4DR7I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7I00
4JYAE 4JI4E 3M6AA 4JI2E 1Z0TA 2E5LI 4DV0I 4LF9E 1XMOI 4JI1E 3LPSA 4B3MI 4DU8A 1WUUA 3OTOI 4K0KE 2DEIA 2F4VE 2EFGA 4DR4E 1N34I 4WUBA 2HKJA 1UEKA 4MYTA 2UUAE 5IWAE 2BV3A 4DR6I 5LL6R 3WU6A 1IBME 3B82A 4DPXA 4DR7E 4LF8E 4FWGA 3J80C 3V5RA 1H74A 1ZM3A 4DR5I 4DR3E 3T1YE 1HNWI 1HR0E 4DR2E 4PRVA 4LF4I 5IT9Q 4X62I 2BM0A 2UXBE 3QT5A 3J7AG 4NXNE 4DR1I 1D6TA 4OX9I 1XHKA 4URLA 1S4EA 4DUYE 2NPFA 4LFCI 4B3SE 1H7SA 2X36A 3T1HE 2UXDE 1A6FA 2XEXA 1BKNA 2HHHI 1HNXE 4DV4E 3JAMC 1NHIA 4DUZI 3PYEA 4ED4A 1Z0GA 2ZITA 1N32I 4DV6I 1KVKA 2V8PA 2Q2EB 3ZM7A 2UXCE 5GMDA 1XNRI 3CWVA 4DV2I 4DV3I 5BR8I 4DXLA 1RR9A 1FJGI 1ZXNA 4JI7E 3J80Q 1Z59A 5GMEA 1J5EE 2VQFE 4JI4I 4Z7YA 4KHPE 1Z5CA 4YHHE 4X66E 1Z0VA 4GKKE 1XNQI 4JV5E 4JI0I 1ZM4A 2VQEI 2BM1A 4K0KI 2F4VI 4JI5I 2HK2A 4GKJE 5LMNE 4DR4I 1NHJA 4FWHA 5LMUI 5IWAI 3V2UC 1IBLE 1IBMI 4DR7I 4USMA 2ZM6I 4JI6E 2ZBKB 4P52A 1U2RA 2A2DA 4DR3I 4YY3E 3T1YI 4AQYE 4B3TI 1OJ4A 2GS8A 1IBKI 4LFBE 1HR0I 4DR2I 1KKHA 4JG4A 3PYDA 2E5LE 2CZ9A 1EA6A 4PU9A 1VISA 1EI1A 4JI8I 2UXBI 3D4JA 3J81C 4DV0E 4UT4A 4DPUA 4DV7I 1RREA 4LF5I 1ZM9A 2AJ4A 1ZXMA 4RPFA 1MX0A 4DUYI 4B3RE 4B3SI 4MYUA 2J7KA 2UXDI 1H7UA 1N0UA 1H73A 4DV1E 3ZZ0A 4LFAE 1B63A 4DU7A 4LF6I 3LTOA 3B78A 3K17A 4NXME 1N36E 5L3JA 1N33I 1PIEA 1HNWE 1QZRA 2OI2A 4LF4E 1FI4A 4XTJA 1FWKA 4LF7E 1PKPA 1J5EI 4DR1E 2VQFI 4OX9E 4Z7CA 4HYMA 1ELOA 5A2QC 2HK3A 4PRXA 4ZVIA 1K47A 4X64I 3Q1QA 4JYAI 1XMQE 2X7IA 5FLXC 4JI2I 2HHHE 1Z0WA 1N0VC 4HXZA 3GONA 4DV5E 4X65E 5LMNI 1Z0EA 1FKAE 1PVGA 4JI3E 4LF9I 4JI1I 2V2QA 2UU9E 1IBLI 4WUCA 1KTVA 2E1RA 1FWLA 1HNZE 4WUDA 2LJPA 4JI6I 1XNRE 2A2CA 4DPYA 4DV3E 2UUAI 3QT8A 1NHHA 1H72C 3PYFA 2UUBE 1B62A 4LF8I 2DEJA 1Z0BA 2UUCE 3ZKDA 4LFBI 4DPTA 1KIJA 3WU4A 1I94E 3JAMQ 1XNQE 4JI0E 2VQEE 4DPWA 1MG7A 4JI5E 4B3RI 5LMUE 4NXNI 1MU5A 5A2QQ 1XMOE 3K1JA 4B3ME 4HACA 3F0NA 4FN5A 3WU5A 3OTOE 3B8HA 2ZM6E 4DV1I 4LFAI 1N34E 5FLXQ 3T1HI 4DR6E 3WU3A 4NXMI 4USKA 3QT7A 1N36I 3QT6A 4B3TE 1HNXI 4DV4I 2HFSA 1IBKE 1DARA 2VF3A 1Z5BA 4M1KA 4P7AA 4DR5E 4KQVA 2V34A 2V2VA 1S16A 4JI8E 4LF7I 4DV7E 2UXCI 4LF5E 1NZ0A 3H4LA 4R1FA 4X62E 4JI7I 4HY1A 1XMQI 4I3HA 4EMDA 3ZZTA 3ZZUA 2WW4A 4DV5I 4X65I 4KHPI 4YHHI 4LFCE 4X66I 1ZM2A 1Z5AA 4LF6E 4JI3I 4GKKI 3J7AM 4JV5I 2UU9I 4FW9A 1N33E 4HACB 3PYGA 1HNZI 3J81Q 4GKJI 3LNUA 4DUZE 4FWDA 1N32E 4DV6E 2R3VA 5IT9C 1FNMA 2UUBI 2HKEA 2UUCI 1Z0CA 2V2ZA 4DV2E 2HFUA 5BR8E 4YY3I 4UTGA 2R42A 3ZKBA 1FJGE 4X64E 4AQYI 3HULA 1I94I
chains in the Genus database with same CATH superfamily
