4DR7I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7I00
4DV6E 1ZM2A 1S16A 4DV3I 4LFBE 4JI3I 4DPYA 4JI1I 5FLXC 1B63A 2X7IA 2HKJA 5A2QQ 4KHPE 1Z5BA 2A2CA 1A6FA 1Z0EA 1H7UA 1Z0WA 4LF6E 4JI8E 4UTGA 3WU5A 4DPWA 5LMUE 1QZRA 1HR0I 4DR6E 4B3TI 1N32I 2DEJA 1XMQE 4DV5I 1Z0CA 2ZM6I 5LMNE 4PU9A 4FWGA 3PYGA 4JI0E 4JV5E 4DU8A 4USMA 5GMDA 2UUCI 4JYAE 1ZM3A 4DUZE 1FWLA 4DV4E 4DR4E 4LF9I 1Z5CA 4MYUA 4GKKI 1EI1A 3WU6A 1OJ4A 1PKPA 4NXNE 2UU9I 4LFCI 3JAMC 2UXCE 2UUAE 2F4VE 1XNQE 4DV6I 1PIEA 1J5EE 2R3VA 2X36A 1HNXI 1K47A 5IWAE 4X62E 1N34E 1IBLE 4YY3E 4DV0E 1D6TA 4P7AA 3QT8A 4JI4E 1ZXNA 2R42A 2E5LE 4LF6I 4GKJE 4LF7I 4DV2E 3B82A 2E1RA 4JI8I 2NPFA 3J80Q 4HY1A 1HNWE 4DPTA 1XHKA 1XMQI 2HFUA 1XNRE 2J7KA 1IBMI 4LF4E 2ZITA 1WUUA 1BKNA 4DR3E 3T1YE 4JI0I 2EFGA 4JV5I 4R1FA 1I94E 5GMEA 4Z7CA 3ZM7A 4HYMA 4DUZI 4FW9A 4DXLA 2HFSA 4LFAE 4B3SE 4DR4I 2BV3A 4NXME 3J81C 3V5RA 4AQYI 3K1JA 4LF8E 4NXNI 3LNUA 2F4VI 1XNQI 4DR1I 3ZKDA 5A2QC 4HACB 2VQEE 4DV7E 1N0UA 4FWDA 1Z0VA 4DV1E 1J5EI 3V2UC 4JI5E 2UXBE 4B3RE 5FLXQ 1FNMA 1HNZE 5IWAI 3QT6A 3PYFA 4X62I 4EMDA 2HHHE 1N34I 1IBLI 4YY3I 4DV0I 2XEXA 4K0KE 3B8HA 2WW4A 4DUYE 1ZM9A 1H7SA 4GKJI 1ELOA 4DV2I 4DR2I 2V2QA 1H74A 4X66E 3WU3A 2Q2EB 4KQVA 4JI6E 4P52A 1XNRI 3J7AG 1KIJA 3Q1QA 4LF4I 4X65E 2HKEA 4DR7E 1FI4A 4DR3I 3F0NA 5BR8E 2UUBE 1N33E 4JI2E 4OX9I 3T1HI 1FJGI 3OTOE 1H73A 4LFAI 4B3SI 1IBKE 2VQFE 4LFBI 3QT5A 1MX0A 1Z0BA 4RPFA 2GS8A 1FWKA 4DV3E 4LF8I 4KHPI 1XMOE 3JAMQ 4HXZA 1RREA 4DV7I 5IT9C 4DV1I 2UXBI 4B3RI 5LMUI 2AJ4A 3PYDA 2HHHI 4DR6I 4WUCA 2V34A 4K0KI 1HR0E 1Z5AA 4B3TE 1N32E 4DPXA 4DU7A 5LMNI 4M1KA 4FN5A 4DV5E 1PVGA 4X66I 4X64E 1NHHA 4JYAI 1U2RA 1EA6A 4PRVA 4DV4I 4DR7I 2ZBKB 2UUCE 5BR8I 4LF5E 1RR9A 2UUBI 1Z0GA 1N33I 3HULA 2DEIA 3ZKBA 4JI2I 4USKA 1VISA 4GKKE 4WUBA 2UXCI 2UUAI 2V2VA 3OTOI 4Z7YA 1IBKI 4YHHE 2VQFI 2UU9E 4LFCE 2HK3A 4DR5E 3QT7A 3PYEA 1B62A 5LL6R 1MG7A 1XMOI 1HNXE 4UT4A 1KTVA 1NHIA 4WUDA 4JI4I 2E5LI 4B3ME 5L3JA 2UXDE 4XTJA 1NHJA 4JG4A 3WU4A 1HNWI 4LF7E 4JI7E 4ED4A 3LPSA 1H72C 1Z59A 4I3HA 4X64I 1UEKA 3H4LA 1IBME 2OI2A 3T1YI 2HK2A 4FWHA 4ZVIA 3B78A 2CZ9A 3GONA 1I94I 3K17A 1N36E 1N0VC 4PRXA 4DPUA 3J7AM 2VF3A 4NXMI 4LF5I 1FJGE 3ZZTA 4JI3E 2BM1A 4JI1E 4AQYE 1KKHA 4YHHI 4HACA 2VQEI 3D4JA 4DR5I 4DR1E 4JI5I 1HNZI 3J80C 5IT9Q 2LJPA 4DUYI 1MU5A 4B3MI 2UXDI 1Z0TA 4URLA 2ZM6E 4DR2E 4JI7I 2V8PA 4JI6I 3LTOA 4X65I 3CWVA 3ZZ0A 1S4EA 2A2DA 3ZZUA 1ZXMA 2V2ZA 1NZ0A 4LF9E 1N36I 1ZM4A 1KVKA 4MYTA 1FKAE 4OX9E 3T1HE 3M6AA 1DARA 3J81Q 2BM0A
chains in the Genus database with same CATH superfamily
