2PO2A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with cdp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
236
structure length
236
Chain Sequence
b'KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
total genus 73
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po2A01
3CDJA 2C37B 2PO0A 4OO1F 2PO2A 2PO0B 3KRNA 3M85G 2WP8A 2PO2B 4OO1A 2C38A 2JE6A 3M85D 2WP8B 3HKMA 5C0XF 4OO1B 2C38B 4OO1C 1OYPA 2JE6B 3L7ZA 5C0XE 4AIDA 3L7ZB 3CDIA 4OO1D 1UDOA 5K36F 2BA1G 5C0XC 5K36E 3H1CA 5JEAE 2BA1D 2JEBA 1R6LA 4BA2A 5C0XD 2JEBB 5K36B 2PNZA 4BA2B 3B4TA 5K36C 3DD6A 3M7NG 2PNZB 2BA0G 4IFDF 3M7ND 2WNRA 1OYRA 2C39A 3GMEA 3GCMA 5K36D 5C0XA 5JEAD 2BA0D 4IFDE 2NN6E 2WNRB 2C39B 4NBQA 5JEAF 2JEAA 5C0XB 4AM3A 2JEAB 3U1KA 4IFDC 1E3HA 1UDSA 5K36A 5JEAA 2BR2A 1OYSA 5JEAB 5JEAC 1UDQA 2BR2B 4IFDD 2NN6F 4OO1E 1E3PA 2PO1A 4IFDA 1UDNA 2NN6A 4BA1A 1R6MA 2PO1B 4IFDB 3GLLA 2NN6B 2NN6C 4BA1B 2C37A 4AIMA 2NN6D
chains in the Genus database with same CATH superfamily
1HR0E 4JI5I 2BM0A 5DRRA 1KKHA 3QT6A 4X66I 4LPFA 4U3BA 1ZM4A 1KIJA 2J65A 2PO0B 3PS2A 1ZM3A 4B3MI 2GO3A 4LF7I 2VQEI 4JI8I 4MQYA 5DNXA 3WU6A 1YH8A 2WP8B 4DV0I 4HYMA 1Y4UA 4DV3E 5DRQA 5C0XF 4JI6E 2C38B 1MU5A 1USVA 4U3DA 3ZZTA 4EMDA 1NHJA 3L7ZA 4Z7YA 5DNLA 2Z5CA 5LMNE 3J7AM 4FWGA 4LFBE 1K47A 2HFUA 1KVKA 4P52A 1RHYA 2A2DA 4MDTA 3V5RA 4DV5I 1HR0I 5IT9C 1PIEA 3P06A 4DR3E 4LCGA 4JI4E 1RR9A 4OZEA 4JYAE 3K17A 2JEBA 2OI2A 4DR6E 2GQ0A 2ZBKB 1Z5AA 1FWKA 1FI4A 1Y60A 3T1HE 2Z5BA 4JI3E 4DPWA 4DV3I 1NHHA 2ZITA 1N34I 1Y4SA 5LMUE 2PNZB 4B3SI 4IFDF 2PNMA 2WNRA 4LFBI 4DR4I 3GMEA 5C0XA 5JEAD 1A6FA 2NN6E 3B82A 4JI1E 2AE8A 1B63A 5JEAF 2JT2A 4AM3A 4DXLA 4JI4I 4FW6A 4JI0E 4DR6I 2F1DA 4Z7CA 4P7AA 1E3HA 1UDSA 4DR7E 2UXBE 2PNLA 4DV6I 3T1HI 2CVEA 4HY1A 5JEAB 4GKKE 1Z0VA 2V8PA 2BR2B 3QT8A 4DPTA 1XNRE 1N0UA 4FWHA 5LL6R 4HACA 2O1UA 4DPYA 4HXZA 1XMQE 2HHHE 4IFDA 4X64E 4BA1A 2PO1B 4JI0I 4KQVA 2VQFE 3GLLA 1S16A 4DR7I 2E5LI 3J80Q 4DR5I 3P3CA 2NPFA 4UTGA 2CZ9A 2UUCE 4LF6E 1FNMA 3V2UC 1I94E 2C37B 2UUBI 1Z0EA 3HULA 4GKJE 1Z0WA 1XNRI 2GS8A 3NZKA 3M85G 1XMQI 2CGEA 3PS1A 3PYEA 4DU8A 4DV1I 4OO1A 3PYGA 1Y6ZA 4NXNE 1ZM9A 3M85D 2VQFI 3HKMA 1QZRA 2BV3A 