4DR7I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7I00
4DU7A 4B3RI 4FWHA 2V2QA 2A2DA 4JI4E 4GKKE 4DR7E 1XHKA 1PIEA 1FKAE 2UUBI 2XEXA 3JAMQ 1A6FA 2A2CA 4DV6E 2DEIA 4AQYE 1XNQI 4JI0I 1HNZE 4P7AA 4LF5E 2VQFE 4JI5E 2HFUA 1MX0A 4JI2E 4DUYI 2EFGA 4JV5E 4X65E 1FJGE 4JI7E 5LMUE 4DV1E 1H7UA 4DR4E 3LNUA 3QT8A 3WU6A 4DPXA 4JI4I 5GMEA 1FNMA 4DR7I 1S16A 4GKJE 2Q2EB 2HKEA 5LMNI 3M6AA 4MYUA 2UU9I 4DV4I 1B63A 4AQYI 4JI3E 4LFBI 1HNZI 2UXDE 1Z0GA 3B82A 4JI2I 1QZRA 4LFCI 2UUAE 2DEJA 3D4JA 4X64I 1FI4A 4X65I 1FJGI 1FWLA 1Z59A 1N34I 2X7IA 4M1KA 1ZXMA 4X66I 4I3HA 2VQEE 4LF7E 1Z5BA 3HULA 4URLA 1N32E 4LF9E 1EI1A 4FW9A 1EA6A 4GKJI 2UUBE 2F4VI 1J5EI 4YHHI 4JI3I 1HNXE 1XNQE 4DR6I 4JI0E 3PYFA 1K47A 4PRVA 3QT7A 4YY3E 2HKJA 4LF8E 3J80C 4DUYE 1MU5A 3ZZUA 2HFSA 1ZXNA 4WUDA 1N0VC 4DV7E 2LJPA 3OTOE 3K1JA 5A2QC 2HK2A 3PYGA 1B62A 1IBKE 4Z7YA 4EMDA 1N32I 4LF9I 1OJ4A 1Z0EA 4B3SI 2V2VA 5LMNE 2UU9E 4DV4E 4JI8E 1HNXI 3T1HI 4LFBE 5GMDA 1D6TA 1I94I 3QT5A 4DUZI 4YY3I 3ZKBA 4LF8I 1H73A 4LFCE 4LF4I 1NHIA 2J7KA 3GONA 4FWGA 4X64E 1UEKA 1Z0CA 4DV7I 3OTOI 4HYMA 3J80Q 2HHHI 1N34E 4FN5A 4NXME 1Z0WA 1RR9A 4X66E 2UUCI 4MYTA 4R1FA 2CZ9A 1IBKI 1Z5CA 5FLXC 4ED4A 1H72C 1RREA 5A2QQ 1PVGA 2V8PA 4HXZA 1HR0I 4ZVIA 2F4VE 2NPFA 1J5EE 3H4LA 4JI8I 4YHHE 4DR6E 4OX9E 1Z0BA 3K17A 2X36A 4B3TE 1NZ0A 4DU8A 1Z5AA 3T1YI 2ZM6I 1XNRI 3PYDA 4NXMI 1MG7A 4DV3E 4DR1E 5BR8I 2GS8A 3B8HA 4JYAI 1KIJA 2BM1A 2V2ZA 4FWDA 1PKPA 4B3SE 4WUBA 1U2RA 2VF3A 5FLXQ 3T1HE 4DR5E 4OX9I 4DPYA 2BM0A 3PYEA 1I94E 1NHJA 2R42A 4DUZE 4NXNE 1XMOE 4LF4E 4B3TI 1IBMI 1N33I 4JG4A 4DR2E 2HHHE 4DV3I 1KVKA 4USMA 1HNWI 4JI1E 3J81C 2R3VA 4DR1I 2UUCE 2OI2A 4DPUA 4KHPE 1HR0E 1NHHA 4UT4A 1ZM4A 3LPSA 4DV0E 1FWKA 4DR5I 4PRXA 1XMQE 5IWAI 3Q1QA 4XTJA 4UTGA 4NXNI 1XMOI 4DPWA 1IBLE 1BKNA 3F0NA 2BV3A 1H7SA 4DV5I 4DR2I 3T1YE 4LF6E 4JI6I 2ZBKB 2ZM6E 1XNRE 1N36E 4K0KI 4JI1I 4PU9A 1ZM9A 5BR8E 5IT9C 3ZKDA 2UXBE 2HK3A 4JYAE 4DXLA 4LFAE 3J81Q 4HACB 4B3MI 3V5RA 4KHPI 4HY1A 2UXCI 4X62E 4LF7I 4RPFA 2E1RA 4DV0I 1ZM3A 1XMQI 4GKKI 1WUUA 3ZM7A 2WW4A 1IBLI 4DV2E 4WUCA 1IBME 1N33E 4LF6I 4DV6I 3B78A 1N36I 1H74A 1VISA 1Z0VA 1HNWE 4LF5I 2VQFI 4JI5I 1ELOA 3QT6A 2UXBI 4Z7CA 2ZITA 4DR3E 4LFAI 2AJ4A 4JV5I 2E5LE 4HACA 3CWVA 4P52A 4X62I 5IT9Q 4JI7I 5LMUI 1KKHA 4DV1I 4DR4I 3LTOA 4B3RE 3ZZTA 1Z0TA 3JAMC 5IWAE 1S4EA 1N0UA 4DV2I 4KQVA 4DV5E 1KTVA 4JI6E 3J7AG 4K0KE 2UXDI 1ZM2A 5LL6R 2V34A 3WU5A 3J7AM 1DARA 4DR3I 3WU4A 4DPTA 2UUAI 2E5LI 4B3ME 2UXCE 3V2UC 5L3JA 4USKA 3WU3A 3ZZ0A 2VQEI
chains in the Genus database with same CATH superfamily
