4DR7I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7I00
4EMDA 1H7UA 1DARA 3J81C 4HACB 1FJGE 3PYGA 3J7AM 2R3VA 1PKPA 4HY1A 4UTGA 4DV7E 2UUBI 4DV1E 2J7KA 3B82A 1FWLA 1IBKE 1IBMI 4DR2I 4B3SE 1I94I 2X7IA 4YY3E 2HKEA 4LF9I 4PRVA 2F4VE 3T1HI 1H73A 3T1YE 3QT6A 4KHPI 3PYDA 4P7AA 1H74A 4PRXA 1U2RA 4Z7YA 4WUBA 4JI0I 4LF7I 4DXLA 2OI2A 1N33I 4B3MI 4DV6I 2R42A 4LFAI 4XTJA 2UXCE 2UUCI 4JV5I 4LF6I 3QT5A 2UUBE 4B3RI 4DR5I 1IBME 4DR2E 1XMQI 1I94E 3J7AG 1RREA 4LF9E 2VQEI 3J80C 3T1HE 1RR9A 1VISA 3ZKDA 1Z0EA 4KHPE 2ZITA 4JYAI 4DR7I 5LMNI 4HACA 1FWKA 4LF8I 1S4EA 4NXMI 2Q2EB 1EA6A 4JI0E 4LF7E 2A2DA 3LNUA 1N33E 1XHKA 4B3ME 4DV6E 4LFAE 2UUCE 4JV5E 4LF6E 4B3SI 1ELOA 5GMEA 4B3RE 4DR5E 4LFBI 1XMQE 1N36I 3T1YI 4DR3I 4B3TI 1FNMA 4X65I 4GKJI 3M6AA 2HHHI 4DPTA 1KTVA 2HK2A 4JYAE 3ZZ0A 4DR7E 5LMNE 2X36A 4YHHI 4LF8E 1NHJA 2V34A 2BM0A 2V8PA 1A6FA 1H72C 4NXME 1XMOI 2UXCI 4NXNI 4Z7CA 4DPYA 3HULA 1HNZI 1PIEA 2A2CA 3JAMC 5L3JA 1WUUA 2BM1A 1D6TA 2HK3A 1Z5AA 3QT8A 3B8HA 1EI1A 3V2UC 4LFBE 1N36E 4DR3E 4B3TE 1N0UA 1Z5BA 4X65E 4GKJE 3Q1QA 4JG4A 2HHHE 4DR6I 1ZM2A 5LL6R 2ZBKB 4YHHE 1QZRA 3PYFA 1XMOE 4NXNE 4MYUA 1HNZE 4ED4A 5FLXQ 2E5LI 2XEXA 4JI3I 1KVKA 2V2QA 3F0NA 4I3HA 1NZ0A 4LF5I 2BV3A 4DPWA 1ZM3A 1Z5CA 4GKKE 5LMUI 4DV5I 4DR6E 1ZXMA 4WUDA 4RPFA 1NHHA 2DEIA 3V5RA 4JI6I 4DUYI 2HFSA 1ZXNA 1UEKA 1Z0BA 4DV0I 4DV2I 1N0VC 4X62I 2E5LE 3D4JA 4JI3E 2GS8A 2WW4A 1MU5A 3CWVA 3ZKBA 4LF5E 4URLA 5IT9Q 4FWDA 4DUZI 2HKJA 4JI5I 5LMUE 4DV5E 1N34I 2V2ZA 1B63A 1Z59A 4HYMA 3J80Q 3WU4A 4FWHA 4JI6E 2DEJA 4FN5A 2ZM6I 4DUYE 4DR1I 4DV4I 3WU6A 1HR0I 4DPXA 4AQYI 5A2QQ 4OX9I 3B78A 1MG7A 5FLXC 4DV0E 4DV2E 4X62E 4X66I 1ZM4A 2LJPA 4MYTA 4JI2I 1B62A 4JI8I 1IBLI 4GKKI 2NPFA 4DUZE 4DR4I 4JI5E 2CZ9A 4USMA 1S16A 4JI1I 2HFUA 1N34E 4LFCI 1HNXI 4LF4I 4K0KI 4X64I 2UXDI 1MX0A 1XNQI 2UXBE 2ZM6E 2UU9I 4DR1E 4DV4E 1HR0E 1KKHA 3GONA 4DU8A 4AQYE 4JI7I 4DU7A 4OX9E 3J81Q 4DV3I 1Z0TA 4R1FA 4X66E 4JI4I 1Z0WA 1XNRI 1HNWI 1BKNA 2VQFI 3K1JA 3JAMQ 4WUCA 4JI2E 4UT4A 1KIJA 5GMDA 4JI8E 1IBLE 4HXZA 5IWAI 1Z0GA 5IT9C 4USKA 2UUAI 3ZZTA 4KQVA 1J5EI 4DR4E 1FI4A 3ZZUA 4FWGA 4DPUA 1OJ4A 4JI1E 4FW9A 4LFCE 3OTOI 1HNXE 4LF4E 4K0KE 4X64E 3ZM7A 3WU5A 5BR8I 1N32I 2UXDE 3LTOA 1XNQE 4ZVIA 2UU9E 1K47A 2VF3A 5A2QC 4JI7E 2AJ4A 4DV3E 1FJGI 3K17A 2E1RA 4JI4E 1XNRE 1HNWE 1Z0CA 2VQFE 1FKAE 1H7SA 1PVGA 4DV7I 1Z0VA 4DV1I 3H4LA 1IBKI 5IWAE 4YY3I 2V2VA 2UUAE 1J5EE 2F4VI 3QT7A 3LPSA 1ZM9A 4P52A 3OTOE 4M1KA 2VQEE 2EFGA 2UXBI 3WU3A 5BR8E 1N32E 4PU9A 1NHIA 3PYEA
chains in the Genus database with same CATH superfamily