4JYAE 4JI4E 4OO1B 5K36A 3M6AA 2NN6F 4JI2E 1Z0TA 2E5LI 2VESA 5DRQA 1UDSA 2NN6C 4DV0I 4BA1B 1R6LA 3P3CA 4LF9E 1XMOI 4JI1E 3LPSA 4B3MI 4DU8A 1WUUA 3OTOI 4K0KE 2DEIA 2F4VE 2O3ZA 4QNJA 2EFGA 5DROA 4DR4E 4OO1F 3PRYA 1N34I 4WUBA 2HKJA 1UEKA 4MYTA 3CDIA 4FW5A 2UUAE 5IWAE 2BV3A 3PS1A 4DR6I 5LL6R 4LOMA 4GQUA 3WU6A 1IBME 3B82A 1RHYA 4DPXA 4DR7E 5DRRA 4LF8E 4FWGA 3J80C 3V5RA 3H1CA 2PO1B 2IOPA 1H74A 1ZM3A 2NN6A 4IFDD 4DR5I 4DR3E 3T1YE 4IFDF 2BA0D 3GLLA 1HNWI 1HR0E 1E3HA 4DR2E 4PRVA 4LF4I 4IFDC 2GO4A 5IT9Q 5JEAE 4X62I 2BM0A 3KRNA 3L7ZB 2UXBE 3QT5A 3J7AG 4NXNE 4DR1I 1D6TA 4OX9I 1XHKA 5K36B 4URLA 1S4EA 4DUYE 2NPFA 4LFCI 4B3SE 1H7SA 2X36A 4IS9A 3T1HE 2UXDE 1A6FA 3P76A 2XEXA 4N3OA 1BKNA 2HHHI 4IFDA 4MU1A 1HNXE 4MDTA 1USUA 4DV4E 3JAMC 5C0XE 1NHIA 4DUZI 2O1UA 2Z5EA 3PYEA 4ED4A 1Z0GA 2ZITA 5K36F 1N32I 4DV6I 1KVKA 2V8PA 2BA0G 2Q2EB 3ZM7A 2UXCE 3PS2A 5GMDA 2AE8A 5JEAD 1XNRI 2O1TA 3CWVA 4DV2I 4DV3I 5BR8I 2NN6B 3UHMA 4DXLA 1RR9A 1FJGI 4MU3A 5JEAF 1ZXNA 4JI7E 3J80Q 1Z59A 5GMEA 1J5EE 2C37A 3NZKA 2VQFE 1Y6ZA 4JI4I 2BR2A 4Z7YA 2PO2A 4FW6A 5JEAC 2JEAA 4KHPE 1Z5CA 4YHHE 4X66E 1Z0VA 4U3BA 4GKKE 1XNQI 4JV5E 4JI0I 1Y60A 1ZM4A 3GMEA 2VQEI 1P42A 2BM1A 5C0XD 4K0KI 2F4VI 4JI5I 2HK2A 1HK7A 4OKGA 4GKJE 5LMNE 4DR4I 1NHJA 4FWHA 5LMUI 5IWAI 4QNKA 3V2UC 3Q6MA 1IBLE 1IBMI 5JEAA 5C0XC 2PO0A 4DR7I 1USVA 2C39A 4IFDB 4USMA 4MQYA 2ZM6I 2ZBKB 4JI6E 4P52A 1U2RA 2A2DA 2CG9A 2GQ0A 2JEBA 4DR3I 4YY3E 3K85A 1UDNA 3M7ND 3T1YI 3M85D 4AQYE 2WP8A 4B3TI 1OJ4A 2PNZA 2GS8A 1IBKI 2PNMA 4LFBE 4NBQA 1HR0I 4DR2I 1KKHA 4JG4A 3PYDA 2E5LE 2CZ9A 1EA6A 4PU9A 1Y4UA 1EI1A 1VISA 2Z5BA 4JI8I 2UXBI 3D4JA 3J81C 4LCFA 2WNRA 4UT4A 4DV0E 4DPUA 4DV7I 1RREA 5C0XA 4LF5I 2C37B 1ZM9A 2BR2B 2PO2B 2JE6A 2AJ4A 1ZXMA 4RPFA 1MX0A 2JEAB 4DUYI 4B3RE 4B3SI 4MYUA 4MU4A 2J7KA 2UXDI 4LPFA 1H7UA 1N0UA 1H73A 5ELWA 4DV1E 3ZZ0A 4LFAE 1B63A 3M7NG 4DU7A 4LF6I 3LTOA 3B78A 1OYSA 3K17A 4NXME 1N36E 5L3JA 1N33I 5JEAB 1PIEA 2PO0B 1Y4SA 4U3DA 1HNWE 2C39B 1QZRA 2OI2A 5EKWA 4LF4E 1FI4A 2F1DA 2JEBB 4XTJA 1FWKA 4LF7E 1PKPA 3U1YA 1J5EI 4DR1E 2VQFI 5DNXA 2WP8B 4OX9E 4Z7CA 4HYMA 1ELOA 5A2QC 2Z5CA 2PNZB 2HK3A 4PRXA 4ZVIA 1K47A 4X64I 1YH8A 3Q1QA 2Z5BB 4JYAI 3U1KA 2WNRB 1XMQE 2X7IA 5C0XB 5FLXC 4JI2I 2HHHE 5FWKA 1Z0WA 1N0VC 2IERA 2JE6B 3GONA 4HXZA 4IZJD 4DV5E 2BA1D 4OO1E 4X65E 5LMNI 3CDJA 1Z0EA 1FKAE 2CVEA 1PVGA 4JI3E 4LF9I 4JI1I 1UDOA 2IESA 2V2QA 1XXEA 2UU9E 1IBLI 4WUCA 1KTVA 2E1RA 4AIDA 2J65A 2PNLA 1FWLA 1HNZE 4AM3A 4WUDA 2LJPA 4JI6I 1XNRE 5C0XF 2A2CA 2GO3A 4DPYA 4DV3E 2UUAI 3QT8A 1NHHA 1H72C 4J3DA 4MU0A 1OYRA 1VI7A 3PYFA 4FW3A 3HKMA 2UUBE 1B62A 4LF8I 2DEJA 1Z0BA 3P3GA 2UUCE 3ZKDA 5EL9A 4LFBI 4DPTA 1KIJA 2C38A 3WU4A 1I94E 3JAMQ 1XNQE 4IZJA 4JI0E 4LCHA 4OO1D 2VQEE 2BA1G 4DPWA 1MG7A 2Z5CB 4IZKA 4BA2A 4JI5E 3B4TA 4B3RI 2O1WA 4FW4A 5LMUE 4NXNI 1MU5A 5A2QQ 1XMOE 2JT2A 1YHCA 3K1JA 4B3ME 4HACA 3F0NA 4OO1C 4FN5A 3HJCA 3WU5A 3OTOE 3B8HA 2ZM6E 4DV1I 4LFAI 4OZEA 1N34E 5K36E 5FLXQ 3T1HI 4DR6E 3WU3A 4NXMI 4USKA 3QT7A 1N36I 3QT6A 4B3TE 1HNXI 4AIMA 4DV4I 2HFSA 1IBKE 