5JEAE

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
266
structure length
256
Chain Sequence
HMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLILPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 60
structure length 256
sequence length 266
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaE00
3GLLA 4IFDA 3CDJA 2PO1A 1UDOA 2BA1D 2BA1G 5C0XC 2C38A 4OO1A 4IFDE 2NN6B 4OO1E 5JEAA 4BA2B 4IFDB 2PNZA 1E3PA 4AM3A 3GCMA 3M85D 1OYRA 5JEAE 4IFDD 4BA1B 3M85G 4OO1B 2JEAA 5K36C 4OO1D 2PO0A 1R6LA 4IFDF 1OYSA 2JE6A 5JEAB 3HKMA 2PNZB 2BA0D 4AIMA 2BA0G 2JEBA 2C37A 4OO1F 2BR2B 5JEAD 2WNRB 2C39A 5JEAF 4NBQA 2NN6C 2JEBB 2C37B 5C0XA 3GMEA 2PO1B 3KRNA 5C0XE 2C38B 3U1KA 1UDSA 5C0XB 2PO2A 5K36A 5C0XD 3DD6A 1OYPA 2JEAB 5K36E 3H1CA 3L7ZA 2PO0B 5C0XF 2JE6B 2PO2B 4IFDC 3M7ND 5K36D 3M7NG 2NN6A 2C39B 3CDIA 3L7ZB 4OO1C 4BA2A 2NN6E 5K36F 1E3HA 5JEAC 4BA1A 1UDQA 4AIDA 2WP8A 2NN6D 2BR2A 1R6MA 2NN6F 5K36B 2WP8B 2WNRA 3B4TA 1UDNA
chains in the Genus database with same CATH superfamily
2XEXA 1FNMA 2BM0A 4B3ME 4DUZE 4IFDA 2Z5BA 3ZKBA 4ED4A 4JI3I 1ZM3A 3CDJA 4DR7E 2PO1A 4JI6E 4OO1A 4FW4A 2F4VE 1RR9A 4USMA 5JEAA 4PRXA 4DV5E 2V2QA 4LFBE 4DPXA 4FW9A 3J81Q 4WUCA 4LF9E 4LFCI 4DR4I 1HR0E 5IT9C 1R6LA 2V2ZA 1U2RA 1P42A 2JE6A 2PNZB 3D4JA 2BA0D 2UUBI 4P52A 2BA0G 5BR8E 2C37A 2BR2B 4FN5A 4B3TI 3NZKA 1Z0EA 2WNRB 3U1YA 1ZXNA 4JI8E 4LOMA 4FWGA 2VQFE 4LCGA 4JV5I 2Z5CA 3T1YI 2UXCI 3WU4A 5DNLA 4DR6I 2IOQA 5C0XB 4K0KI 4YY3I 2UXBE 1Z5BA 5DRRA 4YHHE 3LNUA 2O1UA 3DD6A 4B3SE 3OTOE 5K36E 1KIJA 2PNMA 4IZKB 3ZZ0A 1S16A 2GO4A 4LF6I 4DPUA 1HNXE 1XMOE 4X65I 1XHKA 1NZ0A 5LMUI 4MQYA 2F1DA 1HNWE 5FLXC 1Z0TA 2BM1A 4LF8I 2NN6A 2C39B 3CWVA 1A6FA 1E3HA 1N33I 2Q2EB 1Z0CA 4JI7I 4PU9A 2NPFA 4M1KA 1MU5A 3WU6A 4FW6A 4DUYI 1IBLI 4AIDA 4KHPE 4IS9A 4PRVA 1KKHA 4B3RI 4LF4E 1PIEA 2HHHE 2WP8B 4KQVA 1RHYA 2O1TA 4JG4A 4MYUA 1UDNA 4MYTA 1XMQI 2EFGA 3Q1QA 1N36E 4GKJE 2A2CA 5C0XC 1XNRI 2ZBKB 2ZM6I 3JAMQ 1DARA 1USVA 5LMNI 4DV2I 4MU4A 2VQEI 4BA2B 1OJ4A 4JI2E 4IFDB 2CZ9A 3P3CA 4HYMA 4LF5I 1Z0VA 2UU9I 1OYRA 4NXNI 4OO1B 1Z0BA 1KTVA 2JEAA 2IESA 1Z5CA 5JEAB 3J7AM 3HKMA 3Q6MA 4DR1E 5DNXA 2CGEA 2JEBA 1B63A 5ELWA 4U3DA 4IZJA 