI 1MU5A 5DROA 4DR3E 3WU4A 2EMXA 1Y6ZA 4DPUA 4JV5I 3M6AA 2EPKX 2YTJA 4BCAA 2YTDA 2EN1A 4WPYA 2MDRA 4YHHE 4LF9I 4JI2E 1L4SA 1IBLI 2XEXA 2N3GA 3EPKA 2H36X 3P76A 4IZKA 5IWAE 3M99B 4BMJA 1B62A 2PNMA 3M7ND 4R2PA 1USUA 3WU5A 2V83A 5KL6A 5DRPA 3IWDA 1YYKA 3HPSA 1OYSA 3AUZA 4PRXA 4EMDA 3TQMA 3BGHA 5FLXC 2WBUA 4DV5E 2AE8A 3ADJA 3CDJA 1Z0EA 1UDNA 2BA1G 4KHPE 4DR5I 1FNMA 3GONA 2O1VA 3P3CA 4JI5I 1D6TA 3ZM7A 2EOEA 2YSOA 3VYXA 2GHFA 2EMHA 4OX9I 1EI1A 3ADGA 1IBKI 3P3GA 2L2MA 2CSHA 1GTKA 5K36F 2GO4A 2E1RA 4AIMA 5IT9C 3H1CA 1N0UA 4OO1C 4LOMA 2L8TA 2YRKA 2HFSA 2O1WA 2YTQA 4DV3I 2YTOA 3K85A 3PRYA 2NUGA 2IESA 4X65E 4IS1C 2VRDA 2V8QB 4FW4A 2RSMA 1EH8A 4NXMI 4DPTA 4DU7A 1SFEA 4NXNE 4LF8I 1K47A 4NBQA 2IHR1 3Q6MA 2FGGA 4J8ZA 2WCC3 4B3ME 4XTJA 3RMPA 2DIXA 4LF6I 1HNWI 2J65A 5K36D 1GZ6A 1TN9A 1HNXE 4LCGA 1Z0BA 2UUAI 4BHBA 2CGEA 2EOOA 2UU9I 4HY1A 1BB8A 3B8HA 2CVEA 5C0XF 1U2RA 2Z5BB 2LJHA 1EH6A 4QNJA 2ELZA 2Z5EA 4GKJE 2VQEI 5KL5A 1ZM9A 4GEQB 5LL6R 5DNLA 1T4OA 4N4RB 1HNZI 4DV4I 2RQLA 1UDQA 3KZZA 3B78A 2C39B 2E1MA 2JE6B 4DR7I 2EPZA 4JI0E 1VI7A 4GQUA 4O43A 3ZZUA 4JI7I 2I13A 4LTYA 3EPJA 2WBSA 2HK2A 1ZXMA 1XMQE 4FWDA 1KYQA 2EN4A 3FIGA 2YTEA 5AE2A 2EL6A 2JXPA 4R2DA 5L3JA 1N3GA 1N36E 4OKGA 2UXCE 5A6JA 2EWLA 4DPYA 1I94I 1Z1BA 4B3TE 1TF6A 2ZITA 4WUDA 2O3ZA 2E72A 2HC5A 4R03A 1X5WA 2KOUA 2RS7A 3THNA 5LMNE 1QZRA 3JTZA 2LJPA 5K36E 4B3RE 4DPXA 3QT5A 2JEAA 2CPNA 2D9HA 2Z5BA 2EOZA 2V86A 2YSPA 1NZ0A 2CG9A 2CZ9A 3HJCA 2R76A 2E5LE 5JEAA 2EMYA 2UXBI 1KIJA 4X9JA 2LUPB 1YSAC 4PU9A 3J7Yp 2L2NA 3C4TA 2UUCE 2C39A 1NCSA 4MU3A 5AE1A 2MDGA 2YU5A 4DUZI 4WX9A 4HTGA 4DV7E 1XNRI 1DGCA 2LRSA 4MU1A 4DUYE 1N34E 1G2DC 1NHJA 3PS3A 1RC7A 2BM0A 4LF9E 4O5GA 2ODRD 1IBLE 3P3EA 2EOIA 2LV2A 3B82A 1FJGI 3P1XA 4J3DA 2RPCA 4BBYA 2BM1A 4MU0A 4LF4I 4LF5I 4OO1B 3OTOI 3ZOQB 2V89A 3DF6A 1N32I 2DRPA 3M85D 5LLQA 3H09A 3ZZ0A 3ADIA 3PS2A 1H72C 4JI1I 2ZM6I 3DJWA 3EPLA 4DR4I 2DLQA 2HJJA 4KZSA 4JI4I 1ZU1A 2ENCA 5CFFE 1WUUA 2EN2A 2B7TA 1X6HA 4JI5E 3Q1QA 1ZM3A 2PNLA 4QNKA 1N33E 1Z0VA 2AJ4A 1X49A 2EM7A 4YY3E 1UDOA 4JI3I 5IT9Q 1IBKE 4BA2A 3VK6A 2DMYA 1EKZA 1ZBTA 2EQ0A 5BR8I 4IJDA 3C6MA 4IZJD 1PVGA 5DNXA 2EM3A 4M2ZA 2LE2A 3WU6A 2UUBI 4LFCI 1UEKA 4OO1E 1LLMC 2R1FA 1YYOA 4MYTA 1UDSA 2EL4A 2V2VA 2JEBA 4UTGA 4JG4A 4DV3E 1JK1A 2GQ0A 2OI2A 1ZR9A 4IFDF 4OO1A 1IBME 3OMLA 2LO3A 2DSYA 5EKWA 2HGHA 4LFAI 4URLA 1MGTA 2V88A 4WSPA 2VQFE 2YTGA 4X8WA 4ZYHA 1Y60A 3QT6A 3C4BA 1RR9A 2BB8A 2B9DA 1PIEA 2WW4A 1YHCA 4DV2I 2JOXA 2UUAE 4DU8A 3T1HI 1G2FC 2NABA 1VISA 4ED4A 1J5EI 1IMUA 2JPAA 4IFDD 3J80Q 5AC5A 5A69A 1A1FA 2NN6F 5ADZA 1NHIA 2LJUA 2EPAA 3PYGA 5A6BD 1WRJA 1PJQA 2EL5A 3L00A 1Z59A 4DR2E 1J26A 2WP8B 3Q6NA 1Z0CA 1PJTA 1KTVA 1YFHA 3KZYA 2GS8A 2EOMA 4IS9A 4JI6I 1WHQA 4LFBI 2EM5A 2VF3A 4USMA 3J7AM 4DR7E 4RHBB 4AIDA 4JI7E 4F9BB 5GMDA 4M30A 2RTXA 1T39A 4ISAA 2KONA 4DPWA 2L2KB 1XXEA 2EPUA 2O1UA 2DGCA 3PYFA 2HHHI 2V2QA 3WU3A 4DR3I 2NN6D 4JYAI 1UN6B 3JAMQ 2EMKA 1T4LB 4L5NC 3L7ZB 1MG7A 4AQYI 2PO2B 3H4LA 2HK3A 2EMBA 4FW6A 1UHZA 1MX0A 1P47A 4K0KI 2PO1A 2FV4B 2L92A 4DV6I 5K36B 2BA1D 3J80C 1AH5A 2EN6A 3F0NA 2UXBE 1X3CA 4R2EA 2EQ3A 4HACB 3EPHA 2DB2A 2EOSA 1HR0E 4WFTA 2YT4A 1FWKA 4M1KA 2EMFA 4ZYEA 4DR6I 4DUZE 1B63A 1KVKA 4MDTA 4R2CA 2EMIA 3PS1A 3ECRA 4MYUA 1A6FA 1XMOI 2J7KA 4TUIA 2EMLA 3U1KA 4R1FA 4M0VA 5KL2A 4I8OA 1H7UA 4BA1B 5KL4A 5T6JA 5C0XD 5LMUI 2IERA 2UXDI 2MKNA 1FJGE 1Y4UA 4WUBA 4LF5E 1DARA 4LF4E 2Q8UA 2F1DA 4O24A 4GZNC 2LMZA 1B69A 3L7ZA 1YPNA 1F2IG 3JAMC 1YYWA 4ZYGA 4JI1E 2PO2A 1FWLA 2FTXB 3NZKA 4DXLA 2GPIA 2IOPA 2VESA 4X62I 4DR4E 1Y5YA 1H74A 5C0XB 4JI4E 5K36A 2V8PA 3MHHC 2NUFA 2N8XA 3LMLA 1BBOA 1AAYA 4LU9A 4U3DA 2EM9A 3GCMA 4HACA 1BKNA 4PRVA 4JI3E 1IQOA 2JE6A 2V2ZA 4P78A 5K36C 4MU4A 3D4JA 4DR1I 1HNXI 4JV5E 4LF7I 1EH7A 2EMCA 2LTRA 2UUBE 5AE3A 4LFCE 2BA0G 5DRQA 1SR9A 2M1SA 2MC5A 2DLKA 