1DARA 2VF3A 1Z5BA 4M1KA 3P3EA 4P7AA 3M85G 4DR5E 4KQVA 2V34A 2V2VA 4ISAA 1R6MA 1E3PA 1S16A 4JI8E 4LF7I 4OO1A 4DV7E 3P06A 4LF5E 2UXCI 1NZ0A 3H4LA 4R1FA 1UDQA 2C38B 4X62E 4BA1A 4JI7I 3Q6NA 4HY1A 1XMQI 2NN6E 4IZJB 4I3HA 4EMDA 3ZZTA 3ZZUA 2WW4A 4DV5I 5K36D 4X65I 4IZKB 4BA2B 4KHPI 4YHHI 4LFCE 4X66I 1ZM2A 2IOQA 2O1VA 2CGEA 1Z5AA 4LF6E 4JI3I 3DD6A 4GKKI 3J7AM 4JV5I 2UU9I 4FW9A 1N33E 4HACB 2PO1A 3PYGA 1HNZI 3J81Q 5K36C 4GKJI 3LNUA 4LCGA 4DUZE 4FWDA 5DRPA 4FW7A 1Y5YA 1N32E 4DV6E 3GCMA 2R3VA 5IT9C 1FNMA 2UUBI 2HKEA 2UUCI 3PS3A 1Z0CA 5DNLA 2V2ZA 4DV2E 2HFUA 5BR8E 4YY3I 4UTGA 2R42A 3L7ZA 3ZKBA 1FJGE 4IFDE 1OYPA 4X64E 4AQYI 3HULA 2NN6D 1I94I
chains in the Genus database with same CATH topology
4JYAE 4JI4E 3M6AA 4JI2E 1Z0TA 2E5LI 4DV0I 4LF9E 1XMOI 4JI1E 3LPSA 4B3MI 4DU8A 1WUUA 3OTOI 4K0KE 2DEIA 2F4VE 2EFGA 4DR4E 3PRYA 1N34I 4WUBA 2HKJA 1UEKA 4MYTA 2UUAE 5IWAE 2BV3A 4DR6I 5LL6R 3WU6A 1IBME 3B82A 4DPXA 4DR7E 4LF8E 4FWGA 3J80C 3V5RA 2IOPA 1H74A 1ZM3A 4DR5I 4DR3E 3T1YE 1HNWI 1HR0E 4DR2E 4PRVA 4LF4I 5IT9Q 4X62I 2BM0A 2UXBE 3QT5A 3J7AG 4NXNE 4DR1I 1D6TA 4OX9I 1XHKA 4URLA 1S4EA 4DUYE 2NPFA 4LFCI 4B3SE 1H7SA 2X36A 3T1HE 2UXDE 1A6FA 2XEXA 4N3OA 1BKNA 2HHHI 1HNXE 1USUA 4DV4E 3JAMC 1NHIA 4DUZI 2O1UA 2Z5EA 3PYEA 4ED4A 1Z0GA 2ZITA 1N32I 4DV6I 1KVKA 2V8PA 2Q2EB 3ZM7A 2UXCE 5GMDA 1XNRI 2O1TA 3CWVA 4DV2I 4DV3I 5BR8I 4DXLA 1RR9A 1FJGI 1ZXNA 4JI7E 3J80Q 1Z59A 5GMEA 1J5EE 2VQFE 1Y6ZA 4JI4I 4Z7YA 4KHPE 1Z5CA 4YHHE 4X66E 1Z0VA 4GKKE 1XNQI 4JV5E 4JI0I 1ZM4A 2VQEI 2BM1A 4K0KI 2F4VI 4JI5I 2HK2A 1HK7A 4GKJE 5LMNE 4DR4I 1NHJA 4FWHA 5LMUI 5IWAI 3V2UC 3Q6MA 1IBLE 1IBMI 4DR7I 1USVA 4USMA 2ZM6I 4JI6E 2ZBKB 4P52A 1U2RA 2A2DA 2CG9A 2GQ0A 4DR3I 4YY3E 3K85A 3T1YI 4AQYE 4B3TI 1OJ4A 2GS8A 1IBKI 2PNMA 4LFBE 1HR0I 4DR2I 1KKHA 4JG4A 3PYDA 2E5LE 2CZ9A 1EA6A 1Y4UA 4PU9A 1VISA 1EI1A 2Z5BA 4JI8I 2UXBI 3J81C 3D4JA 4DV0E 4UT4A 4DPUA 4DV7I 1RREA 4LF5I 1ZM9A 2AJ4A 1ZXMA 4RPFA 1MX0A 4DUYI 4B3RE 4B3SI 4MYUA 2J7KA 2UXDI 1H7UA 1N0UA 1H73A 4DV1E 3ZZ0A 4LFAE 1B63A 4DU7A 4LF6I 3LTOA 3B78A 3K17A 4NXME 1N36E 5L3JA 1N33I 1PIEA 1Y4SA 1HNWE 1QZRA 2OI2A 4LF4E 1FI4A 4XTJA 1FWKA 4LF7E 1PKPA 1J5EI 4DR1E 2VQFI 4OX9E 4Z7CA 4HYMA 1ELOA 5A2QC 2Z5CA 2HK3A 4PRXA 4ZVIA 1K47A 4X64I 3Q1QA 2Z5BB 4JYAI 1XMQE 2X7IA 5FLXC 4JI2I 2HHHE 5FWKA 1Z0WA 1N0VC 4HXZA 3GONA 4DV5E 4IZJD 4X65E 5LMNI 1Z0EA 1FKAE 1PVGA 4JI3E 4LF9I 4JI1I 2V2QA 2UU9E 1IBLI 4WUCA 1KTVA 2E1RA 2PNLA 1FWLA 1HNZE 4WUDA 2LJPA 4JI6I 1XNRE 2A2CA 4DPYA 4DV3E 2UUAI 3QT8A 1NHHA 1H72C 3PYFA 2UUBE 1B62A 4LF8I 2DEJA 1Z0BA 2UUCE 3ZKDA 4LFBI 4DPTA 1KIJA 3WU4A 1I94E 3JAMQ 1XNQE 4IZJA 4JI0E 2VQEE 4DPWA 1MG7A 2Z5CB 4IZKA 4JI5E 4B3RI 2O1WA 5LMUE 4NXNI 1MU5A 5A2QQ 1XMOE 3K1JA 4B3ME 4HACA 3F0NA 4FN5A 3HJCA 3WU5A 3OTOE 3B8HA 2ZM6E 4DV1I 4LFAI 1N34E 5FLXQ 3T1HI 