5FLXQ 4I3HA 1UEKA 2X36A 1N33E 4ED4A 3L7ZB 5GMDA 2HFSA 3CDIA 4LF5E 2IESA 4B3RI 2Z5CB 1Z0BA 1Y5YA 4PU9A 1I94I 1UDOA 3Q6MA 2A2CA 4QNKA 1H7SA 2IERA 5C0XC 1DARA 4LF9I 4YHHI 5IWAE 2V2VA 3H1CA 4PRVA 5K36E 4LFCE 3ZKDA 1HNXE 4BA2A 4LCHA 4NXNI 5C0XD 2JEBB 2UXCE 4K0KI 3WU4A 3WU5A 2Z5BB 1KTVA 2VF3A 4IZJA 4JG4A 3PYDA 1OYRA 2C39A 3GCMA 4MU3A 2UXDE 4USKA 2WNRB 4GQUA 5C0XB 4NXME 4IFDC 1B62A 3OTOE 3LTOA 2V2QA 4JI6I 2UXCI 1H7UA 4FW4A 5JEAC 1HNZE 2V34A 5EL9A 5BR8E 4IFDD 3Q1QA 5LMNI 4MYUA 3B8HA 4WUBA 4MYTA 4AQYE 1ZXMA 3ZZUA 3M6AA 1IBKE 4OX9E 1BKNA 1U2RA 3F0NA 5DRPA 2NN6A 4DR3I 4HACB 4DU7A 4DR1E 4JYAI 4LFAE 1R6MA 4IFDB 3OTOI 4BA1B 4XTJA 1XMOE 4JI3I 4DPXA 1FKAE 2DEIA 3J81C 5LMUI 4UT4A 5L3JA 1HNWE 4OO1F 4KHPE 4AQYI 5FWKA 2PO2A 4JI1I 3KRNA 1IBKI 4LF4E 4DUYE 5A2QC 1Z0CA 3QT7A 2JE6A 2X7IA 2UUAE 4JI2E 2J7KA 3Q6NA 2WW4A 4OO1B 3PRYA 1OYPA 2UXBI 3JAMQ 4LF8E 1XNQE 4FW5A 4GKKI 3LNUA 4IS9A 1RREA 2IOQA 2F4VE 5K36F 4IZKA 4DUZE 1FJGE 1IBLE 3B78A 5JEAE 1N36E 1R6LA 2DEJA 2HHHI 2UU9E 5EKWA 3T1YE 4X64I 2LJPA 4X65E 4JV5E 4JI2I 4USMA 5K36B 4URLA 4BA2B 4DV7E 3DD6A 3ZM7A 1H74A 4K0KE 4LF8I 1VISA 2UUCI 4JI5E 4LF6I 4IZJB 4X66E 1EA6A 2F4VI 4M1KA 2C39B 2JEAA 4DUZI 4B3ME 4LF7E 1WUUA 1IBLI 4GKJI 1J5EE 4DV0E 2R42A 5K36A 2Q2EB 3QT5A 4FN5A 4DV4E 2BM1A 2HK3A 5ELWA 1OYSA 4DV7I 1NZ0A 1UDQA 2NN6F 4MU0A 4DR2E 1N33I 4DV5E 1ELOA 3J7AG 1Z5CA 4FW7A 1Z0TA 4LF5I 1PVGA 1E3PA 3GONA 2HKEA 1MG7A 1Z0GA 4LOMA 5IWAI 1J5EI 4LFCI 1IBME 2NN6B 4OKGA 1HNXI 1N34E 3K85A 1MX0A 4DV4I 2O1WA 4B3SE 1Z59A 3UHMA 4LCFA 1YHCA 4DR4E 2V2ZA 2IOPA 3CDJA 4FW9A 2O1TA 2PO0A 4QNJA 4DR2I 2VESA 2HK2A 2UXDI 3K1JA 1H72C 2R3VA 1H73A 1FWLA 2WP8A 3JAMC 2PO2B 2Z5EA 3J80C 1USUA 2C38A 3H4LA 4PRXA 4DV6E 2HKJA 2O3ZA 4B3TE 4J3DA 1IBMI 4NXMI 4OO1C 2JE6B 4X62E 1EI1A 3HJCA 1S4EA 4FW3A 4N3OA 5C0XE 1ZM2A 3P3EA 1HNZI 4AIDA 4DPUA 5BR8I 4OO1D 2XEXA 2BA1G 1NHIA 2E1RA 1OJ4A 1N32E 4IZKB 2BA1D 4OX9I 1P42A 4DV2E 2CG9A 4DR1I 5IT9Q 5FLXC 2E5LE 3PS3A 4DR5E 4LFAI 3PYFA 4B3TI 1N0VC 2PNZA 5K36C 3B4TA 1D6TA 3M7NG 5DROA 4X62I 1XMOI 2ZM6E 2BA0G 2UUBE 3ZKBA 4ISAA 3M7ND 5K36D 2BA0D 4IFDE 2O1VA 3ZZ0A 5GMEA 1HNWI 4RPFA 4NBQA 4KHPI 3P76A 3P3GA 4DV1E 4FWDA 1N32I 4YY3E 2JEAB 