4BC7A 4BA1A 2CTDA 2WZOA 2NA2A 2LUQA 2DEJA 4F9AB 1BBGA 3B4TA 3K17A 5ELWA 2F4VI 2VF1A 1RHYA 2EORA 1KKHA 2A25A 5C0XE 4F2JC 1QNTA 2ENAA 3QT7A 2CT1A 4LFAE 1XHKA 2YWQA 3ZKDA 4R2QA 2VE7C 1Y4SA 3M7NG 4DR5E 2BR2B 2EOFA 5A6KA 2RSIA 4RPFA 4I3HA 3J81Q 4DV2E 2DMIA 4R2RA 4OX9E 1HK7A 2O1TA 4DV0I 5C0XC 2JYAA 1A1JA 1Z5CA 2V34A 1DQ3A 1N36I 2YU8A 1X6FA 3VYYA 3LLHA 2EN8A 4F6NA 3KRNA 2B7VA 4IZKB 3UK3C 2EPXA 5GMEA 4JI8I 3LNUA 4X66I 1ZM2A 1XNQI 2ZBKB 5LMNI 4DMIA 2YTNA 3V5RA 3GLLA 1PKPA 2BBGA 5FWKA 3HXLA 4JI6E 1P42A 2L33A 2YTPA 5AC4A 1WHNA 4LFBE 2EMAA 2EFGA 4B3SI 4FW7A 4P52A 4R2SA 4IZJB 4NXME 3BF2A 3F6HA 2M7QA 3BIDA 5A6AA 4KQVA 4LF8E 4BC9A 1E3HA 4AM3A 1OYPA 2J7JA 2LTSA 2YTFA 2X36A 3AV0A 2EOYA 2EZ6A 1QU6A 2HHHE 4LF6E 4JYAE 1HNWE 2HKJA 4DV7I 4Z7YA 2BR2A 4DV1I 2PO1B 4DUYI 4WYQB 1FKAE 1E3PA 1N34I 4ZVIA 2EJ4A 1Z5AA 1S4EA 2ODRC 4FK5C 1RMDA 2LT7A 1H7SA 3P06A 4AQYE 4LCFA 2EPOA 2M4IA 3J81C 2UU9E 4FW9A 4BHCA 2EPPA 2HFUA 4K0KE 4F54A 2JWOA 2IOQA 4LPFA 4OZEA 2JOBA 3T1YI 4DV6E 5KL7A 3QT8A 3V2UC 2EM6A 2VQEE 2EN3A 1ZXNA 2MC6A 3HPZA 1X47A 2GLIA 2WBTA 1HNZE 4DV4E 2GO3A 1RQ0A 2EPMX 2JT2A 3HTXA 4HEIA 4DR6E 4IFDB 2EOHA 1JK2A 2C38B 5EL9A 4IZJA 4GKKI 3ADLA 2YPNA 5KL3A 4TUGA 2JVAA 2X7IA 3HKMA 4MQYA 3GMEA 3ZKBA 3ZZTA 4Z7CA 1XMOE 4X64I 4FWHA 4O4KA 1X48A 2EOJA 4MLVA 1N33I 2L3CA 2C37B 4YY3I 2Q2EB 4FWGA 5A2QC 3CWVA 2BV3A 2ENHA 5LMUE 4N3OA 2JY9A 2LVHA 1ZBQA 2RS6A 2UXDE 4NHRA 2M9AA 2EPNA 1I94E 4WSGA 3K1JA 4Q35B 2N3HA 5JEAF 3EQ1A 1UBDC 4YHHI 1A1LA 4JI2I 2EPCA 2NUEA 4BS9A 2DEIA 2ADRA 2G7HA 4X62E 1S16A 5IWAI 1IBMI 1IQSA 1YH8A 2JP9A 2NN6B 2MKDA 5TSEA 2WP8A 2LCEA 3BBGA 1R6LA 4IFDE 2K4VA 3PYEA 2PO0B 1MEYC 1NEIA 2PNZB 3IWCA 4WXDA 5DRRA 4DV5I 2EM4A 2VQFI 1KJKA 4MLQA 4IFDA 2C38A 1R6MA 1EA6A 2EQ1A 4KWYA 4KHPI 1PDAA 4RH8A 1XNRE 2B3TB 2EPRA 4DR1E 5JEAD 2I9IA 5A6BA 3MHSC 4LF7E 3KWRA 2YRMA 2HKEA 2KHXA 2C37A 3HULA 2EMZA 1A1IA 2EPLX 2JR1A 2EP3A 2EOXA 4IFDC 2EM8A 4P7AA 3LTOA 3QG5C 5DNYA 2F4VE 1NHHA 2WNRB 2JEAB 3OTOE 5F3WA 1N32E 5IXMB 2EM0A 4DR2I 5JEAB 2NN6E 2YZTA 2ZM6E 3C6KA 3K6QA 2Z5CB 4L8NA 2V85A 4X65I 4NZVA 4LCHA 2L6MA 1YZ9A 1N0VC 2NN6A 3M85G 2EM2A 5IV8B 1RREA 1O0WA 4HYMA 2PO0A 4NXNI 2PNZA 2PRTA 3MSWA 4DKKA 2YRHA 1YUJA 2NPFA 4DV0E 4B3MI 2NN6C 4HXZA 5BR8E 4UT4A 1ELOA 4OO1F 3DD6A 3HQ1A 2EMGA 3THOB 1STUA 4JI8E 4X66E 2V87A 1XNQE 3J7AG 1USVA 1X6EA 1OJ4A 4U3BA 3CDIA
chains in the Genus database with same CATH topology
1Z0GA 2LBSB 1Z5BA 4B3SE 3JU0A 4Q28A 4GKJI 1FI4A 1ZM4A 3LPSA 2Z5CA 1HR0I 1Z0WA 1Z0TA 4OOGC 4JI0I 1WXRA 2R3VA 4FN5A 4USKA 2L3JA 4DV1E 1T4NA 4P7DA 1XMQI 1H73A 4R8OA 3T1HE 1DI2A 1J5EE 2UXCI 3PYDA 4F9CB 4B3TI 5AASA 2F8BA 3T1YE 5FLXQ 4B3RI 2A2DA 1GQEA 3IWBA 2A2CA 4GKKE 2E5LI 3F6GA 5A2QQ 4WUCA 2R42A 4X64E 1UILA 2UUCI 1MU5A 4DR3E 3WU4A 1Y6ZA 4DPUA 4JV5I 3M6AA 4BCAA 4WPYA 2MDRA 4YHHE 4LF9I 4JI2E 1IBLI 2XEXA 2N3GA 2H36X 4IZKA 5IWAE 4BMJA 1B62A 2PNMA 1USUA 3WU5A 2V83A 3IWDA 1YYKA 3HPSA 3AUZA 4PRXA 4EMDA 5FLXC 4DV5E 3ADJA 1Z0EA 4KHPE 4DR5I 1FNMA 3GONA 2O1VA 4JI5I 1D6TA 3ZM7A 3VYXA 4OX9I 1EI1A 3ADGA 1IBKI 2L2MA 2E1RA 5IT9C 1N0UA 2L8TA 2HFSA 2O1WA 4DV3I 3K85A 3PRYA 2NUGA 4X65E 2V8QB 2RSMA 4NXMI 4DPTA 4DU7A 4NXNE 4LF8I 1K47A 2IHR1 3Q6MA 2FGGA 4J8ZA 4B3ME 4XTJA 3RMPA 2DIXA 4LF6I 1HNWI 1GZ6A 1HNXE 1Z0BA 2UUAI 2CGEA 2UU9I 4HY1A 3B8HA 1U2RA 2Z5BB 2LJHA 2Z5EA 4GKJE 2VQEI 1ZM9A 4GEQB 5LL6R 1T4OA 1HNZI 4DV4I 3B78A 4DR7I 2E1MA 4JI0E 3ZZUA 4JI7I 4LTYA 2HK2A 1ZXMA 1XMQE 4FWDA 3FIGA 5AE2A 5L3JA 1N36E 2UXCE 2EWLA 4DPYA 1I94I 4B3TE 2ZITA 4WUDA 4R03A 2RS7A 2KOUA 5LMNE 1QZRA 2LJPA 3JTZA 4B3RE 4DPXA 3QT5A 2CPNA 2Z5BA 2V86A 2CZ9A 1NZ0A 2CG9A 3HJCA 2E5LE 2UXBI 1KIJA 2LUPB 4PU9A 3J7Yp 2L2NA 3C4TA 2UUCE 5AE1A 4DUZI 4DV7E 1XNRI 2LRSA 4DUYE 1N34E 1NHJA 1RC7A 2BM0A 4LF9E 2ODRD 1IBLE 3B82A 1FJGI 3P1XA 2BM1A 4BBYA 4LF5I 4LF4I 3OTOI 3ZOQB 2V89A 3DF6A 1N32I 3H09A 