4DV6E 1ZM2A 1S16A 4DV3I 4LFBE 4JI3I 4DPYA 4JI1I 5FLXC 1B63A 2X7IA 2HKJA 5A2QQ 4BA1B 4KHPE 1Z5BA 2A2CA 2Z5BB 5JEAE 2WNRA 1A6FA 1Z0EA 1H7UA 1Z0WA 1P42A 4LF6E 2C38A 2PO2B 2NN6A 4JI8E 4UTGA 3WU5A 4DPWA 3KRNA 5LMUE 1QZRA 1HR0I 4DR6E 4B3TI 5K36E 1N32I 3GLLA 3PS2A 2DEJA 1XMQE 4DV5I 1Z0CA 2ZM6I 5LMNE 4OKGA 4PU9A 4FWGA 4IZJA 4BA2A 3P3GA 3PYGA 4JI0E 4JV5E 1UDOA 2PNZA 1OYSA 4DU8A 5DRPA 4FW3A 4USMA 5GMDA 2NN6D 2UUCI 4JYAE 1ZM3A 4DUZE 1FWLA 4DV4E 2JEAB 4DR4E 1OYPA 2GO3A 4LF9I 1Z5CA 4MYUA 4FW5A 4GKKI 1E3HA 3PRYA 2BA0D 3DD6A 5C0XE 1EI1A 3WU6A 4MU1A 1OJ4A 1PKPA 4NXNE 2UU9I 4U3BA 4LFCI 3JAMC 4IZJD 2UXCE 2UUAE 2F4VE 1XNQE 2CG9A 4DV6I 3U1YA 1UDNA 4OO1E 1PIEA 1J5EE 2R3VA 2X36A 1HNXI 1K47A 3CDJA 5IWAE 2CGEA 4X62E 1N34E 1IBLE 2Z5BA 4YY3E 4DV0E 1D6TA 4P7AA 5C0XC 3QT8A 4JI4E 1ZXNA 2R42A 4LCGA 2E5LE 4LF6I 4GKJE 2O1UA 2PO2A 4DV2E 4LF7I 3B82A 2E1RA 4JI8I 2NPFA 3J80Q 4HY1A 1HNWE 2NN6F 2IESA 3K85A 1XXEA 4DPTA 1Y6ZA 3P06A 1XHKA 1XMQI 3P3CA 2HFUA 1XNRE 2J7KA 1IBMI 4LF4E 2ZITA 5FWKA 1WUUA 1BKNA 4U3DA 4DR3E 3T1YE 4JI0I 4LCHA 3B4TA 2EFGA 4JV5I 5K36A 4R1FA 1I94E 3Q6NA 2BA0G 5GMEA 4Z7CA 3P76A 4IZKB 3ZM7A 4HYMA 4DUZI 4FW9A 4DXLA 2HFSA 4LFAE 3U1KA 4B3SE 4DR4I 2BR2B 2BV3A 4NXME 5JEAD 4OZEA 1VI7A 3J81C 2C39B 4N3OA 3V5RA 4AQYI 3K1JA 4LF8E 2GQ0A 4NXNI 3GMEA 3LNUA 2F4VI 4J3DA 4DR1I 1XNQI 3ZKDA 5A2QC 5K36D 4HACB 2VQEE 4DV7E 1N0UA 4FWDA 2PNMA 1Z0VA 4DV1E 3HKMA 3V2UC 1J5EI 4JI5E 4B3RE 2UXBE 5FLXQ 1FNMA 1HNZE 5IWAI 3QT6A 5C0XA 1YHCA 3PYFA 4X62I 4EMDA 2HHHE 1OYRA 2GO4A 1N34I 1IBLI 4YY3I 4DV0I 2JE6B 2XEXA 4K0KE 3B8HA 2WW4A 4DUYE 4OO1A 4IS9A 1ZM9A 1H7SA 4GKJI 1ELOA 4DV2I 4DR2I 2V2QA 1H74A 1R6MA 4X66E 4LPFA 5DNLA 3WU3A 2Q2EB 1Y5YA 4KQVA 4JI6E 4AIDA 2J65A 5DRRA 3P3EA 5JEAF 4P52A 2IERA 1XNRI 3J7AG 1KIJA 5C0XD 3Q1QA 4LF4I 1UDQA 4X65E 2HKEA 4DR7E 1FI4A 2Z5CB 2PO1B 4DR3I 5EKWA 3F0NA 5BR8E 3UHMA 2UUBE 2BA1D 4OO1D 5K36F 1N33E 1USVA 2WP8A 4JI2E 4OX9I 3T1HI 1FJGI 3OTOE 1H73A 4LFAI 4B3SI 1IBKE 2BR2A 2VQFE 3NZKA 4LFBI 3QT5A 1HK7A 1MX0A 1Z0BA 2C39A 4RPFA 2GS8A 1FWKA 4DV3E 4LF8I 4KHPI 4BA1A 1XMOE 3JAMQ 3H1CA 4MQYA 4HXZA 4IFDE 1RREA 4DV7I 5IT9C 4DV1I 2UXBI 4B3RI 5LMUI 2AJ4A 2C38B 3PYDA 2HHHI 4DR6I 2NN6B 4WUCA 5C0XF 2V34A 4IFDB 2C37B 4GQUA 1HR0E 4K0KI 1Z5AA 5DROA 4B3TE 4FW6A 1N32E 4DPXA 4DU7A 5LMNI 4M1KA 2JEBB 4IFDC 4FN5A 3PS1A 3GCMA 4OO1F 4DV5E 1PVGA 4X66I 4X64E 2AE8A 3Q6MA 4BA2B 5DRQA 1NHHA 2BA1G 2PO0B 2PNZB 4JYAI 1U2RA 1EA6A 4PRVA 4DV4I 1Y4SA 4DR7I 2JEAA 2ZBKB 2PO1A 2UUCE 5BR8I 2Z5EA 4LF5E 1RR9A 2UUBI 1Z0GA 1N33I 3HULA 2DEIA 3ZKBA 4JI2I 4USKA 1VISA 4GKKE 3CDIA 4WUBA 4FW4A 2UXCI 2V2VA 2UUAI 3OTOI 4Z7YA 1IBKI 4YHHE 2VQFI 2UU9E 4LFCE 2HK3A 4DR5E 3QT7A 3PYEA 4LCFA 4FW7A 1E3PA 1B62A 5LL6R 1MG7A 5EL9A 1XMOI 1HNXE 4UT4A 2O1TA 1KTVA 1NHIA 1UDSA 4WUDA 4JI4I 4ISAA 2E5LI 4B3ME 5L3JA 2UXDE 4XTJA 1NHJA 4JG4A 3WU4A 3M7ND 1HNWI 4MU0A 4LF7E 4JI7E 2O3ZA 2PNLA 4IFDA 2C37A 4ED4A 5JEAB 4MU3A 3LPSA 1YH8A 1H72C 1Z59A 3L7ZB 2JEBA 4I3HA 4X64I 1UEKA 3H4LA 5JEAC 2OI2A 3T1YI 1IBME 2HK2A 4FWHA 4ZVIA 3B78A 2CZ9A 3GONA 1I94I 