1Z0CA

Crystal structure of a. fulgidus lon proteolytic domain d508a mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
203
structure length
200
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGASASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Putative protease La homolog type
total genus 57
structure length 200
sequence length 203
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0cA00
1N34E 4DU8A 1Z5BA 1IBKI 3V5RA 2V2ZA 2AJ4A 1NZ0A 2UXCE 1ZXNA 1H7UA 1N34I 4DV2I 2NPFA 4JI6I 4DPXA 4B3MI 2BM1A 4I3HA 1MU5A 4LF6I 4DV0E 4DV6I 4DXLA 1PIEA 4K0KI 3QT7A 1PKPA 4X66I 4DV1E 1WUUA 1EI1A 4DPUA 2HFUA 1N33E 3WU3A 1HNZE 2HKEA 5IT9Q 1N0VC 3J81Q 4X64I 1KVKA 3JAMC 2UXDI 4X64E 1ELOA 4JI8I 5IWAE 1BKNA 3PYDA 1XNRI 3M6AA 3WU6A 4DR1E 1N0UA 1FWKA 1NHHA 4DUYI 1HNXI 4PRXA 4LF4E 1XMOI 2VQEE 4DR5E 3OTOE 4X66E 4MYTA 4LF8I 3PYEA 4JYAI 4JI5I 3J7AG 2UUCE 1IBLI 4URLA 2UXBI 4DUZE 4DR3E 1ZM4A 3V2UC 4JI3I 1FNMA 4DR1I 4PU9A 3LNUA 1Z0CA 4JV5I 2R3VA 4KHPI 1Z0WA 1B63A 3QT6A 4B3TE 4GKJI 1U2RA 4YY3E 4DR7I 1QZRA 4HXZA 4GKKE 4HY1A 4JI1I 4PRVA 5LL6R 2EFGA 4B3ME 2UUBE 1Z0BA 2BM0A 2X36A 5GMEA 4JI3E 1FI4A 4B3RI 4JI1E 2UU9I 1IBLE 2A2DA 2VQFE 3CWVA 4JI5E 3J7AM 3WU4A 5FLXQ 4B3TI 2Q2EB 3QT8A 1ZM3A 4DR5I 1S16A 2ZBKB 1XNQE 3T1HI 1B62A 1K47A 3ZZUA 2V8PA 1N36I 3Q1QA 4OX9E 4AQYI 1J5EE 4LF7E 4JYAE 4DV3I 2GS8A 2J7KA 1XMQE 2UUCI 1I94I 2HK2A 5BR8I 3ZKDA 1N33I 2DEJA 4DPYA 3F0NA 4XTJA 2UXDE 4DR2E 4HACA 4YHHI 5IWAI 4DR6E 4OX9I 1Z0EA 4FWGA 1Z5CA 3H4LA 1A6FA 4NXME 4X65I 3J80Q 2V2QA 1HR0I 1XHKA 5IT9C 1I94E 1KIJA 3K1JA 1S4EA 4HYMA 4DV7E 2UUAE 4USKA 4USMA 4DU7A 4LFBE 1MX0A 3ZZ0A 3HULA 3B8HA 4LF5E 1HNWE 2UXCI 4JI2I 4JI6E 1NHIA 4R1FA 3ZM7A 1IBKE 1Z0VA 1Z0TA 4WUCA 4FN5A 4MYUA 4X62E 4FWDA 1IBME 4YY3I 1UEKA 4DR7E 1ZXMA 1KTVA 1Z59A 2VQFI 3PYFA 4M1KA 5LMNE 1D6TA 4JV5E 1Z0GA 1NHJA 4DPTA 5LMUI 4LFAE 4JI2E 4DR3I 4KHPE 4DV7I 1OJ4A 4B3SI 2F4VI 4DR2I 4JI4I 4FW9A 4LFCE 4P52A 4HACB 5GMDA 1H7SA 1H73A 5L3JA 2F4VE 1HR0E 4DV3E 3J81C 1XMOE 1N32I 4LF4I 1XMQI 1Z5AA 4JI0I 4JI8E 4DUYE 1HNXE 4ED4A 1J5EI 1H74A 4RPFA 3QT5A 3T1HE 4YHHE 2X7IA 2XEXA 1RREA 3WU5A 2HFSA 4JI7E 1ZM2A 3LTOA 4UTGA 2HKJA 4WUDA 3LPSA 3J80C 4K0KE 4LF9I 4AQYE 4LFBI 1XNRE 4DR4E 2UUBI 4B3SE 4NXNE 3JAMQ 2UUAI 4LF5I 1N36E 1FWLA 2R42A 4LFAI 4LF6E 1MG7A 5A2QC 4LF9E 2WW4A 4NXMI 4DV2E 4UT4A 5FLXC 4X65E 3GONA 3D4JA 2HHHI 4X62I 4B3RE 2A2CA 2ZM6E 2CZ9A 4NXNI 2V2VA 4DV4E 2VF3A 4DUZI 4DR4I 1HNWI 4WUBA 4EMDA 1N32E 2LJPA 4Z7CA 3T1YI 2V34A 4KQVA 2E5LE 2UXBE 1VISA 1KKHA 4GKJE 4JI7I 1FKAE 5BR8E 4DR6I 4ZVIA 4Z7YA 4DV5I 4JI0E 1FJGE 4LF7I 1PVGA 3B78A 4FWHA 1FJGI 1RR9A 5LMUE 4P7AA 3K17A 1HNZI 4DV5E 5LMNI 4LF8E 3B82A 4DPWA 2E1RA 3OTOI 2HK3A 3ZKBA 1EA6A 2DEIA 4DV1I 2OI2A 2BV3A 1H72C 1IBMI 2E5LI 4JI4E 1DARA 4LFCI 2VQEI 4DV0I 4DV6E 2UU9E 3T1YE 1ZM9A 2ZITA 3ZZTA 2ZM6I 1XNQI 3PYGA 2HHHE 4GKKI 4DV4I 4JG4A 5A2QQ