4DU7A 5C0XA 4FWHA 4B3RI 2V2QA 2A2DA 4JI4E 4GKKE 4IZJA 3M85D 5DNXA 4DR7E 1XHKA 1PIEA 1YH8A 1FKAE 2UUBI 2XEXA 3JAMQ 1Y60A 1P42A 1A6FA 1UDQA 4MDTA 4FW5A 2BA0D 2A2CA 4DV6E 4OO1A 4OO1F 2DEIA 4AQYE 1XNQI 4JI0I 1HNZE 4P7AA 4QNKA 4LF5E 2VQFE 5ELWA 4JI5E 5C0XE 2HFUA 1MX0A 4JI2E 2JE6A 1Y4SA 3PS3A 4DUYI 2O3ZA 2GQ0A 2EFGA 4JV5E 4MQYA 4ISAA 1YHCA 4X65E 1FJGE 1VI7A 4JI7E 5LMUE 4DV1E 1H7UA 4DR4E 3LNUA 3QT8A 2CVEA 3NZKA 3WU6A 4DPXA 3H1CA 4JI4I 5GMEA 1FNMA 4IFDE 4DR7I 1S16A 4LCGA 4GKJE 2Q2EB 2HKEA 5LMNI 5K36B 3M6AA 4MYUA 3KRNA 2UU9I 4DV4I 1B63A 4AQYI 4JI3E 4LFBI 1HNZI 2UXDE 1Z0GA 3B82A 5DRPA 2BR2B 4JI2I 1QZRA 1Y5YA 2Z5CB 4LFCI 4BA1A 4LPFA 2UUAE 2DEJA 2O1TA 2PNLA 3D4JA 3L7ZB 5JEAC 5JEAD 4X64I 1FI4A 4X65I 1FJGI 1FWLA 1Z59A 5DRRA 1N34I 2X7IA 4M1KA 1ZXMA 4X66I 4I3HA 2VQEE 4LF7E 4OZEA 1Z5BA 3HULA 4URLA 1N32E 3U1KA 4LF9E 1EI1A 3P06A 3K85A 4FW9A 1EA6A 4GKJI 2UUBE 2NN6C 4MU3A 2F4VI 2IOQA 1J5EI 4AM3A 5K36A 4FW3A 4YHHI 4JI3I 1HNXE 1XNQE 2PO0B 4DR6I 4JI0E 4AIMA 3PYFA 1K47A 3Q6NA 4PRVA 3QT7A 1XXEA 4YY3E 2HKJA 4LF8E 3J80C 5C0XD 2BA1D 4DUYE 1MU5A 3ZZUA 2HFSA 4IZJD 4N3OA 1ZXNA 3L7ZA 4WUDA 1E3HA 1N0VC 4DV7E 2LJPA 3OTOE 3M7NG 5K36E 3K1JA 5C0XF 3DD6A 5A2QC 1USVA 2HK2A 3PYGA 1B62A 4OO1C 4OO1D 3U1YA 1IBKE 4Z7YA 2JEAA 2J65A 2JT2A 4EMDA 1N32I 4LF9I 2C38B 1Y6ZA 1OJ4A 1Z0EA 4B3SI 2V2VA 5LMNE 4U3BA 2IERA 2UU9E 4DV4E 4JI8E 1HNXI 3T1HI 4LFBE 5GMDA 1D6TA 4IFDF 4IFDA 3GLLA 1I94I 3QT5A 2O1VA 4YY3I 3GMEA 3ZKBA 4DUZI 5FWKA 4LF8I 1H73A 4LFCE 4LF4I 1NHIA 2J7KA 2JEBB 3GONA 2WNRA 5DNLA 4FWGA 1R6MA 4X64E 1UEKA 1Z0CA 4DV7I 3OTOI 4IZKA 1UDOA 4HYMA 3J80Q 2HHHI 1N34E 4FN5A 4NXME 1Z0WA 1RR9A 4X66E 2UUCI 4MYTA 4R1FA 4IS9A 2CZ9A 1IBKI 4AIDA 2PO2B 1Z5CA 5FLXC 4ED4A 1H72C 1RREA 1UDSA 5A2QQ 1PVGA 2PNZB 2V8PA 4HXZA 1HR0I 4ZVIA 4FW6A 2F4VE 2NPFA 1J5EE 3H4LA 4JI8I 5EKWA 4YHHE 4DR6E 5JEAB 4OX9E 1Z0BA 4MU0A 3K17A 2X36A 1R6LA 3P3GA 2F1DA 4B3TE 1NZ0A 4DU8A 1Z5AA 3T1YI 2ZM6I 1XNRI 3PYDA 2IOPA 4NXMI 3PS1A 1MG7A 4DV3E 4NBQA 3CDIA 4DR1E 2PNMA 5BR8I 5K36D 2NN6B 4LOMA 2GS8A 4LCHA 3B8HA 4JYAI 1KIJA 2BM1A 2V2ZA 4FWDA 1PKPA 4B3SE 2PO1B 4WUBA 2C37B 1U2RA 2O1WA 5K36F 2VF3A 1OYRA 5FLXQ 1OYPA 3T1HE 4DR5E 4OX9I 4DPYA 2BM0A 2Z5EA 3PYEA 1I94E 1NHJA 2R42A 2BR2A 1HK7A 4DUZE 4NXNE 1XMOE 2VESA 5C0XC 2Z5CA 4LF4E 4B3TI 1IBMI 2Z5BB 2C39B 1N33I 4JG4A 2CG9A 4DR2E 4QNJA 4BA2B 4OO1B 2HHHE 4DV3I 1KVKA 4USMA 1HNWI 4JI1E 3P3CA 3M7ND 3J81C 2R3VA 4DR1I 2UUCE 2OI2A 2NN6F 2NN6A 4DPUA 1UDNA 4IFDC 4IFDD 4KHPE 1HR0E 1NHHA 5DRQA 2PO1A 2C37A 2O1UA 4UT4A 1ZM4A 3LPSA 1E3PA 4DV0E 4FW7A 1FWKA 4DR5I 3M85G 2PO0A 4PRXA 1XMQE 4LCFA 5IWAI 3Q1QA 4XTJA 4UTGA 4NXNI 1XMOI 4DPWA 1IBLE 2NN6E 1BKNA 3F0NA 4U3DA 2BV3A 2BA0G 1H7SA 2Z5BA 4DV5I 2C39A 3PRYA 4DR2I 3T1YE 4LF6E 4JI6I 2ZBKB 2ZM6E 1XNRE 4BA2A 3HKMA 1N36E 4K0KI 4JI1I 4PU9A 1ZM9A 5BR8E 1RHYA 4OKGA 5IT9C 3ZKDA 4BA1B 2UXBE 2HK3A 4JYAE 4DXLA 2C38A 4LFAE 3J81Q 4HACB 4B3MI 3V5RA 4KHPI 4HY1A 2UXCI 4X62E 4LF7I 3GCMA 4RPFA 1Y4UA 2E1RA 4DV0I 4OO1E 1ZM3A 1XMQI 2CGEA 4GKKI 1WUUA 2GO3A 4J3DA 3ZM7A 2WW4A 1IBLI 4DV2E 