3K17A 2O1WA 5K36B 1N36E 2PO0A 1N0VC 4IZKA 4PRXA 4DPUA 3J7AM 2VF3A 4NXMI 4MDTA 5K36C 4LF5I 4IFDD 2VESA 1FJGE 1Y4UA 3ZZTA 2IOPA 2CVEA 4JI3E 2NN6E 2BM1A 4JI1E 4AQYE 3M85D 4QNJA 1KKHA 4YHHI 4HACA 2VQEI 2WNRB 3D4JA 4DR5I 4DR1E 4JI5I 1HNZI 5C0XB 1USUA 2JE6A 3M7NG 3J80C 3HJCA 5ELWA 4AM3A 5IT9Q 2LJPA 4DUYI 1MU5A 2NN6C 4B3MI 2UXDI 1Z0TA 4OO1B 4URLA 2ZM6E 4DR2E 4JI7I 2V8PA 4IZJB 4JI6I 4MU4A 4LOMA 4OO1C 5DNXA 3LTOA 5JEAA 4IFDF 1RHYA 4X65I 3L7ZA 3CWVA 3ZZ0A 2Z5CA 1S4EA 1R6LA 1Y60A 2A2DA 3ZZUA 1ZXMA 2V2ZA 1NZ0A 4AIMA 2IOQA 4LF9E 1N36I 1ZM4A 1KVKA 4MYTA 2F1DA 1FKAE 2WP8B 2JT2A 4QNKA 4OX9E 3T1HE 3M85G 3M6AA 1DARA 2O1VA 3J81Q 4NBQA 2BM0A 3PS3A
chains in the Genus database with same CATH topology
4DV6E 1ZM2A 1S16A 4DV3I 4LFBE 4JI3I 4DPYA 4JI1I 5FLXC 1B63A 2X7IA 2HKJA 5A2QQ 4KHPE 1Z5BA 2A2CA 2Z5BB 1A6FA 1Z0EA 1H7UA 1Z0WA 4LF6E 4JI8E 4UTGA 3WU5A 4DPWA 5LMUE 1QZRA 1HR0I 4DR6E 4B3TI 1N32I 2DEJA 1XMQE 4DV5I 1Z0CA 2ZM6I 5LMNE 4PU9A 4FWGA 4IZJA 3PYGA 4JI0E 4JV5E 4DU8A 4USMA 5GMDA 2UUCI 4JYAE 1ZM3A 4DUZE 1FWLA 4DV4E 4DR4E 4LF9I 1Z5CA 4MYUA 4GKKI 3PRYA 1EI1A 3WU6A 1OJ4A 1PKPA 4NXNE 2UU9I 4LFCI 3JAMC 4IZJD 2UXCE 2UUAE 2F4VE 1XNQE 2CG9A 4DV6I 1PIEA 1J5EE 2R3VA 2X36A 1HNXI 1K47A 5IWAE 2CGEA 4X62E 1N34E 1IBLE 2Z5BA 4YY3E 4DV0E 1D6TA 4P7AA 3QT8A 4JI4E 1ZXNA 2R42A 2E5LE 4LF6I 4GKJE 2O1UA 4LF7I 4DV2E 3B82A 2E1RA 4JI8I 2NPFA 3J80Q 4HY1A 1HNWE 3K85A 4DPTA 1Y6ZA 3P06A 1XHKA 1XMQI 2HFUA 1XNRE 2J7KA 1IBMI 4LF4E 2ZITA 5FWKA 1WUUA 1BKNA 4DR3E 3T1YE 4JI0I 2EFGA 4JV5I 4R1FA 1I94E 3Q6NA 5GMEA 4Z7CA 4IZKB 3ZM7A 4HYMA 4DUZI 4FW9A 4DXLA 2HFSA 4LFAE 4B3SE 4DR4I 2BV3A 4NXME 3J81C 4N3OA 3V5RA 4AQYI 3K1JA 4LF8E 2GQ0A 4NXNI 3LNUA 2F4VI 1XNQI 4DR1I 3ZKDA 5A2QC 4HACB 2VQEE 4DV7E 1N0UA 4FWDA 2PNMA 1Z0VA 4DV1E 1J5EI 3V2UC 4JI5E 2UXBE 4B3RE 5FLXQ 1FNMA 1HNZE 5IWAI 3QT6A 3PYFA 4X62I 4EMDA 2HHHE 1N34I 1IBLI 4YY3I 4DV0I 2XEXA 4K0KE 3B8HA 2WW4A 4DUYE 1ZM9A 1H7SA 4GKJI 1ELOA 4DV2I 4DR2I 2V2QA 1H74A 4X66E 3WU3A 2Q2EB 4KQVA 4JI6E 4P52A 1XNRI 3J7AG 1KIJA 3Q1QA 4LF4I 4X65E 2HKEA 4DR7E 1FI4A 2Z5CB 4DR3I 3F0NA 5BR8E 2UUBE 1N33E 1USVA 4JI2E 4OX9I 3T1HI 1FJGI 3OTOE 1H73A 4LFAI 4B3SI 1IBKE 2VQFE 4LFBI 3QT5A 1HK7A 1MX0A 1Z0BA 4RPFA 2GS8A 1FWKA 4DV3E 4LF8I 4KHPI 1XMOE 3JAMQ 4HXZA 1RREA 4DV7I 5IT9C 4DV1I 2UXBI 4B3RI 5LMUI 2AJ4A 3PYDA 2HHHI 4DR6I 4WUCA 2V34A 4K0KI 1HR0E 1Z5AA 4B3TE 1N32E 4DPXA 4DU7A 5LMNI 4M1KA 4FN5A 4DV5E 1PVGA 4X66I 4X64E 3Q6MA 1NHHA 4JYAI 1U2RA 1EA6A 4PRVA 4DV4I 1Y4SA 4DR7I 2ZBKB 2UUCE 5BR8I 2Z5EA 4LF5E 1RR9A 2UUBI 1Z0GA 1N33I 3HULA 2DEIA 3ZKBA 4JI2I 4USKA 1VISA 4GKKE 4WUBA 2UXCI 2V2VA 2UUAI 3OTOI 4Z7YA 1IBKI 4YHHE 2VQFI 2UU9E 4LFCE 2HK3A 4DR5E 3QT7A 3PYEA 1B62A 5LL6R 1MG7A 1XMOI 1HNXE 4UT4A 2O1TA 1KTVA 1NHIA 4WUDA 4JI4I 2E5LI 4B3ME 5L3JA 2UXDE 4XTJA 1NHJA 4JG4A 3WU4A 