1Z0CA

Crystal structure of a. fulgidus lon proteolytic domain d508a mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
203
structure length
200
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGASASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 57
structure length 200
sequence length 203
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0cA00
4X62I 3B82A 2UXCI 2V2ZA 4B3MI 4LF4E 4B3RE 4GKKE 1XMQE 4PU9A 4Z7YA 4LF8I 4UTGA 4DR4I 1IBKI 4JI5I 4EMDA 4YY3I 4LF7E 4DR2I 2A2DA 3Q1QA 4DV2I 4X65E 1B62A 1PVGA 1H7UA 1H7SA 5IT9Q 2J7KA 4X64I 4FWDA 1N34E 4DUZE 4X62E 1XNRI 2F4VI 4OX9I 1HR0I 4JI6I 4B3ME 4LFAI 1PKPA 3M6AA 4B3SE 4LF8E 3HULA 4DU7A 5BR8I 4JI5E 2E1RA 1VISA 3K1JA 4YY3E 4DV0E 4NXME 2Q2EB 4DV2E 3ZZ0A 4DPTA 3QT5A 1EA6A 1KVKA 3ZKBA 2HFUA 1FI4A 4K0KE 1Z0CA 2ZITA 1ZM3A 4DV7I 4MYUA 3J7AM 1XNRE 2F4VE 4B3TI 4OX9E 1N32I 4JI6E 1Z5AA 3H4LA 4LFAE 4LFCE 4HY1A 3ZZTA 3ZM7A 1IBMI 1FWKA 3QT7A 1ZM9A 4WUBA 2WW4A 2VQFI 4Z7CA 4LFBI 1MG7A 3OTOI 4DV6I 2E5LI 4HXZA 1N36I 3D4JA 1EI1A 4JI8E 4DUYI 4DV7E 4XTJA 2UUCI 1Z0WA 5LMUE 1Z0VA 2HHHI 4ED4A 2NPFA 2DEIA 2UXBI 4JI1I 3T1YE 2HKJA 2VQFE 4HACB 2VQEI 1MX0A 5IT9C 3QT6A 3OTOE 1UEKA 3V2UC 3PYGA 4JG4A 1IBLI 4JV5I 4DR6I 4JI3I 3JAMQ 4DR7E 2UU9E 1D6TA 1PIEA 3LTOA 1I94I 4JI1E 4JI7E 5FLXQ 3QT8A 4NXNI 1Z5BA 5IWAI 3B8HA 2UXCE 1ZXMA 1QZRA 1IBLE 3ZZUA 1KIJA 4DR6E 4DR4E 4JI3E 1IBKE 4LF9I 2V2QA 2R3VA 4DR2E 4HYMA 2HKEA 4X66I 4JI2I 1K47A 2GS8A 1I94E 2BV3A 1HNXI 1HNZI 4X64E 2CZ9A 5LMNI 4LF5I 5IWAE 1HR0E 2V2VA 1Z0BA 4R1FA 4PRVA 2BM1A 2BM0A 1NHHA 4DR3I 3CWVA 4M1KA 4LF9E 5BR8E 2V8PA 4DR1I 1U2RA 4USMA 2HK3A 4X66E 4JI2E 3J7AG 2AJ4A 4JYAI 1HNXE 1Z5CA 1HNZE 4FW9A 1NHJA 3LPSA 1J5EI 4AQYI 4B3TE 4JI0I 4JI4I 2OI2A 2HK2A 4DU8A 3F0NA 4DV4I 1N32E 3J80Q 5L3JA 1MU5A 1IBME 4B3RI 2VF3A 4P52A 4GKKI 3PYDA 3JAMC 4GKJI 1XMQI 4DR1E 4LFBE 3PYEA 3B78A 1FWLA 4DV6E 2E5LE 5FLXC 4YHHI 3WU6A 1N36E 1RREA 4DUYE 1ELOA 1J5EE 1N0VC 1XHKA 4AQYE 4KHPI 4JI0E 2UUCE 5GMEA 1H74A 4DV4E 3LNUA 2HHHE 2UUBI 3WU5A 1H73A 3WU4A 2UXBE 4GKJE 4B3SI 5A2QQ 2LJPA 3T1HI 4MYTA 4DV1I 1ZXNA 2VQEE 4DR5I 2ZBKB 2R42A 1S4EA 4DV0I 4NXMI 4YHHE 4FWHA 4I3HA 3J81Q 1FNMA 4JV5E 1NZ0A 1A6FA 4DV3I 2DEJA 2UUAI 4K0KI 4KHPE 4HACA 3V5RA 1ZM4A 1DARA 2UUBE 1Z59A 4DPWA 1N0UA 4LFCI 3T1HE 1H72C 4DV1E 4NXNE 1NHIA 4DR5E 1FKAE 2XEXA 3WU3A 2ZM6I 4FN5A 4RPFA 1S16A 1B63A 2A2CA 1ZM2A 1Z0EA 1XMOI 1HNWI 3J80C 1FJGI 4DV3E 2UUAE 4JI8I 2UXDI 2X7IA 1KTVA 2V34A 3ZKDA 3GONA 1N33I 4DV5I 4KQVA 1XNQI 4DXLA 5LMUI 5LL6R 4DPXA 3PYFA 4DPUA 4ZVIA 5LMNE 4LF5E 4LF6I 4P7AA 3T1YI 2ZM6E 1Z0GA 4URLA 1XMOE 4LF4I 2HFSA 1Z0TA 4DR3E 1HNWE 1FJGE 4DPYA 2UXDE 4USKA 4WUDA 1BKNA 2X36A 4LF7I 1N33E 5A2QC 4PRXA 3K17A 4DV5E 4JYAE 2EFGA 4FWGA 4WUCA 1XNQE 4X65I 1WUUA 4DR7I 1OJ4A 2UU9I 1KKHA 4UT4A 4LF6E 1RR9A 4JI7I 5GMDA 4JI4E 1N34I 3J81C 4DUZI
