2PO2A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with cdp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
236
structure length
236
Chain Sequence
b'KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
molecule tags Hydrolase/hydrolase
source organism Pyrococcus abyssi
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
total genus 73
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po2A01
3HKMA 2JEAA 5K36A 1UDOA 3L7ZB 3CDIA 4OO1C 2NN6F 3DD6A 2BA0G 2C39A 3M85G 3GMEA 2PO0B 4IFDE 5K36D 5C0XB 1UDSA 3L7ZA 2NN6C 2WNRA 2PNZA 5K36E 4BA2B 2WP8A 5JEAD 3GLLA 2PO0A 3GCMA 5C0XF 2PO1A 2JEBB 4BA2A 2JEAB 2NN6A 1UDNA 5C0XC 3CDJA 4IFDD 5JEAC 3B4TA 2PNZB 4AIDA 4OO1E 2BA1G 4BA1B 3M7ND 4OO1A 5JEAF 4OO1D 2BR2B 2BR2A 5JEAB 1OYPA 2C39B 3U1KA 2WP8B 1E3HA 2C38A 4IFDA 2C37B 3M85D 3H1CA 2NN6E 5C0XD 2NN6B 4IFDC 2JEBA 2PO1B 4AIMA 2NN6D 4IFDF 5K36C 2JE6A 1UDQA 2C37A 2C38B 4IFDB 5K36F 1R6MA 1OYRA 1OYSA 4OO1F 3KRNA 5JEAA 2JE6B 5K36B 1R6LA 1E3PA 2BA0D 5JEAE 4OO1B 4BA1A 2WNRB 4AM3A 2PO2A 2PO2B 5C0XA 3M7NG 2BA1D 4NBQA 5C0XE
chains in the Genus database with same CATH superfamily
4LF5I 3GONA 3J7AM 4X62E 4OO1C 3DD6A 4DR3I 4DXLA 2UXBE 3T1HI 4JI4E 1B62A 3M85G 2V34A 4JI3E 1N32I 4GKJE 3QT8A 1NHHA 4HXZA 4GQUA 2O3ZA 4JI1E 4IFDE 4DV2E 4K0KE 2E5LI 5C0XB 4GKKE 4HACA 1N34E 4DV2I 1XMQE 4X64E 1N33E 3LPSA 4FN5A 4MQYA 2XEXA 1XNRI 1Z0TA 4FWHA 2UUAE 4DUYI 1RREA 4DV3E 3QT5A 4DUZI 2PO1A 4DPYA 1Z0GA 2JEAB 1H73A 4IFDD 2GO3A 4DR6I 3J80Q 3PYGA 1KIJA 4NXMI 4AIDA 1VI7A 2ZM6I 2X36A 2JT2A 4YY3E 1Z5CA 2R3VA 4JI5E 4JYAI 5JEAB 4DPXA 2F4VI 2O1VA 4DPWA 2UXCI 1E3HA 4DR5I 2HHHE 1PKPA 4LFAI 3T1HE 4JI4I 1ZM3A 1J5EE 2NN6E 3Q1QA 4WUCA 1Y5YA 1RR9A 4MYTA 1FJGE 2Z5BA 1U2RA 3ZKDA 4LF6I 2PO1B 4LCHA 1HNXE 4B3SI 4FW5A 1XXEA 5DRRA 1D6TA 4DV1E 3WU5A 4K0KI 2PNLA 1UDQA 1KTVA 4IS9A 1IBLE 2UXDI 3UHMA 4B3TI 5GMEA 5DNXA 4IZKA 4X66E 4DR1E 2CVEA 4JI6I 4DV1I 4X65E 1OYRA 4OO1F 5JEAA 1KKHA 4URLA 4JI6E 5K36B 1R6LA 1E3PA 5JEAE 1K47A 1FNMA 4B3RE 2HK2A 4WUBA 4BA1A 2IESA 2WNRB 4FWGA 1S4EA 1Z5BA 3PRYA 4AM3A 4LF5E 4DUZE 1MU5A 1N0VC 3HKMA 2JEAA 5FLXQ 1HK7A 1Y4UA 3L7ZB 2Z5CA 4UT4A 2NN6F 4LF7I 2C39A 5BR8E 4J3DA 4LCGA 3K1JA 2ZM6E 4LF4E 4X66I 3GMEA 