1Z0CA

Crystal structure of a. fulgidus lon proteolytic domain d508a mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
203
structure length
200
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGASASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 57
structure length 200
sequence length 203
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0cA00
3ZZUA 4JI2E 1FWKA 4JI7I 4JI4I 1RR9A 4B3MI 4DV0I 4LF6E 1FJGI 1VISA 2V2ZA 1WUUA 3T1HI 2EFGA 5LMNE 1IBME 1H7UA 4WUCA 4DR6I 4DR4I 1HNZI 4DPTA 5FLXQ 2HK2A 4LFCE 1ZXMA 4KHPI 4R1FA 1EA6A 2V34A 4DV7I 2VF3A 4DR2E 3LTOA 4X64I 4DV3E 4DR5I 1OJ4A 4DV6I 1U2RA 1S4EA 5GMEA 1KVKA 5L3JA 5FLXC 1HNWE 2UU9E 1PVGA 2BM1A 4JI3I 1XHKA 4LF7E 4K0KE 1Z5AA 3V2UC 1Z0BA 4NXMI 4USKA 4DUYI 4DV1I 2E5LE 4DR3I 2X36A 3GONA 3J81Q 3B78A 4LF9E 1H7SA 4JI6I 3WU3A 4RPFA 1IBLE 3T1YI 1HR0E 4B3SE 2UXBI 4GKKE 1K47A 4ZVIA 1QZRA 4DUZI 1H72C 1N0UA 2BV3A 3QT8A 5LL6R 1ZM9A 1DARA 2CZ9A 2OI2A 4JI1I 4HACA 3JAMQ 3J81C 3PYEA 4GKJI 4WUBA 3OTOE 4X66I 4DR7E 2GS8A 3WU4A 4DR1I 4JI5I 1KKHA 4UT4A 2HK3A 4DPXA 4DV5I 2F4VE 4B3RI 3JAMC 4JI2I 3ZKBA 4DV2E 2VQEE 4JI8E 1Z0TA 4DPYA 2HHHI 4DV4E 4LF6I 1ZXNA 4MYUA 1D6TA 1FI4A 5GMDA 1B63A 4DXLA 1PKPA 1IBMI 3WU6A 4LFCI 4LF4E 3PYDA 2V2VA 2HFUA 1H74A 3J7AM 1XNQE 1MU5A 4HACB 2UUCE 4OX9E 2V2QA 4LF8E 4P52A 4ED4A 4I3HA 4P7AA 4DR2I 4LF5E 1XNRE 4DV3I 3LNUA 1HNXE 5IWAE 4FWGA 4JV5E 4FWDA 1UEKA 1HNWI 2UU9I 4LF7I 4HYMA 4K0KI 1B62A 4DPUA 2A2CA 1XMOE 1PIEA 2UUAE 4UTGA 2ZBKB 2E5LI 1N33E 4PRXA 2ZM6E 2VQFE 4X62E 2A2DA 2DEIA 4LF9I 4X65E 1IBLI 4LFAE 1HR0I 4B3SI 1KIJA 2E1RA 4GKKI 2HKJA 2V8PA 3ZM7A 1ZM3A 4M1KA 4DU8A 5BR8E 2X7IA 4YY3E 1H73A 1ZM2A 1NHHA 1N34E 4NXME 2BM0A 3WU5A 1FKAE 1RREA 3B8HA 1Z0EA 3OTOI 2UXCE 1IBKE 1BKNA 3PYFA 1XMQE 4DR7I 4KQVA 1N32E 4XTJA 1FWLA 1Z0WA 1J5EE 4AQYE 3J80Q 2F4VI 4HXZA 4B3TE 5IT9Q 4DV2I 1Z0GA 2UUBE 2VQEI 3ZKDA 4JI8I 4DV4I 4JYAE 3K1JA 4FW9A 4USMA 4YHHE 4FWHA 3M6AA 4LF4I 3J80C 4HY1A 5LMNI 4NXNE 1XNQI 1Z5BA 2UUCI 4OX9I 5IT9C 4LF8I 1A6FA 4JI0E 2UXDE 1N36E 1ZM4A 3H4LA 1Z5CA 4LF5I 2LJPA 1XNRI 1I94E 1NZ0A 1HNXI 5IWAI 3HULA 4JV5I 2WW4A 4LFBE 5LMUE 2HHHE 1EI1A 4PRVA 5A2QQ 4JI7E 3ZZ0A 1NHIA 4JI4E 4B3ME 4DV0E 3ZZTA 1FJGE 1XMOI 2UUAI 4MYTA 2J7KA 3T1HE 3J7AG 1N33I 1FNMA 4JG4A 2ZM6I 2VQFI 4X62I 4DR4E 4DR6E 4DPWA 1HNZE 4WUDA 2R42A 4X65I 4KHPE 2HKEA 4LFAI 2HFSA 5A2QC 2DEJA 4DV7E 2NPFA 4X64E 1Z0CA 5BR8I 4YY3I 4DR5E 3QT7A 4DV6E 2Q2EB 1N34I 4JI3E 3LPSA 2UXCI 1IBKI 1XMQI 4Z7CA 3V5RA 4DUYE 3Q1QA 1N32I 4DV1E 4DR3E 1MX0A 3K17A 4AQYI 1J5EI 3F0NA 4URLA 4JI6E 1MG7A 3T1YE 2UXBE 4B3TI 3B82A 1NHJA 2UUBI 1Z0VA 3CWVA 1N0VC 4DUZE 3QT5A 1S16A 4JYAI 4JI1E 4YHHI 2ZITA 4DU7A 4FN5A 2AJ4A 4NXNI 4GKJE 1ELOA 3QT6A 4X66E 4JI0I 3D4JA 1KTVA 4DR1E 2XEXA 2UXDI 4JI5E 2R3VA 1N36I 4EMDA 1I94I 4Z7YA 4PU9A 1Z59A 4DV5E 4B3RE 4LFBI 5LMUI 3PYGA
