2C39A

Rnase ph core of the archaeal exosome in complex with adp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
260
Chain Sequence
b'MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
molecule tags Hydrolase
source organism Sulfolobus solfataricus
publication title Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
pubmed doi rcsb
total genus 76
structure length 260
sequence length 275
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2c39A01
1UDNA 2JEBB 2C37A 3L7ZA 1R6LA 5JEAD 2C38A 3M85G 4IFDD 4OO1C 5C0XC 2WNRB 2WP8B 3GCMA 4NBQA 4IFDF 2PO0B 2NN6C 2BR2B 2BA0D 5C0XB 3HKMA 3KRNA 4BA1B 5JEAA 2NN6B 1E3PA 2JE6A 2JEBA 2BR2A 5JEAE 4BA2B 2JEAB 3H1CA 4OO1B 5JEAB 5C0XD 1UDSA 4OO1E 1UDOA 2C38B 1UDQA 4BA2A 2BA1G 2WNRA 5K36B 4IFDB 2NN6E 3GLLA 4IFDC 5C0XF 2C39B 2PO0A 3DD6A 3M7NG 2NN6A 2PO1A 2JE6B 5JEAC 5K36C 3U1KA 1E3HA 2NN6F 2WP8A 3M85D 2PO2A 4OO1A 3CDIA 1R6MA 3B4TA 2PNZB 4IFDE 5K36D 4AM3A 2NN6D 2PO2B 3L7ZB 1OYPA 4BA1A 4IFDA 2PNZA 2JEAA 2BA0G 2C39A 1OYSA 5K36F 5K36E 4AIDA 3CDJA 3GMEA 2PO1B 5C0XE 4OO1D 1OYRA 5K36A 3M7ND 2C37B 4AIMA 5JEAF 5C0XA 4OO1F 2BA1D
chains in the Genus database with same CATH superfamily
5A2QC 4LF6E 4UTGA 4FWGA 4JI6I 2F1DA 4KHPE 1N34E 1BKNA 2BM1A 2XEXA 2PNLA 4DR4I 1Y4SA 3J80Q 2UUCI 5FLXC 4DV1E 1KIJA 3PS3A 4DR4E 1FJGE 4IS9A 4JI7I 4DV1I 2PO0B 2Z5EA 3K17A 4DV0I 4LCGA 4BA1B 1N36E 1HNXI 1H73A 4LFBE 2F4VI 2JE6A 4DXLA 1B62A 4PRVA 2UXCI 4DV2I 4BA2B 2JEAB 4MYUA 2HFSA 5DRPA 2HK2A 4LCFA 3WU5A 1UDSA 5C0XD 4OO1E 1UDOA 2UUBI 4JI4I 4DPYA 2BA1G 2HHHE 4FWHA 3U1YA 4DPWA 3H4LA 1HR0E 3T1YE 4IFDB 5LL6R 4DR1I 3DD6A 2BM0A 3PS2A 4K0KE 4GKJI 3QT8A 1XNRI 2UXDE 2PO1A 4IZJA 2Q2EB 3JAMQ 4USKA 1Z0VA 5K36C 3J7AG 2NPFA 4XTJA 1Z5CA 1RHYA 1HNWE 5EKWA 3V5RA 2NN6F 1H7SA 3CWVA 1PKPA 1ELOA 3CDIA 2CG9A 4X65I 4DR7E 3P3GA 5K36D 1N32E 4FW9A 3P76A 4HACB 5BR8E 2X36A 3D4JA 4DV7E 2PNZA 4B3RE 2HKJA 