4LCFA 4EMDA 1H7UA 1DARA 3J81C 4HACB 2CG9A 1FJGE 3PYGA 4MU4A 3J7AM 2IESA 2R3VA 1PKPA 3PS3A 4HY1A 4UTGA 2F1DA 3UHMA 2CVEA 4IZKA 4DV7E 2UUBI 1USVA 4DV1E 3GCMA 2J7KA 3B82A 1R6MA 1FWLA 1IBKE 1IBMI 4DR2I 4B3SE 2BA0G 1I94I 2PNZB 2X7IA 4YY3E 5JEAB 2HKEA 1YHCA 4LF9I 4PRVA 2F4VE 2NN6B 3T1HI 2C37A 1H73A 3T1YE 3QT6A 4KHPI 4IZJB 3PYDA 5C0XD 3NZKA 4P7AA 4U3BA 1H74A 4PRXA 3H1CA 5JEAC 2WP8B 1U2RA 4Z7YA 4WUBA 4JI0I 2NN6C 4LF7I 4DXLA 4OO1B 2OI2A 1N33I 4B3MI 4DV6I 2GO4A 4MDTA 2R42A 4LFAI 4BA2A 4XTJA 2UXCE 2UUCI 2GO3A 4LF6I 3K85A 4JV5I 2C38B 3QT5A 5ELWA 2UUBE 4B3RI 2IOQA 4DR5I 2O1TA 1IBME 4OO1C 4DR2E 1XMQI 1I94E 3L7ZB 3J7AG 2IOPA 3Q6NA 1RREA 4LF9E 2VQEI 3GLLA 3J80C 4MU0A 3T1HE 1VI7A 1RR9A 1VISA 3ZKDA 1Z0EA 4KHPE 2ZITA 5DRQA 4JYAI 4DR7I 2J65A 5LMNI 4HACA 3P76A 1FWKA 4LF8I 1S4EA 2GQ0A 4NXMI 2Q2EB 1EA6A 4JI0E 5C0XC 3M7NG 4LF7E 2A2DA 3LNUA 1N33E 1XHKA 4B3ME 4DV6E 3M7ND 4LFAE 2PNZA 3HKMA 2UUCE 3PS1A 5JEAA 4JV5E 4LF6E 4B3SI 1ELOA 2AE8A 5GMEA 4B3RE 4DR5E 4LFBI 4IZJA 1XMQE 1N36I 5DROA 3T1YI 4DR3I 4B3TI 1FNMA 4X65I 2JT2A 4GKJI 5EL9A 5DNLA 3P3CA 3M6AA 3U1YA 2HHHI 2WP8A 1E3PA 4DPTA 1KTVA 2HK2A 2PO1B 4JYAE 4MQYA 3ZZ0A 4DR7E 4FW7A 2CGEA 5LMNE 2X36A 3M85G 4YHHI 4LF8E 1NHJA 2V34A 2BM0A 2V8PA 1A6FA 1H72C 4NXME 1XMOI 2UXCI 4NXNI 4Z7CA 4DPYA 4AM3A 1RHYA 3HULA 1HNZI 1PIEA 2A2CA 3JAMC 5L3JA 4FW3A 1WUUA 2BM1A 1D6TA 2HK3A 5K36A 1Z5AA 5C0XE 3QT8A 3U1KA 3B8HA 3GMEA 1EI1A 4LCHA 2PO2B 2BA0D 3V2UC 4LFBE 1UDOA 1XXEA 1N36E 4DR3E 4B3TE 1N0UA 1Z5BA 4AIMA 4X65E 4GKJE 1OYRA 3Q1QA 4JG4A 2HHHE 4DR6I 1ZM2A 5LL6R 5JEAF 4IFDA 2O1UA 2ZBKB 4YHHE 1QZRA 3PYFA 5DNXA 4N3OA 1XMOE 5K36D 4NXNE 1Y4UA 2BA1G 4MYUA 1HNZE 4ED4A 5FLXQ 2E5LI 2XEXA 4FW6A 4JI3I 1KVKA 2V2QA 2Z5BB 4MU1A 3F0NA 4I3HA 4OKGA 2C39A 1NZ0A 2JE6B 1HK7A 4LF5I 5C0XB 3P3GA 2BV3A 4DPWA 1ZM3A 1Z5CA 4GKKE 5LMUI 4DV5I 4IFDD 4DR6E 2PNMA 4OZEA 1ZXMA 4WUDA 5K36F 4RPFA 1NHHA 4MU3A 2DEIA 3V5RA 4JI6I 2BR2B 4LOMA 4DUYI 5DRRA 2Z5CB 2HFSA 1ZXNA 4QNKA 2Z5EA 3KRNA 1UEKA 1Z0BA 2NN6A 4DV0I 1N0VC 4X62I 4DV2I 3D4JA 2E5LE 4JI3E 2GS8A 2WW4A 4IFDF 1MU5A 3CWVA 2JEBB 5DRPA 3ZKBA 1E3HA 4LF5E 4URLA 5IT9Q 4FWDA 4DUZI 2HKJA 4JI5I 5LMUE 4OO1A 4DV5E 4BA2B 1N34I 2V2ZA 1B63A 1Z59A 4LCGA 2JEAB 3B4TA 4HYMA 3J80Q 3WU4A 3M85D 2C38A 3Q6MA 4FWHA 5JEAD 4JI6E 3PS2A 2DEJA 4FN5A 2ZM6I 2Z5BA 4DUYE 4DR1I 2NN6D 3WU6A 4DV4I 4FW5A 1HR0I 4DPXA 2IERA 3DD6A 3L7ZA 4AQYI 5A2QQ 4IZJD 4OX9I 4AIDA 3B78A 1MG7A 5FLXC 5C0XA 4DV0E 4DV2E 4X62E 4X66I 1Y5YA 4QNJA 1ZM4A 2LJPA 4MYTA 4JI2I 2VESA 1B62A 4JI8I 1IBLI 4GKKI 4OO1D 4LPFA 2NPFA 4DUZE 4DR4I 5K36E 2BR2A 4JI5E 2CZ9A 4USMA 1S16A 4JI1I 2HFUA 1N34E 4GQUA 4LFCI 2Z5CA 2NN6F 3HJCA 1HNXI 4ISAA 4LF4I 2PNLA 4K0KI 4X64I 2UXDI 1Y60A 2PO0B 1MX0A 1R6LA 1XNQI 2UXBE 5FWKA 2ZM6E 2UU9I 4DR1E 2WNRB 4DV4E 4BA1B 1HR0E 1UDNA 1KKHA 2BA1D 3GONA 4DU8A 4AQYE 4JI7I 4DU7A 4OX9E 3J81Q 2JEBA 4OO1F 4DV3I 4IFDE 1Z0TA 4R1FA 1OYPA 4X66E 1USUA 4JI4I 1Z0WA 1XNRI 1HNWI 1BKNA 2VQFI 2PO1A 3K1JA 3JAMQ 4WUCA 4JI2E 4UT4A 1KIJA 3P06A 5GMDA 4JI8E 1IBLE 2O1WA 4HXZA 2JEAA 5IWAI 1Z0GA 5IT9C 