1Z0CA

Crystal structure of a. fulgidus lon proteolytic domain d508a mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
203
structure length
200
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGASASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Putative protease La homolog type
total genus 57
structure length 200
sequence length 203
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0cA00
4DR7I 4DV4E 2UU9E 1Z0WA 3WU4A 4DUZI 3QT5A 3V2UC 4UTGA 3Q1QA 4JI7I 3ZKDA 4DR7E 4LF6I 3T1HE 2V2QA 4DV3E 1HNXI 2DEJA 4JI6E 1Z0GA 4WUBA 5A2QQ 3K17A 4DV6I 4DU7A 2VQEI 1WUUA 4DR2E 3B8HA 1MG7A 4URLA 4EMDA 2DEIA 3ZZUA 4JYAE 4LFAE 3QT7A 5FLXC 4DV4I 1N0UA 4ZVIA 1XMQI 4NXME 4NXMI 2BM1A 1KTVA 2A2CA 1FKAE 1Z0VA 4PU9A 4JI8E 3J80Q 4GKJE 1IBME 4DPWA 2ZBKB 4DPTA 1EI1A 2VQEE 3B78A 4LFBE 1U2RA 2UXCE 1B63A 4GKKI 4DV7E 4JI0I 1DARA 3F0NA 5GMEA 4Z7CA 2J7KA 1Z0TA 3WU3A 4DV2E 4K0KI 4NXNI 4DV0I 2EFGA 4USKA 4DV3I 2HKEA 4LFBI 5LMNI 4B3RE 4DR6I 1XNQE 3PYFA 3J7AG 4JI7E 2NPFA 1FJGE 4YHHI 1HNWI 1PIEA 2V2ZA 1N33I 4P7AA 4DUZE 4PRXA 1VISA 2ZM6E 4JI8I 4GKJI 4JI5E 4LF9E 4OX9E 4X64I 4JI2I 4KHPE 1H74A 2GS8A 3HULA 4LF8E 1ZXMA 3D4JA 1HNZE 1XNRE 4DR3E 4DR4I 4LFAI 2UUCI 1H72C 3V5RA 4PRVA 1BKNA 2F4VI 5A2QC 2UUAE 4DV5I 4FN5A 4DU8A 1MX0A 4X66E 4OX9I 4DPYA 1N36E 1A6FA 4HXZA 4LF8I 1HR0E 5GMDA 3T1HI 2E5LE 4LFCI 4LF4E 1N33E 1K47A 5BR8E 2X36A 4DV1E 3WU6A 1HNWE 1FJGI 4JI3I 1XMOI 4JI3E 4YHHE 2HHHI 4B3SI 2LJPA 5LMUI 4DR2I 1Z0BA 5BR8I 3LTOA 4B3TE 4LFCE 4R1FA 5IWAI 4FWDA 4JI0E 1H73A 2BV3A 2UU9I 4DV2I 2UXDE 4P52A 4JV5I 3PYEA 2UUAI 2E1RA 4YY3I 1Z5BA 2VQFI 4LF7I 1IBKI 2HFUA 1PVGA 3OTOE 2V8PA 2ZITA 2VF3A 2HK3A 1ZXNA 1NHHA 4DR5I 4FWHA 1ZM9A 2E5LI 2V34A 1HR0I 1KIJA 1N0VC 2UXBE 1D6TA 2X7IA 4HACA 4LF4I 3ZZ0A 3PYDA 4JYAI 1KVKA 2AJ4A 3WU5A 2WW4A 4DV5E 3H4LA 1B62A 4JI4I 3T1YI 1S4EA 3LNUA 4ED4A 4X65E 4DR6E 3QT8A 2BM0A 4RPFA 1IBLI 5IT9C 4DV0E 4NXNE 4LF7E 3JAMQ 3PYGA 4JI4E 4DV6E 5LL6R 4JV5E 3ZM7A 2HK2A 2R42A 3J81Q 1PKPA 2UXBI 4FWGA 4B3ME 4DPUA 3K1JA 4DR1E 1XMOE 1UEKA 1RR9A 3QT6A 4JG4A 2OI2A 1IBKE 4DPXA 1OJ4A 1N32E 3M6AA 4DXLA 2HKJA 4JI1E 4AQYE 2V2VA 2XEXA 1FWLA 3B82A 1Z0CA 4X66I 4I3HA 1I94I 4B3TI 1ZM3A 1FWKA 4DR4E 2A2DA 3J80C 1XNRI 4KQVA 1NZ0A 1I94E 4X65I 4LF9I 4DV1I 4X64E 3T1YE 4JI5I 5FLXQ 3CWVA 4JI2E 1Z0EA 1N36I 4AQYI 4WUDA 5LMUE 2HHHE 1J5EI 1N32I 1XNQI 1H7UA 1KKHA 2VQFE 4HACB 4WUCA 3J81C 4DR5E 2F4VE 1N34I 4B3RI 2R3VA 5L3JA 3OTOI 2CZ9A 3LPSA 4HY1A 4MYUA 4DR1I 4K0KE 1NHIA 4YY3E 1HNZI 4HYMA 5IT9Q 2HFSA 1HNXE 3ZKBA 5IWAE 1EA6A 4GKKE 2UXCI 1QZRA 4FW9A 1N34E 4LF6E 3JAMC 1Z59A 3GONA 1ELOA 1MU5A 1IBLE 4LF5I 4B3SE 4MYTA 4Z7YA 3J7AM 1IBMI 2UUBI 1NHJA 1J5EE 5LMNE 4B3MI 1RREA 4USMA 3ZZTA 1XMQE 1Z5CA 1Z5AA 2UUBE 1S16A 1FI4A 4DV7I 4DUYE 4LF5E 4X62I 2Q2EB 4M1KA 2UUCE 1FNMA 4DR3I 1H7SA 4UT4A 4X62E 4JI6I 4DUYI 4XTJA 1ZM4A 2ZM6I 4KHPI 4JI1I 2UXDI 1XHKA 1ZM2A
