2C39A

Rnase ph core of the archaeal exosome in complex with adp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c39A01
3KRNA 5C0XF 5C0XC 2WP8B 2BA0G 2C37A 2PO0A 3CDIA 4OO1E 4OO1A 1OYPA 1UDNA 3H1CA 1R6LA 2NN6B 1R6MA 2BR2A 2WNRB 3U1KA 3B4TA 4BA1A 1OYRA 1UDQA 2PO1B 3M85D 3M7ND 2NN6D 5C0XE 1E3HA 3M85G 3M7NG 2BA1D 3HKMA 2C38B 5K36B 2JEBB 5K36F 5K36C 2BR2B 1UDOA 2JEAB 4BA1B 5JEAB 3DD6A 2PO2A 4OO1D 5K36D 2C39B 4BA2A 2NN6F 2NN6C 2PNZA 3L7ZA 4NBQA 4IFDE 4IFDA 5JEAD 2C37B 5C0XA 2JE6A 2PO0B 3GLLA 4OO1B 2WP8A 1UDSA 2PO2B 4OO1C 4OO1F 2BA1G 1OYSA 3CDJA 5JEAF 5JEAC 4AIDA 2NN6E 2NN6A 2WNRA 5C0XB 2BA0D 2PO1A 4IFDD 3GMEA 5C0XD 2C38A 4AM3A 5K36E 5K36A 2JEBA 3GCMA 4BA2B 2PNZB 3L7ZB 4AIMA 2JEAA 5JEAE 5JEAA 4IFDB 4IFDF 4IFDC 2C39A 1E3PA 2JE6B
chains in the Genus database with same CATH superfamily
1ELOA 4LFAE 3KRNA 4K0KE 3T1YI 1N36I 2BA0G 1XMQE 4P52A 2VQFI 4LCFA 3OTOI 1UEKA 4GQUA 2IOQA 5GMDA 4YY3I 3K85A 2CG9A 1OYPA 3H1CA 4DV0I 3B4TA 2ZM6E 3J80Q 4YHHE 5EKWA 4DPUA 1IBME 1H73A 2IESA 4DV6E 4DPTA 4WUDA 3PYEA 4LF8E 4DV1I 3M85G 4JI4I 2V34A 2C38B 5K36B 4X62I 5DNLA 2JEBB 5K36F 1UDOA 2JEAB 4DR3E 3ZZ0A 2CGEA 4RPFA 3UHMA 3J80C 2PO2A 1QZRA 5DRRA 1N32E 1H7SA 3T1HE 5L3JA 4IFDE 1H72C 4IZJB 4JI0I 2UUBI 4X66E 4DR7E 1HNZI 5C0XA 2JE6A 3ZKBA 3JAMC 2F4VI 2J7KA 3GLLA 2EFGA 4OO1B 1ZM2A 2BM0A 1UDSA 4OO1F 4OZEA 1OYSA 3CDJA 4LF5E 3WU4A 2A2DA 4MDTA 1Y4SA 1K47A 5JEAF 1N34E 2HK3A 4LF4E 4HY1A 2GS8A 2BV3A 1ZXMA 5FWKA 4R1FA 4DR4I 1H7UA 4JI8E 1NHHA 2PO1A 4WUBA 3GMEA 4DV7I 5C0XD 4JI5I 5K36E 3V5RA 3J81Q 4LFAI 2HFUA 2O1TA 3ZZTA 4K0KI 1XMQI 3D4JA 2LJPA 5JEAA 4LF6E 2VESA 4FW4A 4LF9E 4B3SE 1XMOE 4NXME 3PS3A 2ZM6I 5IWAE 4GKKE 2Z5EA 3B82A 4YHHI 2VQEE 5LMNE 4ISAA 1S16A 4JG4A 4DPWA 5DROA 4ZVIA 1IBMI 1XHKA 4DV6I 1ZM9A 3P76A 4OO1E 4JI7E 2CVEA 4LF8I 4FW5A 2E1RA 4B3TE 1R6LA 2UXBE 2WNRB 3PYDA 4LPFA 1DARA 4DV4E 3HULA 1P42A 1Z0BA 2AE8A 3M85D 1N33E 1D6TA 4DR2E 2NN6D 1E3HA 3P3GA 1Z59A 1WUUA 1Y60A 5DNXA 3HKMA 1N32I 3LNUA 4JI3E 4QNJA 3T1HI 2Z5BA 2V2QA 1RR9A 2AJ4A 4X66I 4USKA 1Z0EA 3DD6A 3QT5A 4DR7I 2Z5CB 4JV5E 4XTJA 4FN5A 4BA2A 2PNZA 3L7ZA 4DR5E 2J65A 4NBQA 1FJGE 4U3BA 4IFDA 1Z0GA 4LF5I 