2PO2A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with cdp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 73
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po2A01
2C39B 4NBQA 2C38A 2JEBA 4OO1F 3GLLA 4BA2B 2PO0A 2PO1A 4IFDE 4OO1D 3H1CA 4BA1A 4OO1B 2NN6C 4AIDA 3CDIA 1R6MA 2WP8B 4OO1E 2NN6F 4IFDF 2JE6B 5JEAC 2NN6D 2NN6B 2BA0G 2JE6A 2NN6A 4IFDA 2NN6E 2PNZA 5JEAD 2C39A 1E3PA 3M85D 3M7ND 1OYRA 4BA2A 3L7ZB 4OO1A 5K36C 1UDSA 2WP8A 2PO2B 5C0XC 1UDNA 1E3HA 4AM3A 5K36F 5K36D 2BA1D 5K36B 5JEAF 2C37B 5C0XF 3U1KA 5C0XD 5JEAB 5C0XB 5K36E 2BR2B 4AIMA 3HKMA 5JEAA 3DD6A 3M85G 5JEAE 5C0XE 3M7NG 3GMEA 2BR2A 2JEAB 2PO0B 2PO1B 1UDQA 3L7ZA 4BA1B 3KRNA 1OYPA 2JEAA 3B4TA 2PO2A 4IFDC 2WNRB 2BA1G 3GCMA 5K36A 2C37A 2WNRA 1R6LA 5C0XA 2BA0D 4OO1C 2C38B 4IFDD 2JEBB 4IFDB 3CDJA 1OYSA 1UDOA 2PNZB
chains in the Genus database with same CATH superfamily
2C39B 3OTOE 4OO1F 2A2CA 3HJCA 4BA2B 2PO0A 4IZKB 1RR9A 2PNZB 3WU5A 4OO1D 3UHMA 2V2ZA 4AIDA 4DPWA 2VQFI 2O3ZA 2GS8A 3ZKBA 3PYDA 1HNZE 1H7UA 4HACA 1N0UA 3PS1A 1ZM2A 1FI4A 3T1HI 4FW5A 4DR6I 4DXLA 1J5EI 3J81C 4U3BA 1EI1A 4LF9E 1Z0CA 4U3DA 2BA0G 3ZKDA 1N32E 2JE6A 3ZZ0A 1Y6ZA 2Z5EA 2V34A 1H74A 5JEAD 1Z0BA 4I3HA 4DUZE 3WU6A 3JAMQ 3M85D 3ZZTA 1KKHA 4IZJD 1N36I 3K17A 2HHHI 4DV5I 2HK3A 5EL9A 4B3TI 4JI1E 4DV0I 4DV7I 4ISAA 4USKA 5IWAI 1VI7A 4B3RE 4QNJA 4USMA 4KQVA 2WP8A 2HKJA 2PO2B 3T1HE 1UDNA 1J5EE 1E3HA 4DV1I 1IBME 4DV2I 1A6FA 2BA1D 3Q6NA 4JI0I 4DR1I 2C37B 1HNXE 4M1KA 5BR8I 3B78A 3T1YE 5JEAB 2Z5BB 5C0XB 2UXDI 4MQYA 2V2QA 4DU8A 5DRRA 3HKMA 2IOPA 4J3DA 4DV3E 5DROA 4DV0E 1N34I 3M7NG 3CWVA 4N3OA 2UXCE 2PO1B 4K0KI 1ZM4A 1HK7A 2ZM6I 3KRNA 4DV1E 1S4EA 1D6TA 4YY3E 1OYPA 1PVGA 4DV2E 4DR2E 4JI3I 4LFBI 4LF7E 4DPXA 1S16A 1XXEA 1B63A 2DEJA 4DR1E 2HFUA 4GKJE 2E5LE 1EA6A 3GCMA 5LMUE 5K36A 3J7AM 2LJPA 2UXDE 3D4JA 3K85A 4PRVA 1R6LA 1B62A 4LF4E 2C38B 4WUBA 4OX9I 2JEBB 3J80C 1N34E 4IFDD 1VISA 4LOMA 4JI4I 2IOQA 2Z5CA 2O1UA 2ZM6E 4JV5I 5IT9C 2UUCE 4JI3E 4HY1A 2NN6C 2Q2EB 4P7AA 1HNWI 2XEXA 5FLXQ 2VF3A 2VQEI 1XMQI 4HYMA 5A2QC 5DRPA 1HR0E 4NXME 3PRYA 4DR3I 2UU9I 4JI8I 1NHJA 3ZZUA 4OX9E 2UXBI 1PIEA 4X64I 3QT8A 1ZM3A 1XMOI 1XNRI 