4JI7E 3U1KA 4IZJD 4DUYI 4DV2I 4LF4I 2GO4A 5JEAA 2UUAI 2EFGA 1PKPA 2BR2A 1VI7A 4WUCA 1XXEA 2AJ4A 3WU3A 3D4JA 3U1YA 4B3RE 4MU4A 1XNQI 3LPSA 4WUDA 2ZM6I 4LF9E 4YHHE 3J81Q 3CWVA 1HK7A 4OO1E 1FJGI 4R1FA 2PO1A 2VQEE 4JI8E 1UDNA 1XHKA 4YY3I 4JI7I 1N36I 2NN6C 2UU9I 3T1YI 5A2QQ 4X65I 4JV5I 4ZVIA 1Z5BA 2C37A 4AIMA 2NN6D 4MU1A 1ZXNA
chains in the Genus database with same CATH topology
3CDJA 2C37B 2PO0A 4OO1F 2PO2A 2PO0B 3KRNA 3M85G 2WP8A 2PO2B 4OO1A 2C38A 2JE6A 3M85D 2WP8B 3HKMA 5C0XF 4OO1B 2C38B 4OO1C 1OYPA 2JE6B 3L7ZA 5C0XE 4AIDA 3L7ZB 3CDIA 4OO1D 1UDOA 5K36F 2BA1G 5C0XC 5K36E 3H1CA 5JEAE 2BA1D 2JEBA 1R6LA 4BA2A 5C0XD 2JEBB 5K36B 2PNZA 4BA2B 3B4TA 5K36C 3DD6A 3M7NG 2PNZB 2BA0G 4IFDF 3M7ND 2WNRA 1OYRA 2C39A 3GMEA 3GCMA 5K36D 5C0XA 5JEAD 2BA0D 4IFDE 2NN6E 2WNRB 2C39B 4NBQA 5JEAF 2JEAA 5C0XB 4AM3A 2JEAB 3U1KA 4IFDC 1E3HA 1UDSA 5K36A 5JEAA 2BR2A 1OYSA 5JEAB 5JEAC 1UDQA 2BR2B 4IFDD 2NN6F 4OO1E 1E3PA 2PO1A 4IFDA 1UDNA 2NN6A 4BA1A 1R6MA 2PO1B 4IFDB 3GLLA 2NN6B 2NN6C 4BA1B 2C37A 4AIMA 2NN6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDJ A;  2C37 B;  2PO0 A;  4OO1 F;  2PO2 A;  2PO0 B;  3KRN A;  3M85 G;  2WP8 A;  2PO2 B;  4OO1 A;  2C38 A;  2JE6 A;  3M85 D;  2WP8 B;  3HKM A;  5C0X F;  4OO1 B;  2C38 B;  4OO1 C;  1OYP A;  2JE6 B;  3L7Z A;  5C0X E;  4AID A;  3L7Z B;  3CDI A;  4OO1 D;  1UDO A;  5K36 F;  2BA1 G;  5C0X C;  5K36 E;  3H1C A;  5JEA E;  2BA1 D;  2JEB A;  1R6L A;  4BA2 A;  5C0X D;  2JEB B;  5K36 B;  2PNZ A;  4BA2 B;  3B4T A;  5K36 C;  3DD6 A;  3M7N G;  2PNZ B;  2BA0 G;  4IFD F;  3M7N D;  2WNR A;  1OYR A;  2C39 A;  3GME A;  3GCM A;  5K36 D;  5C0X A;  5JEA D;  2BA0 D;  4IFD E;  2NN6 E;  2WNR B;  2C39 B;  4NBQ A;  5JEA F;  2JEA A;  5C0X B;  4AM3 A;  2JEA B;  3U1K A;  4IFD C;  1E3H A;  1UDS A;  5K36 A;  5JEA A;  2BR2 A;  1OYS A;  5JEA B;  5JEA C;  1UDQ A;  2BR2 B;  4IFD D;  2NN6 F;  4OO1 E;  1E3P A;  2PO1 A;  4IFD A;  1UDN A;  2NN6 A;  4BA1 A;  1R6M A;  2PO1 B;  4IFD B;  3GLL A;  2NN6 B;  2NN6 C;  4BA1 B;  2C37 A;  4AIM A;  2NN6 D; 
#chains in the Genus database with same CATH topology