chains in the Genus database with same CATH superfamily
2O3ZA 4DU8A 4GQUA 1N34E 1Z5BA 3DD6A 1IBKI 2PNLA 4BA2B 3V5RA 2V2ZA 2AJ4A 1NZ0A 4OKGA 2UXCE 1ZXNA 1H7UA 1N34I 4DV2I 2NPFA 4JI6I 4DPXA 4B3MI 2BM1A 4I3HA 1MU5A 4DV0E 4DV6I 2NN6E 4LF6I 2Z5BA 2PO0B 4DXLA 1PIEA 4K0KI 3QT7A 1PKPA 3P76A 2PO0A 2BA0G 4X66I 3KRNA 4DV1E 5DRRA 4MU3A 1WUUA 2JEBA 1EI1A 3PS2A 4DPUA 2HFUA 5K36F 4FW4A 1N33E 1XXEA 3WU3A 1HNZE 2HKEA 1RHYA 5IT9Q 1Y4SA 1N0VC 4OO1D 2C38A 3J81Q 4X64I 4LCHA 1KVKA 3JAMC 2UXDI 4X64E 1ELOA 5C0XD 4AIMA 4JI8I 5IWAE 1BKNA 2O1UA 3PYDA 1XNRI 3GCMA 3M6AA 3WU6A 4DR1E 2CVEA 1N0UA 1FWKA 1NHHA 4DUYI 1HNXI 2PO1A 4MU4A 4PRXA 4LF4E 3NZKA 1Y60A 5JEAB 1XMOI 2Z5CB 2VQEE 2C38B 4DR5E 3OTOE 4X66E 4MYTA 4LF8I 2IESA 4OZEA 3PYEA 4JYAI 4JI5I 3J7AG 2UUCE 2JEAA 1IBLI 4URLA 2UXBI 2GQ0A 4DUZE 5C0XA 4DR3E 1ZM4A 4OO1F 3V2UC 4LCFA 1FNMA 4JI3I 4PU9A 4DR1I 3LNUA 1Z0CA 4JV5I 2R3VA 4BA1A 2GO3A 1UDQA 4KHPI 4QNKA 3Q6MA 5K36D 2PNZB 1Z0WA 1B63A 3P3GA 3QT6A 4B3TE 4GKJI 5DNXA 2JE6B 1U2RA 4YY3E 4LPFA 4DR7I 1QZRA 4HXZA 4GKKE 4HY1A 1Y6ZA 4IFDE 4JI1I 4BA2A 4PRVA 4J3DA 5LL6R 2EFGA 2PNMA 3M85G 4B3ME 2UUBE 1Z0BA 2BA1D 2BM0A 2X36A 4OO1E 5GMEA 4IZJD 4JI3E 1FI4A 2PNZA 4B3RI 2Z5CA 5JEAD 4JI1E 2GO4A 2UU9I 2Z5BB 2CGEA 5C0XE 2A2DA 1IBLE 4ISAA 2VQFE 4OO1B 3CWVA 4JI5E 3J7AM 3WU4A 5FLXQ 4B3TI 1OYPA 2Q2EB 3QT8A 1ZM3A 4DR5I 5C0XB 1S16A 2ZBKB 1XNQE 3T1HI 1B62A 1K47A 3PS1A 3ZZUA 2V8PA 3P3EA 4LOMA 1N36I 3HJCA 3Q1QA 4OO1A 4OX9E 4AQYI 4MQYA 2IERA 1J5EE 2C39B 5C0XF 4LF7E 4JYAE 4DV3I 2GS8A 4U3DA 2J7KA 1XMQE 2IOQA 2UUCI 3Q6NA 1I94I 2IOPA 2HK2A 5BR8I 3ZKDA 2BR2B 2NN6B 1N33I 5K36E 3PS3A 2DEJA 4DPYA 1UDSA 3F0NA 4XTJA 2JEAB 2UXDE 4DR2E 4HACA 4YHHI 5IWAI 3H1CA 4DR6E 4N3OA 4OX9I 1Z0EA 4FWGA 3L7ZA 1Z5CA 4BA1B 3H4LA 1A6FA 1E3HA 3M7ND 1Y4UA 4NXME 3M85D 4X65I 3P3CA 3J80Q 5K36A 2CG9A 2V2QA 1HR0I 1XHKA 5IT9C 1I94E 1KIJA 3K1JA 1S4EA 4FW7A 4HYMA 4DV7E 2UUAE 4USKA 4USMA 4DU7A 4LFBE 4FW6A 1MX0A 3ZZ0A 3HULA 3B8HA 4LF5E 2AE8A 1HNWE 2UXCI 4JI2I 4JI6E 1NHIA 4R1FA 3ZM7A 1IBKE 1Z0VA 1Z0TA 4WUCA 4FN5A 4MYUA 4X62E 4IFDB 4FWDA 1IBME 2BA0D 4YY3I 5C0XC 1UEKA 4IS9A 4IFDD 4DR7E 3B4TA 1ZXMA 1KTVA 1Z59A 2VQFI 2WNRB 4MDTA 3PYFA 4AIDA 4M1KA 5LMNE 2WNRA 1D6TA 1USUA 2NN6A 4JV5E 1Z0GA 1NHJA 4DPTA 5LMUI 5JEAE 4LFAE 4JI2E 4DR3I 2VESA 4KHPE 4DV7I 1R6LA 5DROA 4MU0A 1OJ4A 4B3SI 5K36C 2F4VI 4LCGA 2C39A 4DR2I 4JI4I 4FW9A 4LFCE 2O1VA 3GMEA 4P52A 4HACB 5GMDA 1H7SA 1H73A 3UHMA 5L3JA 2PO2A 2F4VE 1HR0E 4FW3A 3U1KA 2NN6D 4DV3E 3J81C 1XMOE 1N32I 4LF4I 1XMQI 1Z5AA 4JI0I 4JI8E 3K85A 4DUYE 1HNXE 5EL9A 4ED4A 1J5EI 1P42A 1H74A 4RPFA 3QT5A 3T1HE 4IZKA 4YHHE 4QNJA 2X7IA 2XEXA 4IFDF 5JEAF 1HK7A 3WU5A 1RREA 1USVA 2HFSA 4JI7E 1ZM2A 3LTOA 4UTGA 2HKJA 4WUDA 3LPSA 3J80C 4OO1C 2NN6F 5EKWA 4K0KE 4LF9I 2F1DA 4AQYE 4LFBI 1XNRE 4DR4E 2UUBI 4B3SE 1OYRA 4NXNE 3JAMQ 2UUAI 1YH8A 