2PO2A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with cdp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
total genus 73
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po2A01
2JEAB 5JEAA 2WP8B 4OO1C 5JEAF 2JEBA 2C37A 5C0XB 3L7ZA 2BA1D 2NN6E 4OO1D 1UDOA 1UDNA 4AM3A 2PO1B 2PO0A 4OO1E 5JEAC 5K36A 5K36F 1R6MA 1OYPA 1OYSA 5JEAD 2BR2B 2JEAA 4NBQA 5JEAE 4IFDB 2WP8A 5C0XA 4BA1B 4BA2B 5C0XF 2JE6B 2PO2B 5K36C 3M7NG 3KRNA 2PO1A 5K36D 2C38B 5K36E 5C0XC 2NN6B 5C0XD 2BR2A 4IFDA 1R6LA 1UDSA 1OYRA 2WNRB 3M7ND 4IFDF 4BA2A 3GMEA 4BA1A 2C39B 2PO2A 3CDIA 2PNZB 4IFDC 2NN6A 2BA1G 2NN6F 4IFDD 3CDJA 3GLLA 4IFDE 3M85G 2WNRA 2BA0G 2C39A 3U1KA 4OO1B 3B4TA 3H1CA 2PNZA 5C0XE 2NN6C 2JE6A 2NN6D 3HKMA 1UDQA 5JEAB 2C38A 2JEBB 1E3HA 2C37B 3L7ZB 3M85D 2BA0D 3GCMA 2PO0B 1E3PA 4AIDA 4OO1A 3DD6A 4OO1F 5K36B 4AIMA
chains in the Genus database with same CATH superfamily
4K0KE 4DV5I 5IWAE 4LFCE 4JI5I 4U3BA 4DU8A 4HACB 2GQ0A 2UXBI 4JI7I 2Z5CB 1UDOA 4FW6A 1B63A 4EMDA 4NXME 2UU9E 4OO1E 1FWKA 2O1TA 4DPYA 4DUYI 2HHHI 4MYTA 2Z5BA 4IZJB 5K36F 1R6MA 4WUBA 4FW4A 3GONA 3J80C 2UU9I 1MU5A 3K85A 5IT9Q 5JEAE 5IT9C 4BA1B 4LF9E 1N33E 4JI0E 5LMNE 1S4EA 2AJ4A 4B3RI 5K36D 2V2QA 1PIEA 4LF9I 2X36A 2R42A 4DV4I 1IBKE 5LMNI 3T1YI 3HJCA 1Z0TA 3D4JA 1KIJA 1XNQE 5DROA 4DPXA 1Z5CA 2E5LE 2WW4A 1FNMA 2GO3A 1WUUA 4LOMA 4BA2A 3GMEA 4MDTA 3CDIA 4LCGA 1NHHA 3PYFA 1XNQI 3Q6MA 1Z0BA 2DEIA 4JV5E 3M6AA 2E5LI 3LNUA 4DR6E 1Z5AA 4MQYA 3K17A 4GKJE 2BA1G 4JV5I 1H7SA 2J7KA 2VQFE 4IFDE 2WNRA 1NZ0A 4DR6I 1YHCA 1J5EE 2BA0G 1Y6ZA 2UUAE 4JI3E 2HK2A 4OO1B 3B4TA 4PRXA 2PNZA 1N34E 1EA6A 4UTGA 2GS8A 4OX9E 3K1JA 3HKMA 4J3DA 1J5EI 2UUAI 4JI3I 2IESA 1USUA 5JEAB 4MU1A 4LF8E 2JEBB 2C37B 1RREA 4OX9I 4JI4I 3F0NA 2ZM6E 2VQEE 3H4LA 3GCMA 1N32I 4AIDA 4JI8E 2V2ZA 4OO1F 4X65E 2VQEI 4GKKE 1I94E 3J81C 3QT5A 1IBLE 1OJ4A 2E1RA 1Z59A 5JEAF 5C0XB 3L7ZA 2BA1D 4X65I 4DR5I 3PS2A 4GKKI 4AQYI 1YH8A 1KTVA 4OO1D 1UDNA 2PO1B 4URLA 2PO0A 5K36A 3U1YA 3PYGA 1ZM9A 4PU9A 4DV5E 1OYSA 5JEAD 1BKNA 1USVA 2BR2B 4P52A 4JI2E 2UXBE 1HK7A 4IFDB 2HKJA 2UXCI 4KHPI 2ZBKB 1H74A 2JE6B 4HACA 5C0XF 5K36C 4DR3E 1QZRA 3KRNA 4Z7CA 4DUYE 2HHHE 4JI2I 