4WUCA 1IBME 2JEBA 1N33E 4LF6I 4MU1A 4DV6I 3B78A 3PS2A 1N36I 1H74A 1VISA 1Z0VA 2IESA 3CDJA 1HNWE 4LF5I 2VQFI 4JI5I 5K36C 1ELOA 3QT6A 4FW4A 2UXBI 3Q6MA 2ZITA 4Z7CA 4DR3E 3P3EA 2PO2A 1USUA 4LFAI 2AJ4A 2WP8B 3P76A 4JV5I 2GO4A 2E5LE 4HACA 2PNZA 3CWVA 4P52A 4X62I 5DROA 5IT9Q 4JI7I 5LMUI 2AE8A 1KKHA 4DV1I 4DR4I 5C0XB 3B4TA 3LTOA 1OYSA 4B3RE 3ZZTA 1Z0TA 4IZJB 2JEAB 3JAMC 5EL9A 4GQUA 5JEAF 5JEAA 5IWAE 1S4EA 1N0UA 4DV2I 4KQVA 2NN6D 4DV5E 1KTVA 4JI6E 3J7AG 4K0KE 2UXDI 1ZM2A 5LL6R 3UHMA 4IFDB 2V34A 3WU5A 2BA1G 2JE6B 3J7AM 1DARA 4DR3I 3WU4A 5JEAE 4DPTA 2UUAI 2WNRB 2E5LI 4B3ME 2WP8A 2UXCE 4IZKB 4MU4A 3HJCA 3V2UC 5L3JA 4USKA 3WU3A 3ZZ0A 2VQEI
chains in the Genus database with same CATH topology
4DU7A 4B3RI 4FWHA 2V2QA 2A2DA 4JI4E 4GKKE 4IZJA 4DR7E 1XHKA 1PIEA 1FKAE 2UUBI 2XEXA 3JAMQ 1A6FA 2A2CA 4DV6E 2DEIA 4AQYE 1XNQI 4JI0I 1HNZE 4P7AA 4LF5E 2VQFE 4JI5E 2HFUA 1MX0A 4JI2E 1Y4SA 4DUYI 2GQ0A 2EFGA 4JV5E 4X65E 1FJGE 4JI7E 5LMUE 4DV1E 1H7UA 4DR4E 3LNUA 3QT8A 3WU6A 4DPXA 4JI4I 5GMEA 1FNMA 4DR7I 1S16A 4GKJE 2Q2EB 2HKEA 5LMNI 3M6AA 4MYUA 2UU9I 4DV4I 1B63A 4AQYI 4JI3E 4LFBI 1HNZI 2UXDE 1Z0GA 3B82A 4JI2I 1QZRA 2Z5CB 4LFCI 2UUAE 2DEJA 2O1TA 2PNLA 3D4JA 4X64I 1FI4A 4X65I 1FJGI 1FWLA 1Z59A 1N34I 2X7IA 4M1KA 1ZXMA 4X66I 4I3HA 2VQEE 4LF7E 1Z5BA 3HULA 4URLA 1N32E 4LF9E 1EI1A 3P06A 3K85A 4FW9A 1EA6A 4GKJI 2UUBE 2F4VI 2IOQA 1J5EI 4YHHI 4JI3I 1HNXE 1XNQE 4DR6I 4JI0E 3PYFA 1K47A 3Q6NA 4PRVA 3QT7A 4YY3E 2HKJA 4LF8E 3J80C 4DUYE 1MU5A 3ZZUA 2HFSA 4IZJD 1ZXNA 4N3OA 4WUDA 1N0VC 4DV7E 2LJPA 3OTOE 3K1JA 5A2QC 1USVA 2HK2A 3PYGA 1B62A 1IBKE 4Z7YA 4EMDA 1N32I 4LF9I 1Y6ZA 1OJ4A 1Z0EA 4B3SI 2V2VA 5LMNE 2UU9E 4DV4E 4JI8E 1HNXI 3T1HI 4LFBE 5GMDA 1D6TA 1I94I 3QT5A 2O1VA 4YY3I 3ZKBA 4DUZI 5FWKA 4LF8I 1H73A 4LFCE 4LF4I 1NHIA 2J7KA 3GONA 4FWGA 4X64E 1UEKA 1Z0CA 4DV7I 3OTOI 4IZKA 4HYMA 3J80Q 2HHHI 1N34E 4FN5A 4NXME 1Z0WA 1RR9A 4X66E 2UUCI 4MYTA 4R1FA 2CZ9A 1IBKI 1Z5CA 5FLXC 4ED4A 1H72C 1RREA 5A2QQ 1PVGA 2V8PA 4HXZA 1HR0I 4ZVIA 2F4VE 2NPFA 1J5EE 3H4LA 4JI8I 4YHHE 4DR6E 4OX9E 1Z0BA 3K17A 2X36A 4B3TE 1NZ0A 4DU8A 1Z5AA 3T1YI 2ZM6I 1XNRI 3PYDA 2IOPA 4NXMI 1MG7A 4DV3E 4DR1E 5BR8I 2PNMA 2GS8A 3B8HA 4JYAI 1KIJA 2BM1A 2V2ZA 4FWDA 1PKPA 4B3SE 4WUBA 1U2RA 2O1WA 2VF3A 5FLXQ 3T1HE 4DR5E 4OX9I 4DPYA 2BM0A 2Z5EA 3PYEA 1I94E 1NHJA 2R42A 4DUZE 1HK7A 4NXNE 1XMOE 2Z5CA 4LF4E 4B3TI 1IBMI 2Z5BB 1N33I 4JG4A 2CG9A 4DR2E 2HHHE 4DV3I 1KVKA 4USMA 1HNWI 4JI1E 3J81C 2R3VA 4DR1I 2UUCE 2OI2A 4DPUA 4KHPE 1HR0E 1NHHA 2O1UA 4UT4A 1ZM4A 3LPSA 4DV0E 1FWKA 4DR5I 4PRXA 1XMQE 5IWAI 3Q1QA 4XTJA 4UTGA 4NXNI 1XMOI 4DPWA 1IBLE 1BKNA 3F0NA 2BV3A 1H7SA 2Z5BA 4DV5I 4DR2I 3PRYA 3T1YE 4LF6E 4JI6I 2ZBKB 2ZM6E 1XNRE 1N36E 4K0KI 4JI1I 4PU9A 1ZM9A 5BR8E 5IT9C 3ZKDA 2UXBE 2HK3A 4JYAE 4DXLA 4LFAE 3J81Q 4HACB 4B3MI 3V5RA 