4DUYE

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4duyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duyE02
5L3JA 1N34I 4AQYI 3PYEA 2X7IA 4K0KI 4JI1I 2E1RA 4Z7CA 1O0WA 4DR6I 4HY1A 2RS6A 4DPWA 4DR4E 4WUBA 2V2VA 4DV6E 2F4VE 1HNXI 4DV1I 4FWDA 4USKA 1FKAE 4DV2E 1DI2A 3V2UC 1MG7A 2UXBE 4LF4E 1IBLI 1Z0BA 3ZZUA 4LFCE 4LF6I 3VYYA 4JI3E 1Z0VA 3J80Q 4JI8I 2VQFI 2L2NA 4X65E 1NHJA 3LLHA 1YYWA 4AQYE 1T4LB 4JI1E 5LMUI 3VYXA 1ZM9A 3K1JA 2J7KA 3ADJA 1J5EI 2N3HA 4HYMA 2F4VI 4DV1E 4YHHE 2CPNA 1Z5CA 2EZ6A 2V34A 1GQEA 3JAMQ 4R1FA 1BKNA 2JVAA 4NXME 1X48A 3M6AA 2LUQA 4JI3I 5IWAI 1X49A 2UXDE 4PU9A 1XNQI 3V5RA 3QT8A 1FI4A 1ZM4A 2HHHE 2DB2A 5LMUE 4P7AA 5A2QQ 1RQ0A 2A2DA 1FWLA 1J5EE 2DMYA 2XEXA 4DR5E 2V8PA 4JI4I 2UUCE 2UXCE 1NZ0A 1H73A 2LRSA 4DR1E 4YHHI 3PYGA 2E5LE 4WUDA 4JI0I 4B3RI 4DV3I 4DPTA 2L2MA 3J7Yp 3LPSA 2Q2EB 4JV5I 1YYOA 4NXMI 3H4LA 4PRVA 4XTJA 1UILA 3ADIA 2IHR1 5IWAE 4FWHA 2YT4A 1QZRA 1UEKA 1S16A 3WU4A 2ZM6I 2UXDI 2B7VA 1XNQE 2HHHI 4JI5I 4WYQB 2LUPB 1ELOA 1D6TA 1ZXNA 1Z0CA 4B3ME 2NUFA 4LF5E 2DEJA 4URLA 4DR5I 2NA2A 1Z5BA 2NUGA 3ADLA 3OTOI 4JI4E 2UUCI 4JI7I 2UXCI 4DR1I 1N36I 4LFBI 4GKJE 2BM0A 2V2QA 3K17A 2E5LI 4JI0E 4B3RE 2HFUA 4DV3E 1RC7A 2AJ4A 2CZ9A 1HNZE 3CWVA 4HXZA 4EMDA 4JV5E 1OJ4A 2RTXA 1NHHA 1YYKA 4PRXA 4YY3E 3WU3A 5A2QC 3QT7A 4DR2I 4LF9E 2NUEA 2HK3A 2ZM6E 4DU7A 4JI6I 2ZITA 2ZBKB 4JI5E 4DPUA 3WU6A 4JYAI 1Z0GA 4DV7I 3HULA 3ZKDA 4DU8A 2L3CA 4B3MI 4LF5I 3WU5A 1Z0EA 4JG4A 4FN5A 3OTOE 1ZBTA 1B63A 4JI7E 3J7AG 2DIXA 4JI2E 4LF7I 1WHNA 3F0NA 3QT6A 4UT4A 2OI2A 2R42A 1N36E 4LFBE 4GKJI 1EKZA 5GMEA 2BM1A 1XNRE 3T1HI 2GS8A 2HK2A 2RS7A 1HNZI 3D4JA 3ZZ0A 2KHXA 1KVKA 1Z5AA 3ZKBA 4YY3I 5IT9C 2UUAE 4DR2E 3J7AM 4LF9I 4JI6E 3QT5A 2HKJA 1H74A 4DV0E 4JYAE 4RPFA 5BR8E 4B3TI 3J81C 1Z0TA 4DV7E 1PVGA 1KIJA 1MX0A 1IBME 4MYTA 3ZZTA 1A6FA 3C4TA 3C4BA 3JAMC 4JI2I 2VQEI 4LF7E 3B82A 1DARA 4FWGA 1PIEA 1EA6A 3GONA 1XNRI 3T1HE 2UU9I 2NPFA 2JY9A 4NXNE 1HR0E 4X66E 2HKEA 1T4OA 4DV4I 2RSMA 4P52A 2HFSA 4KQVA 4DPYA 2UUAI 4DPXA 3J80C 4LF8I 1YZ9A 4KHPE 3ZM7A 2L33A 1H72C 4UTGA 4DV0I 2LTRA 2VF3A 1ZXMA 1N0UA 4B3TE 4HACB 5BR8I 1Z0WA 2V2ZA 1Z59A 1N33I 1ZM2A 1IBMI 3ADGA 3LNUA 4B3SI 5LL6R 4LFAI 4MYUA 1J26A 2VQEE 2EFGA 1S4EA 1N0VC 1UHZA 4M1KA 4M2ZA 1FNMA 2UU9E 4NXNI 1HR0I 1KTVA 1I94E 4Z7YA 2B3TB 4DR3E 4X8WA 4X66I 2L3JA 1X47A 3T1YE 1RREA 4DV4E 3LTOA 1B62A 3PYFA 4LF8E 1XMOE 2BV3A 3P1XA 5FLXQ 1U2RA 1N32E 4DUYE 4KHPI 1MU5A 5LMNI 4DV5E 1HNWI 1H7UA 1IBKI 2MDRA 2L2KB 1N33E 3Q1QA 1NHIA 4DUZE 5FLXC 4DR7E 2A2CA 4DKKA 4B3SE 4LFAE 1XMQI 1QU6A 2LJHA 4WFTA 4USMA 1K47A 4X64I 4ED4A 4OX9I 1XHKA 2UUBE 4M30A 3J81Q 5CFFE 3PYDA 1I94I 4WUCA 4GKKE 4DR3I 4I3HA 4X62I 4HACA 1KKHA 2N3GA 3T1YI 2WW4A 1T4NA 1FJGI 1N34E 3B78A 4K0KE 1XMOI 1PKPA 2DEIA 5IT9Q 1N32I 4DR6E 4DUYI 5GMDA 1EI1A 5LMNE 1VISA 4DR4I 4DV5I 2LBSB 4DV6I 1HNWE 1FWKA 2LJPA 1HNXE 4DXLA 1IBKE 4FW9A 4ZVIA 2B7TA 2X36A 4DUZI 3HTXA 4DR7I 1RR9A 4DV2I 1XMQE 4OOGC 4X64E 1WHQA 2UXBI 4OX9E 4LF4I 1IBLE 2UUBI 4LFCI 4LF6E 3B8HA 2LTSA 1H7SA 2R3VA 4GKKI 1WUUA 4JI8E 4X62E 1STUA 2VQFE 1ZM3A 1FJGE 4X65I
chains in the Genus database with same CATH superfamily
5L3JA 1N34I 4AQYI 3PYEA 2F8BA 3THOB 1YFHA 2X7IA 4K0KI 4JI1I 2E1RA 4Z7CA 3EQ1A 2M4IA 2E72A 3L00A 2JE6B 3L7ZA 4BA2B 4P78A 5K36B 1O0WA 4DR6I 3DF6A 2YTPA 4HY1A 2RS6A 4DPWA 2PO1A 4DR4E 4WUBA 4O5GA 2JP9A 2V2VA 2M7QA 2NN6E 4DV6E 2F4VE 1HNXI 2EL4A 2EMYA 4MDTA 5C0XD 4DV1I 2EOJA 3P3EA 1RHYA 5EL9A 3VHTB 4FWDA 1PJTA 4USKA 1FKAE 4R2DA 5K36A 2YSPA 4DV2E 2EOFA 1DI2A 3L7ZB 4BA2A 3V2UC 4BCAA 1MG7A 1JK1A 2NN6F 2UXBE 5EKWA 4LF4E 1IBLI 3OMLA 2AE8A 2GHFA 4R2QA 2EN1A 2VF1A 4QNJA 1Z0BA 2CG9A 3ZZUA 4O24A 4AM3A 3KZZA 4WSPA 4LFCE 3GMEA 4LF6I 5IV8B 2EMGA 2EOZA 1IQOA 3VYYA 1WRJA 2L6MA 4JI3E 3KWRA 1Z0VA 3J80Q 5DNYA 2EM4A 2EPRA 2G7HA 4JI8I 2WNRA 1BB8A 2O1UA 2VQFI 3AV0A 2L2NA 2LV2A 1MGTA 4FW3A 5KL3A 4X65E 2RSIA 1NHJA 3LLHA 1YYWA 4AQYE 3DD6A 1X6HA 1T4LB 3KZYA 1USVA 4DMIA 4IFDF 3AUZA 5C0XF 2V83A 4JI1E 5LMUI 2L8TA 3MHHC 2PO0A 3VYXA 2EQ0A 1KJKA 5AE3A 2EM3A 2EM2A 2EN6A 1ZM9A 3K1JA 2PO0B 2J7KA 4LF7I 2EPKX 3ADJA 1J5EI 2N3HA 4HYMA 2EOXA 2WP8A 2F4VI 4ISAA 2JT2A 5KL4A 2PNLA 4OO1E 4DV1E 5AC4A 2EPOA 4BMJA 1OYPA 2MKNA 3UHMA 4AIMA 1WJPA 2MC5A 4IZJB 2RPCA 1EH7A 2WNRB 4YHHE 2CPNA 2V87A 2EZ6A 2R1FA 2EM0A 1Z5CA 1OYRA 