4DUYE

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4duyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duyE02
1RC7A 4DR7E 1UHZA 1FKAE 4JI5E 2DEIA 3LPSA 4JYAE 4DR4E 1T4NA 1ZBTA 1N34I 4DPTA 2B7TA 1STUA 3OTOI 2LUQA 4FWGA 5GMDA 4NXNI 4K0KE 2WW4A 5FLXQ 4I3HA 1N0UA 2UU9I 1QU6A 1IBMI 2HK3A 4JG4A 4EMDA 2E1RA 2HFUA 4JI4E 1NHHA 4LF5E 2LBSB 4LF7I 5A2QC 4URLA 4GKKI 1Z5AA 3QT6A 4ED4A 4OX9E 2LJPA 2UXBE 4P52A 4P7AA 4YHHI 4X64E 5IT9C 1OJ4A 3WU5A 2HK2A 4DV5I 1S16A 1N0VC 4DV0E 4DPXA 2UXCE 4MYUA 4DR1E 2HHHE 4X65E 2LTSA 5A2QQ 4LF4I 4B3SE 1RREA 2L2NA 1HR0I 2F4VE 2HKEA 2DMYA 1Z5BA 2N3GA 1HNWI 4JI0E 1N36E 4DU7A 2EFGA 3LLHA 5IT9Q 3J7Yp 4DV4E 4AQYE 4WUBA 3WU3A 4DV7I 2DEJA 3T1YI 1Z5CA 3J81C 2NUEA 1N32I 1HNXI 3ZZTA 4JI8I 3PYDA 2LTRA 4USKA 3QT7A 5L3JA 4DR6E 4JV5E 2X36A 1Z0GA 2ZM6E 1FI4A 3F0NA 4Z7CA 4NXME 4LF6I 1WUUA 3P1XA 2EZ6A 4LFAI 5FLXC 1FJGE 1MG7A 4DR3E 3J81Q 4YY3E 2BM1A 2UXDI 2DB2A 4KHPE 4Z7YA 1ELOA 4WUCA 2ZBKB 1GQEA 4OOGC 4X62I 1XNQI 2UUAI 2E5LI 1NHIA 4JI6E 1ZXNA 2CZ9A 1U2RA 1ZM4A 2VF3A 1ZM3A 2Q2EB 4PRXA 2UUBE 1KIJA 2AJ4A 4UTGA 4B3TI 2NUFA 3PYEA 2LUPB 2VQEI 5LMNE 3K17A 3QT5A 4LFCE 2RTXA 4DR5E 4GKJI 4USMA 4JI3E 1O0WA 1X49A 1XNRE 3ZZ0A 5IWAI 1K47A 4M1KA 2UUCI 4DUZE 4DV6I 3T1HI 4DV3E 2VQFI 1IBKI 1XMOI 3B82A 2JY9A 2V34A 1XMQE 2V8PA 1VISA 4B3RE 4LFBI 1HNZE 1J5EE 2JVAA 5BR8I 4KHPI 4X66I 2BM0A 4LF8I 1B63A 4DR7I 4JI5I 4DV2E 1N33E 4DU8A 4JYAI 4DR4I 4JI2E 4RPFA 4JI7E 1A6FA 1I94E 4DPYA 3JAMQ 4DR2E 3HULA 4LF9E 1ZXMA 1X48A 4K0KI 2RS6A 3C4TA 1S4EA 3PYFA 1X47A 2NUGA 3ADIA 2MDRA 4LFCI 1ZM9A 1YYWA 3ZKDA 4JI4I 4LF5I 2A2DA 3CWVA 4FWHA 1UEKA 2B3TB 4FN5A 1IBLE 3J80Q 3Q1QA 4PRVA 4DKKA 5LMUE 3QT8A 4X8WA 1UILA 2IHR1 1DARA 4OX9I 2UXBI 4B3ME 1RQ0A 2L33A 5GMEA 1N34E 1H7SA 4X64I 3OTOE 4DV1E 2LJHA 2RS7A 4NXNE 1FWKA 1T4OA 4DV0I 3LTOA 2UU9E 1I94I 1IBME 2UXCI 4DR1I 2V2VA 2HHHI 1H7UA 1NHJA 4UT4A 3M6AA 4X65I 4B3SI 2OI2A 1H73A 2F4VI 1D6TA 3B78A 1EI1A 2ZITA 4FW9A 4LF7E 3D4JA 4JI0I 1YZ9A 1N36I 2LRSA 1Z0BA 3J7AM 4DV4I 4GKKE 4AQYI 1PIEA 2V2QA 1KVKA 1QZRA 1Z0EA 1Z0CA 3LNUA 2L3JA 1T4LB 4YHHE 4M2ZA 1WHQA 2L2KB 2A2CA 4DXLA 4DV5E 4DPUA 3ADGA 4B3MI 3ZKBA 3ZZUA 3B8HA 4DR6I 4JV5I 2ZM6I 3WU6A 1ZM2A 1PVGA 3H4LA 4XTJA 1DI2A 2J7KA 4DV1I 4PU9A 2L3CA 4LF4E 4NXMI 1EA6A 3ZM7A 4WYQB 4DUYE 3V2UC 3JAMC 5LL6R 1RR9A 1HR0E 1FJGI 1HNWE 2R3VA 4DR3I 1Z0WA 4YY3I 4R1FA 3GONA 3HTXA 3PYGA 2R42A 2V2ZA 2XEXA 4DV7E 1Z59A 1B62A 3T1YE 2DIXA 2YT4A 3J80C 1WHNA 1N32E 1HNXE 1FNMA 4JI6I 4JI8E 4FWDA 2UUBI 2CPNA 4DPWA 3ADJA 4JI1E 4HY1A 5LMNI 2L2MA 1Z0TA 4LF6E 4DR5I 4WFTA 1MX0A 4JI3I 1XNRI 4LFAE 3C4BA 4DUZI 1J26A 2RSMA 3ADLA 1XHKA 4DUYI 1H72C 3J7AG 2UXDE 4DV3I 2GS8A 4KQVA 4HXZA 1YYOA 1XMQI 3V5RA 4ZVIA 4X62E 4B3RI 1XNQE 2UUAE 1HNZI 2E5LE 1J5EI 2NA2A 2BV3A 3WU4A 1PKPA 3K1JA 1KKHA 4DV2I 1YYKA 1H74A 2KHXA 4HYMA 1N33I 2HFSA 4B3TE 2N3HA 2VQEE 4JI2I 2HKJA 4JI7I 3VYXA 4GKJE 4MYTA 4DR2I 4HACB 4LF9I 1FWLA 4M30A 1NZ0A 4JI1I 5IWAE 1MU5A 2UUCE 2X7IA 1BKNA 1Z0VA 4DV6E 4WUDA 3T1HE 4HACA 2VQFE 1IBKE 1XMOE 1EKZA 2NPFA 3VYYA 2B7VA 4LFBE 1IBLI 5BR8E 5LMUI 4X66E 5CFFE 4LF8E 1KTVA
chains in the Genus database with same CATH superfamily
1RC7A 4DR7E 1UHZA 4ZYHA 1FKAE 4JI5E 2NN6E 4HEIA 2EWLA 2YU5A 3KZYA 4TUGA 2HJJA 2HC5A 2DEIA 4J8ZA 2O1WA 5KL4A 2RQLA 3LPSA 4JYAE 4DR4E 3KZZA 1T4NA 1ZBTA 1N34I 5DNXA 1ZAAC 4DPTA 2B7TA 1STUA 2H36X 4O5GA 4P7DA 1Y5YA 3FIGA 4F6MA 2NN6B 3OTOI 2EM9A 2D9HA 2I13A 4DMIA 2LUQA 1A1GA 1YUJA 4FWGA 1IQSA 2YU8A 5GMDA 4NXNI 4K0KE 3GLLA 2WW4A 1GTKA 4M0VA 5DNLA 5DRQA 5FLXQ 4I3HA 4IFDE 2NN6A 1N0UA 2V86A 2UU9I 5A6JA 2AE8A 1QU6A 1IBMI 2EPOA 4L5NC 3RMPA 2HK3A 4JG4A 4EMDA 2EOHA 2YTQA 2E1RA 2YSPA 1T39A 2HFUA 4JI4E 1NHHA 4FW6A 3MSWA 1BB8A 5AC4A 4LF5E 4IFDB 5A6AA 4IZKB 4MLVA 3THOB 4LPFA 5ELWA 2EE8A 3THNA 2NABA 2JYAA 2LBSB 4LF7I 3CDJA 4IS9A 1IQOA 5A2QC 2O1VA 1YH8A 4URLA 2BA1D 5K36D 2PO2B 4IFDA 2LT7A 4GKKI 5TSEA 4BCAA 1Z5AA 3QT6A 4IZKA 4ED4A 1PJSA 4OX9E 2LJPA 2UXBE 2PO1B 4P52A 4BA2B 1SFEA 4P7AA 4OO1E 2ENAA 1B69A 2NN6C 5AE1A 1G2DC 1YPNA 2LJUA 2IOPA 4YHHI 3BBGA 2PO2A 4MU3A 1X6EA 4X64E 5IT9C 3L00A 4U3DA 1TN9A 1OJ4A 3U1KA 2PO1A 1KYQA 4HTGA 5A6KA 2JEBB 3GCMA 3WU5A 3MHSC 2V8QB 4L8NA 4BS9A 2KOUA 2HK2A 4DV5I 2HGHA 4WX9A 4R2AA 4OO1B 1S16A 1N0VC 4MDTA 5JEAB 4DV0E 4DPXA 4WSGA 1D6TA 4ZYGA 2EM5A 2UXCE 2EPRA 2JEBA 