2PO2A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with cdp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
molecule keywords Probable exosome complex exonuclease 1
total genus 73
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po2A01
1OYPA 2NN6E 2WNRA 5JEAA 4OO1F 2PO0A 4OO1D 5K36D 2PNZB 5K36A 4IFDA 4IFDF 5C0XA 2JE6B 2WP8B 5JEAB 3GCMA 3L7ZA 5C0XD 2BA0D 1OYRA 2BA0G 2PNZA 4IFDC 2NN6C 3DD6A 2JEAA 4OO1B 1UDSA 1E3HA 1R6LA 2C39A 4NBQA 4BA1A 3B4TA 1UDOA 2NN6D 3HKMA 4BA2B 2NN6A 2BA1D 2PO2B 1R6MA 2PO0B 3M85G 2BA1G 3CDIA 2C38B 5K36B 4IFDB 4BA2A 4OO1E 3M7ND 4AIDA 2JE6A 2PO2A 2C37B 4AIMA 2WNRB 5K36F 2BR2A 3GMEA 4AM3A 2JEAB 5JEAC 2JEBA 4BA1B 2PO1B 5C0XB 4OO1C 2C37A 5JEAD 1UDNA 2BR2B 3L7ZB 3H1CA 5C0XF 2JEBB 3KRNA 2PO1A 5C0XE 3GLLA 4OO1A 2C38A 4IFDE 5K36E 3U1KA 2C39B 3M7NG 1E3PA 3CDJA 4IFDD 5JEAF 3M85D 5K36C 1OYSA 2NN6B 5JEAE 2NN6F 5C0XC 1UDQA 2WP8A
chains in the Genus database with same CATH superfamily
3ZZ0A 2VQEI 1N36I 2VQFI 3PYFA 4IFDA 4JV5I 3QT8A 3CWVA 1IBME 2V34A 4IFDF 3HJCA 2ZITA 4K0KI 2X36A 4DUYI 4LFCE 3LTOA 3L7ZA 4X64E 4JG4A 3OTOE 4MDTA 3PS1A 1U2RA 4U3BA 1OJ4A 4DPUA 2Q2EB 1IBKE 3B8HA 2IESA 3J81C 5IWAE 5DNLA 4AQYE 1HNXI 3GONA 4X66I 2O3ZA 1Z0BA 4MU3A 4B3MI 2NN6D 3P06A 4DV3I 5BR8E 1S4EA 3QT7A 1PVGA 1H73A 2BM0A 5DRPA 1FJGI 3J81Q 1P42A 4LF4E 1Z0VA 3WU4A 3P3CA 4YHHI 5L3JA 1HNXE 5K36B 2J7KA 3M7ND 1Z0EA 2E1RA 4R1FA 4KHPE 1Y60A 2EFGA 1MU5A 5FLXQ 1HNZI 4AQYI 2WW4A 3GMEA 4DU7A 4OZEA 4JI2E 2JEAB 2UXDE 1NHIA 4FWDA 5LMUE 4JI3E 1XHKA 5IWAI 4JV5E 4MU0A 1XMOE 2BM1A 1I94E 4DV7E 4NXME 2HFSA 3HULA 4LF6E 2UUBI 4OO1C 2CGEA 2DEIA 4PRVA 2UXBI 1UDNA 4PRXA 4FW3A 1FWKA 1RREA 3L7ZB 1Z0TA 4MU4A 4LCFA 1VI7A 3ZKBA 2HHHI 5C0XF 1XMQE 1QZRA 2NPFA 2UXDI 3KRNA 2PO1A 4DV6E 4OO1A 2HFUA 1B62A 5K36E 3M7NG 2HKEA 1E3PA 2A2DA 3D4JA 2PNLA 4IFDD 4DR6I 5JEAF 4Z7CA 2GO3A 5K36C 1OYSA 4DR5I 4DUZI 4OX9I 1EI1A 5C0XC 1UDQA 1K47A 1OYPA 4JI0I 3QT5A 5JEAA 4IZJB 2Z5EA 4B3RE 4UT4A 2UUCE 4YHHE 2UUBE 4HYMA 3JAMQ 3T1YE 2UU9E 5K36A 1Z5BA 4DV4I 1D6TA 5C0XA 4LF6I 4GKJI 1N32E 1ZXMA 2WP8B 4MYUA 1Z0GA 3Q1QA 1OYRA 1XXEA 2Z5CB 2PNZA 4JI0E 4IFDC 4XTJA 3JAMC 2X7IA 2JEAA 3V5RA 1N36E 2UXCE 4LF9I 