4LF5I 1N36E 4IFDC 1FWLA 2R42A 4AM3A 2PO2B 3HKMA 4LFAI 4LF6E 1OYSA 3L7ZB 1MG7A 2JEBB 5A2QC 4LF9E 5JEAC 2O1TA 2WW4A 4NXMI 4DV2E 3M7NG 4UT4A 5FLXC 5ELWA 4X65E 3GONA 2J65A 3D4JA 1E3PA 2HHHI 3CDJA 4X62I 4B3RE 2A2CA 2ZM6E 1UDNA 2CZ9A 4NXNI 2V2VA 4DV4E 2VF3A 2Z5EA 4DUZI 4DR4I 1HNWI 2BA1G 4WUBA 4EMDA 1N32E 4U3BA 2PO1B 4IZJB 2LJPA 4Z7CA 3T1YI 2V34A 2WP8B 4KQVA 4IZJA 2E5LE 2UXBE 1VISA 1KKHA 3CDIA 4GKJE 4JI7I 1FKAE 5DRPA 5BR8E 4NBQA 1YHCA 2O1WA 4DR6I 5FWKA 3U1YA 4ZVIA 4Z7YA 4MU1A 4DV5I 4JI0E 1FJGE 4LF7I 1PVGA 3B78A 4FWHA 5DRQA 1FJGI 1RR9A 2BR2A 3GLLA 5LMUE 1UDOA 4P7AA 3K17A 2JE6A 2WP8A 1HNZI 4DV5E 5LMNI 4LF8E 3B82A 4DPWA 1Y5YA 2E1RA 3OTOI 4IZKB 4FW5A 2C37A 2HK3A 3ZKBA 1EA6A 2DEIA 4DV1I 2OI2A 2BV3A 1H72C 1IBMI 2NN6C 2E5LI 4LFCI 1DARA 4JI4E 2VQEI 4DV0I 4DV6E 2UU9E 1R6MA 3T1YE 5K36B 3PRYA 1ZM9A 5DNLA 5JEAA 3P06A 2ZITA 3ZZTA 2ZM6I 2C37B 2JT2A 1XNQI 3PYGA 2HHHE 4IFDA 4GKKI 4DV4I 1VI7A 4JG4A 5A2QQ
chains in the Genus database with same CATH topology
1N34E 4DU8A 1Z5BA 1IBKI 2PNLA 3V5RA 2V2ZA 2AJ4A 1NZ0A 2UXCE 1ZXNA 1H7UA 1N34I 4DV2I 2NPFA 4JI6I 4DPXA 4B3MI 2BM1A 4I3HA 1MU5A 4DV0E 4DV6I 4LF6I 2Z5BA 4DXLA 1PIEA 4K0KI 3QT7A 1PKPA 4X66I 4DV1E 1WUUA 1EI1A 4DPUA 2HFUA 1N33E 3WU3A 1HNZE 2HKEA 5IT9Q 1Y4SA 1N0VC 3J81Q 4X64I 1KVKA 3JAMC 2UXDI 4X64E 1ELOA 4JI8I 5IWAE 1BKNA 2O1UA 3PYDA 1XNRI 3M6AA 3WU6A 4DR1E 1N0UA 1FWKA 1NHHA 4DUYI 1HNXI 4PRXA 4LF4E 1XMOI 2Z5CB 2VQEE 4DR5E 3OTOE 4X66E 4MYTA 4LF8I 3PYEA 4JYAI 4JI5I 3J7AG 2UUCE 1IBLI 4URLA 2UXBI 2GQ0A 4DUZE 4DR3E 1ZM4A 3V2UC 1FNMA 4JI3I 4DR1I 4PU9A 3LNUA 1Z0CA 4JV5I 2R3VA 4KHPI 3Q6MA 1Z0WA 1B63A 3QT6A 4B3TE 4GKJI 1U2RA 4YY3E 4DR7I 1QZRA 4HXZA 4GKKE 4HY1A 1Y6ZA 4JI1I 4PRVA 5LL6R 2EFGA 2PNMA 4B3ME 2UUBE 1Z0BA 2BM0A 2X36A 5GMEA 4IZJD 4JI3E 1FI4A 4B3RI 2Z5CA 4JI1E 2UU9I 2Z5BB 2CGEA 1IBLE 2A2DA 2VQFE 3CWVA 4JI5E 3J7AM 3WU4A 5FLXQ 4B3TI 2Q2EB 3QT8A 1ZM3A 4DR5I 1S16A 2ZBKB 1XNQE 3T1HI 1B62A 1K47A 3ZZUA 2V8PA 1N36I 3HJCA 3Q1QA 4OX9E 4AQYI 1J5EE 4LF7E 4JYAE 4DV3I 2GS8A 2J7KA 1XMQE 2IOQA 2UUCI 3Q6NA 1I94I 2IOPA 2HK2A 5BR8I 3ZKDA 1N33I 2DEJA 4DPYA 3F0NA 4XTJA 2UXDE 4DR2E 4HACA 4YHHI 5IWAI 4DR6E 4N3OA 4OX9I 1Z0EA 4FWGA 1Z5CA 3H4LA 1A6FA 1Y4UA 4NXME 4X65I 3J80Q 2CG9A 2V2QA 1HR0I 1XHKA 5IT9C 1I94E 1KIJA 3K1JA 1S4EA 4HYMA 4DV7E 2UUAE 4USKA 4USMA 4DU7A 4LFBE 1MX0A 3ZZ0A 3HULA 3B8HA 4LF5E 1HNWE 2UXCI 4JI2I 4JI6E 1NHIA 4R1FA 3ZM7A 1IBKE 1Z0VA 1Z0TA 4WUCA 4FN5A 4MYUA 4X62E 4FWDA 1IBME 4YY3I 1UEKA 4DR7E 1ZXMA 1KTVA 1Z59A 2VQFI 3PYFA 4M1KA 5LMNE 1D6TA 1USUA 4JV5E 1Z0GA 1NHJA 4DPTA 5LMUI 4LFAE 4JI2E 4DR3I 4KHPE 4DV7I 1OJ4A 4B3SI 2F4VI 4DR2I 4JI4I 4FW9A 4LFCE 2O1VA 4P52A 4HACB 5GMDA 1H7SA 1H73A 5L3JA 2F4VE 1HR0E 4DV3E 3J81C 1XMOE 1N32I 4LF4I 1XMQI 1Z5AA 4JI0I 4JI8E 3K85A 4DUYE 1HNXE 4ED4A 1J5EI 1H74A 4RPFA 3QT5A 3T1HE 4IZKA 4YHHE 2X7IA 2XEXA 1HK7A 1RREA 3WU5A 