4USKA 2UUAI 3ZZTA 4KQVA 1J5EI 4DR4E 1FI4A 3ZZUA 4FWGA 4DPUA 1OJ4A 4JI1E 4IZKB 4FW9A 4LFCE 3OTOI 5K36B 5C0XF 3CDJA 1HNXE 4LF4E 4K0KE 1Y4SA 4X64E 3ZM7A 3WU5A 5BR8I 1N32I 2UXDE 3LTOA 3P3EA 1XNQE 4ZVIA 2C37B 2UU9E 1K47A 2PO2A 2O1VA 2VF3A 5A2QC 4JI7E 5K36C 4NBQA 2AJ4A 4DV3E 1FJGI 3K17A 3PRYA 2E1RA 4FW4A 4JI4E 1XNRE 1HNWE 1Z0CA 2VQFE 4IFDB 1FKAE 1H7SA 1PVGA 4DV7I 1Z0VA 3CDIA 2O3ZA 4DV1I 3H4LA 5JEAE 4J3DA 1IBKI 5IWAE 5EKWA 2NN6E 4YY3I 2V2VA 2UUAE 1J5EE 1UDQA 2PO0A 2F4VI 3QT7A 3LPSA 1ZM9A 4P52A 1OYSA 4IFDC 2WNRA 3OTOE 4M1KA 4BA1A 4U3DA 2VQEE 2EFGA 2UXBI 2C39B 3WU3A 5BR8E 1P42A 1N32E 4IS9A 2JE6A 4PU9A 4OO1E 1Y6ZA 1UDSA 1NHIA 3PYEA 1YH8A
chains in the Genus database with same CATH topology
4EMDA 1H7UA 1DARA 3J81C 4HACB 2CG9A 1FJGE 3PYGA 3J7AM 2R3VA 1PKPA 4HY1A 4UTGA 4IZKA 4DV7E 2UUBI 1USVA 4DV1E 2J7KA 3B82A 1FWLA 1IBKE 1IBMI 4DR2I 4B3SE 1I94I 2X7IA 4YY3E 2HKEA 4LF9I 4PRVA 2F4VE 3T1HI 1H73A 3T1YE 3QT6A 4KHPI 4IZJB 3PYDA 4P7AA 1H74A 4PRXA 1U2RA 4Z7YA 4WUBA 4JI0I 4LF7I 4DXLA 2OI2A 1N33I 4B3MI 4DV6I 2R42A 4LFAI 4XTJA 2UXCE 2UUCI 4JV5I 4LF6I 3K85A 3QT5A 2UUBE 4B3RI 2IOQA 4DR5I 2O1TA 1IBME 4DR2E 1XMQI 1I94E 3J7AG 2IOPA 3Q6NA 1RREA 4LF9E 2VQEI 3J80C 3T1HE 1RR9A 1VISA 3ZKDA 1Z0EA 4KHPE 2ZITA 4JYAI 4DR7I 5LMNI 4HACA 1FWKA 4LF8I 1S4EA 2GQ0A 4NXMI 2Q2EB 1EA6A 4JI0E 4LF7E 2A2DA 3LNUA 1N33E 1XHKA 4B3ME 4DV6E 4LFAE 2UUCE 4JV5E 4LF6E 4B3SI 1ELOA 5GMEA 4B3RE 4DR5E 4LFBI 4IZJA 1XMQE 1N36I 3T1YI 4DR3I 4B3TI 1FNMA 4X65I 4GKJI 3M6AA 2HHHI 4DPTA 1KTVA 2HK2A 4JYAE 3ZZ0A 4DR7E 2CGEA 5LMNE 2X36A 4YHHI 4LF8E 1NHJA 2V34A 2BM0A 2V8PA 1A6FA 1H72C 4NXME 1XMOI 2UXCI 4NXNI 4Z7CA 4DPYA 3HULA 1HNZI 1PIEA 2A2CA 3JAMC 5L3JA 1WUUA 2BM1A 1D6TA 2HK3A 1Z5AA 3QT8A 3B8HA 1EI1A 3V2UC 4LFBE 1N36E 4DR3E 4B3TE 1N0UA 1Z5BA 4X65E 4GKJE 3Q1QA 4JG4A 2HHHE 4DR6I 1ZM2A 5LL6R 2O1UA 2ZBKB 4YHHE 1QZRA 3PYFA 4N3OA 1XMOE 4NXNE 1Y4UA 4MYUA 1HNZE 4ED4A 5FLXQ 2E5LI 2XEXA 4JI3I 1KVKA 2V2QA 2Z5BB 3F0NA 4I3HA 1NZ0A 1HK7A 4LF5I 2BV3A 4DPWA 1ZM3A 1Z5CA 4GKKE 5LMUI 4DV5I 4DR6E 2PNMA 1ZXMA 4WUDA 4RPFA 1NHHA 2DEIA 3V5RA 4JI6I 4DUYI 2Z5CB 2HFSA 1ZXNA 2Z5EA 1UEKA 1Z0BA 4DV0I 4DV2I 1N0VC 4X62I 2E5LE 3D4JA 4JI3E 2GS8A 2WW4A 1MU5A 3CWVA 3ZKBA 4LF5E 4URLA 5IT9Q 4FWDA 4DUZI 2HKJA 4JI5I 5LMUE 4DV5E 1N34I 2V2ZA 1B63A 1Z59A 4HYMA 3J80Q 3WU4A 3Q6MA 4FWHA 4JI6E 2DEJA 4FN5A 2ZM6I 2Z5BA 4DUYE 4DR1I 4DV4I 3WU6A 1HR0I 4DPXA 4AQYI 5A2QQ 4IZJD 4OX9I 3B78A 1MG7A 5FLXC 4DV0E 4DV2E 4X62E 4X66I 1ZM4A 2LJPA 4MYTA 4JI2I 1B62A 4JI8I 1IBLI 4GKKI 2NPFA 4DUZE 4DR4I 4JI5E 2CZ9A 4USMA 1S16A 4JI1I 2HFUA 1N34E 4LFCI 2Z5CA 3HJCA 1HNXI 4LF4I 2PNLA 4K0KI 4X64I 2UXDI 1MX0A 1XNQI 2UXBE 5FWKA 2ZM6E 2UU9I 4DR1E 4DV4E 1HR0E 1KKHA 3GONA 4DU8A 4AQYE 4JI7I 4DU7A 4OX9E 3J81Q 4DV3I 1Z0TA 4R1FA 4X66E 1USUA 4JI4I 1Z0WA 1XNRI 1HNWI 1BKNA 