5JEAE

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
266
structure length
256
Chain Sequence
b'HMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLILPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 60
structure length 256
sequence length 266
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaE00
2PNZB 1E3PA 3CDJA 2BA0D 3L7ZA 2PO2A 4BA2A 2BR2B 2WP8B 4OO1A 1R6LA 5K36C 2PNZA 1UDQA 4OO1E 1OYRA 1OYPA 3H1CA 2NN6B 2WP8A 5K36D 2JE6B 4IFDC 5JEAD 2JEBA 5K36F 3B4TA 3GCMA 4AM3A 5JEAF 2NN6D 4AIDA 5C0XD 4IFDD 2NN6F 5K36B 5C0XF 4IFDF 5JEAB 3HKMA 4BA1B 2JEAB 1OYSA 4OO1C 4AIMA 1UDSA 2BR2A 3CDIA 5C0XB 4IFDB 2PO0B 2PO1B 5K36A 1UDOA 5JEAA 2JEAA 3M85G 2C39B 3M7NG 2NN6A 5C0XA 4IFDA 2C37B 2JE6A 2PO1A 2BA1D 4BA2B 2NN6E 3U1KA 2C39A 4OO1B 3M85D 3DD6A 2C38B 3M7ND 4NBQA 2WNRB 1R6MA 2C37A 3KRNA 4OO1D 3GMEA 2BA1G 4BA1A 2C38A 4OO1F 5K36E 1E3HA 2JEBB 5JEAE 5JEAC 3L7ZB 2WNRA 2PO0A 2BA0G 1UDNA 2PO2B 3GLLA 5C0XE 2NN6C 4IFDE 5C0XC
chains in the Genus database with same CATH superfamily
4X64I 5FLXQ 1E3PA 5BR8I 3K1JA 2UUCE 3LTOA 1HNXI 3UHMA 4DXLA 2VQEE 2PNLA 4BA2A 4ZVIA 1Z0EA 4OO1A 3ZZUA 2UXDI 2ZBKB 4IZKB 3F0NA 3P76A 1MX0A 2VQFE 2PNZA 4OO1E 1P42A 1Z0WA 2UU9E 1Z0VA 5IT9Q 3WU6A 4FN5A 4LF7I 3H1CA 4LF9I 4PRXA 4FW3A 5DRRA 3T1HI 4LFCI 5JEAD 1N36I 2Z5BB 2JEBA 1D6TA 5DRQA 4JI7I 4OZEA 2AJ4A 4MU4A 1H72C 2GS8A 1ZM2A 2CGEA 2PNMA 2X7IA 3J81Q 3PYEA 1XNRE 4X62I 5C0XF 2BV3A 4IZJB 4WUCA 4FWGA 3B8HA 4IS9A 1IBLE 4AIMA 1Y6ZA 4DR2I 4JI4I 5EKWA 1XMQE 3P3GA 3B82A 2V34A 4IZKA 2E1RA 1HR0I 2UUAI 1N32I 1UDOA 4LCHA 5JEAA 2UXBE 1IBKE 4N3OA 2IESA 1IBMI 3PS1A 3M85G 4NXNE 4KHPI 4DPXA 2IERA 4K0KI 4KQVA 1H74A 2C37B 2Z5BA 2AE8A 3M85D 4B3TI 2C38B 4DR6I 4DR4I 2VESA 4LF5I 1H7SA 4HXZA 4DV3E 3K85A 3PRYA 1XNQI 2V2ZA 2E5LE 4JV5E 4X66I 1E3HA 5LMUE 3K17A 4OKGA 1N0UA 1ZM3A 5DROA 3H4LA 3PYDA 1I94E 4DR5E 4LF4E 2Z5EA 4DV4I 4GKJI 2NN6C 4LF6I 4U3DA 4JI8I 2ZITA 1Z5CA 4DV5I 2PNZB 4GKKE 2HHHI 4LOMA 4AQYI 2BR2B 4DV2I 1ZM9A 2R42A 3OTOE 3J7AG 1ZM4A 4DR7I 4DU7A 4LCGA 3ZKBA 4LF8I 4JI3I 5GMEA 3V2UC 2UUBI 1YHCA 1KIJA 1KTVA 2NN6B 2HK3A 2R3VA 3QT6A 4DV6E 2WP8A 5K36D 4JI6E 4DV7I 4JI0E 1MG7A 4OX9I 3T1YE 4DR1E 4YY3E 1FJGI 2NN6D 