4MYUA 4DR1E 2HHHE 2NN6F 4X65E 2LTSA 5A2QQ 4WSPA 4LF4I 4B3SE 4OO1A 1X6FA 4IFDC 1RREA 2EJ4A 2L2NA 2F1DA 5JEAA 2EOOA 5KL2A 1HR0I 2F4VE 4IZJD 2HKEA 2DMYA 1Z5BA 2EOSA 4R8OA 2EN3A 2N3GA 1HNWI 4JI0E 2EPPA 1N36E 4DU7A 2EFGA 2Z5BB 3LLHA 1PJTA 1KJKA 5IT9Q 3J7Yp 4DV4E 4AQYE 1R6LA 5AE3A 2KONA 4WUBA 4IFDF 2M1SA 2O1UA 3WU3A 4R2PA 3U1YA 2EM2A 2EN6A 4DV7I 4GEQB 2EN1A 2DEJA 2Z5BA 5AE2A 3T1YI 5DRRA 4N3OA 4NBQA 1Z5CA 3AUZA 3J81C 2NUEA 2LVHA 2RPCA 1YUIA 2FV4B 2BA0D 1N32I 1HNXI 4OO1C 1BBGA 3ZZTA 1HK7A 4KZSA 2E1MA 5JEAC 4WPYA 4RHBB 1Z1BA 2LV2A 3GMEA 2LTRA 3PYDA 4ISAA 2O3ZA 4JI8I 4USKA 1EH7A 4R03A 3QT7A 5L3JA 4DR6E 4JV5E 1X3CA 1Z0GA 2JXPA 2ZM6E 2X36A 2EOQA 4Q28A 4F9AB 1FI4A 3F0NA 4Z7CA 3BF2A 1UDOA 4NXME 3HQ1A 4LF6I 1ZU1A 1GZ6A 1SR9A 3ECRA 1WUUA 2RSIA 2YTDA 4OO1F 2JR1A 3P1XA 2R1FA 2EMXA 4LOMA 5JEAF 4BBYA 2M7QA 1N3GA 2EZ6A 4LFAI 5FLXC 3PS3A 1FJGE 1MG7A 1EH6A 2JWOA 4F9BB 4DR3E 2L6MA 3J81Q 5F3WA 2EQ3A 4YY3E 4M9VC 2BM1A 2ADRA 2UXDI 2DB2A 4KHPE 2JT2A 5A69A 4Z7YA 4BHBA 2MKNA 1ELOA 4WUCA 2GHFA 2YTNA 2ZBKB 2K4VA 2YTEA 4R2QA 1GQEA 4OOGC 3VK6A 2EMFA 1VI7A 3AV0A 4X62I 4MU1A 2ODRD 1XNQI 2UUAI 2E5LI 1P47A 3H09A 2EN2A 1NHIA 4AM3A 1UBDC 4JI6E 1ZXNA 2WP8A 2EPLX 2EQ0A 5LLQA 2CZ9A 1U2RA 1USUA 1ZM4A 2VF3A 4F9CB 4P78A 1ZM3A 2ENCA 2Q2EB 3F6GA 2UUBE 1KIJA 2AJ4A 4PRXA 1A1FA 2PNLA 2NUFA 4UTGA 3PYEA 4B3TI 4FW7A 4BMJA 2LUPB 2VQEI 1UDQA 2YRHA 5LMNE 2YTPA 2JOBA 3K17A 2YTOA 3QT5A 4LFCE 2RTXA 5A6BD 4TUIA 2EM7A 4IS1C 4DR5E 2BA1G 2DSYA 4GKJI 5DRPA 4BC9A 4USMA 5JEAD 4JI3E 2EL5A 4R2EA 2C38B 1O0WA 1X49A 1XNRE 3ZZ0A 5IWAI 1K47A 1YFHA 4M1KA 2UUCI 2JE6B 2WBTA 4DUZE 4DV6I 5DNYA 3T1HI 4DV3E 5C0XE 2YTJA 2EN8A 2G7HA 2C38A 2VQFI 1IBKI 2PNZB 1XMOI 2MC6A 3UK3C 3B82A 5T6JA 2JY9A 3VHTB 2V34A 4GQUA 2K7IA 1XMQE 2JE6A 2V8PA 3PRYA 1LLMC 1VISA 4B3RE 4LFBI 2Q8UA 2EMBA 1HNZE 1E3PA 1J5EE 3ZOQB 2JVAA 2E72A 5C0XB 5BR8I 5K36C 2EORA 2PNZA 4KHPI 4X66I 2BM0A 4LF8I 1B63A 1DQ3A 4DR7I 4JI5I 4BHCA 2C39B 2EN4A 4DV2E 2EM6A 1N33E 3LMLA 2WNRB 4AIDA 4DU8A 1AAYA 5C0XA 4JYAI 4DR4I 4JI2E 3Q6NA 4RPFA 4JI7E 1A6FA 1I94E 2EPXA 2C39A 2EPMX 4FW5A 2EPAA 4DPYA 2WNRA 3JAMQ 4DR2E 4BA1A 2L92A 2Z5EA 3IWDA 3HULA 4LF9E 1ZXMA 1X48A 4X9JA 2EMWA 4K0KI 2RS6A 3C4TA 1S4EA 3PYFA 1X47A 2NUGA 4QNKA 5EKWA 5IV8B 1USVA 1PDAA 2EPZA 3ADIA 3UHMA 4NZVA 2MDRA 4LFCI 3M85D 2BA0G 1ZM9A 1YYWA 1XXEA 2YPNA 1E3HA 2V87A 3ZKDA 4JI4I 5K36E 3EPLA 4LF5I 2YTFA 3BIDA 5KL7A 1ZR9A 3C6MA 2A2DA 4N4RB 3CWVA 4FWHA 5C0XC 4I8OA 1UEKA 2JPAA 2B3TB 4FN5A 1IBLE 2EM8A 3J80Q 3Q1QA 4PRVA 4DKKA 1NCSA 4O43A 5LMUE 3QT8A 4X8WA 1P42A 1YSAC 1NEIA 2CT1A 2EOMA 1OYSA 1UILA 2IHR1 1DARA 3K85A 4OX9I 2UXBI 2C37B 2EM4A 4B3ME 2PO0B 2EOZA 2J7JA 1RQ0A 2EMLA 4ZYDA 1A1IA 2EM3A 2L33A 2VE7C 5GMEA 5ADZA 2GO4A 2LMZA 2V83A 3K6QA 5C0XF 1N34E 5K36A 1H7SA 2PRTA 5AC5A 2CG9A 4X64I 2FTXB 3OTOE 4DV1E 2NN6D 2F8BA 2C37A 2EMIA 2PO0A 2EMAA 3HJCA 2N8XA 2LJHA 2RS7A 4NXNE 2Z5CB 3M7ND 1BBOA 3P76A 1FWKA 1T4OA 4DV0I 2A25A 3LTOA 2UU9E 1MGTA 2EOFA 1I94I 1PJQA 1IBME 2UXCI 2BR2B 2V2VA 1F2IG 4DR1I 1H7UA 1NHJA 4UT4A 3M6AA 1X5WA 4X65I 2HHHI 4OZEA 4B3SI 2Z5CA 2OI2A 2DMIA 2CGEA 3JTZA 2WZOA 1H73A 3DJWA 4BC7A 3DD6A 2LO3A 3P3GA 1JK2A 4IZJB 2F4VI 1R6MA 3NZKA 4IFDD 3B78A 3C6KA 4RH8A 3TQMA 1EI1A 2BR2A 2WP8B 2ZITA 3EQ1A 3JU0A 2B9DA 2MC5A 2V88A 2EOYA 1A1JA 4LF7E 3D4JA 3Q6MA 4FW9A 3KWRA 1YZ9A 1AH5A 3H1CA 4JI0I 1N36I 1EH8A 2LRSA 1Z0BA 3J7AM 4DV4I 4GKKE 2V85A 1PIEA 2V2QA 4IZJA 4AQYI 1KVKA 1QZRA 1Z0EA 1Z0CA 2BBGA 2YZTA 1A1HA 1UDNA 3LNUA 1A1KA 2EPNA 2L3JA 1T4LB 4YHHE 4M2ZA 4R2RA 4LU9A 1WHQA 5K36F 1WJPA 2L2KB 4R2CA 2JEAB 2L8TA 2A2CA 5KL5A 4DXLA 4DV5E 4DPUA 1WXRA 2YRKA 3ADGA 2YTGA 4MLQA 3ZKBA 4B3MI 5KL3A 2EP3A 4O4KA 3ZZUA 4OO1D 3B8HA 4R2DA 1Y4UA 3B4TA 4DR6I 4JV5I 2ZM6I 3WU6A 2V89A 2JEAA 1ZM2A 1PVGA 3H4LA 4XTJA 1DI2A 2J7KA 4DV1I 4PU9A 2L3CA 3PS1A 4LF4E 4NXMI 1G2FC 1EA6A 3ZM7A 4WYQB 2EL4A 2BB8A 4DUYE 3V2UC 3JAMC 5LL6R 1A1LA 1OYRA 2EMYA 2EMZA 4OKGA 1RR9A 1HR0E 1Y4SA 2M4IA 4IJDA 2YSOA 2EMGA 1FJGI 1HNWE 4LCHA 3QG5C 2R3VA 2M9AA 4DR3I 2DRPA 1Z0WA 1UN6B 3CDIA 4YY3I 5IXMB 2VRDA 4R1FA 3GONA 3P3CA 2JP9A 2CTDA 3HTXA 2WBSA 2EOEA 3BGHA 3PYGA 5FWKA 2R42A 2V2ZA 2XEXA 3PS2A 2CSHA 4DV7E 1Z59A 1B62A 3T1YE 1RHYA 2DGCA 4BA1B 3EPKA 2DIXA 3M85G 4F2JC 2YT4A 4LTYA 3J80C 1WHNA 1N32E 1OYPA 1HNXE 1FNMA 4GZNC 2EM0A 4JI6I 1YHCA 2EOJA 4JI8E 