5JEAE

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
266
structure length
256
Chain Sequence
HMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLILPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 60
structure length 256
sequence length 266
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01138 RNase_PH 3' exoribonuclease family, domain 1
E PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaE00
2PO2A 1R6MA 3L7ZA 3GLLA 4BA2A 3CDJA 2WNRA 5JEAE 2JEBA 2NN6F 4BA1B 5K36F 2C38A 2JE6A 3B4TA 1E3PA 1UDNA 2BA0D 2BA1D 1R6LA 4OO1F 4IFDF 2C37A 2BA0G 3GCMA 5C0XF 2JEAA 2BR2A 2WP8A 2PO0A 2PNZB 2NN6B 5JEAC 1OYRA 3CDIA 3L7ZB 5K36B 5JEAD 3U1KA 4OO1B 4IFDB 3HKMA 5JEAA 4AIDA 4NBQA 1UDSA 2JEBB 5C0XB 3H1CA 3M85D 3M7ND 3M85G 3KRNA 5JEAF 2C39B 3M7NG 2PO2B 1UDOA 4AM3A 3GMEA 4BA2B 2WNRB 2NN6C 2PO1A 4AIMA 2C38B 2NN6D 5K36D 2JE6B 2NN6E 5K36E 3DD6A 2PNZA 2NN6A 5C0XC 5K36A 4OO1D 2C37B 4IFDD 4OO1E 2JEAB 5C0XD 4IFDE 2BR2B 2WP8B 2PO0B 4OO1A 5C0XE 4IFDA 4BA1A 5C0XA 1OYPA 5K36C 1E3HA 5JEAB 1OYSA 2BA1G 2C39A 2PO1B 1UDQA 4OO1C 4IFDC
chains in the Genus database with same CATH superfamily
4Z7CA 4ED4A 4JI4I 2UUBI 2OI2A 3PRYA 1IBKI 1Y60A 4B3MI 4JI0E 1Y4SA 2PNLA 4UT4A 1FJGE 2E5LE 5K36F 2C38A 1USVA 4DR3I 2EFGA 3B4TA 1XXEA 4WUDA 1XNQI 3OTOI 4DR7E 4DV4I 3LTOA 4LFAE 4DR2I 4KQVA 4R1FA 4IFDF 4LF6E 1FWLA 4JI6I 3GCMA 3WU4A 5C0XF 4JV5E 4B3RE 4LF8E 2HK3A 2GO3A 2WP8A 1RR9A 1ZM3A 4Z7YA 4JI8I 4LF7I 2NN6B 3L7ZB 2IESA 2WW4A 2UUAI 1N36I 5JEAD 4PRVA 1PVGA 5IWAI 1BKNA 3PYDA 4OO1B 4GKKE 1NHIA 4DUZE 4JYAE 4LOMA 4AIDA 4FW7A 4OX9E 4ZVIA 4YY3E 4YHHI 4DR6I 1J5EE 1N34I 4IFDC 3PYGA 4YHHE 4DR6E 3M85G 4USMA 2C39B 3P76A 1Z0CA 1IBLE 1N33I 2O1UA 1Z5BA 4JG4A 1N33E 3QT7A 4DXLA 3J80C 4LF9I 2GQ0A 4X66I 4DR5I 2C38B 2NN6D 4JI5I 4DV3I 1HR0E 4JI5E 3DD6A 2PNZA 4LFBE 3B8HA 2HHHE 4JI3I 4DR1E 4AQYE 4OO1D 4DPTA 2J65A 4JI1I 1XMOE 4DV1E 2WP8B 2VQFI 5DNXA 1VISA 3QT5A 3T1HI 4B3TI 3T1YE 2UXCI 3T1HE 5DRQA 2UUCE 2XEXA 2UXCE 2DEJA 4LPFA 1U2RA 2PO1B 4LF5E 2VQEI 4OO1C 1XMQE 2ZM6I 3L7ZA 3GLLA 5DRRA 4DV2I 2V8PA 2VF3A 3ZZTA 4DV7E 2ZITA 3J80Q 3WU5A 3ZZUA 4GKJI 2F4VE 3P3GA 4X62E 3UHMA 3NZKA 5JEAE 3V2UC 2NN6F 4B3SI 4BA1B 4HXZA 4PU9A 1KTVA 