chains in the Genus database with same CATH superfamily
4DR7I 4DV4E 2UU9E 1Z0WA 3WU4A 1OYRA 4DUZI 3QT5A 2PO2B 4J3DA 2GO4A 5C0XD 3V2UC 4FW3A 1Y4UA 2JE6A 4UTGA 3Q1QA 4AIMA 4JI7I 3ZKDA 4DR7E 3M85G 4LF6I 2NN6A 3T1HE 2V2QA 4DV3E 1HNXI 2Z5CA 2DEJA 4JI6E 1Z0GA 4WUBA 5A2QQ 3K17A 5C0XF 1OYPA 4DV6I 4DU7A 3M85D 2VQEI 1YH8A 1WUUA 4DR2E 3Q6NA 2C39A 4U3BA 3B8HA 3PS2A 5C0XA 2PO0A 1MG7A 4URLA 5DNXA 2DEIA 4EMDA 3ZZUA 4JYAE 4LFAE 2IOPA 3QT7A 5FLXC 4DV4I 1N0UA 4ZVIA 1XMQI 4NXME 4NXMI 2BM1A 4AM3A 1KTVA 2A2CA 2C38B 1FKAE 4QNJA 1Z0VA 2IOQA 4PU9A 4JI8E 3J80Q 4GKJE 1IBME 4IFDA 4DPWA 2ZBKB 4DPTA 1EI1A 2VQEE 3B78A 4LFBE 1U2RA 3HKMA 2UXCE 1B63A 4GKKI 4DV7E 3P06A 4JI0I 1DARA 3F0NA 5GMEA 4Z7CA 2J7KA 1Z0TA 3WU3A 4DV2E 4K0KI 4NXNI 4DV0I 3UHMA 2EFGA 4USKA 4IFDB 4DV3I 2HKEA 4LFBI 2IERA 5LMNI 4B3RE 4DR6I 1XNQE 4IS9A 3PYFA 3J7AG 4JI7E 2NPFA 1FJGE 4YHHI 1HNWI 1PIEA 2PO1B 3Q6MA 2V2ZA 4MU3A 1N33I 4P7AA 4DUZE 4PRXA 1VISA 2ZM6E 4JI8I 4GKJI 4JI5E 4LF9E 4OX9E 4X64I 4JI2I 4KHPE 1H74A 2GS8A 3HULA 4LF8E 1ZXMA 3D4JA 2C37A 1HNZE 1XNRE 2J65A 4DR3E 4DR4I 4LFAI 2UUCI 1H72C 3P3GA 3V5RA 3PS3A 4PRVA 4MQYA 2O1UA 3CDJA 1BKNA 2F4VI 3M7ND 5A2QC 2UUAE 4DV5I 5K36E 4FN5A 4DU8A 1MX0A 4IFDE 4OO1C 2PNZA 4X66E 4OX9I 4DPYA 1N36E 1A6FA 4HXZA 4LF8I 1HR0E 1UDSA 5GMDA 3T1HI 2E5LE 4LFCI 2WP8A 4LF4E 5EL9A 1N33E 2JEBB 1K47A 5BR8E 2X36A 4DV1E 3WU6A 1HNWE 1FJGI 1Y4SA 5K36B 4JI3I 5K36D 5JEAF 2GQ0A 1XMOI 4JI3E 4YHHE 2HHHI 4B3SI 5JEAB 2LJPA 5LMUI 4DR2I 1Z0BA 5BR8I 3LTOA 2PNLA 4B3TE 4BA2A 2WNRA 5JEAA 2NN6B 4LFCE 4R1FA 5IWAI 4FWDA 4JI0E 5DRRA 4OZEA 1H73A 1OYSA 2BV3A 2UU9I 2JE6B 4DV2I 4ISAA 2UXDE 4P52A 5JEAD 4JV5I 3L7ZA 3K85A 3PYEA 2UUAI 2E1RA 4YY3I 1Z5BA 3P3EA 2VQFI 4LF7I 1IBKI 2HFUA 1PVGA 3OTOE 2C38A 2V8PA 1E3HA 2Z5CB 2VF3A 2ZITA 5DRPA 2HK3A 1ZXNA 2WP8B 1NHHA 2PNZB 4U3DA 2O1VA 4DR5I 4FWHA 1UDOA 3GCMA 1ZM9A 4OO1F 2E5LI 2V34A 1HR0I 1KIJA 1N0VC 1R6MA 2Z5BB 2BA1D 2UXBE 2X7IA 4HACA 2C39B 1HK7A 1D6TA 4LF4I 3ZZ0A 3PYDA 4FW4A 1KVKA 4JYAI 2AJ4A 3WU5A 5K36A 2WW4A 4DV5E 3H4LA 4IFDD 1B62A 4JI4I 3T1YI 1S4EA 3LNUA 4IZKB 2JEBA 4ED4A 4X65E 4DR6E 2BA0D 3QT8A 2BM0A 4RPFA 3U1KA 1IBLI 4IZJB 5IT9C 2NN6D 4DV0E 4NXNE 4OO1A 4LF7E 3JAMQ 2NN6C 3PYGA 4JI4E 4DV6E 5LL6R 4N3OA 3NZKA 4JV5E 3ZM7A 2PO1A 1R6LA 2HK2A 3PS1A 2JEAB 4AIDA 2R42A 3J81Q 1PKPA 4LPFA 2UXBI 5K36F 1Y60A 4FWGA 2PO2A 4B3ME 5JEAE 4FW7A 4DPUA 3K1JA 3L7ZB 4DR1E 1XMOE 2IESA 1UEKA 1RR9A 3GMEA 3QT6A 4JG4A 2OI2A 1IBKE 4DPXA 1OJ4A 3M6AA 1N32E 4BA2B 4DXLA 4MU0A 2HKJA 4JI1E 4AQYE 2V2VA 2XEXA 1FWLA 3B82A 1Z0CA 2CVEA 3B4TA 4X66I 4I3HA 2O3ZA 1I94I 4LCHA 3KRNA 1E3PA 2C37B 2GO3A 2O1TA 4B3TI 1ZM3A 1XXEA 1FWKA 5DNLA 4DR4E 2A2DA 3J80C 1XNRI 4KQVA 1NZ0A 1I94E 5EKWA 4LOMA 4X65I 4BA1B 3DD6A 4FW5A 5FWKA 4LF9I 4DV1I 4X64E 4FW6A 3T1YE 5C0XB 4JI5I 5FLXQ 2BA1G 2CG9A 3CWVA 4JI2E 1Z0EA 3H1CA 1N36I 4LCGA 