2E1RA 4JI4E 3V2UC 2NN6E 2F4VI 1NHHA 4GKKI 2UUBI 4JI5E 1OYRA 1HNWE 1XMQE 4LF6I 1N33E 4OO1A 5K36C 1YH8A 4DUYI 1FKAE 1USUA 2UXBE 4DPTA 4X62I 4FWHA 5JEAF 5C0XF 1XMOE 2R3VA 4PU9A 3P3EA 3U1KA 5C0XD 4DR4I 5K36E 2VQFE 2GQ0A 3P06A 4LF6E 5JEAA 2Z5BA 4DUYE 2JEAB 2PO0B 4IZJA 4MU0A 4DR6E 2J7KA 3L7ZA 4IS9A 3QT5A 2CG9A 2CVEA 3PYGA 1USVA 3Q6MA 2WW4A 4JI6I 1I94I 4PRXA 1Z59A 4LFCI 4DR4E 4DV4I 1BKNA 3LTOA 2AJ4A 4HXZA 4DU7A 1N36E 2HHHE 4DV5E 5LL6R 3Q1QA 2BA0D 4B3TE 1XNQI 4DV7E 4OO1C 5IWAE 1MX0A 3CDJA 2PNMA 2O1VA 2C38A 2JEBA 3M6AA 4JI7I 4JG4A 3B8HA 2NPFA 4LFAI 4JYAI 4KHPI 3H1CA 4BA1A 4X66I 3V5RA 1NZ0A 4JI0E 3PYFA 4OZEA 3H4LA 4FW4A 3CDIA 5BR8E 2EFGA 4JI6E 1R6MA 3J81Q 2WP8B 5L3JA 4DPUA 4DV4E 5DRQA 4OO1E 4IFDF 4NXNI 4WUDA 4YHHI 5JEAC 1OJ4A 3GONA 2HK2A 2NN6B 1XNQE 4LF8I 4K0KE 2J65A 4RPFA 3PS2A 4IFDA 2PNZA 2C39A 4LFBE 1IBKI 1Z5BA 3M7ND 2O1TA 4BA2A 2O1WA 4IZKA 4LPFA 2OI2A 4UTGA 2VESA 5FWKA 4DR5I 1UDSA 3JAMC 4YHHE 1FWKA 3OTOI 4AM3A 1QZRA 1Z0EA 3NZKA 4LF8E 3QT6A 5K36B 1KTVA 4FW7A 4JV5E 1Y5YA 2IERA 1Y4UA 4LCFA 4DV6I 4B3MI 4JI2I 1K47A 2BR2B 1WUUA 3P3CA 2VQEE 3F0NA 3HULA 3PYEA 3DD6A 3M85G 4LF9I 2V2VA 5DNLA 4DR3E 1ZM9A 2BM0A 4Z7CA 1UDQA 1UEKA 2PNLA 4LCHA 2UU9E 4JI8E 5LMNI 2JEAA 2ZBKB 2IESA 3WU3A 1RREA 2PO2A 5GMEA 2GO4A 4X64E 4DUZI 4MYTA 2DEIA 1XNRE 4IFDC 1Y4SA 2WNRB 4FWDA 2BA1G 2BV3A 4JI1I 1FWLA 4MDTA 3J80Q 2F4VE 4FN5A 4GKKE 2C37A 4DV6E 4B3RI 4B3ME 2UUBE 4JI2E 1Y60A 1MG7A 1KIJA 2CGEA 5C0XA 4LCGA 1IBMI 4XTJA 5IT9Q 1OYSA 3PS3A 1UDOA 4AQYI 1HNXI 1Z0TA 4NBQA 4WUCA 1YHCA 5A2QQ 3T1YI 3GLLA 1PKPA 5LMNE 2PO1A 4IFDE 1Z5CA 4X62E 4OO1B 4HACB 3LNUA 1Z0VA 2JT2A 1ZXMA 2GO3A 2R42A 4DV3I 2UUAI 4ED4A 4MU4A 1MU5A 1Z0WA 1P42A 2NN6F 4URLA 2UXCI 1Z5AA 2V8PA 1KVKA 2JE6B 5FLXC 2A2DA 2NN6D 2X7IA 1H72C 4QNKA 4LF5I 3ZM7A 4YY3I 4DR2I 1RHYA 4MYUA 4LF7I 4AQYE 2NN6A 4MU1A 3LPSA 4GKJI 2E5LI 1XHKA 1E3PA 5LMUI 4DR7I 3WU4A 1I94E 4IZJB 1Z0GA 2HKEA 3L7ZB 4LF4I 2UUAE 4LFCE 5DNXA 3U1YA 1ELOA 4DPYA 1FJGI 4UT4A 4FWGA 1H7SA 5C0XC 1DARA 4X65I 4LF5E 5K36F 5EKWA 2UUCI 4FW6A 5K36D 4GQUA 5ELWA 4JI7E 1NHIA 3QT7A 4FW3A 1HR0I 4B3SI 4LFAE 4JYAE 4NXMI 4KHPE 1IBLI 4X66E 4DR7E 2AE8A 4AIMA 4FW9A 4EMDA 4Z7YA 1H73A 5JEAE 5C0XE 3GMEA 4ZVIA 2BR2A 4NXNE 1FJGE 4BA1B 4X65E 4OKGA 1FNMA 3P3GA 5GMDA 3B4TA 2CZ9A 2BM1A 3P76A 2F1DA 4JI5I 4MU3A 1N33I 3J7AG 2HFSA 1HNZI 4B3SE 1ZXNA 1IBLE 3K1JA 2ZITA 1IBKE 2WNRA 3B82A 4R1FA 1N0VC 1U2RA 4IFDB 2Z5CB 2X36A 4DR5E 4P52A 1N32I