4KHPI 4HY1A 2UXCI 4X62E 4LF7I 4RPFA 1Y4UA 2E1RA 4DV0I 1ZM3A 1XMQI 2CGEA 4GKKI 1WUUA 3ZM7A 2WW4A 1IBLI 4DV2E 4WUCA 1IBME 1N33E 4LF6I 4DV6I 3B78A 1N36I 1H74A 1VISA 1Z0VA 1HNWE 4LF5I 2VQFI 4JI5I 1ELOA 3QT6A 2UXBI 3Q6MA 2ZITA 4Z7CA 4DR3E 1USUA 4LFAI 2AJ4A 4JV5I 2E5LE 4HACA 3CWVA 4P52A 4X62I 5IT9Q 4JI7I 5LMUI 1KKHA 4DV1I 4DR4I 3LTOA 4B3RE 3ZZTA 1Z0TA 4IZJB 3JAMC 5IWAE 1S4EA 1N0UA 4DV2I 4KQVA 4DV5E 1KTVA 4JI6E 3J7AG 4K0KE 2UXDI 1ZM2A 5LL6R 2V34A 3WU5A 3J7AM 1DARA 4DR3I 3WU4A 4DPTA 2UUAI 2E5LI 4B3ME 2UXCE 4IZKB 3HJCA 3V2UC 5L3JA 4USKA 3WU3A 3ZZ0A 2VQEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU7 A;  4B3R I;  4FWH A;  2V2Q A;  2A2D A;  4JI4 E;  4GKK E;  4DR7 E;  1XHK A;  1PIE A;  1FKA E;  2UUB I;  2XEX A;  3JAM Q;  1A6F A;  2A2C A;  4DV6 E;  2DEI A;  4AQY E;  1XNQ I;  4JI0 I;  1HNZ E;  4P7A A;  4LF5 E;  2VQF E;  4JI5 E;  2HFU A;  1MX0 A;  4JI2 E;  4DUY I;  2EFG A;  4JV5 E;  4X65 E;  1FJG E;  4JI7 E;  5LMU E;  4DV1 E;  1H7U A;  4DR4 E;  3LNU A;  3QT8 A;  3WU6 A;  4DPX A;  4JI4 I;  5GME A;  1FNM A;  4DR7 I;  1S16 A;  4GKJ E;  2Q2E B;  2HKE A;  5LMN I;  3M6A A;  4MYU A;  2UU9 I;  4DV4 I;  1B63 A;  4AQY I;  4JI3 E;  4LFB I;  1HNZ I;  2UXD E;  1Z0G A;  3B82 A;  4JI2 I;  1QZR A;  4LFC I;  2UUA E;  2DEJ A;  3D4J A;  4X64 I;  1FI4 A;  4X65 I;  1FJG I;  1FWL A;  1Z59 A;  1N34 I;  2X7I A;  4M1K A;  1ZXM A;  4X66 I;  4I3H A;  2VQE E;  4LF7 E;  1Z5B A;  3HUL A;  4URL A;  1N32 E;  4LF9 E;  1EI1 A;  4FW9 A;  1EA6 A;  4GKJ I;  2UUB E;  2F4V I;  1J5E I;  4YHH I;  4JI3 I;  1HNX E;  1XNQ E;  4DR6 I;  4JI0 E;  3PYF A;  1K47 A;  4PRV A;  3QT7 A;  4YY3 E;  2HKJ A;  4LF8 E;  3J80 C;  4DUY E;  1MU5 A;  3ZZU A;  2HFS A;  1ZXN A;  4WUD A;  1N0V C;  4DV7 E;  2LJP A;  3OTO E;  3K1J A;  5A2Q C;  2HK2 A;  3PYG A;  1B62 A;  1IBK E;  4Z7Y A;  4EMD A;  1N32 I;  4LF9 I;  1OJ4 A;  1Z0E A;  4B3S I;  2V2V A;  5LMN E;  2UU9 E;  4DV4 E;  4JI8 E;  1HNX I;  3T1H I;  4LFB E;  5GMD A;  1D6T A;  1I94 I;  3QT5 A;  4DUZ I;  4YY3 I;  3ZKB A;  4LF8 I;  1H73 A;  4LFC E;  4LF4 I;  1NHI A;  2J7K A;  3GON A;  4FWG A;  4X64 E;  1UEK A;  1Z0C A;  4DV7 I;  3OTO I;  4HYM A;  3J80 Q;  2HHH I;  1N34 E;  4FN5 A;  4NXM E;  1Z0W A;  1RR9 A;  4X66 E;  2UUC I;  4MYT A;  4R1F A;  2CZ9 A;  1IBK I;  1Z5C A;  5FLX C;  4ED4 A;  1H72 C;  1RRE A;  5A2Q Q;  1PVG A;  2V8P A;  4HXZ A;  1HR0 I;  4ZVI A;  2F4V E;  2NPF A;  1J5E E;  3H4L A;  4JI8 I;  4YHH E;  4DR6 E;  4OX9 E;  1Z0B A;  3K17 A;  2X36 A;  4B3T E;  1NZ0 A;  4DU8 A;  1Z5A A;  3T1Y I;  2ZM6 I;  1XNR I;  3PYD A;  4NXM I;  1MG7 A;  4DV3 E;  4DR1 E;  5BR8 I;  2GS8 A;  3B8H A;  4JYA I;  1KIJ A;  2BM1 A;  2V2Z A;  4FWD A;  1PKP A;  4B3S E;  4WUB A;  1U2R A;  2VF3 A;  5FLX Q;  3T1H E;  4DR5 E;  4OX9 I;  4DPY A;  2BM0 A;  3PYE A;  