4IFDF 4AQYI 4IFDC 4OO1E 3CDIA 4WUDA 5LMUE 2HHHE 1J5EI 1N32I 1XNQI 1H7UA 1KKHA 1UDNA 2BA0G 4HACB 4WUCA 3J81C 2VQFE 4DR5E 4QNKA 2F4VE 1N34I 4B3RI 4OKGA 2R3VA 2AE8A 5L3JA 3OTOI 2CZ9A 3LPSA 4OO1D 4HY1A 4BA1A 4OO1B 4MYUA 4DR1I 2O1WA 4K0KE 1NHIA 4GQUA 2WNRB 3HJCA 4YY3E 1HNZI 4HYMA 5IT9Q 2HFSA 1HNXE 4NBQA 3ZKBA 1USVA 2CGEA 5DROA 5IWAE 1VI7A 1EA6A 4GKKE 2UXCI 4MDTA 2NN6E 1QZRA 4FW9A 1N34E 5K36C 2PNMA 4LF6E 3JAMC 2Z5EA 1Z59A 3GONA 2JEAA 1ELOA 1MU5A 1IBLE 4LF5I 4B3SE 4MYTA 4Z7YA 3J7AM 3M7NG 5DRQA 1IBMI 4MU1A 2NN6F 2UUBI 1NHJA 1J5EE 1Y6ZA 2BR2A 4MU4A 5LMNE 4B3MI 3P76A 3U1YA 4IZJA 5C0XC 1RREA 1P42A 4USMA 5ELWA 1RHYA 3ZZTA 1XMQE 4IZKA 5C0XE 1Z5CA 1Z5AA 2UUBE 1S16A 1FI4A 1UDQA 4DV7I 4DUYE 4LF5E 4X62I 2Z5BA 1YHCA 2Q2EB 2VESA 5JEAC 4M1KA 3GLLA 2JT2A 2UUCE 1FNMA 1H7SA 4DR3I 4UT4A 2BR2B 4X62E 1USUA 2F1DA 4JI6I 4DUYI 2PO0B 3PRYA 4XTJA 1ZM4A 4LCFA 2ZM6I 4KHPI 4JI1I 1Y5YA 2UXDI 4IZJD 1XHKA 3P3CA 1ZM2A
chains in the Genus database with same CATH topology
4DR7I 4DV4E 2UU9E 1Z0WA 3WU4A 4DUZI 3QT5A 3V2UC 1Y4UA 4UTGA 3Q1QA 4JI7I 3ZKDA 4DR7E 4LF6I 3T1HE 2V2QA 4DV3E 1HNXI 2Z5CA 2DEJA 4JI6E 1Z0GA 4WUBA 5A2QQ 3K17A 4DV6I 4DU7A 2VQEI 1WUUA 4DR2E 3Q6NA 3B8HA 1MG7A 4URLA 4EMDA 2DEIA 3ZZUA 4JYAE 4LFAE 2IOPA 3QT7A 5FLXC 4DV4I 1N0UA 4ZVIA 1XMQI 4NXME 4NXMI 2BM1A 1KTVA 2A2CA 1FKAE 1Z0VA 2IOQA 4PU9A 4JI8E 3J80Q 4GKJE 1IBME 4DPWA 2ZBKB 4DPTA 1EI1A 2VQEE 3B78A 4LFBE 1U2RA 2UXCE 1B63A 4GKKI 4DV7E 3P06A 4JI0I 1DARA 3F0NA 5GMEA 4Z7CA 2J7KA 1Z0TA 3WU3A 4DV2E 4K0KI 4NXNI 4DV0I 2EFGA 4USKA 4DV3I 2HKEA 4LFBI 5LMNI 4B3RE 4DR6I 1XNQE 3PYFA 3J7AG 4JI7E 2NPFA 1FJGE 4YHHI 1HNWI 1PIEA 3Q6MA 2V2ZA 1N33I 4P7AA 4DUZE 4PRXA 1VISA 2ZM6E 4JI8I 4GKJI 4JI5E 4LF9E 4OX9E 4X64I 4JI2I 4KHPE 1H74A 2GS8A 3HULA 4LF8E 1ZXMA 3D4JA 1HNZE 1XNRE 4DR3E 4DR4I 4LFAI 2UUCI 1H72C 3V5RA 4PRVA 2O1UA 1BKNA 2F4VI 5A2QC 2UUAE 4DV5I 4FN5A 4DU8A 1MX0A 4X66E 4OX9I 4DPYA 1N36E 1A6FA 4HXZA 4LF8I 1HR0E 5GMDA 3T1HI 2E5LE 4LFCI 4LF4E 1N33E 1K47A 5BR8E 2X36A 4DV1E 3WU6A 1HNWE 1FJGI 1Y4SA 4JI3I 2GQ0A 1XMOI 4JI3E 4YHHE 2HHHI 4B3SI 2LJPA 5LMUI 4DR2I 1Z0BA 5BR8I 3LTOA 2PNLA 4B3TE 4LFCE 4R1FA 5IWAI 4FWDA 4JI0E 1H73A 2BV3A 2UU9I 4DV2I 2UXDE 4P52A 4JV5I 3K85A 3PYEA 2UUAI 2E1RA 4YY3I 1Z5BA 2VQFI 4LF7I 1IBKI 2HFUA 1PVGA 3OTOE 2V8PA 2Z5CB 2VF3A 2ZITA 2HK3A 1ZXNA 1NHHA 2O1VA 4DR5I 4FWHA 1ZM9A 2E5LI 2V34A 1HR0I 1KIJA 1N0VC 2Z5BB 2UXBE 1D6TA 2X7IA 4HACA 1HK7A 4LF4I 3ZZ0A 3PYDA 4JYAI 1KVKA 2AJ4A 3WU5A 2WW4A 4DV5E 3H4LA 1B62A 4JI4I 3T1YI 1S4EA 3LNUA 4IZKB 4ED4A 4X65E 4DR6E 3QT8A 2BM0A 4RPFA 1IBLI 4IZJB 5IT9C 4DV0E 4NXNE 4LF7E 3JAMQ 3PYGA 4JI4E 4DV6E 5LL6R 4N3OA 4JV5E 3ZM7A 2HK2A 2R42A 3J81Q 1PKPA 2UXBI 4FWGA 4B3ME 4DPUA 3K1JA 4DR1E 1XMOE 1UEKA 1RR9A 3QT6A 4JG4A 2OI2A 1IBKE 4DPXA 1OJ4A 3M6AA 1N32E 4DXLA 2HKJA 4JI1E 4AQYE 2V2VA 2XEXA 1FWLA 3B82A 1Z0CA 4X66I 4I3HA 