1USVA 2HFSA 4JI7E 1ZM2A 3LTOA 4UTGA 2HKJA 4WUDA 3LPSA 3J80C 4K0KE 4LF9I 4AQYE 4LFBI 1XNRE 4DR4E 2UUBI 4B3SE 4NXNE 3JAMQ 2UUAI 4LF5I 1N36E 1FWLA 2R42A 4LFAI 4LF6E 1MG7A 5A2QC 4LF9E 2O1TA 2WW4A 4NXMI 4DV2E 4UT4A 5FLXC 4X65E 3GONA 3D4JA 2HHHI 4X62I 4B3RE 2A2CA 2ZM6E 2CZ9A 4NXNI 2V2VA 4DV4E 2VF3A 2Z5EA 4DUZI 4DR4I 1HNWI 4WUBA 4EMDA 1N32E 4IZJB 2LJPA 4Z7CA 3T1YI 2V34A 4KQVA 4IZJA 2E5LE 2UXBE 1VISA 1KKHA 4GKJE 4JI7I 1FKAE 5BR8E 2O1WA 4DR6I 5FWKA 4ZVIA 4Z7YA 4DV5I 4JI0E 1FJGE 4LF7I 1PVGA 3B78A 4FWHA 1FJGI 1RR9A 5LMUE 4P7AA 3K17A 1HNZI 4DV5E 5LMNI 4LF8E 3B82A 4DPWA 2E1RA 3OTOI 4IZKB 2HK3A 3ZKBA 1EA6A 2DEIA 4DV1I 2OI2A 2BV3A 1H72C 1IBMI 2E5LI 4LFCI 1DARA 4JI4E 2VQEI 4DV0I 4DV6E 2UU9E 3T1YE 3PRYA 1ZM9A 3P06A 2ZITA 3ZZTA 2ZM6I 1XNQI 3PYGA 2HHHE 4GKKI 4DV4I 4JG4A 5A2QQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 E;  4DU8 A;  1Z5B A;  1IBK I;  3V5R A;  2V2Z A;  2AJ4 A;  1NZ0 A;  2UXC E;  1ZXN A;  1H7U A;  1N34 I;  4DV2 I;  2NPF A;  4JI6 I;  4DPX A;  4B3M I;  2BM1 A;  4I3H A;  1MU5 A;  4LF6 I;  4DV0 E;  4DV6 I;  4DXL A;  1PIE A;  4K0K I;  3QT7 A;  1PKP A;  4X66 I;  4DV1 E;  1WUU A;  1EI1 A;  4DPU A;  2HFU A;  1N33 E;  3WU3 A;  1HNZ E;  2HKE A;  5IT9 Q;  1N0V C;  3J81 Q;  4X64 I;  1KVK A;  3JAM C;  2UXD I;  4X64 E;  1ELO A;  4JI8 I;  5IWA E;  1BKN A;  3PYD A;  1XNR I;  3M6A A;  3WU6 A;  4DR1 E;  1N0U A;  1FWK A;  1NHH A;  4DUY I;  1HNX I;  4PRX A;  4LF4 E;  1XMO I;  2VQE E;  4DR5 E;  3OTO E;  4X66 E;  4MYT A;  4LF8 I;  3PYE A;  4JYA I;  4JI5 I;  3J7A G;  2UUC E;  1IBL I;  4URL A;  2UXB I;  4DUZ E;  4DR3 E;  1ZM4 A;  3V2U C;  4JI3 I;  1FNM A;  4DR1 I;  4PU9 A;  3LNU A;  1Z0C A;  4JV5 I;  2R3V A;  4KHP I;  1Z0W A;  1B63 A;  3QT6 A;  4B3T E;  4GKJ I;  1U2R A;  4YY3 E;  4DR7 I;  1QZR A;  4HXZ A;  4GKK E;  4HY1 A;  4JI1 I;  4PRV A;  5LL6 R;  2EFG A;  4B3M E;  2UUB E;  1Z0B A;  2BM0 A;  2X36 A;  5GME A;  4JI3 E;  1FI4 A;  4B3R I;  4JI1 E;  2UU9 I;  1IBL E;  2A2D A;  2VQF E;  3CWV A;  4JI5 E;  3J7A M;  3WU4 A;  5FLX Q;  4B3T I;  2Q2E B;  3QT8 A;  1ZM3 A;  4DR5 I;  1S16 A;  2ZBK B;  1XNQ E;  3T1H I;  1B62 A;  1K47 A;  3ZZU A;  2V8P A;  1N36 I;  3Q1Q A;  4OX9 E;  4AQY I;  1J5E E;  4LF7 E;  4JYA E;  4DV3 I;  2GS8 A;  2J7K A;  1XMQ E;  2UUC I;  1I94 I;  2HK2 A;  5BR8 I;  3ZKD A;  1N33 I;  2DEJ A;  4DPY A;  3F0N A;  4XTJ A;  2UXD E;  4DR2 E;  4HAC A;  4YHH I;  5IWA I;  4DR6 E;  4OX9 I;  1Z0E A;  4FWG A;  1Z5C A;  3H4L A;  1A6F A;  4NXM E;  4X65 I;  3J80 Q;  2V2Q A;  1HR0 I;  1XHK A;  5IT9 C;  1I94 E;  1KIJ A;  3K1J A;  1S4E A;  4HYM A;  4DV7 E;  2UUA E;  4USK A;  4USM A;  4DU7 A;  4LFB E;  1MX0 A;  3ZZ0 A;  3HUL A;  3B8H A;  4LF5 E;  1HNW E;  2UXC I;  4JI2 I;  4JI6 E;  1NHI A;  4R1F A;  3ZM7 A;  1IBK E;  1Z0V A;  1Z0T A;  4WUC A;  4FN5 A;  4MYU A;  4X62 E;  4FWD A;  1IBM E;  