4IZJD 3ZM7A 3PRYA 1UDSA 4URLA 4DR6E 2GQ0A 4NBQA 1DARA 1ZM2A 4ED4A 2A2CA 3WU3A 1EA6A 4LFCI 4DUZE 4B3RI 4DV2I 3J80Q 3WU6A 2PO0B 1IBLE 1IBMI 5LMNI 3P76A 1XNRE 3K85A 5A2QQ 2BA1G 3CDIA 4DV1E 5FWKA 4EMDA 4JI5I 1HNWI 4IFDB 2R3VA 4B3ME 3PYDA 4LFAE 4N3OA 2PO2A 2V2ZA 4FW5A 4FW6A 4HACB 1NHHA 4HXZA 3J80C 4DPTA 4AIMA 2WNRB 2E5LI 4FWHA 5FLXC 4DV7I 4NXMI 4JI4E 1YHCA 2JEBA 4BA1B 5C0XB 1FNMA 5IT9C 1YH8A 3V2UC 4DR7E 1N34I 3PYEA 1RR9A 3Q6MA 4DU8A 2Z5CA 4DXLA 1HNWE 1XNQE 2VESA 3J7AG 2C38A 4DV1I 4JI5E 1FKAE 3PS3A 4DR2I 4GQUA 3M85D 4DR3E 2NN6B 4ZVIA 4B3SE 1HR0I 2NN6E 4LPFA 4JI4I 2VQFE 2R42A 4DR4E 3P3GA 2PO0A 4OO1D 4J3DA 5K36D 3ZKDA 5DNXA 1H74A 3P3EA 4DPYA 2V8PA 1UEKA 4LFAI 2JE6B 2F1DA 2Z5BA 4M1KA 1ZM3A 2HHHE 4X62E 3LPSA 4B3TE 2UUAE 2BA0G 1Y6ZA 2AE8A 4LF9E 2AJ4A 4DR4I 1XNQI 2V2QA 2ZBKB 4GKKE 2V2VA 4X65I 4OO1B 1HK7A 1J5EE 1Y4SA 2J65A 4BA1A 2C39A 3T1HI 1RHYA 4MQYA 4OX9E 2PNMA 4DR2E 4GKJE 1N32I 1H7SA 2BA1D 4JI8E 5LMNE 3T1YI 1R6MA 4IZJA 2F4VI 1N33I 4LF7I 2CVEA 2GO4A 4GKKI 3PYGA 4PU9A 4FW7A 2C38B 1J5EI 4OO1E 1VISA 4DR1I 5A2QC 4JI1E 1KKHA 4KHPI 4B3TI 4B3SI 2HKJA 2UXCI 2C37B 4JYAI 1N0VC 1B63A 4AM3A 2DEJA 4LF7E 5JEAC 3K1JA 1I94I 2IERA 2O1UA 4DR7I 2PO1B 2UXBE 3F0NA 2Z5BB 2CZ9A 2C37A 4ISAA 5JEAD 2UUAI 1IBLI 2O1TA 4WUDA 4FWGA 5IT9Q 3B82A 3H1CA 1S16A 4P7AA 2F4VE 4MYTA 4FN5A 5C0XE 4IZKB 5DRRA 4DPWA 3B78A 2C39B 1Z5CA 1IBKI 4IS9A 4DUYE 4JI1I 1HR0E 1N34E 3PS2A 4Z7YA 2E5LE 4LOMA 2OI2A 3ZZTA 5JEAE 4JI8I 1FWLA 1PKPA 2WP8A 2WNRA 4IZKA 4LCGA 3ZZUA 2UUCI 4I3HA 4OO1F 5DROA 2JT2A 4LF5I 2PNZB 4RPFA 3U1YA 1FJGE 4X66E 4OKGA 4YY3I 5GMEA 3Q6NA 2O1VA 2UU9I 1FI4A 4U3DA 5ELWA 4DV3E 1NZ0A 4DV4E 4KQVA 5JEAB 4FW9A 2BV3A 5LL6R 4USMA 5BR8I 3GCMA 4JI6E 5C0XD 2BA0D 1MX0A 2HK3A 2NN6C 3DD6A 2XEXA 1KTVA 4LF8E 1HNZE 1Y4UA 1A6FA 1E3HA 4LFBI 3UHMA 1R6LA 1KVKA 3B4TA 2LJPA 3LNUA 4DPXA 1UDOA 3HKMA 4BA2B 1H72C 1Z5AA 4DV2E 2NN6A 4QNJA 1ZXNA 2IOQA 4HY1A 1KIJA 2IOPA 4DV0I 4JI6I 2PO2B 1USVA 2CG9A 5EKWA 5DRQA 3M6AA 1Z0WA 4JI2I 1N0UA 2VQEE 1USUA 3M85G 4DR1E 4WUBA 1XMOI 1BKNA 1MG7A 4BA2A 2O1WA 1XNRI 4AIDA 3T1HE 4X62I 1ZM4A 2JE6A 4NXNI 4DV5I 1WUUA 1ZM9A 4JI7E 2ZM6E 4JYAE 2VF3A 4DV0E 4X65E 1Y5YA 1PIEA 5K36F 4UTGA 2BR2A 4DR5E 4USKA 1N33E 4LCHA 4LF5E 4YY3E 4LFBE 5LMUI 4JI3I 4HACA 3NZKA 4FW4A 4WUCA 2BR2B 5GMDA 3K17A 5EL9A 3J7AM 1Z0CA 4P52A 1Z59A 2JEBB 4LF4I 4LF8I 4X64I 3OTOI 3QT6A 3GLLA 1XMQI 2HK2A 4IFDE 4MU1A 3U1KA 4DR3I 4DV6I 2GS8A 4K0KE 3CDJA 1ELOA 1H7UA 4NXNE 3WU5A 4DV5E 2NN6F 2ZM6I 3H4LA 1NHJA 4QNKA 4JI7I