chains in the Genus database with same CATH topology
2C39B 4NBQA 2C38A 2JEBA 4OO1F 3GLLA 4BA2B 2PO0A 2PO1A 4IFDE 4OO1D 3H1CA 4BA1A 4OO1B 2NN6C 4AIDA 3CDIA 1R6MA 2WP8B 4OO1E 2NN6F 4IFDF 2JE6B 5JEAC 2NN6D 2NN6B 2BA0G 2JE6A 2NN6A 4IFDA 2NN6E 2PNZA 5JEAD 2C39A 1E3PA 3M85D 3M7ND 1OYRA 4BA2A 3L7ZB 4OO1A 5K36C 1UDSA 2WP8A 2PO2B 5C0XC 1UDNA 1E3HA 4AM3A 5K36F 5K36D 2BA1D 5K36B 5JEAF 2C37B 5C0XF 3U1KA 5C0XD 5JEAB 5C0XB 5K36E 2BR2B 4AIMA 3HKMA 5JEAA 3DD6A 3M85G 5JEAE 5C0XE 3M7NG 3GMEA 2BR2A 2JEAB 2PO0B 2PO1B 1UDQA 3L7ZA 4BA1B 3KRNA 1OYPA 2JEAA 3B4TA 2PO2A 4IFDC 2WNRB 2BA1G 3GCMA 5K36A 2C37A 2WNRA 1R6LA 5C0XA 2BA0D 4OO1C 2C38B 4IFDD 2JEBB 4IFDB 3CDJA 1OYSA 1UDOA 2PNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C39 B;  4NBQ A;  2C38 A;  2JEB A;  4OO1 F;  3GLL A;  4BA2 B;  2PO0 A;  2PO1 A;  4IFD E;  4OO1 D;  3H1C A;  4BA1 A;  4OO1 B;  2NN6 C;  4AID A;  3CDI A;  1R6M A;  2WP8 B;  4OO1 E;  2NN6 F;  4IFD F;  2JE6 B;  5JEA C;  2NN6 D;  2NN6 B;  2BA0 G;  2JE6 A;  2NN6 A;  4IFD A;  2NN6 E;  2PNZ A;  5JEA D;  2C39 A;  1E3P A;  3M85 D;  3M7N D;  1OYR A;  4BA2 A;  3L7Z B;  4OO1 A;  5K36 C;  1UDS A;  2WP8 A;  2PO2 B;  5C0X C;  1UDN A;  1E3H A;  4AM3 A;  5K36 F;  5K36 D;  2BA1 D;  5K36 B;  5JEA F;  2C37 B;  5C0X F;  3U1K A;  5C0X D;  5JEA B;  5C0X B;  5K36 E;  2BR2 B;  4AIM A;  3HKM A;  5JEA A;  3DD6 A;  3M85 G;  5JEA E;  5C0X E;  3M7N G;  3GME A;  2BR2 A;  2JEA B;  2PO0 B;  2PO1 B;  1UDQ A;  3L7Z A;  4BA1 B;  3KRN A;  1OYP A;  2JEA A;  3B4T A;  2PO2 A;  4IFD C;  2WNR B;  2BA1 G;  3GCM A;  5K36 A;  2C37 A;  2WNR A;  1R6L A;  5C0X A;  2BA0 D;  4OO1 C;  2C38 B;  4IFD D;  2JEB B;  4IFD B;  3CDJ A;  1OYS A;  1UDO A;  2PNZ B; 
#chains in the Genus database with same CATH topology