chains in the Genus database with same CATH superfamily
3ZZUA 4JI2E 1FWKA 4JI7I 4JI4I 1RR9A 4B3MI 4DV0I 3GLLA 2Z5EA 4OO1E 1UDQA 4LF6E 2O3ZA 1FJGI 1VISA 2V2ZA 1WUUA 3T1HI 4GQUA 2EFGA 5LMNE 1IBME 1H7UA 4WUCA 4DR6I 4DR4I 4OO1F 1YH8A 1HNZI 4DPTA 5FLXQ 2HK2A 4LFCE 1XXEA 1ZXMA 4KHPI 2O1UA 4R1FA 1EA6A 2V34A 4U3DA 4AIMA 4DV7I 2Z5CB 4OKGA 2VF3A 4DR2E 2JEAA 2WNRB 3LTOA 4X64I 2NN6E 5EKWA 4DV3E 4DR5I 1OJ4A 4DV6I 1U2RA 2O1VA 5K36A 1S4EA 5GMEA 4IFDE 1KVKA 5L3JA 4IZKB 5FLXC 2UU9E 1PVGA 2BA1G 2BM1A 4JI3I 1HNWE 1XHKA 2NN6F 2PNLA 4FW3A 4LF7E 4K0KE 1Z5AA 3V2UC 1Z0BA 4IFDF 4NXMI 1UDOA 4USKA 4DUYI 4DV1I 2E5LE 4DR3I 2J65A 2X36A 3GONA 3J81Q 2GO4A 3B78A 3P3EA 5DNXA 4LF9E 1H7SA 4JI6I 3WU3A 4RPFA 1IBLE 3T1YI 1HR0E 5K36D 4B3SE 2UXBI 4GKKE 1K47A 2IERA 4ZVIA 1QZRA 4DUZI 1H72C 1N0UA 1R6MA 2BV3A 3QT8A 4QNKA 5LL6R 1ZM9A 1DARA 2CZ9A 2OI2A 4JI1I 4HACA 4MU1A 1E3PA 4IZJA 3JAMQ 3J81C 2JEAB 5JEAC 3HKMA 3PYEA 2GO3A 4GKJI 4WUBA 3OTOE 4X66I 5K36B 3B4TA 2PO1A 4DR7E 4NBQA 2GS8A 3WU4A 4DR1I 4JI5I 1KKHA 5DRRA 4UT4A 2HK3A 4DPXA 4DV5I 5C0XA 2F4VE 4B3RI 3JAMC 2IOPA 2PO0B 4OZEA 3M7ND 4JI2I 3ZKBA 4DV2E 2VQEE 4JI8E 1Z0TA 1R6LA 2PNMA 2Z5BA 3Q6MA 4DPYA 2HHHI 4DV4E 4LF6I 3DD6A 3M7NG 1ZXNA 4MYUA 1D6TA 3P06A 1FI4A 5GMDA 1B63A 4DXLA 1PKPA 3CDJA 1IBMI 1UDSA 4FW4A 3WU6A 1UDNA 4ISAA 4LFCI 3U1YA 4MDTA 4LF4E 3PYDA 2V2VA 1OYSA 2HFUA 4BA1A 1Y60A 5C0XD 1H74A 3J7AM 1XNQE 1MU5A 4FW7A 4HACB 2UUCE 4OX9E 2V2QA 4MU0A 4LF8E 4P52A 4BA2B 4ED4A 4I3HA 4P7AA 4DR2I 4LF5E 1XNRE 5FWKA 4FW6A 4DV3I 3LNUA 4OO1A 1HNXE 5IWAE 3PS1A 4FWGA 4JV5E 4FWDA 2JE6B 1UEKA 2BA1D 1HNWI 2UU9I 4LF7I 4HYMA 4K0KI 1B62A 2AE8A 4DPUA 2C37A 2VESA 3L7ZB 2CVEA 3Q6NA 2A2CA 1XMOE 1PIEA 2UUAE 4UTGA 5JEAE 2ZBKB 2E5LI 1N33E 2Z5BB 4PRXA 2ZM6E 2VQFE 4X62E 2A2DA 2BA0D 2DEIA 4LF9I 4OO1D 4X65E 1IBLI 1Y4UA 5JEAF 4LFAE 2BR2A 1HR0I 2NN6A 4B3SI 1KIJA 3NZKA 2E1RA 4GKKI 3GMEA 2HKJA 2BA0G 2CG9A 2JEBA 4IFDA 2V8PA 3ZM7A 1ZM3A 4M1KA 3P76A 4MU3A 2IOQA 4DU8A 5BR8E 2X7IA 4YY3E 3M85G 1H73A 4LCHA 1ZM2A 2WP8A 4J3DA 5K36C 1NHHA 1N34E 2PNZA 4LCGA 4NXME 2BM0A 5EL9A 3WU5A 4OO1B 1FKAE 1RREA 2PO2A 3B8HA 1Z0EA 3OTOI 2UXCE 1IBKE 1BKNA 3PYFA 1XMQE 4DR7I 1YHCA 4KQVA 1N32E 2C38A 2GQ0A 4XTJA 1FWLA 2C37B 1Z0WA 1J5EE 4AQYE 3J80Q 4LOMA 2F4VI 4HXZA 4B3TE 5IT9Q 4DV2I 1Z0GA 2UUBE 2VQEI 3ZKDA 4JI8I 1OYRA 4IS9A 2BR2B 4IZJD 4DV4I 1Y5YA 3KRNA 3CDIA 4JYAE 3P3GA 2Z5CA 3K1JA 4FW9A 4USMA 4YHHE 4FWHA 2WNRA 3M6AA 4LF4I 3J80C 4HY1A 5LMNI 4NXNE 1XNQI 1Z5BA 2UUCI 4OX9I 4LPFA 2JT2A 4AM3A 4IZKA 5IT9C 4LF8I 1A6FA 4JI0E 2UXDE 4U3BA 1N36E 1ZM4A 3P3CA 2C39A 3H4LA 4IZJB 1Z5CA 2O1WA 4LF5I 2LJPA 1XNRI 3U1KA 1I94E 1NZ0A 1RHYA 1OYPA 1HNXI 5IWAI 3HULA 2C38B 4MQYA 2WW4A 4JV5I 4LFBE 5C0XC 5LMUE 2HHHE 2PO1B 1EI1A 4PRVA 5A2QQ 1Y4SA 2IESA 4JI7E 3ZZ0A 1NHIA 4JI4E 1USUA 4B3ME 4DV0E 3ZZTA 4N3OA 1FJGE 5K36E 1XMOI 2UUAI 4MYTA 2J7KA 5DRPA 3T1HE 3J7AG 5C0XB 