 1HR0 E;  4JI5 I;  2BM0 A;  5DRR A;  1KKH A;  3QT6 A;  4X66 I;  4LPF A;  4U3B A;  1ZM4 A;  1KIJ A;  2J65 A;  2PO0 B;  3PS2 A;  1ZM3 A;  4B3M I;  2GO3 A;  4LF7 I;  2VQE I;  4JI8 I;  4MQY A;  5DNX A;  3WU6 A;  1YH8 A;  2WP8 B;  4DV0 I;  4HYM A;  1Y4U A;  4DV3 E;  5DRQ A;  5C0X F;  4JI6 E;  2C38 B;  1MU5 A;  1USV A;  4U3D A;  3ZZT A;  4EMD A;  1NHJ A;  3L7Z A;  4Z7Y A;  5DNL A;  2Z5C A;  5LMN E;  3J7A M;  4FWG A;  4LFB E;  1K47 A;  2HFU A;  1KVK A;  4P52 A;  1RHY A;  2A2D A;  4MDT A;  3V5R A;  4DV5 I;  1HR0 I;  5IT9 C;  1PIE A;  3P06 A;  4DR3 E;  4LCG A;  4JI4 E;  1RR9 A;  4OZE A;  4JYA E;  3K17 A;  2JEB A;  2OI2 A;  4DR6 E;  2GQ0 A;  2ZBK B;  1Z5A A;  1FWK A;  1FI4 A;  1Y60 A;  3T1H E;  2Z5B A;  4JI3 E;  4DPW A;  4DV3 I;  1NHH A;  2ZIT A;  1N34 I;  1Y4S A;  5LMU E;  2PNZ B;  4B3S I;  4IFD F;  2PNM A;  2WNR A;  4LFB I;  4DR4 I;  3GME A;  5C0X A;  5JEA D;  1A6F A;  2NN6 E;  3B82 A;  4JI1 E;  2AE8 A;  1B63 A;  5JEA F;  2JT2 A;  4AM3 A;  4DXL A;  4JI4 I;  4FW6 A;  4JI0 E;  4DR6 I;  2F1D A;  4Z7C A;  4P7A A;  1E3H A;  1UDS A;  4DR7 E;  2UXB E;  2PNL A;  4DV6 I;  3T1H I;  2CVE A;  4HY1 A;  5JEA B;  4GKK E;  1Z0V A;  2V8P A;  2BR2 B;  3QT8 A;  4DPT A;  1XNR E;  1N0U A;  4FWH A;  5LL6 R;  4HAC A;  2O1U A;  4DPY A;  4HXZ A;  1XMQ E;  2HHH E;  4IFD A;  4X64 E;  4BA1 A;  2PO1 B;  4JI0 I;  4KQV A;  2VQF E;  3GLL A;  1S16 A;  4DR7 I;  2E5L I;  3J80 Q;  4DR5 I;  3P3C A;  2NPF A;  4UTG A;  2CZ9 A;  2UUC E;  4LF6 E;  1FNM A;  3V2U C;  1I94 E;  2C37 B;  2UUB I;  1Z0E A;  3HUL A;  4GKJ E;  1Z0W A;  1XNR I;  2GS8 A;  3NZK A;  3M85 G;  1XMQ I;  2CGE A;  3PS1 A;  3PYE A;  4DU8 A;  4DV1 I;  4OO1 A;  3PYG A;  1Y6Z A;  4NXN E;  1ZM9 A;  3M85 D;  2VQF I;  3HKM A;  1QZR A;  2BV3 A;  5FLX Q;  4I3H A;  1UEK A;  2X36 A;  1N33 E;  4ED4 A;  3L7Z B;  5GMD A;  2HFS A;  3CDI A;  4LF5 E;  2IES A;  4B3R I;  2Z5C B;  1Z0B A;  1Y5Y A;  4PU9 A;  1I94 I;  1UDO A;  3Q6M A;  2A2C A;  4QNK A;  1H7S A;  2IER A;  5C0X C;  1DAR A;  4LF9 I;  4YHH I;  5IWA E;  2V2V A;  3H1C A;  4PRV A;  5K36 E;  4LFC E;  3ZKD A;  1HNX E;  4BA2 A;  4LCH A;  4NXN I;  5C0X D;  2JEB B;  2UXC E;  4K0K I;  3WU4 A;  3WU5 A;  2Z5B B;  1KTV A;  2VF3 A;  4IZJ A;  4JG4 A;  3PYD A;  1OYR