2C37B 3GONA 3PRYA 4DPYA 1USUA 4X64E 1N34I 4LF4I 2PO0B 4X65E 2PNLA 1KKHA 2PNMA 2PO2B 3JAMQ 4IZKA 4DR1E 4JYAE 4JI8I 4JI1E 4WUCA 1KIJA 4OX9E 1N0VC 1KTVA 1FI4A 4URLA 2F1DA 5C0XB 1XNRE 4DV3E 1BKNA 4KQVA 3PS2A 4MU0A 4LF6I 4IFDD 3PYGA 4LF9I 4FW9A 4B3SI 2X36A 2C38A 1XMOI 1HNWE 5K36A 4U3DA 1Z0CA 4PU9A 4QNKA 4NXMI 2JEBA 1HR0E 4AIMA 1XNQE 2JEAA 4LCGA 5IWAI 4GKKI 2VQEI 5LMNI 4DU8A 2GO3A 2UUAE 1PKPA 4JI7I 1FNMA 4B3TI 2HKEA 1XXEA 4N3OA 5C0XC 1Y4UA 1KVKA 4B3ME 2UXBI 2WP8B 4DV4I 4IZJA 4NXNE 4PRXA 5ELWA 2R3VA 1NHIA 3CDIA 5LMUE 1N33I 4OO1A 4DR2I 2GQ0A 1UDNA 2NN6B 1R6MA 2BR2A 3U1KA 2HHHE 5DRPA 4BA1A 2BM1A 2ZITA 3K1JA 2V2VA 3LTOA 3H4LA 4DUYE 4JI3I 1OYRA 2UUCE 3P06A 1UDQA 3HJCA 3PYFA 2UU9E 3F0NA 1IBLE 4MYTA 1EI1A 5C0XE 1U2RA 4JV5I 4DU7A 3M7NG 2BA1D 4DR5I 4LF7E 3WU3A 3Q1QA 4IZJD 4JI2E 1FJGI 1PVGA 2O3ZA 1J5EE 2UXDE 5IT9Q 4FWHA 3WU6A 4X64I 4OO1D 2GO4A 4HACA 4J3DA 1Y6ZA 4X65I 2C39B 2NN6C 4DR1I 4JYAI 1ZM4A 1Z0WA 3ZZUA 2IERA 4JI1I 4DR3I 5JEAD 1H74A 4OX9I 1FWKA 2XEXA 5BR8E 4B3RE 4AQYE 1S4EA 2Z5BB 5FLXC 1IBKE 4DR6E 4Z7CA 1PIEA 1XNRI 3ZKDA 4DV3I 4Z7YA 5IT9C 3M6AA 2BA1G 4UT4A 2V2ZA 2WW4A 1VI7A 2NN6E 3WU5A 4LCHA 2WNRA 4JI5E 1HNWI 4LOMA 3J7AG 1MG7A 1HR0I 5GMEA 1XNQI 4GKJE 2DEJA 4IZKB 3K17A 3LPSA 4LFBE 4DUZE 2UUAI 1B63A 3CWVA 3V2UC 1HNXE 4M1KA 2R42A 5A2QQ 1OJ4A 2Q2EB 4ED4A 4B3MI 2OI2A 2E5LE 4NXNI 1Z5CA 4LFCE 1N0UA 3P3EA 2Z5CA 2UXCE 4MU4A 5LMUI 4KHPE 4IFDC 1E3PA 4DV5E 2JE6B 1I94E 2HFSA 5C0XF 2JT2A 2V8PA 2HHHI 4DUYI 4USMA 4DV2E 2UUCI 2C37A 3PS1A 5A2QC 2UU9I 1Z5BA 2O1VA 4IS9A 2PO0A 4JI6E 1USVA 1IBLI 3U1YA 4HXZA 3T1YE 1N36E 4LF7I 3QT8A 2VQFE 4JI2I 3OTOE 3Q6NA 1NZ0A 3B78A 3QT6A 2PO1B 1J5EI 4YY3E 2UXDI 3M7ND 4MYUA 1FWLA 4DV0E 2A2CA 1ZXNA 1YH8A 1MX0A 3Q6MA 5K36C 2BR2B 1A6FA 4BA1B 4FWGA 1Z0VA 5BR8I 4B3RI 5JEAB 4AQYI 1EA6A 4DV1E 1IBKI 3NZKA 3P3CA 4DR6I 2HK2A 4OKGA 4JI4E 5K36D 2NN6F 1NHJA 4FWDA 2CZ9A 4X62E 1Z5AA 1Z0TA 2WP8A 4UTGA 5FLXQ 2O1UA 4OO1C 3QT7A 1VISA 4HACB 4GKJI 2DEIA 4JI0E 1ZM3A 4FW6A 2UUBE 1RREA 4PRVA 1HNZE 5JEAC 4AIDA 4LFBI 4DUZI 2ZBKB 2F4VE 2NN6A 3ZM7A 1HNXI 2HKJA 2BA0D 4FW7A 4MU3A 2VF3A 2E5LI 2X7IA 1FKAE 3B8HA 1HK7A 4LFCI 3J7AM 4EMDA 2IOPA 4DXLA 2UXCI 4HYMA 5LL6R 3J81C 4KHPI 4DR4E 4AM3A 4DV5I 1I94I 3GCMA 4BA2B 5EL9A 3L7ZB 2PNZB 1YHCA 4MQYA 5JEAE 4DV2I 4MU1A 2NPFA 4DPXA 1RHYA 5DRQA 4IFDB 1Y5YA 4P7AA 4JI6I 1MU5A 4DV7E 4IFDF 2C39A 2O1WA 4FW3A 4I3HA 1B62A