4HXZA 2AE8A 5LMUI 4DR3I 4DR7E 4DPTA 4HYMA 5C0XD 3PRYA 3JAMQ 5DNXA 4DPUA 3JAMC 1FI4A 1UDSA 4ISAA 4B3TI 4I3HA 4IFDF 4BA1A 4B3RE 4DR7I 4GQUA 2CG9A 1HNXE 4B3ME 2O1UA 4X64E 4JYAE 2GO4A 4DV4E 3T1YE 4DV1I 1HNXI 3CWVA 4DV6I 4IFDD 4B3MI 1XMQI 4X64I 4JYAI 1Z0WA 4FWDA 2BM0A 3B8HA 1XMOI 4LF5E 5DRRA 3U1KA 4JI6E 5C0XE 2V34A 4LFAE 4YHHI 1XHKA 3QT8A 3WU4A 3ZZUA 4LF5I 4LF6I 1ZM2A 4Z7YA 5LL6R 1HNWI 1UDQA 3P3EA 4IZJD 4DR2I 4JI6I 1KKHA 2C38A 5BR8E 1ELOA 3P3GA 1Z0VA 1HNZI 4LFAI 1XNRE 2O1VA 1E3PA 1ZXMA 5GMDA 1ZXNA 4X62I 4OO1A 2A2CA 5BR8I 4WUCA 1MG7A 2V8PA 1XNRI 4DPWA 4QNKA 4DV2E 3PYDA 4JI1I 4X66I 2JEAB 1EI1A 4IZKB 3LTOA 4JI4E 5DRQA 4P7AA 4LF7I 5JEAA 2WP8B 2J65A 4OO1C 2O3ZA 2JEBA 2C37A 2DEJA 1N36I 1N32E 4DV2I 1U2RA 3Q6NA 2A2DA 2BM1A 1Z0GA 4RPFA 1H72C 5ELWA 3PS1A 2OI2A 4FW9A 4DR1E 1Y5YA 5JEAC 1HR0I 3P06A 3OTOI 4USMA 2V2VA 5A2QQ 1Z0CA 5A2QC 4QNJA 4DR5E 2LJPA 4DR1I 4AQYE 5C0XA 2PO2B 2R3VA 2PO1A 1FKAE 5FWKA 1B62A 4FW3A 2HKEA 5GMEA 1MX0A 4MU3A 5C0XC 4M1KA 2NN6B 1N0UA 1IBMI 4ED4A 1H7UA 1ZM4A 2UXCE 2BR2A 4KHPE 1PKPA 3UHMA 4IFDA 1R6LA 1OYRA 4MU4A 4U3DA 4LF4E 3M7ND 4DU7A 2C39B 1S16A 1Y4UA 4YY3E 2UUBE 3WU6A 4FW5A 4JG4A 2VF3A 3J7AM 1D6TA 3ZZ0A 4B3SE 5LMUE 2Z5CA 4LF4I 4IFDC 2HK3A 5DRPA 4YY3I 2UUBI 3V5RA 2NN6F 3T1HI 4B3TE 4IZJA 4B3SI 5FLXQ 3P3CA 5EL9A 3NZKA 4NXNI 5FLXC 4N3OA 5DNLA 2CGEA 3H1CA 2JT2A 3J7AG 2O1WA 4FWHA 3Q1QA 2UUCI 4DV1E 2NN6D 1N0VC 4DV6E 1XMQE 2PNMA 4K0KI 4FWGA 1XMOE 1E3HA 5IWAI 3M85D 2CVEA 4PRVA 4LFCI 1ZM3A 4UT4A 4DUZE 4DV3E 3J80Q 4LFBE 3PS3A 3DD6A 4MU0A 4MYUA 4YHHE 4NXMI 2Z5BB 4LF6E 4HY1A 1HNWE 4DV3I 4DUZI 4DR2E 4LCFA 4LFBI 1VISA 1HNZE 1RR9A 1NHJA 3QT6A 3WU3A 2NN6E 4X62E 4AM3A 1N33I 4JI0I 4DV0E 2EFGA 4FW7A 4JI1E 1Z0EA 2IOPA 4X66E 1P42A 1OYPA 4USKA 1Z5BA 4ZVIA 1XXEA 1RHYA 3B82A 4LF7E 3WU5A 2JEAA 4NBQA 4DV0I 1IBKI 4IZKA 4LPFA 1N36E 2X7IA 2Q2EB 2WP8A 4BA2B 4OKGA 3M7NG 4DR4E 2UXDE 1HR0E 3OTOE 2C38B 5K36E 1VI7A 4R1FA 4DR4I 2UXDI 1Y4SA 1FWLA 2XEXA 4GKJI 4DXLA 2WNRB 3P76A 1KVKA 1PVGA 2VQFI 2Z5EA 3V2UC 2PO2A 1A6FA 3B78A 2HFSA 2PNZB 3PYEA 1UEKA 1N34I 4OZEA 1IBME 4DV7E 5EKWA 1FJGE 2NN6A 1K47A 3LPSA 3QT7A 2F4VE 2IOQA 3CDJA 3GLLA 3HULA 4LF8I 3M85G 1NHIA 3ZZTA 4DV7I 2C39A 3J81Q 2CZ9A 2ZM6I 1FJGI 2VESA 2F4VI 2NN6C 4XTJA 5L3JA 1Y60A 4JI8I 2JE6A 2PNLA 4IS9A 3T1HE 3ZKDA 1I94I 2F1DA 1IBLI 3L7ZB 3ZM7A 4NXNE 2HFUA 3ZKBA 1DARA 2BA0D 2PO0B 2BV3A 4LCHA 4WUDA 2ZITA 4FN5A 2UUCE 1H73A 2NPFA 4KQVA 4JI5E 5K36B 2IERA 4JI7E 4AIMA