4JI1I 3WU5A 1I94E 1J5EI 4X64I 4LFCE 2C37B 4ZVIA 2V8PA 3PYEA 3T1HE 3J81C 4DR3I 1H7SA 4QNKA 5FWKA 2C38B 4MU3A 5L3JA 3U1KA 4HY1A 5A2QQ 1PKPA 1Y60A 1K47A 2WW4A 2IOPA 4LFAE 3LTOA 2UUAE 2PO2A 5K36A 5C0XD 4B3MI 4DUZI 1OYPA 1ZXMA 4USKA 4DR7I 2UUCE 3L7ZA 2PO0B 4FW3A 5C0XF 4MDTA 4JI6I 4I3HA 4DU8A 4FWDA 4IFDC 3K85A 4DR6E 1IBMI 2E1RA 4DV5I 1N34E 4LFBI 3CDIA 4OO1C 1Z5AA 4JI4E 1RREA 1HR0I 2BV3A 1HNZI 5JEAC 3J80C 4DV0E 4LF6E 4JI5I 4AQYE 2ZITA 1IBKI 4QNJA 2J65A 2UXDE 1XNQE 2X36A 3K17A 3PS2A 4DV3E 4LF8E 3PYGA 4OX9E 2BR2A 3ZKDA 1FKAE 1VI7A 4EMDA 2VQFI 4DV6E 4GKKE 1N33E 2WNRA 3B4TA 5GMDA 4OZEA 4DUYE 4WUBA 3GLLA 4LF7E 5GMEA 4FW7A 5DRQA 1N32E 1ZM2A 2BA1D 2BA1G 4B3RE 2UXBI 1ZM9A 4YHHI 1Y6ZA 4B3SI 1S4EA 4DPYA 2O1VA 1FI4A 4LCHA 3OTOI 2X7IA 4NXME 4JI0E 2J7KA 4IFDD 4BA1B 5FLXQ 4ISAA 1HNXI 1XMOI 4X62E 4XTJA 5EL9A 4OO1D 1EA6A 3PS3A 4IFDF 4DR5I 1XNRE 1OYSA 1NHJA 2ZM6E 4URLA 4OO1F 5JEAD 4HXZA 4DV2E 3V2UC 2VQEE 1HK7A 3JAMC 3J7AG 2C39A 5JEAF 2UU9E 2AE8A 2NN6C 4DV7I 4KHPI 4JYAE 2JEBB 1BKNA 3P06A 2Z5BB 4DR2E 3ZM7A 2PO1B 4FW5A 5C0XE 4OKGA 4LF4I 4JI3E 1WUUA 1MG7A 2HKJA 1UDSA 4JI1E 5IWAI 3M6AA 4DV1I 3PRYA 2V34A 5EKWA 1J5EE 3LPSA 2Z5EA 3H4LA 1N36I 4HACA 3GONA 2JE6B 1H74A 2E5LI 1FJGI 2V2VA 4DR4E 1QZRA 1NHIA 2PO2B 3QT5A 1NHHA 2UUBE 3L7ZB 2VF3A 4B3TE 4WUDA 4BA2A 3QT6A 1MX0A 1Z59A 2R42A 3F0NA 4DV4I 2GQ0A 4X66I 2Z5CB 2HFSA 3QT7A 4DR1I 5DROA 4DPWA 2IERA 4JV5E 2HKEA 4DXLA 3UHMA 4DU7A 1IBME 2NN6D 3T1YE 1N0VC 3PYFA 4MU0A 2UXCE 2F4VI 4UTGA 1PVGA 2CVEA 5LL6R 2NN6F 4Z7YA 3P76A 1I94I 3T1HI 1HNZE 4K0KE 4YY3E 3PS1A 4JI5E 4J3DA 5IT9Q 4R1FA 1IBKE 4LF9I 3P3EA 1UDOA 3QT8A 2HFUA 2C38A 4IFDE 4X65E 2NN6B 5LMUE 5BR8I 4LFAI 2UUAI 4OO1E 3Q6NA 2PNZA 2UUCI 1E3PA 4AM3A 3GCMA 3M85D 4JI8I 5JEAE 3M85G 2HK3A 2O1WA 5K36C 4LCFA 3ZZUA 2OI2A 2PO0A 4JI7E 2VESA 1IBLE 1FWLA 1N34I 4AIMA 3J80Q 1Z0GA 4N3OA 5DRPA 4JI4I 1H7UA 1VISA 1KVKA 4NBQA 4DV0I 3B78A 1ZM4A 4AQYI 3V5RA 5C0XA 2UXDI 4FWHA 1XXEA 1XNQI 3GMEA 4DR5E 1Y5YA 1N0UA 3KRNA 4DV3I 1H73A 4P7AA 1ELOA 4OX9I 1XMQE 2R3VA 2JT2A 1H72C 3K1JA 4IZJD 4IZKA 4GKKI 4DV6I 1HNWI 2AJ4A 4RPFA 1YH8A 3B82A 3HULA 5LMNE 4DV7E 2LJPA 2PNLA 1YHCA 4LF7I 2JEAB 1N32I 4LF5E 3H1CA 4LPFA 4NXNE 1Y4UA 