 2C39 B;  3OTO E;  4OO1 F;  2A2C A;  3HJC A;  4BA2 B;  2PO0 A;  4IZK B;  1RR9 A;  2PNZ B;  3WU5 A;  4OO1 D;  3UHM A;  2V2Z A;  4AID A;  4DPW A;  2VQF I;  2O3Z A;  2GS8 A;  3ZKB A;  3PYD A;  1HNZ E;  1H7U A;  4HAC A;  1N0U A;  3PS1 A;  1ZM2 A;  1FI4 A;  3T1H I;  4FW5 A;  4DR6 I;  4DXL A;  1J5E I;  3J81 C;  4U3B A;  1EI1 A;  4LF9 E;  1Z0C A;  4U3D A;  2BA0 G;  3ZKD A;  1N32 E;  2JE6 A;  3ZZ0 A;  1Y6Z A;  2Z5E A;  2V34 A;  1H74 A;  5JEA D;  1Z0B A;  4I3H A;  4DUZ E;  3WU6 A;  3JAM Q;  3M85 D;  3ZZT A;  1KKH A;  4IZJ D;  1N36 I;  3K17 A;  2HHH I;  4DV5 I;  2HK3 A;  5EL9 A;  4B3T I;  4JI1 E;  4DV0 I;  4DV7 I;  4ISA A;  4USK A;  5IWA I;  1VI7 A;  4B3R E;  4QNJ A;  4USM A;  4KQV A;  2WP8 A;  2HKJ A;  2PO2 B;  3T1H E;  1UDN A;  1J5E E;  1E3H A;  4DV1 I;  1IBM E;  4DV2 I;  1A6F A;  2BA1 D;  3Q6N A;  4JI0 I;  4DR1 I;  2C37 B;  1HNX E;  4M1K A;  5BR8 I;  3B78 A;  3T1Y E;  5JEA B;  2Z5B B;  5C0X B;  2UXD I;  4MQY A;  2V2Q A;  4DU8 A;  5DRR A;  3HKM A;  2IOP A;  4J3D A;  4DV3 E;  5DRO A;  4DV0 E;  1N34 I;  3M7N G;  3CWV A;  4N3O A;  2UXC E;  2PO1 B;  4K0K I;  1ZM4 A;  1HK7 A;  2ZM6 I;  3KRN A;  4DV1 E;  1S4E A;  1D6T A;  4YY3 E;  1OYP A;  1PVG A;  4DV2 E;  4DR2 E;  4JI3 I;  4LFB I;  4LF7 E;  4DPX A;  1S16 A;  1XXE A;  1B63 A;  2DEJ A;  4DR1 E;  2HFU A;  4GKJ E;  2E5L E;  1EA6 A;  3GCM A;  5LMU E;  5K36 A;  3J7A M;  2LJP A;  2UXD E;  3D4J A;  3K85 A;  4PRV A;  1R6L A;  1B62 A;  4LF4 E;  2C38 B;  4WUB A;  4OX9 I;  2JEB B;  3J80 C;  1N34 E;  4IFD D;  1VIS A;  4LOM A;  4JI4 I;  2IOQ A;  2Z5C A;  2O1U A;  2ZM6 E;  4JV5 I;  5IT9 C;  2UUC E;  4JI3 E;  4HY1 A;  2NN6 C;  2Q2E B;  4P7A A;  1HNW I;  2XEX A;  5FLX Q;  2VF3 A;  2VQE I;  1XMQ I;  4HYM A;  5A2Q C;  5DRP A;  1HR0 E;  4NXM E;  3PRY A;  4DR3 I;  2UU9 I;  4JI8 I;  1NHJ A;  3ZZU A;  4OX9 E;  2UXB I;  1PIE A;  4X64 I;  3QT8 A;  1ZM3 A;  1XMO I;  1XNR I;  2E1R A;  4JI4 E;  3V2U C;  2NN6 E;  2F4V I;  1NHH A;  4GKK I;  2UUB I;  4JI5 E;  1OYR A;  1HNW E;  1XMQ E;  4LF6 I;  1N33 E;  4OO1 A;  5K36 C;  1YH8 A;  4DUY I;  1FKA E;  1USU A;  2UXB E;  4DPT A;  4X62 I;  4FWH A;  5JEA F;  5C0X F;  1XMO E;  2R3V A;  4PU9 A;  3P3E A;  3U1K A;  5C0X D;  4DR4 I;  5K36 E;  2VQF E;  2GQ0 A;  3P06 A;  4LF6 E;  5JEA A;  2Z5B A;  4DUY