chains in the Genus database with same CATH superfamily
4X62I 3B82A 1UDSA 1USVA 2UXCI 2V2ZA 4B3MI 3L7ZA 4LF4E 4B3RE 4AM3A 2O3ZA 4GKKE 5DRRA 3P3GA 1XMQE 5JEAB 1OYRA 4PU9A 4Z7YA 4LF8I 4UTGA 4DR4I 1IBKI 4JI5I 4U3DA 4EMDA 4YY3I 4LF7E 2C39A 4DR2I 2A2DA 5DNXA 3Q1QA 4DV2I 4X65E 5C0XC 1B62A 1PVGA 2GO4A 1H7UA 1H7SA 4LCGA 5IT9Q 2J7KA 4OO1E 4X64I 4FWDA 1N34E 4DUZE 4X62E 1XNRI 2F4VI 4OX9I 3GCMA 1Y5YA 1HR0I 3B4TA 4JI6I 4B3ME 3DD6A 5FWKA 4LFAI 1PKPA 4BA1B 3M6AA 4B3SE 2PO2B 2CG9A 4LF8E 4MQYA 4FW6A 5JEAE 5K36D 3HULA 4DU7A 5BR8I 4JI5E 2E1RA 1VISA 3K1JA 3CDIA 2PO1A 4YY3E 4DV0E 4NXME 2Q2EB 5DNLA 4DV2E 2CGEA 3ZZ0A 4DPTA 3QT5A 1EA6A 1KVKA 3ZKBA 2O1UA 2HFUA 1FI4A 4K0KE 1Z0CA 2ZITA 1ZM3A 4DV7I 4MYUA 5ELWA 3J7AM 1XNRE 2F4VE 4B3TI 2WP8B 4OX9E 5K36F 2O1TA 1N32I 4JI6E 1P42A 1Z5AA 2JE6B 3H4LA 5EKWA 2VESA 4LFAE 4LFCE 4HY1A 3ZZTA 3ZM7A 1IBMI 1FWKA 5K36A 3QT7A 1ZM9A 4WUBA 2WW4A 2VQFI 4Z7CA 4LFBI 1MG7A 3OTOI 4DV6I 2E5LI 2BA0D 4HXZA 2PNZB 1N36I 3D4JA 1EI1A 1Y6ZA 4JI8E 2JEAA 4DUYI 4GQUA 4DV7E 3K85A 4XTJA 2UUCI 4MU3A 2NN6E 2PO0A 3M85D 1Z0WA 2JEBB 4IFDE 2Z5BA 3UHMA 1Z0VA 5LMUE 2HHHI 4ED4A 2NPFA 4OO1B 2DEIA 2UXBI 4JI1I 3T1YE 4IZKB 2HKJA 2VQFE 4HACB 1UDQA 4LCFA 2VQEI 1MX0A 5IT9C 3QT6A 3OTOE 2Z5CA 2BA1D 1UEKA 3V2UC 3PYGA 4JG4A 1IBLI 4NBQA 4JV5I 4DR6I 4IS9A 4JI3I 2C37B 4AIDA 1YHCA 4BA2A 3JAMQ 3PRYA 2O1WA 4DR7E 2UU9E 4OO1C 1D6TA 1PIEA 3LTOA 2PNMA 1I94I 4JI1E 4JI7E 5FLXQ 3QT8A 2F1DA 3GLLA 4NXNI 1Z5BA 5IWAI 4FW7A 3B8HA 1Y4UA 2UXCE 1ZXMA 1QZRA 2C38A 1IBLE 3ZZUA 1E3PA 1KIJA 5JEAC 2WNRB 5C0XA 4DR6E 4DR4E 4JI3E 1IBKE 4LF9I 2V2QA 2R3VA 1Y60A 1YH8A 4DR2E 2Z5EA 4HYMA 4J3DA 2HKEA 4X66I 4JI2I 4IZJB 1K47A 4FW5A 2GS8A 4ISAA 1I94E 2BV3A 3M7NG 1HNXI 3P76A 4X64E 1HNZI 2BR2B 5JEAA 4OKGA 2CZ9A 5LMNI 4LF5I 5IWAE 2NN6B 4QNKA 1HR0E 2V2VA 3U1KA 4IFDB 2PNLA 5DRQA 1Z0BA 4OZEA 4R1FA 3Q6NA 4PRVA 2BM1A 2GQ0A 2BM0A 4MU1A 1NHHA 1E3HA 4DR3I 3CWVA 3NZKA 4M1KA 4LF9E 5BR8E 4LCHA 5K36E 2V8PA 4DR1I 1U2RA 2GO3A 4USMA 2IOQA 3H1CA 3J81C 2HK3A 3PS3A 4X66E 4JI2E 2O1VA 4AIMA 3L7ZB 3HKMA 3Q6MA 3J7AG 2AJ4A 2BA1G 4JYAI 3P3EA 1HNXE 1Z5CA 1HNZE 4BA1A 4FW9A 3P3CA 1NHJA 3LPSA 2PO2A 1J5EI 4AQYI 2C39B 4B3TE 2NN6C 4JI0I 4JI4I 2OI2A 2HK2A 4DU8A 1OYPA 1OYSA 3F0NA 4DV4I 1N32E 3J80Q 4IFDC 5L3JA 5DROA 3U1YA 1MU5A 1IBME 4B3RI 2VF3A 4P52A 4GKKI 3PYDA 3JAMC 4GKJI 1XMQI 1HK7A 4DR1E 4U3BA 4LFBE 3PYEA 3B78A 1FWLA 1UDOA 4DV6E 2E5LE 2WP8A 5FLXC 2NN6A 4YHHI 3WU6A 4MU4A 4MU0A 1N36E 4IFDA 3GMEA 2JE6A 1RREA 5C0XD 4DUYE 1XXEA 1ELOA 4OO1D 1J5EE 2PO1B 1N0VC 1XHKA 4AQYE 4KHPI 4JI0E 2UUCE 1UDNA 5GMEA 1H74A 4DV4E 4MDTA 3LNUA 2HHHE 2UUBI 3WU5A 1H73A 3WU4A 2UXBE 2PNZA 4GKJE 4B3SI 2IERA 5JEAD 5A2QQ 4LOMA 2LJPA 3T1HI 4MYTA 4DV1I 1ZXNA 5C0XF 2VQEE 4DR5I 2ZBKB 2R42A 5DRPA 4OO1F 1S4EA 4DV0I 4NXMI 2J65A 4YHHE 3CDJA 4FWHA 2JEBA 4I3HA 2IESA 3J81Q 1FNMA 4JV5E 1NZ0A 1A6FA 5C0XE 5K36B 4OO1A 4DV3I 