2HK2A 4AIDA 2XEXA 4MQYA 3NZKA 2HKJA 4IFDD 4LFAE 4B3MI 5LMNE 1N33I 2UXCE 5DNLA 2CVEA 1N34I 5JEAB 3J80C 1UEKA 3WU3A 4BA1B 4B3SI 2F4VI 4JI5E 4GQUA 5FWKA 1HNWE 4X65E 4DUYI 4DU8A 4DUZE 2BR2A 2ZM6I 3HULA 2PO0B 1Y5YA 3PS2A 5K36A 3ZKDA 4NXME 3QT5A 3J7AM 3ZM7A 5IWAE 3M6AA 2NN6A 2HKEA 2O1TA 5BR8E 4LFBI 4IFDA 4MU0A 1HNXE 1FNMA 2NN6E 3U1KA 1Z0CA 4DV0I 4DPTA 2JT2A 2A2CA 3WU4A 4HY1A 2Z5CA 1HNZI 2UXDE 5LL6R 4URLA 1HK7A 4MU3A 1XMOI 4LF7E 1NHHA 1Z0BA 4HYMA 4DR3I 1XHKA 1USUA 4BA1A 4LF9E 1H73A 4LCFA 3WU5A 3T1HE 4OO1F 1OJ4A 4FW5A 4LFCE 1BKNA 5JEAE 1N36E 2GQ0A 3PYFA 2PO0A 4JI7E 5GMDA 3GLLA 3P3EA 1J5EI 5C0XC 4YHHI 4X62E 1NHIA 1VISA 3L7ZA 3QT8A 4DR5I 4RPFA 2WW4A 1Z5BA 2WP8B 3B78A 1Y4UA 5IT9C 4B3RI 4DR2E 4JI4E 5K36C 4JYAI 1UDQA 3LPSA 2HFSA 1HR0E 2UUAE 5DRPA 1N32E 1OYPA 1IBME 4FW6A 4JG4A 1PKPA 1RHYA 2V8PA 4KHPE 3LNUA 2F1DA 1S4EA 2NPFA 1EI1A 4FW4A 4IFDC 4JI2I 3P3CA 1K47A 4DV1I 3B4TA 4AM3A 2GO3A 3HJCA 4I3HA 5JEAF 4B3TE 4DR6E 1FWKA 4JI1I 5C0XD 4DR4E 3ZZTA 4LF5E 3PS3A 3D4JA 4FWDA 2CG9A 4MYTA 2O1VA 4DPYA 4FWHA 3QT7A 5K36B 2UUCI 3Q1QA 1H7UA 1USVA 1XNQE 4Z7CA 2VQEI 2HFUA 4X66E 1UDSA 3CDIA 4IFDB 1FWLA 4J3DA 2VQFI 2VF3A 4FW9A 3JAMC 5DNXA 4P52A 2UU9I 2JEAA 4DV4E 4GKJE 2Z5CB 4LF6E 4JI8E 4DV5E 1KKHA 4QNKA 5C0XA 2HHHE 4MDTA 2PO1A 4AQYE 2BM0A 1Z59A 2BA1D 2BM1A 3DD6A 5ELWA 4UT4A 4DV2E 2IOPA 4MYUA 1Y60A 1XNRI 4NBQA 4DR7E 3PYGA 4HACA 1XXEA 1B62A 3KRNA 4ISAA 4LF8E 3GMEA 4QNJA 4JI3E 1NZ0A 2UUBE 5L3JA 1PIEA 2GO4A 1IBLI 5K36E 4DV7E 4X64E 1KVKA 4OX9E 3L7ZB 1XMQI 2WNRA 2LJPA 2IOQA 1U2RA 2BA0G 1Z0GA 2V2VA 1B63A 2UXBI 1IBKI 1FJGE 4U3BA 3GONA 4NXNI 4IFDE 4FW7A 5A2QC 2V2QA 4B3ME 1N33E 1RR9A 3CDJA 1N34E 2BA0D 4B3SE 2F4VE 4P7AA 2PO2A 1ZXMA 1FI4A 1PVGA 4DUYE 2O1WA 2ZM6E 1R6LA 4PRVA 2J7KA 3P06A 4LPFA 4DV3I 1OYRA 2DEJA 1NHJA 3U1YA 1Z0TA 5FLXC 2E5LI 4JV5I 2JE6B 5LMUI 4LFBE 3ZZ0A 4WUBA 3V5RA 4IZJD 5K36F 4DPUA 3GCMA 1N0VC 1I94I 2X36A 4DV0E 3Q6NA 4LF4I 1FKAE 3JAMQ 1HNZE 1MU5A 2Q2EB 2EFGA 2NN6F 1RREA 1DARA 1WUUA 4R1FA 4GKKI 4PU9A 2DEIA 4IFDF 3HKMA 1QZRA 1XMOE 2JEAB 1OYSA 4OO1C 4DR3E 2O1UA 2OI2A 3OTOI 4USKA 4ED4A 4K0KE 3J80Q 5C0XB 2PO1B 1Y4SA 3Q6MA 3J81C 4IZJA 2C39B 5EL9A 1J5EE 4UTGA 1EA6A 3M7NG 4DV6I 4JI6I 