2VQFI 3K1JA 3JAMQ 4WUCA 4JI2E 4UT4A 1KIJA 3P06A 5GMDA 4JI8E 1IBLE 2O1WA 4HXZA 5IWAI 1Z0GA 5IT9C 4USKA 2UUAI 3ZZTA 4KQVA 1J5EI 4DR4E 1FI4A 3ZZUA 4FWGA 4DPUA 1OJ4A 4JI1E 4IZKB 4FW9A 4LFCE 3OTOI 1HNXE 4LF4E 4K0KE 1Y4SA 4X64E 3ZM7A 3WU5A 5BR8I 1N32I 2UXDE 3LTOA 1XNQE 4ZVIA 2UU9E 1K47A 2O1VA 2VF3A 5A2QC 4JI7E 2AJ4A 4DV3E 1FJGI 3K17A 3PRYA 2E1RA 4JI4E 1XNRE 1HNWE 1Z0CA 2VQFE 1FKAE 1H7SA 1PVGA 4DV7I 1Z0VA 4DV1I 3H4LA 1IBKI 5IWAE 4YY3I 2V2VA 2UUAE 1J5EE 2F4VI 3QT7A 3LPSA 1ZM9A 4P52A 3OTOE 4M1KA 2VQEE 2EFGA 2UXBI 3WU3A 5BR8E 1N32E 4PU9A 1Y6ZA 1NHIA 3PYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMD A;  1H7U A;  1DAR A;  3J81 C;  4HAC B;  1FJG E;  3PYG A;  3J7A M;  2R3V A;  1PKP A;  4HY1 A;  4UTG A;  4DV7 E;  2UUB I;  4DV1 E;  2J7K A;  3B82 A;  1FWL A;  1IBK E;  1IBM I;  4DR2 I;  4B3S E;  1I94 I;  2X7I A;  4YY3 E;  2HKE A;  4LF9 I;  4PRV A;  2F4V E;  3T1H I;  1H73 A;  3T1Y E;  3QT6 A;  4KHP I;  3PYD A;  4P7A A;  1H74 A;  4PRX A;  1U2R A;  4Z7Y A;  4WUB A;  4JI0 I;  4LF7 I;  4DXL A;  2OI2 A;  1N33 I;  4B3M I;  4DV6 I;  2R42 A;  4LFA I;  4XTJ A;  2UXC E;  2UUC I;  4JV5 I;  4LF6 I;  3QT5 A;  2UUB E;  4B3R I;  4DR5 I;  1IBM E;  4DR2 E;  1XMQ I;  1I94 E;  3J7A G;  1RRE A;  4LF9 E;  2VQE I;  3J80 C;  3T1H E;  1RR9 A;  1VIS A;  3ZKD A;  1Z0E A;  4KHP E;  2ZIT A;  4JYA I;  4DR7 I;  5LMN I;  4HAC A;  1FWK A;  4LF8 I;  1S4E A;  4NXM I;  2Q2E B;  1EA6 A;  4JI0 E;  4LF7 E;  2A2D A;  3LNU A;  1N33 E;  1XHK A;  4B3M E;  4DV6 E;  4LFA E;  2UUC E;  4JV5 E;  4LF6 E;  4B3S I;  1ELO A;  5GME A;  4B3R E;  4DR5 E;  4LFB I;  1XMQ E;  1N36 I;  3T1Y I;  4DR3 I;  4B3T I;  1FNM A;  4X65 I;  4GKJ I;  3M6A A;  2HHH I;  4DPT A;  1KTV A;  2HK2 A;  4JYA E;  3ZZ0 A;  4DR7 E;  5LMN E;  2X36 A;  4YHH I;  4LF8 E;  1NHJ A;  2V34 A;  2BM0 A;  2V8P A;  1A6F A;  1H72 C;  4NXM E;  1XMO I;  2UXC I;  4NXN I;  4Z7C A;  4DPY A;  3HUL A;  1HNZ I;  1PIE A;  2A2C A;  3JAM C;  5L3J A;  1WUU A;  2BM1 A;  1D6T A;  2HK3 A;  1Z5A A;  3QT8 A;  3B8H A;  1EI1 A;  3V2U C;  4LFB E;  1N36 E;  4DR3 E;  4B3T E;  1N0U A;  1Z5B A;  4X65 E;  4GKJ E;  3Q1Q A;  4JG4 A;  2HHH E;  4DR6 I;  1ZM2 A;  5LL6 R;  2ZBK B;  4YHH E;  1QZR A;  3PYF A;  1XMO E;  4NXN E;  4MYU A;  1HNZ E;  4ED4 A;  5FLX Q;  2E5L I;  2XEX A;  4JI3 I;  1KVK A;  2V2Q A;  3F0N A;  4I3H A;  1NZ0 A;  4LF5 I;  2BV3 A;  4DPW A;  1ZM3 A;  1Z5C A;  4GKK E;  5LMU I;  4DV5 I;  4DR6 E;  1ZXM A;  4WUD A;  4RPF A;  1NHH A;  2DEI A;  3V5R A;  4JI6 I;  4DUY I;  2HFS A;  1ZXN A;  1UEK A;  1Z0B A;  4DV0 I;  4DV2 I;  1N0V C;  4X62 I;  2E5L E;  3D4J A;  4JI3 E;  2GS8 A;  2WW4 A;  1MU5 A;  3CWV A;  3ZKB A;  4LF5 E;  4URL A;  5IT9 Q;  4FWD A;  4DUZ I;  2HKJ A;  4JI5 I;  5LMU E;  4DV5 E;  1N34 I;  2V2Z A;  1B63 A;  1Z59 A;  4HYM A;  