2DEJA 2UUAI 1R6MA 2CVEA 4K0KI 4KHPE 4IZKA 4N3OA 5JEAF 2IOPA 4HACA 3V5RA 1ZM4A 3KRNA 1DARA 2UUBE 1Z59A 2BA0G 4FW4A 4DPWA 1N0UA 2JEAB 2JT2A 4LFCI 3T1HE 1H72C 4DV1E 4NXNE 1NHIA 4DR5E 1FKAE 2XEXA 3WU3A 2PO0B 4FN5A 4RPFA 2ZM6I 1S16A 2C37A 1B63A 2A2CA 2Z5BB 3M85G 1RHYA 1ZM2A 4IZJD 1Z0EA 1XMOI 1HNWI 3J80C 5K36C 1FJGI 4DV3E 2UUAE 4JI8I 2UXDI 2X7IA 1KTVA 1USUA 2V34A 3ZKDA 3GONA 2NN6D 2Z5CB 1R6LA 1N33I 1Y4SA 4DV5I 4IFDD 4KQVA 4LPFA 2AE8A 1XNQI 1VI7A 4DXLA 5LMUI 5LL6R 4DPXA 3PYFA 2WNRA 4DPUA 4ZVIA 5LMNE 4LF5E 4LF6I 4P7AA 3T1YI 4QNJA 3HJCA 5EL9A 2ZM6E 4BA2B 1Z0GA 4URLA 2NN6F 1XMOE 4LF4I 4IZJA 2HFSA 1Z0TA 4DR3E 3M7ND 1HNWE 1FJGE 4IFDF 4DPYA 2UXDE 4USKA 4WUDA 2BR2A 1BKNA 2X36A 4LF7I 1N33E 5A2QC 2C38B 4PRXA 3K17A 4DV5E 3PS1A 4JYAE 2EFGA 4FW3A 4FWGA 4WUCA 4X65I 1XNQE 1WUUA 5C0XB 4DR7I 1OJ4A 2UU9I 3P06A 1KKHA 4UT4A 4LF6E 1RR9A 4JI7I 5GMDA 4JI4E 1N34I 3PS2A 4DUZI
chains in the Genus database with same CATH topology
4X62I 3B82A 1USVA 2UXCI 2V2ZA 4B3MI 4LF4E 4B3RE 4GKKE 1XMQE 4PU9A 4Z7YA 4LF8I 4UTGA 4DR4I 1IBKI 4JI5I 4EMDA 4YY3I 4LF7E 4DR2I 2A2DA 3Q1QA 4DV2I 4X65E 1B62A 1PVGA 1H7UA 1H7SA 5IT9Q 2J7KA 4X64I 4FWDA 1N34E 4DUZE 4X62E 1XNRI 2F4VI 4OX9I 1HR0I 4JI6I 4B3ME 5FWKA 4LFAI 1PKPA 3M6AA 4B3SE 2CG9A 4LF8E 3HULA 4DU7A 5BR8I 4JI5E 2E1RA 1VISA 3K1JA 4YY3E 4DV0E 4NXME 2Q2EB 4DV2E 2CGEA 3ZZ0A 4DPTA 3QT5A 1EA6A 1KVKA 3ZKBA 2O1UA 2HFUA 1FI4A 4K0KE 1Z0CA 2ZITA 1ZM3A 4DV7I 4MYUA 3J7AM 1XNRE 2F4VE 4B3TI 4OX9E 2O1TA 1N32I 4JI6E 1Z5AA 3H4LA 4LFAE 4LFCE 4HY1A 3ZZTA 3ZM7A 1IBMI 1FWKA 3QT7A 1ZM9A 4WUBA 2WW4A 2VQFI 4Z7CA 4LFBI 1MG7A 3OTOI 4DV6I 2E5LI 4HXZA 1N36I 3D4JA 1EI1A 1Y6ZA 4JI8E 4DUYI 4DV7E 3K85A 4XTJA 2UUCI 1Z0WA 2Z5BA 5LMUE 1Z0VA 2HHHI 4ED4A 2NPFA 2DEIA 2UXBI 4JI1I 3T1YE 4IZKB 2HKJA 2VQFE 4HACB 2VQEI 1MX0A 5IT9C 3QT6A 3OTOE 2Z5CA 1UEKA 3V2UC 3PYGA 4JG4A 1IBLI 4JV5I 4DR6I 4JI3I 3JAMQ 3PRYA 2O1WA 4DR7E 2UU9E 1D6TA 1PIEA 3LTOA 2PNMA 1I94I 4JI1E 4JI7E 5FLXQ 3QT8A 4NXNI 1Z5BA 5IWAI 3B8HA 1Y4UA 2UXCE 1ZXMA 1QZRA 1IBLE 3ZZUA 1KIJA 4DR6E 4DR4E 4JI3E 1IBKE 4LF9I 2V2QA 2R3VA 4DR2E 2Z5EA 4HYMA 2HKEA 4X66I 4JI2I 4IZJB 1K47A 2GS8A 1I94E 2BV3A 1HNXI 1HNZI 4X64E 2CZ9A 5LMNI 4LF5I 5IWAE 1HR0E 2V2VA 2PNLA 1Z0BA 4R1FA 3Q6NA 4PRVA 2BM1A 2GQ0A 2BM0A 1NHHA 4DR3I 3CWVA 4M1KA 4LF9E 5BR8E 2V8PA 4DR1I 1U2RA 4USMA 2IOQA 2HK3A 4X66E 4JI2E 2O1VA 3Q6MA 3J7AG 2AJ4A 4JYAI 1HNXE 1Z5CA 1HNZE 4FW9A 1NHJA 3LPSA 1J5EI 4AQYI 4B3TE 4JI0I 4JI4I 2OI2A 2HK2A 4DU8A 3F0NA 4DV4I 1N32E 3J80Q 5L3JA 1MU5A 1IBME 4B3RI 2VF3A 4P52A 4GKKI 3PYDA 3JAMC 4GKJI 1XMQI 1HK7A 4DR1E 4LFBE 3PYEA 3B78A 1FWLA 4DV6E 2E5LE 5FLXC 4YHHI 3WU6A 1N36E 1RREA 4DUYE 1ELOA 1J5EE 1N0VC 1XHKA 4AQYE 4KHPI 4JI0E 2UUCE 5GMEA 1H74A 4DV4E 3LNUA 2HHHE 2UUBI 3WU5A 1H73A 3WU4A 2UXBE 4GKJE 4B3SI 5A2QQ 2LJPA 3T1HI 4MYTA 4DV1I 1ZXNA 2VQEE 4DR5I 2ZBKB 2R42A 1S4EA 