1I94 E;  1NHJ A;  2R42 A;  4DUZ E;  4NXN E;  1XMO E;  4LF4 E;  4B3T I;  1IBM I;  1N33 I;  4JG4 A;  4DR2 E;  2HHH E;  4DV3 I;  1KVK A;  4USM A;  1HNW I;  4JI1 E;  3J81 C;  2R3V A;  4DR1 I;  2UUC E;  2OI2 A;  4DPU A;  4KHP E;  1HR0 E;  1NHH A;  4UT4 A;  1ZM4 A;  3LPS A;  4DV0 E;  1FWK A;  4DR5 I;  4PRX A;  1XMQ E;  5IWA I;  3Q1Q A;  4XTJ A;  4UTG A;  4NXN I;  1XMO I;  4DPW A;  1IBL E;  1BKN A;  3F0N A;  2BV3 A;  1H7S A;  4DV5 I;  4DR2 I;  3T1Y E;  4LF6 E;  4JI6 I;  2ZBK B;  2ZM6 E;  1XNR E;  1N36 E;  4K0K I;  4JI1 I;  4PU9 A;  1ZM9 A;  5BR8 E;  5IT9 C;  3ZKD A;  2UXB E;  2HK3 A;  4JYA E;  4DXL A;  4LFA E;  3J81 Q;  4HAC B;  4B3M I;  3V5R A;  4KHP I;  4HY1 A;  2UXC I;  4X62 E;  4LF7 I;  4RPF A;  2E1R A;  4DV0 I;  1ZM3 A;  1XMQ I;  4GKK I;  1WUU A;  3ZM7 A;  2WW4 A;  1IBL I;  4DV2 E;  4WUC A;  1IBM E;  1N33 E;  4LF6 I;  4DV6 I;  3B78 A;  1N36 I;  1H74 A;  1VIS A;  1Z0V A;  1HNW E;  4LF5 I;  2VQF I;  4JI5 I;  1ELO A;  3QT6 A;  2UXB I;  4Z7C A;  2ZIT A;  4DR3 E;  4LFA I;  2AJ4 A;  4JV5 I;  2E5L E;  4HAC A;  3CWV A;  4P52 A;  4X62 I;  5IT9 Q;  4JI7 I;  5LMU I;  1KKH A;  4DV1 I;  4DR4 I;  3LTO A;  4B3R E;  3ZZT A;  1Z0T A;  3JAM C;  5IWA E;  1S4E A;  1N0U A;  4DV2 I;  4KQV A;  4DV5 E;  1KTV A;  4JI6 E;  3J7A G;  4K0K E;  2UXD I;  1ZM2 A;  5LL6 R;  2V34 A;  3WU5 A;  3J7A M;  1DAR A;  4DR3 I;  3WU4 A;  4DPT A;  2UUA I;  2E5L I;  4B3M E;  2UXC E;  3V2U C;  5L3J A;  4USK A;  3WU3 A;  3ZZ0 A;  2VQE I; 
#chains in the Genus database with same CATH topology
 4DU7 A;  5C0X A;  4FWH A;  4B3R I;  2V2Q A;  2A2D A;  4JI4 E;  4GKK E;  4IZJ A;  3M85 D;  5DNX A;  4DR7 E;  1XHK A;  1PIE A;  1YH8 A;  1FKA E;  2UUB I;  2XEX A;  3JAM Q;  1Y60 A;  1P42 A;  1A6F A;  1UDQ A;  4MDT A;  4FW5 A;  2BA0 D;  2A2C A;  4DV6 E;  4OO1 A;  4OO1 F;  2DEI A;  4AQY E;  1XNQ I;  4JI0 I;  1HNZ E;  4P7A A;  4QNK A;  4LF5 E;  2VQF E;  5ELW A;  4JI5 E;  5C0X E;  2HFU A;  1MX0 A;  4JI2 E;  2JE6 A;  1Y4S A;  3PS3 A;  4DUY I;  2O3Z A;  2GQ0 A;  2EFG A;  4JV5 E;  4MQY A;  4ISA A;  1YHC A;  4X65 E;  1FJG E;  1VI7 A;  4JI7 E;  5LMU E;  4DV1 E;  1H7U A;  4DR4 E;  3LNU A;  3QT8 A;  2CVE A;  3NZK A;  3WU6 A;  4DPX A;  3H1C A;  4JI4 I;  5GME A;  1FNM A;  4IFD E;  4DR7 I;  1S16 A;  4LCG A;  4GKJ E;  2Q2E B;  2HKE A;  5LMN I;  5K36 B;  3M6A A;  4MYU A;  3KRN A;  2UU9 I;  4DV4 I;  1B63 A;  4AQY I;  4JI3 E;  4LFB I;  1HNZ I;  2UXD E;  1Z0G A;  3B82 A;  5DRP A;  2BR2 B;  4JI2 I;  1QZR A;  1Y5Y A;  2Z5C B;  4LFC I;  4BA1 A;  4LPF A;  2UUA E;  2DEJ A;  2O1T A;  2PNL A;  3D4J A;  3L7Z B;  5JEA C;  5JEA D;  4X64 I;  1FI4 A;  4X65 I;  1FJG I;  1FWL A;  1Z59 A;  5DRR A;  1N34 I;  2X7I A;  4M1K A;  1ZXM A;  4X66 I;  4I3H A;  2VQE E;  4LF7 E;  4OZE A;  1Z5B A;  3HUL A;  4URL A;  1N32 