1I94I 2O1TA 4B3TI 1ZM3A 1FWKA 4DR4E 2A2DA 3J80C 1XNRI 4KQVA 1NZ0A 1I94E 4X65I 5FWKA 4LF9I 4DV1I 4X64E 3T1YE 4JI5I 5FLXQ 2CG9A 3CWVA 4JI2E 1Z0EA 1N36I 4AQYI 4WUDA 5LMUE 2HHHE 1J5EI 1N32I 1XNQI 1H7UA 1KKHA 2VQFE 4HACB 4WUCA 3J81C 4DR5E 2F4VE 1N34I 4B3RI 2R3VA 5L3JA 3OTOI 2CZ9A 3LPSA 4HY1A 4MYUA 4DR1I 2O1WA 4K0KE 1NHIA 3HJCA 4YY3E 1HNZI 4HYMA 5IT9Q 2HFSA 1HNXE 3ZKBA 1USVA 2CGEA 5IWAE 1EA6A 4GKKE 2UXCI 1QZRA 4FW9A 1N34E 2PNMA 4LF6E 3JAMC 2Z5EA 1Z59A 3GONA 1ELOA 1MU5A 1IBLE 4LF5I 4B3SE 4MYTA 4Z7YA 3J7AM 1IBMI 2UUBI 1NHJA 1J5EE 1Y6ZA 5LMNE 4B3MI 4IZJA 1RREA 4USMA 3ZZTA 1XMQE 4IZKA 1Z5CA 1Z5AA 2UUBE 1S16A 1FI4A 4DV7I 4DUYE 4LF5E 4X62I 2Z5BA 2Q2EB 4M1KA 2UUCE 1FNMA 4DR3I 1H7SA 4UT4A 4X62E 1USUA 4JI6I 4DUYI 3PRYA 4XTJA 1ZM4A 2ZM6I 4KHPI 4JI1I 2UXDI 4IZJD 1XHKA 1ZM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 I;  4DV4 E;  2UU9 E;  1Z0W A;  3WU4 A;  4DUZ I;  3QT5 A;  3V2U C;  4UTG A;  3Q1Q A;  4JI7 I;  3ZKD A;  4DR7 E;  4LF6 I;  3T1H E;  2V2Q A;  4DV3 E;  1HNX I;  2DEJ A;  4JI6 E;  1Z0G A;  4WUB A;  5A2Q Q;  3K17 A;  4DV6 I;  4DU7 A;  2VQE I;  1WUU A;  4DR2 E;  3B8H A;  1MG7 A;  4URL A;  4EMD A;  2DEI A;  3ZZU A;  4JYA E;  4LFA E;  3QT7 A;  5FLX C;  4DV4 I;  1N0U A;  4ZVI A;  1XMQ I;  4NXM E;  4NXM I;  2BM1 A;  1KTV A;  2A2C A;  1FKA E;  1Z0V A;  4PU9 A;  4JI8 E;  3J80 Q;  4GKJ E;  1IBM E;  4DPW A;  2ZBK B;  4DPT A;  1EI1 A;  2VQE E;  3B78 A;  4LFB E;  1U2R A;  2UXC E;  1B63 A;  4GKK I;  4DV7 E;  4JI0 I;  1DAR A;  3F0N A;  5GME A;  4Z7C A;  2J7K A;  1Z0T A;  3WU3 A;  4DV2 E;  4K0K I;  4NXN I;  4DV0 I;  2EFG A;  4USK A;  4DV3 I;  2HKE A;  4LFB I;  5LMN I;  4B3R E;  4DR6 I;  1XNQ E;  3PYF A;  3J7A G;  4JI7 E;  2NPF A;  1FJG E;  4YHH I;  1HNW I;  1PIE A;  2V2Z A;  1N33 I;  4P7A A;  4DUZ E;  4PRX A;  1VIS A;  2ZM6 E;  4JI8 I;  4GKJ I;  4JI5 E;  4LF9 E;  4OX9 E;  4X64 I;  4JI2 I;  4KHP E;  1H74 A;  2GS8 A;  3HUL A;  4LF8 E;  1ZXM A;  3D4J A;  1HNZ E;  1XNR E;  4DR3 E;  4DR4 I;  4LFA I;  2UUC I;  1H72 C;  3V5R A;  4PRV A;  1BKN A;  2F4V I;  5A2Q C;  2UUA E;  4DV5 I;  4FN5 A;  4DU8 A;  1MX0 A;  4X66 E;  4OX9 I;  4DPY A;  1N36 E;  1A6F A;  4HXZ A;  4LF8 I;  1HR0 E;  5GMD A;  3T1H I;  2E5L E;  4LFC I;  4LF4 E;  1N33 E;  1K47 A;  5BR8 E;  2X36 A;  4DV1 E;  3WU6 A;  1HNW E;  1FJG I;  4JI3 I;  1XMO I;  4JI3 E;  4YHH E;  2HHH I;  4B3S I;  2LJP A;  5LMU I;  4DR2 I;  1Z0B A;  5BR8 I;  3LTO A;  4B3T E;  4LFC E;  4R1F A;  5IWA I;  4FWD A;  4JI0 E;  1H73 A;  2BV3 A;  2UU9 I;  4DV2 I;  2UXD E;  4P52 A;  4JV5 I;  3PYE A;  2UUA I;  2E1R A;  4YY3 I;  1Z5B A;  2VQF I;  4LF7 I;  1IBK I;  2HFU A;  1PVG A;  3OTO E;  2V8P A;  2ZIT A;  2VF3 A;  2HK3 A;  1ZXN A;  1NHH A;  4DR5 I;  4FWH A;  1ZM9 A;  2E5L I;  2V34 A;  1HR0 I;  1KIJ A;  1N0V C;  2UXB E;  1D6T A;  2X7I A;  4HAC A;  4LF4 I;  