4DUYE

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4duyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duyE02
4USKA 2UXCI 4DR6I 2HFUA 2N3HA 1HNXE 4DUZI 1FWKA 4JI7E 1Z5AA 4NXME 1U2RA 4DV5I 3T1YE 1D6TA 1N36E 2NPFA 4I3HA 4LFBI 3LTOA 2V2QA 4X64E 4LF4E 2NUGA 1FJGI 1IBLI 3PYDA 1DI2A 4DR3I 2HK2A 2HKJA 2N3GA 3QT7A 4DV1E 4YY3E 4UTGA 1YYKA 2UU9I 2NUEA 4JI5E 4DR7I 4LF7I 1KVKA 1BKNA 1FI4A 3GONA 2DEIA 1T4NA 4DV4E 3CWVA 1N34I 4DV6I 2UXDI 4DXLA 4B3MI 2A2CA 1EKZA 3J81Q 2HFSA 5IT9Q 2L33A 3OTOE 4DR1I 1XMQI 3ADIA 2L3JA 4DV0E 1HNWI 4K0KE 2LTSA 1HR0I 4PU9A 4KHPE 2LJHA 2UXBE 4DR4I 1I94E 1ZM2A 2R42A 3WU6A 1YYWA 4JV5I 2AJ4A 3PYEA 2LRSA 3ADGA 4B3RE 4UT4A 4B3TE 2V34A 2V2VA 3JAMC 3QT8A 2Q2EB 1X48A 4P52A 1Z0EA 4X66E 4NXNE 4FN5A 4HXZA 5GMDA 2BV3A 3K17A 4Z7CA 1H7SA 4JI6E 4PRVA 5IWAE 2UUCE 4OX9I 1N0UA 3C4TA 4GKJI 2X36A 1KIJA 5LL6R 1J5EI 2GS8A 1HNZI 1XNRI 3ZKBA 4ED4A 4DUYE 2B7VA 4JI8E 2VQFI 4DV2I 4ZVIA 3P1XA 1EI1A 1N0VC 4DR2I 1IBME 1FNMA 4JI1I 2DEJA 4JI2E 4YHHE 5LMUI 1H72C 1RR9A 1N34E 4DV7E 2RS6A 4LF8I 1Z5CA 1YZ9A 3PYGA 4M2ZA 3VYXA 1Z0BA 4JI0E 4JI3I 1XNQE 4JYAE 3LLHA 4KQVA 2EFGA 2JVAA 1IBKE 4LF9I 4B3SE 4LF6E 2E5LE 1VISA 4JG4A 1UHZA 4DPXA 4GKKE 3ZZTA 2F4VI 4MYUA 3ZZ0A 2X7IA 1DARA 1N32I 2DIXA 4OOGC 4DKKA 4JI4E 4DPYA 4HYMA 2HHHI 1XMOE 1MG7A 2UUBE 2BM1A 1N33I 2E1RA 5LMNE 3WU4A 4AQYI 2UUAI 1H73A 1RREA 4DR5I 3M6AA 1ZBTA 3JAMQ 1PKPA 4DU7A 4X65E 4LF5E 2LJPA 4DV3E 3ZM7A 4FWHA 1PVGA 1FKAE 3K1JA 2ZBKB 4FW9A 4LFCE 1RC7A 4P7AA 4LFAI 5BR8E 1HNXI 2B3TB 1X47A 4JI7I 1WHQA 4DPWA 4NXMI 4X62E 3T1YI 1N36I 1PIEA 2UXCE 4X64I 4DR6E 4LF4I 4DUZE 2L2MA 1ZXMA 1H7UA 5FLXC 3T1HI 4DV5E 4R1FA 2RS7A 4LFBE 4DV1I 3ZZUA 3B82A 4YY3I 1KKHA 1Z0WA 1ZM9A 1Z59A 1FJGE 1YYOA 1IBLE 2B7TA 4JI5I 4DR3E 1NHJA 3VYYA 2ZM6I 5IT9C 1WHNA 2LUQA 2A2DA 2UU9E 3ADLA 3LNUA 2KHXA 3J7AM 1MX0A 3HTXA 1WUUA 2LTRA 4DR7E 4LF7E 5L3JA 3D4JA 3B8HA 2DMYA 3OTOI 4HACB 4DV0I 4DV6E 2UXDE 4B3ME 4K0KI 1T4LB 5GMEA 2VQEI 1XMQE 4DR1E 4KHPI 3HULA 2UXBI 1OJ4A 1I94I 2CZ9A 1HNWE 3B78A 4RPFA 2V8PA 1Z5BA 1NZ0A 4MYTA 2R3VA 4B3RI 4X8WA 4B3TI 5A2QC 1HR0E 2ZITA 2RSMA 4HY1A 4DR4E 4DPUA 1H74A 2XEXA 2L2NA 1B63A 4X66I 4Z7YA 4NXNI 4JV5E 1A6FA 1ZXNA 3QT6A 4JI6I 2BM0A 5IWAI 2UUCI 2DB2A 3C4BA 1EA6A 3J80C 3WU3A 2J7KA 4USMA 