chains in the Genus database with same CATH topology
3KRNA 5C0XF 5C0XC 2WP8B 2BA0G 2C37A 2PO0A 3CDIA 4OO1E 4OO1A 1OYPA 1UDNA 3H1CA 1R6LA 2NN6B 1R6MA 2BR2A 2WNRB 3U1KA 3B4TA 4BA1A 1OYRA 1UDQA 2PO1B 3M85D 3M7ND 2NN6D 5C0XE 1E3HA 3M85G 3M7NG 2BA1D 3HKMA 2C38B 5K36B 2JEBB 5K36F 5K36C 2BR2B 1UDOA 2JEAB 4BA1B 5JEAB 3DD6A 2PO2A 4OO1D 5K36D 2C39B 4BA2A 2NN6F 2NN6C 2PNZA 3L7ZA 4NBQA 4IFDE 4IFDA 5JEAD 2C37B 5C0XA 2JE6A 2PO0B 3GLLA 4OO1B 2WP8A 1UDSA 2PO2B 4OO1C 4OO1F 2BA1G 1OYSA 3CDJA 5JEAF 5JEAC 4AIDA 2NN6E 2NN6A 2WNRA 5C0XB 2BA0D 2PO1A 4IFDD 3GMEA 5C0XD 2C38A 4AM3A 5K36E 5K36A 2JEBA 3GCMA 4BA2B 2PNZB 3L7ZB 4AIMA 2JEAA 5JEAE 5JEAA 4IFDB 4IFDF 4IFDC 2C39A 1E3PA 2JE6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRN A;  5C0X F;  5C0X C;  2WP8 B;  2BA0 G;  2C37 A;  2PO0 A;  3CDI A;  4OO1 E;  4OO1 A;  1OYP A;  1UDN A;  3H1C A;  1R6L A;  2NN6 B;  1R6M A;  2BR2 A;  2WNR B;  3U1K A;  3B4T A;  4BA1 A;  1OYR A;  1UDQ A;  2PO1 B;  3M85 D;  3M7N D;  2NN6 D;  5C0X E;  1E3H A;  3M85 G;  3M7N G;  2BA1 D;  3HKM A;  2C38 B;  5K36 B;  2JEB B;  5K36 F;  5K36 C;  2BR2 B;  1UDO A;  2JEA B;  4BA1 B;  5JEA B;  3DD6 A;  2PO2 A;  4OO1 D;  5K36 D;  2C39 B;  4BA2 A;  2NN6 F;  2NN6 C;  2PNZ A;  3L7Z A;  4NBQ A;  4IFD E;  4IFD A;  5JEA D;  2C37 B;  5C0X A;  2JE6 A;  2PO0 B;  3GLL A;  4OO1 B;  2WP8 A;  1UDS A;  2PO2 B;  4OO1 C;  4OO1 F;  2BA1 G;  1OYS A;  3CDJ A;  5JEA F;  5JEA C;  4AID A;  2NN6 E;  2NN6 A;  2WNR A;  5C0X B;  2BA0 D;  2PO1 A;  4IFD D;  3GME A;  5C0X D;  2C38 A;  4AM3 A;  5K36 E;  5K36 A;  2JEB A;  3GCM A;  4BA2 B;  2PNZ B;  3L7Z B;  4AIM A;  2JEA A;  5JEA E;  5JEA A;  4IFD B;  4IFD F;  4IFD C;  2C39 A;  1E3P A;  2JE6 B; 
#chains in the Genus database with same CATH topology