2V34A 3P06A 1A1FA 3HPZA 3JTZA 2EM7A 1GQEA 3JAMQ 2DRPA 4R1FA 1USUA 5KL2A 1BKNA 2JVAA 2LMZA 4NXME 1X48A 2LUQA 2Z5BA 3M6AA 1NCSA 2YU8A 2NN6B 2GPIA 3H1CA 4JI3I 3GLLA 4IZKB 4BS9A 1YUJA 3MHSC 5IWAI 5C0XC 1B69A 1X49A 4ZYEA 2UXDE 4PU9A 4IJDA 1XNQI 2FTXB 4WXDA 3V5RA 4OO1B 3QT8A 1X6EA 3C6MA 1UBDC 2HGHA 1PDAA 2DGCA 2HHHE 2DSYA 1FI4A 3FIGA 2DB2A 2PNZB 5LMUE 4P7AA 1KYQA 5A2QQ 2EMWA 5JEAC 3VK6A 1RQ0A 1E3PA 1ZU1A 4LOMA 2A2DA 1FWLA 3P3GA 1YUIA 1J5EE 2YTNA 4N3OA 2EOMA 2DMYA 4BHCA 2XEXA 3EPLA 4DR5E 1JK2A 3NZKA 2V8PA 2EOSA 2EN7A 4JI4I 1P47A 2UUCE 2UXCE 1NZ0A 4F9AB 4GZNC 1DGCA 2LRSA 1H73A 4DR1E 2C39A 1UDQA 3ECRA 1VI7A 5C0XA 2WCC3 4YHHI 2CGEA 4IFDA 3PYGA 2EM8A 2E5LE 4WUDA 4JI0I 4B3RI 5K36E 2EN8A 1Y6ZA 4DPTA 4DV3I 2L2MA 2ELYA 2EMIA 3J7Yp 2O1VA 3BIDA 3LPSA 5FWKA 2Q2EB 4JV5I 1YYOA 2E1MA 1YPNA 4WSGA 1E3HA 4NXMI 2JOXA 1QNTA 3H4LA 4R2EA 4PRVA 4U3DA 2FV4B 4XTJA 1UILA 2EPXA 1YSAC 1UN6B 1IQSA 1IMUA 3ADIA 2JEAA 4O43A 2IHR1 2IESA 5IWAE 4FWHA 2EMKA 2YT4A 4FK5C 1QZRA 1UEKA 1S16A 3WU4A 5JEAF 2ZM6I 2PNZA 2YU5A 2UXDI 2B7VA 1XNQE 4IZJD 4ZYHA 2HHHI 1Y4SA 3EPKA 2LT7A 2NN6C 4JI5I 2ENHA 4WYQB 1AAYA 3LMLA 2LUPB 2VE7C 1ELOA 1D6TA 1A1JA 4NHRA 4IZKA 2EMBA 1ZXNA 1Z0CA 3HJCA 2LJUA 4B3ME 2NUFA 4LF5E 2DEJA 5TSEA 4BA1B 4URLA 4DR5I 2NA2A 2PRTA 2NUGA 1Z5BA 5JEAA 3ADLA 3OTOI 2EWLA 4JI4E 2J65A 2UUCI 4JI7I 3JU0A 2UXCI 1A1HA 5A6BD 4DR1I 2IERA 1PJQA 4FW4A 1EH8A 1N36I 4LFBI 4BC7A 4GKJE 2BM0A 2V2QA 3K17A 2E5LI 3M7NG 4JI0E 4B3RE 2HFUA 4DV3E 2V86A 2DLKA 1RC7A 2AJ4A 2BA1D 1Y60A 2O1WA 3RMPA 2CZ9A 1HNZE 2YTJA 3CWVA 2EOOA 4HXZA 4EMDA 4JV5E 4LPFA 1R6MA 1EH6A 1OJ4A 2RTXA 3H09A 1G2DC 4FW5A 5JEAD 2I9IA 2HJJA 2EMFA 4N4RB 1YYKA 1NHHA 4PRXA 2EOIA 4P7DA 4YY3E 4KZSA 2B9DA 2KONA 2ODRC 5A2QC 2C37A 4RHBB 2WP8B 3WU3A 4FW7A 3QT7A 3HKMA 5AE1A 2BA0G 4DR2I 2I13A 2JR1A 2Z5CA 4LF9E 2NUEA 2HK3A 2JEAB 4F6MA 2ZM6E 1BBGA 1X6FA 4DU7A 4JI6I 2ZITA 2PO2B 5A6AA 2EOQA 2ZBKB 5AE2A 1X3CA 1TF6A 3BGHA 3THNA 4JI5E 3CDIA 5DRPA 3WU6A 4DPUA 2JWOA 4JYAI 4BBYA 3P76A 4HEIA 1RMDA 3BBGA 1Y5YA 1Z0GA 4DV7I 3HULA 2GLIA 3ZKDA 1N3GA 3HPSA 4LCFA 2L3CA 4DU8A 4MU3A 4B3MI 4LF5I 3M7ND 4IFDB 3WU5A 1Z0EA 4JG4A 4FN5A 3M85D 1ZR9A 3OTOE 1ZBTA 3F6HA 1B63A 2Z5EA 4JI7E 3J7AG 2DIXA 2YZTA 1A1LA 5IXMB 4JI2E 2YTDA 2EMHA 1WHNA 5A69A 3F0NA 2BR2B 2GO4A 3QT6A 4UT4A 1T38A 2O3ZA 2OI2A 2R42A 5KL7A 1N36E 4LFBE 3EPHA 4GKJI 2CTDA 1EKZA 4AIDA 5GMEA 2EORA 2BM1A 2EM5A 1XNRE 4QNKA 3T1HI 2GS8A 2ADRA 4M9VC 2EPCA 2K7IA 2HK2A 4L5NC 2RS7A 2EPNA 1HNZI 4NZVA 3D4JA 3ZZ0A 3PS1A 2KHXA 3TQMA 2EOEA 2JEBB 1KVKA 2YTEA 1Z5AA 3ZKBA 5AASA 4R2RA 2YTOA 2F1DA 2IOQA 4I8OA 4YY3I 2EL6A 4F54A 2JEBA 4OKGA 5IT9C 2PO1B 2J7JA 2CVEA 2V89A 2UUAE 4DR2E 3J7AM 4LF9I 2EOYA 2EPAA 2FGGA 4JI6E 2H36X 2YTGA 4RH8A 3QT5A 4TUIA 2YTQA 3Q6MA 2HKJA 1BBOA 4GQUA 2YWQA 3ZOQB 1H74A 1UDNA 4DV0E 4JYAE 4RPFA 2YTIA 5BR8E 4B3TI 1A1IA 1UDOA 3J81C 1Z0TA 4DV7E 1PVGA 4J3DA 1KIJA 1MX0A 3M85G 1MEYC 1Z1BA 4IS9A 2VRDA 1IBME 4MYTA 1TF3A 4R2SA 5A6KA 3ZZTA 1G2FC 3HQ1A 1A6FA 3C4TA 4Q35B 3C4BA 3K85A 4IZJA 3JAMC 4MQYA 4JI2I 2VQEI 4LF7E 2HC5A 2EP3A 3B82A 2EPUA 1DARA 2PO2A 4FWGA 1PIEA 1EA6A 3GONA 1XNRI 2EMZA 2YPNA 2EPZA 3T1HE 2UU9I 2EPLX 2NPFA 2JY9A 4NXNE 1HR0E 3CDJA 5ELWA 3K6QA 2C37B 4X66E 2MC6A 3C6KA 2HKEA 1T4OA 4MU0A 2IOPA 5T6JA 4ZYDA 4DV4I 2RSMA 2YRHA 2WBSA 1R6LA 2HFSA 4P52A 1HK7A 4KQVA 3IWDA 3PRYA 2LO3A 4R2PA 4DPYA 3QG5C 1UDSA 2UUAI 2NABA 2WBTA 1NEIA 4X9JA 3J80C 1YHCA 4DPXA 4LF8I 1YZ9A 4LTYA 2YRMA 2EQ3A 1AH5A 2RQLA 5JEAE 1YH8A 4F2JC 4KHPE 3PS3A 2EJ4A 2EOHA 2L33A 1H72C 4UTGA 3ZM7A 2EL5A 3KRNA 4MLQA 1X5WA 4DV0I 2R76A 2LTRA 2YRKA 4GEQB 2VF3A 5JEAB 1ZXMA 1N0UA 5A6JA 4B3TE 4HACB 2YTFA 1Z0WA 4BA1A 2V2ZA 1Z59A 5BR8I 4OO1D 1ZM2A 1N33I 1IBMI 3ADGA 3DJWA 3GCMA 2EMAA 3LNUA 5LL6R 4B3SI 4IFDC 2JXPA 4LFAI 4MYUA 4FW6A 1J26A 4M0VA 2VQEE 2EFGA 5ADZA 1S4EA 1N0VC 1UHZA 4M1KA 2YSOA 4IS1C 2EPPA 2Q8UA 3MSWA 4IFDD 2EN3A 1A1GA 4M2ZA 1FNMA 4WX9A 1OYSA 2UU9E 4U3BA 3BF2A 2JE6A 5DROA 4NXNI 1HR0I 1KTVA 1I94E 4IFDE 4Z7YA 2B3TB 5KL5A 4DR3E 2ENAA 4BHBA 1ZM4A 4X8WA 2GQ0A 4MU1A 3EPJA 1F2IG 3U1KA 2LVHA 1GZ6A 2DLQA 4X66I 2BR2A 1XXEA 2V85A 1X47A 2L3JA 3IWCA 3T1YE 5F3WA 4DV4E 1RREA 3LTOA 1TN9A 1B62A 2ENCA 4OO1C 1P42A 3PYFA 5KL6A 2WZOA 4LF8E 1XMOE 2BV3A 3P1XA 1SFEA 5FLXQ 1U2RA 1PJSA 5K36C 1N32E 4DUYE 4NBQA 4KHPI 1MU5A 2C39B 5LMNI 4DV5E 