4KHPE 5IT9C 3J7AM 4OKGA 2BA1D 4X65E 2AJ4A 3D4JA 3PYFA 4OO1F 4FW9A 2BM1A 4DV6E 1H7UA 4DPYA 1HNZI 2CZ9A 3ZKDA 1Y4UA 2UXDE 4JI0I 2PNZB 1OYRA 2LJPA 3CDIA 1FJGI 1XNRE 2E5LI 1Z59A 1H7SA 4M1KA 3HKMA 4LF4E 4MYUA 4DR7I 1UDSA 4LCFA 4LFAI 2R3VA 1HK7A 2J7KA 4LF6I 1HNXE 1Z0GA 3H1CA 4MU1A 3M85D 4JV5I 4B3RI 3LNUA 4LF8I 2UU9I 2Q2EB 4FW4A 1KKHA 2UU9E 2IOQA 1ZM2A 4MYTA 1UDOA 5IT9Q 1KVKA 2GS8A 4DU7A 5ELWA 4J3DA 4GKKI 4DUZI 4JI2E 3GMEA 4JYAI 4IZKA 4OX9I 1MU5A 1Z0BA 2CG9A 2PO1A 4AIMA 4NXNE 4YY3I 3QT8A 1J5EI 1H73A 5K36E 3HULA 3JAMC 3Q1QA 2UXBE 1H72C 1P42A 4DV5I 4USKA 1IBLI 4DV5E 2CVEA 4IFDE 1DARA 5C0XE 4BA1A 4N3OA 3K17A 3LPSA 1YH8A 4K0KE 1Y5YA 2PNMA 4WUCA 2HFUA 1S4EA 1OYPA 3J81C 1EA6A 1IBME 5DROA 1HR0I 2F1DA 1OYSA 2E1RA 4LCGA 3ZZ0A 1Z0WA 4DPUA 4DV0E 4HACA 4LFBI 4U3DA 4HY1A 2HHHI 4DR1I 4AQYI 1HNWE 1XMOI 4X64E 4DV1I 2IOPA 5GMEA 4LFCE 5DRPA 5EL9A 5A2QC 1B63A 2WNRA 5BR8I 1NHJA 4NXME 1QZRA 5BR8E 3T1YI 4MDTA 1Z0VA 4PRXA 5GMDA 3JAMQ 2UUCI 2O1VA 3PYEA 1E3PA 2O1TA 4HYMA 2NPFA 4IZKB 2HKEA 4LF5I 2Z5EA 1UEKA 2C37A 2BA0G 2O1WA 1XMQI 4DPXA 3HJCA 2JEAA 2BR2A 2PO0A 4FWGA 4UTGA 3U1YA 4DV7I 2V34A 2F4VI 4X62I 3J81Q 3Q6NA 1NHHA 1KIJA 5LMNE 1I94E 5EKWA 4URLA 4IZJA 4DPWA 3ZM7A 4KHPI 2JEBB 2V2QA 4X65I 4RPFA 1D6TA 4U3BA 4DV6I 3PS1A 4JI7E 2O3ZA 1FKAE 5A2QQ 2UXDI 4HACB 5LMUE 1FNMA 3M7NG 2DEIA 4DR4E 4FW6A 3P3EA 1XNRI 4AM3A 5FLXC 4LF4I 3GONA 2WNRB 1Y6ZA 1WUUA 1HNXI 2BV3A 2NN6E 4DUYE 3PS3A 1Z5CA 5FWKA 5C0XC 1Z0TA 5K36A 2Z5CA 1N0UA 2C37B 3K85A 4OZEA 4OO1E 2JEAB 3V5RA 4JI4E 2BR2B 2UUBE 2PO0B 1NZ0A 1IBKE 1K47A 4IFDA 4B3ME 4JI2I 5C0XA 4MU0A 4FWHA 2Z5BB 1Z5AA 4NXNI 4WUBA 4DR3E 4IZJB 1XNQE 3OTOE 4DU8A 1VI7A 1A6FA 4DV4E 2IERA 4DR2E 1PIEA 2BA1G 1RHYA 2UXBI 1UDQA 4JI6E 2PO2A 1R6MA 3K1JA 5FLXQ 1ELOA 4JI8E 1N32I 1EI1A 4GQUA 1N0VC 1YHCA 4LF7E 3CDJA 4BA2A 1N32E 3QT6A 4FW5A 2UUAE 4K0KI 5LL6R 2A2CA 1N36E 2X36A 2JEBA 3P3CA 5IWAE 3H4LA 4EMDA 1ZXNA 2JE6A 1IBMI 1UDNA 2BA0D 1ZXMA 3F0NA 1MG7A 1R6LA 2ZBKB 5DNLA 4DV0I 4FWDA 1HNWI 2GO4A 2X7IA 4X64I 1N34E 4LFCI 5JEAC 5K36B 5L3JA 4IZJD 2Z5CB 2V2ZA 4NXMI 1B62A 3U1KA 2JT2A 3Q6MA 2AE8A 2A2DA 4IFDB 2V2VA 4MU3A 4MU4A 2R42A 5JEAA 4NBQA 1S16A 5C0XB 3ZKBA 2BM0A 3J7AG 4LF9E 4P52A 1Z0EA 4X66E 4DR5E 