3J80 Q;  3WU4 A;  4FWH A;  4JI6 E;  2DEJ A;  4FN5 A;  2ZM6 I;  4DUY E;  4DR1 I;  4DV4 I;  3WU6 A;  1HR0 I;  4DPX A;  4AQY I;  5A2Q Q;  4OX9 I;  3B78 A;  1MG7 A;  5FLX C;  4DV0 E;  4DV2 E;  4X62 E;  4X66 I;  1ZM4 A;  2LJP A;  4MYT A;  4JI2 I;  1B62 A;  4JI8 I;  1IBL I;  4GKK I;  2NPF A;  4DUZ E;  4DR4 I;  4JI5 E;  2CZ9 A;  4USM A;  1S16 A;  4JI1 I;  2HFU A;  1N34 E;  4LFC I;  1HNX I;  4LF4 I;  4K0K I;  4X64 I;  2UXD I;  1MX0 A;  1XNQ I;  2UXB E;  2ZM6 E;  2UU9 I;  4DR1 E;  4DV4 E;  1HR0 E;  1KKH A;  3GON A;  4DU8 A;  4AQY E;  4JI7 I;  4DU7 A;  4OX9 E;  3J81 Q;  4DV3 I;  1Z0T A;  4R1F A;  4X66 E;  4JI4 I;  1Z0W A;  1XNR I;  1HNW I;  1BKN A;  2VQF I;  3K1J A;  3JAM Q;  4WUC A;  4JI2 E;  4UT4 A;  1KIJ A;  5GMD A;  4JI8 E;  1IBL E;  4HXZ A;  5IWA I;  1Z0G A;  5IT9 C;  4USK A;  2UUA I;  3ZZT A;  4KQV A;  1J5E I;  4DR4 E;  1FI4 A;  3ZZU A;  4FWG A;  4DPU A;  1OJ4 A;  4JI1 E;  4FW9 A;  4LFC E;  3OTO I;  1HNX E;  4LF4 E;  4K0K E;  4X64 E;  3ZM7 A;  3WU5 A;  5BR8 I;  1N32 I;  2UXD E;  3LTO A;  1XNQ E;  4ZVI A;  2UU9 E;  1K47 A;  2VF3 A;  5A2Q C;  4JI7 E;  2AJ4 A;  4DV3 E;  1FJG I;  3K17 A;  2E1R A;  4JI4 E;  1XNR E;  1HNW E;  1Z0C A;  2VQF E;  1FKA E;  1H7S A;  1PVG A;  4DV7 I;  1Z0V A;  4DV1 I;  3H4L A;  1IBK I;  5IWA E;  4YY3 I;  2V2V A;  2UUA E;  1J5E E;  2F4V I;  3QT7 A;  3LPS A;  1ZM9 A;  4P52 A;  3OTO E;  4M1K A;  2VQE E;  2EFG A;  2UXB I;  3WU3 A;  5BR8 E;  1N32 E;  4PU9 A;  1NHI A;  3PYE A; 
#chains in the Genus database with same CATH topology
 4LCF A;  4EMD A;  1H7U A;  1DAR A;  3J81 C;  4HAC B;  2CG9 A;  1FJG E;  3PYG A;  4MU4 A;  3J7A M;  2IES A;  2R3V A;  1PKP A;  3PS3 A;  4HY1 A;  4UTG A;  2F1D A;  3UHM A;  2CVE A;  4IZK A;  4DV7 E;  2UUB I;  1USV A;  4DV1 E;  3GCM A;  2J7K A;  3B82 A;  1R6M A;  1FWL A;  1IBK E;  1IBM I;  4DR2 I;  4B3S E;  2BA0 G;  1I94 I;  2PNZ B;  2X7I A;  4YY3 E;  5JEA B;  2HKE A;  1YHC A;  4LF9 I;  4PRV A;  2F4V E;  2NN6 B;  3T1H I;  2C37 A;  1H73 A;  3T1Y E;  3QT6 A;  4KHP I;  4IZJ B;  3PYD A;  5C0X D;  3NZK A;  4P7A A;  4U3B A;  1H74 A;  4PRX A;  3H1C A;  5JEA C;  2WP8 B;  1U2R A;  4Z7Y A;  4WUB A;  4JI0 I;  2NN6 C;  4LF7 I;  4DXL A;  4OO1 B;  2OI2 A;  1N33 I;  4B3M I;  4DV6 I;  2GO4 A;  4MDT A;  2R42 A;  4LFA I;  4BA2 A;  4XTJ A;  2UXC E;  2UUC I;  2GO3 A;  4LF6 I;  3K85 A;  4JV5 I;  2C38 B;  3QT5 A;  5ELW A;  2UUB E;  4B3R I;  2IOQ A;  4DR5 I;  2O1T A;  1IBM E;  4OO1 C;  4DR2 E;  1XMQ I;  1I94 E;  3L7Z B;  3J7A G;  2IOP A;  3Q6N A;  1RRE A;  4LF9 E;  2VQE I;  3GLL A;  3J80 C;  4MU0 A;  3T1H E;  1VI7 A;  1RR9 A;  1VIS A;  3ZKD A;  1Z0E A;  4KHP E;  2ZIT A;  5DRQ A;  4JYA I;  4DR7 I;  2J65 A;  5LMN I;  4HAC A;  3P76 A;  1FWK A;  4LF8 I;  1S4E A;  2GQ0 A;  4NXM I;  2Q2E B;  1EA6 A;  4JI0 