chains in the Genus database with same CATH topology
2JEAB 5JEAA 2WP8B 4OO1C 5JEAF 2JEBA 2C37A 5C0XB 3L7ZA 2BA1D 2NN6E 4OO1D 1UDOA 1UDNA 4AM3A 2PO1B 2PO0A 4OO1E 5JEAC 5K36A 5K36F 1R6MA 1OYPA 1OYSA 5JEAD 2BR2B 2JEAA 4NBQA 5JEAE 4IFDB 2WP8A 5C0XA 4BA1B 4BA2B 5C0XF 2JE6B 2PO2B 5K36C 3M7NG 3KRNA 2PO1A 5K36D 2C38B 5K36E 5C0XC 2NN6B 5C0XD 2BR2A 4IFDA 1R6LA 1UDSA 1OYRA 2WNRB 3M7ND 4IFDF 4BA2A 3GMEA 4BA1A 2C39B 2PO2A 3CDIA 2PNZB 4IFDC 2NN6A 2BA1G 2NN6F 4IFDD 3CDJA 3GLLA 4IFDE 3M85G 2WNRA 2BA0G 2C39A 3U1KA 4OO1B 3B4TA 3H1CA 2PNZA 5C0XE 2NN6C 2JE6A 2NN6D 3HKMA 1UDQA 5JEAB 2C38A 2JEBB 1E3HA 2C37B 3L7ZB 3M85D 2BA0D 3GCMA 2PO0B 1E3PA 4AIDA 4OO1A 3DD6A 4OO1F 5K36B 4AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEA B;  5JEA A;  2WP8 B;  4OO1 C;  5JEA F;  2JEB A;  2C37 A;  5C0X B;  3L7Z A;  2BA1 D;  2NN6 E;  4OO1 D;  1UDO A;  1UDN A;  4AM3 A;  2PO1 B;  2PO0 A;  4OO1 E;  5JEA C;  5K36 A;  5K36 F;  1R6M A;  1OYP A;  1OYS A;  5JEA D;  2BR2 B;  2JEA A;  4NBQ A;  5JEA E;  4IFD B;  2WP8 A;  5C0X A;  4BA1 B;  4BA2 B;  5C0X F;  2JE6 B;  2PO2 B;  5K36 C;  3M7N G;  3KRN A;  2PO1 A;  5K36 D;  2C38 B;  5K36 E;  5C0X C;  2NN6 B;  5C0X D;  2BR2 A;  4IFD A;  1R6L A;  1UDS A;  1OYR A;  2WNR B;  3M7N D;  4IFD F;  4BA2 A;  3GME A;  4BA1 A;  2C39 B;  2PO2 A;  3CDI A;  2PNZ B;  4IFD C;  2NN6 A;  2BA1 G;  2NN6 F;  4IFD D;  3CDJ A;  3GLL A;  4IFD E;  3M85 G;  2WNR A;  2BA0 G;  2C39 A;  3U1K A;  4OO1 B;  3B4T A;  3H1C A;  2PNZ A;  5C0X E;  2NN6 C;  2JE6 A;  2NN6 D;  3HKM A;  1UDQ A;  5JEA B;  2C38 A;  2JEB B;  1E3H A;  2C37 B;  3L7Z B;  3M85 D;  2BA0 D;  3GCM A;  2PO0 B;  1E3P A;  4AID A;  4OO1 A;  3DD6 A;  4OO1 F;  5K36 B;  4AIM A; 
#chains in the Genus database with same CATH topology