4DR6E 3WU3A 4NXMI 4USKA 3QT7A 1N36I 3QT6A 4B3TE 1HNXI 4DV4I 2HFSA 1IBKE 1DARA 2VF3A 1Z5BA 4M1KA 4P7AA 4DR5E 4KQVA 2V34A 2V2VA 1S16A 4JI8E 4LF7I 4DV7E 3P06A 4LF5E 2UXCI 1NZ0A 3H4LA 4R1FA 4X62E 4JI7I 3Q6NA 4HY1A 1XMQI 4IZJB 4I3HA 4EMDA 3ZZTA 3ZZUA 2WW4A 4DV5I 4X65I 4IZKB 4KHPI 4YHHI 4LFCE 4X66I 1ZM2A 2IOQA 2O1VA 2CGEA 1Z5AA 4LF6E 4JI3I 4GKKI 3J7AM 4JV5I 2UU9I 4FW9A 1N33E 4HACB 3PYGA 1HNZI 3J81Q 4GKJI 3LNUA 4DUZE 4FWDA 1N32E 4DV6E 2R3VA 5IT9C 1FNMA 2UUBI 2HKEA 2UUCI 1Z0CA 2V2ZA 4DV2E 2HFUA 5BR8E 4YY3I 4UTGA 2R42A 3ZKBA 1FJGE 4X64E 4AQYI 3HULA 1I94I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA E;  4JI4 E;  3M6A A;  4JI2 E;  1Z0T A;  2E5L I;  4DV0 I;  4LF9 E;  1XMO I;  4JI1 E;  3LPS A;  4B3M I;  4DU8 A;  1WUU A;  3OTO I;  4K0K E;  2DEI A;  2F4V E;  2EFG A;  4DR4 E;  1N34 I;  4WUB A;  2HKJ A;  1UEK A;  4MYT A;  2UUA E;  5IWA E;  2BV3 A;  4DR6 I;  5LL6 R;  3WU6 A;  1IBM E;  3B82 A;  4DPX A;  4DR7 E;  4LF8 E;  4FWG A;  3J80 C;  3V5R A;  1H74 A;  1ZM3 A;  4DR5 I;  4DR3 E;  3T1Y E;  1HNW I;  1HR0 E;  4DR2 E;  4PRV A;  4LF4 I;  5IT9 Q;  4X62 I;  2BM0 A;  2UXB E;  3QT5 A;  3J7A G;  4NXN E;  4DR1 I;  1D6T A;  4OX9 I;  1XHK A;  4URL A;  1S4E A;  4DUY E;  2NPF A;  4LFC I;  4B3S E;  1H7S A;  2X36 A;  3T1H E;  2UXD E;  1A6F A;  2XEX A;  1BKN A;  2HHH I;  1HNX E;  4DV4 E;  3JAM C;  1NHI A;  4DUZ I;  3PYE A;  4ED4 A;  1Z0G A;  2ZIT A;  1N32 I;  4DV6 I;  1KVK A;  2V8P A;  2Q2E B;  3ZM7 A;  2UXC E;  5GMD A;  1XNR I;  3CWV A;  4DV2 I;  4DV3 I;  5BR8 I;  4DXL A;  1RR9 A;  1FJG I;  1ZXN A;  4JI7 E;  3J80 Q;  1Z59 A;  5GME A;  1J5E E;  2VQF E;  4JI4 I;  4Z7Y A;  4KHP E;  1Z5C A;  4YHH E;  4X66 E;  1Z0V A;  4GKK E;  1XNQ I;  4JV5 E;  4JI0 I;  1ZM4 A;  2VQE I;  2BM1 A;  4K0K I;  2F4V I;  4JI5 I;  2HK2 A;  4GKJ E;  5LMN E;  4DR4 I;  1NHJ A;  4FWH A;  5LMU I;  5IWA I;  3V2U C;  1IBL E;  1IBM I;  4DR7 I;  4USM A;  2ZM6 I;  4JI6 E;  2ZBK B;  4P52 A;  1U2R A;  2A2D A;  4DR3 I;  4YY3 E;  3T1Y I;  4AQY E;  4B3T I;  1OJ4 A;  2GS8 A;  1IBK I;  4LFB E;  1HR0 I;  4DR2 I;  1KKH A;  4JG4 A;  3PYD A;  2E5L E;  2CZ9 A;  1EA6 A;  4PU9 A;  1VIS A;  1EI1 A;  4JI8 I;  2UXB I;  3D4J A;  3J81 C;  4DV0 E;  4UT4 A;  4DPU A;  4DV7 I;  1RRE A;  4LF5 I;  1ZM9 A;  2AJ4 A;  1ZXM A;  4RPF A;  1MX0 A;  4DUY I;  4B3R E;  4B3S I;  4MYU A;  2J7K A;  2UXD I;  1H7U A;  1N0U A;  1H73 A;  4DV1 E;  3ZZ0 A;  4LFA E;  1B63 A;  4DU7 A;  4LF6 I;  3LTO A;  3B78 A;  3K17 A;  4NXM E;  1N36 E;  5L3J A;  1N33 I;  1PIE A;  1HNW E;  1QZR A;  2OI2 A;  4LF4 E;  1FI4 A;  4XTJ A;  1FWK A;  4LF7 E;  1PKP A;  1J5E I;  4DR1 E;  2VQF I;  4OX9 E;  4Z7C A;  4HYM A;  1ELO A;  5A2Q C;  2HK3 A;  4PRX A;  4ZVI A;  1K47 A;  4X64 I;  3Q1Q A;  4JYA I;  1XMQ E;  2X7I A;  5FLX C;  4JI2 I;  2HHH E;  