2J7KA 3B8HA 2PNMA 4LF9E 5L3JA 2Z5BA 4NXNI 5DRRA 1FKAE 2UU9E 3GMEA 4X62E 2UXBE 2OI2A 1HNZE 2IESA 1I94E 1Y5YA 2UXBI 1IBKE 4WUCA 5JEAF 4JV5I 4MU0A 4NXME 4OO1F 1KVKA 4JG4A 1IBLE 1FWLA 4DV3I 2JEBB 3L7ZA 1N34I 5LMNE 1YH8A 1HNXE 4I3HA 3M85G 4LF7E 4P52A 4LOMA 1DARA 4MQYA 4Z7CA 2ZM6I 5C0XC 2WNRB 4B3MI 4DPUA 3QT5A 2A2CA 2GO4A 1XHKA 1NHIA 4DV6E 4JI4E 1FJGI 1D6TA 4LF8I 5C0XB 2CGEA 4JI3E 4DR3I 4DR5E 4LPFA 1H72C 5LMUI 1VI7A 4OX9E 3Q6MA 1NZ0A 4K0KI 3H1CA 1MG7A 4UT4A 4DV4I 1IBME 4LF4I 4LF5E 1B63A 1ZXMA 2C38B 2DEJA 4MU1A 4FN5A 1UDQA 5IT9Q 1J5EI 1XNQI 2UUAI 4HXZA 2NN6E 4JI0E 2HFUA 5C0XF 1N33I 2C39B 1Z0CA 2PO0A 2A2DA 4JI5I 2V34A 2ZBKB 1XMOE 2NN6A 2JE6B 2F4VE 4U3BA 2IOQA 4AQYI 4X64I 4GKKI 5JEAC 4FW7A 4JI8E 1XMOI 4AQYE 1Z0EA 4FWDA 2WP8A 1Z59A 4FW5A 4HACA 4LFCI 4R1FA 4OO1A 4USMA 1R6MA 1XMQE 3B4TA 2HHHI 2PNZB 2IERA 3PYFA 4DPTA 4AM3A 2NN6D 4X65E 1OYPA 3PYDA 4DR1E 4KHPI 4BA1A 4X66I 4MU3A 4NXMI 1ZM4A 4MDTA 2AJ4A 4LF9I 2VQFE 3NZKA 2BA0G 1OYSA 4FW6A 5IWAE 5K36F 1ZM9A 5K36E 2R3VA 3WU4A 3HULA 1PVGA 3CDJA 4DU8A 3OTOE 5GMEA 5IT9C 4B3SE 4ZVIA 3K1JA 4MYTA 3P06A 4JI2E 1FWKA 4JI7E 2HK3A 5FWKA 3T1HE 5K36A 1VISA 4B3SI 3K85A 4JI2I 1U2RA 3Q6NA 4JYAE 4FW4A 4LFBI 1IBKI 4DV5I 1UDNA 4OKGA 2V2VA 1R6LA 2J65A 5JEAD 5BR8I 3Q1QA 4LF7I 1N0VC 2IOPA 4JI1I 2GQ0A 4DV5E 2E1RA 1NHHA 4IFDD 1A6FA 4DPXA 2LJPA 1P42A 3QT6A 3UHMA 3GONA 1Z5BA 3PYGA 2WP8B 1HNZI 3GCMA 2V8PA 1WUUA 1ZM3A 3QT7A 5DRQA 2VESA 4EMDA 2NN6C 4ISAA 1N36I 4LFAI 4PRXA 3HKMA 2UXDI 3T1YI 4IZKA 5JEAA 5LMUE 4OX9I 2UXCE 4LFAE 1N33E 4DR6I 3J81C 4DV2E 2JEBA 4LF6I 2O3ZA 2CZ9A 5JEAE 4OO1B 4IZKB 4KQVA 5JEAB 1EI1A 2UUBE 3B82A 4YHHI 4MU4A 4N3OA 1Y60A 2BV3A 4DUZI 2WNRA 1FNMA 1MU5A 4YHHE 5K36B 4GQUA 4U3DA 1N32I 3ZZ0A 4WUBA 3M7NG 4PU9A 2Z5CA 4DR7I 4YY3E 1KTVA 3ZZUA 1OJ4A 4QNJA 1HNWI 2ZITA 2HKEA 3ZKBA 3U1KA 1HR0I 1H74A 4J3DA 4DV4E 5A2QQ 4B3TI 1Z0BA 4DR2E 3ZZTA 4B3TE 4HYMA 3J81Q 2PO2B 