4DV0I 4NXMI 4YHHE 4FWHA 4I3HA 3J81Q 1FNMA 4JV5E 1NZ0A 1A6FA 4DV3I 2DEJA 2UUAI 4K0KI 4KHPE 4IZKA 4N3OA 2IOPA 4HACA 3V5RA 1ZM4A 1DARA 2UUBE 1Z59A 4DPWA 1N0UA 4LFCI 3T1HE 1H72C 4DV1E 4NXNE 1NHIA 4DR5E 1FKAE 2XEXA 3WU3A 2ZM6I 4FN5A 4RPFA 1S16A 1B63A 2A2CA 2Z5BB 1ZM2A 4IZJD 1Z0EA 1XMOI 1HNWI 3J80C 1FJGI 4DV3E 2UUAE 4JI8I 2UXDI 2X7IA 1KTVA 1USUA 2V34A 3ZKDA 3GONA 2Z5CB 1N33I 1Y4SA 4DV5I 4KQVA 1XNQI 4DXLA 5LMUI 5LL6R 4DPXA 3PYFA 4DPUA 4ZVIA 5LMNE 4LF5E 4LF6I 4P7AA 3T1YI 3HJCA 2ZM6E 1Z0GA 4URLA 1XMOE 4LF4I 4IZJA 2HFSA 1Z0TA 4DR3E 1HNWE 1FJGE 4DPYA 2UXDE 4USKA 4WUDA 1BKNA 2X36A 4LF7I 1N33E 5A2QC 4PRXA 3K17A 4DV5E 4JYAE 2EFGA 4FWGA 4WUCA 1XNQE 4X65I 1WUUA 4DR7I 1OJ4A 2UU9I 3P06A 1KKHA 4UT4A 4LF6E 1RR9A 4JI7I 5GMDA 4JI4E 1N34I 3J81C 4DUZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 I;  3B82 A;  2UXC I;  2V2Z A;  4B3M I;  4LF4 E;  4B3R E;  4GKK E;  1XMQ E;  4PU9 A;  4Z7Y A;  4LF8 I;  4UTG A;  4DR4 I;  1IBK I;  4JI5 I;  4EMD A;  4YY3 I;  4LF7 E;  4DR2 I;  2A2D A;  3Q1Q A;  4DV2 I;  4X65 E;  1B62 A;  1PVG A;  1H7U A;  1H7S A;  5IT9 Q;  2J7K A;  4X64 I;  4FWD A;  1N34 E;  4DUZ E;  4X62 E;  1XNR I;  2F4V I;  4OX9 I;  1HR0 I;  4JI6 I;  4B3M E;  4LFA I;  1PKP A;  3M6A A;  4B3S E;  4LF8 E;  3HUL A;  4DU7 A;  5BR8 I;  4JI5 E;  2E1R A;  1VIS A;  3K1J A;  4YY3 E;  4DV0 E;  4NXM E;  2Q2E B;  4DV2 E;  3ZZ0 A;  4DPT A;  3QT5 A;  1EA6 A;  1KVK A;  3ZKB A;  2HFU A;  1FI4 A;  4K0K E;  1Z0C A;  2ZIT A;  1ZM3 A;  4DV7 I;  4MYU A;  3J7A M;  1XNR E;  2F4V E;  4B3T I;  4OX9 E;  1N32 I;  4JI6 E;  1Z5A A;  3H4L A;  4LFA E;  4LFC E;  4HY1 A;  3ZZT A;  3ZM7 A;  1IBM I;  1FWK A;  3QT7 A;  1ZM9 A;  4WUB A;  2WW4 A;  2VQF I;  4Z7C A;  4LFB I;  1MG7 A;  3OTO I;  4DV6 I;  2E5L I;  4HXZ A;  1N36 I;  3D4J A;  1EI1 A;  4JI8 E;  4DUY I;  4DV7 E;  4XTJ A;  2UUC I;  1Z0W A;  5LMU E;  1Z0V A;  2HHH I;  4ED4 A;  2NPF A;  2DEI A;  2UXB I;  4JI1 I;  3T1Y E;  2HKJ A;  2VQF E;  4HAC B;  2VQE I;  1MX0 A;  5IT9 C;  3QT6 A;  3OTO E;  1UEK A;  3V2U C;  3PYG A;  4JG4 A;  1IBL I;  4JV5 I;  4DR6 I;  4JI3 I;  3JAM Q;  4DR7 E;  2UU9 E;  1D6T A;  1PIE A;  3LTO A;  1I94 I;  4JI1 E;  4JI7 E;  5FLX Q;  3QT8 A;  4NXN I;  1Z5B A;  5IWA I;  3B8H A;  2UXC E;  1ZXM A;  1QZR A;  1IBL E;  3ZZU A;  1KIJ A;  4DR6 E;  4DR4 E;  4JI3 E;  1IBK E;  4LF9 I;  2V2Q A;  2R3V A;  4DR2 E;  4HYM A;  2HKE A;  4X66 I;  4JI2 I;  1K47 A;  2GS8 A;  1I94 E;  2BV3 A;  1HNX I;  1HNZ I;  4X64 E;  2CZ9 A;  5LMN I;  4LF5 I;  5IWA E;  1HR0 E;  2V2V A;  1Z0B A;  4R1F A;  4PRV A;  2BM1 A;  2BM0 A;  1NHH A;  4DR3 I;  3CWV A;  4M1K A;  4LF9 E;  5BR8 E;  2V8P A;  4DR1 I;  1U2R A;  4USM A;  2HK3 A;  4X66 E;  4JI2 E;  3J7A G;  2AJ4 A;  4JYA I;  1HNX E;  1Z5C A;  1HNZ E;  4FW9 A;  1NHJ A;  3LPS A;  1J5E I;  4AQY I;  4B3T E;  4JI0 I;  4JI4 I;  2OI2 