2CGEA 4DV3E 3M7ND 3B82A 1H74A 4QNJA 3KRNA 5JEAF 4I3HA 4JI3E 3WU3A 4MQYA 3CWVA 2PO2B 4JI1E 5LMNI 2VQFE 1I94I 2Z5BA 4BA2B 2NN6C 4FW3A 4B3TE 4JI7I 1PKPA 3M6AA 5K36D 2JE6B 1FWKA 2NN6A 4FN5A 1MX0A 2VQEE 5LMUI 2VESA 2HFSA 4DR4I 1USUA 2ZM6E 1OJ4A 3B78A 4IFDD 4DV2E 1ZM4A 5C0XD 3PS2A 1RREA 4OO1A 3P06A 4XTJA 4LCHA 4GKJE 1XHKA 4IS9A 3WU6A 4B3SE 1ZM9A 4ISAA 4P7AA 5K36C 2HKJA 4QNKA 1E3HA 5JEAB 4DUYI 2C39A 1FI4A 2HK2A 1HNZE
chains in the Genus database with same CATH topology
2PO2A 1R6MA 3L7ZA 3GLLA 4BA2A 3CDJA 2WNRA 5JEAE 2JEBA 2NN6F 4BA1B 5K36F 2C38A 2JE6A 3B4TA 1E3PA 1UDNA 2BA0D 2BA1D 1R6LA 4OO1F 4IFDF 2C37A 2BA0G 3GCMA 5C0XF 2JEAA 2BR2A 2WP8A 2PO0A 2PNZB 2NN6B 5JEAC 1OYRA 3CDIA 3L7ZB 5K36B 5JEAD 3U1KA 4OO1B 4IFDB 3HKMA 5JEAA 4AIDA 4NBQA 1UDSA 2JEBB 5C0XB 3H1CA 3M85D 3M7ND 3M85G 3KRNA 5JEAF 2C39B 3M7NG 2PO2B 1UDOA 4AM3A 3GMEA 4BA2B 2WNRB 2NN6C 2PO1A 4AIMA 2C38B 2NN6D 5K36D 2JE6B 2NN6E 5K36E 3DD6A 2PNZA 2NN6A 5C0XC 5K36A 4OO1D 2C37B 4IFDD 4OO1E 2JEAB 5C0XD 4IFDE 2BR2B 2WP8B 2PO0B 4OO1A 5C0XE 4IFDA 4BA1A 5C0XA 1OYPA 5K36C 1E3HA 5JEAB 1OYSA 2BA1G 2C39A 2PO1B 1UDQA 4OO1C 4IFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PO2 A;  1R6M A;  3L7Z A;  3GLL A;  4BA2 A;  3CDJ A;  2WNR A;  5JEA E;  2JEB A;  2NN6 F;  4BA1 B;  5K36 F;  2C38 A;  2JE6 A;  3B4T A;  1E3P A;  1UDN A;  2BA0 D;  2BA1 D;  1R6L A;  4OO1 F;  4IFD F;  2C37 A;  2BA0 G;  3GCM A;  5C0X F;  2JEA A;  2BR2 A;  2WP8 A;  2PO0 A;  2PNZ B;  2NN6 B;  5JEA C;  1OYR A;  3CDI A;  3L7Z B;  5K36 B;  5JEA D;  3U1K A;  4OO1 B;  4IFD B;  3HKM A;  5JEA A;  4AID A;  4NBQ A;  1UDS A;  2JEB B;  5C0X B;  3H1C A;  3M85 D;  3M7N D;  3M85 G;  3KRN A;  5JEA F;  2C39 B;  3M7N G;  2PO2 B;  1UDO A;  4AM3 A;  3GME A;  4BA2 B;  2WNR B;  2NN6 C;  2PO1 A;  4AIM A;  2C38 B;  2NN6 D;  5K36 D;  2JE6 B;  2NN6 E;  5K36 E;  3DD6 A;  2PNZ A;  2NN6 A;  5C0X C;  5K36 A;  4OO1 D;  2C37 B;  4IFD D;  4OO1 E;  2JEA B;  5C0X D;  4IFD E;  2BR2 B;  2WP8 B;  2PO0 B;  4OO1 A;  5C0X E;  4IFD A;  4BA1 A;  5C0X A;  1OYP A;  5K36 C;  1E3H A;  5JEA B;  1OYS A;  2BA1 G;  2C39 A;  2PO1 B;  1UDQ A;  4OO1 C;  4IFD C; 
#chains in the Genus database with same CATH topology