chains in the Genus database with same CATH topology
1OYPA 2NN6E 2WNRA 5JEAA 4OO1F 2PO0A 4OO1D 5K36D 2PNZB 5K36A 4IFDA 4IFDF 5C0XA 2JE6B 2WP8B 5JEAB 3GCMA 3L7ZA 5C0XD 2BA0D 1OYRA 2BA0G 2PNZA 4IFDC 2NN6C 3DD6A 2JEAA 4OO1B 1UDSA 1E3HA 1R6LA 2C39A 4NBQA 4BA1A 3B4TA 1UDOA 2NN6D 3HKMA 4BA2B 2NN6A 2BA1D 2PO2B 1R6MA 2PO0B 3M85G 2BA1G 3CDIA 2C38B 5K36B 4IFDB 4BA2A 4OO1E 3M7ND 4AIDA 2JE6A 2PO2A 2C37B 4AIMA 2WNRB 5K36F 2BR2A 3GMEA 4AM3A 2JEAB 5JEAC 2JEBA 4BA1B 2PO1B 5C0XB 4OO1C 2C37A 5JEAD 1UDNA 2BR2B 3L7ZB 3H1CA 5C0XF 2JEBB 3KRNA 2PO1A 5C0XE 3GLLA 4OO1A 2C38A 4IFDE 5K36E 3U1KA 2C39B 3M7NG 1E3PA 3CDJA 4IFDD 5JEAF 3M85D 5K36C 1OYSA 2NN6B 5JEAE 2NN6F 5C0XC 1UDQA 2WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYP A;  2NN6 E;  2WNR A;  5JEA A;  4OO1 F;  2PO0 A;  4OO1 D;  5K36 D;  2PNZ B;  5K36 A;  4IFD A;  4IFD F;  5C0X A;  2JE6 B;  2WP8 B;  5JEA B;  3GCM A;  3L7Z A;  5C0X D;  2BA0 D;  1OYR A;  2BA0 G;  2PNZ A;  4IFD C;  2NN6 C;  3DD6 A;  2JEA A;  4OO1 B;  1UDS A;  1E3H A;  1R6L A;  2C39 A;  4NBQ A;  4BA1 A;  3B4T A;  1UDO A;  2NN6 D;  3HKM A;  4BA2 B;  2NN6 A;  2BA1 D;  2PO2 B;  1R6M A;  2PO0 B;  3M85 G;  2BA1 G;  3CDI A;  2C38 B;  5K36 B;  4IFD B;  4BA2 A;  4OO1 E;  3M7N D;  4AID A;  2JE6 A;  2PO2 A;  2C37 B;  4AIM A;  2WNR B;  5K36 F;  2BR2 A;  3GME A;  4AM3 A;  2JEA B;  5JEA C;  2JEB A;  4BA1 B;  2PO1 B;  5C0X B;  4OO1 C;  2C37 A;  5JEA D;  1UDN A;  2BR2 B;  3L7Z B;  3H1C A;  5C0X F;  2JEB B;  3KRN A;  2PO1 A;  5C0X E;  3GLL A;  4OO1 A;  2C38 A;  4IFD E;  5K36 E;  3U1K A;  2C39 B;  3M7N G;  1E3P A;  3CDJ A;  4IFD D;  5JEA F;  3M85 D;  5K36 C;  1OYS A;  2NN6 B;  5JEA E;  2NN6 F;  5C0X C;  1UDQ A;  2WP8 A; 
#chains in the Genus database with same CATH topology