4OZEA 2R42A 3WU6A 4IFDA 4GKJE 2E5LI 2UUCE 3ZM7A 4JYAI 3JAMC 4X64E 3T1HI 4JI8I 1QZRA 5IWAI 2O1VA 3PYEA 1OYRA 1RR9A 1ZXNA 3OTOI 2C37B 4AIMA 2X7IA 3LPSA 5C0XA 5DNLA 4DUYI 4DV3E 2VQEE 3LNUA 2BA1D 1S16A 2C37A 5DNXA 2Z5CB 1ZM2A 2C38A 1S4EA 1K47A 5ELWA 2Z5BB 4JI1E 4OO1C 4QNKA 4NXNE 1XNQE 2GO3A 4URLA 4JV5E 2UUAE 1EA6A 3P3EA 4NBQA 4IFDF 2GS8A 4LCHA 1I94I 2CVEA 2BR2B 4DUZE 2BA0D 2DEIA 1J5EE 4JI6E 3KRNA 4FW3A 2NN6B 4IZJD 1E3PA 1USUA 4LF8E 3J80C 2VF3A 1NHJA 1Y6ZA 2BR2A 1N0UA 4JI3I 1H7UA 1Z0WA 4DR6E 4DU7A 1YHCA 4GKKE 2V2QA 2O1TA 3ZKDA 4DV6I 4DV0E 1Z5AA 4Z7YA 2EFGA 1XMQI 1IBMI 4LF4E 4JI0I 4LF5I 4BA2A 1KKHA 3PS1A 4B3ME 4JI5E 3GLLA 1Z0GA 4DR3E 4DR5I 4IFDC 4DV7I 3J7AM 4B3RI 1XXEA 1XNRE 3M6AA 4ED4A 1HK7A 4YY3I 3V2UC 3HJCA 1USVA 3F0NA 1RREA 3WU3A 1E3HA 3M85D 2PO2A 5FLXQ 2JT2A 2V2ZA 1MX0A 4IFDE 5EL9A 2AE8A 2O1UA 3PRYA 3L7ZB 5LMNI 4DR2I 2VQFI 5GMDA 4DUYE 1Z0TA 1Y4UA 4M1KA 2JEAA 2C39A 4X62I 3B78A 2ZM6E 2O1WA 5DROA 4AIDA 4HY1A 2E5LE 3P3CA 2PO1B 4P7AA 5C0XE 4OO1D 4IZJB 2UU9I 3M7ND 1IBLI 3LTOA 2WW4A 4WUDA 4LFCE 2VQEI 4X66E 1PIEA 1FI4A 1UEKA 4RPFA
chains in the Genus database with same CATH topology
1UDNA 2JEBB 2C37A 3L7ZA 1R6LA 5JEAD 2C38A 3M85G 4IFDD 4OO1C 5C0XC 2WNRB 2WP8B 3GCMA 4NBQA 4IFDF 2PO0B 2NN6C 2BR2B 2BA0D 5C0XB 3HKMA 3KRNA 4BA1B 5JEAA 2NN6B 1E3PA 2JE6A 2JEBA 2BR2A 5JEAE 4BA2B 2JEAB 3H1CA 4OO1B 5JEAB 5C0XD 1UDSA 4OO1E 1UDOA 2C38B 1UDQA 4BA2A 2BA1G 2WNRA 5K36B 4IFDB 2NN6E 3GLLA 4IFDC 5C0XF 2C39B 2PO0A 3DD6A 3M7NG 2NN6A 2PO1A 2JE6B 5JEAC 5K36C 3U1KA 1E3HA 2NN6F 2WP8A 3M85D 2PO2A 4OO1A 3CDIA 1R6MA 3B4TA 2PNZB 4IFDE 5K36D 4AM3A 2NN6D 2PO2B 3L7ZB 1OYPA 4BA1A 4IFDA 2PNZA 2JEAA 2BA0G 2C39A 1OYSA 5K36F 5K36E 4AIDA 3CDJA 3GMEA 2PO1B 5C0XE 4OO1D 1OYRA 5K36A 3M7ND 2C37B 4AIMA 5JEAF 5C0XA 4OO1F 2BA1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDN A;  2JEB B;  2C37 A;  3L7Z A;  1R6L A;  5JEA D;  