A;  2HK2 A;  4DU8 A;  3F0N A;  4DV4 I;  1N32 E;  3J80 Q;  5L3J A;  1MU5 A;  1IBM E;  4B3R I;  2VF3 A;  4P52 A;  4GKK I;  3PYD A;  3JAM C;  4GKJ I;  1XMQ I;  4DR1 E;  4LFB E;  3PYE A;  3B78 A;  1FWL A;  4DV6 E;  2E5L E;  5FLX C;  4YHH I;  3WU6 A;  1N36 E;  1RRE A;  4DUY E;  1ELO A;  1J5E E;  1N0V C;  1XHK A;  4AQY E;  4KHP I;  4JI0 E;  2UUC E;  5GME A;  1H74 A;  4DV4 E;  3LNU A;  2HHH E;  2UUB I;  3WU5 A;  1H73 A;  3WU4 A;  2UXB E;  4GKJ E;  4B3S I;  5A2Q Q;  2LJP A;  3T1H I;  4MYT A;  4DV1 I;  1ZXN A;  2VQE E;  4DR5 I;  2ZBK B;  2R42 A;  1S4E A;  4DV0 I;  4NXM I;  4YHH E;  4FWH A;  4I3H A;  3J81 Q;  1FNM A;  4JV5 E;  1NZ0 A;  1A6F A;  4DV3 I;  2DEJ A;  2UUA I;  4K0K I;  4KHP E;  4HAC A;  3V5R A;  1ZM4 A;  1DAR A;  2UUB E;  1Z59 A;  4DPW A;  1N0U A;  4LFC I;  3T1H E;  1H72 C;  4DV1 E;  4NXN E;  1NHI A;  4DR5 E;  1FKA E;  2XEX A;  3WU3 A;  2ZM6 I;  4FN5 A;  4RPF A;  1S16 A;  1B63 A;  2A2C A;  1ZM2 A;  1Z0E A;  1XMO I;  1HNW I;  3J80 C;  1FJG I;  4DV3 E;  2UUA E;  4JI8 I;  2UXD I;  2X7I A;  1KTV A;  2V34 A;  3ZKD A;  3GON A;  1N33 I;  4DV5 I;  4KQV A;  1XNQ I;  4DXL A;  5LMU I;  5LL6 R;  4DPX A;  3PYF A;  4DPU A;  4ZVI A;  5LMN E;  4LF5 E;  4LF6 I;  4P7A A;  3T1Y I;  2ZM6 E;  1Z0G A;  4URL A;  1XMO E;  4LF4 I;  2HFS A;  1Z0T A;  4DR3 E;  1HNW E;  1FJG E;  4DPY A;  2UXD E;  4USK A;  4WUD A;  1BKN A;  2X36 A;  4LF7 I;  1N33 E;  5A2Q C;  4PRX A;  3K17 A;  4DV5 E;  4JYA E;  2EFG A;  4FWG A;  4WUC A;  1XNQ E;  4X65 I;  1WUU A;  4DR7 I;  1OJ4 A;  2UU9 I;  1KKH A;  4UT4 A;  4LF6 E;  1RR9 A;  4JI7 I;  5GMD A;  4JI4 E;  1N34 I;  3J81 C;  4DUZ I; 
#chains in the Genus database with same CATH topology
 4X62 I;  3B82 A;  1UDS A;  1USV A;  2UXC I;  2V2Z A;  4B3M I;  3L7Z A;  4LF4 E;  4B3R E;  4AM3 A;  2O3Z A;  4GKK E;  5DRR A;  3P3G A;  1XMQ E;  5JEA B;  1OYR A;  4PU9 A;  4Z7Y A;  4LF8 I;  4UTG A;  4DR4 I;  1IBK I;  4JI5 I;  4U3D A;  4EMD A;  4YY3 I;  4LF7 E;  2C39 A;  4DR2 I;  2A2D A;  5DNX A;  3Q1Q A;  4DV2 I;  4X65 E;  5C0X C;  1B62 A;  1PVG A;  2GO4 A;  1H7U A;  1H7S A;  4LCG A;  5IT9 Q;  2J7K A;  4OO1 E;  4X64 I;  4FWD A;  1N34 E;  4DUZ E;  4X62 E;  1XNR I;  2F4V I;  4OX9 I;  3GCM A;  1Y5Y A;  1HR0 I;  3B4T A;  4JI6 I;  4B3M E;  3DD6 A;  5FWK A;  4LFA I;  1PKP A;  4BA1 B;  3M6A A;  4B3S E;  2PO2 B;  2CG9 A;  4LF8 E;  4MQY A;  4FW6 A;  5JEA E;  5K36 D;  3HUL A;  4DU7 A;  5BR8 I;  4JI5 E;  2E1R A;  1VIS A;  3K1J A;  3CDI A;  2PO1 A;  4YY3 E;  4DV0 E;  4NXM E;  2Q2E B;  5DNL A;  4DV2 E;  2CGE A;  3ZZ0 A;  4DPT A;  3QT5 A;  1EA6 A;  1KVK A;  3ZKB A;  2O1U A;  2HFU A;  1FI4 A;  4K0K E;  1Z0C A;  2ZIT A;  1ZM3 A;  4DV7 I;  4MYU A;  5ELW A;  3J7A M;  1XNR E;  2F4V E;  4B3T I;  2WP8 B;  4OX9 E;  5K36 F;  2O1T A;  1N32 I;  4JI6 E;  1P42 A;  1Z5A A;  2JE6 B;  3H4L A;  