3ZZ0A 3ADIA 4JI1I 1H72C 2ZM6I 3DJWA 4DR4I 4KZSA 4JI4I 5CFFE 1WUUA 2B7TA 4JI5E 3Q1QA 1ZM3A 2PNLA 1N33E 1Z0VA 2AJ4A 1X49A 4YY3E 5IT9Q 4JI3I 1IBKE 3VK6A 2DMYA 1EKZA 1ZBTA 5BR8I 4IZJD 1PVGA 4M2ZA 2LE2A 3WU6A 2UUBI 4LFCI 1UEKA 1YYOA 4MYTA 2V2VA 4UTGA 4JG4A 4DV3E 2GQ0A 2OI2A 1IBME 3OMLA 2DSYA 4LFAI 4URLA 2V88A 4WSPA 2VQFE 4X8WA 3QT6A 3C4BA 1RR9A 2B9DA 1PIEA 2WW4A 4DV2I 2JOXA 2UUAE 4DU8A 3T1HI 1VISA 4ED4A 1J5EI 3J80Q 5ADZA 1NHIA 3PYGA 1Z59A 4DR2E 1J26A 3Q6NA 1Z0CA 1KTVA 2GS8A 4JI6I 1WHQA 4LFBI 2VF3A 4USMA 3J7AM 4DR7E 4JI7E 4F9BB 5GMDA 4M30A 2RTXA 2KONA 4DPWA 2L2KB 2O1UA 3PYFA 2HHHI 2V2QA 3WU3A 4DR3I 4JYAI 3JAMQ 1T4LB 4L5NC 1MG7A 4AQYI 3H4LA 2HK3A 1UHZA 1MX0A 4K0KI 2FV4B 2L92A 4DV6I 3J80C 3F0NA 2UXBE 4HACB 2DB2A 1HR0E 4WFTA 2YT4A 1FWKA 4M1KA 4DR6I 4DUZE 1B63A 1KVKA 4MYUA 1A6FA 1XMOI 2J7KA 4TUIA 4R1FA 4M0VA 4I8OA 1H7UA 5LMUI 5T6JA 2UXDI 1FJGE 1Y4UA 4WUBA 4LF5E 1DARA 4LF4E 2LMZA 3JAMC 1YYWA 4JI1E 1FWLA 2FTXB 4DXLA 2IOPA 4X62I 4DR4E 1H74A 4JI4E 2V8PA 2NUFA 3LMLA 4LU9A 4HACA 1BKNA 4PRVA 4JI3E 2V2ZA 4P78A 3D4JA 4DR1I 1HNXI 4JV5E 4LF7I 2LTRA 2UUBE 4LFCE 5AE3A 1SR9A 2M1SA 2MC5A 4BC7A 2WZOA 2NA2A 2LUQA 2DEJA 4F9AB 2F4VI 3K17A 2VF1A 1KKHA 3QT7A 4LFAE 1XHKA 3ZKDA 2VE7C 1Y4SA 4DR5E 4RPFA 3J81Q 4I3HA 4DV2E 4OX9E 1HK7A 2O1TA 4DV0I 1Z5CA 2V34A 1DQ3A 1N36I 3VYYA 3LLHA 4IZKB 2B7VA 5GMEA 4JI8I 3LNUA 4X66I 1ZM2A 1XNQI 2ZBKB 5LMNI 4DMIA 3V5RA 1PKPA 5FWKA 3HXLA 4JI6E 2L33A 4LFBE 2EFGA 1WHNA 4B3SI 4P52A 4IZJB 4NXME 3F6HA 2M7QA 4KQVA 4LF8E 4BC9A 2X36A 2LTSA 3AV0A 2EZ6A 1QU6A 2HHHE 4LF6E 4JYAE 1HNWE 2HKJA 4DV7I 4Z7YA 4DV1I 4DUYI 4WYQB 1FKAE 1N34I 4ZVIA 1Z5AA 1S4EA 2ODRC 1H7SA 3P06A 4AQYE 2M4IA 3J81C 2UU9E 4FW9A 2HFUA 4K0KE 4F54A 2JWOA 2IOQA 2JOBA 3T1YI 4DV6E 3QT8A 3V2UC 2VQEE 1ZXNA 2MC6A 3HPZA 1X47A 1HNZE 4DV4E 1RQ0A 3HTXA 4DR6E 4IZJA 4GKKI 3ADLA 4TUGA 2X7IA 2JVAA 3ZKBA 3ZZTA 4Z7CA 1XMOE 4X64I 4FWHA 1N33I 1X48A 2L3CA 4YY3I 2Q2EB 4FWGA 5A2QC 3CWVA 2BV3A 5LMUE 4N3OA 2JY9A 1ZBQA 2RS6A 2UXDE 1I94E 3K1JA 2N3HA 4YHHI 4JI2I 2NUEA 4BS9A 2DEIA 2G7HA 4X62E 1S16A 5IWAI 1IBMI 2K4VA 3PYEA 3IWCA 4DV5I 2VQFI 1EA6A 4KHPI 1XNRE 2B3TB 4DR1E 4LF7E 3KWRA 2HKEA 2KHXA 3HULA 2JR1A 4P7AA 3LTOA 5DNYA 2F4VE 1NHHA 3OTOE 5F3WA 1N32E 4DR2I 2YZTA 2ZM6E 3K6QA 2Z5CB 4L8NA 2V85A 4X65I 2L6MA 1YZ9A 1N0VC 1RREA 1O0WA 4HYMA 4NXNI 3MSWA 4DKKA 2NPFA 4DV0E 4B3MI 4HXZA 5BR8E 4UT4A 1ELOA 3HQ1A 1STUA 4JI8E 4X66E 2V87A 1XNQE 3J7AG 1USVA 1OJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0G A;  2LBS B;  1Z5B A;  4B3S E;  4GKJ I;  1FI4 A;  1ZM4 A;  3LPS A;  1HR0 I;  1Z0W A;  1Z0T A;  4OOG C;  4JI0 I;  4FN5 A;  2R3V A;  4USK A;  2L3J A;  4DV1 E;  1T4N A;  1XMQ I;  1H73 A;  3T1H E;  1DI2 A;  1J5E E;  2UXC I;  3PYD A;  4B3T I;  3T1Y E;  5FLX Q;  4B3R I;  2A2D A;  1GQE A;  2A2C A;  4GKK E;  2E5L I;  5A2Q Q;  4WUC A;  2R42 A;  4X64 E;  1UIL A;  2UUC I;  1MU5 A;  4DR3 E;  3WU4 A;  4DPU A;  4JV5 I;  3M6A A;  2MDR A;  4YHH E;  4LF9 I;  4JI2 E;  1IBL I;  2XEX A;  2N3G A;  5IWA E;  1B62 A;  3WU5 A;  1YYK A;  4PRX A;  4EMD A;  4DV5 E;  5FLX C;  3ADJ A;  1Z0E A;  4KHP E;  4DR5 I;  1FNM A;  3GON A;  4JI5 I;  1D6T A;  3ZM7 A;  3VYX A;  4OX9 I;  1EI1 A;  3ADG A;  1IBK I;  2L2M A;  2E1R A;  5IT9 C;  1N0U A;  2HFS A;  4DV3 I;  2NUG A;  4X65 E;  2RSM A;  4NXM I;  4DPT A;  4DU7 A;  4NXN E;  4LF8 I;  1K47 A;  2IHR 1;  4B3M E;  4XTJ A;  2DIX A;  4LF6 I;  1HNW I;  1HNX E;  1Z0B A;  2UUA I;  2UU9 I;  4HY1 A;  3B8H A;  1U2R A;  2LJH A;  4GKJ E;  2VQE I;  1ZM9 A;  5LL6 R;  1T4O A;  1HNZ I;  4DV4 I;  3B78 A;  4DR7 I;  4JI0 E;  3ZZU A;  4JI7 I;  2HK2 A;  1ZXM A;  1XMQ E;  4FWD A;  5L3J A;  1N36 E;  2UXC E;  4DPY A;  1I94 I;  4B3T E;  2ZIT A;  4WUD A;  2RS7 A;  5LMN E;  1QZR A;  2LJP A;  4B3R E;  4DPX A;  3QT5 A;  2CPN A;  2CZ9 A;  1NZ0 A;  2E5L E;  2UXB I;  