1Z0W A;  1N0V C;  4HXZ A;  3GON A;  4DV5 E;  4X65 E;  5LMN I;  1Z0E A;  1FKA E;  1PVG A;  4JI3 E;  4LF9 I;  4JI1 I;  2V2Q A;  2UU9 E;  1IBL I;  4WUC A;  1KTV A;  2E1R A;  1FWL A;  1HNZ E;  4WUD A;  2LJP A;  4JI6 I;  1XNR E;  2A2C A;  4DPY A;  4DV3 E;  2UUA I;  3QT8 A;  1NHH A;  1H72 C;  3PYF A;  2UUB E;  1B62 A;  4LF8 I;  2DEJ A;  1Z0B A;  2UUC E;  3ZKD A;  4LFB I;  4DPT A;  1KIJ A;  3WU4 A;  1I94 E;  3JAM Q;  1XNQ E;  4JI0 E;  2VQE E;  4DPW A;  1MG7 A;  4JI5 E;  4B3R I;  5LMU E;  4NXN I;  1MU5 A;  5A2Q Q;  1XMO E;  3K1J A;  4B3M E;  4HAC A;  3F0N A;  4FN5 A;  3WU5 A;  3OTO E;  3B8H A;  2ZM6 E;  4DV1 I;  4LFA I;  1N34 E;  5FLX Q;  3T1H I;  4DR6 E;  3WU3 A;  4NXM I;  4USK A;  3QT7 A;  1N36 I;  3QT6 A;  4B3T E;  1HNX I;  4DV4 I;  2HFS A;  1IBK E;  1DAR A;  2VF3 A;  1Z5B A;  4M1K A;  4P7A A;  4DR5 E;  4KQV A;  2V34 A;  2V2V A;  1S16 A;  4JI8 E;  4LF7 I;  4DV7 E;  2UXC I;  4LF5 E;  1NZ0 A;  3H4L A;  4R1F A;  4X62 E;  4JI7 I;  4HY1 A;  1XMQ I;  4I3H A;  4EMD A;  3ZZT A;  3ZZU A;  2WW4 A;  4DV5 I;  4X65 I;  4KHP I;  4YHH I;  4LFC E;  4X66 I;  1ZM2 A;  1Z5A A;  4LF6 E;  4JI3 I;  4GKK I;  3J7A M;  4JV5 I;  2UU9 I;  4FW9 A;  1N33 E;  4HAC B;  3PYG A;  1HNZ I;  3J81 Q;  4GKJ I;  3LNU A;  4DUZ E;  4FWD A;  1N32 E;  4DV6 E;  2R3V A;  5IT9 C;  1FNM A;  2UUB I;  2HKE A;  2UUC I;  1Z0C A;  2V2Z A;  4DV2 E;  2HFU A;  5BR8 E;  4YY3 I;  4UTG A;  2R42 A;  3ZKB A;  1FJG E;  4X64 E;  4AQY I;  3HUL A;  1I94 I; 
#chains in the Genus database with same CATH topology
 4JYA E;  4JI4 E;  4OO1 B;  5K36 A;  3M6A A;  2NN6 F;  4JI2 E;  1Z0T A;  2E5L I;  2VES A;  5DRQ A;  1UDS A;  2NN6 C;  4DV0 I;  4BA1 B;  1R6L A;  3P3C A;  4LF9 E;  1XMO I;  4JI1 E;  3LPS A;  4B3M I;  4DU8 A;  1WUU A;  3OTO I;  4K0K E;  2DEI A;  2F4V E;  2O3Z A;  4QNJ A;  2EFG A;  5DRO A;  4DR4 E;  4OO1 F;  3PRY A;  1N34 I;  4WUB A;  2HKJ A;  1UEK A;  4MYT A;  3CDI A;  4FW5 A;  2UUA E;  5IWA E;  2BV3 A;  3PS1 A;  4DR6 I;  5LL6 R;  4LOM A;  4GQU A;  3WU6 A;  1IBM E;  3B82 A;  1RHY A;  4DPX A;  4DR7 E;  5DRR A;  4LF8 E;  4FWG A;  3J80 C;  3V5R A;  3H1C A;  2PO1 B;  2IOP A;  1H74 A;  1ZM3 A;  2NN6 A;  4IFD D;  4DR5 I;  4DR3 E;  3T1Y E;  4IFD F;  2BA0 D;  3GLL A;  1HNW I;  1HR0 E;  1E3H A;  4DR2 E;  4PRV A;  4LF4 I;  4IFD C;  2GO4 A;  5IT9 Q;  5JEA E;  4X62 I;  2BM0 A;  3KRN A;  3L7Z B;  2UXB E;  3QT5 A;  3J7A G;  4NXN E;  4DR1 I;  1D6T A;  4OX9 I;  1XHK A;  5K36 B;  4URL A;  1S4E A;  4DUY E;  2NPF A;  4LFC I;  4B3S E;  1H7S A;  2X36 A;  4IS9 A;  3T1H E;  2UXD E;  1A6F A;  3P76 A;  2XEX A;  4N3O A;  1BKN A;  2HHH I;  4IFD A;  4MU1 A;  1HNX E;  4MDT A;  1USU A;  4DV4 E;  3JAM C;  5C0X E;  1NHI A;  4DUZ I;  2O1U A;  2Z5E A;  3PYE A;  4ED4 A;  1Z0G A;  2ZIT A;  5K36 F;  1N32 I;  4DV6 