4DR1I 3P3CA 1XMQI 4MU4A 5IWAI 1H74A 5K36D 4GKKI 4IZJB 2PNZA 1Z0EA 5IT9C 1N36I 4PRXA 5K36E 4KQVA 2VQEI 2HHHI 4LFAE 4DV7I 4DUYE 3ZKBA 4P7AA 1FWLA 3P76A 2UUAI 4Z7YA 2PO0A 4JI0I 1Z0WA 4PRVA 4USKA 4U3DA 3M6AA 1MG7A 3PS1A 1N32E 3PYEA 5A2QC 4LF8I 2BV3A 2UUCE 4BA2A 2O1TA 2NN6A 3CDJA 3K17A 1YHCA 5DRPA 4LF8E 2A2CA 4N3OA 3K85A 1H7UA 2BA1G 4WUDA 5LMNI 4ISAA 3T1YE 4LF9I 4FW4A 2UXBI 2WP8B 4AQYI 1XHKA 2UUBI 4DPTA 2C38A 5BR8I 4OX9E 2Z5CB 2OI2A 1ZM9A 2HKEA 2J65A 5EKWA 4HACB 4DPUA 4FW6A 4IFDC 5IWAE 4JI1I 4ZVIA 4AIMA 2NN6D 5DNLA 4DU7A 3Q6MA 4IFDF 2F4VE 2C37A 4B3RI 3PYDA 4KHPE 1IBME 1J5EI 1MX0A 3B78A 1FWKA 1R6MA 2BM0A 3H4LA 2UXCE 3KRNA 2VQFE 2JE6B 4LCFA 1HR0I 4JV5I 4OO1B 1HNZE 3QT7A 4DV5E 2Z5BB 4FW7A 3PS2A 1VISA 3D4JA 2BA1D 1HNXI 4LF6E 1PIEA 4DV3I 1UDOA 1Z0BA 5IT9Q 3CDIA 2J7KA 2CZ9A 1IBKI 4JI5I 4JYAE 4DV6E 2CG9A 4RPFA 1Y4SA 1WUUA 3T1YI 4LPFA 5FWKA 2V2QA 1H72C 1KVKA 5EL9A 2PO0B 4KHPI 1USUA 3WU6A 4B3MI 4QNJA 1PVGA 4ED4A 4I3HA 4DU8A 2NN6C 2O1UA 2WNRA 1RHYA 3JAMC 4B3ME 4JI7I 1N0UA 1Z0VA 4FW9A 1B63A 3PS3A 4M1KA 1ZXNA 2WP8A 2UUCI 4LFCI 3B82A 4DR4E 3HULA 3GLLA 4IZKB 4JI0E 4NXNI 1I94I 3GCMA 2UU9I 3ZM7A 2EFGA 3P3GA 4DV0E 5C0XF 2CGEA 4DR7I 2JEBB 4PU9A 1XMOI 4DR3E 1UDNA 5C0XC 2GO4A 1P42A 5JEAC 4DR7E 2Z5EA 1HNZI 1BKNA 2NPFA 2VQEE 5A2QQ 1N36E 4OO1E 4MU0A 4HYMA 2VF3A 1UEKA 4BA1B 3J81C 2VQFI 5DRQA 3B8HA 5JEAF 4USMA 4LFBE 4JI3I 1HNWE 1ZM2A 3ZZ0A 4MU1A 1FKAE 3U1KA 3J81Q 4OZEA 3P3EA 4YHHE 2X7IA 4GKJI 2DEIA 4X64I 4IFDA 1N33I 3JAMQ 3M85D 1IBKE 3H1CA 2IERA 5L3JA 2LJPA 4IZJD 2JEBA 5LMUI 4LF4I 4MYUA 1Z5AA 3OTOI 4JI8I 3J80C 5K36C 4FWDA 1IBMI 4AQYE 2JE6A 1HR0E 2A2DA 4DV4I 3P06A 4IFDB 1OJ4A 2BM1A 5K36F 1HNWI 4B3SE 4FW3A 2UUBE 4DV4E 2BA0D 4JI2I 2UXDE 4DV5I 2PO2A 3LNUA 2PO2B 5C0XA 4DR2E 4YY3I 3ZZUA 1XMOE 2DEJA 5K36A 1XNQE 2ZBKB 2PNMA 2BA0G 2F1DA 4LFBI 4R1FA 4EMDA 3V5RA 1FI4A 3Q6NA 1NHJA 5DROA 3QT6A 1UDSA 3L7ZA 2HKJA 2WW4A 1ELOA 2ZITA 3F0NA 3HJCA 4BA2B 4NXME 2AE8A 2HK3A 4MU3A 1EA6A 2GS8A 4NXNE 1NHIA 3NZKA 2UU9E 4DR4I 5JEAD 1YH8A 3LTOA 4DV6I 4Z7CA 1A6FA 2V2VA 4DV0I 3WU4A 1XNRE 1NZ0A 1DARA 4MDTA 4LF9E 5ELWA 3V2UC 3U1YA 4IZJA 4JI2E 2IOPA 3B4TA 4XTJA 4JI7E 2PNZB 2AJ4A 2V2ZA 4DR6E 3CWVA 4OKGA 4QNKA 3M7ND 4OO1A 4UTGA 