3ZZ0 A;  3PYD A;  4JYA I;  1KVK A;  2AJ4 A;  3WU5 A;  2WW4 A;  4DV5 E;  3H4L A;  1B62 A;  4JI4 I;  3T1Y I;  1S4E A;  3LNU A;  4ED4 A;  4X65 E;  4DR6 E;  3QT8 A;  2BM0 A;  4RPF A;  1IBL I;  5IT9 C;  4DV0 E;  4NXN E;  4LF7 E;  3JAM Q;  3PYG A;  4JI4 E;  4DV6 E;  5LL6 R;  4JV5 E;  3ZM7 A;  2HK2 A;  2R42 A;  3J81 Q;  1PKP A;  2UXB I;  4FWG A;  4B3M E;  4DPU A;  3K1J A;  4DR1 E;  1XMO E;  1UEK A;  1RR9 A;  3QT6 A;  4JG4 A;  2OI2 A;  1IBK E;  4DPX A;  1OJ4 A;  1N32 E;  3M6A A;  4DXL A;  2HKJ A;  4JI1 E;  4AQY E;  2V2V A;  2XEX A;  1FWL A;  3B82 A;  1Z0C A;  4X66 I;  4I3H A;  1I94 I;  4B3T I;  1ZM3 A;  1FWK A;  4DR4 E;  2A2D A;  3J80 C;  1XNR I;  4KQV A;  1NZ0 A;  1I94 E;  4X65 I;  4LF9 I;  4DV1 I;  4X64 E;  3T1Y E;  4JI5 I;  5FLX Q;  3CWV A;  4JI2 E;  1Z0E A;  1N36 I;  4AQY I;  4WUD A;  5LMU E;  2HHH E;  1J5E I;  1N32 I;  1XNQ I;  1H7U A;  1KKH A;  2VQF E;  4HAC B;  4WUC A;  3J81 C;  4DR5 E;  2F4V E;  1N34 I;  4B3R I;  2R3V A;  5L3J A;  3OTO I;  2CZ9 A;  3LPS A;  4HY1 A;  4MYU A;  4DR1 I;  4K0K E;  1NHI A;  4YY3 E;  1HNZ I;  4HYM A;  5IT9 Q;  2HFS A;  1HNX E;  3ZKB A;  5IWA E;  1EA6 A;  4GKK E;  2UXC I;  1QZR A;  4FW9 A;  1N34 E;  4LF6 E;  3JAM C;  1Z59 A;  3GON A;  1ELO A;  1MU5 A;  1IBL E;  4LF5 I;  4B3S E;  4MYT A;  4Z7Y A;  3J7A M;  1IBM I;  2UUB I;  1NHJ A;  1J5E E;  5LMN E;  4B3M I;  1RRE A;  4USM A;  3ZZT A;  1XMQ E;  1Z5C A;  1Z5A A;  2UUB E;  1S16 A;  1FI4 A;  4DV7 I;  4DUY E;  4LF5 E;  4X62 I;  2Q2E B;  4M1K A;  2UUC E;  1FNM A;  4DR3 I;  1H7S A;  4UT4 A;  4X62 E;  4JI6 I;  4DUY I;  4XTJ A;  1ZM4 A;  2ZM6 I;  4KHP I;  4JI1 I;  2UXD I;  1XHK A;  1ZM2 A; 
#chains in the Genus database with same CATH topology
 4DR7 I;  4DV4 E;  2UU9 E;  1Z0W A;  3WU4 A;  1OYR A;  4DUZ I;  3QT5 A;  2PO2 B;  4J3D A;  2GO4 A;  5C0X D;  3V2U C;  4FW3 A;  1Y4U A;  2JE6 A;  4UTG A;  3Q1Q A;  4AIM A;  4JI7 I;  3ZKD A;  4DR7 E;  3M85 G;  4LF6 I;  2NN6 A;  3T1H E;  2V2Q A;  4DV3 E;  1HNX I;  2Z5C A;  2DEJ A;  4JI6 E;  1Z0G A;  4WUB A;  5A2Q Q;  3K17 A;  5C0X F;  1OYP A;  4DV6 I;  4DU7 A;  3M85 D;  2VQE I;  1YH8 A;  1WUU A;  4DR2 E;  3Q6N A;  2C39 A;  4U3B A;  3B8H A;  3PS2 A;  5C0X A;  2PO0 A;  1MG7 A;  4URL A;  5DNX A;  2DEI A;  4EMD A;  3ZZU A;  4JYA E;  4LFA E;  2IOP A;  3QT7 A;  5FLX C;  4DV4 I;  1N0U A;  4ZVI A;  1XMQ I;  4NXM E;  4NXM I;  2BM1 A;  4AM3 A;  1KTV A;  2A2C A;  2C38 B;  1FKA E;  4QNJ A;  1Z0V A;  2IOQ A;  4PU9 A;  4JI8 E;  3J80 Q;  4GKJ E;  1IBM E;  4IFD A;  4DPW A;  2ZBK B;  4DPT A;  1EI1 A;  2VQE E;  3B78 A;  4LFB E;  1U2R A;  3HKM A;  2UXC E;  1B63 A;  4GKK I;  4DV7 E;  3P06 A;  4JI0 I;  1DAR A;  3F0N A;  5GME A;  4Z7C A;  2J7K A;  1Z0T A;  3WU3 A;  4DV2 E;  4K0K I;  4NXN I;  4DV0 I;  3UHM A;  2EFG A;  4USK A;  4IFD B;  4DV3 I;  2HKE A;  4LFB I;  2IER A;  