2C38 A;  3M85 G;  4IFD D;  4OO1 C;  5C0X C;  2WNR B;  2WP8 B;  3GCM A;  4NBQ A;  4IFD F;  2PO0 B;  2NN6 C;  2BR2 B;  2BA0 D;  5C0X B;  3HKM A;  3KRN A;  4BA1 B;  5JEA A;  2NN6 B;  1E3P A;  2JE6 A;  2JEB A;  2BR2 A;  5JEA E;  4BA2 B;  2JEA B;  3H1C A;  4OO1 B;  5JEA B;  5C0X D;  1UDS A;  4OO1 E;  1UDO A;  2C38 B;  1UDQ A;  4BA2 A;  2BA1 G;  2WNR A;  5K36 B;  4IFD B;  2NN6 E;  3GLL A;  4IFD C;  5C0X F;  2C39 B;  2PO0 A;  3DD6 A;  3M7N G;  2NN6 A;  2PO1 A;  2JE6 B;  5JEA C;  5K36 C;  3U1K A;  1E3H A;  2NN6 F;  2WP8 A;  3M85 D;  2PO2 A;  4OO1 A;  3CDI A;  1R6M A;  3B4T A;  2PNZ B;  4IFD E;  5K36 D;  4AM3 A;  2NN6 D;  2PO2 B;  3L7Z B;  1OYP A;  4BA1 A;  4IFD A;  2PNZ A;  2JEA A;  2BA0 G;  2C39 A;  1OYS A;  5K36 F;  5K36 E;  4AID A;  3CDJ A;  3GME A;  2PO1 B;  5C0X E;  4OO1 D;  1OYR A;  5K36 A;  3M7N D;  2C37 B;  4AIM A;  5JEA F;  5C0X A;  4OO1 F;  2BA1 D; 
#chains in the Genus database with same CATH topology
 5A2Q C;  4LF6 E;  4UTG A;  4FWG A;  4JI6 I;  2F1D A;  4KHP E;  1N34 E;  1BKN A;  2BM1 A;  2XEX A;  2PNL A;  4DR4 I;  1Y4S A;  3J80 Q;  2UUC I;  5FLX C;  4DV1 E;  1KIJ A;  3PS3 A;  4DR4 E;  1FJG E;  4IS9 A;  4JI7 I;  4DV1 I;  2PO0 B;  2Z5E A;  3K17 A;  4DV0 I;  4LCG A;  4BA1 B;  1N36 E;  1HNX I;  1H73 A;  4LFB E;  2F4V I;  2JE6 A;  4DXL A;  1B62 A;  4PRV A;  2UXC I;  4DV2 I;  4BA2 B;  2JEA B;  4MYU A;  2HFS A;  5DRP A;  2HK2 A;  4LCF A;  3WU5 A;  1UDS A;  5C0X D;  4OO1 E;  1UDO A;  2UUB I;  4JI4 I;  4DPY A;  2BA1 G;  2HHH E;  4FWH A;  3U1Y A;  4DPW A;  3H4L A;  1HR0 E;  3T1Y E;  4IFD B;  5LL6 R;  4DR1 I;  3DD6 A;  2BM0 A;  3PS2 A;  4K0K E;  4GKJ I;  3QT8 A;  1XNR I;  2UXD E;  2PO1 A;  4IZJ A;  2Q2E B;  3JAM Q;  4USK A;  1Z0V A;  5K36 C;  3J7A G;  2NPF A;  4XTJ A;  1Z5C A;  1RHY A;  1HNW E;  5EKW A;  3V5R A;  2NN6 F;  1H7S A;  3CWV A;  1PKP A;  1ELO A;  3CDI A;  2CG9 A;  4X65 