2GLIA 4FWDA 4KWYA 2EL6A 2EN7A 4MU0A 3HPZA 5DROA 2UUBI 2EOIA 2CPNA 4QNJA 2DLQA 4DPWA 5JEAE 3ADJA 4JI1E 4FW4A 4HY1A 5LMNI 4R2SA 4AIMA 2CVEA 4FW3A 2L2MA 3DF6A 4LCGA 1Z0TA 3F6HA 4LF6E 5EL9A 4BA2A 1IMUA 4DR5I 2YTIA 2YRMA 2EMKA 4WFTA 1MX0A 1Y60A 5AASA 4JI3I 4LCFA 2MKDA 1T38A 1XNRI 3HXLA 2EMHA 4LFAE 3MHHC 3EPHA 2ELZA 4NHRA 5A6BA 3M99B 3C4BA 2WCC3 3P3EA 4DUZI 1J26A 2RSMA 4WXCA 3OMLA 3ADLA 3J7AG 1H72C 1XHKA 2UXDE 4DUYI 4DV3I 2GS8A 2YWQA 4KQVA 5K36B 2J65A 4ZYEA 4HXZA 2EPCA 2ODRC 1YYOA 3M7NG 1DGCA 4O24A 1XMQI 3V5RA 4ZVIA 4U3BA 4X62E 4B3RI 1XNQE 2UUAE 1HNZI 2E5LE 2DLKA 1J5EI 2GQ0A 3HPSA 4WXDA 1L4SA 3L7ZB 3IWBA 2NA2A 2BV3A 1QNTA 4Q35B 3WU4A 1PKPA 1UDSA 2EQ1A 3K1JA 1KKHA 5KL6A 2GPIA 1YYKA 4DV2I 2LE2A 4F54A 1H74A 2KHXA 4HYMA 2JOXA 2WBUA 1N33I 2HFSA 1Y6ZA 4B3TE 2O1TA 3L7ZA 2MDGA 2EOXA 2N3HA 2VQEE 4JI2I 2EPUA 2HKJA 3HKMA 4JI7I 2LCEA 1TF6A 4FK5C 3VYXA 1RMDA 4GKJE 3P06A 4MU4A 4MYTA 4DR2I 4HACB 2I9IA 1FWLA 4M30A 4LF9I 2FGGA 1TF3A 1NZ0A 4JI1I 1X6HA 2IERA 5IWAE 1MU5A 2UUCE 2PNMA 2X7IA 1BKNA 1Z0VA 3KRNA 4DV6E 1ZBQA 4WUDA 3T1HE 4F6NA 4HACA 2R76A 2ELYA 2EMCA 2EPKX 2ENHA 3EPJA 2VQFE 4J3DA 1IBKE 1XMOE 4MQYA 1EKZA 2NPFA 2GO3A 3VYYA 2B7VA 1WRJA 2IESA 2IOQA 4LFBE 2VF1A 2VESA 1JK1A 1IBLI 1MEYC 5BR8E 5C0XD 3IWCA 5LMUI 4X66E 5CFFE 4LF8E 1KTVA
chains in the Genus database with same CATH topology
1RC7A 4DR7E 1UHZA 1FKAE 4JI5E 2EWLA 4TUGA 2DEIA 4J8ZA 2O1WA 3LPSA 4JYAE 4DR4E 1T4NA 1ZBTA 1N34I 4DPTA 2B7TA 1STUA 2H36X 4P7DA 3FIGA 3OTOI 4DMIA 2LUQA 4FWGA 5GMDA 4NXNI 4K0KE 2WW4A 4M0VA 5FLXQ 4I3HA 1N0UA 2V86A 2UU9I 1QU6A 1IBMI 3RMPA 4L5NC 2HK3A 4JG4A 4EMDA 2E1RA 2HFUA 4JI4E 1NHHA 3MSWA 4LF5E 4IZKB 2LBSB 4LF7I 5A2QC 2O1VA 4URLA 4GKKI 1Z5AA 4BCAA 3QT6A 4IZKA 4ED4A 4OX9E 2LJPA 2UXBE 4P52A 4P7AA 5AE1A 2IOPA 4YHHI 4X64E 5IT9C 1OJ4A 3WU5A 4BS9A 2V8QB 4L8NA 2HK2A 2KOUA 4DV5I 1S16A 1N0VC 4DV0E 4DPXA 2UXCE 4MYUA 4DR1E 2HHHE 4X65E 2LTSA 5A2QQ 4WSPA 4LF4I 4B3SE 1RREA 2L2NA 1HR0I 2F4VE 4IZJD 2HKEA 2DMYA 1Z5BA 4R8OA 2N3GA 1HNWI 4JI0E 1N36E 4DU7A 2EFGA 2Z5BB 3LLHA 5IT9Q 3J7Yp 4DV4E 4AQYE 5AE3A 2KONA 4WUBA 2M1SA 2O1UA 3WU3A 4DV7I 4GEQB 2DEJA 2Z5BA 5AE2A 3T1YI 4N3OA 1Z5CA 3AUZA 3J81C 2NUEA 2FV4B 1N32I 1HNXI 3ZZTA 1HK7A 4KZSA 2E1MA 4WPYA 4JI8I 3PYDA 2LTRA 4USKA 4R03A 3QT7A 5L3JA 4DR6E 4JV5E 2X36A 1Z0GA 2ZM6E 1FI4A 4Q28A 4F9AB 3F0NA 4Z7CA 4NXME 3HQ1A 4LF6I 1GZ6A 1SR9A 1WUUA 2JR1A 3P1XA 4BBYA 2M7QA 2EZ6A 4LFAI 5FLXC 1FJGE 1MG7A 2JWOA 4F9BB 4DR3E 2L6MA 3J81Q 5F3WA 4YY3E 2BM1A 2UXDI 2DB2A 4KHPE 4Z7YA 1ELOA 4WUCA 2ZBKB 2K4VA 1GQEA 4OOGC 3VK6A 3AV0A 4X62I 2ODRD 1XNQI 2UUAI 2E5LI 3H09A 1NHIA 4JI6E 1ZXNA 2CZ9A 1U2RA 1USUA 1ZM4A 2VF3A 4F9CB 4P78A 1ZM3A 2Q2EB 4PRXA 3F6GA 2UUBE 1KIJA 2AJ4A 4UTGA 2PNLA 4B3TI 2NUFA 3PYEA 4BMJA 2LUPB 2VQEI 5LMNE 2JOBA 3K17A 3QT5A 4LFCE 2RTXA 4TUIA 4DR5E 2DSYA 4GKJI 4BC9A 4USMA 4JI3E 1O0WA 1X49A 1XNRE 3ZZ0A 5IWAI 1K47A 4M1KA 2UUCI 4DUZE 4DV6I 5DNYA 3T1HI 4DV3E 2G7HA 2VQFI 1IBKI 1XMOI 2MC6A 3B82A 5T6JA 2JY9A 2V34A 1XMQE 3PRYA 2V8PA 1VISA 4B3RE 4LFBI 1HNZE 1J5EE 3ZOQB 2JVAA 5BR8I 4KHPI 4X66I 2BM0A 4LF8I 1B63A 1DQ3A 4DR7I 4JI5I 4DV2E 1N33E 3LMLA 4DU8A 4JYAI 4DR4I 4JI2E 3Q6NA 4RPFA 4JI7E 1A6FA 1I94E 4DPYA 3JAMQ 4DR2E 2L92A 2Z5EA 3IWDA 3HULA 4LF9E 1ZXMA 1X48A 4K0KI 2RS6A 3C4TA 1S4EA 3PYFA 1X47A 2NUGA 1USVA 3ADIA 2MDRA 4LFCI 1ZM9A 1YYWA 3ZKDA 4JI4I 2V87A 4LF5I 2A2DA 3CWVA 4FWHA 4I8OA 1UEKA 2B3TB 4FN5A 1IBLE 3J80Q 3Q1QA 4PRVA 4DKKA 5LMUE 3QT8A 4X8WA 1UILA 2IHR1 1DARA 3K85A 4OX9I 2UXBI 4B3ME 1RQ0A 2L33A 5GMEA 2VE7C 5ADZA 2LMZA 2V83A 3K6QA 1N34E 1H7SA 2CG9A 4X64I 2FTXB 3OTOE 4DV1E 2F8BA 3HJCA 2LJHA 2RS7A 4NXNE 2Z5CB 1FWKA 1T4OA 4DV0I 3LTOA 2UU9E 1I94I 1IBME 2UXCI 4DR1I 2V2VA 2HHHI 1H7UA 1NHJA 4UT4A 3M6AA 4X65I 4B3SI 2Z5CA 2OI2A 2CGEA 3JTZA 2WZOA 1H73A 3DJWA 4BC7A 4IZJB 2F4VI 1D6TA 3B78A 1EI1A 2ZITA 2B9DA 3JU0A 2MC5A 2V88A 3Q6MA 4LF7E 4FW9A 3D4JA 4JI0I 3KWRA 1YZ9A 1N36I 2LRSA 1Z0BA 3J7AM 4DV4I 4GKKE 2V85A 1PIEA 2V2QA 4IZJA 4AQYI 1KVKA 1QZRA 1Z0EA 1Z0CA 2YZTA 3LNUA 2L3JA 1T4LB 4YHHE 4M2ZA 4LU9A 1WHQA 2L2KB 2L8TA 2A2CA 4DXLA 4DV5E 4DPUA 1WXRA 3ADGA 4B3MI 3ZKBA 3ZZUA 3B8HA 1Y4UA 4DR6I 4JV5I 2ZM6I 3WU6A 2V89A 1ZM2A 1PVGA 3H4LA 4XTJA 1DI2A 2J7KA 4DV1I 4PU9A 2L3CA 4LF4E 4NXMI 1EA6A 3ZM7A 4WYQB 4DUYE 3V2UC 3JAMC 5LL6R 1RR9A 1HR0E 1Y4SA 2M4IA 1FJGI 