5EKW A;  2VES A;  4LFA E;  4LFC E;  4HY1 A;  3ZZT A;  3ZM7 A;  1IBM I;  1FWK A;  5K36 A;  3QT7 A;  1ZM9 A;  4WUB A;  2WW4 A;  2VQF I;  4Z7C A;  4LFB I;  1MG7 A;  3OTO I;  4DV6 I;  2E5L I;  2BA0 D;  4HXZ A;  2PNZ B;  1N36 I;  3D4J A;  1EI1 A;  1Y6Z A;  4JI8 E;  2JEA A;  4DUY I;  4GQU A;  4DV7 E;  3K85 A;  4XTJ A;  2UUC I;  4MU3 A;  2NN6 E;  2PO0 A;  3M85 D;  1Z0W A;  2JEB B;  4IFD E;  2Z5B A;  3UHM A;  1Z0V A;  5LMU E;  2HHH I;  4ED4 A;  2NPF A;  4OO1 B;  2DEI A;  2UXB I;  4JI1 I;  3T1Y E;  4IZK B;  2HKJ A;  2VQF E;  4HAC B;  1UDQ A;  4LCF A;  2VQE I;  1MX0 A;  5IT9 C;  3QT6 A;  3OTO E;  2Z5C A;  2BA1 D;  1UEK A;  3V2U C;  3PYG A;  4JG4 A;  1IBL I;  4NBQ A;  4JV5 I;  4DR6 I;  4IS9 A;  4JI3 I;  2C37 B;  4AID A;  1YHC A;  4BA2 A;  3JAM Q;  3PRY A;  2O1W A;  4DR7 E;  2UU9 E;  4OO1 C;  1D6T A;  1PIE A;  3LTO A;  2PNM A;  1I94 I;  4JI1 E;  4JI7 E;  5FLX Q;  3QT8 A;  2F1D A;  3GLL A;  4NXN I;  1Z5B A;  5IWA I;  4FW7 A;  3B8H A;  1Y4U A;  2UXC E;  1ZXM A;  1QZR A;  2C38 A;  1IBL E;  3ZZU A;  1E3P A;  1KIJ A;  5JEA C;  2WNR B;  5C0X A;  4DR6 E;  4DR4 E;  4JI3 E;  1IBK E;  4LF9 I;  2V2Q A;  2R3V A;  1Y60 A;  1YH8 A;  4DR2 E;  2Z5E A;  4HYM A;  4J3D A;  2HKE A;  4X66 I;  4JI2 I;  4IZJ B;  1K47 A;  4FW5 A;  2GS8 A;  4ISA A;  1I94 E;  2BV3 A;  3M7N G;  1HNX I;  3P76 A;  4X64 E;  1HNZ I;  2BR2 B;  5JEA A;  4OKG A;  2CZ9 A;  5LMN I;  4LF5 I;  5IWA E;  2NN6 B;  4QNK A;  1HR0 E;  2V2V A;  3U1K A;  4IFD B;  2PNL A;  5DRQ A;  1Z0B A;  4OZE A;  4R1F A;  3Q6N A;  4PRV A;  2BM1 A;  2GQ0 A;  2BM0 A;  4MU1 A;  1NHH A;  1E3H A;  4DR3 I;  3CWV A;  3NZK A;  4M1K A;  4LF9 E;  5BR8 E;  4LCH A;  5K36 E;  2V8P A;  4DR1 I;  1U2R A;  2GO3 A;  4USM A;  2IOQ A;  3H1C A;  3J81 C;  2HK3 A;  3PS3 A;  4X66 E;  4JI2 E;  2O1V A;  4AIM A;  3L7Z B;  3HKM A;  3Q6M A;  3J7A G;  2AJ4 A;  2BA1 G;  4JYA I;  3P3E A;  1HNX E;  1Z5C A;  1HNZ E;  4BA1 A;  4FW9 A;  3P3C A;  1NHJ A;  3LPS A;  2PO2 A;  1J5E I;  4AQY I;  2C39 B;  4B3T E;  2NN6 C;  4JI0 I;  4JI4 I;  2OI2 A;  2HK2 A;  4DU8 A;  1OYP A;  1OYS A;  3F0N A;  4DV4 I;  1N32 E;  3J80 Q;  4IFD C;  5L3J A;  5DRO A;  3U1Y A;  1MU5 A;  1IBM E;  4B3R I;  2VF3 A;  4P52 A;  4GKK I;  3PYD A;  3JAM C;  4GKJ I;  1XMQ I;  1HK7 A;  4DR1 E;  4U3B A;  4LFB E;  3PYE A;  3B78 A;  1FWL A;  1UDO A;  4DV6 E;  2E5L E;  2WP8 A;  5FLX C;  2NN6 A;  4YHH I;  3WU6 A;  4MU4 A;  4MU0 A;  1N36 E;  4IFD A;  3GME A;  2JE6 A;  1RRE A;  5C0X D;  4DUY E;  1XXE A;  1ELO A;  4OO1 D;  1J5E E;  2PO1 B;  1N0V C;  1XHK A;  4AQY E;  4KHP I;  4JI0 E;  2UUC E;  1UDN A;  5GME A;  1H74 A;  4DV4 E;  4MDT A;  3LNU A;  2HHH E;  2UUB I;  3WU5 A;  1H73 A;  3WU4 A;  2UXB E;  2PNZ A;  4GKJ E;  4B3S I;  2IER A;  5JEA D;  5A2Q Q;  4LOM A;  2LJP A;  3T1H I;  4MYT A;  4DV1 I;  1ZXN A;  5C0X F;  2VQE E;  