4OZEA 2KOUA 4R8OA 1HNWI 5DNXA 2V88A 1H7UA 1IBKI 1LLMC 2MDRA 1A1KA 2L2KB 1N33E 5C0XE 1WXRA 2WBUA 3Q1QA 5K36D 1NHIA 4DUZE 5FLXC 2PNMA 2NN6D 4DR7E 3F6GA 4DKKA 2A2CA 4B3SE 2Z5CB 3HXLA 2BB8A 4LFAE 1XMQI 4KWYA 1QU6A 4J8ZA 2LJHA 4WFTA 4USMA 1K47A 4X64I 4ED4A 4OX9I 2GO3A 2VESA 1T39A 1L4SA 1XHKA 2LCEA 2ELZA 2EMCA 2EQ1A 2D9HA 2JOBA 4HTGA 2EE8A 4OO1A 4LU9A 4F9CB 2UUBE 4M30A 2EN2A 4F6NA 3J81Q 2JYAA 5CFFE 2ODRD 4R2CA 5LLQA 3M99B 3PYDA 4OO1F 1I94I 5DNLA 4WUCA 4GKKE 2N8XA 4DR3I 2JPAA 4I3HA 2M1SA 2NN6A 3P3CA 4X62I 4HACA 5AC5A 2Z5BB 2LE2A 1KKHA 2N3GA 2C38B 2EM6A 2BBGA 2BA1G 3T1YI 2EN4A 5K36F 1ZAAC 2CT1A 5DRQA 2EMXA 2WW4A 1T4NA 1FJGI 4BC9A 2C38A 1N34E 4ZYGA 4R03A 3B78A 4K0KE 1XMOI 4WXCA 1PKPA 2DEIA 2DMIA 5IT9Q 3PS2A 1N32I 4L8NA 4DR6E 4DUYI 4LCHA 1SR9A 5GMDA 2V8QB 5LMNE 1EI1A 1VISA 4DV5I 4DR4I 2LBSB 2BA0D 4DV6I 1HNWE 1FWKA 2LJPA 4LCGA 1HNXE 4DXLA 1IBKE 4R2AA 2O1TA 3Q6NA 4FW9A 2EM9A 4ZVIA 2B7TA 2X36A 4DUZI 3HTXA 2EMLA 4DR7I 5DRRA 4F9BB 4O4KA 1RR9A 4DV2I 4WPYA 1XMQE 3IWBA 4OOGC 4X64E 1Y4UA 1WHQA 2UXBI 2L92A 4OX9E 4LF4I 4Q28A 2MKDA 1IBLE 4MU4A 2CSHA 5A6BA 1ZBQA 3U1YA 2M9AA 3B4TA 2UUBI 1DQ3A 4LFCI 4LF6E 3B8HA 2MDGA 2LTSA 1H7SA 4TUGA 2A25A 2R3VA 2EPMX 2K4VA 4GKKI 1WUUA 4JI8E 4X62E 1STUA 5C0XB 2VQFE 1ZM3A 4MLVA 1GTKA 3UK3C 1FJGE 4X65I
chains in the Genus database with same CATH topology
5L3JA 1N34I 4AQYI 3PYEA 2F8BA 2X7IA 4K0KI 4JI1I 2E1RA 4Z7CA 2M4IA 4P78A 1O0WA 4DR6I 3DF6A 4HY1A 2RS6A 4DPWA 4DR4E 4WUBA 2V2VA 2M7QA 4DV6E 2F4VE 1HNXI 4DV1I 4FWDA 4USKA 1FKAE 4DV2E 1DI2A 3V2UC 4BCAA 1MG7A 2UXBE 4LF4E 1IBLI 3OMLA 2VF1A 1Z0BA 2CG9A 3ZZUA 4WSPA 4LFCE 4LF6I 3VYYA 2L6MA 4JI3E 3KWRA 1Z0VA 3J80Q 5DNYA 2G7HA 4JI8I 2O1UA 2VQFI 3AV0A 2L2NA 4X65E 1NHJA 3LLHA 1YYWA 4AQYE 1T4LB 1USVA 4DMIA 3AUZA 2V83A 4JI1E 5LMUI 2L8TA 3VYXA 5AE3A 1ZM9A 3K1JA 2J7KA 3ADJA 1J5EI 2N3HA 4HYMA 2F4VI 2PNLA 4DV1E 4BMJA 2MC5A 4IZJB 4YHHE 2CPNA 2V87A 2EZ6A 1Z5CA 2V34A 3P06A 3HPZA 3JTZA 1GQEA 3JAMQ 4R1FA 1USUA 1BKNA 2JVAA 2LMZA 4NXME 1X48A 2LUQA 2Z5BA 3M6AA 4JI3I 4IZKB 4BS9A 5IWAI 1X49A 2UXDE 4PU9A 1XNQI 2FTXB 3V5RA 3QT8A 1FI4A 1ZM4A 2HHHE 2DSYA 3FIGA 2DB2A 5LMUE 4P7AA 5A2QQ 3VK6A 1RQ0A 2A2DA 1FWLA 1J5EE 4N3OA 2DMYA 2XEXA 4DR5E 2V8PA 4JI4I 2UUCE 2UXCE 1NZ0A 4F9AB 1H73A 2LRSA 4DR1E 4YHHI 2CGEA 3PYGA 2E5LE 4WUDA 4JI0I 4B3RI 4DV3I 1Y6ZA 4DPTA 2L2MA 3J7Yp 2O1VA 3LPSA 5FWKA 2Q2EB 4JV5I 1YYOA 2E1MA 4NXMI 2JOXA 3H4LA 4PRVA 2FV4B 4XTJA 1UILA 3ADIA 2IHR1 5IWAE 4FWHA 2YT4A 1QZRA 1UEKA 1S16A 3WU4A 2ZM6I 2UXDI 2B7VA 1XNQE 4IZJD 2HHHI 1Y4SA 4JI5I 4WYQB 3LMLA 2LUPB 2VE7C 1ELOA 1D6TA 4IZKA 1ZXNA 1Z0CA 3HJCA 4B3ME 2NUFA 4LF5E 2DEJA 4URLA 4DR5I 2NA2A 1Z5BA 2NUGA 3ADLA 3OTOI 2EWLA 4JI4E 2UUCI 4JI7I 3JU0A 2UXCI 4DR1I 1N36I 4LFBI 4BC7A 4GKJE 2BM0A 2V2QA 3K17A 2E5LI 4JI0E 4B3RE 2HFUA 4DV3E 2V86A 1RC7A 2AJ4A 2O1WA 3RMPA 2CZ9A 1HNZE 3CWVA 4HXZA 4EMDA 4JV5E 1OJ4A 2RTXA 3H09A 1NHHA 1YYKA 4PRXA 4P7DA 4YY3E 2KONA 2B9DA 4KZSA 2ODRC 5A2QC 3WU3A 3QT7A 5AE1A 4DR2I 2JR1A 2Z5CA 2NUEA 4LF9E 2HK3A 2ZM6E 4DU7A 4JI6I 2ZITA 2ZBKB 5AE2A 4JI5E 4DPUA 3WU6A 2JWOA 4JYAI 4BBYA 1Z0GA 4DV7I 3HULA 3ZKDA 3HPSA 4DU8A 2L3CA 4B3MI 4LF5I 3WU5A 1Z0EA 4JG4A 4FN5A 3OTOE 1ZBTA 3F6HA 1B63A 2Z5EA 4JI7E 3J7AG 2DIXA 2YZTA 4JI2E 4LF7I 1WHNA 3F0NA 3QT6A 4UT4A 2OI2A 2R42A 1N36E 4LFBE 4GKJI 1EKZA 5GMEA 2BM1A 1XNRE 3T1HI 2GS8A 2HK2A 4L5NC 2RS7A 1HNZI 3D4JA 3ZZ0A 2KHXA 1KVKA 1Z5AA 3ZKBA 5AASA 2IOQA 4I8OA 4YY3I 4F54A 5IT9C 2V89A 2UUAE 4DR2E 3J7AM 4LF9I 2FGGA 4JI6E 2H36X 3QT5A 4TUIA 3Q6MA 2HKJA 3ZOQB 1H74A 4DV0E 4JYAE 4RPFA 5BR8E 4B3TI 3J81C 1Z0TA 4DV7E 1PVGA 1KIJA 1MX0A 1IBME 4MYTA 3ZZTA 3HQ1A 1A6FA 3C4TA 3C4BA 3K85A 4IZJA 3JAMC 4JI2I 2VQEI 4LF7E 3B82A 1DARA 4FWGA 1PIEA 1EA6A 3GONA 1XNRI 3T1HE 2UU9I 2NPFA 2JY9A 4NXNE 1HR0E 3K6QA 4X66E 2MC6A 2HKEA 1T4OA 2IOPA 5T6JA 4DV4I 2RSMA 4P52A 2HFSA 1HK7A 4KQVA 3IWDA 3PRYA 4DPYA 2UUAI 4DPXA 3J80C 4LF8I 1YZ9A 4LTYA 4KHPE 3ZM7A 2L33A 1H72C 4UTGA 4DV0I 2LTRA 4GEQB 2VF3A 1ZXMA 1N0UA 4B3TE 4HACB 5BR8I 1Z0WA 2V2ZA 1Z59A 1N33I 1ZM2A 1IBMI 3ADGA 3DJWA 3LNUA 4B3SI 5LL6R 4LFAI 4MYUA 1J26A 4M0VA 2VQEE 2EFGA 5ADZA 1S4EA 1N0VC 1UHZA 4M1KA 3MSWA 4M2ZA 1FNMA 2UU9E 4NXNI 1HR0I 1KTVA 1I94E 4Z7YA 2B3TB 4DR3E 2GQ0A 4X8WA 4X66I 1GZ6A 1RREA 1X47A 2V85A 3IWCA 2L3JA 3T1YE 4DV4E 5F3WA 3LTOA 1B62A 3PYFA 2WZOA 