1HNWE 2R3VA 4DR3I 1Z0WA 4YY3I 4R1FA 3GONA 3HTXA 3PYGA 5FWKA 2R42A 2V2ZA 2XEXA 4DV7E 1Z59A 1B62A 3T1YE 2DIXA 2YT4A 4LTYA 3J80C 1WHNA 1N32E 1HNXE 1FNMA 4JI6I 4JI8E 4FWDA 3HPZA 2UUBI 2CPNA 4DPWA 3ADJA 4JI1E 4HY1A 5LMNI 2L2MA 3DF6A 1Z0TA 3F6HA 4LF6E 4DR5I 4WFTA 1MX0A 5AASA 4JI3I 1XNRI 3HXLA 4LFAE 3C4BA 4DUZI 1J26A 2RSMA 3OMLA 3ADLA 3J7AG 1H72C 1XHKA 2UXDE 4DUYI 4DV3I 2GS8A 4KQVA 4HXZA 2ODRC 1YYOA 1XMQI 3V5RA 4ZVIA 4X62E 4B3RI 1XNQE 2UUAE 1HNZI 2E5LE 1J5EI 2GQ0A 3HPSA 3IWBA 2NA2A 2BV3A 3WU4A 1PKPA 3K1JA 1KKHA 4DV2I 1YYKA 2LE2A 4F54A 1H74A 2KHXA 4HYMA 2JOXA 1N33I 2HFSA 1Y6ZA 4B3TE 2O1TA 2N3HA 2VQEE 4JI2I 2HKJA 4JI7I 3VYXA 4GKJE 3P06A 4MYTA 4DR2I 4HACB 4LF9I 1FWLA 4M30A 2FGGA 1NZ0A 4JI1I 5IWAE 1MU5A 2UUCE 2PNMA 2X7IA 1BKNA 1Z0VA 4DV6E 1ZBQA 4WUDA 3T1HE 4HACA 2VQFE 1IBKE 1XMOE 1EKZA 2NPFA 3VYYA 2B7VA 2IOQA 4LFBE 2VF1A 1IBLI 5BR8E 3IWCA 5LMUI 4X66E 5CFFE 4LF8E 1KTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RC7 A;  4DR7 E;  1UHZ A;  1FKA E;  4JI5 E;  2DEI A;  3LPS A;  4JYA E;  4DR4 E;  1T4N A;  1ZBT A;  1N34 I;  4DPT A;  2B7T A;  1STU A;  3OTO I;  2LUQ A;  4FWG A;  5GMD A;  4NXN I;  4K0K E;  2WW4 A;  5FLX Q;  4I3H A;  1N0U A;  2UU9 I;  1QU6 A;  1IBM I;  2HK3 A;  4JG4 A;  4EMD A;  2E1R A;  2HFU A;  4JI4 E;  1NHH A;  4LF5 E;  2LBS B;  4LF7 I;  5A2Q C;  4URL A;  4GKK I;  1Z5A A;  3QT6 A;  4ED4 A;  4OX9 E;  2LJP A;  2UXB E;  4P52 A;  4P7A A;  4YHH I;  4X64 E;  5IT9 C;  1OJ4 A;  3WU5 A;  2HK2 A;  4DV5 I;  1S16 A;  1N0V C;  4DV0 E;  4DPX A;  2UXC E;  4MYU A;  4DR1 E;  2HHH E;  4X65 E;  2LTS A;  5A2Q Q;  4LF4 I;  4B3S E;  1RRE A;  2L2N A;  1HR0 I;  2F4V E;  2HKE A;  2DMY A;  1Z5B A;  2N3G A;  1HNW I;  4JI0 E;  1N36 E;  4DU7 A;  2EFG A;  3LLH A;  5IT9 Q;  3J7Y p;  4DV4 E;  4AQY E;  4WUB A;  3WU3 A;  4DV7 I;  2DEJ A;  3T1Y I;  1Z5C A;  3J81 C;  2NUE A;  1N32 I;  1HNX I;  3ZZT A;  4JI8 I;  3PYD A;  2LTR A;  4USK A;  3QT7 A;  5L3J A;  4DR6 E;  4JV5 E;  2X36 A;  1Z0G A;  2ZM6 E;  1FI4 A;  3F0N A;  4Z7C A;  4NXM E;  4LF6 I;  1WUU A;  3P1X A;  2EZ6 A;  4LFA I;  5FLX C;  1FJG E;  1MG7 A;  4DR3 E;  3J81 Q;  4YY3 E;  2BM1 A;  2UXD I;  2DB2 A;  4KHP E;  4Z7Y A;  1ELO A;  4WUC A;  2ZBK B;  1GQE A;  4OOG C;  4X62 I;  1XNQ I;  2UUA I;  2E5L I;  1NHI A;  4JI6 E;  1ZXN A;  2CZ9 A;  1U2R A;  1ZM4 A;  2VF3 A;  1ZM3 A;  2Q2E B;  4PRX A;  2UUB E;  1KIJ A;  2AJ4 A;  4UTG A;  4B3T I;  2NUF A;  3PYE A;  2LUP B;  2VQE I;  5LMN E;  3K17 A;  3QT5 A;  4LFC E;  2RTX A;  4DR5 E;  4GKJ I;  4USM A;  4JI3 E;  1O0W A;  1X49 A;  1XNR E;  3ZZ0 A;  5IWA I;  1K47 A;  4M1K A;  2UUC I;  4DUZ E;  4DV6 I;  3T1H I;  4DV3 E;  2VQF I;  1IBK I;  1XMO I;  3B82 A;  2JY9 A;  2V34 A;  1XMQ E;  2V8P A;  1VIS A;  4B3R E;  4LFB I;  1HNZ E;  1J5E E;  2JVA A;  5BR8 I;  4KHP I;  4X66 I;  2BM0 A;  4LF8 I;  1B63 A;  4DR7 I;  4JI5 I;  4DV2 E;  1N33 E;  4DU8 A;  4JYA I;  4DR4 I;  4JI2 E;  4RPF A;  4JI7 E;  1A6F A;  1I94 E;  4DPY A;  3JAM Q;  4DR2 E;  3HUL A;  4LF9 E;  1ZXM A;  1X48 A;  4K0K I;  2RS6 A;  3C4T A;  1S4E A;  3PYF A;  1X47 A;  2NUG A;  3ADI A;  2MDR A;  4LFC I;  1ZM9 A;  1YYW A;  3ZKD A;  4JI4 I;  4LF5 I;  2A2D A;  3CWV A;  4FWH A;  1UEK A;  2B3T B;  4FN5 A;  1IBL E;  3J80 Q;  3Q1Q A;  4PRV A;  4DKK A;  5LMU E;  3QT8 A;  4X8W A;  1UIL A;  2IHR 1;  1DAR A;  4OX9 I;  2UXB I;  4B3M E;  1RQ0 A;  2L33 A;  5GME A;  1N34 E;  1H7S A;  4X64 I;  3OTO E;  4DV1 E;  2LJH A;  2RS7 A;  4NXN E;  1FWK A;  1T4O A;  4DV0 I;  3LTO A;  2UU9 E;  1I94 I;  1IBM E;  2UXC I;  4DR1 I;  2V2V A;  2HHH I;  1H7U A;  1NHJ A;  4UT4 A;  3M6A A;  4X65 I;  4B3S I;  2OI2 A;  1H73 A;  2F4V I;  1D6T A;  3B78 A;  1EI1 A;  2ZIT A;  4FW9 A;  4LF7 E;  3D4J A;  4JI0 I;  1YZ9 A;  1N36 I;  2LRS A;  1Z0B A;  3J7A M;  4DV4 I;  4GKK E;  4AQY I;  1PIE A;  2V2Q A;  1KVK A;  1QZR A;  1Z0E A;  1Z0C A;  3LNU A;  2L3J A;  1T4L B;  4YHH E;  4M2Z A;  1WHQ A;  2L2K B;  2A2C A;  4DXL A;  4DV5 E;  4DPU A;  3ADG A;  4B3M I;  3ZKB A;  3ZZU A;  3B8H A;  4DR6 I;  4JV5 I;  2ZM6 I;  3WU6 A;  1ZM2 A;  1PVG A;  3H4L A;  4XTJ A;  1DI2 A;  2J7K A;  4DV1 I;  4PU9 A;  2L3C A;  4LF4 E;  4NXM I;  1EA6 A;  3ZM7 A;  4WYQ B;  4DUY E;  3V2U C;  3JAM C;  5LL6 R;  1RR9 A;  1HR0 E;  1FJG I;  1HNW E;  2R3V A;  4DR3 I;  1Z0W A;  4YY3 I;  4R1F A;  3GON A;  3HTX A;  3PYG A;  2R42 A;  2V2Z A;  2XEX A;  4DV7 E;  1Z59 A;  1B62 A;  3T1Y E;  2DIX A;  2YT4 A;  3J80 C;  1WHN A;  1N32 E;  1HNX E;  1FNM A;  4JI6 I;  4JI8 E;  4FWD A;  2UUB I;  2CPN A;  4DPW A;  3ADJ A;  4JI1 E;  4HY1 A;  5LMN I;  2L2M A;  1Z0T A;  4LF6 E;  4DR5 I;  4WFT A;  1MX0 A;  4JI3 I;  1XNR I;  4LFA E;  3C4B A;  4DUZ I;  1J26 A;  2RSM A;  3ADL A;  1XHK A;  4DUY I;  1H72 C;  3J7A G;  2UXD E;  4DV3 I;  2GS8 A;  4KQV A;  4HXZ A;  1YYO A;  1XMQ I;  3V5R A;  4ZVI A;  4X62 E;  4B3R I;  1XNQ E;  2UUA E;  1HNZ I;  2E5L E;  1J5E I;  2NA2 A;  2BV3 A;  3WU4 A;  1PKP A;  3K1J A;  1KKH A;  4DV2 I;  1YYK A;  1H74 A;  2KHX A;  4HYM A;  1N33 I;  2HFS A;  4B3T E;  2N3H A;  2VQE E;  4JI2 I;  2HKJ A;  4JI7 I;  3VYX A;  4GKJ E;  4MYT A;  4DR2 I;  4HAC B;  4LF9 I;  1FWL A;  4M30 A;  1NZ0 A;  4JI1 I;  5IWA E;  1MU5 A;  2UUC E;  2X7I A;  1BKN A;  1Z0V A;  4DV6 E;  4WUD A;  3T1H E;  4HAC A;  2VQF E;  1IBK E;  1XMO E;  1EKZ A;  2NPF A;  3VYY A;  2B7V A;  4LFB E;  1IBL I;  5BR8 E;  5LMU I;  4X66 E;  5CFF E;  4LF8 E;  1KTV A; 
#chains in the Genus database with same CATH topology
 1RC7 A;  4DR7 E;  1UHZ A;  4ZYH A;  1FKA E;  4JI5 E;  2NN6 E;  4HEI A;  2EWL A;  2YU5 A;  3KZY A;  4TUG A;  2HJJ A;  2HC5 A;  2DEI A;  4J8Z A;  2O1W A;  5KL4 A;  2RQL A;  3LPS A;  4JYA E;  4DR4 E;  3KZZ A;  1T4N A;  1ZBT A;  1N34 I;  5DNX A;  1ZAA C;  4DPT A;  2B7T A;  1STU A;  2H36 X;  4O5G A;  4P7D A;  1Y5Y A;  3FIG A;  4F6M A;  2NN6 B;  3OTO I;  2EM9 A;  2D9H A;  2I13 A;  4DMI A;  2LUQ A;  1A1G A;  1YUJ A;  4FWG A;  1IQS A;  2YU8 A;  5GMD A;  4NXN I;  4K0K E;  3GLL A;  2WW4 A;  1GTK A;  4M0V A;  5DNL A;  5DRQ A;  5FLX Q;  4I3H A;  4IFD E;  2NN6 A;  1N0U A;  2V86 A;  2UU9 I;  5A6J A;  2AE8 A;  1QU6 A;  1IBM I;  2EPO A;  4L5N C;  3RMP A;  2HK3 A;  4JG4 A;  4EMD A;  2EOH A;  2YTQ A;  2E1R A;  2YSP A;  1T39 A;  2HFU A;  4JI4 E;  1NHH A;  4FW6 A;  3MSW A;  1BB8 A;  5AC4 A;  4LF5 E;  4IFD B;  5A6A A;  4IZK B;  4MLV A;  3THO B;  4LPF A;  5ELW A;  2EE8 A;  3THN A;  2NAB A;  2JYA A;  2LBS B;  4LF7 I;  3CDJ A;  4IS9 A;  1IQO A;  5A2Q C;  2O1V A;  1YH8 A;  4URL A;  2BA1 D;  5K36 D;  2PO2 B;  4IFD A;  2LT7 A;  4GKK I;  5TSE A;  4BCA A;  1Z5A A;  3QT6 A;  4IZK A;  4ED4 A;  1PJS A;  4OX9 E;  2LJP A;  2UXB E;  2PO1 B;  4P52 A;  4BA2 B;  1SFE A;  4P7A A;  4OO1 E;  2ENA A;  1B69 A;  2NN6 C;  5AE1 A;  1G2D C;  1YPN A;  2LJU A;  2IOP A;  4YHH I;  3BBG A;  2PO2 A;  4MU3 A;  1X6E A;  4X64 E;  5IT9 C;  3L00 A;  4U3D A;  1TN9 A;  1OJ4 A;  3U1K A;  2PO1 A;  1KYQ A;  4HTG A;  5A6K A;  2JEB B;  3GCM A;  3WU5 A;  3MHS C;  2V8Q B;  4L8N A;  4BS9 A;  2KOU A;  2HK2 A;  4DV5 I;  2HGH A;  4WX9 A;  4R2A A;  4OO1 B;  1S16 A;  1N0V C;  4MDT A;  5JEA B;  4DV0 E;  4DPX A;  4WSG A;  1D6T A;  4ZYG A;  2EM5 A;  2UXC E;  2EPR A;  2JEB A;  4MYU A;  4DR1 E;  2HHH E;  2NN6 F;  4X65 E;  2LTS A;  5A2Q Q;  4WSP A;  4LF4 I;  4B3S E;  4OO1 A;  1X6F A;  4IFD C;  1RRE A;  2EJ4 A;  2L2N A;  2F1D A;  5JEA A;  2EOO A;  5KL2 A;  1HR0 I;  2F4V E;  4IZJ D;  2HKE A;  2DMY A;  1Z5B A;  2EOS A;  4R8O A;  2EN3 A;  2N3G A;  1HNW I;  4JI0 E;  2EPP A;  1N36 E;  4DU7 A;  2EFG A;  2Z5B B;  3LLH A;  1PJT A;  1KJK A;  5IT9 Q;  3J7Y p;  4DV4 E;  4AQY E;  1R6L A;  5AE3 A;  2KON A;  4WUB A;  4IFD F;  2M1S A;  2O1U A;  3WU3 A;  4R2P A;  3U1Y A;  2EM2 A;  2EN6 A;  4DV7 I;  4GEQ B;  2EN1 A;  2DEJ A;  2Z5B A;  5AE2 A;  3T1Y I;  5DRR A;  4N3O A;  4NBQ A;  1Z5C A;  3AUZ A;  3J81 C;  2NUE A;  2LVH A;  2RPC A;  1YUI A;  2FV4 B;  2BA0 D;  1N32 I;  1HNX I;  4OO1 C;  1BBG A;  3ZZT A;  1HK7 A;  4KZS A;  2E1M A;  5JEA C;  4WPY A;  4RHB B;  1Z1B A;  2LV2 A;  3GME A;  2LTR A;  3PYD A;  4ISA A;  2O3Z A;  4JI8 I;  4USK A;  1EH7 A;  4R03 A;  3QT7 A;  5L3J A;  4DR6 E;  4JV5 E;  1X3C A;  1Z0G A;  2JXP A;  2ZM6 E;  2X36 A;  2EOQ A;  4Q28 A;  4F9A B;  1FI4 A;  3F0N A;  4Z7C A;  3BF2 A;  1UDO A;  4NXM E;  3HQ1 A;  4LF6 I;  1ZU1 A;  1GZ6 A;  1SR9 A;  3ECR A;  1WUU A;  2RSI A;  2YTD A;  4OO1 F;  2JR1 A;  3P1X A;  2R1F A;  2EMX A;  4LOM A;  5JEA F;  4BBY A;  2M7Q A;  1N3G A;  2EZ6 A;  4LFA I;  5FLX C;  3PS3 A;  1FJG E;  1MG7 A;  1EH6 A;  2JWO A;  4F9B B;  4DR3 E;  2L6M A;  3J81 Q;  5F3W A;  2EQ3 