4DR5 I;  2ZBK B;  2R42 A;  5DRP A;  4OO1 F;  1S4E A;  4DV0 I;  4NXM I;  2J65 A;  4YHH E;  3CDJ A;  4FWH A;  2JEB A;  4I3H A;  2IES A;  3J81 Q;  1FNM A;  4JV5 E;  1NZ0 A;  1A6F A;  5C0X E;  5K36 B;  4OO1 A;  4DV3 I;  2DEJ A;  2UUA I;  1R6M A;  2CVE A;  4K0K I;  4KHP E;  4IZK A;  4N3O A;  5JEA F;  2IOP A;  4HAC A;  3V5R A;  1ZM4 A;  3KRN A;  1DAR A;  2UUB E;  1Z59 A;  2BA0 G;  4FW4 A;  4DPW A;  1N0U A;  2JEA B;  2JT2 A;  4LFC I;  3T1H E;  1H72 C;  4DV1 E;  4NXN E;  1NHI A;  4DR5 E;  1FKA E;  2XEX A;  3WU3 A;  2PO0 B;  4FN5 A;  4RPF A;  2ZM6 I;  1S16 A;  2C37 A;  1B63 A;  2A2C A;  2Z5B B;  3M85 G;  1RHY A;  1ZM2 A;  4IZJ D;  1Z0E A;  1XMO I;  1HNW I;  3J80 C;  5K36 C;  1FJG I;  4DV3 E;  2UUA E;  4JI8 I;  2UXD I;  2X7I A;  1KTV A;  1USU A;  2V34 A;  3ZKD A;  3GON A;  2NN6 D;  2Z5C B;  1R6L A;  1N33 I;  1Y4S A;  4DV5 I;  4IFD D;  4KQV A;  4LPF A;  2AE8 A;  1XNQ I;  1VI7 A;  4DXL A;  5LMU I;  5LL6 R;  4DPX A;  3PYF A;  2WNR A;  4DPU A;  4ZVI A;  5LMN E;  4LF5 E;  4LF6 I;  4P7A A;  3T1Y I;  4QNJ A;  3HJC A;  5EL9 A;  2ZM6 E;  4BA2 B;  1Z0G A;  4URL A;  2NN6 F;  1XMO E;  4LF4 I;  4IZJ A;  2HFS A;  1Z0T A;  4DR3 E;  3M7N D;  1HNW E;  1FJG E;  4IFD F;  4DPY A;  2UXD E;  4USK A;  4WUD A;  2BR2 A;  1BKN A;  2X36 A;  4LF7 I;  1N33 E;  5A2Q C;  2C38 B;  4PRX A;  3K17 A;  4DV5 E;  3PS1 A;  4JYA E;  2EFG A;  4FW3 A;  4FWG A;  4WUC A;  4X65 I;  1XNQ E;  1WUU A;  5C0X B;  4DR7 I;  1OJ4 A;  2UU9 I;  3P06 A;  1KKH A;  4UT4 A;  4LF6 E;  1RR9 A;  4JI7 I;  5GMD A;  4JI4 E;  1N34 I;  3PS2 A;  4DUZ I; 
#chains in the Genus database with same CATH homology
 4X62 I;  3B82 A;  1USV A;  2UXC I;  2V2Z A;  4B3M I;  4LF4 E;  4B3R E;  4GKK E;  1XMQ E;  4PU9 A;  4Z7Y A;  4LF8 I;  4UTG A;  4DR4 I;  1IBK I;  4JI5 I;  4EMD A;  4YY3 I;  4LF7 E;  4DR2 I;  2A2D A;  3Q1Q A;  4DV2 I;  4X65 E;  1B62 A;  1PVG A;  1H7U A;  1H7S A;  5IT9 Q;  2J7K A;  4X64 I;  4FWD A;  1N34 E;  4DUZ E;  4X62 E;  1XNR I;  2F4V I;  4OX9 I;  1HR0 I;  4JI6 I;  4B3M E;  5FWK A;  4LFA I;  1PKP A;  3M6A A;  4B3S E;  2CG9 A;  4LF8 E;  3HUL A;  4DU7 A;  5BR8 I;  4JI5 E;  2E1R A;  1VIS A;  3K1J A;  4YY3 E;  4DV0 E;  4NXM E;  2Q2E B;  4DV2 E;  2CGE A;  3ZZ0 A;  4DPT A;  3QT5 A;  1EA6 A;  1KVK A;  3ZKB A;  2O1U A;  2HFU A;  1FI4 A;  4K0K E;  1Z0C A;  2ZIT A;  1ZM3 A;  4DV7 I;  4MYU A;  3J7A M;  1XNR E;  2F4V E;  4B3T I;  4OX9 E;  2O1T A;  1N32 I;  4JI6 E;  1Z5A A;  3H4L A;  4LFA E;  4LFC E;  4HY1 A;  3ZZT A;  3ZM7 A;  1IBM I;  1FWK A;  3QT7 A;  1ZM9 A;  4WUB A;  2WW4 A;  2VQF I;  4Z7C A;  4LFB I;  1MG7 A;  3OTO I;  4DV6 I;  2E5L I;  4HXZ A;  1N36 I;  3D4J A;  1EI1 A;  1Y6Z A;  4JI8 E;  4DUY I;  4DV7 E;  3K85 A;  4XTJ A;  2UUC I;  1Z0W A;  2Z5B A;  5LMU E;  1Z0V A;  2HHH I;  4ED4 A;  2NPF A;  2DEI A;  2UXB I;  4JI1 I;  3T1Y E;  