3HJCA 2DEJA 1B62A 1EI1A 1UEKA 1USUA 3M7ND 3WU3A 5IWAE 4DV1E 3M7NG 5K36D 4IZJB 4NXMI 4JI0I 4HACB 4U3BA 2HHHI 2NN6E 4X62I 2HK2A 5K36F 2DEIA 3ZZTA 4BA1A 1UDQA 2GO3A 2A2DA 2E5LE 3PYDA 1FJGE 4MU1A 2WP8A 3B8HA 4X64E 2O3ZA 3P3GA 4DPTA 4DR3E 2GS8A 4Z7CA 4GKJI 1Z0WA 1FWKA 1R6MA 5K36B 4JYAI 1D6TA 4GQUA 4JI2I 1Y4SA 4DV4E 4DR2I 2CG9A 4UT4A 4X66E 5A2QC
chains in the Genus database with same CATH topology
3GLLA 4IFDA 3CDJA 2PO1A 1UDOA 2BA1D 2BA1G 5C0XC 2C38A 4OO1A 4IFDE 2NN6B 4OO1E 5JEAA 4BA2B 4IFDB 2PNZA 1E3PA 4AM3A 3GCMA 3M85D 1OYRA 5JEAE 4IFDD 4BA1B 3M85G 4OO1B 2JEAA 5K36C 4OO1D 2PO0A 1R6LA 4IFDF 1OYSA 2JE6A 5JEAB 3HKMA 2PNZB 2BA0D 4AIMA 2BA0G 2JEBA 2C37A 4OO1F 2BR2B 5JEAD 2WNRB 2C39A 5JEAF 4NBQA 2NN6C 2JEBB 2C37B 5C0XA 3GMEA 2PO1B 3KRNA 5C0XE 2C38B 3U1KA 1UDSA 5C0XB 2PO2A 5K36A 5C0XD 3DD6A 1OYPA 2JEAB 5K36E 3H1CA 3L7ZA 2PO0B 5C0XF 2JE6B 2PO2B 4IFDC 3M7ND 5K36D 3M7NG 2NN6A 2C39B 3CDIA 3L7ZB 4OO1C 4BA2A 2NN6E 5K36F 1E3HA 5JEAC 4BA1A 1UDQA 4AIDA 2WP8A 2NN6D 2BR2A 1R6MA 2NN6F 5K36B 2WP8B 2WNRA 3B4TA 1UDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLL A;  4IFD A;  3CDJ A;  2PO1 A;  1UDO A;  2BA1 D;  2BA1 G;  5C0X C;  2C38 A;  4OO1 A;  4IFD E;  2NN6 B;  4OO1 E;  5JEA A;  4BA2 B;  4IFD B;  2PNZ A;  1E3P A;  4AM3 A;  3GCM A;  3M85 D;  1OYR A;  5JEA E;  4IFD D;  4BA1 B;  3M85 G;  4OO1 B;  2JEA A;  5K36 C;  4OO1 D;  2PO0 A;  1R6L A;  4IFD F;  1OYS A;  2JE6 A;  5JEA B;  3HKM A;  2PNZ B;  2BA0 D;  4AIM A;  2BA0 G;  2JEB A;  2C37 A;  4OO1 F;  2BR2 B;  5JEA D;  2WNR B;  2C39 A;  5JEA F;  4NBQ A;  2NN6 C;  2JEB B;  2C37 B;  5C0X A;  3GME A;  2PO1 B;  3KRN A;  5C0X E;  2C38 B;  3U1K A;  1UDS A;  5C0X B;  2PO2 A;  5K36 A;  5C0X D;  3DD6 A;  1OYP A;  2JEA B;  5K36 E;  3H1C A;  3L7Z A;  2PO0 B;  5C0X F;  2JE6 B;  2PO2 B;  4IFD C;  3M7N D;  5K36 D;  3M7N G;  2NN6 A;  2C39 B;  3CDI A;  3L7Z B;  4OO1 C;  4BA2 A;  2NN6 E;  5K36 F;  1E3H A;  5JEA C;  4BA1 A;  1UDQ A;  4AID A;  2WP8 A;  2NN6 D;  2BR2 A;  1R6M A;  2NN6 F;  5K36 B;  2WP8 B;  2WNR A;  3B4T A;  1UDN A; 
#chains in the Genus database with same CATH topology