1A6FA 4HACB 4Z7YA 4XTJA 4JI0I 4YHHE 4MU1A 2JE6A 3T1YI 4M1KA 4DR1I 4YY3I 4BA2B 4OO1B 1VI7A 4USMA 3M7ND 2CZ9A 4B3RE 4LFAI 4EMDA 5LMNI 4JYAE 2UXCI 2WNRB 2J65A 1R6MA 2C37A 4OO1D 1ELOA 5A2QQ 4JI5I 2BA1G 2C38A 1HNWI 4X65I 1ZXNA 4DPWA 4DUZI 2JEBB 4JI2E 5JEAC 2O3ZA 2A2DA 4NXMI 1YH8A 1UDNA 2PO2B 4DV1E 3CWVA 1S16A 1Z5AA 4JI1E 4WUDA 5C0XE 5IWAI 2C39A
chains in the Genus database with same CATH topology
2PNZB 1E3PA 3CDJA 2BA0D 3L7ZA 2PO2A 4BA2A 2BR2B 2WP8B 4OO1A 1R6LA 5K36C 2PNZA 1UDQA 4OO1E 1OYRA 1OYPA 3H1CA 2NN6B 2WP8A 5K36D 2JE6B 4IFDC 5JEAD 2JEBA 5K36F 3B4TA 3GCMA 4AM3A 5JEAF 2NN6D 4AIDA 5C0XD 4IFDD 2NN6F 5K36B 5C0XF 4IFDF 5JEAB 3HKMA 4BA1B 2JEAB 1OYSA 4OO1C 4AIMA 1UDSA 2BR2A 3CDIA 5C0XB 4IFDB 2PO0B 2PO1B 5K36A 1UDOA 5JEAA 2JEAA 3M85G 2C39B 3M7NG 2NN6A 5C0XA 4IFDA 2C37B 2JE6A 2PO1A 2BA1D 4BA2B 2NN6E 3U1KA 2C39A 4OO1B 3M85D 3DD6A 2C38B 3M7ND 4NBQA 2WNRB 1R6MA 2C37A 3KRNA 4OO1D 3GMEA 2BA1G 4BA1A 2C38A 4OO1F 5K36E 1E3HA 2JEBB 5JEAE 5JEAC 3L7ZB 2WNRA 2PO0A 2BA0G 1UDNA 2PO2B 3GLLA 5C0XE 2NN6C 4IFDE 5C0XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNZ B;  1E3P A;  3CDJ A;  2BA0 D;  3L7Z A;  2PO2 A;  4BA2 A;  2BR2 B;  2WP8 B;  4OO1 A;  1R6L A;  5K36 C;  2PNZ A;  1UDQ A;  4OO1 E;  1OYR A;  1OYP A;  3H1C A;  2NN6 B;  2WP8 A;  5K36 D;  2JE6 B;  4IFD C;  5JEA D;  2JEB A;  5K36 F;  3B4T A;  3GCM A;  4AM3 A;  5JEA F;  2NN6 D;  4AID A;  5C0X D;  4IFD D;  2NN6 F;  5K36 B;  5C0X F;  4IFD F;  5JEA B;  3HKM A;  4BA1 B;  2JEA B;  1OYS A;  4OO1 C;  4AIM A;  1UDS A;  2BR2 A;  3CDI A;  5C0X B;  4IFD B;  2PO0 B;  2PO1 B;  5K36 A;  1UDO A;  5JEA A;  2JEA A;  3M85 G;  2C39 B;  3M7N G;  2NN6 A;  5C0X A;  4IFD A;  2C37 B;  2JE6 A;  2PO1 A;  2BA1 D;  4BA2 B;  2NN6 E;  3U1K A;  2C39 A;  4OO1 B;  3M85 D;  3DD6 A;  2C38 B;  3M7N D;  4NBQ A;  2WNR B;  1R6M A;  2C37 A;  3KRN A;  4OO1 D;  3GME A;  2BA1 G;  4BA1 A;  2C38 A;  4OO1 F;  5K36 E;  1E3H A;  2JEB B;  5JEA E;  5JEA C;  3L7Z B;  2WNR A;  2PO0 A;  2BA0 G;  1UDN A;  2PO2 B;  3GLL A;  5C0X E;  2NN6 C;  4IFD E;  5C0X C; 
#chains in the Genus database with same CATH topology