1KIJ A;  2LUP B;  4PU9 A;  3J7Y p;  2L2N A;  3C4T A;  2UUC E;  4DUZ I;  4DV7 E;  1XNR I;  2LRS A;  4DUY E;  1N34 E;  1NHJ A;  1RC7 A;  2BM0 A;  4LF9 E;  1IBL E;  3B82 A;  1FJG I;  3P1X A;  2BM1 A;  4LF5 I;  4LF4 I;  3OTO I;  1N32 I;  3ZZ0 A;  3ADI A;  4JI1 I;  1H72 C;  2ZM6 I;  4DR4 I;  4JI4 I;  5CFF E;  1WUU A;  2B7T A;  4JI5 E;  3Q1Q A;  1ZM3 A;  1N33 E;  1Z0V A;  2AJ4 A;  1X49 A;  4YY3 E;  5IT9 Q;  4JI3 I;  1IBK E;  2DMY A;  1EKZ A;  1ZBT A;  5BR8 I;  1PVG A;  4M2Z A;  3WU6 A;  2UUB I;  4LFC I;  1UEK A;  1YYO A;  4MYT A;  2V2V A;  4UTG A;  4JG4 A;  4DV3 E;  2OI2 A;  1IBM E;  4LFA I;  4URL A;  2VQF E;  3QT6 A;  4X8W A;  3C4B A;  1RR9 A;  1PIE A;  2WW4 A;  4DV2 I;  2UUA E;  4DU8 A;  3T1H I;  1VIS A;  4ED4 A;  1J5E I;  3J80 Q;  3PYG A;  1NHI A;  1Z59 A;  4DR2 E;  1J26 A;  1Z0C A;  1KTV A;  2GS8 A;  4JI6 I;  1WHQ A;  4LFB I;  2VF3 A;  4USM A;  3J7A M;  4DR7 E;  4JI7 E;  5GMD A;  4M30 A;  2RTX A;  4DPW A;  2L2K B;  3PYF A;  2HHH I;  2V2Q A;  3WU3 A;  4DR3 I;  4JYA I;  3JAM Q;  1T4L B;  1MG7 A;  4AQY I;  3H4L A;  2HK3 A;  1UHZ A;  1MX0 A;  4K0K I;  4DV6 I;  3J80 C;  3F0N A;  2UXB E;  4HAC B;  2DB2 A;  1HR0 E;  4WFT A;  2YT4 A;  1FWK A;  4M1K A;  4DR6 I;  4DUZ E;  1B63 A;  1KVK A;  4MYU A;  1A6F A;  1XMO I;  2J7K A;  4R1F A;  1H7U A;  5LMU I;  2UXD I;  1FJG E;  4WUB A;  4LF5 E;  1DAR A;  4LF4 E;  1YYW A;  3JAM C;  4JI1 E;  1FWL A;  4DXL A;  4X62 I;  4DR4 E;  1H74 A;  4JI4 E;  2V8P A;  2NUF A;  4HAC A;  1BKN A;  4PRV A;  4JI3 E;  2V2Z A;  3D4J A;  4DR1 I;  1HNX I;  4JV5 E;  4LF7 I;  2LTR A;  2UUB E;  4LFC E;  2NA2 A;  2LUQ A;  2DEJ A;  2F4V I;  3K17 A;  1KKH A;  3QT7 A;  4LFA E;  1XHK A;  3ZKD A;  4DR5 E;  4RPF A;  3J81 Q;  4I3H A;  4DV2 E;  4OX9 E;  4DV0 I;  1Z5C A;  2V34 A;  1N36 I;  3VYY A;  3LLH A;  2B7V A;  5GME A;  4JI8 I;  3LNU A;  4X66 I;  1ZM2 A;  1XNQ I;  2ZBK B;  5LMN I;  3V5R A;  1PKP A;  4JI6 E;  2L33 A;  4LFB E;  2EFG A;  1WHN A;  4B3S I;  4P52 A;  4NXM E;  4KQV A;  4LF8 E;  2X36 A;  2LTS A;  2EZ6 A;  1QU6 A;  2HHH E;  4LF6 E;  4JYA E;  1HNW E;  2HKJ A;  4DV7 I;  4Z7Y A;  4DV1 I;  4DUY I;  4WYQ B;  1FKA E;  1N34 I;  4ZVI A;  1Z5A A;  1S4E A;  1H7S A;  4AQY E;  3J81 C;  2UU9 E;  4FW9 A;  2HFU A;  4K0K E;  3T1Y I;  4DV6 E;  3QT8 A;  3V2U C;  2VQE E;  1ZXN A;  1X47 A;  1HNZ E;  4DV4 E;  1RQ0 A;  3HTX A;  4DR6 E;  4GKK I;  3ADL A;  2X7I A;  2JVA A;  3ZKB A;  3ZZT A;  4Z7C A;  1XMO E;  4X64 I;  4FWH A;  1N33 I;  1X48 A;  2L3C A;  4YY3 I;  2Q2E B;  4FWG A;  5A2Q C;  3CWV A;  2BV3 A;  5LMU E;  2JY9 A;  2RS6 A;  2UXD E;  1I94 E;  3K1J A;  2N3H A;  4YHH I;  4JI2 I;  2NUE A;  2DEI A;  4X62 E;  1S16 A;  5IWA I;  1IBM I;  3PYE A;  4DV5 I;  2VQF I;  1EA6 A;  4KHP I;  1XNR E;  2B3T B;  4DR1 E;  4LF7 E;  2HKE A;  2KHX A;  3HUL A;  4P7A A;  3LTO A;  2F4V E;  1NHH A;  3OTO E;  1N32 E;  4DR2 I;  2ZM6 E;  4X65 I;  1YZ9 A;  1N0V C;  1RRE A;  1O0W A;  4HYM A;  4NXN I;  4DKK A;  2NPF A;  4DV0 E;  4B3M I;  4HXZ A;  5BR8 E;  4UT4 A;  1ELO A;  1STU A;  4JI8 E;  4X66 E;  1XNQ E;  3J7A G;  1OJ4 A; 
#chains in the Genus database with same CATH topology
 1Z0G A;  2LBS B;  1PJS A;  1OYR A;  1Z5B A;  5JEA E;  4B3S E;  1WJP A;  2K7I A;  2WNR A;  3JU0 A;  2EN7 A;  4Q28 A;  4GKJ I;  4FW5 A;  2ELY A;  1FI4 A;  4R2A A;  1T38 A;  1ZM4 A;  3LPS A;  2Z5C A;  1HR0 I;  1Z0W A;  1Z0T A;  4OOG C;  5C0X A;  4M9V C;  4OO1 D;  4JI0 I;  4BA2 B;  1WXR A;  2R3V A;  4FN5 A;  4USK A;  2L3J A;  4DV1 E;  5JEA C;  1T4N A;  4P7D A;  1XMQ I;  1H73 A;  4R8O A;  3T1H E;  1DI2 A;  1J5E E;  1YUI A;  2EE8 A;  1A1G A;  2JEB B;  2UXC I;  3PYD A;  4F9C B;  4B3T I;  5AAS A;  2F8B A;  3T1Y E;  3UHM A;  5FLX Q;  1TF3 A;  1A1K A;  2YTI A;  4FW3 A;  4F6M A;  4B3R I;  2EOQ A;  4WXC A;  2A2D A;  4ZYD A;  2EMW A;  1A1H A;  1GQE