I;  4DR7 E;  3P3G A;  5K36 D;  1N32 E;  4FW9 A;  3P76 A;  4HAC B;  5BR8 E;  2X36 A;  3D4J A;  4DV7 E;  2PNZ A;  4B3R E;  2HKJ A;  2J7K A;  3B8H A;  2PNM A;  4LF9 E;  5L3J A;  2Z5B A;  4NXN I;  5DRR A;  1FKA E;  2UU9 E;  3GME A;  4X62 E;  2UXB E;  2OI2 A;  1HNZ E;  2IES A;  1I94 E;  1Y5Y A;  2UXB I;  1IBK E;  4WUC A;  5JEA F;  4JV5 I;  4MU0 A;  4NXM E;  4OO1 F;  1KVK A;  4JG4 A;  1IBL E;  1FWL A;  4DV3 I;  2JEB B;  3L7Z A;  1N34 I;  5LMN E;  1YH8 A;  1HNX E;  4I3H A;  3M85 G;  4LF7 E;  4P52 A;  4LOM A;  1DAR A;  4MQY A;  4Z7C A;  2ZM6 I;  5C0X C;  2WNR B;  4B3M I;  4DPU A;  3QT5 A;  2A2C A;  2GO4 A;  1XHK A;  1NHI A;  4DV6 E;  4JI4 E;  1FJG I;  1D6T A;  4LF8 I;  5C0X B;  2CGE A;  4JI3 E;  4DR3 I;  4DR5 E;  4LPF A;  1H72 C;  5LMU I;  1VI7 A;  4OX9 E;  3Q6M A;  1NZ0 A;  4K0K I;  3H1C A;  1MG7 A;  4UT4 A;  4DV4 I;  1IBM E;  4LF4 I;  4LF5 E;  1B63 A;  1ZXM A;  2C38 B;  2DEJ A;  4MU1 A;  4FN5 A;  1UDQ A;  5IT9 Q;  1J5E I;  1XNQ I;  2UUA I;  4HXZ A;  2NN6 E;  4JI0 E;  2HFU A;  5C0X F;  1N33 I;  2C39 B;  1Z0C A;  2PO0 A;  2A2D A;  4JI5 I;  2V34 A;  2ZBK B;  1XMO E;  2NN6 A;  2JE6 B;  2F4V E;  4U3B A;  2IOQ A;  4AQY I;  4X64 I;  4GKK I;  5JEA C;  4FW7 A;  4JI8 E;  1XMO I;  4AQY E;  1Z0E A;  4FWD A;  2WP8 A;  1Z59 A;  4FW5 A;  4HAC A;  4LFC I;  4R1F A;  4OO1 A;  4USM A;  1R6M A;  1XMQ E;  3B4T A;  2HHH I;  2PNZ B;  2IER A;  3PYF A;  4DPT A;  4AM3 A;  2NN6 D;  4X65 E;  1OYP A;  3PYD A;  4DR1 E;  4KHP I;  4BA1 A;  4X66 I;  4MU3 A;  4NXM I;  1ZM4 A;  4MDT A;  2AJ4 A;  4LF9 I;  2VQF E;  3NZK A;  2BA0 G;  1OYS A;  4FW6 A;  5IWA E;  5K36 F;  1ZM9 A;  5K36 E;  2R3V A;  3WU4 A;  3HUL A;  1PVG A;  3CDJ A;  4DU8 A;  3OTO E;  5GME A;  5IT9 C;  4B3S E;  4ZVI A;  3K1J A;  4MYT A;  3P06 A;  4JI2 E;  1FWK A;  4JI7 E;  2HK3 A;  5FWK A;  3T1H E;  5K36 A;  1VIS A;  4B3S I;  3K85 A;  4JI2 I;  1U2R A;  3Q6N