4LF8E 1XMOE 2BV3A 3P1XA 5FLXQ 1U2RA 1N32E 4DUYE 4KHPI 1MU5A 5LMNI 4DV5E 1HNWI 2KOUA 4R8OA 2V88A 1H7UA 1IBKI 2MDRA 2L2KB 1N33E 1WXRA 3Q1QA 1NHIA 4DUZE 5FLXC 2PNMA 4DR7E 3F6GA 4DKKA 2A2CA 4B3SE 2Z5CB 3HXLA 4LFAE 1XMQI 1QU6A 4J8ZA 2LJHA 4WFTA 4USMA 1K47A 4X64I 4ED4A 4OX9I 1XHKA 2JOBA 4LU9A 4F9CB 2UUBE 4M30A 3J81Q 5CFFE 2ODRD 3PYDA 1I94I 4WUCA 4GKKE 4DR3I 4I3HA 2M1SA 4X62I 4HACA 2Z5BB 2LE2A 1KKHA 2N3GA 3T1YI 2WW4A 1T4NA 1FJGI 4BC9A 1N34E 4R03A 3B78A 4K0KE 1XMOI 1PKPA 2DEIA 5IT9Q 1N32I 4L8NA 4DR6E 4DUYI 1SR9A 5GMDA 2V8QB 5LMNE 1EI1A 1VISA 4DV5I 4DR4I 2LBSB 4DV6I 1HNWE 1FWKA 2LJPA 1HNXE 4DXLA 1IBKE 2O1TA 3Q6NA 4FW9A 4ZVIA 2B7TA 2X36A 4DUZI 3HTXA 4DR7I 4F9BB 1RR9A 4DV2I 4WPYA 1XMQE 3IWBA 4OOGC 4X64E 1Y4UA 1WHQA 2UXBI 2L92A 4OX9E 4LF4I 4Q28A 1IBLE 1ZBQA 2UUBI 1DQ3A 4LFCI 4LF6E 3B8HA 2LTSA 1H7SA 4TUGA 2R3VA 2K4VA 4GKKI 1WUUA 4JI8E 4X62E 1STUA 2VQFE 1ZM3A 1FJGE 4X65I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3J A;  1N34 I;  4AQY I;  3PYE A;  2X7I A;  4K0K I;  4JI1 I;  2E1R A;  4Z7C A;  1O0W A;  4DR6 I;  4HY1 A;  2RS6 A;  4DPW A;  4DR4 E;  4WUB A;  2V2V A;  4DV6 E;  2F4V E;  1HNX I;  4DV1 I;  4FWD A;  4USK A;  1FKA E;  4DV2 E;  1DI2 A;  3V2U C;  1MG7 A;  2UXB E;  4LF4 E;  1IBL I;  1Z0B A;  3ZZU A;  4LFC E;  4LF6 I;  3VYY A;  4JI3 E;  1Z0V A;  3J80 Q;  4JI8 I;  2VQF I;  2L2N A;  4X65 E;  1NHJ A;  3LLH A;  1YYW A;  4AQY E;  1T4L B;  4JI1 E;  5LMU I;  3VYX A;  1ZM9 A;  3K1J A;  2J7K A;  3ADJ A;  1J5E I;  2N3H A;  4HYM A;  2F4V I;  4DV1 E;  4YHH E;  2CPN A;  1Z5C A;  2EZ6 A;  2V34 A;  1GQE A;  3JAM Q;  4R1F A;  1BKN A;  2JVA A;  4NXM E;  1X48 A;  3M6A A;  2LUQ A;  4JI3 I;  5IWA I;  1X49 A;  2UXD E;  4PU9 A;  1XNQ I;  3V5R A;  3QT8 A;  1FI4 A;  1ZM4 A;  2HHH E;  2DB2 A;  5LMU E;  4P7A A;  5A2Q Q;  1RQ0 A;  2A2D A;  1FWL A;  1J5E E;  2DMY A;  2XEX A;  4DR5 E;  2V8P A;  4JI4 I;  2UUC E;  2UXC E;  1NZ0 A;  1H73 A;  2LRS A;  4DR1 E;  4YHH I;  3PYG A;  2E5L E;  4WUD A;  4JI0 I;  4B3R I;  4DV3 I;  4DPT A;  2L2M A;  3J7Y p;  3LPS A;  2Q2E B;  4JV5 I;  1YYO A;  4NXM I;  3H4L A;  4PRV A;  4XTJ A;  1UIL A;  3ADI A;  2IHR 1;  5IWA E;  4FWH A;  2YT4 A;  1QZR A;  1UEK A;  1S16 A;  3WU4 A;  2ZM6 I;  2UXD I;  2B7V A;  1XNQ E;  2HHH I;  4JI5 I;  4WYQ B;  2LUP B;  1ELO A;  1D6T A;  1ZXN A;  1Z0C A;  4B3M E;  2NUF A;  4LF5 E;  2DEJ A;  4URL A;  4DR5 I;  2NA2 A;  1Z5B A;  2NUG A;  3ADL A;  3OTO I;  4JI4 E;  2UUC I;  4JI7 I;  2UXC I;  4DR1 I;  1N36 I;  4LFB I;  4GKJ E;  2BM0 A;  2V2Q A;  3K17 A;  2E5L I;  4JI0 E;  4B3R E;  2HFU A;  4DV3 E;  1RC7 A;  2AJ4 A;  2CZ9 A;  1HNZ E;  3CWV A;  4HXZ A;  4EMD A;  4JV5 E;  1OJ4 A;  2RTX A;  1NHH A;  1YYK A;  4PRX A;  4YY3 E;  3WU3 A;  5A2Q C;  3QT7 A;  4DR2 I;  4LF9 E;  2NUE A;  2HK3 A;  2ZM6 E;  4DU7 A;  4JI6 I;  2ZIT A;  2ZBK B;  4JI5 E;  4DPU A;  3WU6 A;  4JYA I;  1Z0G A;  4DV7 I;  3HUL A;  3ZKD A;  4DU8 A;  2L3C A;  4B3M I;  4LF5 I;  3WU5 A;  1Z0E A;  4JG4 A;  4FN5 A;  3OTO E;  1ZBT A;  1B63 A;  4JI7 E;  3J7A G;  2DIX A;  4JI2 E;  4LF7 I;  1WHN A;  3F0N A;  3QT6 A;  4UT4 A;  2OI2 A;  2R42 A;  1N36 E;  4LFB E;  4GKJ I;  1EKZ A;  5GME A;  2BM1 A;  1XNR E;  3T1H I;  2GS8 A;  2HK2 A;  2RS7 A;  1HNZ I;  3D4J A;  3ZZ0 A;  2KHX A;  1KVK A;  1Z5A A;  3ZKB A;  4YY3 I;  5IT9 C;  2UUA E;  4DR2 E;  3J7A M;  4LF9 I;  4JI6 E;  3QT5 A;  2HKJ A;  1H74 A;  4DV0 E;  4JYA E;  4RPF A;  5BR8 E;  4B3T I;  3J81 C;  1Z0T A;  4DV7 E;  1PVG A;  1KIJ A;  1MX0 A;  1IBM E;  4MYT A;  3ZZT A;  1A6F A;  3C4T A;  3C4B A;  3JAM C;  4JI2 I;  2VQE I;  4LF7 E;  3B82 A;  1DAR A;  4FWG A;  1PIE A;  1EA6 A;  3GON A;  1XNR I;  3T1H E;  2UU9 I;  2NPF A;  2JY9 A;  4NXN E;  1HR0 E;  4X66 E;  2HKE A;  1T4O A;  4DV4 I;  2RSM A;  4P52 A;  2HFS A;  4KQV A;  4DPY A;  2UUA I;  4DPX A;  3J80 C;  4LF8 I;  1YZ9 A;  4KHP E;  3ZM7 A;  2L33 A;  1H72 C;  4UTG A;  4DV0 I;  2LTR A;  2VF3 A;  1ZXM A;  1N0U A;  4B3T E;  4HAC B;  5BR8 I;  1Z0W A;  2V2Z A;  1Z59 A;  1N33 I;  1ZM2 A;  1IBM I;  3ADG A;  3LNU A;  4B3S I;  5LL6 R;  4LFA I;  4MYU A;  1J26 A;  2VQE E;  2EFG A;  1S4E A;  1N0V C;  1UHZ A;  4M1K A;  4M2Z A;  1FNM A;  2UU9 E;  4NXN I;  1HR0 I;  1KTV A;  1I94 E;  4Z7Y A;  2B3T B;  4DR3 E;  4X8W A;  4X66 I;  2L3J A;  1X47 A;  3T1Y E;  