E;  5C0X C;  3M7N G;  4LF7 E;  2A2D A;  3LNU A;  1N33 E;  1XHK A;  4B3M E;  4DV6 E;  3M7N D;  4LFA E;  2PNZ A;  3HKM A;  2UUC E;  3PS1 A;  5JEA A;  4JV5 E;  4LF6 E;  4B3S I;  1ELO A;  2AE8 A;  5GME A;  4B3R E;  4DR5 E;  4LFB I;  4IZJ A;  1XMQ E;  1N36 I;  5DRO A;  3T1Y I;  4DR3 I;  4B3T I;  1FNM A;  4X65 I;  2JT2 A;  4GKJ I;  5EL9 A;  5DNL A;  3P3C A;  3M6A A;  3U1Y A;  2HHH I;  2WP8 A;  1E3P A;  4DPT A;  1KTV A;  2HK2 A;  2PO1 B;  4JYA E;  4MQY A;  3ZZ0 A;  4DR7 E;  4FW7 A;  2CGE A;  5LMN E;  2X36 A;  3M85 G;  4YHH I;  4LF8 E;  1NHJ A;  2V34 A;  2BM0 A;  2V8P A;  1A6F A;  1H72 C;  4NXM E;  1XMO I;  2UXC I;  4NXN I;  4Z7C A;  4DPY A;  4AM3 A;  1RHY A;  3HUL A;  1HNZ I;  1PIE A;  2A2C A;  3JAM C;  5L3J A;  4FW3 A;  1WUU A;  2BM1 A;  1D6T A;  2HK3 A;  5K36 A;  1Z5A A;  5C0X E;  3QT8 A;  3U1K A;  3B8H A;  3GME A;  1EI1 A;  4LCH A;  2PO2 B;  2BA0 D;  3V2U C;  4LFB E;  1UDO A;  1XXE A;  1N36 E;  4DR3 E;  4B3T E;  1N0U A;  1Z5B A;  4AIM A;  4X65 E;  4GKJ E;  1OYR A;  3Q1Q A;  4JG4 A;  2HHH E;  4DR6 I;  1ZM2 A;  5LL6 R;  5JEA F;  4IFD A;  2O1U A;  2ZBK B;  4YHH E;  1QZR A;  3PYF A;  5DNX A;  4N3O A;  1XMO E;  5K36 D;  4NXN E;  1Y4U A;  2BA1 G;  4MYU A;  1HNZ E;  4ED4 A;  5FLX Q;  2E5L I;  2XEX A;  4FW6 A;  4JI3 I;  1KVK A;  2V2Q A;  2Z5B B;  4MU1 A;  3F0N A;  4I3H A;  4OKG A;  2C39 A;  1NZ0 A;  2JE6 B;  1HK7 A;  4LF5 I;  5C0X B;  3P3G A;  2BV3 A;  4DPW A;  1ZM3 A;  1Z5C A;  4GKK E;  5LMU I;  4DV5 I;  4IFD D;  4DR6 E;  2PNM A;  4OZE A;  1ZXM A;  4WUD A;  5K36 F;  4RPF A;  1NHH A;  4MU3 A;  2DEI A;  3V5R A;  4JI6 I;  2BR2 B;  4LOM A;  4DUY I;  5DRR A;  2Z5C B;  2HFS A;  1ZXN A;  4QNK A;  2Z5E A;  3KRN A;  1UEK A;  1Z0B A;  2NN6 A;  4DV0 I;  1N0V C;  4X62 I;  4DV2 I;  3D4J A;  2E5L E;  4JI3 E;  2GS8 A;  2WW4 A;  4IFD F;  1MU5 A;  3CWV A;  2JEB B;  5DRP A;  3ZKB A;  1E3H A;  4LF5 E;  4URL A;  5IT9 Q;  4FWD A;  4DUZ I;  2HKJ A;  4JI5 I;  5LMU E;  4OO1 A;  4DV5 E;  4BA2 B;  1N34 I;  2V2Z A;  1B63 A;  1Z59 A;  4LCG A;  2JEA B;  3B4T A;  4HYM A;  3J80 Q;  3WU4 A;  3M85 D;  2C38 A;  3Q6M A;  4FWH A;  5JEA D;  4JI6 E;  3PS2 A;  2DEJ A;  4FN5 A;  2ZM6 I;  2Z5B A;  4DUY E;  4DR1 I;  2NN6 D;  3WU6 A;  4DV4 I;  4FW5 A;  1HR0 I;  4DPX A;  2IER A;  3DD6 A;  3L7Z A;  4AQY I;  5A2Q Q;  4IZJ D;  4OX9 I;  4AID A;  3B78 A;  1MG7 A;  5FLX C;  5C0X A;  4DV0 E;  4DV2 E;  4X62 E;  4X66 I;  1Y5Y A;  4QNJ A;  1ZM4 A;  2LJP A;  4MYT A;  4JI2 I;  2VES A;  1B62 A;  4JI8 I;  1IBL I;  4GKK I;  4OO1 D;  4LPF A;  2NPF A;  4DUZ E;  4DR4 I;  5K36 E;  2BR2 A;  4JI5 E;  2CZ9 A;  4USM A;  1S16 A;  4JI1 I;  2HFU A;  1N34 E;  4GQU A;  4LFC I;  2Z5C A;  2NN6 F;  3HJC A;  1HNX I;  4ISA A;  4LF4 I;  2PNL A;  4K0K I;  4X64 I;  2UXD I;  1Y60 A;  2PO0 B;  1MX0 A;  