 4Z7C A;  4ED4 A;  4JI4 I;  2UUB I;  2OI2 A;  3PRY A;  1IBK I;  1Y60 A;  4B3M I;  4JI0 E;  1Y4S A;  2PNL A;  4UT4 A;  1FJG E;  2E5L E;  5K36 F;  2C38 A;  1USV A;  4DR3 I;  2EFG A;  3B4T A;  1XXE A;  4WUD A;  1XNQ I;  3OTO I;  4DR7 E;  4DV4 I;  3LTO A;  4LFA E;  4DR2 I;  4KQV A;  4R1F A;  4IFD F;  4LF6 E;  1FWL A;  4JI6 I;  3GCM A;  3WU4 A;  5C0X F;  4JV5 E;  4B3R E;  4LF8 E;  2HK3 A;  2GO3 A;  2WP8 A;  1RR9 A;  1ZM3 A;  4Z7Y A;  4JI8 I;  4LF7 I;  2NN6 B;  3L7Z B;  2IES A;  2WW4 A;  2UUA I;  1N36 I;  5JEA D;  4PRV A;  1PVG A;  5IWA I;  1BKN A;  3PYD A;  4OO1 B;  4GKK E;  1NHI A;  4DUZ E;  4JYA E;  4LOM A;  4AID A;  4FW7 A;  4OX9 E;  4ZVI A;  4YY3 E;  4YHH I;  4DR6 I;  1J5E E;  1N34 I;  4IFD C;  3PYG A;  4YHH E;  4DR6 E;  3M85 G;  4USM A;  2C39 B;  3P76 A;  1Z0C A;  1IBL E;  1N33 I;  2O1U A;  1Z5B A;  4JG4 A;  1N33 E;  3QT7 A;  4DXL A;  3J80 C;  4LF9 I;  2GQ0 A;  4X66 I;  4DR5 I;  2C38 B;  2NN6 D;  4JI5 I;  4DV3 I;  1HR0 E;  4JI5 E;  3DD6 A;  2PNZ A;  4LFB E;  3B8H A;  2HHH E;  4JI3 I;  4DR1 E;  4AQY E;  4OO1 D;  4DPT A;  2J65 A;  4JI1 I;  1XMO E;  4DV1 E;  2WP8 B;  2VQF I;  5DNX A;  1VIS A;  3QT5 A;  3T1H I;  4B3T I;  3T1Y E;  2UXC I;  3T1H E;  5DRQ A;  2UUC E;  2XEX A;  2UXC E;  2DEJ A;  4LPF A;  1U2R A;  2PO1 B;  4LF5 E;  2VQE I;  4OO1 C;  1XMQ E;  2ZM6 I;  3L7Z A;  3GLL A;  5DRR A;  4DV2 I;  2V8P A;  2VF3 A;  3ZZT A;  4DV7 E;  2ZIT A;  3J80 Q;  3WU5 A;  3ZZU A;  4GKJ I;  2F4V E;  3P3G A;  4X62 E;  3UHM A;  3NZK A;  5JEA E;  3V2U C;  2NN6 F;  4B3S I;  4BA1 B;  4HXZ A;  4PU9 A;  1KTV A;  4KHP E;  5IT9 C;  3J7A M;  4OKG A;  2BA1 D;  4X65 E;  2AJ4 A;  3D4J A;  3PYF A;  4OO1 F;  4FW9 A;  2BM1 A;  4DV6 E;  1H7U A;  4DPY A;  1HNZ I;  2CZ9 A;  3ZKD A;  1Y4U A;  2UXD E;  4JI0 I;  2PNZ B;  1OYR A;  2LJP A;  3CDI A;  1FJG I;  1XNR E;  2E5L I;  1Z59 A;  1H7S A;  4M1K A;  3HKM A;  4LF4 E;  4MYU A;  4DR7 I;  1UDS A;  4LCF A;  4LFA I;  2R3V A;  1HK7 A;  2J7K A;  4LF6 I;  1HNX E;  1Z0G A;  3H1C A;  4MU1 A;  3M85 D;  4JV5 I;  4B3R I;  3LNU A;  4LF8 I;  2UU9 I;  2Q2E B;  4FW4 A;  1KKH A;  2UU9 E;  2IOQ A;  1ZM2 A;  4MYT A;  1UDO A;  5IT9 Q;  1KVK A;  2GS8 A;  4DU7 A;  5ELW A;  4J3D