1RRE A;  4DV4 E;  3LTO A;  1B62 A;  3PYF A;  4LF8 E;  1XMO E;  2BV3 A;  3P1X A;  5FLX Q;  1U2R A;  1N32 E;  4DUY E;  4KHP I;  1MU5 A;  5LMN I;  4DV5 E;  1HNW I;  1H7U A;  1IBK I;  2MDR A;  2L2K B;  1N33 E;  3Q1Q A;  1NHI A;  4DUZ E;  5FLX C;  4DR7 E;  2A2C A;  4DKK A;  4B3S E;  4LFA E;  1XMQ I;  1QU6 A;  2LJH A;  4WFT A;  4USM A;  1K47 A;  4X64 I;  4ED4 A;  4OX9 I;  1XHK A;  2UUB E;  4M30 A;  3J81 Q;  5CFF E;  3PYD A;  1I94 I;  4WUC A;  4GKK E;  4DR3 I;  4I3H A;  4X62 I;  4HAC A;  1KKH A;  2N3G A;  3T1Y I;  2WW4 A;  1T4N A;  1FJG I;  1N34 E;  3B78 A;  4K0K E;  1XMO I;  1PKP A;  2DEI A;  5IT9 Q;  1N32 I;  4DR6 E;  4DUY I;  5GMD A;  1EI1 A;  5LMN E;  1VIS A;  4DR4 I;  4DV5 I;  2LBS B;  4DV6 I;  1HNW E;  1FWK A;  2LJP A;  1HNX E;  4DXL A;  1IBK E;  4FW9 A;  4ZVI A;  2B7T A;  2X36 A;  4DUZ I;  3HTX A;  4DR7 I;  1RR9 A;  4DV2 I;  1XMQ E;  4OOG C;  4X64 E;  1WHQ A;  2UXB I;  4OX9 E;  4LF4 I;  1IBL E;  2UUB I;  4LFC I;  4LF6 E;  3B8H A;  2LTS A;  1H7S A;  2R3V A;  4GKK I;  1WUU A;  4JI8 E;  4X62 E;  1STU A;  2VQF E;  1ZM3 A;  1FJG E;  4X65 I; 
#chains in the Genus database with same CATH topology
 5L3J A;  1N34 I;  4AQY I;  3PYE A;  2F8B A;  3THO B;  1YFH A;  2X7I A;  4K0K I;  4JI1 I;  2E1R A;  4Z7C A;  3EQ1 A;  2M4I A;  2E72 A;  3L00 A;  2JE6 B;  3L7Z A;  4BA2 B;  4P78 A;  5K36 B;  1O0W A;  4DR6 I;  3DF6 A;  2YTP A;  4HY1 A;  2RS6 A;  4DPW A;  2PO1 A;  4DR4 E;  4WUB A;  4O5G A;  2JP9 A;  2V2V A;  2M7Q A;  2NN6 E;  4DV6 E;  2F4V E;  1HNX I;  2EL4 A;  2EMY A;  4MDT A;  5C0X D;  4DV1 I;  2EOJ A;  3P3E A;  1RHY A;  5EL9 A;  3VHT B;  4FWD A;  1PJT A;  4USK A;  1FKA E;  4R2D A;  5K36 A;  2YSP A;  4DV2 E;  2EOF A;  1DI2 A;  3L7Z B;  4BA2 A;  3V2U C;  4BCA A;  1MG7 A;  1JK1 A;  2NN6 F;  2UXB E;  5EKW A;  4LF4 E;  1IBL I;  3OML A;  2AE8 A;  2GHF A;  4R2Q A;  2EN1 A;  2VF1 A;  4QNJ A;  1Z0B A;  2CG9 A;  3ZZU A;  4O24 A;  4AM3 A;  3KZZ A;  4WSP A;  4LFC E;  3GME A;  4LF6 I;  5IV8 B;  2EMG A;  2EOZ A;  1IQO A;  3VYY A;  1WRJ A;  2L6M A;  4JI3 E;  3KWR A;  1Z0V A;  3J80 Q;  5DNY A;  2EM4 A;  2EPR A;  2G7H A;  4JI8 I;  2WNR A;  1BB8 A;  2O1U A;  2VQF I;  3AV0 A;  2L2N A;  2LV2 A;  1MGT A;  4FW3 A;  5KL3 A;  4X65 E;  2RSI A;  1NHJ A;  3LLH A;  1YYW A;  4AQY E;  3DD6 A;  1X6H A;  1T4L B;  3KZY A;  1USV A;  4DMI A;  4IFD F;  3AUZ A;  5C0X F;  2V83 A;  4JI1 E;  5LMU I;  2L8T A;  3MHH C;  2PO0 A;  3VYX A;  2EQ0 A;  1KJK A;  5AE3 A;  2EM3 A;  2EM2 A;  2EN6 A;  1ZM9 A;  3K1J A;  2PO0 B;  2J7K A;  4LF7 I;  2EPK X;  3ADJ A;  1J5E I;  2N3H A;  4HYM A;  2EOX A;  2WP8 A;  2F4V I;  4ISA A;  2JT2 A;  5KL4 A;  2PNL A;  4OO1 E;  4DV1 E;  5AC4 A;  2EPO A;  4BMJ A;  1OYP A;  2MKN A;  3UHM A;  4AIM A;  1WJP A;  2MC5 A;  4IZJ B;  2RPC A;  1EH7 A;  2WNR B;  4YHH E;  2CPN A;  2V87 A;  2EZ6 A;  2R1F A;  2EM0 A;  1Z5C A;  1OYR A;  2V34 A;  3P06 A;  1A1F A;  3HPZ A;  3JTZ A;  2EM7 A;  1GQE A;  3JAM Q;  2DRP A;  4R1F A;  1USU A;  5KL2 A;  1BKN A;  2JVA A;  2LMZ A;  4NXM E;  1X48 A;  2LUQ A;  2Z5B A;  3M6A A;  1NCS A;  2YU8 A;  2NN6 B;  2GPI A;  3H1C A;  4JI3 I;  3GLL A;  4IZK B;  4BS9 A;  1YUJ A;  3MHS C;  5IWA I;  5C0X C;  1B69 A;  1X49 A;  4ZYE A;  2UXD E;  4PU9 A;  4IJD A;  1XNQ I;  2FTX B;  4WXD A;  3V5R A;  4OO1 B;  3QT8 A;  1X6E A;  3C6M A;  1UBD C;  2HGH A;  1PDA A;  2DGC A;  2HHH E;  2DSY A;  1FI4 A;  3FIG A;  2DB2 A;  2PNZ B;  5LMU E;  4P7A A;  1KYQ A;  5A2Q Q;  2EMW A;  5JEA C;  3VK6 A;  1RQ0 A;  1E3P A;  1ZU1 A;  4LOM A;  2A2D A;  1FWL A;  3P3G A;  1YUI A;  1J5E E;  2YTN A;  4N3O A;  2EOM A;  2DMY A;  4BHC A;  2XEX A;  3EPL A;  4DR5 E;  1JK2 A;  3NZK A;  2V8P A;  2EOS A;  2EN7 A;  4JI4 I;  1P47 A;  2UUC E;  2UXC E;  1NZ0 A;  4F9A B;  4GZN C;  1DGC A;  2LRS A;  1H73 A;  4DR1 E;  2C39 A;  1UDQ A;  3ECR A;  1VI7 A;  5C0X A;  2WCC 3;  4YHH I;  2CGE A;  4IFD A;  3PYG A;  2EM8 A;  2E5L E;  4WUD A;  4JI0 I;  4B3R I;  5K36 E;  2EN8 A;  1Y6Z A;  4DPT A;  4DV3 I;  2L2M A;  2ELY A;  2EMI A;  3J7Y p;  2O1V A;  3BID A;  3LPS A;  5FWK A;  2Q2E B;  4JV5 I;  1YYO A;  2E1M A;  1YPN A;  4WSG A;  1E3H A;  4NXM I;  2JOX A;  1QNT A;  3H4L A;  4R2E A;  4PRV A;  4U3D A;  2FV4 B;  4XTJ A;  1UIL A;  2EPX A;  1YSA C;  1UN6 B;  1IQS A;  1IMU A;  3ADI A;  