E;  2JEA B;  2PO0 B;  4IZJ A;  4MU0 A;  4DR6 E;  2J7K A;  3L7Z A;  4IS9 A;  3QT5 A;  2CG9 A;  2CVE A;  3PYG A;  1USV A;  3Q6M A;  2WW4 A;  4JI6 I;  1I94 I;  4PRX A;  1Z59 A;  4LFC I;  4DR4 E;  4DV4 I;  1BKN A;  3LTO A;  2AJ4 A;  4HXZ A;  4DU7 A;  1N36 E;  2HHH E;  4DV5 E;  5LL6 R;  3Q1Q A;  2BA0 D;  4B3T E;  1XNQ I;  4DV7 E;  4OO1 C;  5IWA E;  1MX0 A;  3CDJ A;  2PNM A;  2O1V A;  2C38 A;  2JEB A;  3M6A A;  4JI7 I;  4JG4 A;  3B8H A;  2NPF A;  4LFA I;  4JYA I;  4KHP I;  3H1C A;  4BA1 A;  4X66 I;  3V5R A;  1NZ0 A;  4JI0 E;  3PYF A;  4OZE A;  3H4L A;  4FW4 A;  3CDI A;  5BR8 E;  2EFG A;  4JI6 E;  1R6M A;  3J81 Q;  2WP8 B;  5L3J A;  4DPU A;  4DV4 E;  5DRQ A;  4OO1 E;  4IFD F;  4NXN I;  4WUD A;  4YHH I;  5JEA C;  1OJ4 A;  3GON A;  2HK2 A;  2NN6 B;  1XNQ E;  4LF8 I;  4K0K E;  2J65 A;  4RPF A;  3PS2 A;  4IFD A;  2PNZ A;  2C39 A;  4LFB E;  1IBK I;  1Z5B A;  3M7N D;  2O1T A;  4BA2 A;  2O1W A;  4IZK A;  4LPF A;  2OI2 A;  4UTG A;  2VES A;  5FWK A;  4DR5 I;  1UDS A;  3JAM C;  4YHH E;  1FWK A;  3OTO I;  4AM3 A;  1QZR A;  1Z0E A;  3NZK A;  4LF8 E;  3QT6 A;  5K36 B;  1KTV A;  4FW7 A;  4JV5 E;  1Y5Y A;  2IER A;  1Y4U A;  4LCF A;  4DV6 I;  4B3M I;  4JI2 I;  1K47 A;  2BR2 B;  1WUU A;  3P3C A;  2VQE E;  3F0N A;  3HUL A;  3PYE A;  3DD6 A;  3M85 G;  4LF9 I;  2V2V A;  5DNL A;  4DR3 E;  1ZM9 A;  2BM0 A;  4Z7C A;  1UDQ A;  1UEK A;  2PNL A;  4LCH A;  2UU9 E;  4JI8 E;  5LMN I;  2JEA A;  2ZBK B;  2IES A;  3WU3 A;  1RRE A;  2PO2 A;  5GME A;  2GO4 A;  4X64 E;  4DUZ I;  4MYT A;  2DEI A;  1XNR E;  4IFD C;  1Y4S A;  2WNR B;  4FWD A;  2BA1 G;  2BV3 A;  4JI1 I;  1FWL A;  4MDT A;  3J80 Q;  2F4V E;  4FN5 A;  4GKK E;  2C37 A;  4DV6 E;  4B3R I;  4B3M E;  2UUB E;  4JI2 E;  1Y60 A;  1MG7 A;  1KIJ A;  2CGE A;  5C0X A;  4LCG A;  1IBM I;  4XTJ A;  5IT9 Q;  1OYS A;  3PS3 A;  1UDO A;  4AQY I;  1HNX I;  1Z0T A;  4NBQ A;  4WUC A;  1YHC A;  5A2Q Q;  3T1Y I;  3GLL A;  1PKP A;  5LMN E;  2PO1 A;  4IFD E;  1Z5C A;  4X62 E;  4OO1 B;  4HAC B;  3LNU A;  1Z0V A;  2JT2 A;  1ZXM A;  2GO3 A;  2R42 A;  4DV3 I;  2UUA I;  4ED4 A;  4MU4 A;  1MU5 A;  1Z0W A;  1P42 A;  2NN6 F;  4URL A;  2UXC