1I94E 4LOMA 4OO1D 2E5LE 3WU3A 4HY1A 2BR2B 1QZRA 4LFCE 1EI1A 2BR2A 4P52A 1OYPA 2C39B 2O1WA 4JG4A 1Z0CA 5LL6R 4X65I 2C37B 2VESA 3PYFA 1N34I 2E1RA 5GMDA 4DV7E 5C0XD 2NN6B 4X62I 3OTOE 2HFSA 2HFUA 1Y6ZA 4OX9I 2Q2EB 1FJGI 4JV5E 1ZXMA 1IBLI 1USVA 2C38B 4LF7E 1S16A 1H7SA 3J7AG 1ZM4A 4YHHI 1OYSA 1Z59A 3ZZTA 4B3TE 4DR2I 1Y60A 2GQ0A 5FLXC 2R42A 1XNQI 2V8PA 5LMNE 4JI8E 3M7NG 4U3BA 5LMUE 4NBQA 2IOQA 5C0XE 4DR5E
chains in the Genus database with same CATH topology
3HKMA 2JEAA 5K36A 1UDOA 3L7ZB 3CDIA 4OO1C 2NN6F 3DD6A 2BA0G 2C39A 3M85G 3GMEA 2PO0B 4IFDE 5K36D 5C0XB 1UDSA 3L7ZA 2NN6C 2WNRA 2PNZA 5K36E 4BA2B 2WP8A 5JEAD 3GLLA 2PO0A 3GCMA 5C0XF 2PO1A 2JEBB 4BA2A 2JEAB 2NN6A 1UDNA 5C0XC 3CDJA 4IFDD 5JEAC 3B4TA 2PNZB 4AIDA 4OO1E 2BA1G 4BA1B 3M7ND 4OO1A 5JEAF 4OO1D 2BR2B 2BR2A 5JEAB 1OYPA 2C39B 3U1KA 2WP8B 1E3HA 2C38A 4IFDA 2C37B 3M85D 3H1CA 2NN6E 5C0XD 2NN6B 4IFDC 2JEBA 2PO1B 4AIMA 2NN6D 4IFDF 5K36C 2JE6A 1UDQA 2C37A 2C38B 4IFDB 5K36F 1R6MA 1OYRA 1OYSA 4OO1F 3KRNA 5JEAA 2JE6B 5K36B 1R6LA 1E3PA 2BA0D 5JEAE 4OO1B 4BA1A 2WNRB 4AM3A 2PO2A 2PO2B 5C0XA 3M7NG 2BA1D 4NBQA 5C0XE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKM A;  2JEA A;  5K36 A;  1UDO A;  3L7Z B;  3CDI A;  4OO1 C;  2NN6 F;  3DD6 A;  2BA0 G;  2C39 A;  3M85 G;  3GME A;  2PO0 B;  4IFD E;  5K36 D;  5C0X B;  1UDS A;  3L7Z A;  2NN6 C;  2WNR A;  2PNZ A;  5K36 E;  4BA2 B;  2WP8 A;  5JEA D;  3GLL A;  2PO0 A;  3GCM A;  5C0X F;  2PO1 A;  2JEB B;  4BA2 A;  2JEA B;  2NN6 A;  1UDN A;  5C0X C;  3CDJ A;  4IFD D;  5JEA C;  3B4T A;  2PNZ B;  4AID A;  4OO1 E;  2BA1 G;  4BA1 B;  3M7N D;  4OO1 A;  5JEA F;  4OO1 D;  2BR2 B;  2BR2 A;  5JEA B;  1OYP A;  2C39 B;  3U1K A;  2WP8 B;  1E3H A;  2C38 A;  4IFD A;  2C37 B;  3M85 D;  3H1C A;  2NN6 E;  5C0X D;  2NN6 B;  4IFD C;  2JEB A;  2PO1 B;  4AIM A;  2NN6 D;  4IFD F;  5K36 C;  2JE6 A;  1UDQ A;  2C37 A;  2C38 B;  4IFD B;  5K36 F;  1R6M A;  1OYR A;  1OYS A;  4OO1 F;  3KRN A;  5JEA A;  2JE6 B;  5K36 B;  1R6L A;  1E3P A;  2BA0 D;  5JEA E;  4OO1 B;  4BA1 A;  2WNR B;  4AM3 A;  2PO2 A;  2PO2 B;  5C0X A;  3M7N G;  2BA1 D;  4NBQ A;  5C0X E; 
#chains in the Genus database with same CATH topology