1N33I 1FNMA 4JG4A 2ZM6I 2VQFI 4X62I 4DR4E 4DR6E 4DPWA 4WUDA 1HNZE 2R42A 5K36F 3HJCA 4X65I 4KHPE 2HKEA 4LFAI 4FW5A 2HFSA 5A2QC 1P42A 2F1DA 2DEJA 4DV7E 2NPFA 3PS3A 5ELWA 4X64E 1Z0CA 3M85D 5BR8I 4YY3I 4BA1B 4DR5E 4OO1C 3QT7A 4DV6E 2C39B 5JEAA 2Q2EB 1N34I 3PS2A 1VI7A 4JI3E 3LPSA 2UXCI 1IBKI 2PO0A 1XMQI 4Z7CA 3V5RA 4DUYE 1USVA 2NN6D 3Q1QA 4QNJA 1N32I 4DV1E 4DR3E 1MX0A 3K17A 4AQYI 1E3HA 1J5EI 3F0NA 5DROA 4URLA 4IFDD 4JI6E 1MG7A 3T1YE 5JEAD 2NN6C 2UXBE 4B3TI 3B82A 1NHJA 2UUBI 1Z0VA 3CWVA 1N0VC 4DUZE 4IFDC 3QT5A 1S16A 1HK7A 5C0XE 4JYAI 3PRYA 4BA2A 2NN6B 2O1TA 4JI1E 4YHHI 2ZITA 4MU4A 1Y6ZA 2JEBB 4DU7A 5C0XF 3H1CA 3GCMA 4FN5A 4IFDB 3UHMA 2AJ4A 4NXNI 4GKJE 1ELOA 3K85A 3QT6A 4X66E 2JE6A 5JEAB 4LCFA 4JI0I 3D4JA 1KTVA 4DR1E 2XEXA 2UXDI 4JI5E 2R3VA 1N36I 4AIDA 4EMDA 2WP8B 2PNZB 3L7ZA 2CGEA 4Z7YA 1I94I 4PU9A 1Z59A 2PO2B 4DV5E 5DNLA 4B3RE 5DRQA 4LFBI 5LMUI 3PYGA
chains in the Genus database with same CATH topology
3ZZUA 4JI2E 1FWKA 4JI7I 4JI4I 1RR9A 4B3MI 4DV0I 2Z5EA 4LF6E 1FJGI 1VISA 2V2ZA 1WUUA 3T1HI 2EFGA 5LMNE 1IBME 1H7UA 4WUCA 4DR6I 4DR4I 1HNZI 4DPTA 5FLXQ 2HK2A 4LFCE 1ZXMA 4KHPI 2O1UA 4R1FA 1EA6A 2V34A 4DV7I 2Z5CB 2VF3A 4DR2E 3LTOA 4X64I 4DV3E 4DR5I 1OJ4A 4DV6I 1U2RA 2O1VA 1S4EA 5GMEA 1KVKA 5L3JA 4IZKB 5FLXC 2UU9E 1PVGA 2BM1A 4JI3I 1HNWE 1XHKA 2PNLA 4LF7E 4K0KE 1Z5AA 3V2UC 1Z0BA 4NXMI 4USKA 4DUYI 4DV1I 2E5LE 4DR3I 2X36A 3GONA 3J81Q 3B78A 4LF9E 1H7SA 4JI6I 3WU3A 4RPFA 1IBLE 3T1YI 1HR0E 4B3SE 2UXBI 4GKKE 1K47A 4ZVIA 1QZRA 4DUZI 1H72C 1N0UA 2BV3A 3QT8A 5LL6R 1ZM9A 1DARA 2CZ9A 2OI2A 4JI1I 4HACA 3JAMQ 4IZJA 3J81C 3PYEA 4GKJI 4WUBA 3OTOE 4X66I 4DR7E 2GS8A 3WU4A 4DR1I 4JI5I 1KKHA 4UT4A 2HK3A 4DPXA 4DV5I 2F4VE 4B3RI 3JAMC 2IOPA 4JI2I 3ZKBA 4DV2E 2VQEE 4JI8E 1Z0TA 3Q6MA 2PNMA 2Z5BA 4DPYA 2HHHI 4DV4E 4LF6I 1ZXNA 4MYUA 1D6TA 3P06A 1FI4A 5GMDA 1B63A 4DXLA 1PKPA 1IBMI 3WU6A 4LFCI 4LF4E 3PYDA 2V2VA 2HFUA 1H74A 3J7AM 1XNQE 1MU5A 4HACB 2UUCE 4OX9E 2V2QA 4LF8E 4P52A 4ED4A 4I3HA 4P7AA 4DR2I 4LF5E 1XNRE 5FWKA 4DV3I 3LNUA 1HNXE 5IWAE 4FWGA 4JV5E 4FWDA 1UEKA 1HNWI 2UU9I 4LF7I 4HYMA 4K0KI 1B62A 4DPUA 3Q6NA 2A2CA 1XMOE 1PIEA 2UUAE 4UTGA 2ZBKB 2E5LI 1N33E 2Z5BB 4PRXA 2ZM6E 2VQFE 4X62E 2A2DA 2DEIA 4LF9I 4X65E 1IBLI 1Y4UA 4LFAE 1HR0I 4B3SI 1KIJA 2E1RA 4GKKI 2HKJA 2CG9A 2V8PA 3ZM7A 1ZM3A 4M1KA 2IOQA 4DU8A 5BR8E 2X7IA 4YY3E 1H73A 1ZM2A 1NHHA 1N34E 4NXME 2BM0A 3WU5A 1FKAE 1RREA 3B8HA 1Z0EA 3OTOI 2UXCE 1IBKE 1BKNA 3PYFA 1XMQE 4DR7I 4KQVA 1N32E 2GQ0A 4XTJA 1FWLA 1Z0WA 1J5EE 4AQYE 3J80Q 2F4VI 4HXZA 4B3TE 5IT9Q 4DV2I 1Z0GA 2UUBE 2VQEI 3ZKDA 4JI8I 4IZJD 4DV4I 4JYAE 2Z5CA 3K1JA 4FW9A 4USMA 4YHHE 4FWHA 3M6AA 4LF4I 3J80C 4HY1A 5LMNI 4NXNE 1XNQI 1Z5BA 2UUCI 4OX9I 4IZKA 5IT9C 4LF8I 1A6FA 4JI0E 2UXDE 1N36E 1ZM4A 3H4LA 4IZJB 1Z5CA 2O1WA 4LF5I 2LJPA 1XNRI 1I94E 1NZ0A 1HNXI 5IWAI 3HULA 4JV5I 2WW4A 4LFBE 