1HNWI 4LF7E 4JI7E 2PNLA 4ED4A 3LPSA 1H72C 1Z59A 4I3HA 4X64I 1UEKA 3H4LA 1IBME 2OI2A 3T1YI 2HK2A 4FWHA 4ZVIA 3B78A 2CZ9A 3GONA 1I94I 3K17A 2O1WA 1N36E 1N0VC 4IZKA 4PRXA 4DPUA 3J7AM 2VF3A 4NXMI 4LF5I 1FJGE 1Y4UA 3ZZTA 2IOPA 4JI3E 2BM1A 4JI1E 4AQYE 1KKHA 4YHHI 4HACA 2VQEI 3D4JA 4DR5I 4DR1E 4JI5I 1HNZI 1USUA 3J80C 3HJCA 5IT9Q 2LJPA 4DUYI 1MU5A 4B3MI 2UXDI 1Z0TA 4URLA 2ZM6E 4DR2E 4JI7I 2V8PA 4IZJB 4JI6I 3LTOA 4X65I 3CWVA 3ZZ0A 2Z5CA 1S4EA 2A2DA 3ZZUA 1ZXMA 2V2ZA 1NZ0A 2IOQA 4LF9E 1N36I 1ZM4A 1KVKA 4MYTA 1FKAE 4OX9E 3T1HE 3M6AA 1DARA 2O1VA 3J81Q 2BM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 E;  1ZM2 A;  1S16 A;  4DV3 I;  4LFB E;  4JI3 I;  4DPY A;  4JI1 I;  5FLX C;  1B63 A;  2X7I A;  2HKJ A;  5A2Q Q;  4KHP E;  1Z5B A;  2A2C A;  1A6F A;  1Z0E A;  1H7U A;  1Z0W A;  4LF6 E;  4JI8 E;  4UTG A;  3WU5 A;  4DPW A;  5LMU E;  1QZR A;  1HR0 I;  4DR6 E;  4B3T I;  1N32 I;  2DEJ A;  1XMQ E;  4DV5 I;  1Z0C A;  2ZM6 I;  5LMN E;  4PU9 A;  4FWG A;  3PYG A;  4JI0 E;  4JV5 E;  4DU8 A;  4USM A;  5GMD A;  2UUC I;  4JYA E;  1ZM3 A;  4DUZ E;  1FWL A;  4DV4 E;  4DR4 E;  4LF9 I;  1Z5C A;  4MYU A;  4GKK I;  1EI1 A;  3WU6 A;  1OJ4 A;  1PKP A;  4NXN E;  2UU9 I;  4LFC I;  3JAM C;  2UXC E;  2UUA E;  2F4V E;  1XNQ E;  4DV6 I;  1PIE A;  1J5E E;  2R3V A;  2X36 A;  1HNX I;  1K47 A;  5IWA E;  4X62 E;  1N34 E;  1IBL E;  4YY3 E;  4DV0 E;  1D6T A;  4P7A A;  3QT8 A;  4JI4 E;  1ZXN A;  2R42 A;  2E5L E;  4LF6 I;  4GKJ E;  4LF7 I;  4DV2 E;  3B82 A;  2E1R A;  4JI8 I;  2NPF A;  3J80 Q;  4HY1 A;  1HNW E;  4DPT A;  1XHK A;  1XMQ I;  2HFU A;  1XNR E;  2J7K A;  1IBM I;  4LF4 E;  2ZIT A;  1WUU A;  1BKN A;  4DR3 E;  3T1Y E;  4JI0 I;  2EFG A;  4JV5 I;  4R1F A;  1I94 E;  5GME A;  4Z7C A;  3ZM7 A;  4HYM A;  4DUZ I;  4FW9 A;  4DXL A;  2HFS A;  4LFA E;  4B3S E;  4DR4 I;  2BV3 A;  4NXM E;  3J81 C;  3V5R A;  4AQY I;  3K1J A;  4LF8 E;  4NXN I;  3LNU A;  2F4V I;  1XNQ I;  4DR1 I;  3ZKD A;  5A2Q C;  4HAC B;  2VQE E;  4DV7 E;  1N0U A;  4FWD A;  1Z0V A;  4DV1 E;  1J5E I;  3V2U C;  4JI5 E;  2UXB E;  4B3R E;  5FLX Q;  1FNM A;  1HNZ E;  5IWA I;  3QT6 A;  3PYF A;  4X62 I;  4EMD A;  2HHH E;  1N34 I;  1IBL I;  4YY3 I;  4DV0 I;  2XEX A;  4K0K E;  3B8H A;  2WW4 A;  4DUY E;  1ZM9 A;  1H7S A;  4GKJ I;  1ELO A;  4DV2 I;  4DR2 I;  2V2Q A;  1H74 A;  4X66 E;  3WU3 A;  2Q2E B;  4KQV A;  4JI6 E;  4P52 A;  1XNR I;  3J7A G;  1KIJ A;  3Q1Q A;  4LF4 I;  4X65 E;  2HKE A;  4DR7 E;  1FI4 A;  4DR3 I;  3F0N A;  5BR8 E;  2UUB E;  1N33 E;  4JI2 E;  4OX9 I;  3T1H I;  1FJG I;  3OTO E;  1H73 A;  4LFA I;  4B3S I;  1IBK E;  2VQF E;  4LFB I;  3QT5 A;  1MX0 A;  1Z0B A;  4RPF A;  2GS8 A;  1FWK A;  4DV3 E;  4LF8 I;  4KHP I;  1XMO E;  3JAM Q;  4HXZ A;  1RRE A;  4DV7 I;  5IT9 C;  4DV1 I;  2UXB I;  4B3R I;  