A;  4YY3 E;  4M9V C;  2BM1 A;  2ADR A;  2UXD I;  2DB2 A;  4KHP E;  2JT2 A;  5A69 A;  4Z7Y A;  4BHB A;  2MKN A;  1ELO A;  4WUC A;  2GHF A;  2YTN A;  2ZBK B;  2K4V A;  2YTE A;  4R2Q A;  1GQE A;  4OOG C;  3VK6 A;  2EMF A;  1VI7 A;  3AV0 A;  4X62 I;  4MU1 A;  2ODR D;  1XNQ I;  2UUA I;  2E5L I;  1P47 A;  3H09 A;  2EN2 A;  1NHI A;  4AM3 A;  1UBD C;  4JI6 E;  1ZXN A;  2WP8 A;  2EPL X;  2EQ0 A;  5LLQ A;  2CZ9 A;  1U2R A;  1USU A;  1ZM4 A;  2VF3 A;  4F9C B;  4P78 A;  1ZM3 A;  2ENC A;  2Q2E B;  3F6G A;  2UUB E;  1KIJ A;  2AJ4 A;  4PRX A;  1A1F A;  2PNL A;  2NUF A;  4UTG A;  3PYE A;  4B3T I;  4FW7 A;  4BMJ A;  2LUP B;  2VQE I;  1UDQ A;  2YRH A;  5LMN E;  2YTP A;  2JOB A;  3K17 A;  2YTO A;  3QT5 A;  4LFC E;  2RTX A;  5A6B D;  4TUI A;  2EM7 A;  4IS1 C;  4DR5 E;  2BA1 G;  2DSY A;  4GKJ I;  5DRP A;  4BC9 A;  4USM A;  5JEA D;  4JI3 E;  2EL5 A;  4R2E A;  2C38 B;  1O0W A;  1X49 A;  1XNR E;  3ZZ0 A;  5IWA I;  1K47 A;  1YFH A;  4M1K A;  2UUC I;  2JE6 B;  2WBT A;  4DUZ E;  4DV6 I;  5DNY A;  3T1H I;  4DV3 E;  5C0X E;  2YTJ A;  2EN8 A;  2G7H A;  2C38 A;  2VQF I;  1IBK I;  2PNZ B;  1XMO I;  2MC6 A;  3UK3 C;  3B82 A;  5T6J A;  2JY9 A;  3VHT B;  2V34 A;  4GQU A;  2K7I A;  1XMQ E;  2JE6 A;  2V8P A;  3PRY A;  1LLM C;  1VIS A;  4B3R E;  4LFB I;  2Q8U A;  2EMB A;  1HNZ E;  1E3P A;  1J5E E;  3ZOQ B;  2JVA A;  2E72 A;  5C0X B;  5BR8 I;  5K36 C;  2EOR A;  2PNZ A;  4KHP I;  4X66 I;  2BM0 A;  4LF8 I;  1B63 A;  1DQ3 A;  4DR7 I;  4JI5 I;  4BHC A;  2C39 B;  2EN4 A;  4DV2 E;  2EM6 A;  1N33 E;  3LML A;  2WNR B;  4AID A;  4DU8 A;  1AAY A;  5C0X A;  4JYA I;  4DR4 I;  4JI2 E;  3Q6N A;  4RPF A;  4JI7 E;  1A6F A;  1I94 E;  2EPX A;  2C39 A;  2EPM X;  4FW5 A;  2EPA A;  4DPY A;  2WNR A;  3JAM Q;  4DR2 E;  4BA1 A;  2L92 A;  2Z5E A;  3IWD A;  3HUL A;  4LF9 E;  1ZXM A;  1X48 A;  4X9J A;  2EMW A;  4K0K I;  2RS6 A;  3C4T A;  1S4E A;  3PYF A;  1X47 A;  2NUG A;  4QNK A;  5EKW A;  5IV8 B;  1USV A;  1PDA A;  2EPZ A;  3ADI A;  3UHM A;  4NZV A;  2MDR A;  4LFC I;  3M85 D;  2BA0 G;  1ZM9 A;  1YYW A;  1XXE A;  2YPN A;  1E3H A;  2V87 A;  3ZKD A;  4JI4 I;  5K36 E;  3EPL A;  4LF5 I;  2YTF A;  3BID A;  5KL7 A;  1ZR9 A;  3C6M A;  2A2D A;  4N4R B;  3CWV A;  4FWH A;  5C0X C;  4I8O A;  1UEK A;  2JPA A;  2B3T B;  4FN5 A;  1IBL E;  2EM8 A;  3J80 Q;  3Q1Q A;  4PRV A;  4DKK A;  1NCS A;  4O43 A;  5LMU E;  3QT8 A;  4X8W A;  1P42 A;  1YSA C;  1NEI A;  2CT1 A;  2EOM A;  1OYS A;  1UIL A;  2IHR 1;  1DAR A;  3K85 A;  4OX9 I;  2UXB I;  2C37 B;  2EM4 A;  4B3M E;  2PO0 B;  2EOZ A;  2J7J A;  1RQ0 A;  2EML A;  4ZYD A;  1A1I A;  2EM3 A;  2L33 A;  2VE7 C;  5GME A;  5ADZ A;  2GO4 A;  2LMZ A;  2V83 A;  3K6Q A;  5C0X F;  1N34 E;  5K36 A;  1H7S A;  2PRT A;  5AC5 A;  2CG9 A;  4X64 I;  2FTX B;  3OTO E;  4DV1 E;  2NN6 D;  2F8B A;  2C37 A;  2EMI A;  2PO0 A;  2EMA A;  3HJC A;  2N8X A;  2LJH A;  2RS7 A;  4NXN E;  2Z5C B;  3M7N D;  1BBO A;  3P76 A;  1FWK A;  1T4O A;  4DV0 I;  2A25 A;  3LTO A;  2UU9 E;  1MGT A;  2EOF A;  1I94 I;  1PJQ A;  1IBM E;  2UXC I;  2BR2 B;  2V2V A;  1F2I G;  4DR1 I;  1H7U A;  1NHJ A;  4UT4 A;  3M6A A;  1X5W A;  4X65 I;  2HHH I;  4OZE A;  4B3S I;  2Z5C A;  2OI2 A;  2DMI A;  2CGE A;  3JTZ A;  2WZO A;  1H73 A;  3DJW A;  4BC7 A;  3DD6 A;  2LO3 A;  3P3G A;  1JK2 A;  4IZJ B;  2F4V I;  1R6M A;  3NZK A;  4IFD D;  3B78 A;  3C6K A;  4RH8 A;  3TQM A;  1EI1 A;  2BR2 A;  2WP8 B;  2ZIT A;  3EQ1 A;  3JU0 A;  2B9D A;  2MC5 A;  2V88 A;  2EOY A;  1A1J A;  4LF7 E;  3D4J A;  3Q6M A;  4FW9 A;  3KWR A;  1YZ9 A;  1AH5 A;  3H1C A;  4JI0 I;  1N36 I;  1EH8 A;  2LRS A;  1Z0B A;  3J7A M;  4DV4 I;  4GKK E;  2V85 A;  1PIE A;  2V2Q A;  4IZJ A;  4AQY I;  1KVK A;  1QZR A;  1Z0E A;  1Z0C A;  2BBG A;  2YZT A;  1A1H A;  1UDN A;  3LNU A;  1A1K A;  2EPN A;  2L3J A;  1T4L B;  4YHH E;  4M2Z A;  4R2R A;  4LU9 A;  1WHQ A;  5K36 F;  1WJP A;  2L2K B;  4R2C A;  2JEA B;  2L8T A;  2A2C A;  5KL5 A;  4DXL A;  4DV5 E;  4DPU A;  1WXR A;  2YRK A;  3ADG A;  2YTG A;  4MLQ A;  3ZKB A;  4B3M I;  5KL3 A;  2EP3 A;  4O4K A;  3ZZU A;  4OO1 D;  3B8H A;  4R2D A;  1Y4U A;  3B4T A;  4DR6 I;  4JV5 I;  2ZM6 I;  3WU6 A;  2V89 A;  2JEA A;  1ZM2 A;  1PVG A;  3H4L A;  4XTJ A;  1DI2 A;  2J7K A;  4DV1 I;  4PU9 A;  2L3C A;  3PS1 A;  4LF4 