 3ZZ0 A;  2VQE I;  1N36 I;  2VQF I;  3PYF A;  4IFD A;  4JV5 I;  3QT8 A;  3CWV A;  1IBM E;  2V34 A;  4IFD F;  3HJC A;  2ZIT A;  4K0K I;  2X36 A;  4DUY I;  4LFC E;  3LTO A;  3L7Z A;  4X64 E;  4JG4 A;  3OTO E;  4MDT A;  3PS1 A;  1U2R A;  4U3B A;  1OJ4 A;  4DPU A;  2Q2E B;  1IBK E;  3B8H A;  2IES A;  3J81 C;  5IWA E;  5DNL A;  4AQY E;  1HNX I;  3GON A;  4X66 I;  2O3Z A;  1Z0B A;  4MU3 A;  4B3M I;  2NN6 D;  3P06 A;  4DV3 I;  5BR8 E;  1S4E A;  3QT7 A;  1PVG A;  1H73 A;  2BM0 A;  5DRP A;  1FJG I;  3J81 Q;  1P42 A;  4LF4 E;  1Z0V A;  3WU4 A;  3P3C A;  4YHH I;  5L3J A;  1HNX E;  5K36 B;  2J7K A;  3M7N D;  1Z0E A;  2E1R A;  4R1F A;  4KHP E;  1Y60 A;  2EFG A;  1MU5 A;  5FLX Q;  1HNZ I;  4AQY I;  2WW4 A;  3GME A;  4DU7 A;  4OZE A;  4JI2 E;  2JEA B;  2UXD E;  1NHI A;  4FWD A;  5LMU E;  4JI3 E;  1XHK A;  5IWA I;  4JV5 E;  4MU0 A;  1XMO E;  2BM1 A;  1I94 E;  4DV7 E;  4NXM E;  2HFS A;  3HUL A;  4LF6 E;  2UUB I;  4OO1 C;  2CGE A;  2DEI A;  4PRV A;  2UXB I;  1UDN A;  4PRX A;  4FW3 A;  1FWK A;  1RRE A;  3L7Z B;  1Z0T A;  4MU4 A;  4LCF A;  1VI7 A;  3ZKB A;  2HHH I;  5C0X F;  1XMQ E;  1QZR A;  2NPF A;  2UXD I;  3KRN A;  2PO1 A;  4DV6 E;  4OO1 A;  2HFU A;  1B62 A;  5K36 E;  3M7N G;  2HKE A;  1E3P A;  2A2D A;  3D4J A;  2PNL A;  4IFD D;  4DR6 I;  5JEA F;  4Z7C A;  2GO3 A;  5K36 C;  1OYS A;  4DR5 I;  4DUZ I;  4OX9 I;  1EI1 A;  5C0X C;  1UDQ A;  1K47 A;  1OYP A;  4JI0 I;  3QT5 A;  5JEA A;  4IZJ B;  2Z5E A;  4B3R E;  4UT4 A;  2UUC E;  4YHH E;  2UUB E;  4HYM A;  3JAM Q;  3T1Y E;  2UU9 E;  5K36 A;  1Z5B A;  4DV4 I;  1D6T A;  5C0X A;  4LF6 I;  4GKJ I;  1N32 E;  1ZXM A;  2WP8 B;  4MYU A;  1Z0G A;  3Q1Q A;  1OYR A;  1XXE A;  2Z5C B;  2PNZ A;  4JI0 E;  4IFD C;  4XTJ A;  3JAM C;  2X7I A;  2JEA A;  3V5R A;  1N36 E;  2UXC E;  4LF9 I;  4IZJ D;  3ZM7 A;  3PRY A;  1UDS A;  4URL A;  4DR6 E;  2GQ0 A;  4NBQ A;  1DAR A;  1ZM2 A;  4ED4 A;  2A2C A;  3WU3 A;  1EA6 A;  4LFC I;  4DUZ E;  4B3R I;  4DV2 I;  3J80 Q;  3WU6 A;  2PO0 B;  1IBL E;  1IBM I;  5LMN I;  3P76 A;  1XNR E;  3K85 A;  5A2Q Q;  2BA1 G;  3CDI A;  4DV1 E;  5FWK A;  4EMD A;  4JI5 I;  1HNW I;  4IFD B;  2R3V A;  4B3M E;  3PYD A;  4LFA E;  4N3O A;  2PO2 A;  2V2Z A;  4FW5 A;  4FW6 A;  4HAC B;  1NHH A;  4HXZ A;  