5LMN I;  4B3R E;  4DR6 I;  1XNQ E;  4IS9 A;  3PYF A;  3J7A G;  4JI7 E;  2NPF A;  1FJG E;  4YHH I;  1HNW I;  1PIE A;  2PO1 B;  3Q6M A;  2V2Z A;  4MU3 A;  1N33 I;  4P7A A;  4DUZ E;  4PRX A;  1VIS A;  2ZM6 E;  4JI8 I;  4GKJ I;  4JI5 E;  4LF9 E;  4OX9 E;  4X64 I;  4JI2 I;  4KHP E;  1H74 A;  2GS8 A;  3HUL A;  4LF8 E;  1ZXM A;  3D4J A;  2C37 A;  1HNZ E;  1XNR E;  2J65 A;  4DR3 E;  4DR4 I;  4LFA I;  2UUC I;  1H72 C;  3P3G A;  3V5R A;  3PS3 A;  4PRV A;  4MQY A;  2O1U A;  3CDJ A;  1BKN A;  2F4V I;  3M7N D;  5A2Q C;  2UUA E;  4DV5 I;  5K36 E;  4FN5 A;  4DU8 A;  1MX0 A;  4IFD E;  4OO1 C;  2PNZ A;  4X66 E;  4OX9 I;  4DPY A;  1N36 E;  1A6F A;  4HXZ A;  4LF8 I;  1HR0 E;  1UDS A;  5GMD A;  3T1H I;  2E5L E;  4LFC I;  2WP8 A;  4LF4 E;  5EL9 A;  1N33 E;  2JEB B;  1K47 A;  5BR8 E;  2X36 A;  4DV1 E;  3WU6 A;  1HNW E;  1FJG I;  1Y4S A;  5K36 B;  4JI3 I;  5K36 D;  5JEA F;  2GQ0 A;  1XMO I;  4JI3 E;  4YHH E;  2HHH I;  4B3S I;  5JEA B;  2LJP A;  5LMU I;  4DR2 I;  1Z0B A;  5BR8 I;  3LTO A;  2PNL A;  4B3T E;  4BA2 A;  2WNR A;  5JEA A;  2NN6 B;  4LFC E;  4R1F A;  5IWA I;  4FWD A;  4JI0 E;  5DRR A;  4OZE A;  1H73 A;  1OYS A;  2BV3 A;  2UU9 I;  2JE6 B;  4DV2 I;  4ISA A;  2UXD E;  4P52 A;  5JEA D;  4JV5 I;  3L7Z A;  3K85 A;  3PYE A;  2UUA I;  2E1R A;  4YY3 I;  1Z5B A;  3P3E A;  2VQF I;  4LF7 I;  1IBK I;  2HFU A;  1PVG A;  3OTO E;  2C38 A;  2V8P A;  1E3H A;  2Z5C B;  2VF3 A;  2ZIT A;  5DRP A;  2HK3 A;  1ZXN A;  2WP8 B;  1NHH A;  2PNZ B;  4U3D A;  2O1V A;  4DR5 I;  4FWH A;  1UDO A;  3GCM A;  1ZM9 A;  4OO1 F;  2E5L I;  2V34 A;  1HR0 I;  1KIJ A;  1N0V C;  1R6M A;  2Z5B B;  2BA1 D;  2UXB E;  2X7I A;  4HAC A;  2C39 B;  1HK7 A;  1D6T A;  4LF4 I;  3ZZ0 A;  3PYD A;  4FW4 A;  1KVK A;  4JYA I;  2AJ4 A;  3WU5 A;  5K36 A;  2WW4 A;  4DV5 E;  3H4L A;  4IFD D;  1B62 A;  4JI4 I;  3T1Y I;  1S4E A;  3LNU A;  4IZK B;  2JEB A;  4ED4 A;  4X65 E;  4DR6 E;  2BA0 D;  3QT8 A;  2BM0 A;  4RPF A;  3U1K A;  1IBL I;  4IZJ B;  5IT9 C;  2NN6 D;  4DV0 E;  4NXN E;  4OO1 A;  4LF7 E;  3JAM Q;  2NN6 C;  3PYG A;  4JI4 E;  4DV6 E;  5LL6 R;  4N3O A;  3NZK A;  4JV5 E;  3ZM7 A;  2PO1 A;  1R6L A;  2HK2 A;  3PS1 A;  2JEA B;  4AID A;  2R42 A;  3J81 Q;  1PKP A;  4LPF A;  2UXB I;  5K36 F;  1Y60 A;  4FWG A;  2PO2 A;  4B3M E;  5JEA E;  4FW7 A;  4DPU A;  3K1J A;  3L7Z B;  4DR1 E;  1XMO E;  2IES A;  1UEK A;  1RR9 A;  3GME A;  3QT6 A;  4JG4 A;  2OI2 A;  1IBK E;  4DPX A;  1OJ4 A;  3M6A A;  1N32 E;  4BA2 B;  4DXL A;  4MU0 A;  2HKJ A;  4JI1 E;  4AQY E;  2V2V A;  2XEX A;  1FWL A;  3B82 A;  1Z0C A;  2CVE A;  3B4T A;  4X66 I;  4I3H A;  2O3Z A;  1I94 I;  4LCH A;  3KRN A;  1E3P A;  2C37 B;  2GO3 A;  2O1T A;  4B3T I;  1ZM3 A;  1XXE A;  1FWK A;  5DNL A;  4DR4 E;  2A2D A;  3J80 C;  1XNR I;  4KQV A;  1NZ0 A;  1I94 E;  5EKW A;  4LOM A;  4X65 I;  4BA1 