 2XEX A;  1FNM A;  2BM0 A;  4B3M E;  4DUZ E;  4IFD A;  2Z5B A;  3ZKB A;  4ED4 A;  4JI3 I;  1ZM3 A;  3CDJ A;  4DR7 E;  2PO1 A;  4JI6 E;  4OO1 A;  4FW4 A;  2F4V E;  1RR9 A;  4USM A;  5JEA A;  4PRX A;  4DV5 E;  2V2Q A;  4LFB E;  4DPX A;  4FW9 A;  3J81 Q;  4WUC A;  4LF9 E;  4LFC I;  4DR4 I;  1HR0 E;  5IT9 C;  1R6L A;  2V2Z A;  1U2R A;  1P42 A;  2JE6 A;  2PNZ B;  3D4J A;  2BA0 D;  2UUB I;  4P52 A;  2BA0 G;  5BR8 E;  2C37 A;  2BR2 B;  4FN5 A;  4B3T I;  3NZK A;  1Z0E A;  2WNR B;  3U1Y A;  1ZXN A;  4JI8 E;  4LOM A;  4FWG A;  2VQF E;  4LCG A;  4JV5 I;  2Z5C A;  3T1Y I;  2UXC I;  3WU4 A;  5DNL A;  4DR6 I;  2IOQ A;  5C0X B;  4K0K I;  4YY3 I;  2UXB E;  1Z5B A;  5DRR A;  4YHH E;  3LNU A;  2O1U A;  3DD6 A;  4B3S E;  3OTO E;  5K36 E;  1KIJ A;  2PNM A;  4IZK B;  3ZZ0 A;  1S16 A;  2GO4 A;  4LF6 I;  4DPU A;  1HNX E;  1XMO E;  4X65 I;  1XHK A;  1NZ0 A;  5LMU I;  4MQY A;  2F1D A;  1HNW E;  5FLX C;  1Z0T A;  2BM1 A;  4LF8 I;  2NN6 A;  2C39 B;  3CWV A;  1A6F A;  1E3H A;  1N33 I;  2Q2E B;  1Z0C A;  4JI7 I;  4PU9 A;  2NPF A;  4M1K A;  1MU5 A;  3WU6 A;  4FW6 A;  4DUY I;  1IBL I;  4AID A;  4KHP E;  4IS9 A;  4PRV A;  1KKH A;  4B3R I;  4LF4 E;  1PIE A;  2HHH E;  2WP8 B;  4KQV A;  1RHY A;  2O1T A;  4JG4 A;  4MYU A;  1UDN A;  4MYT A;  1XMQ I;  2EFG A;  3Q1Q A;  1N36 E;  4GKJ E;  2A2C A;  5C0X C;  1XNR I;  2ZBK B;  2ZM6 I;  3JAM Q;  1DAR A;  1USV A;  5LMN I;  4DV2 I;  4MU4 A;  2VQE I;  4BA2 B;  1OJ4 A;  4JI2 E;  4IFD B;  2CZ9 A;  3P3C A;  4HYM A;  4LF5 I;  1Z0V A;  2UU9 I;  1OYR A;  4NXN I;  4OO1 B;  1Z0B A;  1KTV A;  2JEA A;  2IES A;  1Z5C A;  5JEA B;  3J7A M;  3HKM A;  3Q6M A;  4DR1 E;  5DNX A;  2CGE A;  2JEB A;  1B63 A;  5ELW A;  4U3D A;  4IZJ A;  4JI1 I;  3WU5 A;  1I94 E;  1J5E I;  4X64 I;  4LFC E;  2C37 B;  4ZVI A;  2V8P A;  3PYE A;  3T1H E;  3J81 C;  4DR3 I;  1H7S A;  4QNK A;  5FWK A;  2C38 B;  4MU3 A;  5L3J A;  3U1K A;  4HY1 A;  5A2Q Q;  1PKP A;  1Y60 A;  1K47 A;  2WW4 A;  2IOP A;  4LFA E;  3LTO A;  2UUA E;  2PO2 A;  5K36 A;  5C0X D;  4B3M I;  4DUZ I;  1OYP A;  1ZXM A;  4USK A;  4DR7 I;  2UUC E;  3L7Z A;  2PO0 B;  4FW3 A;  5C0X F;  4MDT A;  4JI6 I;  4I3H A;  4DU8 A;  4FWD A;  4IFD C;  3K85 A;  4DR6 E;  1IBM I;  2E1R A;  4DV5 