4YY3 I;  1UEK A;  4DR7 E;  1ZXM A;  1KTV A;  1Z59 A;  2VQF I;  3PYF A;  4M1K A;  5LMN E;  1D6T A;  4JV5 E;  1Z0G A;  1NHJ A;  4DPT A;  5LMU I;  4LFA E;  4JI2 E;  4DR3 I;  4KHP E;  4DV7 I;  1OJ4 A;  4B3S I;  2F4V I;  4DR2 I;  4JI4 I;  4FW9 A;  4LFC E;  4P52 A;  4HAC B;  5GMD A;  1H7S A;  1H73 A;  5L3J A;  2F4V E;  1HR0 E;  4DV3 E;  3J81 C;  1XMO E;  1N32 I;  4LF4 I;  1XMQ I;  1Z5A A;  4JI0 I;  4JI8 E;  4DUY E;  1HNX E;  4ED4 A;  1J5E I;  1H74 A;  4RPF A;  3QT5 A;  3T1H E;  4YHH E;  2X7I A;  2XEX A;  1RRE A;  3WU5 A;  2HFS A;  4JI7 E;  1ZM2 A;  3LTO A;  4UTG A;  2HKJ A;  4WUD A;  3LPS A;  3J80 C;  4K0K E;  4LF9 I;  4AQY E;  4LFB I;  1XNR E;  4DR4 E;  2UUB I;  4B3S E;  4NXN E;  3JAM Q;  2UUA I;  4LF5 I;  1N36 E;  1FWL A;  2R42 A;  4LFA I;  4LF6 E;  1MG7 A;  5A2Q C;  4LF9 E;  2WW4 A;  4NXM I;  4DV2 E;  4UT4 A;  5FLX C;  4X65 E;  3GON A;  3D4J A;  2HHH I;  4X62 I;  4B3R E;  2A2C A;  2ZM6 E;  2CZ9 A;  4NXN I;  2V2V A;  4DV4 E;  2VF3 A;  4DUZ I;  4DR4 I;  1HNW I;  4WUB A;  4EMD A;  1N32 E;  2LJP A;  4Z7C A;  3T1Y I;  2V34 A;  4KQV A;  2E5L E;  2UXB E;  1VIS A;  1KKH A;  4GKJ E;  4JI7 I;  1FKA E;  5BR8 E;  4DR6 I;  4ZVI A;  4Z7Y A;  4DV5 I;  4JI0 E;  1FJG E;  4LF7 I;  1PVG A;  3B78 A;  4FWH A;  1FJG I;  1RR9 A;  5LMU E;  4P7A A;  3K17 A;  1HNZ I;  4DV5 E;  5LMN I;  4LF8 E;  3B82 A;  4DPW A;  2E1R A;  3OTO I;  2HK3 A;  3ZKB A;  1EA6 A;  2DEI A;  4DV1 I;  2OI2 A;  2BV3 A;  1H72 C;  1IBM I;  2E5L I;  4JI4 E;  1DAR A;  4LFC I;  2VQE I;  4DV0 I;  4DV6 E;  2UU9 E;  3T1Y E;  1ZM9 A;  2ZIT A;  3ZZT A;  2ZM6 I;  1XNQ I;  3PYG A;  2HHH E;  4GKK I;  4DV4 I;  4JG4 A;  5A2Q Q; 
#chains in the Genus database with same CATH topology
 2O3Z A;  4DU8 A;  4GQU A;  1N34 E;  1Z5B A;  3DD6 A;  1IBK I;  2PNL A;  4BA2 B;  3V5R A;  2V2Z A;  2AJ4 A;  1NZ0 A;  4OKG A;  2UXC E;  1ZXN A;  1H7U A;  1N34 I;  4DV2 I;  2NPF A;  4JI6 I;  4DPX A;  4B3M I;  2BM1 A;  4I3H A;  1MU5 A;  4DV0 E;  4DV6 I;  2NN6 E;  4LF6 I;  2Z5B A;  2PO0 B;  4DXL A;  1PIE A;  4K0K I;  3QT7 A;  1PKP A;  3P76 A;  2PO0 A;  2BA0 G;  4X66 I;  3KRN A;  4DV1 E;  5DRR A;  4MU3 A;  1WUU A;  2JEB A;  1EI1 A;  3PS2 A;  4DPU A;  2HFU A;  5K36 F;  4FW4 A;  1N33 E;  1XXE A;  3WU3 A;  1HNZ E;  2HKE A;  1RHY A;  5IT9 Q;  1Y4S A;  1N0V C;  4OO1 D;  2C38 A;  3J81 Q;  4X64 I;  4LCH A;  1KVK A;  3JAM C;  2UXD I;  4X64 E;  1ELO A;  5C0X D;  4AIM A;  4JI8 I;  5IWA E;  1BKN A;  2O1U A;  3PYD A;  1XNR I;  3GCM A;  3M6A A;  3WU6 A;  4DR1 E;  2CVE A;  1N0U A;  1FWK A;  1NHH A;  4DUY I;  1HNX I;  2PO1 A;  4MU4 A;  4PRX A;  4LF4 E;  3NZK A;  1Y60 A;  5JEA B;  1XMO I;  2Z5C B;  2VQE E;  2C38 B;  4DR5 E;  3OTO E;  4X66 E;  4MYT A;  4LF8 I;  2IES A;  4OZE A;  3PYE A;  4JYA I;  4JI5 I;  3J7A G;  2UUC E;  2JEA A;  1IBL I;  4URL A;  2UXB I;  2GQ0 A;  