E;  4NXM I;  1G2F C;  1EA6 A;  3ZM7 A;  4WYQ B;  2EL4 A;  2BB8 A;  4DUY E;  3V2U C;  3JAM C;  5LL6 R;  1A1L A;  1OYR A;  2EMY A;  2EMZ A;  4OKG A;  1RR9 A;  1HR0 E;  1Y4S A;  2M4I A;  4IJD A;  2YSO A;  2EMG A;  1FJG I;  1HNW E;  4LCH A;  3QG5 C;  2R3V A;  2M9A A;  4DR3 I;  2DRP A;  1Z0W A;  1UN6 B;  3CDI A;  4YY3 I;  5IXM B;  2VRD A;  4R1F A;  3GON A;  3P3C A;  2JP9 A;  2CTD A;  3HTX A;  2WBS A;  2EOE A;  3BGH A;  3PYG A;  5FWK A;  2R42 A;  2V2Z A;  2XEX A;  3PS2 A;  2CSH A;  4DV7 E;  1Z59 A;  1B62 A;  3T1Y E;  1RHY A;  2DGC A;  4BA1 B;  3EPK A;  2DIX A;  3M85 G;  4F2J C;  2YT4 A;  4LTY A;  3J80 C;  1WHN A;  1N32 E;  1OYP A;  1HNX E;  1FNM A;  4GZN C;  2EM0 A;  4JI6 I;  1YHC A;  2EOJ A;  4JI8 E;  2GLI A;  4FWD A;  4KWY A;  2EL6 A;  2EN7 A;  4MU0 A;  3HPZ A;  5DRO A;  2UUB I;  2EOI A;  2CPN A;  4QNJ A;  2DLQ A;  4DPW A;  5JEA E;  3ADJ A;  4JI1 E;  4FW4 A;  4HY1 A;  5LMN I;  4R2S A;  4AIM A;  2CVE A;  4FW3 A;  2L2M A;  3DF6 A;  4LCG A;  1Z0T A;  3F6H A;  4LF6 E;  5EL9 A;  4BA2 A;  1IMU A;  4DR5 I;  2YTI A;  2YRM A;  2EMK A;  4WFT A;  1MX0 A;  1Y60 A;  5AAS A;  4JI3 I;  4LCF A;  2MKD A;  1T38 A;  1XNR I;  3HXL A;  2EMH A;  4LFA E;  3MHH C;  3EPH A;  2ELZ A;  4NHR A;  5A6B A;  3M99 B;  3C4B A;  2WCC 3;  3P3E A;  4DUZ I;  1J26 A;  2RSM A;  4WXC A;  3OML A;  3ADL A;  3J7A G;  1H72 C;  1XHK A;  2UXD E;  4DUY I;  4DV3 I;  2GS8 A;  2YWQ A;  4KQV A;  5K36 B;  2J65 A;  4ZYE A;  4HXZ A;  2EPC A;  2ODR C;  1YYO A;  3M7N G;  1DGC A;  4O24 A;  1XMQ I;  3V5R A;  4ZVI A;  4U3B A;  4X62 E;  4B3R I;  1XNQ E;  2UUA E;  1HNZ I;  2E5L E;  2DLK A;  1J5E I;  2GQ0 A;  3HPS A;  4WXD A;  1L4S A;  3L7Z B;  3IWB A;  2NA2 A;  2BV3 A;  1QNT A;  4Q35 B;  3WU4 A;  1PKP A;  1UDS A;  2EQ1 A;  3K1J A;  1KKH A;  5KL6 A;  2GPI A;  1YYK A;  4DV2 I;  2LE2 A;  4F54 A;  1H74 A;  2KHX A;  4HYM A;  2JOX A;  2WBU A;  1N33 I;  2HFS A;  1Y6Z A;  4B3T E;  2O1T A;  3L7Z A;  2MDG A;  2EOX A;  2N3H A;  2VQE E;  4JI2 I;  2EPU A;  2HKJ A;  3HKM A;  4JI7 I;  2LCE A;  1TF6 A;  4FK5 C;  3VYX A;  1RMD A;  4GKJ E;  3P06 A;  4MU4 A;  4MYT A;  4DR2 I;  4HAC B;  2I9I A;  1FWL A;  4M30 A;  4LF9 I;  2FGG A;  1TF3 A;  1NZ0 A;  4JI1 I;  1X6H A;  2IER A;  5IWA E;  1MU5 A;  2UUC E;  2PNM A;  2X7I A;  1BKN A;  1Z0V A;  3KRN A;  4DV6 E;  1ZBQ A;  4WUD A;  3T1H E;  4F6N A;  4HAC A;  2R76 A;  2ELY A;  2EMC A;  2EPK X;  2ENH A;  3EPJ A;  2VQF E;  4J3D A;  1IBK E;  1XMO E;  4MQY A;  1EKZ A;  2NPF A;  2GO3 A;  3VYY A;  2B7V A;  1WRJ A;  2IES A;  2IOQ A;  4LFB E;  2VF1 A;  2VES A;  1JK1 A;  1IBL I;  1MEY C;  5BR8 E;  5C0X D;  3IWC A;  5LMU I;  4X66 E;  5CFF E;  4LF8 E;  1KTV A; 
#chains in the Genus database with same CATH homology
 1RC7 A;  4DR7 E;  1UHZ A;  1FKA E;  4JI5 E;  2EWL A;  4TUG A;  2DEI A;  4J8Z A;  2O1W A;  3LPS A;  4JYA E;  4DR4 E;  1T4N A;  1ZBT A;  1N34 I;  4DPT A;  2B7T A;  1STU A;  2H36 X;  4P7D A;  3FIG A;  3OTO I;  4DMI A;  2LUQ A;  4FWG A;  5GMD A;  4NXN I;  4K0K E;  2WW4 A;  4M0V A;  5FLX Q;  4I3H A;  1N0U A;  2V86 A;  2UU9 I;  1QU6 A;  1IBM I;  3RMP A;  4L5N C;  2HK3 A;  4JG4 A;  4EMD A;  2E1R A;  2HFU A;  4JI4 E;  1NHH A;  3MSW A;  4LF5 E;  4IZK B;  2LBS B;  4LF7 I;  5A2Q C;  2O1V A;  4URL A;  4GKK I;  1Z5A A;  4BCA A;  3QT6 A;  4IZK A;  4ED4 A;  4OX9 E;  2LJP A;  2UXB E;  4P52 A;  4P7A A;  5AE1 A;  2IOP A;  4YHH I;  4X64 E;  5IT9 C;  1OJ4 A;  3WU5 A;  4BS9 A;  2V8Q B;  4L8N A;  2HK2 A;  2KOU A;  4DV5 I;  1S16 A;  1N0V C;  4DV0 E;  4DPX A;  2UXC E;  4MYU A;  4DR1 E;  2HHH E;  4X65 E;  2LTS A;  5A2Q Q;  4WSP A;  4LF4 I;  4B3S E;  1RRE A;  2L2N A;  1HR0 I;  2F4V E;  4IZJ D;  2HKE A;  2DMY A;  1Z5B A;  4R8O A;  2N3G A;  1HNW I;  4JI0 E;  1N36 E;  4DU7 A;  2EFG A;  2Z5B B;  3LLH A;  5IT9 Q;  3J7Y p;  4DV4 E;  4AQY E;  5AE3 A;  2KON A;  4WUB A;  2M1S A;  2O1U A;  3WU3 A;  4DV7 I;  4GEQ B;  2DEJ A;  2Z5B A;  5AE2 A;  3T1Y I;  4N3O A;  1Z5C A;  3AUZ A;  3J81 C;  2NUE A;  2FV4 B;  1N32 I;  1HNX I;  3ZZT A;  1HK7 A;  4KZS A;  2E1M A;  4WPY A;  4JI8 I;  3PYD A;  2LTR A;  4USK A;  4R03 A;  3QT7 A;  5L3J A;  4DR6 E;  4JV5 E;  2X36 A;  1Z0G A;  2ZM6 E;  1FI4 A;  4Q28 A;  4F9A B;  3F0N A;  4Z7C A;  4NXM E;  3HQ1 A;  4LF6 I;  1GZ6 A;  1SR9 A;  1WUU A;  2JR1 