I;  1KVK A;  2V8P A;  2BA0 G;  2Q2E B;  3ZM7 A;  2UXC E;  3PS2 A;  5GMD A;  2AE8 A;  5JEA D;  1XNR I;  2O1T A;  3CWV A;  4DV2 I;  4DV3 I;  5BR8 I;  2NN6 B;  3UHM A;  4DXL A;  1RR9 A;  1FJG I;  4MU3 A;  5JEA F;  1ZXN A;  4JI7 E;  3J80 Q;  1Z59 A;  5GME A;  1J5E E;  2C37 A;  3NZK A;  2VQF E;  1Y6Z A;  4JI4 I;  2BR2 A;  4Z7Y A;  2PO2 A;  4FW6 A;  5JEA C;  2JEA A;  4KHP E;  1Z5C A;  4YHH E;  4X66 E;  1Z0V A;  4U3B A;  4GKK E;  1XNQ I;  4JV5 E;  4JI0 I;  1Y60 A;  1ZM4 A;  3GME A;  2VQE I;  1P42 A;  2BM1 A;  5C0X D;  4K0K I;  2F4V I;  4JI5 I;  2HK2 A;  1HK7 A;  4OKG A;  4GKJ E;  5LMN E;  4DR4 I;  1NHJ A;  4FWH A;  5LMU I;  5IWA I;  4QNK A;  3V2U C;  3Q6M A;  1IBL E;  1IBM I;  5JEA A;  5C0X C;  2PO0 A;  4DR7 I;  1USV A;  2C39 A;  4IFD B;  4USM A;  4MQY A;  2ZM6 I;  2ZBK B;  4JI6 E;  4P52 A;  1U2R A;  2A2D A;  2CG9 A;  2GQ0 A;  2JEB A;  4DR3 I;  4YY3 E;  3K85 A;  1UDN A;  3M7N D;  3T1Y I;  3M85 D;  4AQY E;  2WP8 A;  4B3T I;  1OJ4 A;  2PNZ A;  2GS8 A;  1IBK I;  2PNM A;  4LFB E;  4NBQ A;  1HR0 I;  4DR2 I;  1KKH A;  4JG4 A;  3PYD A;  2E5L E;  2CZ9 A;  1EA6 A;  4PU9 A;  1Y4U A;  1EI1 A;  1VIS A;  2Z5B A;  4JI8 I;  2UXB I;  3D4J A;  3J81 C;  4LCF A;  2WNR A;  4UT4 A;  4DV0 E;  4DPU A;  4DV7 I;  1RRE A;  5C0X A;  4LF5 I;  2C37 B;  1ZM9 A;  2BR2 B;  2PO2 B;  2JE6 A;  2AJ4 A;  1ZXM A;  4RPF A;  1MX0 A;  2JEA B;  4DUY I;  4B3R E;  4B3S I;  4MYU A;  4MU4 A;  2J7K A;  2UXD I;  4LPF A;  1H7U A;  1N0U A;  1H73 A;  5ELW A;  4DV1 E;  3ZZ0 A;  4LFA E;  1B63 A;  3M7N G;  4DU7 A;  4LF6 I;  3LTO A;  3B78 A;  1OYS A;  3K17 A;  4NXM E;  1N36 E;  5L3J A;  1N33 I;  5JEA B;  1PIE A;  2PO0 B;  1Y4S A;  4U3D A;  1HNW E;  2C39 B;  1QZR A;  2OI2 A;  5EKW A;  4LF4 E;  1FI4 A;  2F1D A;  2JEB B;  4XTJ A;  1FWK A;  4LF7 E;  1PKP A;  3U1Y A;  1J5E I;  4DR1 E;  2VQF I;  5DNX A;  2WP8 B;  4OX9 E;  4Z7C A;  4HYM A;  1ELO A;  5A2Q C;  2Z5C A;  2PNZ B;  2HK3 A;  4PRX A;  4ZVI A;  1K47 A;  4X64 I;  1YH8 A;  3Q1Q A;  2Z5B B;  4JYA I;  3U1K A;  2WNR B;  1XMQ E;  2X7I A;  5C0X B;  5FLX C;  4JI2 I;  2HHH E;  5FWK A;  1Z0W A;  1N0V C;  2IER A;  2JE6 B;  3GON A;  4HXZ A;  4IZJ D;  4DV5 E;  2BA1 D;  4OO1 E;  4X65 E;  5LMN I;  3CDJ A;  1Z0E A;  1FKA E;  2CVE A;  1PVG A;  4JI3 E;  4LF9 I;  4JI1 I;  1UDO A;  2IES A;  2V2Q A;  1XXE A;  2UU9 E;  1IBL I;  4WUC A;  1KTV A;  2E1R A;  4AID A;  2J65 A;  2PNL A;  1FWL A;  1HNZ E;  4AM3 A;  4WUD A;  2LJP A;  4JI6 I;  1XNR E;  5C0X F;  2A2C A;  2GO3 A;  4DPY A;  4DV3 E;  2UUA I;  3QT8 A;  1NHH A;  1H72 C;  4J3D A;  4MU0 A;  1OYR A;  1VI7 A;  3PYF A;  4FW3 A;  3HKM A;  2UUB E;  1B62 A;  4LF8 I;  2DEJ A;  1Z0B A;  3P3G A;  2UUC E;  3ZKD A;  5EL9 A;  4LFB I;  4DPT A;  1KIJ A;  2C38 A;  3WU4 A;  1I94 E;  3JAM Q;  1XNQ E;  4IZJ A;  4JI0 