 4K0K E;  4DV5 I;  5IWA E;  4LFC E;  4JI5 I;  4U3B A;  4DU8 A;  4HAC B;  2GQ0 A;  2UXB I;  4JI7 I;  2Z5C B;  1UDO A;  4FW6 A;  1B63 A;  4EMD A;  4NXM E;  2UU9 E;  4OO1 E;  1FWK A;  2O1T A;  4DPY A;  4DUY I;  2HHH I;  4MYT A;  2Z5B A;  4IZJ B;  5K36 F;  1R6M A;  4WUB A;  4FW4 A;  3GON A;  3J80 C;  2UU9 I;  1MU5 A;  3K85 A;  5IT9 Q;  5JEA E;  5IT9 C;  4BA1 B;  4LF9 E;  1N33 E;  4JI0 E;  5LMN E;  1S4E A;  2AJ4 A;  4B3R I;  5K36 D;  2V2Q A;  1PIE A;  4LF9 I;  2X36 A;  2R42 A;  4DV4 I;  1IBK E;  5LMN I;  3T1Y I;  3HJC A;  1Z0T A;  3D4J A;  1KIJ A;  1XNQ E;  5DRO A;  4DPX A;  1Z5C A;  2E5L E;  2WW4 A;  1FNM A;  2GO3 A;  1WUU A;  4LOM A;  4BA2 A;  3GME A;  4MDT A;  3CDI A;  4LCG A;  1NHH A;  3PYF A;  1XNQ I;  3Q6M A;  1Z0B A;  2DEI A;  4JV5 E;  3M6A A;  2E5L I;  3LNU A;  4DR6 E;  1Z5A A;  4MQY A;  3K17 A;  4GKJ E;  2BA1 G;  4JV5 I;  1H7S A;  2J7K A;  2VQF E;  4IFD E;  2WNR A;  1NZ0 A;  4DR6 I;  1YHC A;  1J5E E;  2BA0 G;  1Y6Z A;  2UUA E;  4JI3 E;  2HK2 A;  4OO1 B;  3B4T A;  4PRX A;  2PNZ A;  1N34 E;  1EA6 A;  4UTG A;  2GS8 A;  4OX9 E;  3K1J A;  3HKM A;  4J3D A;  1J5E I;  2UUA I;  4JI3 I;  2IES A;  1USU A;  5JEA B;  4MU1 A;  4LF8 E;  2JEB B;  2C37 B;  1RRE A;  4OX9 I;  4JI4 I;  3F0N A;  2ZM6 E;  2VQE E;  3H4L A;  3GCM A;  1N32 I;  4AID A;  4JI8 E;  2V2Z A;  4OO1 F;  4X65 E;  2VQE I;  4GKK E;  1I94 E;  3J81 C;  3QT5 A;  1IBL E;  1OJ4 A;  2E1R A;  1Z59 A;  5JEA F;  5C0X B;  3L7Z A;  2BA1 D;  4X65 I;  4DR5 I;  3PS2 A;  4GKK I;  4AQY I;  1YH8 A;  1KTV A;  4OO1 D;  1UDN A;  2PO1 B;  4URL A;  2PO0 A;  5K36 A;  3U1Y A;  3PYG A;  1ZM9 A;  4PU9 A;  4DV5 E;  1OYS A;  5JEA D;  1BKN A;  1USV A;  2BR2 B;  4P52 A;  4JI2 E;  2UXB E;  1HK7 A;  4IFD B;  2HKJ A;  2UXC I;  4KHP I;  2ZBK B;  1H74 A;  2JE6 B;  4HAC A;  5C0X F;  5K36 C;  4DR3 E;  1QZR A;  3KRN A;  4Z7C A;  4DUY E;  2HHH E;  4JI2 I;  4HXZ A;  2AE8 A;  5LMU I;  4DR3 I;  4DR7 E;  4DPT A;  4HYM A;  5C0X D;  3PRY A;  3JAM Q;  5DNX A;  4DPU A;  3JAM C;  1FI4 A;  1UDS A;  4ISA A;  4B3T I;  4I3H A;  4IFD F;  4BA1 A;  4B3R E;  4DR7 I;  4GQU A;  2CG9 A;  1HNX E;  4B3M E;  2O1U A;  4X64 E;  4JYA E;  2GO4 A;  4DV4 E;  3T1Y E;  4DV1 I;  1HNX I;  3CWV A;  4DV6 I;  4IFD D;  4B3M I;  1XMQ I;  4X64 I;  4JYA I;  1Z0W A;  