5LMUE 2HHHE 1EI1A 4PRVA 5A2QQ 1Y4SA 4JI7E 3ZZ0A 1NHIA 4JI4E 1USUA 4B3ME 4DV0E 3ZZTA 4N3OA 1FJGE 1XMOI 2UUAI 4MYTA 2J7KA 3T1HE 3J7AG 1N33I 1FNMA 4JG4A 2ZM6I 2VQFI 4X62I 4DR4E 4DR6E 4DPWA 4WUDA 1HNZE 2R42A 3HJCA 4X65I 4KHPE 2HKEA 4LFAI 2HFSA 5A2QC 2DEJA 4DV7E 2NPFA 4X64E 1Z0CA 5BR8I 4YY3I 4DR5E 3QT7A 4DV6E 2Q2EB 1N34I 4JI3E 3LPSA 2UXCI 1IBKI 1XMQI 4Z7CA 3V5RA 4DUYE 1USVA 3Q1QA 1N32I 4DV1E 4DR3E 1MX0A 3K17A 4AQYI 1J5EI 3F0NA 4URLA 4JI6E 1MG7A 3T1YE 2UXBE 4B3TI 3B82A 1NHJA 2UUBI 1Z0VA 3CWVA 1N0VC 4DUZE 3QT5A 1S16A 1HK7A 4JYAI 3PRYA 2O1TA 4JI1E 4YHHI 2ZITA 1Y6ZA 4DU7A 4FN5A 2AJ4A 4NXNI 4GKJE 1ELOA 3K85A 3QT6A 4X66E 4JI0I 3D4JA 1KTVA 4DR1E 2XEXA 2UXDI 4JI5E 2R3VA 1N36I 4EMDA 2CGEA 4Z7YA 1I94I 4PU9A 1Z59A 4DV5E 4B3RE 4LFBI 5LMUI 3PYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZU A;  4JI2 E;  1FWK A;  4JI7 I;  4JI4 I;  1RR9 A;  4B3M I;  4DV0 I;  4LF6 E;  1FJG I;  1VIS A;  2V2Z A;  1WUU A;  3T1H I;  2EFG A;  5LMN E;  1IBM E;  1H7U A;  4WUC A;  4DR6 I;  4DR4 I;  1HNZ I;  4DPT A;  5FLX Q;  2HK2 A;  4LFC E;  1ZXM A;  4KHP I;  4R1F A;  1EA6 A;  2V34 A;  4DV7 I;  2VF3 A;  4DR2 E;  3LTO A;  4X64 I;  4DV3 E;  4DR5 I;  1OJ4 A;  4DV6 I;  1U2R A;  1S4E A;  5GME A;  1KVK A;  5L3J A;  5FLX C;  1HNW E;  2UU9 E;  1PVG A;  2BM1 A;  4JI3 I;  1XHK A;  4LF7 E;  4K0K E;  1Z5A A;  3V2U C;  1Z0B A;  4NXM I;  4USK A;  4DUY I;  4DV1 I;  2E5L E;  4DR3 I;  2X36 A;  3GON A;  3J81 Q;  3B78 A;  4LF9 E;  1H7S A;  4JI6 I;  3WU3 A;  4RPF A;  1IBL E;  3T1Y I;  1HR0 E;  4B3S E;  2UXB I;  4GKK E;  1K47 A;  4ZVI A;  1QZR A;  4DUZ I;  1H72 C;  1N0U A;  2BV3 A;  3QT8 A;  5LL6 R;  1ZM9 A;  1DAR A;  2CZ9 A;  2OI2 A;  4JI1 I;  4HAC A;  3JAM Q;  3J81 C;  3PYE A;  4GKJ I;  4WUB A;  3OTO E;  4X66 I;  4DR7 E;  2GS8 A;  3WU4 A;  4DR1 I;  4JI5 I;  1KKH A;  4UT4 A;  2HK3 A;  4DPX A;  4DV5 I;  2F4V E;  4B3R I;  3JAM C;  4JI2 I;  3ZKB A;  4DV2 E;  2VQE E;  4JI8 E;  1Z0T A;  4DPY A;  2HHH I;  4DV4 E;  4LF6 I;  1ZXN A;  4MYU A;  1D6T A;  1FI4 A;  5GMD A;  1B63 A;  4DXL A;  1PKP A;  1IBM I;  3WU6 A;  4LFC I;  4LF4 E;  3PYD A;  2V2V A;  2HFU A;  1H74 A;  3J7A M;  1XNQ E;  1MU5 A;  4HAC B;  2UUC E;  4OX9 E;  2V2Q A;  4LF8 E;  4P52 A;  4ED4 A;  4I3H A;  4P7A A;  4DR2 I;  4LF5 E;  1XNR E;  4DV3 I;  3LNU A;  1HNX E;  5IWA E;  4FWG A;  4JV5 E;  4FWD A;  1UEK A;  1HNW I;  2UU9 I;  4LF7 I;  4HYM A;  4K0K I;  1B62 A;  4DPU A;  2A2C A;  1XMO E;  1PIE A;  2UUA E;  4UTG A;  2ZBK B;  2E5L I;  1N33 E;  4PRX A;  2ZM6 E;  2VQF E;  4X62 E;  2A2D A;  2DEI A;  4LF9 I;  4X65 E;  1IBL I;  4LFA E;  1HR0 I;  4B3S I;  1KIJ A;  2E1R A;  4GKK I;  2HKJ A;  2V8P A;  3ZM7 A;  1ZM3 A;  4M1K A;  4DU8 A;  5BR8 E;  2X7I A;  4YY3 E;  1H73 A;  1ZM2 A;  1NHH A;  1N34 E;  4NXM E;  2BM0 A;  3WU5 A;  1FKA E;  1RRE A;  3B8H A;  1Z0E A;  