E;  3U1K A;  4LF9 E;  1EI1 A;  3P06 A;  3K85 A;  4FW9 A;  1EA6 A;  4GKJ I;  2UUB E;  2NN6 C;  4MU3 A;  2F4V I;  2IOQ A;  1J5E I;  4AM3 A;  5K36 A;  4FW3 A;  4YHH I;  4JI3 I;  1HNX E;  1XNQ E;  2PO0 B;  4DR6 I;  4JI0 E;  4AIM A;  3PYF A;  1K47 A;  3Q6N A;  4PRV A;  3QT7 A;  1XXE A;  4YY3 E;  2HKJ A;  4LF8 E;  3J80 C;  5C0X D;  2BA1 D;  4DUY E;  1MU5 A;  3ZZU A;  2HFS A;  4IZJ D;  4N3O A;  1ZXN A;  3L7Z A;  4WUD A;  1E3H A;  1N0V C;  4DV7 E;  2LJP A;  3OTO E;  3M7N G;  5K36 E;  3K1J A;  5C0X F;  3DD6 A;  5A2Q C;  1USV A;  2HK2 A;  3PYG A;  1B62 A;  4OO1 C;  4OO1 D;  3U1Y A;  1IBK E;  4Z7Y A;  2JEA A;  2J65 A;  2JT2 A;  4EMD A;  1N32 I;  4LF9 I;  2C38 B;  1Y6Z A;  1OJ4 A;  1Z0E A;  4B3S I;  2V2V A;  5LMN E;  4U3B A;  2IER A;  2UU9 E;  4DV4 E;  4JI8 E;  1HNX I;  3T1H I;  4LFB E;  5GMD A;  1D6T A;  4IFD F;  4IFD A;  3GLL A;  1I94 I;  3QT5 A;  2O1V A;  4YY3 I;  3GME A;  3ZKB A;  4DUZ I;  5FWK A;  4LF8 I;  1H73 A;  4LFC E;  4LF4 I;  1NHI A;  2J7K A;  2JEB B;  3GON A;  2WNR A;  5DNL A;  4FWG A;  1R6M A;  4X64 E;  1UEK A;  1Z0C A;  4DV7 I;  3OTO I;  4IZK A;  1UDO A;  4HYM A;  3J80 Q;  2HHH I;  1N34 E;  4FN5 A;  4NXM E;  1Z0W A;  1RR9 A;  4X66 E;  2UUC I;  4MYT A;  4R1F A;  4IS9 A;  2CZ9 A;  1IBK I;  4AID A;  2PO2 B;  1Z5C A;  5FLX C;  4ED4 A;  1H72 C;  1RRE A;  1UDS A;  5A2Q Q;  1PVG A;  2PNZ B;  2V8P A;  4HXZ A;  1HR0 I;  4ZVI A;  4FW6 A;  2F4V E;  2NPF A;  1J5E E;  3H4L A;  4JI8 I;  5EKW A;  4YHH E;  4DR6 E;  5JEA B;  4OX9 E;  1Z0B A;  4MU0 A;  3K17 A;  2X36 A;  1R6L A;  3P3G A;  2F1D A;  4B3T E;  1NZ0 A;  4DU8 A;  1Z5A A;  3T1Y I;  2ZM6 I;  1XNR I;  3PYD A;  2IOP A;  4NXM I;  3PS1 A;  1MG7 A;  4DV3 E;  4NBQ A;  3CDI A;  4DR1 E;  2PNM A;  5BR8 I;  5K36 D;  2NN6 B;  4LOM A;  2GS8 A;  4LCH A;  3B8H A;  4JYA I;  1KIJ A;  2BM1 A;  2V2Z A;  4FWD A;  1PKP A;  4B3S E;  2PO1 B;  4WUB A;  2C37 B;  1U2R A;  2O1W A;  5K36 F;  2VF3 A;  1OYR A;  5FLX Q;  1OYP A;  3T1H E;  4DR5 E;  4OX9 I;  4DPY A;  2BM0 A;  2Z5E A;  3PYE A;  1I94 E;  1NHJ A;  2R42 A;  2BR2 A;  1HK7 A;  4DUZ E;  4NXN E;  1XMO E;  2VES A;  5C0X C;  2Z5C A;  4LF4 E;  4B3T I;  1IBM I;  2Z5B B;  2C39 B;  1N33 I;  4JG4 A;  2CG9 A;  4DR2 E;  4QNJ A;  4BA2 B;  4OO1 B;  2HHH E;  4DV3 I;  1KVK A;  4USM A;  1HNW I;  4JI1 E;  3P3C A;  3M7N D;  3J81 C;  2R3V A;  4DR1 I;  2UUC E;  2OI2 A;  2NN6 F;  2NN6 A;  4DPU A;  1UDN A;  4IFD C;  4IFD D;  4KHP E;  1HR0 E;  1NHH A;  5DRQ A;  2PO1 A;  2C37 A;  2O1U A;  4UT4 A;  1ZM4 A;  3LPS A;  1E3P A;  4DV0 E;  4FW7 A;  1FWK A;  4DR5 I;  3M85 G;  2PO0 A;  4PRX A;  1XMQ E;  4LCF A;  5IWA I;  3Q1Q A;  4XTJ A;  4UTG A;  4NXN I;  1XMO I;  4DPW A;  1IBL E;  2NN6 E;  1BKN A;  3F0N A;  4U3D A;  2BV3 A;  2BA0 G;  1H7S A;  2Z5B A;  4DV5 I;  2C39 A;  3PRY