5LMU I;  2AJ4 A;  3PYD A;  2HHH I;  4DR6 I;  4WUC A;  2V34 A;  4K0K I;  1HR0 E;  1Z5A A;  4B3T E;  1N32 E;  4DPX A;  4DU7 A;  5LMN I;  4M1K A;  4FN5 A;  4DV5 E;  1PVG A;  4X66 I;  4X64 E;  1NHH A;  4JYA I;  1U2R A;  1EA6 A;  4PRV A;  4DV4 I;  4DR7 I;  2ZBK B;  2UUC E;  5BR8 I;  4LF5 E;  1RR9 A;  2UUB I;  1Z0G A;  1N33 I;  3HUL A;  2DEI A;  3ZKB A;  4JI2 I;  4USK A;  1VIS A;  4GKK E;  4WUB A;  2UXC I;  2UUA I;  2V2V A;  3OTO I;  4Z7Y A;  1IBK I;  4YHH E;  2VQF I;  2UU9 E;  4LFC E;  2HK3 A;  4DR5 E;  3QT7 A;  3PYE A;  1B62 A;  5LL6 R;  1MG7 A;  1XMO I;  1HNX E;  4UT4 A;  1KTV A;  1NHI A;  4WUD A;  4JI4 I;  2E5L I;  4B3M E;  5L3J A;  2UXD E;  4XTJ A;  1NHJ A;  4JG4 A;  3WU4 A;  1HNW I;  4LF7 E;  4JI7 E;  4ED4 A;  3LPS A;  1H72 C;  1Z59 A;  4I3H A;  4X64 I;  1UEK A;  3H4L A;  1IBM E;  2OI2 A;  3T1Y I;  2HK2 A;  4FWH A;  4ZVI A;  3B78 A;  2CZ9 A;  3GON A;  1I94 I;  3K17 A;  1N36 E;  1N0V C;  4PRX A;  4DPU A;  3J7A M;  2VF3 A;  4NXM I;  4LF5 I;  1FJG E;  3ZZT A;  4JI3 E;  2BM1 A;  4JI1 E;  4AQY E;  1KKH A;  4YHH I;  4HAC A;  2VQE I;  3D4J A;  4DR5 I;  4DR1 E;  4JI5 I;  1HNZ I;  3J80 C;  5IT9 Q;  2LJP A;  4DUY I;  1MU5 A;  4B3M I;  2UXD I;  1Z0T A;  4URL A;  2ZM6 E;  4DR2 E;  4JI7 I;  2V8P A;  4JI6 I;  3LTO A;  4X65 I;  3CWV A;  3ZZ0 A;  1S4E A;  2A2D A;  3ZZU A;  1ZXM A;  2V2Z A;  1NZ0 A;  4LF9 E;  1N36 I;  1ZM4 A;  1KVK A;  4MYT A;  1FKA E;  4OX9 E;  3T1H E;  3M6A A;  1DAR A;  3J81 Q;  2BM0 A; 
#chains in the Genus database with same CATH topology
 4DV6 E;  1ZM2 A;  1S16 A;  4DV3 I;  4LFB E;  4JI3 I;  4DPY A;  4JI1 I;  5FLX C;  1B63 A;  2X7I A;  2HKJ A;  5A2Q Q;  4BA1 B;  4KHP E;  1Z5B A;  2A2C A;  2Z5B B;  5JEA E;  2WNR A;  1A6F A;  1Z0E A;  1H7U A;  1Z0W A;  1P42 A;  4LF6 E;  2C38 A;  2PO2 B;  2NN6 A;  4JI8 E;  4UTG A;  3WU5 A;  4DPW A;  3KRN A;  5LMU E;  1QZR A;  1HR0 I;  4DR6 E;  4B3T I;  5K36 E;  1N32 I;  3GLL A;  3PS2 A;  2DEJ A;  1XMQ E;  4DV5 I;  1Z0C A;  2ZM6 I;  5LMN E;  4OKG A;  4PU9 A;  4FWG A;  4IZJ A;  4BA2 A;  3P3G A;  3PYG A;  4JI0 E;  4JV5 E;  1UDO A;  2PNZ A;  1OYS A;  4DU8 A;  5DRP A;  4FW3 A;  4USM A;  5GMD A;  2NN6 D;  2UUC I;  4JYA E;  1ZM3 A;  4DUZ E;  1FWL A;  4DV4 E;  2JEA B;  4DR4 E;  1OYP A;  2GO3 A;  4LF9 I;  1Z5C A;  4MYU A;  4FW5 A;  4GKK I;  1E3H A;  3PRY A;  2BA0 D;  3DD6 A;  5C0X E;  1EI1 A;  3WU6 A;  4MU1 A;  1OJ4 A;  1PKP A;  4NXN E;  2UU9 I;  4U3B A;  4LFC I;  3JAM C;  4IZJ D;  2UXC E;  2UUA E;  2F4V E;  1XNQ E;  2CG9 A;  4DV6 I;  3U1Y A;  1UDN A;  4OO1 E;  1PIE A;  1J5E E;  2R3V A;  2X36 A;  1HNX I;  1K47 A;  3CDJ A;  5IWA E;  2CGE A;  4X62 E;  1N34 E;  1IBL E;  2Z5B A;  4YY3 E;  4DV0 E;  1D6T A;  4P7A A;  5C0X C;  3QT8 A;  4JI4 E;  1ZXN A;  2R42 A;  4LCG A;  2E5L E;  4LF6 I;  4GKJ E;  2O1U A;  2PO2 A;  4DV2 E;  4LF7 I;  3B82 A;  2E1R A;  4JI8 I;  2NPF A;  3J80 Q;  4HY1 A;  1HNW E;  2NN6 F;  2IES A;  3K85 A;  1XXE A;  4DPT A;  1Y6Z A;  3P06 A;  1XHK A;  1XMQ I;  3P3C A;  2HFU A;  1XNR E;  2J7K A;  1IBM I;  4LF4 E;  2ZIT A;  5FWK A;  1WUU A;  1BKN A;  4U3D A;  4DR3 E;  3T1Y E;  4JI0 I;  4LCH A;  3B4T A;  2EFG A;  4JV5 I;  5K36 A;  4R1F A;  1I94 E;  3Q6N A;  2BA0 G;  5GME A;  4Z7C A;  3P76 A;  4IZK B;  3ZM7 A;  4HYM A;  4DUZ I;  4FW9 A;  4DXL A;  2HFS A;  4LFA E;  3U1K A;  4B3S E;  4DR4 I;  2BR2 B;  2BV3 A;  4NXM E;  5JEA D;  4OZE A;  1VI7 A;  3J81 C;  2C39 B;  4N3O A;  3V5R A;  4AQY I;  3K1J A;  4LF8 E;  2GQ0 A;  4NXN I;  3GME A;  3LNU A;  2F4V I;  4J3D A;  4DR1 I;  1XNQ I;  3ZKD A;  5A2Q C;  5K36 D;  4HAC B;  2VQE E;  4DV7 E;  1N0U A;  4FWD A;  2PNM A;  1Z0V A;  4DV1 E;  3HKM A;  3V2U C;  1J5E I;  4JI5 E;  4B3R E;  2UXB E;  5FLX Q;  1FNM A;  1HNZ E;  5IWA I;  3QT6 A;  5C0X A;  1YHC A;  3PYF A;  4X62 I;  4EMD A;  2HHH E;  1OYR A;  2GO4 A;  1N34 I;  1IBL I;  4YY3 I;  4DV0 I;  2JE6 B;  2XEX A;  4K0K E;  3B8H A;  2WW4 A;  4DUY E;  4OO1 A;  4IS9 A;  1ZM9 A;  1H7S A;  4GKJ I;  1ELO A;  4DV2 I;  4DR2 I;  2V2Q A;  1H74 A;  1R6M A;  4X66 E;  4LPF A;  5DNL A;  3WU3 A;  2Q2E B;  1Y5Y A;  4KQV A;  4JI6 E;  4AID A;  2J65 A;  5DRR A;  3P3E A;  5JEA F;  4P52 A;  2IER A;  1XNR I;  3J7A G;  1KIJ A;  5C0X D;  3Q1Q A;  4LF4 I;  1UDQ A;  4X65 E;  2HKE A;  4DR7 E;  1FI4 A;  2Z5C B;  2PO1 B;  4DR3 I;  5EKW A;  3F0N A;  5BR8 E;  3UHM A;  2UUB E;  2BA1 D;  4OO1 D;  5K36 F;  1N33 E;  1USV A;  2WP8 A;  4JI2 E;  4OX9 I;  3T1H I;  1FJG I;  3OTO E;  1H73 A;  4LFA I;  4B3S I;  1IBK E;  2BR2 A;  2VQF E;  3NZK A;  4LFB I;  3QT5 A;  1HK7 A;  1MX0 A;  1Z0B A;  2C39 A;  4RPF A;  2GS8 A;  1FWK A;  4DV3 E;  4LF8 I;  4KHP I;  4BA1 A;  1XMO E;  3JAM Q;  3H1C A;  4MQY A;  4HXZ A;  4IFD E;  1RRE A;  4DV7 I;  5IT9 C;  4DV1 I;  2UXB I;  4B3R I;  5LMU I;  2AJ4 A;  2C38 B;  3PYD A;  2HHH I;  4DR6 I;  2NN6 B;  4WUC A;  5C0X F;  2V34 A;  4IFD B;  2C37 B;  4GQU A;  1HR0 E;  4K0K I;  1Z5A A;  5DRO A;  4B3T E;  4FW6 A;  1N32 E;  4DPX A;  4DU7 A;  5LMN I;  4M1K A;  2JEB B;  4IFD C;  4FN5 A;  3PS1 A;  3GCM A;  4OO1 F;  4DV5 E;  1PVG A;  4X66 I;  4X64 E;  2AE8 A;  3Q6M A;  4BA2 B;  5DRQ A;  1NHH A;  2BA1 G;  2PO0 B;  2PNZ B;  4JYA I;  1U2R A;  1EA6 A;  4PRV A;  4DV4 I;  1Y4S A;  4DR7 I;  2JEA A;  2ZBK B;  2PO1 A;  2UUC E;  5BR8 I;  2Z5E A;  4LF5 E;  1RR9 A;  2UUB I;  1Z0G A;  1N33 I;  3HUL A;  2DEI A;  3ZKB A;  4JI2 I;  4USK A;  1VIS A;  4GKK E;  3CDI A;  4WUB A;  4FW4 A;  2UXC I;  2V2V A;  2UUA I;  3OTO I;  4Z7Y A;  1IBK I;  4YHH E;  2VQF I;  2UU9 E;  4LFC E;  2HK3 A;  4DR5 E;  3QT7 A;  3PYE A;  4LCF A;  4FW7 A;  1E3P A;  1B62 A;  5LL6 R;  1MG7 