A;  4GKK I;  4DUZ I;  4JI2 E;  3GME A;  4JYA I;  4IZK A;  4OX9 I;  1MU5 A;  1Z0B A;  2CG9 A;  2PO1 A;  4AIM A;  4NXN E;  4YY3 I;  3QT8 A;  1J5E I;  1H73 A;  5K36 E;  3HUL A;  3JAM C;  3Q1Q A;  2UXB E;  1H72 C;  1P42 A;  4DV5 I;  4USK A;  1IBL I;  4DV5 E;  2CVE A;  4IFD E;  1DAR A;  5C0X E;  4BA1 A;  4N3O A;  3K17 A;  3LPS A;  1YH8 A;  4K0K E;  1Y5Y A;  2PNM A;  4WUC A;  2HFU A;  1S4E A;  1OYP A;  3J81 C;  1EA6 A;  1IBM E;  5DRO A;  1HR0 I;  2F1D A;  1OYS A;  2E1R A;  4LCG A;  3ZZ0 A;  1Z0W A;  4DPU A;  4DV0 E;  4HAC A;  4LFB I;  4U3D A;  4HY1 A;  2HHH I;  4DR1 I;  4AQY I;  1HNW E;  1XMO I;  4X64 E;  4DV1 I;  2IOP A;  5GME A;  4LFC E;  5DRP A;  5EL9 A;  5A2Q C;  1B63 A;  2WNR A;  5BR8 I;  1NHJ A;  4NXM E;  1QZR A;  5BR8 E;  3T1Y I;  4MDT A;  1Z0V A;  4PRX A;  5GMD A;  3JAM Q;  2UUC I;  2O1V A;  3PYE A;  1E3P A;  2O1T A;  4HYM A;  2NPF A;  4IZK B;  2HKE A;  4LF5 I;  2Z5E A;  1UEK A;  2C37 A;  2BA0 G;  2O1W A;  1XMQ I;  4DPX A;  3HJC A;  2JEA A;  2BR2 A;  2PO0 A;  4FWG A;  4UTG A;  3U1Y A;  4DV7 I;  2V34 A;  2F4V I;  4X62 I;  3J81 Q;  3Q6N A;  1NHH A;  1KIJ A;  5LMN E;  1I94 E;  5EKW A;  4URL A;  4IZJ A;  4DPW A;  3ZM7 A;  4KHP I;  2JEB B;  2V2Q A;  4X65 I;  4RPF A;  1D6T A;  4U3B A;  4DV6 I;  3PS1 A;  4JI7 E;  2O3Z A;  1FKA E;  5A2Q Q;  2UXD I;  4HAC B;  5LMU E;  1FNM A;  3M7N G;  2DEI A;  4DR4 E;  4FW6 A;  3P3E A;  1XNR I;  4AM3 A;  5FLX C;  4LF4 I;  3GON A;  2WNR B;  1Y6Z A;  1WUU A;  1HNX I;  2BV3 A;  2NN6 E;  4DUY E;  3PS3 A;  1Z5C A;  5FWK A;  5C0X C;  1Z0T A;  5K36 A;  2Z5C A;  1N0U A;  2C37 B;  3K85 A;  4OZE A;  4OO1 E;  2JEA B;  3V5R A;  4JI4 E;  2BR2 B;  2UUB E;  2PO0 B;  1NZ0 A;  1IBK E;  1K47 A;  4IFD A;  4B3M E;  4JI2 I;  5C0X A;  4MU0 A;  4FWH A;  2Z5B B;  1Z5A A;  4NXN I;  4WUB A;  4DR3 E;  4IZJ B;  1XNQ E;  3OTO E;  4DU8 A;  1VI7 A;  1A6F A;  4DV4 E;  2IER A;  4DR2 E;  1PIE A;  2BA1 G;  1RHY A;  2UXB I;  1UDQ A;  4JI6 E;  2PO2 A;  1R6M A;  3K1J A;  5FLX Q;  1ELO A;  4JI8 E;  1N32 I;  1EI1 A;  4GQU A;  1N0V C;  1YHC A;  4LF7 E;  3CDJ A;  4BA2 A;  1N32 E;  3QT6 A;  4FW5 A;  2UUA E;  4K0K I;  5LL6 R;  2A2C A;  1N36 E;  2X36 A;  2JEB A;  3P3C A;  5IWA E;  