2JEA A;  4O43 A;  2IHR 1;  2IES A;  5IWA E;  4FWH A;  2EMK A;  2YT4 A;  4FK5 C;  1QZR A;  1UEK A;  1S16 A;  3WU4 A;  5JEA F;  2ZM6 I;  2PNZ A;  2YU5 A;  2UXD I;  2B7V A;  1XNQ E;  4IZJ D;  4ZYH A;  2HHH I;  1Y4S A;  3EPK A;  2LT7 A;  2NN6 C;  4JI5 I;  2ENH A;  4WYQ B;  1AAY A;  3LML A;  2LUP B;  2VE7 C;  1ELO A;  1D6T A;  1A1J A;  4NHR A;  4IZK A;  2EMB A;  1ZXN A;  1Z0C A;  3HJC A;  2LJU A;  4B3M E;  2NUF A;  4LF5 E;  2DEJ A;  5TSE A;  4BA1 B;  4URL A;  4DR5 I;  2NA2 A;  2PRT A;  2NUG A;  1Z5B A;  5JEA A;  3ADL A;  3OTO I;  2EWL A;  4JI4 E;  2J65 A;  2UUC I;  4JI7 I;  3JU0 A;  2UXC I;  1A1H A;  5A6B D;  4DR1 I;  2IER A;  1PJQ A;  4FW4 A;  1EH8 A;  1N36 I;  4LFB I;  4BC7 A;  4GKJ E;  2BM0 A;  2V2Q A;  3K17 A;  2E5L I;  3M7N G;  4JI0 E;  4B3R E;  2HFU A;  4DV3 E;  2V86 A;  2DLK A;  1RC7 A;  2AJ4 A;  2BA1 D;  1Y60 A;  2O1W A;  3RMP A;  2CZ9 A;  1HNZ E;  2YTJ A;  3CWV A;  2EOO A;  4HXZ A;  4EMD A;  4JV5 E;  4LPF A;  1R6M A;  1EH6 A;  1OJ4 A;  2RTX A;  3H09 A;  1G2D C;  4FW5 A;  5JEA D;  2I9I A;  2HJJ A;  2EMF A;  4N4R B;  1YYK A;  1NHH A;  4PRX A;  2EOI A;  4P7D A;  4YY3 E;  4KZS A;  2B9D A;  2KON A;  2ODR C;  5A2Q C;  2C37 A;  4RHB B;  2WP8 B;  3WU3 A;  4FW7 A;  3QT7 A;  3HKM A;  5AE1 A;  2BA0 G;  4DR2 I;  2I13 A;  2JR1 A;  2Z5C A;  4LF9 E;  2NUE A;  2HK3 A;  2JEA B;  4F6M A;  2ZM6 E;  1BBG A;  1X6F A;  4DU7 A;  4JI6 I;  2ZIT A;  2PO2 B;  5A6A A;  2EOQ A;  2ZBK B;  5AE2 A;  1X3C A;  1TF6 A;  3BGH A;  3THN A;  4JI5 E;  3CDI A;  5DRP A;  3WU6 A;  4DPU A;  2JWO A;  4JYA I;  4BBY A;  3P76 A;  4HEI A;  1RMD A;  3BBG A;  1Y5Y A;  1Z0G A;  4DV7 I;  3HUL A;  2GLI A;  3ZKD A;  1N3G A;  3HPS A;  4LCF A;  2L3C A;  4DU8 A;  4MU3 A;  4B3M I;  4LF5 I;  3M7N D;  4IFD B;  3WU5 A;  1Z0E A;  4JG4 A;  4FN5 A;  3M85 D;  1ZR9 A;  3OTO E;  1ZBT A;  3F6H A;  1B63 A;  2Z5E A;  4JI7 E;  3J7A G;  2DIX A;  2YZT A;  1A1L A;  5IXM B;  4JI2 E;  2YTD A;  2EMH A;  1WHN A;  5A69 A;  3F0N A;  2BR2 B;  2GO4 A;  3QT6 A;  4UT4 A;  1T38 A;  2O3Z A;  2OI2 A;  2R42 A;  5KL7 A;  1N36 E;  4LFB E;  3EPH A;  4GKJ I;  2CTD A;  1EKZ A;  4AID A;  5GME A;  2EOR A;  2BM1 A;  2EM5 A;  1XNR E;  4QNK A;  3T1H I;  2GS8 A;  2ADR A;  4M9V C;  2EPC A;  2K7I A;  2HK2 A;  4L5N C;  2RS7 A;  2EPN A;  1HNZ I;  4NZV A;  3D4J A;  3ZZ0 A;  3PS1 A;  2KHX A;  3TQM A;  2EOE A;  2JEB B;  1KVK A;  2YTE A;  1Z5A A;  3ZKB A;  5AAS A;  4R2R A;  2YTO A;  2F1D A;  2IOQ A;  4I8O A;  4YY3 I;  2EL6 A;  4F54 A;  2JEB A;  4OKG A;  5IT9 C;  2PO1 B;  2J7J A;  2CVE A;  2V89 A;  2UUA E;  4DR2 E;  3J7A M;  4LF9 I;  2EOY A;  2EPA A;  2FGG A;  4JI6 E;  2H36 X;  2YTG A;  4RH8 A;  3QT5 A;  4TUI A;  2YTQ A;  3Q6M A;  2HKJ A;  1BBO A;  4GQU A;  2YWQ A;  3ZOQ B;  1H74 A;  1UDN A;  4DV0 E;  4JYA E;  4RPF A;  2YTI A;  5BR8 E;  4B3T I;  1A1I A;  1UDO A;  3J81 C;  1Z0T A;  4DV7 E;  1PVG A;  4J3D A;  1KIJ A;  1MX0 A;  3M85 G;  1MEY C;  1Z1B A;  4IS9 A;  2VRD A;  1IBM E;  4MYT A;  1TF3 A;  4R2S A;  5A6K A;  3ZZT A;  1G2F C;  3HQ1 A;  1A6F A;  3C4T A;  4Q35 B;  3C4B A;  3K85 A;  4IZJ A;  3JAM C;  4MQY A;  4JI2 I;  2VQE I;  4LF7 E;  2HC5 A;  2EP3 A;  3B82 A;  2EPU A;  1DAR A;  2PO2 A;  4FWG A;  1PIE A;  1EA6 A;  3GON A;  1XNR I;  2EMZ A;  2YPN A;  2EPZ A;  3T1H E;  2UU9 I;  2EPL X;  2NPF A;  2JY9 A;  4NXN E;  1HR0 E;  3CDJ A;  5ELW A;  3K6Q A;  2C37 B;  4X66 E;  2MC6 A;  3C6K A;  2HKE A;  1T4O A;  4MU0 A;  2IOP A;  5T6J A;  4ZYD A;  4DV4 I;  2RSM A;  2YRH A;  2WBS A;  1R6L A;  2HFS A;  4P52 A;  1HK7 A;  4KQV A;  3IWD A;  3PRY A;  2LO3 A;  4R2P A;  4DPY A;  3QG5 C;  1UDS A;  2UUA I;  2NAB A;  2WBT A;  1NEI A;  4X9J A;  3J80 C;  1YHC A;  4DPX A;  4LF8 I;  1YZ9 A;  4LTY A;  2YRM A;  2EQ3 A;  1AH5 A;  2RQL A;  5JEA E;  1YH8 A;  4F2J C;  4KHP E;  3PS3 A;  2EJ4 A;  2EOH A;  2L33 A;  1H72 C;  4UTG A;  3ZM7 A;  2EL5 A;  3KRN A;  4MLQ A;  1X5W A;  4DV0 I;  2R76 A;  2LTR A;  2YRK A;  4GEQ B;  2VF3 A;  5JEA B;  1ZXM A;  1N0U A;  5A6J A;  4B3T E;  4HAC B;  2YTF A;  1Z0W A;  4BA1 A;  2V2Z A;  1Z59 A;  5BR8 I;  4OO1 D;  1ZM2 A;  1N33 I;  1IBM I;  3ADG A;  3DJW A;  3GCM A;  2EMA A;  3LNU A;  5LL6 R;  4B3S I;  4IFD C;  2JXP A;  4LFA I;  4MYU A;  4FW6 A;  1J26 A;  4M0V A;  2VQE E;  2EFG A;  5ADZ A;  1S4E A;  