3J80 C;  4DPT A;  4AIM A;  2WNR B;  2E5L I;  4FWH A;  5FLX C;  4DV7 I;  4NXM I;  4JI4 E;  1YHC A;  2JEB A;  4BA1 B;  5C0X B;  1FNM A;  5IT9 C;  1YH8 A;  3V2U C;  4DR7 E;  1N34 I;  3PYE A;  1RR9 A;  3Q6M A;  4DU8 A;  2Z5C A;  4DXL A;  1HNW E;  1XNQ E;  2VES A;  3J7A G;  2C38 A;  4DV1 I;  4JI5 E;  1FKA E;  3PS3 A;  4DR2 I;  4GQU A;  3M85 D;  4DR3 E;  2NN6 B;  4ZVI A;  4B3S E;  1HR0 I;  2NN6 E;  4LPF A;  4JI4 I;  2VQF E;  2R42 A;  4DR4 E;  3P3G A;  2PO0 A;  4OO1 D;  4J3D A;  5K36 D;  3ZKD A;  5DNX A;  1H74 A;  3P3E A;  4DPY A;  2V8P A;  1UEK A;  4LFA I;  2JE6 B;  2F1D A;  2Z5B A;  4M1K A;  1ZM3 A;  2HHH E;  4X62 E;  3LPS A;  4B3T E;  2UUA E;  2BA0 G;  1Y6Z A;  2AE8 A;  4LF9 E;  2AJ4 A;  4DR4 I;  1XNQ I;  2V2Q A;  2ZBK B;  4GKK E;  2V2V A;  4X65 I;  4OO1 B;  1HK7 A;  1J5E E;  1Y4S A;  2J65 A;  4BA1 A;  2C39 A;  3T1H I;  1RHY A;  4MQY A;  4OX9 E;  2PNM A;  4DR2 E;  4GKJ E;  1N32 I;  1H7S A;  2BA1 D;  4JI8 E;  5LMN E;  3T1Y I;  1R6M A;  4IZJ A;  2F4V I;  1N33 I;  4LF7 I;  2CVE A;  2GO4 A;  4GKK I;  3PYG A;  4PU9 A;  4FW7 A;  2C38 B;  1J5E I;  4OO1 E;  1VIS A;  4DR1 I;  5A2Q C;  4JI1 E;  1KKH A;  4KHP I;  4B3T I;  4B3S I;  2HKJ A;  2UXC I;  2C37 B;  4JYA I;  1N0V C;  1B63 A;  4AM3 A;  2DEJ A;  4LF7 E;  5JEA C;  3K1J A;  1I94 I;  2IER A;  2O1U A;  4DR7 I;  2PO1 B;  2UXB E;  3F0N A;  2Z5B B;  2CZ9 A;  2C37 A;  4ISA A;  5JEA D;  2UUA I;  1IBL I;  2O1T A;  4WUD A;  4FWG A;  5IT9 Q;  3B82 A;  3H1C A;  1S16 A;  4P7A A;  2F4V E;  4MYT A;  4FN5 A;  5C0X E;  4IZK B;  5DRR A;  4DPW A;  3B78 A;  2C39 B;  1Z5C A;  1IBK I;  4IS9 A;  4DUY E;  4JI1 I;  1HR0 E;  1N34 E;  3PS2 A;  4Z7Y A;  2E5L E;  4LOM A;  2OI2 A;  3ZZT A;  5JEA E;  4JI8 I;  1FWL A;  1PKP A;  2WP8 A;  2WNR A;  4IZK A;  4LCG A;  3ZZU A;  2UUC I;  4I3H A;  4OO1 F;  5DRO A;  2JT2 A;  4LF5 I;  2PNZ B;  4RPF A;  3U1Y A;  1FJG E;  4X66 E;  4OKG A;  4YY3 I;  5GME A;  3Q6N A;  2O1V A;  2UU9 I;  1FI4 A;  4U3D A;  5ELW A;  4DV3 E;  1NZ0 A;  4DV4 E;  4KQV A;  5JEA B;  4FW9 A;  2BV3 A;  5LL6 R;  4USM A;  5BR8 I;  3GCM A;  4JI6 E;  5C0X D;  2BA0 D;  1MX0 A;  2HK3 A;  2NN6 C;  3DD6 A;  2XEX A;  1KTV A;  4LF8 