 1ELO A;  4LFA E;  3KRN A;  4K0K E;  3T1Y I;  1N36 I;  2BA0 G;  1XMQ E;  4P52 A;  2VQF I;  4LCF A;  3OTO I;  1UEK A;  4GQU A;  2IOQ A;  5GMD A;  4YY3 I;  3K85 A;  2CG9 A;  1OYP A;  3H1C A;  4DV0 I;  3B4T A;  2ZM6 E;  3J80 Q;  4YHH E;  5EKW A;  4DPU A;  1IBM E;  1H73 A;  2IES A;  4DV6 E;  4DPT A;  4WUD A;  3PYE A;  4LF8 E;  4DV1 I;  3M85 G;  4JI4 I;  2V34 A;  2C38 B;  5K36 B;  4X62 I;  5DNL A;  2JEB B;  5K36 F;  1UDO A;  2JEA B;  4DR3 E;  3ZZ0 A;  2CGE A;  4RPF A;  3UHM A;  3J80 C;  2PO2 A;  1QZR A;  5DRR A;  1N32 E;  1H7S A;  3T1H E;  5L3J A;  4IFD E;  1H72 C;  4IZJ B;  4JI0 I;  2UUB I;  4X66 E;  4DR7 E;  1HNZ I;  5C0X A;  2JE6 A;  3ZKB A;  3JAM C;  2F4V I;  2J7K A;  3GLL A;  2EFG A;  4OO1 B;  1ZM2 A;  2BM0 A;  1UDS A;  4OO1 F;  4OZE A;  1OYS A;  3CDJ A;  4LF5 E;  3WU4 A;  2A2D A;  4MDT A;  1Y4S A;  1K47 A;  5JEA F;  1N34 E;  2HK3 A;  4LF4 E;  4HY1 A;  2GS8 A;  2BV3 A;  1ZXM A;  5FWK A;  4R1F A;  4DR4 I;  1H7U A;  4JI8 E;  1NHH A;  2PO1 A;  4WUB A;  3GME A;  4DV7 I;  5C0X D;  4JI5 I;  5K36 E;  3V5R A;  3J81 Q;  4LFA I;  2HFU A;  2O1T A;  3ZZT A;  4K0K I;  1XMQ I;  3D4J A;  2LJP A;  5JEA A;  4LF6 E;  2VES A;  4FW4 A;  4LF9 E;  4B3S E;  1XMO E;  4NXM E;  3PS3 A;  2ZM6 I;  5IWA E;  4GKK E;  2Z5E A;  3B82 A;  4YHH I;  2VQE E;  5LMN E;  4ISA A;  1S16 A;  4JG4 A;  4DPW A;  5DRO A;  4ZVI A;  1IBM I;  1XHK A;  4DV6 I;  1ZM9 A;  3P76 A;  4OO1 E;  4JI7 E;  2CVE A;  4LF8 I;  4FW5 A;  2E1R A;  4B3T E;  1R6L A;  2UXB E;  2WNR B;  3PYD A;  4LPF A;  1DAR A;  4DV4 E;  3HUL A;  1P42 A;  1Z0B A;  2AE8 A;  3M85 D;  1N33 E;  1D6T A;  4DR2 E;  2NN6 D;  1E3H A;  3P3G A;  1Z59 A;  1WUU A;  1Y60 A;  5DNX A;  3HKM A;  1N32 I;  3LNU A;  4JI3 E;  4QNJ A;  3T1H I;  2Z5B A;  2V2Q A;  1RR9 A;  2AJ4 A;  4X66 I;  4USK A;  1Z0E A;  3DD6 A;  3QT5 A;  4DR7 I;  2Z5C B;  4JV5 E;  4XTJ A;  4FN5 A;  4BA2 A;  2PNZ A;  3L7Z A;  4DR5 E;  2J65 A;  4NBQ A;  1FJG E;  4U3B A;  4IFD A;  1Z0G A;  4LF5 I;  2C37 B;  3GON A;  3PRY A;  4DPY A;  1USU A;  4X64 E;  1N34 I;  4LF4 I;  2PO0 B;  4X65 E;  2PNL A;  1KKH A;  2PNM A;  2PO2 B;  3JAM Q;  4IZK A;  4DR1 E;  4JYA E;  4JI8 I;  4JI1 E;  4WUC A;  1KIJ A;  4OX9 E;  1N0V C;  1KTV A;  1FI4 A;  4URL A;  2F1D A;  5C0X B;  1XNR E;  4DV3 E;  1BKN A;  4KQV A;  3PS2 A;  4MU0 A;  