B;  3DD6 A;  4FW5 A;  5FWK A;  4LF9 I;  4DV1 I;  4X64 E;  4FW6 A;  3T1Y E;  5C0X B;  4JI5 I;  5FLX Q;  2BA1 G;  2CG9 A;  3CWV A;  4JI2 E;  1Z0E A;  3H1C A;  1N36 I;  4LCG A;  4IFD F;  4AQY I;  4IFD C;  4OO1 E;  3CDI A;  4WUD A;  5LMU E;  2HHH E;  1J5E I;  1N32 I;  1XNQ I;  1H7U A;  1KKH A;  1UDN A;  2BA0 G;  4HAC B;  4WUC A;  3J81 C;  2VQF E;  4DR5 E;  4QNK A;  2F4V E;  1N34 I;  4B3R I;  4OKG A;  2R3V A;  2AE8 A;  5L3J A;  3OTO I;  2CZ9 A;  3LPS A;  4OO1 D;  4HY1 A;  4BA1 A;  4OO1 B;  4MYU A;  4DR1 I;  2O1W A;  4K0K E;  1NHI A;  4GQU A;  2WNR B;  3HJC A;  4YY3 E;  1HNZ I;  4HYM A;  5IT9 Q;  2HFS A;  1HNX E;  4NBQ A;  3ZKB A;  1USV A;  2CGE A;  5DRO A;  5IWA E;  1VI7 A;  1EA6 A;  4GKK E;  2UXC I;  4MDT A;  2NN6 E;  1QZR A;  4FW9 A;  1N34 E;  5K36 C;  2PNM A;  4LF6 E;  3JAM C;  2Z5E A;  1Z59 A;  3GON A;  2JEA A;  1ELO A;  1MU5 A;  1IBL E;  4LF5 I;  4B3S E;  4MYT A;  4Z7Y A;  3J7A M;  3M7N G;  5DRQ A;  1IBM I;  4MU1 A;  2NN6 F;  2UUB I;  1NHJ A;  1J5E E;  1Y6Z A;  2BR2 A;  4MU4 A;  5LMN E;  4B3M I;  3P76 A;  3U1Y A;  4IZJ A;  5C0X C;  1RRE A;  1P42 A;  4USM A;  5ELW A;  1RHY A;  3ZZT A;  1XMQ E;  4IZK A;  5C0X E;  1Z5C A;  1Z5A A;  2UUB E;  1S16 A;  1FI4 A;  1UDQ A;  4DV7 I;  4DUY E;  4LF5 E;  4X62 I;  2Z5B A;  1YHC A;  2Q2E B;  2VES A;  5JEA C;  4M1K A;  3GLL A;  2JT2 A;  2UUC E;  1FNM A;  1H7S A;  4DR3 I;  4UT4 A;  2BR2 B;  4X62 E;  1USU A;  2F1D A;  4JI6 I;  4DUY I;  2PO0 B;  3PRY A;  4XTJ A;  1ZM4 A;  4LCF A;  2ZM6 I;  4KHP I;  4JI1 I;  1Y5Y A;  2UXD I;  4IZJ D;  1XHK A;  3P3C A;  1ZM2 A; 
#chains in the Genus database with same CATH homology
 4DR7 I;  4DV4 E;  2UU9 E;  1Z0W A;  3WU4 A;  4DUZ I;  3QT5 A;  3V2U C;  1Y4U A;  4UTG A;  3Q1Q A;  4JI7 I;  3ZKD A;  4DR7 E;  4LF6 I;  3T1H E;  2V2Q A;  4DV3 E;  1HNX I;  2Z5C A;  2DEJ A;  4JI6 E;  1Z0G A;  4WUB A;  5A2Q Q;  3K17 A;  4DV6 I;  4DU7 A;  2VQE I;  1WUU A;  4DR2 E;  3Q6N A;  3B8H A;  1MG7 A;  4URL A;  4EMD A;  2DEI A;  3ZZU A;  4JYA E;  4LFA E;  2IOP A;  3QT7 A;  5FLX C;  4DV4 I;  1N0U A;  4ZVI A;  1XMQ I;  4NXM E;  4NXM I;  2BM1 A;  1KTV A;  2A2C A;  1FKA E;  1Z0V A;  2IOQ A;  4PU9 A;  4JI8 E;  3J80 Q;  4GKJ E;  1IBM E;  4DPW A;  2ZBK B;  4DPT A;  1EI1 A;  2VQE E;  3B78 A;  4LFB E;  1U2R A;  2UXC E;  1B63 A;  4GKK I;  4DV7 E;  3P06 A;  4JI0 I;  1DAR A;  3F0N A;  5GME A;  4Z7C A;  2J7K A;  1Z0T A;  3WU3 A;  4DV2 E;  4K0K I;  4NXN I;  4DV0 I;  2EFG A;  4USK A;  4DV3 I;  2HKE A;  4LFB I;  5LMN I;  4B3R E;  4DR6 I;  1XNQ E;  3PYF A;  3J7A G;  4JI7 E;  2NPF A;  1FJG E;  4YHH I;  1HNW I;  1PIE A;  3Q6M A;  2V2Z A;  1N33 I;  4P7A A;  4DUZ E;  4PRX A;  1VIS A;  2ZM6 E;  4JI8 I;  4GKJ I;  4JI5 E;  4LF9 E;  4OX9 E;  4X64 I;  4JI2 I;  4KHP E;  1H74 A;  2GS8 A;  3HUL A;  4LF8 E;  1ZXM A;  3D4J A;  1HNZ E;  1XNR E;  