3OTO I;  2UXC E;  1IBK E;  1BKN A;  3PYF A;  1XMQ E;  4DR7 I;  4KQV A;  1N32 E;  4XTJ A;  1FWL A;  1Z0W A;  1J5E E;  4AQY E;  3J80 Q;  2F4V I;  4HXZ A;  4B3T E;  5IT9 Q;  4DV2 I;  1Z0G A;  2UUB E;  2VQE I;  3ZKD A;  4JI8 I;  4DV4 I;  4JYA E;  3K1J A;  4FW9 A;  4USM A;  4YHH E;  4FWH A;  3M6A A;  4LF4 I;  3J80 C;  4HY1 A;  5LMN I;  4NXN E;  1XNQ I;  1Z5B A;  2UUC I;  4OX9 I;  5IT9 C;  4LF8 I;  1A6F A;  4JI0 E;  2UXD E;  1N36 E;  1ZM4 A;  3H4L A;  1Z5C A;  4LF5 I;  2LJP A;  1XNR I;  1I94 E;  1NZ0 A;  1HNX I;  5IWA I;  3HUL A;  4JV5 I;  2WW4 A;  4LFB E;  5LMU E;  2HHH E;  1EI1 A;  4PRV A;  5A2Q Q;  4JI7 E;  3ZZ0 A;  1NHI A;  4JI4 E;  4B3M E;  4DV0 E;  3ZZT A;  1FJG E;  1XMO I;  2UUA I;  4MYT A;  2J7K A;  3T1H E;  3J7A G;  1N33 I;  1FNM A;  4JG4 A;  2ZM6 I;  2VQF I;  4X62 I;  4DR4 E;  4DR6 E;  4DPW A;  1HNZ E;  4WUD A;  2R42 A;  4X65 I;  4KHP E;  2HKE A;  4LFA I;  2HFS A;  5A2Q C;  2DEJ A;  4DV7 E;  2NPF A;  4X64 E;  1Z0C A;  5BR8 I;  4YY3 I;  4DR5 E;  3QT7 A;  4DV6 E;  2Q2E B;  1N34 I;  4JI3 E;  3LPS A;  2UXC I;  1IBK I;  1XMQ I;  4Z7C A;  3V5R A;  4DUY E;  3Q1Q A;  1N32 I;  4DV1 E;  4DR3 E;  1MX0 A;  3K17 A;  4AQY I;  1J5E I;  3F0N A;  4URL A;  4JI6 E;  1MG7 A;  3T1Y E;  2UXB E;  4B3T I;  3B82 A;  1NHJ A;  2UUB I;  1Z0V A;  3CWV A;  1N0V C;  4DUZ E;  3QT5 A;  1S16 A;  4JYA I;  4JI1 E;  4YHH I;  2ZIT A;  4DU7 A;  4FN5 A;  2AJ4 A;  4NXN I;  4GKJ E;  1ELO A;  3QT6 A;  4X66 E;  4JI0 I;  3D4J A;  1KTV A;  4DR1 E;  2XEX A;  2UXD I;  4JI5 E;  2R3V A;  1N36 I;  4EMD A;  1I94 I;  4Z7Y A;  4PU9 A;  1Z59 A;  4DV5 E;  4B3R E;  4LFB I;  5LMU I;  3PYG A; 
#chains in the Genus database with same CATH topology
 3ZZU A;  4JI2 E;  1FWK A;  4JI7 I;  4JI4 I;  1RR9 A;  4B3M I;  4DV0 I;  3GLL A;  2Z5E A;  4OO1 E;  1UDQ A;  4LF6 E;  2O3Z A;  1FJG I;  1VIS A;  2V2Z A;  1WUU A;  3T1H I;  4GQU A;  2EFG A;  5LMN E;  1IBM E;  1H7U A;  4WUC A;  4DR6 I;  4DR4 I;  4OO1 F;  1YH8 A;  1HNZ I;  4DPT A;  5FLX Q;  2HK2 A;  4LFC E;  1XXE A;  1ZXM A;  4KHP I;  2O1U A;  4R1F A;  1EA6 A;  2V34 A;  4U3D A;  4AIM A;  4DV7 I;  2Z5C B;  4OKG A;  2VF3 A;  4DR2 E;  2JEA A;  2WNR B;  3LTO A;  4X64 I;  2NN6 E;  5EKW A;  4DV3 E;  4DR5 I;  1OJ4 A;  4DV6 I;  1U2R A;  2O1V A;  5K36 A;  1S4E A;  5GME A;  4IFD E;  1KVK A;  5L3J A;  4IZK B;  5FLX C;  2UU9 E;  1PVG A;  2BA1 G;  2BM1 A;  4JI3 I;  1HNW E;  1XHK A;  2NN6 F;  2PNL A;  4FW3 A;  4LF7 E;  4K0K E;  1Z5A A;  3V2U C;  1Z0B A;  4IFD F;  4NXM I;  1UDO A;  4USK A;  4DUY I;  4DV1 I;  2E5L E;  4DR3 I;  2J65 A;  2X36 A;  3GON A;  3J81 Q;  2GO4 A;  3B78 A;  3P3E A;  5DNX A;  4LF9 E;  1H7S A;  4JI6 I;  3WU3 A;  4RPF A;  1IBL E;  3T1Y I;  1HR0 E;  5K36 D;  4B3S E;  2UXB I;  4GKK E;  1K47 A;  2IER A;  4ZVI A;  1QZR A;  4DUZ I;  1H72 C;  1N0U A;  1R6M A;  2BV3 A;  