A;  3P1X A;  4BBY A;  2M7Q A;  2EZ6 A;  4LFA I;  5FLX C;  1FJG E;  1MG7 A;  2JWO A;  4F9B B;  4DR3 E;  2L6M A;  3J81 Q;  5F3W A;  4YY3 E;  2BM1 A;  2UXD I;  2DB2 A;  4KHP E;  4Z7Y A;  1ELO A;  4WUC A;  2ZBK B;  2K4V A;  1GQE A;  4OOG C;  3VK6 A;  3AV0 A;  4X62 I;  2ODR D;  1XNQ I;  2UUA I;  2E5L I;  3H09 A;  1NHI A;  4JI6 E;  1ZXN A;  2CZ9 A;  1U2R A;  1USU A;  1ZM4 A;  2VF3 A;  4F9C B;  4P78 A;  1ZM3 A;  2Q2E B;  4PRX A;  3F6G A;  2UUB E;  1KIJ A;  2AJ4 A;  4UTG A;  2PNL A;  4B3T I;  2NUF A;  3PYE A;  4BMJ A;  2LUP B;  2VQE I;  5LMN E;  2JOB A;  3K17 A;  3QT5 A;  4LFC E;  2RTX A;  4TUI A;  4DR5 E;  2DSY A;  4GKJ I;  4BC9 A;  4USM A;  4JI3 E;  1O0W A;  1X49 A;  1XNR E;  3ZZ0 A;  5IWA I;  1K47 A;  4M1K A;  2UUC I;  4DUZ E;  4DV6 I;  5DNY A;  3T1H I;  4DV3 E;  2G7H A;  2VQF I;  1IBK I;  1XMO I;  2MC6 A;  3B82 A;  5T6J A;  2JY9 A;  2V34 A;  1XMQ E;  3PRY A;  2V8P A;  1VIS A;  4B3R E;  4LFB I;  1HNZ E;  1J5E E;  3ZOQ B;  2JVA A;  5BR8 I;  4KHP I;  4X66 I;  2BM0 A;  4LF8 I;  1B63 A;  1DQ3 A;  4DR7 I;  4JI5 I;  4DV2 E;  1N33 E;  3LML A;  4DU8 A;  4JYA I;  4DR4 I;  4JI2 E;  3Q6N A;  4RPF A;  4JI7 E;  1A6F A;  1I94 E;  4DPY A;  3JAM Q;  4DR2 E;  2L92 A;  2Z5E A;  3IWD A;  3HUL A;  4LF9 E;  1ZXM A;  1X48 A;  4K0K I;  2RS6 A;  3C4T A;  1S4E A;  3PYF A;  1X47 A;  2NUG A;  1USV A;  3ADI A;  2MDR A;  4LFC I;  1ZM9 A;  1YYW A;  3ZKD A;  4JI4 I;  2V87 A;  4LF5 I;  2A2D A;  3CWV A;  4FWH A;  4I8O A;  1UEK A;  2B3T B;  4FN5 A;  1IBL E;  3J80 Q;  3Q1Q A;  4PRV A;  4DKK A;  5LMU E;  3QT8 A;  4X8W A;  1UIL A;  2IHR 1;  1DAR A;  3K85 A;  4OX9 I;  2UXB I;  4B3M E;  1RQ0 A;  2L33 A;  5GME A;  2VE7 C;  5ADZ A;  2LMZ A;  2V83 A;  3K6Q A;  1N34 E;  1H7S A;  2CG9 A;  4X64 I;  2FTX B;  3OTO E;  4DV1 E;  2F8B A;  3HJC A;  2LJH A;  2RS7 A;  4NXN E;  2Z5C B;  1FWK A;  1T4O A;  4DV0 I;  3LTO A;  2UU9 E;  1I94 I;  1IBM E;  2UXC I;  4DR1 I;  2V2V A;  2HHH I;  1H7U A;  1NHJ A;  4UT4 A;  3M6A A;  4X65 I;  4B3S I;  2Z5C A;  2OI2 A;  2CGE A;  3JTZ A;  2WZO A;  1H73 A;  3DJW A;  4BC7 A;  4IZJ B;  2F4V I;  1D6T A;  3B78 A;  1EI1 A;  2ZIT A;  2B9D A;  3JU0 A;  2MC5 A;  2V88 A;  3Q6M A;  4LF7 E;  4FW9 A;  3D4J A;  4JI0 I;  3KWR A;  1YZ9 A;  1N36 I;  2LRS A;  1Z0B A;  3J7A M;  4DV4 I;  4GKK E;  2V85 A;  1PIE A;  2V2Q A;  4IZJ A;  4AQY I;  1KVK A;  1QZR A;  1Z0E A;  1Z0C A;  2YZT A;  3LNU A;  2L3J A;  1T4L B;  4YHH E;  4M2Z A;  4LU9 A;  1WHQ A;  2L2K B;  2L8T A;  2A2C A;  4DXL A;  4DV5 E;  4DPU A;  1WXR A;  3ADG A;  4B3M I;  3ZKB A;  3ZZU A;  3B8H A;  1Y4U A;  4DR6 I;  4JV5 I;  2ZM6 I;  3WU6 A;  2V89 A;  1ZM2 A;  1PVG A;  3H4L A;  4XTJ A;  1DI2 A;  2J7K A;  4DV1 I;  4PU9 A;  2L3C A;  4LF4 E;  4NXM I;  1EA6 A;  3ZM7 A;  4WYQ B;  4DUY E;  3V2U C;  3JAM C;  5LL6 R;  1RR9 A;  1HR0 E;  1Y4S A;  2M4I A;  1FJG I;  1HNW E;  2R3V A;  4DR3 I;  1Z0W A;  4YY3 I;  4R1F A;  3GON A;  3HTX A;  3PYG A;  5FWK A;  2R42 A;  2V2Z A;  2XEX A;  4DV7 E;  1Z59 A;  1B62 A;  3T1Y E;  2DIX A;  2YT4 A;  4LTY A;  3J80 C;  1WHN A;  1N32 E;  1HNX E;  1FNM A;  4JI6 I;  4JI8 E;  4FWD A;  3HPZ A;  2UUB I;  2CPN A;  4DPW A;  3ADJ A;  4JI1 E;  4HY1 A;  5LMN I;  2L2M A;  3DF6 A;  1Z0T A;  3F6H A;  4LF6 E;  4DR5 I;  4WFT A;  1MX0 A;  5AAS A;  4JI3 I;  1XNR I;  3HXL A;  4LFA E;  3C4B A;  4DUZ I;  1J26 A;  2RSM A;  3OML A;  3ADL A;  3J7A G;  1H72 C;  1XHK A;  2UXD E;  4DUY I;  4DV3 I;  2GS8 A;  4KQV A;  4HXZ A;  2ODR C;  1YYO A;  1XMQ I;  3V5R A;  4ZVI A;  4X62 E;  4B3R I;  1XNQ E;  2UUA E;  1HNZ I;  2E5L E;  1J5E I;  2GQ0 A;  3HPS A;  3IWB A;  2NA2 A;  2BV3 A;  3WU4 A;  1PKP A;  3K1J A;  1KKH A;  4DV2 I;  1YYK A;  2LE2 A;  4F54 A;  1H74 A;  2KHX A;  4HYM A;  2JOX A;  1N33 I;  2HFS A;  1Y6Z A;  4B3T E;  2O1T A;  2N3H A;  2VQE E;  4JI2 I;  2HKJ A;  4JI7 I;  3VYX A;  4GKJ E;  3P06 A;  4MYT A;  4DR2 I;  4HAC B;  4LF9 I;  1FWL A;  4M30 A;  2FGG A;  1NZ0 A;  4JI1 I;  5IWA E;  1MU5 A;  2UUC E;  2PNM A;  2X7I A;  1BKN A;  1Z0V A;  4DV6 E;  1ZBQ A;  4WUD A;  3T1H E;  4HAC A;  2VQF E;  1IBK E;  1XMO E;  1EKZ A;  2NPF A;  3VYY A;  2B7V A;  2IOQ A;  4LFB E;  2VF1 A;  1IBL I;  5BR8 E;  3IWC A;  5LMU I;  4X66 E;  5CFF E;  4LF8 E;  1KTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...