4LF6 I;  4IFD D;  3PYG A;  4LF9 I;  4FW9 A;  4B3S I;  2X36 A;  2C38 A;  1XMO I;  1HNW E;  5K36 A;  4U3D A;  1Z0C A;  4PU9 A;  4QNK A;  4NXM I;  2JEB A;  1HR0 E;  4AIM A;  1XNQ E;  2JEA A;  4LCG A;  5IWA I;  4GKK I;  2VQE I;  5LMN I;  4DU8 A;  2GO3 A;  2UUA E;  1PKP A;  4JI7 I;  1FNM A;  4B3T I;  2HKE A;  1XXE A;  4N3O A;  5C0X C;  1Y4U A;  1KVK A;  4B3M E;  2UXB I;  2WP8 B;  4DV4 I;  4IZJ A;  4NXN E;  4PRX A;  5ELW A;  2R3V A;  1NHI A;  3CDI A;  5LMU E;  1N33 I;  4OO1 A;  4DR2 I;  2GQ0 A;  1UDN A;  2NN6 B;  1R6M A;  2BR2 A;  3U1K A;  2HHH E;  5DRP A;  4BA1 A;  2BM1 A;  2ZIT A;  3K1J A;  2V2V A;  3LTO A;  3H4L A;  4DUY E;  4JI3 I;  1OYR A;  2UUC E;  3P06 A;  1UDQ A;  3HJC A;  3PYF A;  2UU9 E;  3F0N A;  1IBL E;  4MYT A;  1EI1 A;  5C0X E;  1U2R A;  4JV5 I;  4DU7 A;  3M7N G;  2BA1 D;  4DR5 I;  4LF7 E;  3WU3 A;  3Q1Q A;  4IZJ D;  4JI2 E;  1FJG I;  1PVG A;  2O3Z A;  1J5E E;  2UXD E;  5IT9 Q;  4FWH A;  3WU6 A;  4X64 I;  4OO1 D;  2GO4 A;  4HAC A;  4J3D A;  1Y6Z A;  4X65 I;  2C39 B;  2NN6 C;  4DR1 I;  4JYA I;  1ZM4 A;  1Z0W A;  3ZZU A;  2IER A;  4JI1 I;  4DR3 I;  5JEA D;  1H74 A;  4OX9 I;  1FWK A;  2XEX A;  5BR8 E;  4B3R E;  4AQY E;  1S4E A;  2Z5B B;  5FLX C;  1IBK E;  4DR6 E;  4Z7C A;  1PIE A;  1XNR I;  3ZKD A;  4DV3 I;  4Z7Y A;  5IT9 C;  3M6A A;  2BA1 G;  4UT4 A;  2V2Z A;  2WW4 A;  1VI7 A;  2NN6 E;  3WU5 A;  4LCH A;  2WNR A;  4JI5 E;  1HNW I;  4LOM A;  3J7A G;  1MG7 A;  1HR0 I;  5GME A;  1XNQ I;  4GKJ E;  2DEJ A;  4IZK B;  3K17 A;  3LPS A;  4LFB E;  4DUZ E;  2UUA I;  1B63 A;  3CWV A;  3V2U C;  1HNX E;  4M1K A;  2R42 A;  5A2Q Q;  1OJ4 A;  2Q2E B;  4ED4 A;  4B3M I;  2OI2 A;  2E5L E;  4NXN I;  1Z5C A;  4LFC E;  1N0U A;  3P3E A;  2Z5C A;  2UXC E;  4MU4 A;  5LMU I;  4KHP E;  4IFD C;  1E3P A;  4DV5 E;  2JE6 B;  1I94 E;  2HFS A;  5C0X F;  2JT2 A;  2V8P A;  2HHH I;  4DUY I;  4USM A;  4DV2 E;  2UUC I;  2C37 A;  3PS1 A;  5A2Q C;  2UU9 I;  1Z5B A;  2O1V A;  4IS9 A;  2PO0 A;  4JI6 E;  1USV A;  1IBL I;  3U1Y A;  4HXZ A;  3T1Y E;  1N36 E;  4LF7 I;  3QT8 A;  2VQF E;  4JI2 I;  3OTO E;  3Q6N A;  1NZ0 A;  3B78 A;  3QT6 A;  2PO1 B;  1J5E I;  