A;  2C39 A;  3GCM A;  4MU3 A;  2UXD E;  4USK A;  2WNR B;  4GQU A;  5C0X B;  4NXM E;  4IFD C;  1B62 A;  3OTO E;  3LTO A;  2V2Q A;  4JI6 I;  2UXC I;  1H7U A;  4FW4 A;  5JEA C;  1HNZ E;  2V34 A;  5EL9 A;  5BR8 E;  4IFD D;  3Q1Q A;  5LMN I;  4MYU A;  3B8H A;  4WUB A;  4MYT A;  4AQY E;  1ZXM A;  3ZZU A;  3M6A A;  1IBK E;  4OX9 E;  1BKN A;  1U2R A;  3F0N A;  5DRP A;  2NN6 A;  4DR3 I;  4HAC B;  4DU7 A;  4DR1 E;  4JYA I;  4LFA E;  1R6M A;  4IFD B;  3OTO I;  4BA1 B;  4XTJ A;  1XMO E;  4JI3 I;  4DPX A;  1FKA E;  2DEI A;  3J81 C;  5LMU I;  4UT4 A;  5L3J A;  1HNW E;  4OO1 F;  4KHP E;  4AQY I;  5FWK A;  2PO2 A;  4JI1 I;  3KRN A;  1IBK I;  4LF4 E;  4DUY E;  5A2Q C;  1Z0C A;  3QT7 A;  2JE6 A;  2X7I A;  2UUA E;  4JI2 E;  2J7K A;  3Q6N A;  2WW4 A;  4OO1 B;  3PRY A;  1OYP A;  2UXB I;  3JAM Q;  4LF8 E;  1XNQ E;  4FW5 A;  4GKK I;  3LNU A;  4IS9 A;  1RRE A;  2IOQ A;  2F4V E;  5K36 F;  4IZK A;  4DUZ E;  1FJG E;  1IBL E;  3B78 A;  5JEA E;  1N36 E;  1R6L A;  2DEJ A;  2HHH I;  2UU9 E;  5EKW A;  3T1Y E;  4X64 I;  2LJP A;  4X65 E;  4JV5 E;  4JI2 I;  4USM A;  5K36 B;  4URL A;  4BA2 B;  4DV7 E;  3DD6 A;  3ZM7 A;  1H74 A;  4K0K E;  4LF8 I;  1VIS A;  2UUC I;  4JI5 E;  4LF6 I;  4IZJ B;  4X66 E;  1EA6 A;  2F4V I;  4M1K A;  2C39 B;  2JEA A;  4DUZ I;  4B3M E;  4LF7 E;  1WUU A;  1IBL I;  4GKJ I;  1J5E E;  4DV0 E;  2R42 A;  5K36 A;  2Q2E B;  3QT5 A;  4FN5 A;  4DV4 E;  2BM1 A;  2HK3 A;  5ELW A;  1OYS A;  4DV7 I;  1NZ0 A;  1UDQ A;  2NN6 F;  4MU0 A;  4DR2 E;  1N33 I;  4DV5 E;  1ELO A;  3J7A G;  1Z5C A;  4FW7 A;  1Z0T A;  4LF5 I;  1PVG A;  1E3P A;  3GON A;  2HKE A;  1MG7 A;  1Z0G A;  4LOM A;  5IWA I;  1J5E I;  4LFC I;  1IBM E;  2NN6 B;  4OKG A;  1HNX I;  1N34 E;  3K85 A;  1MX0 A;  4DV4 I;  2O1W A;  4B3S E;  1Z59 A;  3UHM A;  4LCF A;  1YHC A;  4DR4 E;  2V2Z A;  2IOP A;  3CDJ A;  4FW9 A;  2O1T A;  2PO0 A;  4QNJ A;  4DR2 I;  2VES A;  2HK2 A;  2UXD I;  3K1J A;  1H72 C;  2R3V A;  1H73 A;  1FWL A;  2WP8 A;  3JAM C;  2PO2 B;  2Z5E A;  3J80 C;  1USU A;  2C38 A;  3H4L A;  4PRX A;  4DV6 E;  2HKJ A;  2O3Z A;  4B3T E;  4J3D A;  1IBM I;  4NXM I;  4OO1 C;  2JE6 B;  4X62 E;  1EI1 A;  3HJC A;  1S4E