4DR3 E;  4DR4 I;  4LFA I;  2UUC I;  1H72 C;  3V5R A;  4PRV A;  2O1U A;  1BKN A;  2F4V I;  5A2Q C;  2UUA E;  4DV5 I;  4FN5 A;  4DU8 A;  1MX0 A;  4X66 E;  4OX9 I;  4DPY A;  1N36 E;  1A6F A;  4HXZ A;  4LF8 I;  1HR0 E;  5GMD A;  3T1H I;  2E5L E;  4LFC I;  4LF4 E;  1N33 E;  1K47 A;  5BR8 E;  2X36 A;  4DV1 E;  3WU6 A;  1HNW E;  1FJG I;  1Y4S A;  4JI3 I;  2GQ0 A;  1XMO I;  4JI3 E;  4YHH E;  2HHH I;  4B3S I;  2LJP A;  5LMU I;  4DR2 I;  1Z0B A;  5BR8 I;  3LTO A;  2PNL A;  4B3T E;  4LFC E;  4R1F A;  5IWA I;  4FWD A;  4JI0 E;  1H73 A;  2BV3 A;  2UU9 I;  4DV2 I;  2UXD E;  4P52 A;  4JV5 I;  3K85 A;  3PYE A;  2UUA I;  2E1R A;  4YY3 I;  1Z5B A;  2VQF I;  4LF7 I;  1IBK I;  2HFU A;  1PVG A;  3OTO E;  2V8P A;  2Z5C B;  2VF3 A;  2ZIT A;  2HK3 A;  1ZXN A;  1NHH A;  2O1V A;  4DR5 I;  4FWH A;  1ZM9 A;  2E5L I;  2V34 A;  1HR0 I;  1KIJ A;  1N0V C;  2Z5B B;  2UXB E;  1D6T A;  2X7I A;  4HAC A;  1HK7 A;  4LF4 I;  3ZZ0 A;  3PYD A;  4JYA I;  1KVK A;  2AJ4 A;  3WU5 A;  2WW4 A;  4DV5 E;  3H4L A;  1B62 A;  4JI4 I;  3T1Y I;  1S4E A;  3LNU A;  4IZK B;  4ED4 A;  4X65 E;  4DR6 E;  3QT8 A;  2BM0 A;  4RPF A;  1IBL I;  4IZJ B;  5IT9 C;  4DV0 E;  4NXN E;  4LF7 E;  3JAM Q;  3PYG A;  4JI4 E;  4DV6 E;  5LL6 R;  4N3O A;  4JV5 E;  3ZM7 A;  2HK2 A;  2R42 A;  3J81 Q;  1PKP A;  2UXB I;  4FWG A;  4B3M E;  4DPU A;  3K1J A;  4DR1 E;  1XMO E;  1UEK A;  1RR9 A;  3QT6 A;  4JG4 A;  2OI2 A;  1IBK E;  4DPX A;  1OJ4 A;  3M6A A;  1N32 E;  4DXL A;  2HKJ A;  4JI1 E;  4AQY E;  2V2V A;  2XEX A;  1FWL A;  3B82 A;  1Z0C A;  4X66 I;  4I3H A;  1I94 I;  2O1T A;  4B3T I;  1ZM3 A;  1FWK A;  4DR4 E;  2A2D A;  3J80 C;  1XNR I;  4KQV A;  1NZ0 A;  1I94 E;  4X65 I;  5FWK A;  4LF9 I;  4DV1 I;  4X64 E;  3T1Y E;  4JI5 I;  5FLX Q;  2CG9 A;  3CWV A;  4JI2 E;  1Z0E A;  1N36 I;  4AQY I;  4WUD A;  5LMU E;  2HHH E;  1J5E I;  1N32 I;  1XNQ I;  1H7U A;  1KKH A;  2VQF E;  4HAC B;  4WUC A;  3J81 C;  4DR5 E;  2F4V E;  1N34 I;  4B3R I;  2R3V A;  5L3J A;  3OTO I;  2CZ9 A;  3LPS A;  4HY1 A;  4MYU A;  4DR1 I;  2O1W A;  4K0K E;  1NHI A;  3HJC A;  4YY3 E;  1HNZ I;  4HYM A;  5IT9 Q;  2HFS A;  1HNX E;  3ZKB A;  1USV A;  2CGE A;  5IWA E;  1EA6 A;  4GKK E;  2UXC I;  1QZR A;  4FW9 A;  1N34 E;  2PNM A;  4LF6 E;  3JAM C;  2Z5E A;  1Z59 A;  3GON A;  1ELO A;  1MU5 A;  1IBL E;  4LF5 I;  4B3S E;  4MYT A;  4Z7Y A;  3J7A M;  1IBM I;  2UUB I;  1NHJ A;  1J5E E;  1Y6Z A;  5LMN E;  4B3M I;  4IZJ A;  1RRE A;  4USM A;  3ZZT A;  1XMQ E;  4IZK A;  1Z5C A;  1Z5A A;  2UUB E;  1S16 A;  1FI4 A;  4DV7 I;  4DUY E;  4LF5 E;  4X62 I;  2Z5B A;  2Q2E B;  4M1K A;  2UUC E;  1FNM A;  4DR3 I;  1H7S A;  4UT4 A;  4X62 E;  1USU A;  4JI6 I;  4DUY I;  3PRY A;  4XTJ A;  1ZM4 A;  2ZM6 I;  4KHP I;  4JI1 I;  2UXD I;  4IZJ D;  1XHK A;  1ZM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...