A;  3IWB A;  2A2C A;  4GKK E;  2E5L I;  3F6G A;  5A2Q Q;  3VHT B;  4WUC A;  2R42 A;  3U1Y A;  4X64 E;  1ZAA C;  1UIL A;  2BA0 D;  2UUC I;  1MU5 A;  5DRO A;  4DR3 E;  3WU4 A;  2EMX A;  1Y6Z A;  4DPU A;  4JV5 I;  3M6A A;  2EPK X;  2YTJ A;  4BCA A;  2YTD A;  2EN1 A;  4WPY A;  2MDR A;  4YHH E;  4LF9 I;  4JI2 E;  1L4S A;  1IBL I;  2XEX A;  2N3G A;  3EPK A;  2H36 X;  3P76 A;  4IZK A;  5IWA E;  3M99 B;  4BMJ A;  1B62 A;  2PNM A;  3M7N D;  4R2P A;  1USU A;  3WU5 A;  2V83 A;  5KL6 A;  5DRP A;  3IWD A;  1YYK A;  3HPS A;  1OYS A;  3AUZ A;  4PRX A;  4EMD A;  3TQM A;  3BGH A;  5FLX C;  2WBU A;  4DV5 E;  2AE8 A;  3ADJ A;  3CDJ A;  1Z0E A;  1UDN A;  2BA1 G;  4KHP E;  4DR5 I;  1FNM A;  3GON A;  2O1V A;  3P3C A;  4JI5 I;  1D6T A;  3ZM7 A;  2EOE A;  2YSO A;  3VYX A;  2GHF A;  2EMH A;  4OX9 I;  1EI1 A;  3ADG A;  1IBK I;  3P3G A;  2L2M A;  2CSH A;  1GTK A;  5K36 F;  2GO4 A;  2E1R A;  4AIM A;  5IT9 C;  3H1C A;  1N0U A;  4OO1 C;  4LOM A;  2L8T A;  2YRK A;  2HFS A;  2O1W A;  2YTQ A;  4DV3 I;  2YTO A;  3K85 A;  3PRY A;  2NUG A;  2IES A;  4X65 E;  4IS1 C;  2VRD A;  2V8Q B;  4FW4 A;  2RSM A;  1EH8 A;  4NXM I;  4DPT A;  4DU7 A;  1SFE A;  4NXN E;  4LF8 I;  1K47 A;  4NBQ A;  2IHR 1;  3Q6M A;  2FGG A;  4J8Z A;  2WCC 3;  4B3M E;  4XTJ A;  3RMP A;  2DIX A;  4LF6 I;  1HNW I;  2J65 A;  5K36 D;  1GZ6 A;  1TN9 A;  1HNX E;  4LCG A;  1Z0B A;  2UUA I;  4BHB A;  2CGE A;  2EOO A;  2UU9 I;  4HY1 A;  1BB8 A;  3B8H A;  2CVE A;  5C0X F;  1U2R A;  2Z5B B;  2LJH A;  1EH6 A;  4QNJ A;  2ELZ A;  2Z5E A;  4GKJ E;  2VQE I;  5KL5 A;  1ZM9 A;  4GEQ B;  5LL6 R;  5DNL A;  1T4O A;  4N4R B;  1HNZ I;  4DV4 I;  2RQL A;  1UDQ A;  3KZZ A;  3B78 A;  2C39 B;  2E1M A;  2JE6 B;  4DR7 I;  2EPZ A;  4JI0 E;  1VI7 A;  4GQU A;  4O43 A;  3ZZU A;  4JI7 I;  2I13 A;  4LTY A;  3EPJ A;  2WBS A;  2HK2 A;  1ZXM A;  1XMQ E;  4FWD A;  1KYQ A;  2EN4 A;  3FIG A;  2YTE A;  5AE2 A;  2EL6 A;  2JXP A;  4R2D A;  5L3J A;  1N3G A;  1N36 E;  4OKG A;  2UXC E;  5A6J A;  2EWL A;  4DPY A;  1I94 I;  1Z1B A;  4B3T E;  1TF6 A;  2ZIT A;  4WUD A;  2O3Z A;  2E72 A;  2HC5 A;  4R03 A;  1X5W A;  2KOU A;  2RS7 A;  3THN A;  5LMN E;  1QZR A;  3JTZ A;  2LJP A;  5K36 E;  4B3R E;  4DPX A;  3QT5 A;  2JEA A;  2CPN A;  2D9H A;  2Z5B A;  2EOZ A;  2V86 A;  2YSP A;  1NZ0 A;  2CG9 A;  2CZ9 A;  3HJC A;  2R76 A;  2E5L E;  5JEA A;  2EMY A;  2UXB I;  1KIJ A;  4X9J A;  2LUP B;  1YSA C;  4PU9 A;  3J7Y p;  2L2N A;  3C4T A;  2UUC E;  2C39 A;  1NCS A;  4MU3 A;  5AE1 A;  2MDG A;  2YU5 A;  4DUZ I;  4WX9 A;  4HTG A;  4DV7 E;  1XNR I;  1DGC A;  2LRS A;  4MU1 A;  4DUY E;  1N34 E;  1G2D C;  1NHJ A;  3PS3 A;  1RC7 A;  2BM0 A;  4LF9 E;  4O5G A;  2ODR D;  1IBL E;  3P3E A;  2EOI A;  2LV2 A;  3B82 A;  1FJG I;  3P1X A;  4J3D A;  2RPC A;  4BBY A;  2BM1 A;  4MU0 A;  4LF4 I;  4LF5 I;  4OO1 B;  3OTO I;  3ZOQ B;  2V89 A;  3DF6 A;  1N32 I;  2DRP A;  3M85 D;  5LLQ A;  3H09 A;  3ZZ0 A;  3ADI A;  3PS2 A;  1H72 C;  4JI1 I;  2ZM6 I;  3DJW A;  3EPL A;  4DR4 I;  2DLQ A;  2HJJ A;  4KZS A;  4JI4 I;  1ZU1 A;  2ENC A;  5CFF E;  1WUU A;  2EN2 A;  2B7T A;  1X6H A;  4JI5 E;  3Q1Q A;  1ZM3 A;  2PNL A;  4QNK A;  1N33 E;  1Z0V A;  2AJ4 A;  1X49 A;  2EM7 A;  4YY3 E;  1UDO A;  4JI3 I;  5IT9 Q;  1IBK E;  4BA2 A;  3VK6 A;  2DMY A;  1EKZ A;  1ZBT A;  2EQ0 A;  5BR8 I;  4IJD A;  3C6M A;  4IZJ D;  1PVG A;  5DNX A;  2EM3 A;  4M2Z A;  2LE2 A;  3WU6 A;  2UUB I;  4LFC I;  1UEK A;  4OO1 E;  1LLM C;  2R1F A;  1YYO A;  4MYT A;  1UDS A;  2EL4 A;  2V2V A;  2JEB A;  4UTG A;  4JG4 A;  4DV3 E;  1JK1 A;  2GQ0 A;  2OI2 A;  1ZR9 A;  4IFD F;  4OO1 A;  1IBM E;  3OML A;  2LO3 A;  2DSY A;  5EKW A;  2HGH A;  4LFA I;  4URL A;  1MGT A;  2V88 A;  4WSP A;  2VQF E;  2YTG A;  4X8W A;  4ZYH A;  1Y60 A;  3QT6 A;  3C4B A;  1RR9 A;  2BB8 A;  2B9D A;  1PIE