A;  5EL9 A;  1XMO I;  1HNX E;  4UT4 A;  2O1T A;  1KTV A;  1NHI A;  1UDS A;  4WUD A;  4JI4 I;  4ISA A;  2E5L I;  4B3M E;  5L3J A;  2UXD E;  4XTJ A;  1NHJ A;  4JG4 A;  3WU4 A;  3M7N D;  1HNW I;  4MU0 A;  4LF7 E;  4JI7 E;  2O3Z A;  2PNL A;  4IFD A;  2C37 A;  4ED4 A;  5JEA B;  4MU3 A;  3LPS A;  1YH8 A;  1H72 C;  1Z59 A;  3L7Z B;  2JEB A;  4I3H A;  4X64 I;  1UEK A;  3H4L A;  5JEA C;  2OI2 A;  3T1Y I;  1IBM E;  2HK2 A;  4FWH A;  4ZVI A;  3B78 A;  2CZ9 A;  3GON A;  1I94 I;  3K17 A;  2O1W A;  5K36 B;  1N36 E;  2PO0 A;  1N0V C;  4IZK A;  4PRX A;  4DPU A;  3J7A M;  2VF3 A;  4NXM I;  4MDT A;  5K36 C;  4LF5 I;  4IFD D;  2VES A;  1FJG E;  1Y4U A;  3ZZT A;  2IOP A;  2CVE A;  4JI3 E;  2NN6 E;  2BM1 A;  4JI1 E;  4AQY E;  3M85 D;  4QNJ A;  1KKH A;  4YHH I;  4HAC A;  2VQE I;  2WNR B;  3D4J A;  4DR5 I;  4DR1 E;  4JI5 I;  1HNZ I;  5C0X B;  1USU A;  2JE6 A;  3M7N G;  3J80 C;  3HJC A;  5ELW A;  4AM3 A;  5IT9 Q;  2LJP A;  4DUY I;  1MU5 A;  2NN6 C;  4B3M I;  2UXD I;  1Z0T A;  4OO1 B;  4URL A;  2ZM6 E;  4DR2 E;  4JI7 I;  2V8P A;  4IZJ B;  4JI6 I;  4MU4 A;  4LOM A;  4OO1 C;  5DNX A;  3LTO A;  5JEA A;  4IFD F;  1RHY A;  4X65 I;  3L7Z A;  3CWV A;  3ZZ0 A;  2Z5C A;  1S4E A;  1R6L A;  1Y60 A;  2A2D A;  3ZZU A;  1ZXM A;  2V2Z A;  1NZ0 A;  4AIM A;  2IOQ A;  4LF9 E;  1N36 I;  1ZM4 A;  1KVK A;  4MYT A;  2F1D A;  1FKA E;  2WP8 B;  2JT2 A;  4QNK A;  4OX9 E;  3T1H E;  3M85 G;  3M6A A;  1DAR A;  2O1V A;  3J81 Q;  4NBQ A;  2BM0 A;  3PS3 A; 
#chains in the Genus database with same CATH homology
 4DV6 E;  1ZM2 A;  1S16 A;  4DV3 I;  4LFB E;  4JI3 I;  4DPY A;  4JI1 I;  5FLX C;  1B63 A;  2X7I A;  2HKJ A;  5A2Q Q;  4KHP E;  1Z5B A;  2A2C A;  2Z5B B;  1A6F A;  1Z0E A;  1H7U A;  1Z0W A;  4LF6 E;  4JI8 E;  4UTG A;  3WU5 A;  4DPW A;  5LMU E;  1QZR A;  1HR0 I;  4DR6 E;  4B3T I;  1N32 I;  2DEJ A;  1XMQ E;  4DV5 I;  1Z0C A;  2ZM6 I;  5LMN E;  4PU9 A;  4FWG A;  4IZJ A;  3PYG A;  4JI0 E;  4JV5 E;  4DU8 A;  4USM A;  5GMD A;  2UUC I;  4JYA E;  1ZM3 A;  4DUZ E;  1FWL A;  4DV4 E;  4DR4 E;  4LF9 I;  1Z5C A;  4MYU A;  4GKK I;  3PRY A;  1EI1 A;  3WU6 A;  1OJ4 A;  1PKP A;  4NXN E;  2UU9 I;  4LFC I;  3JAM C;  4IZJ D;  2UXC E;  2UUA E;  2F4V E;  1XNQ E;  2CG9 A;  4DV6 I;  1PIE A;  1J5E E;  2R3V A;  2X36 A;  1HNX I;  1K47 A;  5IWA E;  2CGE A;  4X62 E;  1N34 E;  1IBL E;  2Z5B A;  4YY3 E;  4DV0 E;  1D6T A;  4P7A A;  3QT8 A;  4JI4 E;  1ZXN A;  2R42 A;  2E5L E;  4LF6 I;  4GKJ E;  2O1U A;  4LF7 I;  4DV2 E;  3B82 A;  2E1R A;  4JI8 I;  2NPF A;  3J80 Q;  4HY1 A;  1HNW E;  3K85 A;  4DPT A;  1Y6Z A;  3P06 A;  1XHK A;  1XMQ I;  2HFU A;  1XNR E;  2J7K A;  1IBM I;  4LF4 E;  2ZIT A;  5FWK A;  1WUU A;  1BKN A;  4DR3 E;  3T1Y E;  4JI0 I;  2EFG A;  4JV5 I;  4R1F A;  1I94 E;  3Q6N A;  5GME A;  