A;  4JYA E;  4FW4 A;  4LFB I;  1IBK I;  4DV5 I;  1UDN A;  4OKG A;  2V2V A;  1R6L A;  2J65 A;  5JEA D;  5BR8 I;  3Q1Q A;  4LF7 I;  1N0V C;  2IOP A;  4JI1 I;  2GQ0 A;  4DV5 E;  2E1R A;  1NHH A;  4IFD D;  1A6F A;  4DPX A;  2LJP A;  1P42 A;  3QT6 A;  3UHM A;  3GON A;  1Z5B A;  3PYG A;  2WP8 B;  1HNZ I;  3GCM A;  2V8P A;  1WUU A;  1ZM3 A;  3QT7 A;  5DRQ A;  2VES A;  4EMD A;  2NN6 C;  4ISA A;  1N36 I;  4LFA I;  4PRX A;  3HKM A;  2UXD I;  3T1Y I;  4IZK A;  5JEA A;  5LMU E;  4OX9 I;  2UXC E;  4LFA E;  1N33 E;  4DR6 I;  3J81 C;  4DV2 E;  2JEB A;  4LF6 I;  2O3Z A;  2CZ9 A;  5JEA E;  4OO1 B;  4IZK B;  4KQV A;  5JEA B;  1EI1 A;  2UUB E;  3B82 A;  4YHH I;  4MU4 A;  4N3O A;  1Y60 A;  2BV3 A;  4DUZ I;  2WNR A;  1FNM A;  1MU5 A;  4YHH E;  5K36 B;  4GQU A;  4U3D A;  1N32 I;  3ZZ0 A;  4WUB A;  3M7N G;  4PU9 A;  2Z5C A;  4DR7 I;  4YY3 E;  1KTV A;  3ZZU A;  1OJ4 A;  4QNJ A;  1HNW I;  2ZIT A;  2HKE A;  3ZKB A;  3U1K A;  1HR0 I;  1H74 A;  4J3D A;  4DV4 E;  5A2Q Q;  4B3T I;  1Z0B A;  4DR2 E;  3ZZT A;  4B3T E;  4HYM A;  3J81 Q;  2PO2 B;  4OZE A;  2R42 A;  3WU6 A;  4IFD A;  4GKJ E;  2E5L I;  2UUC E;  3ZM7 A;  4JYA I;  3JAM C;  4X64 E;  3T1H I;  4JI8 I;  1QZR A;  5IWA I;  2O1V A;  3PYE A;  1OYR A;  1RR9 A;  1ZXN A;  3OTO I;  2C37 B;  4AIM A;  2X7I A;  3LPS A;  5C0X A;  5DNL A;  4DUY I;  4DV3 E;  2VQE E;  3LNU A;  2BA1 D;  1S16 A;  2C37 A;  5DNX A;  2Z5C B;  1ZM2 A;  2C38 A;  1S4E A;  1K47 A;  5ELW A;  2Z5B B;  4JI1 E;  4OO1 C;  4QNK A;  4NXN E;  1XNQ E;  2GO3 A;  4URL A;  4JV5 E;  2UUA E;  1EA6 A;  3P3E A;  4NBQ A;  4IFD F;  2GS8 A;  4LCH A;  1I94 I;  2CVE A;  2BR2 B;  4DUZ E;  2BA0 D;  2DEI A;  1J5E E;  4JI6 E;  3KRN A;  4FW3 A;  2NN6 B;  4IZJ D;  1E3P A;  1USU A;  4LF8 E;  3J80 C;  2VF3 A;  1NHJ A;  1Y6Z A;  2BR2 A;  1N0U A;  4JI3 I;  1H7U A;  1Z0W A;  4DR6 E;  4DU7 A;  1YHC A;  4GKK E;  2V2Q A;  