A;  2WW4 A;  1YHC A;  4DV2 I;  2JOX A;  2UUA E;  4DU8 A;  3T1H I;  1G2F C;  2NAB A;  1VIS A;  4ED4 A;  1J5E I;  1IMU A;  2JPA A;  4IFD D;  3J80 Q;  5AC5 A;  5A69 A;  1A1F A;  2NN6 F;  5ADZ A;  1NHI A;  2LJU A;  2EPA A;  3PYG A;  5A6B D;  1WRJ A;  1PJQ A;  2EL5 A;  3L00 A;  1Z59 A;  4DR2 E;  1J26 A;  2WP8 B;  3Q6N A;  1Z0C A;  1PJT A;  1KTV A;  1YFH A;  3KZY A;  2GS8 A;  2EOM A;  4IS9 A;  4JI6 I;  1WHQ A;  4LFB I;  2EM5 A;  2VF3 A;  4USM A;  3J7A M;  4DR7 E;  4RHB B;  4AID A;  4JI7 E;  4F9B B;  5GMD A;  4M30 A;  2RTX A;  1T39 A;  4ISA A;  2KON A;  4DPW A;  2L2K B;  1XXE A;  2EPU A;  2O1U A;  2DGC A;  3PYF A;  2HHH I;  2V2Q A;  3WU3 A;  4DR3 I;  2NN6 D;  4JYA I;  1UN6 B;  3JAM Q;  2EMK A;  1T4L B;  4L5N C;  3L7Z B;  1MG7 A;  4AQY I;  2PO2 B;  3H4L A;  2HK3 A;  2EMB A;  4FW6 A;  1UHZ A;  1MX0 A;  1P47 A;  4K0K I;  2PO1 A;  2FV4 B;  2L92 A;  4DV6 I;  5K36 B;  2BA1 D;  3J80 C;  1AH5 A;  2EN6 A;  3F0N A;  2UXB E;  1X3C A;  4R2E A;  2EQ3 A;  4HAC B;  3EPH A;  2DB2 A;  2EOS A;  1HR0 E;  4WFT A;  2YT4 A;  1FWK A;  4M1K A;  2EMF A;  4ZYE A;  4DR6 I;  4DUZ E;  1B63 A;  1KVK A;  4MDT A;  4R2C A;  2EMI A;  3PS1 A;  3ECR A;  4MYU A;  1A6F A;  1XMO I;  2J7K A;  4TUI A;  2EML A;  3U1K A;  4R1F A;  4M0V A;  5KL2 A;  4I8O A;  1H7U A;  4BA1 B;  5KL4 A;  5T6J A;  5C0X D;  5LMU I;  2IER A;  2UXD I;  2MKN A;  1FJG E;  1Y4U A;  4WUB A;  4LF5 E;  1DAR A;  4LF4 E;  2Q8U A;  2F1D A;  4O24 A;  4GZN C;  2LMZ A;  1B69 A;  3L7Z A;  1YPN A;  1F2I G;  3JAM C;  1YYW A;  4ZYG A;  4JI1 E;  2PO2 A;  1FWL A;  2FTX B;  3NZK A;  4DXL A;  2GPI A;  2IOP A;  2VES A;  4X62 I;  4DR4 E;  1Y5Y A;  1H74 A;  5C0X B;  4JI4 E;  5K36 A;  2V8P A;  3MHH C;  2NUF A;  2N8X A;  3LML A;  1BBO A;  1AAY A;  4LU9 A;  4U3D A;  2EM9 A;  3GCM A;  4HAC A;  1BKN A;  4PRV A;  4JI3 E;  1IQO A;  2JE6 A;  2V2Z A;  4P78 A;  5K36 C;  4MU4 A;  3D4J A;  4DR1 I;  1HNX I;  4JV5 E;  4LF7 I;  1EH7 A;  2EMC A;  2LTR A;  2UUB E;  5AE3 A;  4LFC E;  2BA0 G;  5DRQ A;  1SR9 A;  2M1S A;  2MC5 A;  2DLK A;  4BC7 A;  4BA1 A;  2CTD A;  2WZO A;  2NA2 A;  2LUQ A;  2DEJ A;  4F9A B;  1BBG A;  3B4T A;  3K17 A;  5ELW A;  2F4V I;  2VF1 A;  1RHY A;  2EOR A;  1KKH A;  2A25 A;  5C0X E;  4F2J C;  1QNT A;  2ENA A;  3QT7 A;  2CT1 A;  4LFA E;  1XHK A;  2YWQ A;  3ZKD A;  4R2Q A;  2VE7 C;  1Y4S A;  3M7N G;  4DR5 E;  2BR2 B;  2EOF A;  5A6K A;  2RSI A;  4RPF A;  4I3H A;  3J81 Q;  4DV2 E;  2DMI A;  4R2R A;  4OX9 E;  1HK7 A;  2O1T A;  4DV0 I;  5C0X C;  2JYA A;  1A1J A;  1Z5C A;  2V34 A;  1DQ3 A;  1N36 I;  2YU8 A;  1X6F A;  3VYY A;  3LLH A;  2EN8 A;  4F6N A;  3KRN A;  2B7V A;  4IZK B;  3UK3 C;  2EPX A;  5GME A;  4JI8 I;  3LNU A;  4X66 I;  1ZM2 A;  1XNQ I;  2ZBK B;  5LMN I;  4DMI A;  2YTN A;  3V5R A;  3GLL A;  1PKP A;  2BBG A;  5FWK A;  3HXL A;  4JI6 E;  1P42 A;  2L33 A;  2YTP A;  5AC4 A;  1WHN A;  4LFB E;  2EMA A;  2EFG A;  4B3S I;  4FW7 A;  4P52 A;  4R2S A;  4IZJ B;  4NXM E;  3BF2 A;  3F6H A;  2M7Q A;  3BID A;  5A6A A;  4KQV A;  4LF8 E;  4BC9 A;  1E3H A;  4AM3 A;  1OYP A;  2J7J A;  2LTS A;  2YTF A;  2X36 A;  3AV0 A;  2EOY A;  2EZ6 A;  1QU6 A;  2HHH E;  4LF6 E;  4JYA E;  1HNW E;  2HKJ A;  4DV7 I;  4Z7Y A;  2BR2 A;  4DV1 I;  2PO1 B;  4DUY I;  4WYQ B;  1FKA E;  1E3P A;  1N34 I;  4ZVI A;  2EJ4 A;  1Z5A A;  1S4E A;  2ODR C;  4FK5 C;  1RMD A;  2LT7 A;  1H7S A;  3P06 A;  4AQY E;  4LCF A;  2EPO A;  2M4I A;  3J81 C;  2UU9 E;  4FW9 A;  4BHC A;  2EPP A;  2HFU A;  4K0K E;  4F54 A;  2JWO A;  2IOQ A;  4LPF A;  4OZE A;  2JOB A;  3T1Y I;  4DV6 E;  5KL7 A;  3QT8 A;  3V2U C;  2EM6 A;  2VQE E;  2EN3 A;  1ZXN A;  2MC6 A;  3HPZ A;  1X47 A;  2GLI A;  2WBT A;  1HNZ E;  4DV4 E;  2GO3 A;  1RQ0 A;  2EPM X;  2JT2 A;  3HTX A;  4HEI A;  4DR6 E;  4IFD B;  2EOH A;  1JK2 A;  2C38 B;  5EL9 A;  4IZJ A;  