4FWD A;  2BM0 A;  3B8H A;  1XMO I;  4LF5 E;  5DRR A;  3U1K A;  4JI6 E;  5C0X E;  2V34 A;  4LFA E;  4YHH I;  1XHK A;  3QT8 A;  3WU4 A;  3ZZU A;  4LF5 I;  4LF6 I;  1ZM2 A;  4Z7Y A;  5LL6 R;  1HNW I;  1UDQ A;  3P3E A;  4IZJ D;  4DR2 I;  4JI6 I;  1KKH A;  2C38 A;  5BR8 E;  1ELO A;  3P3G A;  1Z0V A;  1HNZ I;  4LFA I;  1XNR E;  2O1V A;  1E3P A;  1ZXM A;  5GMD A;  1ZXN A;  4X62 I;  4OO1 A;  2A2C A;  5BR8 I;  4WUC A;  1MG7 A;  2V8P A;  1XNR I;  4DPW A;  4QNK A;  4DV2 E;  3PYD A;  4JI1 I;  4X66 I;  2JEA B;  1EI1 A;  4IZK B;  3LTO A;  4JI4 E;  5DRQ A;  4P7A A;  4LF7 I;  5JEA A;  2WP8 B;  2J65 A;  4OO1 C;  2O3Z A;  2JEB A;  2C37 A;  2DEJ A;  1N36 I;  1N32 E;  4DV2 I;  1U2R A;  3Q6N A;  2A2D A;  2BM1 A;  1Z0G A;  4RPF A;  1H72 C;  5ELW A;  3PS1 A;  2OI2 A;  4FW9 A;  4DR1 E;  1Y5Y A;  5JEA C;  1HR0 I;  3P06 A;  3OTO I;  4USM A;  2V2V A;  5A2Q Q;  1Z0C A;  5A2Q C;  4QNJ A;  4DR5 E;  2LJP A;  4DR1 I;  4AQY E;  5C0X A;  2PO2 B;  2R3V A;  2PO1 A;  1FKA E;  5FWK A;  1B62 A;  4FW3 A;  2HKE A;  5GME A;  1MX0 A;  4MU3 A;  5C0X C;  4M1K A;  2NN6 B;  1N0U A;  1IBM I;  4ED4 A;  1H7U A;  1ZM4 A;  2UXC E;  2BR2 A;  4KHP E;  1PKP A;  3UHM A;  4IFD A;  1R6L A;  1OYR A;  4MU4 A;  4U3D A;  4LF4 E;  3M7N D;  4DU7 A;  2C39 B;  1S16 A;  1Y4U A;  4YY3 E;  2UUB E;  3WU6 A;  4FW5 A;  4JG4 A;  2VF3 A;  3J7A M;  1D6T A;  3ZZ0 A;  4B3S E;  5LMU E;  2Z5C A;  4LF4 I;  4IFD C;  2HK3 A;  5DRP A;  4YY3 I;  2UUB I;  3V5R A;  2NN6 F;  3T1H I;  4B3T E;  4IZJ A;  4B3S I;  5FLX Q;  3P3C A;  5EL9 A;  3NZK A;  4NXN I;  5FLX C;  4N3O A;  5DNL A;  2CGE A;  3H1C A;  2JT2 A;  3J7A G;  2O1W A;  4FWH A;  3Q1Q A;  2UUC I;  4DV1 E;  2NN6 D;  1N0V C;  4DV6 E;  1XMQ E;  2PNM A;  4K0K I;  4FWG A;  1XMO E;  1E3H A;  5IWA I;  3M85 D;  2CVE A;  4PRV A;  4LFC I;  1ZM3 A;  4UT4 A;  4DUZ E;  4DV3 E;  3J80 Q;  4LFB E;  3PS3 A;  3DD6 A;  4MU0 A;  4MYU A;  4YHH E;  4NXM I;  2Z5B B;  4LF6 E;  4HY1 A;  1HNW E;  4DV3 I;  4DUZ I;  4DR2 E;  4LCF A;  4LFB I;  1VIS A;  1HNZ E;  1RR9 A;  1NHJ A;  3QT6 A;  3WU3 A;  2NN6 E;  4X62 E;  4AM3 A;  1N33 I;  4JI0 I;  4DV0 E;  2EFG A;  4FW7 A;  4JI1 E;  1Z0E A;  2IOP