 4X64 I;  5FLX Q;  1E3P A;  5BR8 I;  3K1J A;  2UUC E;  3LTO A;  1HNX I;  3UHM A;  4DXL A;  2VQE E;  2PNL A;  4BA2 A;  4ZVI A;  1Z0E A;  4OO1 A;  3ZZU A;  2UXD I;  2ZBK B;  4IZK B;  3F0N A;  3P76 A;  1MX0 A;  2VQF E;  2PNZ A;  4OO1 E;  1P42 A;  1Z0W A;  2UU9 E;  1Z0V A;  5IT9 Q;  3WU6 A;  4FN5 A;  4LF7 I;  3H1C A;  4LF9 I;  4PRX A;  4FW3 A;  5DRR A;  3T1H I;  4LFC I;  5JEA D;  1N36 I;  2Z5B B;  2JEB A;  1D6T A;  5DRQ A;  4JI7 I;  4OZE A;  2AJ4 A;  4MU4 A;  1H72 C;  2GS8 A;  1ZM2 A;  2CGE A;  2PNM A;  2X7I A;  3J81 Q;  3PYE A;  1XNR E;  4X62 I;  5C0X F;  2BV3 A;  4IZJ B;  4WUC A;  4FWG A;  3B8H A;  4IS9 A;  1IBL E;  4AIM A;  1Y6Z A;  4DR2 I;  4JI4 I;  5EKW A;  1XMQ E;  3P3G A;  3B82 A;  2V34 A;  4IZK A;  2E1R A;  1HR0 I;  2UUA I;  1N32 I;  1UDO A;  4LCH A;  5JEA A;  2UXB E;  1IBK E;  4N3O A;  2IES A;  1IBM I;  3PS1 A;  3M85 G;  4NXN E;  4KHP I;  4DPX A;  2IER A;  4K0K I;  4KQV A;  1H74 A;  2C37 B;  2Z5B A;  2AE8 A;  3M85 D;  4B3T I;  2C38 B;  4DR6 I;  4DR4 I;  2VES A;  4LF5 I;  1H7S A;  4HXZ A;  4DV3 E;  3K85 A;  3PRY A;  1XNQ I;  2V2Z A;  2E5L E;  4JV5 E;  4X66 I;  1E3H A;  5LMU E;  3K17 A;  4OKG A;  1N0U A;  1ZM3 A;  5DRO A;  3H4L A;  3PYD A;  1I94 E;  4DR5 E;  4LF4 E;  2Z5E A;  4DV4 I;  4GKJ I;  2NN6 C;  4LF6 I;  4U3D A;  4JI8 I;  2ZIT A;  1Z5C A;  4DV5 I;  2PNZ B;  4GKK E;  2HHH I;  4LOM A;  4AQY I;  2BR2 B;  4DV2 I;  1ZM9 A;  2R42 A;  3OTO E;  3J7A G;  1ZM4 A;  4DR7 I;  4DU7 A;  4LCG A;  3ZKB A;  4LF8 I;  4JI3 I;  5GME A;  3V2U C;  2UUB I;  1YHC A;  1KIJ A;  1KTV A;  2NN6 B;  2HK3 A;  2R3V A;  3QT6 A;  4DV6 E;  2WP8 A;  5K36 D;  4JI6 E;  4DV7 I;  4JI0 E;  1MG7 A;  4OX9 I;  3T1Y E;  4DR1 E;  4YY3 E;  1FJG I;  2NN6 D;  2HK2 A;  4AID A;  2XEX A;  4MQY A;  3NZK A;  2HKJ A;  4IFD D;  4LFA E;  4B3M I;  5LMN E;  1N33 I;  2UXC E;  5DNL A;  2CVE A;  1N34 I;  5JEA B;  3J80 C;  1UEK A;  3WU3 A;  4BA1 B;  4B3S I;  2F4V I;  4JI5 E;  4GQU A;  5FWK A;  1HNW E;  4X65 E;  4DUY I;  4DU8 A;  4DUZ E;  2BR2 A;  2ZM6 I;  3HUL A;  2PO0 B;  1Y5Y A;  3PS2 A;  5K36 A;  3ZKD A;  4NXM E;  3QT5 A;  3J7A M;  3ZM7 A;  5IWA E;  3M6A A;  2NN6 A;  2HKE A;  2O1T A;  5BR8 E;  4LFB I;  4IFD A;  4MU0 A;  1HNX E;  1FNM A;  2NN6 E;  3U1K