4GKK I;  3ADL A;  2YPN A;  5KL3 A;  4TUG A;  2JVA A;  2X7I A;  3HKM A;  4MQY A;  3GME A;  3ZKB A;  3ZZT A;  4Z7C A;  1XMO E;  4X64 I;  4FWH A;  4O4K A;  1X48 A;  2EOJ A;  4MLV A;  1N33 I;  2L3C A;  2C37 B;  4YY3 I;  2Q2E B;  4FWG A;  5A2Q C;  3CWV A;  2BV3 A;  2ENH A;  5LMU E;  4N3O A;  2JY9 A;  2LVH A;  1ZBQ A;  2RS6 A;  2UXD E;  4NHR A;  2M9A A;  2EPN A;  1I94 E;  4WSG A;  3K1J A;  4Q35 B;  2N3H A;  5JEA F;  3EQ1 A;  1UBD C;  4YHH I;  1A1L A;  4JI2 I;  2EPC A;  2NUE A;  4BS9 A;  2DEI A;  2ADR A;  2G7H A;  4X62 E;  1S16 A;  5IWA I;  1IBM I;  1IQS A;  1YH8 A;  2JP9 A;  2NN6 B;  2MKD A;  5TSE A;  2WP8 A;  2LCE A;  3BBG A;  1R6L A;  4IFD E;  2K4V A;  3PYE A;  2PO0 B;  1MEY C;  1NEI A;  2PNZ B;  3IWC A;  4WXD A;  5DRR A;  4DV5 I;  2EM4 A;  2VQF I;  1KJK A;  4MLQ A;  4IFD A;  2C38 A;  1R6M A;  1EA6 A;  2EQ1 A;  4KWY A;  4KHP I;  1PDA A;  4RH8 A;  1XNR E;  2B3T B;  2EPR A;  4DR1 E;  5JEA D;  2I9I A;  5A6B A;  3MHS C;  4LF7 E;  3KWR A;  2YRM A;  2HKE A;  2KHX A;  2C37 A;  3HUL A;  2EMZ A;  1A1I A;  2EPL X;  2JR1 A;  2EP3 A;  2EOX A;  4IFD C;  2EM8 A;  4P7A A;  3LTO A;  3QG5 C;  5DNY A;  2F4V E;  1NHH A;  2WNR B;  2JEA B;  3OTO E;  5F3W A;  1N32 E;  5IXM B;  2EM0 A;  4DR2 I;  5JEA B;  2NN6 E;  2YZT A;  2ZM6 E;  3C6K A;  3K6Q A;  2Z5C B;  4L8N A;  2V85 A;  4X65 I;  4NZV A;  4LCH A;  2L6M A;  1YZ9 A;  1N0V C;  2NN6 A;  3M85 G;  2EM2 A;  5IV8 B;  1RRE A;  1O0W A;  4HYM A;  2PO0 A;  4NXN I;  2PNZ A;  2PRT A;  3MSW A;  4DKK A;  2YRH A;  1YUJ A;  2NPF A;  4DV0 E;  4B3M I;  2NN6 C;  4HXZ A;  5BR8 E;  4UT4 A;  1ELO A;  4OO1 F;  3DD6 A;  3HQ1 A;  2EMG A;  3THO B;  1STU A;  4JI8 E;  4X66 E;  2V87 A;  1XNQ E;  3J7A G;  1USV A;  1X6E A;  1OJ4 A;  4U3B A;  3CDI A; 
#chains in the Genus database with same CATH homology
 1Z0G A;  2LBS B;  1Z5B A;  4B3S E;  3JU0 A;  4Q28 A;  4GKJ I;  1FI4 A;  1ZM4 A;  3LPS A;  2Z5C A;  1HR0 I;  1Z0W A;  1Z0T A;  4OOG C;  4JI0 I;  1WXR A;  2R3V A;  4FN5 A;  4USK A;  2L3J A;  4DV1 E;  1T4N A;  4P7D A;  1XMQ I;  1H73 A;  4R8O A;  3T1H E;  1DI2 A;  1J5E E;  2UXC I;  3PYD A;  4F9C B;  4B3T I;  5AAS A;  2F8B A;  3T1Y E;  5FLX Q;  4B3R I;  2A2D A;  1GQE A;  3IWB A;  2A2C A;  4GKK E;  2E5L I;  3F6G A;  5A2Q Q;  4WUC A;  2R42 A;  4X64 E;  1UIL A;  2UUC I;  1MU5 A;  4DR3 E;  3WU4 A;  1Y6Z A;  4DPU A;  4JV5 I;  3M6A A;  4BCA A;  4WPY A;  2MDR A;  4YHH E;  4LF9 I;  4JI2 E;  1IBL I;  2XEX A;  2N3G A;  2H36 X;  4IZK A;  5IWA E;  4BMJ A;  1B62 A;  2PNM A;  1USU A;  3WU5 A;  2V83 A;  3IWD A;  1YYK A;  3HPS A;  3AUZ A;  4PRX A;  4EMD A;  5FLX C;  4DV5 E;  3ADJ A;  1Z0E A;  4KHP E;  4DR5 I;  1FNM A;  3GON A;  2O1V A;  4JI5 I;  1D6T A;  3ZM7 A;  3VYX A;  4OX9 I;  1EI1 A;  3ADG A;  1IBK I;  2L2M A;  2E1R A;  5IT9 C;  1N0U A;  2L8T A;  2HFS A;  2O1W A;  4DV3 I;  3K85 A;  3PRY A;  2NUG A;  4X65 E;  2V8Q B;  2RSM A;  4NXM I;  4DPT A;  4DU7 A;  4NXN E;  4LF8 I;  1K47 A;  2IHR 1;  3Q6M A;  2FGG A;  4J8Z A;  4B3M E;  4XTJ A;  3RMP A;  2DIX A;  4LF6 I;  1HNW I;  1GZ6 A;  1HNX E;  1Z0B A;  2UUA I;  2CGE A;  2UU9 I;  4HY1 A;  3B8H A;  1U2R A;  2Z5B B;  2LJH A;  2Z5E A;  4GKJ E;  2VQE I;  1ZM9 A;  4GEQ B;  5LL6 R;  1T4O A;  1HNZ I;  4DV4 I;  3B78 A;  4DR7 I;  2E1M A;  4JI0 E;  3ZZU A;  4JI7 I;  4LTY A;  2HK2 A;  1ZXM A;  1XMQ E;  4FWD A;  3FIG A;  5AE2 A;  5L3J A;  1N36 E;  2UXC E;  2EWL A;  4DPY A;  1I94 I;  4B3T E;  2ZIT A;  4WUD A;  4R03 A;  2RS7 A;  2KOU A;  5LMN E;  1QZR A;  2LJP A;  3JTZ A;  4B3R E;  4DPX A;  3QT5 A;  2CPN A;  2Z5B A;  2V86 A;  2CZ9 A;  1NZ0 A;  2CG9 A;  3HJC A;  2E5L E;  2UXB I;  1KIJ A;  2LUP B;  4PU9 A;  3J7Y p;  2L2N A;  3C4T A;  2UUC E;  5AE1 A;  4DUZ I;  4DV7 E;  1XNR I;  2LRS A;  4DUY E;  1N34 E;  1NHJ A;  1RC7 A;  2BM0 A;  4LF9 E;  2ODR D;  1IBL E;  