 4LF5 I;  3GON A;  3J7A M;  4X62 E;  4OO1 C;  3DD6 A;  4DR3 I;  4DXL A;  2UXB E;  3T1H I;  4JI4 E;  1B62 A;  3M85 G;  2V34 A;  4JI3 E;  1N32 I;  4GKJ E;  3QT8 A;  1NHH A;  4HXZ A;  4GQU A;  2O3Z A;  4JI1 E;  4IFD E;  4DV2 E;  4K0K E;  2E5L I;  5C0X B;  4GKK E;  4HAC A;  1N34 E;  4DV2 I;  1XMQ E;  4X64 E;  1N33 E;  3LPS A;  4FN5 A;  4MQY A;  2XEX A;  1XNR I;  1Z0T A;  4FWH A;  2UUA E;  4DUY I;  1RRE A;  4DV3 E;  3QT5 A;  4DUZ I;  2PO1 A;  4DPY A;  1Z0G A;  2JEA B;  1H73 A;  4IFD D;  2GO3 A;  4DR6 I;  3J80 Q;  3PYG A;  1KIJ A;  4NXM I;  4AID A;  1VI7 A;  2ZM6 I;  2X36 A;  2JT2 A;  4YY3 E;  1Z5C A;  2R3V A;  4JI5 E;  4JYA I;  5JEA B;  4DPX A;  2F4V I;  2O1V A;  4DPW A;  2UXC I;  1E3H A;  4DR5 I;  2HHH E;  1PKP A;  4LFA I;  3T1H E;  4JI4 I;  1ZM3 A;  1J5E E;  2NN6 E;  3Q1Q A;  4WUC A;  1Y5Y A;  1RR9 A;  4MYT A;  1FJG E;  2Z5B A;  1U2R A;  3ZKD A;  4LF6 I;  2PO1 B;  4LCH A;  1HNX E;  4B3S I;  4FW5 A;  1XXE A;  5DRR A;  1D6T A;  4DV1 E;  3WU5 A;  4K0K I;  2PNL A;  1UDQ A;  1KTV A;  4IS9 A;  1IBL E;  2UXD I;  3UHM A;  4B3T I;  5GME A;  5DNX A;  4IZK A;  4X66 E;  4DR1 E;  2CVE A;  4JI6 I;  4DV1 I;  4X65 E;  1OYR A;  4OO1 F;  5JEA A;  1KKH A;  4URL A;  4JI6 E;  5K36 B;  1R6L A;  1E3P A;  5JEA E;  1K47 A;  1FNM A;  4B3R E;  2HK2 A;  4WUB A;  4BA1 A;  2IES A;  2WNR B;  4FWG A;  1S4E A;  1Z5B A;  3PRY A;  4AM3 A;  4LF5 E;  4DUZ E;  1MU5 A;  1N0V C;  3HKM A;  2JEA A;  5FLX Q;  1HK7 A;  1Y4U A;  3L7Z B;  2Z5C A;  4UT4 A;  2NN6 F;  4LF7 I;  2C39 A;  5BR8 E;  4J3D A;  4LCG A;  3K1J A;  2ZM6 E;  4LF4 E;  4X66 I;  3GME A;  4DR1 I;  3P3C A;  1XMQ I;  4MU4 A;  5IWA I;  1H74 A;  5K36 D;  4GKK I;  4IZJ B;  2PNZ A;  1Z0E A;  5IT9 C;  1N36 I;  4PRX A;  5K36 E;  4KQV A;  2VQE I;  2HHH I;  4LFA E;  4DV7 I;  4DUY E;  3ZKB A;  4P7A A;  1FWL A;  3P76 A;  2UUA I;  4Z7Y A;  2PO0 A;  4JI0 I;  1Z0W A;  4PRV A;  4USK A;  4U3D A;  3M6A A;  1MG7 A;  3PS1 A;  1N32 E;  3PYE A;  5A2Q C;  4LF8 I;  2BV3 A;  2UUC E;  4BA2 A;  2O1T A;  2NN6 A;  3CDJ A;  3K17 A;  1YHC A;  5DRP A;  4LF8 E;  2A2C A;  4N3O A;  3K85 A;  1H7U A;  2BA1 G;  4WUD A;  5LMN I;  4ISA A;  3T1Y E;  4LF9 I;  4FW4 A;  2UXB I;  2WP8 B;  4AQY I;  1XHK