1R6L A;  1XNQ I;  2UXB E;  5FWK A;  2ZM6 E;  2UU9 I;  4DR1 E;  2WNR B;  4DV4 E;  4BA1 B;  1HR0 E;  1UDN A;  1KKH A;  2BA1 D;  3GON A;  4DU8 A;  4AQY E;  4JI7 I;  4DU7 A;  4OX9 E;  3J81 Q;  2JEB A;  4OO1 F;  4DV3 I;  4IFD E;  1Z0T A;  4R1F A;  1OYP A;  4X66 E;  1USU A;  4JI4 I;  1Z0W A;  1XNR I;  1HNW I;  1BKN A;  2VQF I;  2PO1 A;  3K1J A;  3JAM Q;  4WUC A;  4JI2 E;  4UT4 A;  1KIJ A;  3P06 A;  5GMD A;  4JI8 E;  1IBL E;  2O1W A;  4HXZ A;  2JEA A;  5IWA I;  1Z0G A;  5IT9 C;  4USK A;  2UUA I;  3ZZT A;  4KQV A;  1J5E I;  4DR4 E;  1FI4 A;  3ZZU A;  4FWG A;  4DPU A;  1OJ4 A;  4JI1 E;  4IZK B;  4FW9 A;  4LFC E;  3OTO I;  5K36 B;  5C0X F;  3CDJ A;  1HNX E;  4LF4 E;  4K0K E;  1Y4S A;  4X64 E;  3ZM7 A;  3WU5 A;  5BR8 I;  1N32 I;  2UXD E;  3LTO A;  3P3E A;  1XNQ E;  4ZVI A;  2C37 B;  2UU9 E;  1K47 A;  2PO2 A;  2O1V A;  2VF3 A;  5A2Q C;  4JI7 E;  5K36 C;  4NBQ A;  2AJ4 A;  4DV3 E;  1FJG I;  3K17 A;  3PRY A;  2E1R A;  4FW4 A;  4JI4 E;  1XNR E;  1HNW E;  1Z0C A;  2VQF E;  4IFD B;  1FKA E;  1H7S A;  1PVG A;  4DV7 I;  1Z0V A;  3CDI A;  2O3Z A;  4DV1 I;  3H4L A;  5JEA E;  4J3D A;  1IBK I;  5IWA E;  5EKW A;  2NN6 E;  4YY3 I;  2V2V A;  2UUA E;  1J5E E;  1UDQ A;  2PO0 A;  2F4V I;  3QT7 A;  3LPS A;  1ZM9 A;  4P52 A;  1OYS A;  4IFD C;  2WNR A;  3OTO E;  4M1K A;  4BA1 A;  4U3D A;  2VQE E;  2EFG A;  2UXB I;  2C39 B;  3WU3 A;  5BR8 E;  1P42 A;  1N32 E;  4IS9 A;  2JE6 A;  4PU9 A;  4OO1 E;  1Y6Z A;  1UDS A;  1NHI A;  3PYE A;  1YH8 A; 
#chains in the Genus database with same CATH homology
 4EMD A;  1H7U A;  1DAR A;  3J81 C;  4HAC B;  2CG9 A;  1FJG E;  3PYG A;  3J7A M;  2R3V A;  1PKP A;  4HY1 A;  4UTG A;  4IZK A;  4DV7 E;  2UUB I;  1USV A;  4DV1 E;  2J7K A;  3B82 A;  1FWL A;  1IBK E;  1IBM I;  4DR2 I;  4B3S E;  1I94 I;  2X7I A;  4YY3 E;  2HKE A;  4LF9 I;  4PRV A;  2F4V E;  3T1H I;  1H73 A;  3T1Y E;  3QT6 A;  4KHP I;  4IZJ B;  3PYD A;  4P7A A;  1H74 A;  4PRX A;  1U2R A;  4Z7Y A;  4WUB A;  4JI0 I;  4LF7 I;  4DXL A;  2OI2 A;  1N33 I;  4B3M I;  4DV6 I;  2R42 A;  4LFA I;  4XTJ A;  2UXC E;  2UUC I;  4JV5 I;  4LF6 I;  3K85 A;  3QT5 A;  2UUB E;  4B3R I;  2IOQ A;  4DR5 I;  2O1T A;  1IBM E;  4DR2 E;  1XMQ I;  1I94 E;  3J7A G;  2IOP A;  3Q6N A;  1RRE A;  4LF9 E;  2VQE I;  3J80 C;  3T1H E;  1RR9 A;  1VIS A;  3ZKD A;  1Z0E A;  4KHP E;  2ZIT A;  4JYA I;  4DR7 I;  5LMN I;  4HAC A;  1FWK A;  4LF8 I;  1S4E A;  2GQ0 A;  4NXM I;  2Q2E B;  1EA6 A;  4JI0 E;  4LF7 E;  2A2D A;  3LNU A;  1N33 E;  1XHK A;  4B3M E;  4DV6 E;  4LFA E;  2UUC E;  4JV5 E;  4LF6 E;  4B3S I;  1ELO A;  5GME A;  4B3R E;  4DR5 E;  4LFB I;  4IZJ A;  1XMQ E;  1N36 I;  3T1Y I;  4DR3 I;  4B3T I;  1FNM A;  4X65 I;  4GKJ I;  3M6A A;  2HHH I;  4DPT A;  1KTV A;  2HK2 A;  4JYA E;  3ZZ0 A;  4DR7 E;  2CGE A;  