A;  4DR2 I;  3T1Y E;  4LF6 E;  4JI6 I;  2ZBK B;  2ZM6 E;  1XNR E;  4BA2 A;  3HKM A;  1N36 E;  4K0K I;  4JI1 I;  4PU9 A;  1ZM9 A;  5BR8 E;  1RHY A;  4OKG A;  5IT9 C;  3ZKD A;  4BA1 B;  2UXB E;  2HK3 A;  4JYA E;  4DXL A;  2C38 A;  4LFA E;  3J81 Q;  4HAC B;  4B3M I;  3V5R A;  4KHP I;  4HY1 A;  2UXC I;  4X62 E;  4LF7 I;  3GCM A;  4RPF A;  1Y4U A;  2E1R A;  4DV0 I;  4OO1 E;  1ZM3 A;  1XMQ I;  2CGE A;  4GKK I;  1WUU A;  2GO3 A;  4J3D A;  3ZM7 A;  2WW4 A;  1IBL I;  4DV2 E;  4WUC A;  1IBM E;  2JEB A;  1N33 E;  4LF6 I;  4MU1 A;  4DV6 I;  3B78 A;  3PS2 A;  1N36 I;  1H74 A;  1VIS A;  1Z0V A;  2IES A;  3CDJ A;  1HNW E;  4LF5 I;  2VQF I;  4JI5 I;  5K36 C;  1ELO A;  3QT6 A;  4FW4 A;  2UXB I;  3Q6M A;  2ZIT A;  4Z7C A;  4DR3 E;  3P3E A;  2PO2 A;  1USU A;  4LFA I;  2AJ4 A;  2WP8 B;  3P76 A;  4JV5 I;  2GO4 A;  2E5L E;  4HAC A;  2PNZ A;  3CWV A;  4P52 A;  4X62 I;  5DRO A;  5IT9 Q;  4JI7 I;  5LMU I;  2AE8 A;  1KKH A;  4DV1 I;  4DR4 I;  5C0X B;  3B4T A;  3LTO A;  1OYS A;  4B3R E;  3ZZT A;  1Z0T A;  4IZJ B;  2JEA B;  3JAM C;  5EL9 A;  4GQU A;  5JEA F;  5JEA A;  5IWA E;  1S4E A;  1N0U A;  4DV2 I;  4KQV A;  2NN6 D;  4DV5 E;  1KTV A;  4JI6 E;  3J7A G;  4K0K E;  2UXD I;  1ZM2 A;  5LL6 R;  3UHM A;  4IFD B;  2V34 A;  3WU5 A;  2BA1 G;  2JE6 B;  3J7A M;  1DAR A;  4DR3 I;  3WU4 A;  5JEA E;  4DPT A;  2UUA I;  2WNR B;  2E5L I;  4B3M E;  2WP8 A;  2UXC E;  4IZK B;  4MU4 A;  3HJC A;  3V2U C;  5L3J A;  4USK A;  3WU3 A;  3ZZ0 A;  2VQE I; 
#chains in the Genus database with same CATH homology
 4DU7 A;  4B3R I;  4FWH A;  2V2Q A;  2A2D A;  4JI4 E;  4GKK E;  4IZJ A;  4DR7 E;  1XHK A;  1PIE A;  1FKA E;  2UUB I;  2XEX A;  3JAM Q;  1A6F A;  2A2C A;  4DV6 E;  2DEI A;  4AQY E;  1XNQ I;  4JI0 I;  1HNZ E;  4P7A A;  4LF5 E;  2VQF E;  4JI5 E;  2HFU A;  1MX0 A;  4JI2 E;  1Y4S A;  4DUY I;  2GQ0 A;  2EFG A;  4JV5 E;  4X65 E;  1FJG E;  4JI7 E;  5LMU E;  4DV1 E;  1H7U A;  4DR4 E;  3LNU A;  3QT8 A;  3WU6 A;  4DPX A;  4JI4 I;  5GME A;  1FNM A;  4DR7 I;  1S16 A;  4GKJ E;  2Q2E B;  2HKE A;  5LMN I;  3M6A A;  4MYU A;  2UU9 I;  4DV4 I;  1B63 A;  4AQY I;  4JI3 E;  4LFB I;  1HNZ I;  2UXD E;  1Z0G A;  3B82 A;  4JI2 I;  1QZR A;  2Z5C B;  4LFC I;  2UUA E;  2DEJ A;  2O1T A;  2PNL A;  3D4J A;  4X64 I;  1FI4 A;  4X65 I;  1FJG I;  1FWL A;  1Z59 A;  1N34 I;  2X7I A;  4M1K A;  1ZXM A;  4X66 I;  4I3H A;  2VQE E;  4LF7 E;  1Z5B A;  3HUL A;  4URL A;  1N32 E;  4LF9 E;  1EI1 A;  3P06 A;  3K85 A;  4FW9 A;  1EA6 A;  4GKJ I;  2UUB E;  2F4V I;  2IOQ A;  1J5E I;  4YHH I;  4JI3 I;  1HNX E;  1XNQ E;  4DR6 I;  4JI0 E;  3PYF A;  1K47 A;  3Q6N A;  4PRV A;  3QT7 A;  4YY3 E;  2HKJ A;  4LF8 E;  3J80 C;  4DUY E;  1MU5 A;  3ZZU A;  2HFS A;  4IZJ D;  1ZXN A;  4N3O A;  4WUD A;  1N0V C;  4DV7 E;  2LJP A;  