A;  4FW3 A;  4N3O A;  5C0X E;  1ZM2 A;  3P3E A;  1HNZ I;  4AID A;  4DPU A;  5BR8 I;  4OO1 D;  2XEX A;  2BA1 G;  1NHI A;  2E1R A;  1OJ4 A;  1N32 E;  4IZK B;  2BA1 D;  4OX9 I;  1P42 A;  4DV2 E;  2CG9 A;  4DR1 I;  5IT9 Q;  5FLX C;  2E5L E;  3PS3 A;  4DR5 E;  4LFA I;  3PYF A;  4B3T I;  1N0V C;  2PNZ A;  5K36 C;  3B4T A;  1D6T A;  3M7N G;  5DRO A;  4X62 I;  1XMO I;  2ZM6 E;  2BA0 G;  2UUB E;  3ZKB A;  4ISA A;  3M7N D;  5K36 D;  2BA0 D;  4IFD E;  2O1V A;  3ZZ0 A;  5GME A;  1HNW I;  4RPF A;  4NBQ A;  4KHP I;  3P76 A;  3P3G A;  4DV1 E;  4FWD A;  1N32 I;  4YY3 E;  2JEA B;  4JI7 E;  3U1K A;  4IZJ D;  4DUY I;  4DV2 I;  4LF4 I;  2GO4 A;  5JEA A;  2UUA I;  2EFG A;  1PKP A;  2BR2 A;  1VI7 A;  4WUC A;  1XXE A;  2AJ4 A;  3WU3 A;  3D4J A;  3U1Y A;  4B3R E;  4MU4 A;  1XNQ I;  3LPS A;  4WUD A;  2ZM6 I;  4LF9 E;  4YHH E;  3J81 Q;  3CWV A;  1HK7 A;  4OO1 E;  1FJG I;  4R1F A;  2PO1 A;  2VQE E;  4JI8 E;  1UDN A;  1XHK A;  4YY3 I;  4JI7 I;  1N36 I;  2NN6 C;  2UU9 I;  3T1Y I;  5A2Q Q;  4X65 I;  4JV5 I;  4ZVI A;  1Z5B A;  2C37 A;  4AIM A;  2NN6 D;  4MU1 A;  1ZXN A; 
#chains in the Genus database with same CATH homology
 3CDJ A;  2C37 B;  2PO0 A;  4OO1 F;  2PO2 A;  2PO0 B;  3KRN A;  3M85 G;  2WP8 A;  2PO2 B;  4OO1 A;  2C38 A;  2JE6 A;  3M85 D;  2WP8 B;  3HKM A;  5C0X F;  4OO1 B;  2C38 B;  4OO1 C;  1OYP A;  2JE6 B;  3L7Z A;  5C0X E;  4AID A;  3L7Z B;  3CDI A;  4OO1 D;  1UDO A;  5K36 F;  2BA1 G;  5C0X C;  5K36 E;  3H1C A;  5JEA E;  2BA1 D;  2JEB A;  1R6L A;  4BA2 A;  5C0X D;  2JEB B;  5K36 B;  2PNZ A;  4BA2 B;  3B4T A;  5K36 C;  3DD6 A;  3M7N G;  2PNZ B;  2BA0 G;  4IFD F;  3M7N D;  2WNR A;  1OYR A;  2C39 A;  3GME A;  3GCM A;  5K36 D;  5C0X A;  5JEA D;  2BA0 D;  4IFD E;  2NN6 E;  2WNR B;  2C39 B;  4NBQ A;  5JEA F;  2JEA A;  5C0X B;  4AM3 A;  2JEA B;  3U1K A;  4IFD C;  1E3H A;  1UDS A;  5K36 A;  5JEA A;  2BR2 A;  1OYS A;  5JEA B;  5JEA C;  1UDQ A;  2BR2 B;  4IFD D;  2NN6 F;  4OO1 E;  1E3P A;  2PO1 A;  4IFD A;  1UDN A;  2NN6 A;  4BA1 A;  1R6M A;  2PO1 B;  4IFD B;  3GLL A;  2NN6 B;  2NN6 C;  4BA1 B;  2C37 A;  4AIM A;  2NN6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...