5LMN E;  2X36 A;  4YHH I;  4LF8 E;  1NHJ A;  2V34 A;  2BM0 A;  2V8P A;  1A6F A;  1H72 C;  4NXM E;  1XMO I;  2UXC I;  4NXN I;  4Z7C A;  4DPY A;  3HUL A;  1HNZ I;  1PIE A;  2A2C A;  3JAM C;  5L3J A;  1WUU A;  2BM1 A;  1D6T A;  2HK3 A;  1Z5A A;  3QT8 A;  3B8H A;  1EI1 A;  3V2U C;  4LFB E;  1N36 E;  4DR3 E;  4B3T E;  1N0U A;  1Z5B A;  4X65 E;  4GKJ E;  3Q1Q A;  4JG4 A;  2HHH E;  4DR6 I;  1ZM2 A;  5LL6 R;  2O1U A;  2ZBK B;  4YHH E;  1QZR A;  3PYF A;  4N3O A;  1XMO E;  4NXN E;  1Y4U A;  4MYU A;  1HNZ E;  4ED4 A;  5FLX Q;  2E5L I;  2XEX A;  4JI3 I;  1KVK A;  2V2Q A;  2Z5B B;  3F0N A;  4I3H A;  1NZ0 A;  1HK7 A;  4LF5 I;  2BV3 A;  4DPW A;  1ZM3 A;  1Z5C A;  4GKK E;  5LMU I;  4DV5 I;  4DR6 E;  2PNM A;  1ZXM A;  4WUD A;  4RPF A;  1NHH A;  2DEI A;  3V5R A;  4JI6 I;  4DUY I;  2Z5C B;  2HFS A;  1ZXN A;  2Z5E A;  1UEK A;  1Z0B A;  4DV0 I;  4DV2 I;  1N0V C;  4X62 I;  2E5L E;  3D4J A;  4JI3 E;  2GS8 A;  2WW4 A;  1MU5 A;  3CWV A;  3ZKB A;  4LF5 E;  4URL A;  5IT9 Q;  4FWD A;  4DUZ I;  2HKJ A;  4JI5 I;  5LMU E;  4DV5 E;  1N34 I;  2V2Z A;  1B63 A;  1Z59 A;  4HYM A;  3J80 Q;  3WU4 A;  3Q6M A;  4FWH A;  4JI6 E;  2DEJ A;  4FN5 A;  2ZM6 I;  2Z5B A;  4DUY E;  4DR1 I;  4DV4 I;  3WU6 A;  1HR0 I;  4DPX A;  4AQY I;  5A2Q Q;  4IZJ D;  4OX9 I;  3B78 A;  1MG7 A;  5FLX C;  4DV0 E;  4DV2 E;  4X62 E;  4X66 I;  1ZM4 A;  2LJP A;  4MYT A;  4JI2 I;  1B62 A;  4JI8 I;  1IBL I;  4GKK I;  2NPF A;  4DUZ E;  4DR4 I;  4JI5 E;  2CZ9 A;  4USM A;  1S16 A;  4JI1 I;  2HFU A;  1N34 E;  4LFC I;  2Z5C A;  3HJC A;  1HNX I;  4LF4 I;  2PNL A;  4K0K I;  4X64 I;  2UXD I;  1MX0 A;  1XNQ I;  2UXB E;  5FWK A;  2ZM6 E;  2UU9 I;  4DR1 E;  4DV4 E;  1HR0 E;  1KKH A;  3GON A;  4DU8 A;  4AQY E;  4JI7 I;  4DU7 A;  4OX9 E;  3J81 Q;  4DV3 I;  1Z0T A;  4R1F A;  4X66 E;  1USU A;  4JI4 I;  1Z0W A;  1XNR I;  1HNW I;  1BKN A;  2VQF I;  3K1J A;  3JAM Q;  4WUC A;  4JI2 E;  4UT4 A;  1KIJ A;  3P06 A;  5GMD A;  4JI8 E;  1IBL E;  2O1W A;  4HXZ A;  5IWA I;  1Z0G A;  5IT9 C;  4USK A;  2UUA I;  3ZZT A;  4KQV A;  1J5E I;  4DR4 E;  1FI4 A;  3ZZU A;  4FWG A;  4DPU A;  1OJ4 A;  4JI1 E;  4IZK B;  4FW9 A;  4LFC E;  3OTO I;  1HNX E;  4LF4 E;  4K0K E;  1Y4S A;  4X64 E;  3ZM7 A;  3WU5 A;  5BR8 I;  1N32 I;  2UXD E;  3LTO A;  1XNQ E;  4ZVI A;  2UU9 E;  1K47 A;  2O1V A;  2VF3 A;  5A2Q C;  4JI7 E;  2AJ4 A;  4DV3 E;  1FJG I;  3K17 A;  3PRY A;  2E1R A;  4JI4 E;  1XNR E;  1HNW E;  1Z0C A;  2VQF E;  1FKA E;  1H7S A;  1PVG A;  4DV7 I;  1Z0V A;  4DV1 I;  3H4L A;  1IBK I;  5IWA E;  4YY3 I;  2V2V A;  2UUA E;  1J5E E;  2F4V I;  3QT7 A;  3LPS A;  1ZM9 A;  4P52 A;  3OTO E;  4M1K A;  2VQE E;  2EFG A;  2UXB I;  3WU3 A;  5BR8 E;  1N32 E;  4PU9 A;  1Y6Z A;  1NHI A;  3PYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...