E;  4LCH A;  4OO1 D;  2VQE E;  2BA1 G;  4DPW A;  1MG7 A;  2Z5C B;  4IZK A;  4BA2 A;  4JI5 E;  3B4T A;  4B3R I;  2O1W A;  4FW4 A;  5LMU E;  4NXN I;  1MU5 A;  5A2Q Q;  1XMO E;  2JT2 A;  1YHC A;  3K1J A;  4B3M E;  4HAC A;  3F0N A;  4OO1 C;  4FN5 A;  3HJC A;  3WU5 A;  3OTO E;  3B8H A;  2ZM6 E;  4DV1 I;  4LFA I;  4OZE A;  1N34 E;  5K36 E;  5FLX Q;  3T1H I;  4DR6 E;  3WU3 A;  4NXM I;  4USK A;  3QT7 A;  1N36 I;  3QT6 A;  4B3T E;  1HNX I;  4AIM A;  4DV4 I;  2HFS A;  1IBK E;  1DAR A;  2VF3 A;  1Z5B A;  4M1K A;  3P3E A;  4P7A A;  3M85 G;  4DR5 E;  4KQV A;  2V34 A;  2V2V A;  4ISA A;  1R6M A;  1E3P A;  1S16 A;  4JI8 E;  4LF7 I;  4OO1 A;  4DV7 E;  3P06 A;  4LF5 E;  2UXC I;  1NZ0 A;  3H4L A;  4R1F A;  1UDQ A;  2C38 B;  4X62 E;  4BA1 A;  4JI7 I;  3Q6N A;  4HY1 A;  1XMQ I;  2NN6 E;  4IZJ B;  4I3H A;  4EMD A;  3ZZT A;  3ZZU A;  2WW4 A;  4DV5 I;  5K36 D;  4X65 I;  4IZK B;  4BA2 B;  4KHP I;  4YHH I;  4LFC E;  4X66 I;  1ZM2 A;  2IOQ A;  2O1V A;  2CGE A;  1Z5A A;  4LF6 E;  4JI3 I;  3DD6 A;  4GKK I;  3J7A M;  4JV5 I;  2UU9 I;  4FW9 A;  1N33 E;  4HAC B;  2PO1 A;  3PYG A;  1HNZ I;  3J81 Q;  5K36 C;  4GKJ I;  3LNU A;  4LCG A;  4DUZ E;  4FWD A;  5DRP A;  4FW7 A;  1Y5Y A;  1N32 E;  4DV6 E;  3GCM A;  2R3V A;  5IT9 C;  1FNM A;  2UUB I;  2HKE A;  2UUC I;  3PS3 A;  1Z0C A;  5DNL A;  2V2Z A;  4DV2 E;  2HFU A;  5BR8 E;  4YY3 I;  4UTG A;  2R42 A;  3L7Z A;  3ZKB A;  1FJG E;  4IFD E;  1OYP A;  4X64 E;  4AQY I;  3HUL A;  2NN6 D;  1I94 I; 
#chains in the Genus database with same CATH homology
 4JYA E;  4JI4 E;  3M6A A;  4JI2 E;  1Z0T A;  2E5L I;  4DV0 I;  4LF9 E;  1XMO I;  4JI1 E;  3LPS A;  4B3M I;  4DU8 A;  1WUU A;  3OTO I;  4K0K E;  2DEI A;  2F4V E;  2EFG A;  4DR4 E;  3PRY A;  1N34 I;  4WUB A;  2HKJ A;  1UEK A;  4MYT A;  2UUA E;  5IWA E;  2BV3 A;  4DR6 I;  5LL6 R;  3WU6 A;  1IBM E;  3B82 A;  4DPX A;  4DR7 E;  4LF8 E;  4FWG A;  3J80 C;  3V5R A;  2IOP A;  1H74 A;  1ZM3 A;  4DR5 I;  4DR3 E;  3T1Y E;  1HNW I;  1HR0 E;  4DR2 E;  4PRV A;  4LF4 I;  5IT9 Q;  4X62 I;  2BM0 A;  2UXB E;  3QT5 A;  3J7A G;  4NXN E;  4DR1 I;  1D6T A;  4OX9 I;  1XHK A;  4URL A;  1S4E A;  4DUY E;  2NPF A;  4LFC I;  4B3S E;  1H7S A;  2X36 A;  3T1H E;  2UXD E;  1A6F A;  2XEX A;  4N3O A;  1BKN A;  2HHH I;  1HNX E;  1USU A;  4DV4 E;  3JAM C;  1NHI A;  4DUZ I;  2O1U A;  2Z5E A;  3PYE A;  4ED4 A;  1Z0G A;  2ZIT A;  1N32 I;  4DV6 I;  1KVK A;  2V8P A;  2Q2E B;  3ZM7 A;  2UXC E;  5GMD A;  1XNR I;  2O1T A;  3CWV A;  4DV2 I;  4DV3 I;  5BR8 I;  4DXL A;  1RR9 A;  1FJG I;  1ZXN A;  4JI7 E;  3J80 Q;  1Z59 A;  5GME A;  1J5E E;  2VQF E;  1Y6Z A;  4JI4 I;  4Z7Y A;  4KHP E;  1Z5C A;  4YHH E;  4X66 E;  1Z0V A;  4GKK E;  1XNQ I;  4JV5 E;  4JI0 I;  1ZM4 A;  2VQE I;  2BM1 A;  4K0K I;  2F4V I;  4JI5 I;  