A;  1Z0C A;  4DV0 I;  4DPT A;  2JT2 A;  2A2C A;  3WU4 A;  4HY1 A;  2Z5C A;  1HNZ I;  2UXD E;  5LL6 R;  4URL A;  1HK7 A;  4MU3 A;  1XMO I;  4LF7 E;  1NHH A;  1Z0B A;  4HYM A;  4DR3 I;  1XHK A;  1USU A;  4BA1 A;  4LF9 E;  1H73 A;  4LCF A;  3WU5 A;  3T1H E;  4OO1 F;  1OJ4 A;  4FW5 A;  4LFC E;  1BKN A;  5JEA E;  1N36 E;  2GQ0 A;  3PYF A;  2PO0 A;  4JI7 E;  5GMD A;  3GLL A;  3P3E A;  1J5E I;  5C0X C;  4YHH I;  4X62 E;  1NHI A;  1VIS A;  3L7Z A;  3QT8 A;  4DR5 I;  4RPF A;  2WW4 A;  1Z5B A;  2WP8 B;  3B78 A;  1Y4U A;  5IT9 C;  4B3R I;  4DR2 E;  4JI4 E;  5K36 C;  4JYA I;  1UDQ A;  3LPS A;  2HFS A;  1HR0 E;  2UUA E;  5DRP A;  1N32 E;  1OYP A;  1IBM E;  4FW6 A;  4JG4 A;  1PKP A;  1RHY A;  2V8P A;  4KHP E;  3LNU A;  2F1D A;  1S4E A;  2NPF A;  1EI1 A;  4FW4 A;  4IFD C;  4JI2 I;  3P3C A;  1K47 A;  4DV1 I;  3B4T A;  4AM3 A;  2GO3 A;  3HJC A;  4I3H A;  5JEA F;  4B3T E;  4DR6 E;  1FWK A;  4JI1 I;  5C0X D;  4DR4 E;  3ZZT A;  4LF5 E;  3PS3 A;  3D4J A;  4FWD A;  2CG9 A;  4MYT A;  2O1V A;  4DPY A;  4FWH A;  3QT7 A;  5K36 B;  2UUC I;  3Q1Q A;  1H7U A;  1USV A;  1XNQ E;  4Z7C A;  2VQE I;  2HFU A;  4X66 E;  1UDS A;  3CDI A;  4IFD B;  1FWL A;  4J3D A;  2VQF I;  2VF3 A;  4FW9 A;  3JAM C;  5DNX A;  4P52 A;  2UU9 I;  2JEA A;  4DV4 E;  4GKJ E;  2Z5C B;  4LF6 E;  4JI8 E;  4DV5 E;  1KKH A;  4QNK A;  5C0X A;  2HHH E;  4MDT A;  2PO1 A;  4AQY E;  2BM0 A;  1Z59 A;  2BA1 D;  2BM1 A;  3DD6 A;  5ELW A;  4UT4 A;  4DV2 E;  2IOP A;  4MYU A;  1Y60 A;  1XNR I;  4NBQ A;  4DR7 E;  3PYG A;  4HAC A;  1XXE A;  1B62 A;  3KRN A;  4ISA A;  4LF8 E;  3GME A;  4QNJ A;  4JI3 E;  1NZ0 A;  2UUB E;  5L3J A;  1PIE A;  2GO4 A;  1IBL I;  5K36 E;  4DV7 E;  4X64 E;  1KVK A;  4OX9 E;  3L7Z B;  1XMQ I;  2WNR A;  2LJP A;  2IOQ A;  1U2R A;  2BA0 G;  1Z0G A;  2V2V A;  1B63 A;  2UXB I;  1IBK I;  1FJG E;  4U3B A;  3GON A;  4NXN I;  4IFD E;  4FW7 A;  5A2Q C;  2V2Q A;  4B3M E;  1N33 E;  1RR9 A;  3CDJ A;  1N34 E;  2BA0 D;  4B3S E;  2F4V E;  4P7A A;  2PO2 A;  1ZXM A;  1FI4 A;  1PVG A;  4DUY E;  2O1W A;  2ZM6 E;  1R6L A;  4PRV A;  2J7K A;  3P06 A;  4LPF A;  4DV3 I;  1OYR A;  2DEJ A;  1NHJ A;  3U1Y A;  1Z0T A;  5FLX C;  