4YY3 E;  2UXD I;  3M7N D;  4MYU A;  1FWL A;  4DV0 E;  2A2C A;  1ZXN A;  1YH8 A;  1MX0 A;  3Q6M A;  5K36 C;  2BR2 B;  1A6F A;  4BA1 B;  4FWG A;  1Z0V A;  5BR8 I;  4B3R I;  5JEA B;  4AQY I;  1EA6 A;  4DV1 E;  1IBK I;  3NZK A;  3P3C A;  4DR6 I;  2HK2 A;  4OKG A;  4JI4 E;  5K36 D;  2NN6 F;  1NHJ A;  4FWD A;  2CZ9 A;  4X62 E;  1Z5A A;  1Z0T A;  2WP8 A;  4UTG A;  5FLX Q;  2O1U A;  4OO1 C;  3QT7 A;  1VIS A;  4HAC B;  4GKJ I;  2DEI A;  4JI0 E;  1ZM3 A;  4FW6 A;  2UUB E;  1RRE A;  4PRV A;  1HNZ E;  5JEA C;  4AID A;  4LFB I;  4DUZ I;  2ZBK B;  2F4V E;  2NN6 A;  3ZM7 A;  1HNX I;  2HKJ A;  2BA0 D;  4FW7 A;  4MU3 A;  2VF3 A;  2E5L I;  2X7I A;  1FKA E;  3B8H A;  1HK7 A;  4LFC I;  3J7A M;  4EMD A;  2IOP A;  4DXL A;  2UXC I;  4HYM A;  5LL6 R;  3J81 C;  4KHP I;  4DR4 E;  4AM3 A;  4DV5 I;  1I94 I;  3GCM A;  4BA2 B;  5EL9 A;  3L7Z B;  2PNZ B;  1YHC A;  4MQY A;  5JEA E;  4DV2 I;  4MU1 A;  2NPF A;  4DPX A;  1RHY A;  5DRQ A;  4IFD B;  1Y5Y A;  4P7A A;  4JI6 I;  1MU5 A;  4DV7 E;  4IFD F;  2C39 A;  2O1W A;  4FW3 A;  4I3H A;  1B62 A; 
#chains in the Genus database with same CATH homology
 3KRN A;  5C0X F;  5C0X C;  2WP8 B;  2BA0 G;  2C37 A;  2PO0 A;  3CDI A;  4OO1 E;  4OO1 A;  1OYP A;  1UDN A;  3H1C A;  1R6L A;  2NN6 B;  1R6M A;  2BR2 A;  2WNR B;  3U1K A;  3B4T A;  4BA1 A;  1OYR A;  1UDQ A;  2PO1 B;  3M85 D;  3M7N D;  2NN6 D;  5C0X E;  1E3H A;  3M85 G;  3M7N G;  2BA1 D;  3HKM A;  2C38 B;  5K36 B;  2JEB B;  5K36 F;  5K36 C;  2BR2 B;  1UDO A;  2JEA B;  4BA1 B;  5JEA B;  3DD6 A;  2PO2 A;  4OO1 D;  5K36 D;  2C39 B;  4BA2 A;  2NN6 F;  2NN6 C;  2PNZ A;  3L7Z A;  4NBQ A;  4IFD E;  4IFD A;  5JEA D;  2C37 B;  5C0X A;  2JE6 A;  2PO0 B;  3GLL A;  4OO1 B;  2WP8 A;  1UDS A;  2PO2 B;  4OO1 C;  4OO1 F;  2BA1 G;  1OYS A;  3CDJ A;  5JEA F;  5JEA C;  4AID A;  2NN6 E;  2NN6 A;  2WNR A;  5C0X B;  2BA0 D;  2PO1 A;  4IFD D;  3GME A;  5C0X D;  2C38 A;  4AM3 A;  5K36 E;  5K36 A;  2JEB A;  3GCM A;  4BA2 B;  2PNZ B;  3L7Z B;  4AIM A;  2JEA A;  5JEA E;  5JEA A;  4IFD B;  4IFD F;  4IFD C;  2C39 A;  1E3P A;  2JE6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...