2HK2 A;  1HK7 A;  4GKJ E;  5LMN E;  4DR4 I;  1NHJ A;  4FWH A;  5LMU I;  5IWA I;  3V2U C;  3Q6M A;  1IBL E;  1IBM I;  4DR7 I;  1USV A;  4USM A;  2ZM6 I;  4JI6 E;  2ZBK B;  4P52 A;  1U2R A;  2A2D A;  2CG9 A;  2GQ0 A;  4DR3 I;  4YY3 E;  3K85 A;  3T1Y I;  4AQY E;  4B3T I;  1OJ4 A;  2GS8 A;  1IBK I;  2PNM A;  4LFB E;  1HR0 I;  4DR2 I;  1KKH A;  4JG4 A;  3PYD A;  2E5L E;  2CZ9 A;  1EA6 A;  1Y4U A;  4PU9 A;  1VIS A;  1EI1 A;  2Z5B A;  4JI8 I;  2UXB I;  3J81 C;  3D4J A;  4DV0 E;  4UT4 A;  4DPU A;  4DV7 I;  1RRE A;  4LF5 I;  1ZM9 A;  2AJ4 A;  1ZXM A;  4RPF A;  1MX0 A;  4DUY I;  4B3R E;  4B3S I;  4MYU A;  2J7K A;  2UXD I;  1H7U A;  1N0U A;  1H73 A;  4DV1 E;  3ZZ0 A;  4LFA E;  1B63 A;  4DU7 A;  4LF6 I;  3LTO A;  3B78 A;  3K17 A;  4NXM E;  1N36 E;  5L3J A;  1N33 I;  1PIE A;  1Y4S A;  1HNW E;  1QZR A;  2OI2 A;  4LF4 E;  1FI4 A;  4XTJ A;  1FWK A;  4LF7 E;  1PKP A;  1J5E I;  4DR1 E;  2VQF I;  4OX9 E;  4Z7C A;  4HYM A;  1ELO A;  5A2Q C;  2Z5C A;  2HK3 A;  4PRX A;  4ZVI A;  1K47 A;  4X64 I;  3Q1Q A;  2Z5B B;  4JYA I;  1XMQ E;  2X7I A;  5FLX C;  4JI2 I;  2HHH E;  5FWK A;  1Z0W A;  1N0V C;  4HXZ A;  3GON A;  4DV5 E;  4IZJ D;  4X65 E;  5LMN I;  1Z0E A;  1FKA E;  1PVG A;  4JI3 E;  4LF9 I;  4JI1 I;  2V2Q A;  2UU9 E;  1IBL I;  4WUC A;  1KTV A;  2E1R A;  2PNL A;  1FWL A;  1HNZ E;  4WUD A;  2LJP A;  4JI6 I;  1XNR E;  2A2C A;  4DPY A;  4DV3 E;  2UUA I;  3QT8 A;  1NHH A;  1H72 C;  3PYF A;  2UUB E;  1B62 A;  4LF8 I;  2DEJ A;  1Z0B A;  2UUC E;  3ZKD A;  4LFB I;  4DPT A;  1KIJ A;  3WU4 A;  1I94 E;  3JAM Q;  1XNQ E;  4IZJ A;  4JI0 E;  2VQE E;  4DPW A;  1MG7 A;  2Z5C B;  4IZK A;  4JI5 E;  4B3R I;  2O1W A;  5LMU E;  4NXN I;  1MU5 A;  5A2Q Q;  1XMO E;  3K1J A;  4B3M E;  4HAC A;  3F0N A;  4FN5 A;  3HJC A;  3WU5 A;  3OTO E;  3B8H A;  2ZM6 E;  4DV1 I;  4LFA I;  1N34 E;  5FLX Q;  3T1H I;  4DR6 E;  3WU3 A;  4NXM I;  4USK A;  3QT7 A;  1N36 I;  3QT6 A;  4B3T E;  1HNX I;  4DV4 I;  2HFS A;  1IBK E;  1DAR A;  2VF3 A;  1Z5B A;  4M1K A;  4P7A A;  4DR5 E;  4KQV A;  2V34 A;  2V2V A;  1S16 A;  4JI8 E;  4LF7 I;  4DV7 E;  3P06 A;  4LF5 E;  2UXC I;  1NZ0 A;  3H4L A;  4R1F A;  4X62 E;  4JI7 I;  3Q6N A;  4HY1 A;  1XMQ I;  4IZJ B;  4I3H A;  4EMD A;  3ZZT A;  3ZZU A;  2WW4 A;  4DV5 I;  4X65 I;  4IZK B;  4KHP I;  4YHH I;  4LFC E;  4X66 I;  1ZM2 A;  2IOQ A;  2O1V A;  2CGE A;  1Z5A A;  4LF6 E;  4JI3 I;  4GKK I;  3J7A M;  4JV5 I;  2UU9 I;  4FW9 A;  1N33 E;  4HAC B;  3PYG A;  1HNZ I;  3J81 Q;  4GKJ I;  3LNU A;  4DUZ E;  4FWD A;  1N32 E;  4DV6 E;  2R3V A;  5IT9 C;  1FNM A;  2UUB I;  2HKE A;  2UUC I;  1Z0C A;  2V2Z A;  4DV2 E;  2HFU A;  5BR8 E;  4YY3 I;  4UTG A;  2R42 A;  3ZKB A;  1FJG E;  4X64 E;  4AQY I;  3HUL A;  1I94 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...