E;  1HNZ E;  1Y4U A;  1A6F A;  1E3H A;  4LFB I;  3UHM A;  1R6L A;  1KVK A;  3B4T A;  2LJP A;  3LNU A;  4DPX A;  1UDO A;  3HKM A;  4BA2 B;  1H72 C;  1Z5A A;  4DV2 E;  2NN6 A;  4QNJ A;  1ZXN A;  2IOQ A;  4HY1 A;  1KIJ A;  2IOP A;  4DV0 I;  4JI6 I;  2PO2 B;  1USV A;  2CG9 A;  5EKW A;  5DRQ A;  3M6A A;  1Z0W A;  4JI2 I;  1N0U A;  2VQE E;  1USU A;  3M85 G;  4DR1 E;  4WUB A;  1XMO I;  1BKN A;  1MG7 A;  4BA2 A;  2O1W A;  1XNR I;  4AID A;  3T1H E;  4X62 I;  1ZM4 A;  2JE6 A;  4NXN I;  4DV5 I;  1WUU A;  1ZM9 A;  4JI7 E;  2ZM6 E;  4JYA E;  2VF3 A;  4DV0 E;  4X65 E;  1Y5Y A;  1PIE A;  5K36 F;  4UTG A;  2BR2 A;  4DR5 E;  4USK A;  1N33 E;  4LCH A;  4LF5 E;  4YY3 E;  4LFB E;  5LMU I;  4JI3 I;  4HAC A;  3NZK A;  4FW4 A;  4WUC A;  2BR2 B;  5GMD A;  3K17 A;  5EL9 A;  3J7A M;  1Z0C A;  4P52 A;  1Z59 A;  2JEB B;  4LF4 I;  4LF8 I;  4X64 I;  3OTO I;  3QT6 A;  3GLL A;  1XMQ I;  2HK2 A;  4IFD E;  4MU1 A;  3U1K A;  4DR3 I;  4DV6 I;  2GS8 A;  4K0K E;  3CDJ A;  1ELO A;  1H7U A;  4NXN E;  3WU5 A;  4DV5 E;  2NN6 F;  2ZM6 I;  3H4L A;  1NHJ A;  4QNK A;  4JI7 I; 
#chains in the Genus database with same CATH homology
 1OYP A;  2NN6 E;  2WNR A;  5JEA A;  4OO1 F;  2PO0 A;  4OO1 D;  5K36 D;  2PNZ B;  5K36 A;  4IFD A;  4IFD F;  5C0X A;  2JE6 B;  2WP8 B;  5JEA B;  3GCM A;  3L7Z A;  5C0X D;  2BA0 D;  1OYR A;  2BA0 G;  2PNZ A;  4IFD C;  2NN6 C;  3DD6 A;  2JEA A;  4OO1 B;  1UDS A;  1E3H A;  1R6L A;  2C39 A;  4NBQ A;  4BA1 A;  3B4T A;  1UDO A;  2NN6 D;  3HKM A;  4BA2 B;  2NN6 A;  2BA1 D;  2PO2 B;  1R6M A;  2PO0 B;  3M85 G;  2BA1 G;  3CDI A;  2C38 B;  5K36 B;  4IFD B;  4BA2 A;  4OO1 E;  3M7N D;  4AID A;  2JE6 A;  2PO2 A;  2C37 B;  4AIM A;  2WNR B;  5K36 F;  2BR2 A;  3GME A;  4AM3 A;  2JEA B;  5JEA C;  2JEB A;  4BA1 B;  2PO1 B;  5C0X B;  4OO1 C;  2C37 A;  5JEA D;  1UDN A;  2BR2 B;  3L7Z B;  3H1C A;  5C0X F;  2JEB B;  3KRN A;  2PO1 A;  5C0X E;  3GLL A;  4OO1 A;  2C38 A;  4IFD E;  5K36 E;  3U1K A;  2C39 B;  3M7N G;  1E3P A;  3CDJ A;  4IFD D;  5JEA F;  3M85 D;  5K36 C;  1OYS A;  2NN6 B;  5JEA E;  2NN6 F;  5C0X C;  1UDQ A;  2WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...