A;  2UUB I;  4DPT A;  2C38 A;  5BR8 I;  4OX9 E;  2Z5C B;  2OI2 A;  1ZM9 A;  2HKE A;  2J65 A;  5EKW A;  4HAC B;  4DPU A;  4FW6 A;  4IFD C;  5IWA E;  4JI1 I;  4ZVI A;  4AIM A;  2NN6 D;  5DNL A;  4DU7 A;  3Q6M A;  4IFD F;  2F4V E;  2C37 A;  4B3R I;  3PYD A;  4KHP E;  1IBM E;  1J5E I;  1MX0 A;  3B78 A;  1FWK A;  1R6M A;  2BM0 A;  3H4L A;  2UXC E;  3KRN A;  2VQF E;  2JE6 B;  4LCF A;  1HR0 I;  4JV5 I;  4OO1 B;  1HNZ E;  3QT7 A;  4DV5 E;  2Z5B B;  4FW7 A;  3PS2 A;  1VIS A;  3D4J A;  2BA1 D;  1HNX I;  4LF6 E;  1PIE A;  4DV3 I;  1UDO A;  1Z0B A;  5IT9 Q;  3CDI A;  2J7K A;  2CZ9 A;  1IBK I;  4JI5 I;  4JYA E;  4DV6 E;  2CG9 A;  4RPF A;  1Y4S A;  1WUU A;  3T1Y I;  4LPF A;  5FWK A;  2V2Q A;  1H72 C;  1KVK A;  5EL9 A;  2PO0 B;  4KHP I;  1USU A;  3WU6 A;  4B3M I;  4QNJ A;  1PVG A;  4ED4 A;  4I3H A;  4DU8 A;  2NN6 C;  2O1U A;  2WNR A;  1RHY A;  3JAM C;  4B3M E;  4JI7 I;  1N0U A;  1Z0V A;  4FW9 A;  1B63 A;  3PS3 A;  4M1K A;  1ZXN A;  2WP8 A;  2UUC I;  4LFC I;  3B82 A;  4DR4 E;  3HUL A;  3GLL A;  4IZK B;  4JI0 E;  4NXN I;  1I94 I;  3GCM A;  2UU9 I;  3ZM7 A;  2EFG A;  3P3G A;  4DV0 E;  5C0X F;  2CGE A;  4DR7 I;  2JEB B;  4PU9 A;  1XMO I;  4DR3 E;  1UDN A;  5C0X C;  2GO4 A;  1P42 A;  5JEA C;  4DR7 E;  2Z5E A;  1HNZ I;  1BKN A;  2NPF A;  2VQE E;  5A2Q Q;  1N36 E;  4OO1 E;  4MU0 A;  4HYM A;  2VF3 A;  1UEK A;  4BA1 B;  3J81 C;  2VQF I;  5DRQ A;  3B8H A;  5JEA F;  4USM A;  4LFB E;  4JI3 I;  1HNW E;  1ZM2 A;  3ZZ0 A;  4MU1 A;  1FKA E;  3U1K A;  3J81 Q;  4OZE A;  3P3E A;  4YHH E;  2X7I A;  4GKJ I;  2DEI A;  4X64 I;  4IFD A;  1N33 I;  3JAM Q;  3M85 D;  1IBK E;  3H1C A;  2IER A;  5L3J A;  2LJP A;  4IZJ D;  2JEB A;  5LMU I;  4LF4 I;  4MYU A;  1Z5A A;  3OTO I;  4JI8 I;  3J80 C;  5K36 C;  4FWD A;  1IBM I;  4AQY E;  2JE6 A;  1HR0 E;  2A2D A;  4DV4 I;  3P06 A;  4IFD B;  1OJ4 A;  2BM1 A;  5K36 F;  1HNW I;  4B3S E;  4FW3 A;  2UUB E;  4DV4 E;  2BA0 D;  4JI2 I;  2UXD E;  4DV5 I;  2PO2 A;  3LNU A;  2PO2 B;  5C0X A;  4DR2 E;  4YY3 I;  3ZZU A;  1XMO E;  2DEJ A;  5K36 A;  1XNQ E;  2ZBK B;  2PNM A;  2BA0 G;  2F1D A;  4LFB I;  4R1F A;  4EMD A;  3V5R A;  1FI4 A;  3Q6N A;  1NHJ A;  5DRO A;  3QT6 A;  1UDS