A;  4X66 E;  1P42 A;  1OYP A;  4USK A;  1Z5B A;  4ZVI A;  1XXE A;  1RHY A;  3B82 A;  4LF7 E;  3WU5 A;  2JEA A;  4NBQ A;  4DV0 I;  1IBK I;  4IZK A;  4LPF A;  1N36 E;  2X7I A;  2Q2E B;  2WP8 A;  4BA2 B;  4OKG A;  3M7N G;  4DR4 E;  2UXD E;  1HR0 E;  3OTO E;  2C38 B;  5K36 E;  1VI7 A;  4R1F A;  4DR4 I;  2UXD I;  1Y4S A;  1FWL A;  2XEX A;  4GKJ I;  4DXL A;  2WNR B;  3P76 A;  1KVK A;  1PVG A;  2VQF I;  2Z5E A;  3V2U C;  2PO2 A;  1A6F A;  3B78 A;  2HFS A;  2PNZ B;  3PYE A;  1UEK A;  1N34 I;  4OZE A;  1IBM E;  4DV7 E;  5EKW A;  1FJG E;  2NN6 A;  1K47 A;  3LPS A;  3QT7 A;  2F4V E;  2IOQ A;  3CDJ A;  3GLL A;  3HUL A;  4LF8 I;  3M85 G;  1NHI A;  3ZZT A;  4DV7 I;  2C39 A;  3J81 Q;  2CZ9 A;  2ZM6 I;  1FJG I;  2VES A;  2F4V I;  2NN6 C;  4XTJ A;  5L3J A;  1Y60 A;  4JI8 I;  2JE6 A;  2PNL A;  4IS9 A;  3T1H E;  3ZKD A;  1I94 I;  2F1D A;  1IBL I;  3L7Z B;  3ZM7 A;  4NXN E;  2HFU A;  3ZKB A;  1DAR A;  2BA0 D;  2PO0 B;  2BV3 A;  4LCH A;  4WUD A;  2ZIT A;  4FN5 A;  2UUC E;  1H73 A;  2NPF A;  4KQV A;  4JI5 E;  5K36 B;  2IER A;  4JI7 E;  4AIM A; 
#chains in the Genus database with same CATH homology
 2JEA B;  5JEA A;  2WP8 B;  4OO1 C;  5JEA F;  2JEB A;  2C37 A;  5C0X B;  3L7Z A;  2BA1 D;  2NN6 E;  4OO1 D;  1UDO A;  1UDN A;  4AM3 A;  2PO1 B;  2PO0 A;  4OO1 E;  5JEA C;  5K36 A;  5K36 F;  1R6M A;  1OYP A;  1OYS A;  5JEA D;  2BR2 B;  2JEA A;  4NBQ A;  5JEA E;  4IFD B;  2WP8 A;  5C0X A;  4BA1 B;  4BA2 B;  5C0X F;  2JE6 B;  2PO2 B;  5K36 C;  3M7N G;  3KRN A;  2PO1 A;  5K36 D;  2C38 B;  5K36 E;  5C0X C;  2NN6 B;  5C0X D;  2BR2 A;  4IFD A;  1R6L A;  1UDS A;  1OYR A;  2WNR B;  3M7N D;  4IFD F;  4BA2 A;  3GME A;  4BA1 A;  2C39 B;  2PO2 A;  3CDI A;  2PNZ B;  4IFD C;  2NN6 A;  2BA1 G;  2NN6 F;  4IFD D;  3CDJ A;  3GLL A;  4IFD E;  3M85 G;  2WNR A;  2BA0 G;  2C39 A;  3U1K A;  4OO1 B;  3B4T A;  3H1C A;  2PNZ A;  5C0X E;  2NN6 C;  2JE6 A;  2NN6 D;  3HKM A;  1UDQ A;  5JEA B;  2C38 A;  2JEB B;  1E3H A;  2C37 B;  3L7Z B;  3M85 D;  2BA0 D;  3GCM A;  2PO0 B;  1E3P A;  4AID A;  4OO1 A;  3DD6 A;  4OO1 F;  5K36 B;  4AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...