3QT8 A;  4QNK A;  5LL6 R;  1ZM9 A;  1DAR A;  2CZ9 A;  2OI2 A;  4JI1 I;  4HAC A;  4MU1 A;  1E3P A;  4IZJ A;  3JAM Q;  3J81 C;  2JEA B;  5JEA C;  3HKM A;  3PYE A;  2GO3 A;  4GKJ I;  4WUB A;  3OTO E;  4X66 I;  5K36 B;  3B4T A;  2PO1 A;  4DR7 E;  4NBQ A;  2GS8 A;  3WU4 A;  4DR1 I;  4JI5 I;  1KKH A;  5DRR A;  4UT4 A;  2HK3 A;  4DPX A;  4DV5 I;  5C0X A;  2F4V E;  4B3R I;  3JAM C;  2IOP A;  2PO0 B;  4OZE A;  3M7N D;  4JI2 I;  3ZKB A;  4DV2 E;  2VQE E;  4JI8 E;  1Z0T A;  1R6L A;  2PNM A;  2Z5B A;  3Q6M A;  4DPY A;  2HHH I;  4DV4 E;  4LF6 I;  3DD6 A;  3M7N G;  1ZXN A;  4MYU A;  1D6T A;  3P06 A;  1FI4 A;  5GMD A;  1B63 A;  4DXL A;  1PKP A;  3CDJ A;  1IBM I;  1UDS A;  4FW4 A;  3WU6 A;  1UDN A;  4ISA A;  4LFC I;  3U1Y A;  4MDT A;  4LF4 E;  3PYD A;  2V2V A;  1OYS A;  2HFU A;  4BA1 A;  1Y60 A;  5C0X D;  1H74 A;  3J7A M;  1XNQ E;  1MU5 A;  4FW7 A;  4HAC B;  2UUC E;  4OX9 E;  2V2Q A;  4MU0 A;  4LF8 E;  4P52 A;  4BA2 B;  4ED4 A;  4I3H A;  4P7A A;  4DR2 I;  4LF5 E;  1XNR E;  5FWK A;  4FW6 A;  4DV3 I;  3LNU A;  4OO1 A;  1HNX E;  5IWA E;  3PS1 A;  4FWG A;  4JV5 E;  4FWD A;  2JE6 B;  1UEK A;  2BA1 D;  1HNW I;  2UU9 I;  4LF7 I;  4HYM A;  4K0K I;  1B62 A;  2AE8 A;  4DPU A;  2C37 A;  2VES A;  3L7Z B;  2CVE A;  3Q6N A;  2A2C A;  1XMO E;  1PIE A;  2UUA E;  4UTG A;  5JEA E;  2ZBK B;  2E5L I;  1N33 E;  2Z5B B;  4PRX A;  2ZM6 E;  2VQF E;  4X62 E;  2A2D A;  2BA0 D;  2DEI A;  4LF9 I;  4OO1 D;  4X65 E;  1IBL I;  1Y4U A;  5JEA F;  4LFA E;  2BR2 A;  1HR0 I;  2NN6 A;  4B3S I;  1KIJ A;  3NZK A;  2E1R A;  4GKK I;  3GME A;  2HKJ A;  2BA0 G;  2CG9 A;  2JEB A;  4IFD A;  2V8P A;  3ZM7 A;  1ZM3 A;  4M1K A;  3P76 A;  4MU3 A;  2IOQ A;  4DU8 A;  5BR8 E;  2X7I A;  4YY3 E;  3M85 G;  1H73 A;  4LCH A;  1ZM2 A;  2WP8 A;  4J3D A;  5K36 C;  1NHH A;  1N34 E;  2PNZ A;  4LCG A;  4NXM E;  2BM0 A;  5EL9 A;  3WU5 A;  4OO1 B;  1FKA E;  1RRE A;  2PO2 A;  3B8H A;  1Z0E A;  3OTO I;  2UXC E;  1IBK E;  1BKN A;  3PYF A;  1XMQ E;  4DR7 I;  1YHC A;  4KQV A;  1N32 E;  2C38 A;  2GQ0 A;  4XTJ A;  1FWL A;  2C37 B;  1Z0W A;  1J5E E;  4AQY E;  3J80 Q;  4LOM A;  2F4V I;  4HXZ A;  4B3T E;  5IT9 Q;  4DV2 I;  1Z0G A;  2UUB E;  2VQE I;  3ZKD A;  4JI8 I;  1OYR A;  4IS9 A;  2BR2 B;  4IZJ D;  4DV4 I;  1Y5Y A;  3KRN A;  3CDI A;  4JYA E;  3P3G A;  2Z5C A;  3K1J A;  4FW9 A;  4USM A;  4YHH E;  4FWH A;  2WNR A;  3M6A A;  4LF4 I;  3J80 C;  4HY1 A;  5LMN I;  4NXN E;  1XNQ I;  1Z5B A;  2UUC I;  4OX9 I;  4LPF A;  2JT2 A;  4AM3 A;  4IZK A;  5IT9 C;  4LF8 I;  1A6F A;  4JI0 E;  2UXD E;  4U3B A;  1N36 E;  1ZM4 A;  3P3C A;  2C39 A;  3H4L A;  4IZJ B;  1Z5C A;  2O1W A;  4LF5 I;  2LJP A;  1XNR I;  3U1K A;  1I94 E;  1NZ0 A;  1RHY A;  1OYP A;  1HNX I;  5IWA I;  3HUL A;  2C38 B;  4MQY A;  2WW4 A;  4JV5 I;  4LFB E;  5C0X C;  5LMU E;  2HHH E;  2PO1 B;  