I;  1N34 E;  4LFB I;  3CDI A;  4OO1 C;  1Z5A A;  4JI4 E;  1RRE A;  1HR0 I;  2BV3 A;  1HNZ I;  5JEA C;  3J80 C;  4DV0 E;  4LF6 E;  4JI5 I;  4AQY E;  2ZIT A;  1IBK I;  4QNJ A;  2J65 A;  2UXD E;  1XNQ E;  2X36 A;  3K17 A;  3PS2 A;  4DV3 E;  4LF8 E;  3PYG A;  4OX9 E;  2BR2 A;  3ZKD A;  1FKA E;  1VI7 A;  4EMD A;  2VQF I;  4DV6 E;  4GKK E;  1N33 E;  2WNR A;  3B4T A;  5GMD A;  4OZE A;  4DUY E;  4WUB A;  3GLL A;  4LF7 E;  5GME A;  4FW7 A;  5DRQ A;  1N32 E;  1ZM2 A;  2BA1 D;  2BA1 G;  4B3R E;  2UXB I;  1ZM9 A;  4YHH I;  1Y6Z A;  4B3S I;  1S4E A;  4DPY A;  2O1V A;  1FI4 A;  4LCH A;  3OTO I;  2X7I A;  4NXM E;  4JI0 E;  2J7K A;  4IFD D;  4BA1 B;  5FLX Q;  4ISA A;  1HNX I;  1XMO I;  4X62 E;  4XTJ A;  5EL9 A;  4OO1 D;  1EA6 A;  3PS3 A;  4IFD F;  4DR5 I;  1XNR E;  1OYS A;  1NHJ A;  2ZM6 E;  4URL A;  4OO1 F;  5JEA D;  4HXZ A;  4DV2 E;  3V2U C;  2VQE E;  1HK7 A;  3JAM C;  3J7A G;  2C39 A;  5JEA F;  2UU9 E;  2AE8 A;  2NN6 C;  4DV7 I;  4KHP I;  4JYA E;  2JEB B;  1BKN A;  3P06 A;  2Z5B B;  4DR2 E;  3ZM7 A;  2PO1 B;  4FW5 A;  5C0X E;  4OKG A;  4LF4 I;  4JI3 E;  1WUU A;  1MG7 A;  2HKJ A;  1UDS A;  4JI1 E;  5IWA I;  3M6A A;  4DV1 I;  3PRY A;  2V34 A;  5EKW A;  1J5E E;  3LPS A;  2Z5E A;  3H4L A;  1N36 I;  4HAC A;  3GON A;  2JE6 B;  1H74 A;  2E5L I;  1FJG I;  2V2V A;  4DR4 E;  1QZR A;  1NHI A;  2PO2 B;  3QT5 A;  1NHH A;  2UUB E;  3L7Z B;  2VF3 A;  4B3T E;  4WUD A;  4BA2 A;  3QT6 A;  1MX0 A;  1Z59 A;  2R42 A;  3F0N A;  4DV4 I;  2GQ0 A;  4X66 I;  2Z5C B;  2HFS A;  3QT7 A;  4DR1 I;  5DRO A;  4DPW A;  2IER A;  4JV5 E;  2HKE A;  4DXL A;  3UHM A;  4DU7 A;  1IBM E;  2NN6 D;  3T1Y E;  1N0V C;  3PYF A;  4MU0 A;  2UXC E;  2F4V I;  4UTG A;  1PVG A;  2CVE A;  5LL6 R;  2NN6 F;  4Z7Y A;  3P76 A;  1I94 I;  3T1H I;  1HNZ E;  4K0K E;  4YY3 E;  3PS1 A;  4JI5 E;  4J3D A;  5IT9 Q;  4R1F A;  1IBK E;  4LF9 I;  3P3E A;  1UDO A;  3QT8 A;  2HFU A;  2C38 A;  4IFD E;  4X65 E;  2NN6 B;  5LMU E;  5BR8 I;  4LFA I;  2UUA I;  4OO1 E;  3Q6N A;  2PNZ A;  2UUC I;  1E3P A;  4AM3 A;  3GCM A;  3M85 D;  4JI8 I;  5JEA E;  3M85 G;  2HK3 A;  2O1W A;  5K36 C;  4LCF A;  3ZZU A;  2OI2 A;  2PO0 A;  4JI7 E;  2VES A;  