1N0V C;  1UHZ A;  4M1K A;  2YSO A;  4IS1 C;  2EPP A;  2Q8U A;  3MSW A;  4IFD D;  2EN3 A;  1A1G A;  4M2Z A;  1FNM A;  4WX9 A;  1OYS A;  2UU9 E;  4U3B A;  3BF2 A;  2JE6 A;  5DRO A;  4NXN I;  1HR0 I;  1KTV A;  1I94 E;  4IFD E;  4Z7Y A;  2B3T B;  5KL5 A;  4DR3 E;  2ENA A;  4BHB A;  1ZM4 A;  4X8W A;  2GQ0 A;  4MU1 A;  3EPJ A;  1F2I G;  3U1K A;  2LVH A;  1GZ6 A;  2DLQ A;  4X66 I;  2BR2 A;  1XXE A;  2V85 A;  1X47 A;  2L3J A;  3IWC A;  3T1Y E;  5F3W A;  4DV4 E;  1RRE A;  3LTO A;  1TN9 A;  1B62 A;  2ENC A;  4OO1 C;  1P42 A;  3PYF A;  5KL6 A;  2WZO A;  4LF8 E;  1XMO E;  2BV3 A;  3P1X A;  1SFE A;  5FLX Q;  1U2R A;  1PJS A;  5K36 C;  1N32 E;  4DUY E;  4NBQ A;  4KHP I;  1MU5 A;  2C39 B;  5LMN I;  4DV5 E;  4OZE A;  2KOU A;  4R8O A;  1HNW I;  5DNX A;  2V88 A;  1H7U A;  1IBK I;  1LLM C;  2MDR A;  1A1K A;  2L2K B;  1N33 E;  5C0X E;  1WXR A;  2WBU A;  3Q1Q A;  5K36 D;  1NHI A;  4DUZ E;  5FLX C;  2PNM A;  2NN6 D;  4DR7 E;  3F6G A;  4DKK A;  2A2C A;  4B3S E;  2Z5C B;  3HXL A;  2BB8 A;  4LFA E;  1XMQ I;  4KWY A;  1QU6 A;  4J8Z A;  2LJH A;  4WFT A;  4USM A;  1K47 A;  4X64 I;  4ED4 A;  4OX9 I;  2GO3 A;  2VES A;  1T39 A;  1L4S A;  1XHK A;  2LCE A;  2ELZ A;  2EMC A;  2EQ1 A;  2D9H A;  2JOB A;  4HTG A;  2EE8 A;  4OO1 A;  4LU9 A;  4F9C B;  2UUB E;  4M30 A;  2EN2 A;  4F6N A;  3J81 Q;  2JYA A;  5CFF E;  2ODR D;  4R2C A;  5LLQ A;  3M99 B;  3PYD A;  4OO1 F;  1I94 I;  5DNL A;  4WUC A;  4GKK E;  2N8X A;  4DR3 I;  2JPA A;  4I3H A;  2M1S A;  2NN6 A;  3P3C A;  4X62 I;  4HAC A;  5AC5 A;  2Z5B B;  2LE2 A;  1KKH A;  2N3G A;  2C38 B;  2EM6 A;  2BBG A;  2BA1 G;  3T1Y I;  2EN4 A;  5K36 F;  1ZAA C;  2CT1 A;  5DRQ A;  2EMX A;  2WW4 A;  1T4N A;  1FJG I;  4BC9 A;  2C38 A;  1N34 E;  4ZYG A;  4R03 A;  3B78 A;  4K0K E;  1XMO I;  4WXC A;  1PKP A;  2DEI A;  2DMI A;  5IT9 Q;  3PS2 A;  1N32 I;  4L8N A;  4DR6 E;  4DUY I;  4LCH A;  1SR9 A;  5GMD A;  2V8Q B;  5LMN E;  1EI1 A;  1VIS A;  4DV5 I;  4DR4 I;  2LBS B;  2BA0 D;  4DV6 I;  1HNW E;  1FWK A;  2LJP A;  4LCG A;  1HNX E;  4DXL A;  1IBK E;  4R2A A;  2O1T A;  3Q6N A;  4FW9 A;  2EM9 A;  4ZVI A;  2B7T A;  2X36 A;  4DUZ I;  3HTX A;  2EML A;  4DR7 I;  5DRR A;  4F9B B;  4O4K A;  1RR9 A;  4DV2 I;  4WPY A;  1XMQ E;  3IWB A;  4OOG C;  4X64 E;  1Y4U A;  1WHQ A;  2UXB I;  2L92 A;  4OX9 E;  4LF4 I;  4Q28 A;  2MKD A;  1IBL E;  4MU4 A;  2CSH A;  5A6B A;  1ZBQ A;  3U1Y A;  2M9A A;  3B4T A;  2UUB I;  1DQ3 A;  4LFC I;  4LF6 E;  3B8H A;  2MDG A;  2LTS A;  1H7S A;  4TUG A;  2A25 A;  2R3V A;  2EPM X;  2K4V A;  4GKK I;  1WUU A;  4JI8 E;  4X62 E;  1STU A;  5C0X B;  2VQF E;  1ZM3 A;  4MLV A;  1GTK A;  3UK3 C;  1FJG E;  4X65 I; 
#chains in the Genus database with same CATH homology
 5L3J A;  1N34 I;  4AQY I;  3PYE A;  2F8B A;  2X7I A;  4K0K I;  4JI1 I;  2E1R A;  4Z7C A;  2M4I A;  4P78 A;  1O0W A;  4DR6 I;  3DF6 A;  4HY1 A;  2RS6 A;  4DPW A;  4DR4 E;  4WUB A;  2V2V A;  2M7Q A;  4DV6 E;  2F4V E;  1HNX I;  4DV1 I;  4FWD A;  4USK A;  1FKA E;  4DV2 E;  1DI2 A;  3V2U C;  4BCA A;  1MG7 A;  2UXB E;  4LF4 E;  1IBL I;  3OML A;  2VF1 A;  1Z0B A;  2CG9 A;  3ZZU A;  4WSP A;  4LFC E;  4LF6 I;  3VYY A;  2L6M A;  4JI3 E;  3KWR A;  1Z0V A;  3J80 Q;  5DNY A;  2G7H A;  4JI8 I;  2O1U A;  2VQF I;  3AV0 A;  2L2N A;  4X65 E;  1NHJ A;  3LLH A;  1YYW A;  4AQY E;  1T4L B;  1USV A;  4DMI A;  3AUZ A;  2V83 A;  4JI1 E;  5LMU I;  2L8T A;  3VYX A;  5AE3 A;  1ZM9 A;  3K1J A;  2J7K A;  3ADJ A;  1J5E I;  2N3H A;  4HYM A;  2F4V I;  2PNL A;  4DV1 E;  4BMJ A;  2MC5 A;  4IZJ B;  4YHH E;  2CPN A;  2V87 A;  2EZ6 A;  1Z5C A;  2V34 A;  3P06 A;  3HPZ A;  3JTZ A;  1GQE A;  3JAM Q;  4R1F A;  1USU A;  1BKN A;  2JVA A;  2LMZ A;  4NXM E;  1X48 A;  2LUQ A;  2Z5B A;  3M6A A;  4JI3 I;  4IZK B;  4BS9 A;  5IWA I;  1X49 A;  2UXD E;  4PU9 A;  1XNQ I;  2FTX B;  3V5R A;  3QT8 A;  1FI4 A;  1ZM4 A;  2HHH E;  2DSY A;  3FIG A;  2DB2 A;  5LMU E;  4P7A A;  5A2Q Q;  3VK6 A;  1RQ0 A;  2A2D A;  1FWL A;  1J5E E;  4N3O A;  2DMY A;  2XEX A;  4DR5 E;  2V8P A;  4JI4 I;  2UUC E;  2UXC E;  1NZ0 A;  4F9A B;  1H73 A;  2LRS A;  4DR1 E;  4YHH I;  2CGE A;  3PYG A;  2E5L E;  4WUD A;  4JI0 I;  4B3R I;  4DV3 I;  1Y6Z A;  4DPT A;  2L2M A;  3J7Y p;  2O1V A;  3LPS A;  5FWK A;  2Q2E B;  4JV5 I;  1YYO