1EI1 A;  4PRV A;  5A2Q Q;  1Y4S A;  2IES A;  4JI7 E;  3ZZ0 A;  1NHI A;  4JI4 E;  1USU A;  4B3M E;  4DV0 E;  3ZZT A;  4N3O A;  1FJG E;  5K36 E;  1XMO I;  2UUA I;  4MYT A;  2J7K A;  5DRP A;  3T1H E;  3J7A G;  5C0X B;  1N33 I;  1FNM A;  4JG4 A;  2ZM6 I;  2VQF I;  4X62 I;  4DR4 E;  4DR6 E;  4DPW A;  4WUD A;  1HNZ E;  2R42 A;  5K36 F;  3HJC A;  4X65 I;  4KHP E;  2HKE A;  4LFA I;  4FW5 A;  2HFS A;  5A2Q C;  1P42 A;  2F1D A;  2DEJ A;  4DV7 E;  2NPF A;  3PS3 A;  5ELW A;  4X64 E;  1Z0C A;  3M85 D;  5BR8 I;  4YY3 I;  4BA1 B;  4DR5 E;  4OO1 C;  3QT7 A;  4DV6 E;  2C39 B;  5JEA A;  2Q2E B;  1N34 I;  3PS2 A;  1VI7 A;  4JI3 E;  3LPS A;  2UXC I;  1IBK I;  2PO0 A;  1XMQ I;  4Z7C A;  3V5R A;  4DUY E;  1USV A;  2NN6 D;  3Q1Q A;  4QNJ A;  1N32 I;  4DV1 E;  4DR3 E;  1MX0 A;  3K17 A;  4AQY I;  1E3H A;  1J5E I;  3F0N A;  5DRO A;  4URL A;  4IFD D;  4JI6 E;  1MG7 A;  3T1Y E;  5JEA D;  2NN6 C;  2UXB E;  4B3T I;  3B82 A;  1NHJ A;  2UUB I;  1Z0V A;  3CWV A;  1N0V C;  4DUZ E;  4IFD C;  3QT5 A;  1S16 A;  1HK7 A;  5C0X E;  4JYA I;  3PRY A;  4BA2 A;  2NN6 B;  2O1T A;  4JI1 E;  4YHH I;  2ZIT A;  4MU4 A;  1Y6Z A;  2JEB B;  4DU7 A;  5C0X F;  3H1C A;  3GCM A;  4FN5 A;  4IFD B;  3UHM A;  2AJ4 A;  4NXN I;  4GKJ E;  1ELO A;  3K85 A;  3QT6 A;  4X66 E;  2JE6 A;  5JEA B;  4LCF A;  4JI0 I;  3D4J A;  1KTV A;  4DR1 E;  2XEX A;  2UXD I;  4JI5 E;  2R3V A;  1N36 I;  4AID A;  4EMD A;  2WP8 B;  2PNZ B;  3L7Z A;  2CGE A;  4Z7Y A;  1I94 I;  4PU9 A;  1Z59 A;  2PO2 B;  4DV5 E;  5DNL A;  4B3R E;  5DRQ A;  4LFB I;  5LMU I;  3PYG A; 
#chains in the Genus database with same CATH homology
 3ZZU A;  4JI2 E;  1FWK A;  4JI7 I;  4JI4 I;  1RR9 A;  4B3M I;  4DV0 I;  2Z5E A;  4LF6 E;  1FJG I;  1VIS A;  2V2Z A;  1WUU A;  3T1H I;  2EFG A;  5LMN E;  1IBM E;  1H7U A;  4WUC A;  4DR6 I;  4DR4 I;  1HNZ I;  4DPT A;  5FLX Q;  2HK2 A;  4LFC E;  1ZXM A;  4KHP I;  2O1U A;  4R1F A;  1EA6 A;  2V34 A;  4DV7 I;  2Z5C B;  2VF3 A;  4DR2 E;  3LTO A;  4X64 I;  4DV3 E;  4DR5 I;  1OJ4 A;  4DV6 I;  1U2R A;  2O1V A;  1S4E A;  5GME A;  1KVK A;  5L3J A;  4IZK B;  5FLX C;  2UU9 E;  1PVG A;  2BM1 A;  4JI3 I;  1HNW E;  1XHK A;  2PNL A;  4LF7 E;  4K0K E;  1Z5A A;  3V2U C;  1Z0B A;  4NXM I;  4USK A;  4DUY I;  4DV1 I;  2E5L E;  4DR3 I;  2X36 A;  3GON A;  3J81 Q;  3B78 A;  4LF9 E;  1H7S A;  4JI6 I;  3WU3 A;  4RPF A;  1IBL E;  3T1Y I;  1HR0 E;  4B3S E;  2UXB I;  4GKK E;  1K47 A;  4ZVI A;  1QZR A;  4DUZ I;  1H72 C;  1N0U A;  2BV3 A;  3QT8 A;  5LL6 R;  1ZM9 A;  1DAR A;  2CZ9 A;  2OI2 A;  4JI1 I;  4HAC A;  3JAM Q;  4IZJ A;  3J81 C;  3PYE A;  4GKJ I;  4WUB A;  3OTO E;  4X66 I;  4DR7 E;  2GS8 A;  3WU4 A;  4DR1 I;  4JI5 I;  1KKH A;  4UT4 A;  2HK3 A;  4DPX A;  4DV5 I;  2F4V E;  4B3R I;  3JAM C;  2IOP A;  4JI2 I;  3ZKB A;  4DV2 E;  2VQE E;  4JI8 E;  1Z0T