3OTO E;  3K1J A;  5A2Q C;  1USV A;  2HK2 A;  3PYG A;  1B62 A;  1IBK E;  4Z7Y A;  4EMD A;  1N32 I;  4LF9 I;  1Y6Z A;  1OJ4 A;  1Z0E A;  4B3S I;  2V2V A;  5LMN E;  2UU9 E;  4DV4 E;  4JI8 E;  1HNX I;  3T1H I;  4LFB E;  5GMD A;  1D6T A;  1I94 I;  3QT5 A;  2O1V A;  4YY3 I;  3ZKB A;  4DUZ I;  5FWK A;  4LF8 I;  1H73 A;  4LFC E;  4LF4 I;  1NHI A;  2J7K A;  3GON A;  4FWG A;  4X64 E;  1UEK A;  1Z0C A;  4DV7 I;  3OTO I;  4IZK A;  4HYM A;  3J80 Q;  2HHH I;  1N34 E;  4FN5 A;  4NXM E;  1Z0W A;  1RR9 A;  4X66 E;  2UUC I;  4MYT A;  4R1F A;  2CZ9 A;  1IBK I;  1Z5C A;  5FLX C;  4ED4 A;  1H72 C;  1RRE A;  5A2Q Q;  1PVG A;  2V8P A;  4HXZ A;  1HR0 I;  4ZVI A;  2F4V E;  2NPF A;  1J5E E;  3H4L A;  4JI8 I;  4YHH E;  4DR6 E;  4OX9 E;  1Z0B A;  3K17 A;  2X36 A;  4B3T E;  1NZ0 A;  4DU8 A;  1Z5A A;  3T1Y I;  2ZM6 I;  1XNR I;  3PYD A;  2IOP A;  4NXM I;  1MG7 A;  4DV3 E;  4DR1 E;  5BR8 I;  2PNM A;  2GS8 A;  3B8H A;  4JYA I;  1KIJ A;  2BM1 A;  2V2Z A;  4FWD A;  1PKP A;  4B3S E;  4WUB A;  1U2R A;  2O1W A;  2VF3 A;  5FLX Q;  3T1H E;  4DR5 E;  4OX9 I;  4DPY A;  2BM0 A;  2Z5E A;  3PYE A;  1I94 E;  1NHJ A;  2R42 A;  4DUZ E;  1HK7 A;  4NXN E;  1XMO E;  2Z5C A;  4LF4 E;  4B3T I;  1IBM I;  2Z5B B;  1N33 I;  4JG4 A;  2CG9 A;  4DR2 E;  2HHH E;  4DV3 I;  1KVK A;  4USM A;  1HNW I;  4JI1 E;  3J81 C;  2R3V A;  4DR1 I;  2UUC E;  2OI2 A;  4DPU A;  4KHP E;  1HR0 E;  1NHH A;  2O1U A;  4UT4 A;  1ZM4 A;  3LPS A;  4DV0 E;  1FWK A;  4DR5 I;  4PRX A;  1XMQ E;  5IWA I;  3Q1Q A;  4XTJ A;  4UTG A;  4NXN I;  1XMO I;  4DPW A;  1IBL E;  1BKN A;  3F0N A;  2BV3 A;  1H7S A;  2Z5B A;  4DV5 I;  4DR2 I;  3PRY A;  3T1Y E;  4LF6 E;  4JI6 I;  2ZBK B;  2ZM6 E;  1XNR E;  1N36 E;  4K0K I;  4JI1 I;  4PU9 A;  1ZM9 A;  5BR8 E;  5IT9 C;  3ZKD A;  2UXB E;  2HK3 A;  4JYA E;  4DXL A;  4LFA E;  3J81 Q;  4HAC B;  4B3M I;  3V5R A;  4KHP I;  4HY1 A;  2UXC I;  4X62 E;  4LF7 I;  4RPF A;  1Y4U A;  2E1R A;  4DV0 I;  1ZM3 A;  1XMQ I;  2CGE A;  4GKK I;  1WUU A;  3ZM7 A;  2WW4 A;  1IBL I;  4DV2 E;  4WUC A;  1IBM E;  1N33 E;  4LF6 I;  4DV6 I;  3B78 A;  1N36 I;  1H74 A;  1VIS A;  1Z0V A;  1HNW E;  4LF5 I;  2VQF I;  4JI5 I;  1ELO A;  3QT6 A;  2UXB I;  3Q6M A;  2ZIT A;  4Z7C A;  4DR3 E;  1USU A;  4LFA I;  2AJ4 A;  4JV5 I;  2E5L E;  4HAC A;  3CWV A;  4P52 A;  4X62 I;  5IT9 Q;  4JI7 I;  5LMU I;  1KKH A;  4DV1 I;  4DR4 I;  3LTO A;  4B3R E;  3ZZT A;  1Z0T A;  4IZJ B;  3JAM C;  5IWA E;  1S4E A;  1N0U A;  4DV2 I;  4KQV A;  4DV5 E;  1KTV A;  4JI6 E;  3J7A G;  4K0K E;  2UXD I;  1ZM2 A;  5LL6 R;  2V34 A;  3WU5 A;  3J7A M;  1DAR A;  4DR3 I;  3WU4 A;  4DPT A;  2UUA I;  2E5L I;  4B3M E;  2UXC E;  4IZK B;  3HJC A;  3V2U C;  5L3J A;  4USK A;  3WU3 A;  3ZZ0 A;  2VQE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...