4IZK B;  2HKJ A;  2VQF E;  4HAC B;  2VQE I;  1MX0 A;  5IT9 C;  3QT6 A;  3OTO E;  2Z5C A;  1UEK A;  3V2U C;  3PYG A;  4JG4 A;  1IBL I;  4JV5 I;  4DR6 I;  4JI3 I;  3JAM Q;  3PRY A;  2O1W A;  4DR7 E;  2UU9 E;  1D6T A;  1PIE A;  3LTO A;  2PNM A;  1I94 I;  4JI1 E;  4JI7 E;  5FLX Q;  3QT8 A;  4NXN I;  1Z5B A;  5IWA I;  3B8H A;  1Y4U A;  2UXC E;  1ZXM A;  1QZR A;  1IBL E;  3ZZU A;  1KIJ A;  4DR6 E;  4DR4 E;  4JI3 E;  1IBK E;  4LF9 I;  2V2Q A;  2R3V A;  4DR2 E;  2Z5E A;  4HYM A;  2HKE A;  4X66 I;  4JI2 I;  4IZJ B;  1K47 A;  2GS8 A;  1I94 E;  2BV3 A;  1HNX I;  1HNZ I;  4X64 E;  2CZ9 A;  5LMN I;  4LF5 I;  5IWA E;  1HR0 E;  2V2V A;  2PNL A;  1Z0B A;  4R1F A;  3Q6N A;  4PRV A;  2BM1 A;  2GQ0 A;  2BM0 A;  1NHH A;  4DR3 I;  3CWV A;  4M1K A;  4LF9 E;  5BR8 E;  2V8P A;  4DR1 I;  1U2R A;  4USM A;  2IOQ A;  2HK3 A;  4X66 E;  4JI2 E;  2O1V A;  3Q6M A;  3J7A G;  2AJ4 A;  4JYA I;  1HNX E;  1Z5C A;  1HNZ E;  4FW9 A;  1NHJ A;  3LPS A;  1J5E I;  4AQY I;  4B3T E;  4JI0 I;  4JI4 I;  2OI2 A;  2HK2 A;  4DU8 A;  3F0N A;  4DV4 I;  1N32 E;  3J80 Q;  5L3J A;  1MU5 A;  1IBM E;  4B3R I;  2VF3 A;  4P52 A;  4GKK I;  3PYD A;  3JAM C;  4GKJ I;  1XMQ I;  1HK7 A;  4DR1 E;  4LFB E;  3PYE A;  3B78 A;  1FWL A;  4DV6 E;  2E5L E;  5FLX C;  4YHH I;  3WU6 A;  1N36 E;  1RRE A;  4DUY E;  1ELO A;  1J5E E;  1N0V C;  1XHK A;  4AQY E;  4KHP I;  4JI0 E;  2UUC E;  5GME A;  1H74 A;  4DV4 E;  3LNU A;  2HHH E;  2UUB I;  3WU5 A;  1H73 A;  3WU4 A;  2UXB E;  4GKJ E;  4B3S I;  5A2Q Q;  2LJP A;  3T1H I;  4MYT A;  4DV1 I;  1ZXN A;  2VQE E;  4DR5 I;  2ZBK B;  2R42 A;  1S4E A;  4DV0 I;  4NXM I;  4YHH E;  4FWH A;  4I3H A;  3J81 Q;  1FNM A;  4JV5 E;  1NZ0 A;  1A6F A;  4DV3 I;  2DEJ A;  2UUA I;  4K0K I;  4KHP E;  4IZK A;  4N3O A;  2IOP A;  4HAC A;  3V5R A;  1ZM4 A;  1DAR A;  2UUB E;  1Z59 A;  4DPW A;  1N0U A;  4LFC I;  3T1H E;  1H72 C;  4DV1 E;  4NXN E;  1NHI A;  4DR5 E;  1FKA E;  2XEX A;  3WU3 A;  2ZM6 I;  4FN5 A;  4RPF A;  1S16 A;  1B63 A;  2A2C A;  2Z5B B;  1ZM2 A;  4IZJ D;  1Z0E A;  1XMO I;  1HNW I;  3J80 C;  1FJG I;  4DV3 E;  2UUA E;  4JI8 I;  2UXD I;  2X7I A;  1KTV A;  1USU A;  2V34 A;  3ZKD A;  3GON A;  2Z5C B;  1N33 I;  1Y4S A;  4DV5 I;  4KQV A;  1XNQ I;  4DXL A;  5LMU I;  5LL6 R;  4DPX A;  3PYF A;  4DPU A;  4ZVI A;  5LMN E;  4LF5 E;  4LF6 I;  4P7A A;  3T1Y I;  3HJC A;  2ZM6 E;  1Z0G A;  4URL A;  1XMO E;  4LF4 I;  4IZJ A;  2HFS A;  1Z0T A;  4DR3 E;  1HNW E;  1FJG E;  4DPY A;  2UXD E;  4USK A;  4WUD A;  1BKN A;  2X36 A;  4LF7 I;  1N33 E;  5A2Q C;  4PRX A;  3K17 A;  4DV5 E;  4JYA E;  2EFG A;  4FWG A;  4WUC A;  1XNQ E;  4X65 I;  1WUU A;  4DR7 I;  1OJ4 A;  2UU9 I;  3P06 A;  1KKH A;  4UT4 A;  4LF6 E;  1RR9 A;  4JI7 I;  5GMD A;  4JI4 E;  1N34 I;  3J81 C;  4DUZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...