4Z7C A;  4IZK B;  3ZM7 A;  4HYM A;  4DUZ I;  4FW9 A;  4DXL A;  2HFS A;  4LFA E;  4B3S E;  4DR4 I;  2BV3 A;  4NXM E;  3J81 C;  4N3O A;  3V5R A;  4AQY I;  3K1J A;  4LF8 E;  2GQ0 A;  4NXN I;  3LNU A;  2F4V I;  1XNQ I;  4DR1 I;  3ZKD A;  5A2Q C;  4HAC B;  2VQE E;  4DV7 E;  1N0U A;  4FWD A;  2PNM A;  1Z0V A;  4DV1 E;  1J5E I;  3V2U C;  4JI5 E;  2UXB E;  4B3R E;  5FLX Q;  1FNM A;  1HNZ E;  5IWA I;  3QT6 A;  3PYF A;  4X62 I;  4EMD A;  2HHH E;  1N34 I;  1IBL I;  4YY3 I;  4DV0 I;  2XEX A;  4K0K E;  3B8H A;  2WW4 A;  4DUY E;  1ZM9 A;  1H7S A;  4GKJ I;  1ELO A;  4DV2 I;  4DR2 I;  2V2Q A;  1H74 A;  4X66 E;  3WU3 A;  2Q2E B;  4KQV A;  4JI6 E;  4P52 A;  1XNR I;  3J7A G;  1KIJ A;  3Q1Q A;  4LF4 I;  4X65 E;  2HKE A;  4DR7 E;  1FI4 A;  2Z5C B;  4DR3 I;  3F0N A;  5BR8 E;  2UUB E;  1N33 E;  1USV A;  4JI2 E;  4OX9 I;  3T1H I;  1FJG I;  3OTO E;  1H73 A;  4LFA I;  4B3S I;  1IBK E;  2VQF E;  4LFB I;  3QT5 A;  1HK7 A;  1MX0 A;  1Z0B A;  4RPF A;  2GS8 A;  1FWK A;  4DV3 E;  4LF8 I;  4KHP I;  1XMO E;  3JAM Q;  4HXZ A;  1RRE A;  4DV7 I;  5IT9 C;  4DV1 I;  2UXB I;  4B3R I;  5LMU I;  2AJ4 A;  3PYD A;  2HHH I;  4DR6 I;  4WUC A;  2V34 A;  4K0K I;  1HR0 E;  1Z5A A;  4B3T E;  1N32 E;  4DPX A;  4DU7 A;  5LMN I;  4M1K A;  4FN5 A;  4DV5 E;  1PVG A;  4X66 I;  4X64 E;  3Q6M A;  1NHH A;  4JYA I;  1U2R A;  1EA6 A;  4PRV A;  4DV4 I;  1Y4S A;  4DR7 I;  2ZBK B;  2UUC E;  5BR8 I;  2Z5E A;  4LF5 E;  1RR9 A;  2UUB I;  1Z0G A;  1N33 I;  3HUL A;  2DEI A;  3ZKB A;  4JI2 I;  4USK A;  1VIS A;  4GKK E;  4WUB A;  2UXC I;  2V2V A;  2UUA I;  3OTO I;  4Z7Y A;  1IBK I;  4YHH E;  2VQF I;  2UU9 E;  4LFC E;  2HK3 A;  4DR5 E;  3QT7 A;  3PYE A;  1B62 A;  5LL6 R;  1MG7 A;  1XMO I;  1HNX E;  4UT4 A;  2O1T A;  1KTV A;  1NHI A;  4WUD A;  4JI4 I;  2E5L I;  4B3M E;  5L3J A;  2UXD E;  4XTJ A;  1NHJ A;  4JG4 A;  3WU4 A;  1HNW I;  4LF7 E;  4JI7 E;  2PNL A;  4ED4 A;  3LPS A;  1H72 C;  1Z59 A;  4I3H A;  4X64 I;  1UEK A;  3H4L A;  1IBM E;  2OI2 A;  3T1Y I;  2HK2 A;  4FWH A;  4ZVI A;  3B78 A;  2CZ9 A;  3GON A;  1I94 I;  3K17 A;  2O1W A;  1N36 E;  1N0V C;  4IZK A;  4PRX A;  4DPU A;  3J7A M;  2VF3 A;  4NXM I;  4LF5 I;  1FJG E;  1Y4U A;  3ZZT A;  2IOP A;  4JI3 E;  2BM1 A;  4JI1 E;  4AQY E;  1KKH A;  4YHH I;  4HAC A;  2VQE I;  3D4J A;  4DR5 I;  4DR1 E;  4JI5 I;  1HNZ I;  1USU A;  3J80 C;  3HJC A;  5IT9 Q;  2LJP A;  4DUY I;  1MU5 A;  4B3M I;  2UXD I;  1Z0T A;  4URL A;  2ZM6 E;  4DR2 E;  4JI7 I;  2V8P A;  4IZJ B;  4JI6 I;  3LTO A;  4X65 I;  3CWV A;  3ZZ0 A;  2Z5C A;  1S4E A;  2A2D A;  3ZZU A;  1ZXM A;  2V2Z A;  1NZ0 A;  2IOQ A;  4LF9 E;  1N36 I;  1ZM4 A;  1KVK A;  4MYT A;  1FKA E;  4OX9 E;  3T1H E;  3M6A A;  1DAR A;  2O1V A;  3J81 Q;  2BM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...