2E5L I;  4JV5 I;  2JE6 B;  5LMU I;  4LFB E;  3ZZ0 A;  4WUB A;  3V5R A;  4IZJ D;  5K36 F;  4DPU A;  3GCM A;  1N0V C;  1I94 I;  2X36 A;  4DV0 E;  3Q6N A;  4LF4 I;  1FKA E;  3JAM Q;  1HNZ E;  1MU5 A;  2Q2E B;  2EFG A;  2NN6 F;  1RRE A;  1DAR A;  1WUU A;  4R1F A;  4GKK I;  4PU9 A;  2DEI A;  4IFD F;  3HKM A;  1QZR A;  1XMO E;  2JEA B;  1OYS A;  4OO1 C;  4DR3 E;  2O1U A;  2OI2 A;  3OTO I;  4USK A;  4ED4 A;  4K0K E;  3J80 Q;  5C0X B;  2PO1 B;  1Y4S A;  3Q6M A;  3J81 C;  4IZJ A;  2C39 B;  5EL9 A;  1J5E E;  4UTG A;  1EA6 A;  3M7N G;  4DV6 I;  4JI6 I;  1A6F A;  4HAC B;  4Z7Y A;  4XTJ A;  4JI0 I;  4YHH E;  4MU1 A;  2JE6 A;  3T1Y I;  4M1K A;  4DR1 I;  4YY3 I;  4BA2 B;  4OO1 B;  1VI7 A;  4USM A;  3M7N D;  2CZ9 A;  4B3R E;  4LFA I;  4EMD A;  5LMN I;  4JYA E;  2UXC I;  2WNR B;  2J65 A;  1R6M A;  2C37 A;  4OO1 D;  1ELO A;  5A2Q Q;  4JI5 I;  2BA1 G;  2C38 A;  1HNW I;  4X65 I;  1ZXN A;  4DPW A;  4DUZ I;  2JEB B;  4JI2 E;  5JEA C;  2O3Z A;  2A2D A;  4NXM I;  1YH8 A;  1UDN A;  2PO2 B;  4DV1 E;  3CWV A;  1S16 A;  1Z5A A;  4JI1 E;  4WUD A;  5C0X E;  5IWA I;  2C39 A; 
#chains in the Genus database with same CATH homology
 2PNZ B;  1E3P A;  3CDJ A;  2BA0 D;  3L7Z A;  2PO2 A;  4BA2 A;  2BR2 B;  2WP8 B;  4OO1 A;  1R6L A;  5K36 C;  2PNZ A;  1UDQ A;  4OO1 E;  1OYR A;  1OYP A;  3H1C A;  2NN6 B;  2WP8 A;  5K36 D;  2JE6 B;  4IFD C;  5JEA D;  2JEB A;  5K36 F;  3B4T A;  3GCM A;  4AM3 A;  5JEA F;  2NN6 D;  4AID A;  5C0X D;  4IFD D;  2NN6 F;  5K36 B;  5C0X F;  4IFD F;  5JEA B;  3HKM A;  4BA1 B;  2JEA B;  1OYS A;  4OO1 C;  4AIM A;  1UDS A;  2BR2 A;  3CDI A;  5C0X B;  4IFD B;  2PO0 B;  2PO1 B;  5K36 A;  1UDO A;  5JEA A;  2JEA A;  3M85 G;  2C39 B;  3M7N G;  2NN6 A;  5C0X A;  4IFD A;  2C37 B;  2JE6 A;  2PO1 A;  2BA1 D;  4BA2 B;  2NN6 E;  3U1K A;  2C39 A;  4OO1 B;  3M85 D;  3DD6 A;  2C38 B;  3M7N D;  4NBQ A;  2WNR B;  1R6M A;  2C37 A;  3KRN A;  4OO1 D;  3GME A;  2BA1 G;  4BA1 A;  2C38 A;  4OO1 F;  5K36 E;  1E3H A;  2JEB B;  5JEA E;  5JEA C;  3L7Z B;  2WNR A;  2PO0 A;  2BA0 G;  1UDN A;  2PO2 B;  3GLL A;  5C0X E;  2NN6 C;  4IFD E;  5C0X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...