4DUZ E;  5C0X A;  4DR3 E;  1ZM4 A;  4OO1 F;  3V2U C;  4LCF A;  1FNM A;  4JI3 I;  4PU9 A;  4DR1 I;  3LNU A;  1Z0C A;  4JV5 I;  2R3V A;  4BA1 A;  2GO3 A;  1UDQ A;  4KHP I;  4QNK A;  3Q6M A;  5K36 D;  2PNZ B;  1Z0W A;  1B63 A;  3P3G A;  3QT6 A;  4B3T E;  4GKJ I;  5DNX A;  2JE6 B;  1U2R A;  4YY3 E;  4LPF A;  4DR7 I;  1QZR A;  4HXZ A;  4GKK E;  4HY1 A;  1Y6Z A;  4IFD E;  4JI1 I;  4BA2 A;  4PRV A;  4J3D A;  5LL6 R;  2EFG A;  2PNM A;  3M85 G;  4B3M E;  2UUB E;  1Z0B A;  2BA1 D;  2BM0 A;  2X36 A;  4OO1 E;  5GME A;  4IZJ D;  4JI3 E;  1FI4 A;  2PNZ A;  4B3R I;  2Z5C A;  5JEA D;  4JI1 E;  2GO4 A;  2UU9 I;  2Z5B B;  2CGE A;  5C0X E;  2A2D A;  1IBL E;  4ISA A;  2VQF E;  4OO1 B;  3CWV A;  4JI5 E;  3J7A M;  3WU4 A;  5FLX Q;  4B3T I;  1OYP A;  2Q2E B;  3QT8 A;  1ZM3 A;  4DR5 I;  5C0X B;  1S16 A;  2ZBK B;  1XNQ E;  3T1H I;  1B62 A;  1K47 A;  3PS1 A;  3ZZU A;  2V8P A;  3P3E A;  4LOM A;  1N36 I;  3HJC A;  3Q1Q A;  4OO1 A;  4OX9 E;  4AQY I;  4MQY A;  2IER A;  1J5E E;  2C39 B;  5C0X F;  4LF7 E;  4JYA E;  4DV3 I;  2GS8 A;  4U3D A;  2J7K A;  1XMQ E;  2IOQ A;  2UUC I;  3Q6N A;  1I94 I;  2IOP A;  2HK2 A;  5BR8 I;  3ZKD A;  2BR2 B;  2NN6 B;  1N33 I;  5K36 E;  3PS3 A;  2DEJ A;  4DPY A;  1UDS A;  3F0N A;  4XTJ A;  2JEA B;  2UXD E;  4DR2 E;  4HAC A;  4YHH I;  5IWA I;  3H1C A;  4DR6 E;  4N3O A;  4OX9 I;  1Z0E A;  4FWG A;  3L7Z A;  1Z5C A;  4BA1 B;  3H4L A;  1A6F A;  1E3H A;  3M7N D;  1Y4U A;  4NXM E;  3M85 D;  4X65 I;  3P3C A;  3J80 Q;  5K36 A;  2CG9 A;  2V2Q A;  1HR0 I;  1XHK A;  5IT9 C;  1I94 E;  1KIJ A;  3K1J A;  1S4E A;  4FW7 A;  4HYM A;  4DV7 E;  2UUA E;  4USK A;  4USM A;  4DU7 A;  4LFB E;  4FW6 A;  1MX0 A;  3ZZ0 A;  3HUL A;  3B8H A;  4LF5 E;  2AE8 A;  1HNW E;  2UXC I;  4JI2 I;  4JI6 E;  1NHI A;  4R1F A;  3ZM7 A;  1IBK E;  1Z0V A;  1Z0T A;  4WUC A;  4FN5 A;  4MYU A;  4X62 E;  4IFD B;  4FWD A;  1IBM E;  2BA0 D;  4YY3 I;  5C0X C;  1UEK A;  4IS9 A;  4IFD D;  4DR7 E;  3B4T A;  1ZXM A;  1KTV A;  1Z59 A;  2VQF I;  2WNR B;  4MDT A;  3PYF A;  4AID A;  4M1K A;  5LMN E;  2WNR A;  1D6T A;  1USU A;  2NN6 A;  4JV5 E;  1Z0G A;  1NHJ A;  4DPT A;  5LMU I;  5JEA E;  4LFA E;  4JI2 E;  4DR3 I;  2VES A;  4KHP E;  4DV7 I;  1R6L A;  5DRO A;  4MU0 A;  1OJ4 A;  4B3S I;  5K36 C;  2F4V I;  4LCG A;  2C39 A;  4DR2 I;  4JI4 I;  4FW9 A;  4LFC E;  2O1V A;  3GME A;  4P52 A;  4HAC B;  5GMD A;  1H7S A;  1H73 A;  3UHM A;  5L3J A;  2PO2 A;  2F4V E;  1HR0 E;  4FW3 A;  3U1K A;  2NN6 D;  4DV3 E;  3J81 C;  1XMO E;  1N32 I;  4LF4 I;  1XMQ I;  1Z5A A;  4JI0 I;  4JI8 E;  3K85 A;  4DUY E;  1HNX E;  5EL9 A;  4ED4 A;  1J5E I;  1P42 A;  1H74 A;  4RPF A;  3QT5 A;  3T1H E;  4IZK A;  4YHH E;  4QNJ A;  2X7I A;  2XEX A;  4IFD F;  5JEA F;  1HK7 A;  3WU5 A;  1RRE A;  1USV A;  2HFS A;  4JI7 E;  1ZM2 A;  3LTO A;  4UTG A;  2HKJ A;  4WUD