2O1T A;  3ZKD A;  4DV6 I;  4DV0 E;  1Z5A A;  4Z7Y A;  2EFG A;  1XMQ I;  1IBM I;  4LF4 E;  4JI0 I;  4LF5 I;  4BA2 A;  1KKH A;  3PS1 A;  4B3M E;  4JI5 E;  3GLL A;  1Z0G A;  4DR3 E;  4DR5 I;  4IFD C;  4DV7 I;  3J7A M;  4B3R I;  1XXE A;  1XNR E;  3M6A A;  4ED4 A;  1HK7 A;  4YY3 I;  3V2U C;  3HJC A;  1USV A;  3F0N A;  1RRE A;  3WU3 A;  1E3H A;  3M85 D;  2PO2 A;  5FLX Q;  2JT2 A;  2V2Z A;  1MX0 A;  4IFD E;  5EL9 A;  2AE8 A;  2O1U A;  3PRY A;  3L7Z B;  5LMN I;  4DR2 I;  2VQF I;  5GMD A;  4DUY E;  1Z0T A;  1Y4U A;  4M1K A;  2JEA A;  2C39 A;  4X62 I;  3B78 A;  2ZM6 E;  2O1W A;  5DRO A;  4AID A;  4HY1 A;  2E5L E;  3P3C A;  2PO1 B;  4P7A A;  5C0X E;  4OO1 D;  4IZJ B;  2UU9 I;  3M7N D;  1IBL I;  3LTO A;  2WW4 A;  4WUD A;  4LFC E;  2VQE I;  4X66 E;  1PIE A;  1FI4 A;  1UEK A;  4RPF A; 
#chains in the Genus database with same CATH homology
 1UDN A;  2JEB B;  2C37 A;  3L7Z A;  1R6L A;  5JEA D;  2C38 A;  3M85 G;  4IFD D;  4OO1 C;  5C0X C;  2WNR B;  2WP8 B;  3GCM A;  4NBQ A;  4IFD F;  2PO0 B;  2NN6 C;  2BR2 B;  2BA0 D;  5C0X B;  3HKM A;  3KRN A;  4BA1 B;  5JEA A;  2NN6 B;  1E3P A;  2JE6 A;  2JEB A;  2BR2 A;  5JEA E;  4BA2 B;  2JEA B;  3H1C A;  4OO1 B;  5JEA B;  5C0X D;  1UDS A;  4OO1 E;  1UDO A;  2C38 B;  1UDQ A;  4BA2 A;  2BA1 G;  2WNR A;  5K36 B;  4IFD B;  2NN6 E;  3GLL A;  4IFD C;  5C0X F;  2C39 B;  2PO0 A;  3DD6 A;  3M7N G;  2NN6 A;  2PO1 A;  2JE6 B;  5JEA C;  5K36 C;  3U1K A;  1E3H A;  2NN6 F;  2WP8 A;  3M85 D;  2PO2 A;  4OO1 A;  3CDI A;  1R6M A;  3B4T A;  2PNZ B;  4IFD E;  5K36 D;  4AM3 A;  2NN6 D;  2PO2 B;  3L7Z B;  1OYP A;  4BA1 A;  4IFD A;  2PNZ A;  2JEA A;  2BA0 G;  2C39 A;  1OYS A;  5K36 F;  5K36 E;  4AID A;  3CDJ A;  3GME A;  2PO1 B;  5C0X E;  4OO1 D;  1OYR A;  5K36 A;  3M7N D;  2C37 B;  4AIM A;  5JEA F;  5C0X A;  4OO1 F;  2BA1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...