3B82 A;  1FJG I;  3P1X A;  2BM1 A;  4BBY A;  4LF5 I;  4LF4 I;  3OTO I;  3ZOQ B;  2V89 A;  3DF6 A;  1N32 I;  3H09 A;  3ZZ0 A;  3ADI A;  4JI1 I;  1H72 C;  2ZM6 I;  3DJW A;  4DR4 I;  4KZS A;  4JI4 I;  5CFF E;  1WUU A;  2B7T A;  4JI5 E;  3Q1Q A;  1ZM3 A;  2PNL A;  1N33 E;  1Z0V A;  2AJ4 A;  1X49 A;  4YY3 E;  5IT9 Q;  4JI3 I;  1IBK E;  3VK6 A;  2DMY A;  1EKZ A;  1ZBT A;  5BR8 I;  4IZJ D;  1PVG A;  4M2Z A;  2LE2 A;  3WU6 A;  2UUB I;  4LFC I;  1UEK A;  1YYO A;  4MYT A;  2V2V A;  4UTG A;  4JG4 A;  4DV3 E;  2GQ0 A;  2OI2 A;  1IBM E;  3OML A;  2DSY A;  4LFA I;  4URL A;  2V88 A;  4WSP A;  2VQF E;  4X8W A;  3QT6 A;  3C4B A;  1RR9 A;  2B9D A;  1PIE A;  2WW4 A;  4DV2 I;  2JOX A;  2UUA E;  4DU8 A;  3T1H I;  1VIS A;  4ED4 A;  1J5E I;  3J80 Q;  5ADZ A;  1NHI A;  3PYG A;  1Z59 A;  4DR2 E;  1J26 A;  3Q6N A;  1Z0C A;  1KTV A;  2GS8 A;  4JI6 I;  1WHQ A;  4LFB I;  2VF3 A;  4USM A;  3J7A M;  4DR7 E;  4JI7 E;  4F9B B;  5GMD A;  4M30 A;  2RTX A;  2KON A;  4DPW A;  2L2K B;  2O1U A;  3PYF A;  2HHH I;  2V2Q A;  3WU3 A;  4DR3 I;  4JYA I;  3JAM Q;  1T4L B;  4L5N C;  1MG7 A;  4AQY I;  3H4L A;  2HK3 A;  1UHZ A;  1MX0 A;  4K0K I;  2FV4 B;  2L92 A;  4DV6 I;  3J80 C;  3F0N A;  2UXB E;  4HAC B;  2DB2 A;  1HR0 E;  4WFT A;  2YT4 A;  1FWK A;  4M1K A;  4DR6 I;  4DUZ E;  1B63 A;  1KVK A;  4MYU A;  1A6F A;  1XMO I;  2J7K A;  4TUI A;  4R1F A;  4M0V A;  4I8O A;  1H7U A;  5LMU I;  5T6J A;  2UXD I;  1FJG E;  1Y4U A;  4WUB A;  4LF5 E;  1DAR A;  4LF4 E;  2LMZ A;  3JAM C;  1YYW A;  4JI1 E;  1FWL A;  2FTX B;  4DXL A;  2IOP A;  4X62 I;  4DR4 E;  1H74 A;  4JI4 E;  2V8P A;  2NUF A;  3LML A;  4LU9 A;  4HAC A;  1BKN A;  4PRV A;  4JI3 E;  2V2Z A;  4P78 A;  3D4J A;  4DR1 I;  1HNX I;  4JV5 E;  4LF7 I;  2LTR A;  2UUB E;  4LFC E;  5AE3 A;  1SR9 A;  2M1S A;  2MC5 A;  4BC7 A;  2WZO A;  2NA2 A;  2LUQ A;  2DEJ A;  4F9A B;  2F4V I;  3K17 A;  2VF1 A;  1KKH A;  3QT7 A;  4LFA E;  1XHK A;  3ZKD A;  2VE7 C;  1Y4S A;  4DR5 E;  4RPF A;  3J81 Q;  4I3H A;  4DV2 E;  4OX9 E;  1HK7 A;  2O1T A;  4DV0 I;  1Z5C A;  2V34 A;  1DQ3 A;  1N36 I;  3VYY A;  3LLH A;  4IZK B;  2B7V A;  5GME A;  4JI8 I;  3LNU A;  4X66 I;  1ZM2 A;  1XNQ I;  2ZBK B;  5LMN I;  4DMI A;  3V5R A;  1PKP A;  5FWK A;  3HXL A;  4JI6 E;  2L33 A;  4LFB E;  2EFG A;  1WHN A;  4B3S I;  4P52 A;  4IZJ B;  4NXM E;  3F6H A;  2M7Q A;  4KQV A;  4LF8 E;  4BC9 A;  2X36 A;  2LTS A;  3AV0 A;  2EZ6 A;  1QU6 A;  2HHH E;  4LF6 E;  4JYA E;  1HNW E;  2HKJ A;  4DV7 I;  4Z7Y A;  4DV1 I;  4DUY I;  4WYQ B;  1FKA E;  1N34 I;  4ZVI A;  1Z5A A;  1S4E A;  2ODR C;  1H7S A;  3P06 A;  4AQY E;  2M4I A;  3J81 C;  2UU9 E;  4FW9 A;  2HFU A;  4K0K E;  4F54 A;  2JWO A;  2IOQ A;  2JOB A;  3T1Y I;  4DV6 E;  3QT8 A;  3V2U C;  2VQE E;  1ZXN A;  2MC6 A;  3HPZ A;  1X47 A;  1HNZ E;  4DV4 E;  1RQ0 A;  3HTX A;  4DR6 E;  4IZJ A;  4GKK I;  3ADL A;  4TUG A;  2X7I A;  2JVA A;  3ZKB A;  3ZZT A;  4Z7C A;  1XMO E;  4X64 I;  4FWH A;  1N33 I;  1X48 A;  2L3C A;  4YY3 I;  2Q2E B;  4FWG A;  5A2Q C;  3CWV A;  2BV3 A;  5LMU E;  4N3O A;  2JY9 A;  1ZBQ A;  2RS6 A;  2UXD E;  1I94 E;  3K1J A;  2N3H A;  4YHH I;  4JI2 I;  2NUE A;  4BS9 A;  2DEI A;  2G7H A;  4X62 E;  1S16 A;  5IWA I;  1IBM I;  2K4V A;  3PYE A;  3IWC A;  4DV5 I;  2VQF I;  1EA6 A;  4KHP I;  1XNR E;  2B3T B;  4DR1 E;  4LF7 E;  3KWR A;  2HKE A;  2KHX A;  3HUL A;  2JR1 A;  4P7A A;  3LTO A;  5DNY A;  2F4V E;  1NHH A;  3OTO E;  5F3W A;  1N32 E;  4DR2 I;  2YZT A;  2ZM6 E;  3K6Q A;  2Z5C B;  4L8N A;  2V85 A;  4X65 I;  2L6M A;  1YZ9 A;  1N0V C;  1RRE A;  1O0W A;  4HYM A;  4NXN I;  3MSW A;  4DKK A;  2NPF A;  4DV0 E;  4B3M I;  4HXZ A;  5BR8 E;  4UT4 A;  1ELO A;  3HQ1 A;  1STU A;  4JI8 E;  4X66 E;  2V87 A;  1XNQ E;  3J7A G;  1USV A;  1OJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...