A;  2E1M A;  4NXM I;  2JOX A;  3H4L A;  4PRV A;  2FV4 B;  4XTJ A;  1UIL A;  3ADI A;  2IHR 1;  5IWA E;  4FWH A;  2YT4 A;  1QZR A;  1UEK A;  1S16 A;  3WU4 A;  2ZM6 I;  2UXD I;  2B7V A;  1XNQ E;  4IZJ D;  2HHH I;  1Y4S A;  4JI5 I;  4WYQ B;  3LML A;  2LUP B;  2VE7 C;  1ELO A;  1D6T A;  4IZK A;  1ZXN A;  1Z0C A;  3HJC A;  4B3M E;  2NUF A;  4LF5 E;  2DEJ A;  4URL A;  4DR5 I;  2NA2 A;  1Z5B A;  2NUG A;  3ADL A;  3OTO I;  2EWL A;  4JI4 E;  2UUC I;  4JI7 I;  3JU0 A;  2UXC I;  4DR1 I;  1N36 I;  4LFB I;  4BC7 A;  4GKJ E;  2BM0 A;  2V2Q A;  3K17 A;  2E5L I;  4JI0 E;  4B3R E;  2HFU A;  4DV3 E;  2V86 A;  1RC7 A;  2AJ4 A;  2O1W A;  3RMP A;  2CZ9 A;  1HNZ E;  3CWV A;  4HXZ A;  4EMD A;  4JV5 E;  1OJ4 A;  2RTX A;  3H09 A;  1NHH A;  1YYK A;  4PRX A;  4P7D A;  4YY3 E;  2KON A;  2B9D A;  4KZS A;  2ODR C;  5A2Q C;  3WU3 A;  3QT7 A;  5AE1 A;  4DR2 I;  2JR1 A;  2Z5C A;  2NUE A;  4LF9 E;  2HK3 A;  2ZM6 E;  4DU7 A;  4JI6 I;  2ZIT A;  2ZBK B;  5AE2 A;  4JI5 E;  4DPU A;  3WU6 A;  2JWO A;  4JYA I;  4BBY A;  1Z0G A;  4DV7 I;  3HUL A;  3ZKD A;  3HPS A;  4DU8 A;  2L3C A;  4B3M I;  4LF5 I;  3WU5 A;  1Z0E A;  4JG4 A;  4FN5 A;  3OTO E;  1ZBT A;  3F6H A;  1B63 A;  2Z5E A;  4JI7 E;  3J7A G;  2DIX A;  2YZT A;  4JI2 E;  4LF7 I;  1WHN A;  3F0N A;  3QT6 A;  4UT4 A;  2OI2 A;  2R42 A;  1N36 E;  4LFB E;  4GKJ I;  1EKZ A;  5GME A;  2BM1 A;  1XNR E;  3T1H I;  2GS8 A;  2HK2 A;  4L5N C;  2RS7 A;  1HNZ I;  3D4J A;  3ZZ0 A;  2KHX A;  1KVK A;  1Z5A A;  3ZKB A;  5AAS A;  2IOQ A;  4I8O A;  4YY3 I;  4F54 A;  5IT9 C;  2V89 A;  2UUA E;  4DR2 E;  3J7A M;  4LF9 I;  2FGG A;  4JI6 E;  2H36 X;  3QT5 A;  4TUI A;  3Q6M A;  2HKJ A;  3ZOQ B;  1H74 A;  4DV0 E;  4JYA E;  4RPF A;  5BR8 E;  4B3T I;  3J81 C;  1Z0T A;  4DV7 E;  1PVG A;  1KIJ A;  1MX0 A;  1IBM E;  4MYT A;  3ZZT A;  3HQ1 A;  1A6F A;  3C4T A;  3C4B A;  3K85 A;  4IZJ A;  3JAM C;  4JI2 I;  2VQE I;  4LF7 E;  3B82 A;  1DAR A;  4FWG A;  1PIE A;  1EA6 A;  3GON A;  1XNR I;  3T1H E;  2UU9 I;  2NPF A;  2JY9 A;  4NXN E;  1HR0 E;  3K6Q A;  4X66 E;  2MC6 A;  2HKE A;  1T4O A;  2IOP A;  5T6J A;  4DV4 I;  2RSM A;  4P52 A;  2HFS A;  1HK7 A;  4KQV A;  3IWD A;  3PRY A;  4DPY A;  2UUA I;  4DPX A;  3J80 C;  4LF8 I;  1YZ9 A;  4LTY A;  4KHP E;  3ZM7 A;  2L33 A;  1H72 C;  4UTG A;  4DV0 I;  2LTR A;  4GEQ B;  2VF3 A;  1ZXM A;  1N0U A;  4B3T E;  4HAC B;  5BR8 I;  1Z0W A;  2V2Z A;  1Z59 A;  1N33 I;  1ZM2 A;  1IBM I;  3ADG A;  3DJW A;  3LNU A;  4B3S I;  5LL6 R;  4LFA I;  4MYU A;  1J26 A;  4M0V A;  2VQE E;  2EFG A;  5ADZ A;  1S4E A;  1N0V C;  1UHZ A;  4M1K A;  3MSW A;  4M2Z A;  1FNM A;  2UU9 E;  4NXN I;  1HR0 I;  1KTV A;  1I94 E;  4Z7Y A;  2B3T B;  4DR3 E;  2GQ0 A;  4X8W A;  4X66 I;  1GZ6 A;  1RRE A;  1X47 A;  2V85 A;  3IWC A;  2L3J A;  3T1Y E;  4DV4 E;  5F3W A;  3LTO A;  1B62 A;  3PYF A;  2WZO A;  4LF8 E;  1XMO E;  2BV3 A;  3P1X A;  5FLX Q;  1U2R A;  1N32 E;  4DUY E;  4KHP I;  1MU5 A;  5LMN I;  4DV5 E;  1HNW I;  2KOU A;  4R8O A;  2V88 A;  1H7U A;  1IBK I;  2MDR A;  2L2K B;  1N33 E;  1WXR A;  3Q1Q A;  1NHI A;  4DUZ E;  5FLX C;  2PNM A;  4DR7 E;  3F6G A;  4DKK A;  2A2C A;  4B3S E;  2Z5C B;  3HXL A;  4LFA E;  1XMQ I;  1QU6 A;  4J8Z A;  2LJH A;  4WFT A;  4USM A;  1K47 A;  4X64 I;  4ED4 A;  4OX9 I;  1XHK A;  2JOB A;  4LU9 A;  4F9C B;  2UUB E;  4M30 A;  3J81 Q;  5CFF E;  2ODR D;  3PYD A;  1I94 I;  4WUC A;  4GKK E;  4DR3 I;  4I3H A;  2M1S A;  4X62 I;  4HAC A;  2Z5B B;  2LE2 A;  1KKH A;  2N3G A;  3T1Y I;  2WW4 A;  1T4N A;  1FJG I;  4BC9 A;  1N34 E;  4R03 A;  3B78 A;  4K0K E;  1XMO I;  1PKP A;  2DEI A;  5IT9 Q;  1N32 I;  4L8N A;  4DR6 E;  4DUY I;  1SR9 A;  5GMD A;  2V8Q B;  5LMN E;  1EI1 A;  1VIS A;  4DV5 I;  4DR4 I;  2LBS B;  4DV6 I;  1HNW E;  1FWK A;  2LJP A;  1HNX E;  4DXL A;  1IBK E;  2O1T A;  3Q6N A;  4FW9 A;  4ZVI A;  2B7T A;  2X36 A;  4DUZ I;  3HTX A;  4DR7 I;  4F9B B;  1RR9 A;  4DV2 I;  4WPY A;  1XMQ E;  3IWB A;  4OOG C;  4X64 E;  1Y4U A;  1WHQ A;  2UXB I;  2L92 A;  4OX9 E;  4LF4 I;  4Q28 A;  1IBL E;  1ZBQ A;  2UUB I;  1DQ3 A;  4LFC I;  4LF6 E;  3B8H A;  2LTS A;  1H7S A;  4TUG A;  2R3V A;  2K4V A;  4GKK I;  1WUU A;  4JI8 E;  4X62 E;  1STU A;  2VQF E;  1ZM3 A;  1FJG E;  4X65 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...