3H4L A;  4EMD A;  1ZXN A;  2JE6 A;  1IBM I;  1UDN A;  2BA0 D;  1ZXM A;  3F0N A;  1MG7 A;  1R6L A;  2ZBK B;  5DNL A;  4DV0 I;  4FWD A;  1HNW I;  2GO4 A;  2X7I A;  4X64 I;  1N34 E;  4LFC I;  5JEA C;  5K36 B;  5L3J A;  4IZJ D;  2Z5C B;  2V2Z A;  4NXM I;  1B62 A;  3U1K A;  2JT2 A;  3Q6M A;  2AE8 A;  2A2D A;  4IFD B;  2V2V A;  4MU3 A;  4MU4 A;  2R42 A;  5JEA A;  4NBQ A;  1S16 A;  5C0X B;  3ZKB A;  2BM0 A;  3J7A G;  4LF9 E;  4P52 A;  1Z0E A;  4X66 E;  4DR5 E;  2CGE A;  4DV3 E;  3M7N D;  3B82 A;  1H74 A;  4QNJ A;  3KRN A;  5JEA F;  4I3H A;  4JI3 E;  3WU3 A;  4MQY A;  3CWV A;  2PO2 B;  4JI1 E;  5LMN I;  2VQF E;  1I94 I;  2Z5B A;  4BA2 B;  2NN6 C;  4FW3 A;  4B3T E;  4JI7 I;  1PKP A;  3M6A A;  5K36 D;  2JE6 B;  1FWK A;  2NN6 A;  4FN5 A;  1MX0 A;  2VQE E;  5LMU I;  2VES A;  2HFS A;  4DR4 I;  1USU A;  2ZM6 E;  1OJ4 A;  3B78 A;  4IFD D;  4DV2 E;  1ZM4 A;  5C0X D;  3PS2 A;  1RRE A;  4OO1 A;  3P06 A;  4XTJ A;  4LCH A;  4GKJ E;  1XHK A;  4IS9 A;  3WU6 A;  4B3S E;  1ZM9 A;  4ISA A;  4P7A A;  5K36 C;  2HKJ A;  4QNK A;  1E3H A;  5JEA B;  4DUY I;  2C39 A;  1FI4 A;  2HK2 A;  1HNZ E; 
#chains in the Genus database with same CATH homology
 2PO2 A;  1R6M A;  3L7Z A;  3GLL A;  4BA2 A;  3CDJ A;  2WNR A;  5JEA E;  2JEB A;  2NN6 F;  4BA1 B;  5K36 F;  2C38 A;  2JE6 A;  3B4T A;  1E3P A;  1UDN A;  2BA0 D;  2BA1 D;  1R6L A;  4OO1 F;  4IFD F;  2C37 A;  2BA0 G;  3GCM A;  5C0X F;  2JEA A;  2BR2 A;  2WP8 A;  2PO0 A;  2PNZ B;  2NN6 B;  5JEA C;  1OYR A;  3CDI A;  3L7Z B;  5K36 B;  5JEA D;  3U1K A;  4OO1 B;  4IFD B;  3HKM A;  5JEA A;  4AID A;  4NBQ A;  1UDS A;  2JEB B;  5C0X B;  3H1C A;  3M85 D;  3M7N D;  3M85 G;  3KRN A;  5JEA F;  2C39 B;  3M7N G;  2PO2 B;  1UDO A;  4AM3 A;  3GME A;  4BA2 B;  2WNR B;  2NN6 C;  2PO1 A;  4AIM A;  2C38 B;  2NN6 D;  5K36 D;  2JE6 B;  2NN6 E;  5K36 E;  3DD6 A;  2PNZ A;  2NN6 A;  5C0X C;  5K36 A;  4OO1 D;  2C37 B;  4IFD D;  4OO1 E;  2JEA B;  5C0X D;  4IFD E;  2BR2 B;  2WP8 B;  2PO0 B;  4OO1 A;  5C0X E;  4IFD A;  4BA1 A;  5C0X A;  1OYP A;  5K36 C;  1E3H A;  5JEA B;  1OYS A;  2BA1 G;  2C39 A;  2PO1 B;  1UDQ A;  4OO1 C;  4IFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...