A;  3LPS A;  3J80 C;  4OO1 C;  2NN6 F;  5EKW A;  4K0K E;  4LF9 I;  2F1D A;  4AQY E;  4LFB I;  1XNR E;  4DR4 E;  2UUB I;  4B3S E;  1OYR A;  4NXN E;  3JAM Q;  2UUA I;  1YH8 A;  4LF5 I;  1N36 E;  4IFD C;  1FWL A;  2R42 A;  4AM3 A;  2PO2 B;  3HKM A;  4LFA I;  4LF6 E;  1OYS A;  3L7Z B;  1MG7 A;  2JEB B;  5A2Q C;  4LF9 E;  5JEA C;  2O1T A;  2WW4 A;  4NXM I;  4DV2 E;  3M7N G;  4UT4 A;  5FLX C;  5ELW A;  4X65 E;  3GON A;  2J65 A;  3D4J A;  1E3P A;  2HHH I;  3CDJ A;  4X62 I;  4B3R E;  2A2C A;  2ZM6 E;  1UDN A;  2CZ9 A;  4NXN I;  2V2V A;  4DV4 E;  2VF3 A;  2Z5E A;  4DUZ I;  4DR4 I;  1HNW I;  2BA1 G;  4WUB A;  4EMD A;  1N32 E;  4U3B A;  2PO1 B;  4IZJ B;  2LJP A;  4Z7C A;  3T1Y I;  2V34 A;  2WP8 B;  4KQV A;  4IZJ A;  2E5L E;  2UXB E;  1VIS A;  1KKH A;  3CDI A;  4GKJ E;  4JI7 I;  1FKA E;  5DRP A;  5BR8 E;  4NBQ A;  1YHC A;  2O1W A;  4DR6 I;  5FWK A;  3U1Y A;  4ZVI A;  4Z7Y A;  4MU1 A;  4DV5 I;  4JI0 E;  1FJG E;  4LF7 I;  1PVG A;  3B78 A;  4FWH A;  5DRQ A;  1FJG I;  1RR9 A;  2BR2 A;  3GLL A;  5LMU E;  1UDO A;  4P7A A;  3K17 A;  2JE6 A;  2WP8 A;  1HNZ I;  4DV5 E;  5LMN I;  4LF8 E;  3B82 A;  4DPW A;  1Y5Y A;  2E1R A;  3OTO I;  4IZK B;  4FW5 A;  2C37 A;  2HK3 A;  3ZKB A;  1EA6 A;  2DEI A;  4DV1 I;  2OI2 A;  2BV3 A;  1H72 C;  1IBM I;  2NN6 C;  2E5L I;  4LFC I;  1DAR A;  4JI4 E;  2VQE I;  4DV0 I;  4DV6 E;  2UU9 E;  1R6M A;  3T1Y E;  5K36 B;  3PRY A;  1ZM9 A;  5DNL A;  5JEA A;  3P06 A;  2ZIT A;  3ZZT A;  2ZM6 I;  2C37 B;  2JT2 A;  1XNQ I;  3PYG A;  2HHH E;  4IFD A;  4GKK I;  4DV4 I;  1VI7 A;  4JG4 A;  5A2Q Q; 
#chains in the Genus database with same CATH homology
 1N34 E;  4DU8 A;  1Z5B A;  1IBK I;  2PNL A;  3V5R A;  2V2Z A;  2AJ4 A;  1NZ0 A;  2UXC E;  1ZXN A;  1H7U A;  1N34 I;  4DV2 I;  2NPF A;  4JI6 I;  4DPX A;  4B3M I;  2BM1 A;  4I3H A;  1MU5 A;  4DV0 E;  4DV6 I;  4LF6 I;  2Z5B A;  4DXL A;  1PIE A;  4K0K I;  3QT7 A;  1PKP A;  4X66 I;  4DV1 E;  1WUU A;  1EI1 A;  4DPU A;  2HFU A;  1N33 E;  3WU3 A;  1HNZ E;  2HKE A;  5IT9 Q;  1Y4S A;  1N0V C;  3J81 Q;  4X64 I;  1KVK A;  3JAM C;  2UXD I;  4X64 E;  1ELO A;  4JI8 I;  5IWA E;  1BKN A;  2O1U A;  3PYD A;  1XNR I;  3M6A A;  3WU6 A;  4DR1 E;  1N0U A;  1FWK A;  1NHH A;  4DUY I;  1HNX I;  4PRX A;  4LF4 E;  1XMO I;  2Z5C B;  2VQE E;  4DR5 E;  3OTO E;  4X66 E;  4MYT A;  4LF8 I;  3PYE A;  4JYA I;  4JI5 I;  3J7A G;  2UUC E;  1IBL I;  4URL A;  2UXB I;  2GQ0 A;  4DUZ E;  4DR3 E;  1ZM4 A;  3V2U C;  1FNM A;  4JI3 I;  4DR1 I;  4PU9 A;  3LNU A;  1Z0C A;  4JV5 I;  2R3V A;  4KHP I;  3Q6M A;  1Z0W A;  1B63 A;  3QT6 A;  4B3T E;  4GKJ I;  1U2R A;  4YY3 E;  4DR7 I;  1QZR A;  4HXZ A;  4GKK E;  4HY1 A;  1Y6Z A;  4JI1 I;  4PRV A;  5LL6 R;  2EFG A;  2PNM A;  4B3M E;  2UUB E;  1Z0B A;  2BM0 A;  2X36 A;  5GME A;  4IZJ D;  4JI3 E;  1FI4 A;  4B3R I;  2Z5C A;  