1IBL E;  1FWL A;  1N34 I;  4AIM A;  3J80 Q;  1Z0G A;  4N3O A;  5DRP A;  4JI4 I;  1H7U A;  1VIS A;  1KVK A;  4NBQ A;  4DV0 I;  3B78 A;  1ZM4 A;  4AQY I;  3V5R A;  5C0X A;  2UXD I;  4FWH A;  1XXE A;  1XNQ I;  3GME A;  4DR5 E;  1Y5Y A;  1N0U A;  3KRN A;  4DV3 I;  1H73 A;  4P7A A;  1ELO A;  4OX9 I;  1XMQ E;  2R3V A;  2JT2 A;  1H72 C;  3K1J A;  4IZJ D;  4IZK A;  4GKK I;  4DV6 I;  1HNW I;  2AJ4 A;  4RPF A;  1YH8 A;  3B82 A;  3HUL A;  5LMN E;  4DV7 E;  2LJP A;  2PNL A;  1YHC A;  4LF7 I;  2JEA B;  1N32 I;  4LF5 E;  3H1C A;  4LPF A;  4NXN E;  1Y4U A;  3HJC A;  2DEJ A;  1B62 A;  1EI1 A;  1UEK A;  1USU A;  3M7N D;  3WU3 A;  5IWA E;  4DV1 E;  3M7N G;  5K36 D;  4IZJ B;  4NXM I;  4JI0 I;  4HAC B;  4U3B A;  2HHH I;  2NN6 E;  4X62 I;  2HK2 A;  5K36 F;  2DEI A;  3ZZT A;  4BA1 A;  1UDQ A;  2GO3 A;  2A2D A;  2E5L E;  3PYD A;  1FJG E;  4MU1 A;  2WP8 A;  3B8H A;  4X64 E;  2O3Z A;  3P3G A;  4DPT A;  4DR3 E;  2GS8 A;  4Z7C A;  4GKJ I;  1Z0W A;  1FWK A;  1R6M A;  5K36 B;  4JYA I;  1D6T A;  4GQU A;  4JI2 I;  1Y4S A;  4DV4 E;  4DR2 I;  2CG9 A;  4UT4 A;  4X66 E;  5A2Q C; 
#chains in the Genus database with same CATH homology
 3GLL A;  4IFD A;  3CDJ A;  2PO1 A;  1UDO A;  2BA1 D;  2BA1 G;  5C0X C;  2C38 A;  4OO1 A;  4IFD E;  2NN6 B;  4OO1 E;  5JEA A;  4BA2 B;  4IFD B;  2PNZ A;  1E3P A;  4AM3 A;  3GCM A;  3M85 D;  1OYR A;  5JEA E;  4IFD D;  4BA1 B;  3M85 G;  4OO1 B;  2JEA A;  5K36 C;  4OO1 D;  2PO0 A;  1R6L A;  4IFD F;  1OYS A;  2JE6 A;  5JEA B;  3HKM A;  2PNZ B;  2BA0 D;  4AIM A;  2BA0 G;  2JEB A;  2C37 A;  4OO1 F;  2BR2 B;  5JEA D;  2WNR B;  2C39 A;  5JEA F;  4NBQ A;  2NN6 C;  2JEB B;  2C37 B;  5C0X A;  3GME A;  2PO1 B;  3KRN A;  5C0X E;  2C38 B;  3U1K A;  1UDS A;  5C0X B;  2PO2 A;  5K36 A;  5C0X D;  3DD6 A;  1OYP A;  2JEA B;  5K36 E;  3H1C A;  3L7Z A;  2PO0 B;  5C0X F;  2JE6 B;  2PO2 B;  4IFD C;  3M7N D;  5K36 D;  3M7N G;  2NN6 A;  2C39 B;  3CDI A;  3L7Z B;  4OO1 C;  4BA2 A;  2NN6 E;  5K36 F;  1E3H A;  5JEA C;  4BA1 A;  1UDQ A;  4AID A;  2WP8 A;  2NN6 D;  2BR2 A;  1R6M A;  2NN6 F;  5K36 B;  2WP8 B;  2WNR A;  3B4T A;  1UDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...