A;  3L7Z A;  2HKJ A;  2WW4 A;  1ELO A;  2ZIT A;  3F0N A;  3HJC A;  4BA2 B;  4NXM E;  2AE8 A;  2HK3 A;  4MU3 A;  1EA6 A;  2GS8 A;  4NXN E;  1NHI A;  3NZK A;  2UU9 E;  4DR4 I;  5JEA D;  1YH8 A;  3LTO A;  4DV6 I;  4Z7C A;  1A6F A;  2V2V A;  4DV0 I;  3WU4 A;  1XNR E;  1NZ0 A;  1DAR A;  4MDT A;  4LF9 E;  5ELW A;  3V2U C;  3U1Y A;  4IZJ A;  4JI2 E;  2IOP A;  3B4T A;  4XTJ A;  4JI7 E;  2PNZ B;  2AJ4 A;  2V2Z A;  4DR6 E;  3CWV A;  4OKG A;  4QNK A;  3M7N D;  4OO1 A;  4UTG A;  1I94 E;  4LOM A;  4OO1 D;  2E5L E;  3WU3 A;  4HY1 A;  2BR2 B;  1QZR A;  4LFC E;  1EI1 A;  2BR2 A;  4P52 A;  1OYP A;  2C39 B;  2O1W A;  4JG4 A;  1Z0C A;  5LL6 R;  4X65 I;  2C37 B;  2VES A;  3PYF A;  1N34 I;  2E1R A;  5GMD A;  4DV7 E;  5C0X D;  2NN6 B;  4X62 I;  3OTO E;  2HFS A;  2HFU A;  1Y6Z A;  4OX9 I;  2Q2E B;  1FJG I;  4JV5 E;  1ZXM A;  1IBL I;  1USV A;  2C38 B;  4LF7 E;  1S16 A;  1H7S A;  3J7A G;  1ZM4 A;  4YHH I;  1OYS A;  1Z59 A;  3ZZT A;  4B3T E;  4DR2 I;  1Y60 A;  2GQ0 A;  5FLX C;  2R42 A;  1XNQ I;  2V8P A;  5LMN E;  4JI8 E;  3M7N G;  4U3B A;  5LMU E;  4NBQ A;  2IOQ A;  5C0X E;  4DR5 E; 
#chains in the Genus database with same CATH homology
 3HKM A;  2JEA A;  5K36 A;  1UDO A;  3L7Z B;  3CDI A;  4OO1 C;  2NN6 F;  3DD6 A;  2BA0 G;  2C39 A;  3M85 G;  3GME A;  2PO0 B;  4IFD E;  5K36 D;  5C0X B;  1UDS A;  3L7Z A;  2NN6 C;  2WNR A;  2PNZ A;  5K36 E;  4BA2 B;  2WP8 A;  5JEA D;  3GLL A;  2PO0 A;  3GCM A;  5C0X F;  2PO1 A;  2JEB B;  4BA2 A;  2JEA B;  2NN6 A;  1UDN A;  5C0X C;  3CDJ A;  4IFD D;  5JEA C;  3B4T A;  2PNZ B;  4AID A;  4OO1 E;  2BA1 G;  4BA1 B;  3M7N D;  4OO1 A;  5JEA F;  4OO1 D;  2BR2 B;  2BR2 A;  5JEA B;  1OYP A;  2C39 B;  3U1K A;  2WP8 B;  1E3H A;  2C38 A;  4IFD A;  2C37 B;  3M85 D;  3H1C A;  2NN6 E;  5C0X D;  2NN6 B;  4IFD C;  2JEB A;  2PO1 B;  4AIM A;  2NN6 D;  4IFD F;  5K36 C;  2JE6 A;  1UDQ A;  2C37 A;  2C38 B;  4IFD B;  5K36 F;  1R6M A;  1OYR A;  1OYS A;  4OO1 F;  3KRN A;  5JEA A;  2JE6 B;  5K36 B;  1R6L A;  1E3P A;  2BA0 D;  5JEA E;  4OO1 B;  4BA1 A;  2WNR B;  4AM3 A;  2PO2 A;  2PO2 B;  5C0X A;  3M7N G;  2BA1 D;  4NBQ A;  5C0X E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...