4JI1 E;  2UU9 I;  2Z5B B;  2CGE A;  1IBL E;  2A2D A;  2VQF E;  3CWV A;  4JI5 E;  3J7A M;  3WU4 A;  5FLX Q;  4B3T I;  2Q2E B;  3QT8 A;  1ZM3 A;  4DR5 I;  1S16 A;  2ZBK B;  1XNQ E;  3T1H I;  1B62 A;  1K47 A;  3ZZU A;  2V8P A;  1N36 I;  3HJC A;  3Q1Q A;  4OX9 E;  4AQY I;  1J5E E;  4LF7 E;  4JYA E;  4DV3 I;  2GS8 A;  2J7K A;  1XMQ E;  2IOQ A;  2UUC I;  3Q6N A;  1I94 I;  2IOP A;  2HK2 A;  5BR8 I;  3ZKD A;  1N33 I;  2DEJ A;  4DPY A;  3F0N A;  4XTJ A;  2UXD E;  4DR2 E;  4HAC A;  4YHH I;  5IWA I;  4DR6 E;  4N3O A;  4OX9 I;  1Z0E A;  4FWG A;  1Z5C A;  3H4L A;  1A6F A;  1Y4U A;  4NXM E;  4X65 I;  3J80 Q;  2CG9 A;  2V2Q A;  1HR0 I;  1XHK A;  5IT9 C;  1I94 E;  1KIJ A;  3K1J A;  1S4E A;  4HYM A;  4DV7 E;  2UUA E;  4USK A;  4USM A;  4DU7 A;  4LFB E;  1MX0 A;  3ZZ0 A;  3HUL A;  3B8H A;  4LF5 E;  1HNW E;  2UXC I;  4JI2 I;  4JI6 E;  1NHI A;  4R1F A;  3ZM7 A;  1IBK E;  1Z0V A;  1Z0T A;  4WUC A;  4FN5 A;  4MYU A;  4X62 E;  4FWD A;  1IBM E;  4YY3 I;  1UEK A;  4DR7 E;  1ZXM A;  1KTV A;  1Z59 A;  2VQF I;  3PYF A;  4M1K A;  5LMN E;  1D6T A;  1USU A;  4JV5 E;  1Z0G A;  1NHJ A;  4DPT A;  5LMU I;  4LFA E;  4JI2 E;  4DR3 I;  4KHP E;  4DV7 I;  1OJ4 A;  4B3S I;  2F4V I;  4DR2 I;  4JI4 I;  4FW9 A;  4LFC E;  2O1V A;  4P52 A;  4HAC B;  5GMD A;  1H7S A;  1H73 A;  5L3J A;  2F4V E;  1HR0 E;  4DV3 E;  3J81 C;  1XMO E;  1N32 I;  4LF4 I;  1XMQ I;  1Z5A A;  4JI0 I;  4JI8 E;  3K85 A;  4DUY E;  1HNX E;  4ED4 A;  1J5E I;  1H74 A;  4RPF A;  3QT5 A;  3T1H E;  4IZK A;  4YHH E;  2X7I A;  2XEX A;  1HK7 A;  1RRE A;  3WU5 A;  1USV A;  2HFS A;  4JI7 E;  1ZM2 A;  3LTO A;  4UTG A;  2HKJ A;  4WUD A;  3LPS A;  3J80 C;  4K0K E;  4LF9 I;  4AQY E;  4LFB I;  1XNR E;  4DR4 E;  2UUB I;  4B3S E;  4NXN E;  3JAM Q;  2UUA I;  4LF5 I;  1N36 E;  1FWL A;  2R42 A;  4LFA I;  4LF6 E;  1MG7 A;  5A2Q C;  4LF9 E;  2O1T A;  2WW4 A;  4NXM I;  4DV2 E;  4UT4 A;  5FLX C;  4X65 E;  3GON A;  3D4J A;  2HHH I;  4X62 I;  4B3R E;  2A2C A;  2ZM6 E;  2CZ9 A;  4NXN I;  2V2V A;  4DV4 E;  2VF3 A;  2Z5E A;  4DUZ I;  4DR4 I;  1HNW I;  4WUB A;  4EMD A;  1N32 E;  4IZJ B;  2LJP A;  4Z7C A;  3T1Y I;  2V34 A;  4KQV A;  4IZJ A;  2E5L E;  2UXB E;  1VIS A;  1KKH A;  4GKJ E;  4JI7 I;  1FKA E;  5BR8 E;  2O1W A;  4DR6 I;  5FWK A;  4ZVI A;  4Z7Y A;  4DV5 I;  4JI0 E;  1FJG E;  4LF7 I;  1PVG A;  3B78 A;  4FWH A;  1FJG I;  1RR9 A;  5LMU E;  4P7A A;  3K17 A;  1HNZ I;  4DV5 E;  5LMN I;  4LF8 E;  3B82 A;  4DPW A;  2E1R A;  3OTO I;  4IZK B;  2HK3 A;  3ZKB A;  1EA6 A;  2DEI A;  4DV1 I;  2OI2 A;  2BV3 A;  1H72 C;  1IBM I;  2E5L I;  4LFC I;  1DAR A;  4JI4 E;  2VQE I;  4DV0 I;  4DV6 E;  2UU9 E;  3T1Y E;  3PRY A;  1ZM9 A;  3P06 A;  2ZIT A;  3ZZT A;  2ZM6 I;  1XNQ I;  3PYG A;  2HHH E;  4GKK I;  4DV4 I;  4JG4 A;  5A2Q Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...