A;  3Q6M A;  2PNM A;  2Z5B A;  4DPY A;  2HHH I;  4DV4 E;  4LF6 I;  1ZXN A;  4MYU A;  1D6T A;  3P06 A;  1FI4 A;  5GMD A;  1B63 A;  4DXL A;  1PKP A;  1IBM I;  3WU6 A;  4LFC I;  4LF4 E;  3PYD A;  2V2V A;  2HFU A;  1H74 A;  3J7A M;  1XNQ E;  1MU5 A;  4HAC B;  2UUC E;  4OX9 E;  2V2Q A;  4LF8 E;  4P52 A;  4ED4 A;  4I3H A;  4P7A A;  4DR2 I;  4LF5 E;  1XNR E;  5FWK A;  4DV3 I;  3LNU A;  1HNX E;  5IWA E;  4FWG A;  4JV5 E;  4FWD A;  1UEK A;  1HNW I;  2UU9 I;  4LF7 I;  4HYM A;  4K0K I;  1B62 A;  4DPU A;  3Q6N A;  2A2C A;  1XMO E;  1PIE A;  2UUA E;  4UTG A;  2ZBK B;  2E5L I;  1N33 E;  2Z5B B;  4PRX A;  2ZM6 E;  2VQF E;  4X62 E;  2A2D A;  2DEI A;  4LF9 I;  4X65 E;  1IBL I;  1Y4U A;  4LFA E;  1HR0 I;  4B3S I;  1KIJ A;  2E1R A;  4GKK I;  2HKJ A;  2CG9 A;  2V8P A;  3ZM7 A;  1ZM3 A;  4M1K A;  2IOQ A;  4DU8 A;  5BR8 E;  2X7I A;  4YY3 E;  1H73 A;  1ZM2 A;  1NHH A;  1N34 E;  4NXM E;  2BM0 A;  3WU5 A;  1FKA E;  1RRE A;  3B8H A;  1Z0E A;  3OTO I;  2UXC E;  1IBK E;  1BKN A;  3PYF A;  1XMQ E;  4DR7 I;  4KQV A;  1N32 E;  2GQ0 A;  4XTJ A;  1FWL A;  1Z0W A;  1J5E E;  4AQY E;  3J80 Q;  2F4V I;  4HXZ A;  4B3T E;  5IT9 Q;  4DV2 I;  1Z0G A;  2UUB E;  2VQE I;  3ZKD A;  4JI8 I;  4IZJ D;  4DV4 I;  4JYA E;  2Z5C A;  3K1J A;  4FW9 A;  4USM A;  4YHH E;  4FWH A;  3M6A A;  4LF4 I;  3J80 C;  4HY1 A;  5LMN I;  4NXN E;  1XNQ I;  1Z5B A;  2UUC I;  4OX9 I;  4IZK A;  5IT9 C;  4LF8 I;  1A6F A;  4JI0 E;  2UXD E;  1N36 E;  1ZM4 A;  3H4L A;  4IZJ B;  1Z5C A;  2O1W A;  4LF5 I;  2LJP A;  1XNR I;  1I94 E;  1NZ0 A;  1HNX I;  5IWA I;  3HUL A;  4JV5 I;  2WW4 A;  4LFB E;  5LMU E;  2HHH E;  1EI1 A;  4PRV A;  5A2Q Q;  1Y4S A;  4JI7 E;  3ZZ0 A;  1NHI A;  4JI4 E;  1USU A;  4B3M E;  4DV0 E;  3ZZT A;  4N3O A;  1FJG E;  1XMO I;  2UUA I;  4MYT A;  2J7K A;  3T1H E;  3J7A G;  1N33 I;  1FNM A;  4JG4 A;  2ZM6 I;  2VQF I;  4X62 I;  4DR4 E;  4DR6 E;  4DPW A;  4WUD A;  1HNZ E;  2R42 A;  3HJC A;  4X65 I;  4KHP E;  2HKE A;  4LFA I;  2HFS A;  5A2Q C;  2DEJ A;  4DV7 E;  2NPF A;  4X64 E;  1Z0C A;  5BR8 I;  4YY3 I;  4DR5 E;  3QT7 A;  4DV6 E;  2Q2E B;  1N34 I;  4JI3 E;  3LPS A;  2UXC I;  1IBK I;  1XMQ I;  4Z7C A;  3V5R A;  4DUY E;  1USV A;  3Q1Q A;  1N32 I;  4DV1 E;  4DR3 E;  1MX0 A;  3K17 A;  4AQY I;  1J5E I;  3F0N A;  4URL A;  4JI6 E;  1MG7 A;  3T1Y E;  2UXB E;  4B3T I;  3B82 A;  1NHJ A;  2UUB I;  1Z0V A;  3CWV A;  1N0V C;  4DUZ E;  3QT5 A;  1S16 A;  1HK7 A;  4JYA I;  3PRY A;  2O1T A;  4JI1 E;  4YHH I;  2ZIT A;  1Y6Z A;  4DU7 A;  4FN5 A;  2AJ4 A;  4NXN I;  4GKJ E;  1ELO A;  3K85 A;  3QT6 A;  4X66 E;  4JI0 I;  3D4J A;  1KTV A;  4DR1 E;  2XEX A;  2UXD I;  4JI5 E;  2R3V A;  1N36 I;  4EMD A;  2CGE A;  4Z7Y A;  1I94 I;  4PU9 A;  1Z59 A;  4DV5 E;  4B3R E;  4LFB I;  5LMU I;  3PYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...