I;  1Z5A A;  2V8P A;  1KVK A;  2JE6 B;  5FLX C;  2A2D A;  2NN6 D;  2X7I A;  1H72 C;  4QNK A;  4LF5 I;  3ZM7 A;  4YY3 I;  4DR2 I;  1RHY A;  4MYU A;  4LF7 I;  4AQY E;  2NN6 A;  4MU1 A;  3LPS A;  4GKJ I;  2E5L I;  1XHK A;  1E3P A;  5LMU I;  4DR7 I;  3WU4 A;  1I94 E;  4IZJ B;  1Z0G A;  2HKE A;  3L7Z B;  4LF4 I;  2UUA E;  4LFC E;  5DNX A;  3U1Y A;  1ELO A;  4DPY A;  1FJG I;  4UT4 A;  4FWG A;  1H7S A;  5C0X C;  1DAR A;  4X65 I;  4LF5 E;  5K36 F;  5EKW A;  2UUC I;  4FW6 A;  5K36 D;  4GQU A;  5ELW A;  4JI7 E;  1NHI A;  3QT7 A;  4FW3 A;  1HR0 I;  4B3S I;  4LFA E;  4JYA E;  4NXM I;  4KHP E;  1IBL I;  4X66 E;  4DR7 E;  2AE8 A;  4AIM A;  4FW9 A;  4EMD A;  4Z7Y A;  1H73 A;  5JEA E;  5C0X E;  3GME A;  4ZVI A;  2BR2 A;  4NXN E;  1FJG E;  4BA1 B;  4X65 E;  4OKG A;  1FNM A;  3P3G A;  5GMD A;  3B4T A;  2CZ9 A;  2BM1 A;  3P76 A;  2F1D A;  4JI5 I;  4MU3 A;  1N33 I;  3J7A G;  2HFS A;  1HNZ I;  4B3S E;  1ZXN A;  1IBL E;  3K1J A;  2ZIT A;  1IBK E;  2WNR A;  3B82 A;  4R1F A;  1N0V C;  1U2R A;  4IFD B;  2Z5C B;  2X36 A;  4DR5 E;  4P52 A;  1N32 I; 
#chains in the Genus database with same CATH homology
 2C39 B;  4NBQ A;  2C38 A;  2JEB A;  4OO1 F;  3GLL A;  4BA2 B;  2PO0 A;  2PO1 A;  4IFD E;  4OO1 D;  3H1C A;  4BA1 A;  4OO1 B;  2NN6 C;  4AID A;  3CDI A;  1R6M A;  2WP8 B;  4OO1 E;  2NN6 F;  4IFD F;  2JE6 B;  5JEA C;  2NN6 D;  2NN6 B;  2BA0 G;  2JE6 A;  2NN6 A;  4IFD A;  2NN6 E;  2PNZ A;  5JEA D;  2C39 A;  1E3P A;  3M85 D;  3M7N D;  1OYR A;  4BA2 A;  3L7Z B;  4OO1 A;  5K36 C;  1UDS A;  2WP8 A;  2PO2 B;  5C0X C;  1UDN A;  1E3H A;  4AM3 A;  5K36 F;  5K36 D;  2BA1 D;  5K36 B;  5JEA F;  2C37 B;  5C0X F;  3U1K A;  5C0X D;  5JEA B;  5C0X B;  5K36 E;  2BR2 B;  4AIM A;  3HKM A;  5JEA A;  3DD6 A;  3M85 G;  5JEA E;  5C0X E;  3M7N G;  3GME A;  2BR2 A;  2JEA B;  2PO0 B;  2PO1 B;  1UDQ A;  3L7Z A;  4BA1 B;  3KRN A;  1OYP A;  2JEA A;  3B4T A;  2PO2 A;  4IFD C;  2WNR B;  2BA1 G;  3GCM A;  5K36 A;  2C37 A;  2WNR A;  1R6L A;  5C0X A;  2BA0 D;  4OO1 C;  2C38 B;  4IFD D;  2JEB B;  4IFD B;  3CDJ A;  1OYS A;  1UDO A;  2PNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...