2CPNA 2L2KB 3T1HE 1Z0TA 1S16A 2LUPB 1MU5A 4FWGA 1ELOA 4OX9E 1ZM3A 4DUYI 4DPTA 1NHHA 4JI8I 4GKJE 4XTJA 3V5RA 2IHR1 2L3CA 4M1KA 1J5EE 3WU5A 5FLXQ 2ZM6E 1IBMI 1HNZE 1XNRE 2RTXA 4JI2I 4YHHI 2VQFE 2V2ZA 4DV2E 3H4LA 4WUCA 3ADJA 2VF3A 4FWDA 3J7AG 4DR2E 4DV7I 1RQ0A 1S4EA 2HK3A 4JI1E 3PYFA 5LMUE 4JI0I 1XNQI 4JYAI 3Q1QA 3V2UC 4LF8E 1IBKI 4B3SI 4LF6I 2E5LI 2VQEE 4JI3E 4GKKI 3QT5A 4WUDA 1FWLA 4WFTA 1UEKA 4LF9E 2JY9A 1Z0GA 4JI4I 2F4VE 1XMOI 2UUBI 1K47A 3J81C 2HKEA 2LBSB 5LMNI 1T4OA 4M30A 1N32E 1STUA 4PRXA 4DV4I 2HHHE 1GQEA 4WYQB 5A2QQ 1B62A 1J26A 1QZRA 1N33E 1XHKA 1Z0VA 4X65I 4URLA 4LF5I 4AQYE 2UUAE 2OI2A 1Z0CA 4DV3I 4EMDA 1KTVA 4DR5E 2YT4A 4DU8A 1ZM4A 3J7Yp 2EZ6A 4LFCI 3J80Q 1O0WA 3F0NA 4WUBA 5BR8I 2NA2A 3LPSA 3ZKDA 2NUFA 2WW4A 4HACA 2MDRA 4X62I 1QU6A 1X49A 1UILA 4LFAE 1NHIA 5CFFE
chains in the Genus database with same CATH superfamily
1NEIA 4USKA 2BB8A 2UXCI 2DRPA 4OO1A 5JEAE 4DR6I 2HFUA 2N3HA 1HNXE 4DUZI 1FWKA 4JI7E 1Z5AA 4N4RB 3HQ1A 4NXME 1U2RA 4IZKA 3T1YE 3MHSC 4DV5I 1D6TA 1N36E 1KJKA 3P3GA 2NPFA 4I3HA 4LFBI 2Z5CB 3ZOQB 2F1DA 3BF2A 3LTOA 2GO3A 2V2QA 1IMUA 4DV4I 4GQUA 4X64E 3F6HA 2DLKA 4LF4E 2NUGA 2EN3A 2E1MA 3KZZA 3U1YA 1FJGI 1IBLI 2EOOA 3PYDA 1UBDC 2WZOA 1DI2A 4DR3I 2HK2A 2HKJA 2N3GA 3QT7A 3M7ND 4DV1E 4YY3E 3PRYA 4UTGA 4HEIA 2EPUA 4P78A 1A1HA 4BC9A 1YYKA 2UU9I 5KL6A 3CDIA 2NUEA 2V87A 4M0VA 5A69A 2Z5BA 2EMBA 1UN6B 1E3PA 1BBGA 4JI5E 2DSYA 4DR7I 4U3DA 2DGCA 4AIMA 4LF7I 1KVKA 1BKNA 1FI4A 2JEAB 2KONA 2YTJA 5C0XF 1DGCA 2JXPA 3GONA 1MEYC 2DEIA 1N3GA 2RSIA 4L5NC 1T4NA 3C6MA 5K36D 4DV4E 3CWVA 5K36A 1N34I 4DV6I 2UXDI 4DXLA 2LE2A 4R2CA 4O4KA 4B3MI 5AC5A 2A2CA 1EKZA 2BA0G 3IWBA 2N8XA 3J81Q 2EM8A 2HFSA 4MU0A 3U1KA 5IT9Q 2YZTA 2L33A 2EPLX 1WXRA 3OTOE 4DR1I 1XMQI 3IWDA 2EN2A 2H36X 2EPCA 2L3JA 3ADIA 4DV0E 1HNWI 2EM7A 5C0XB 5AE3A 4IS9A 4K0KE 3CDJA 2YRMA 3GMEA 4MU3A 2ENAA 4FW7A 2EPNA 2LTSA 2EPXA 1HR0I 2ODRD 2R76A 5DNYA 4PU9A 5JEAF 4KHPE 2LJHA 2UXBE 4DR4I 4FK5C 1I94E 4BA1B 4BBYA 1ZM2A 2R42A 1GTKA 2EM4A 2EMXA 1YFHA 1YYWA 3WU6A 3OMLA 2AJ4A 3PYEA 2RQLA 2LRSA 4MQYA 3ADGA 4B3RE 4UT4A 2EQ0A 3AV0A 2JEBB 4B3TE 1A1GA 2V34A 2V2VA 2ODRC 4MDTA 3EPLA 1WJPA 1X5WA 4MLQA 2EPZA 3JAMC 3QT8A 4LPFA 4DMIA 2Q2EB 1X48A 4P52A 4IJDA 1Z0EA 2C38B 4X66E 4NXNE 2WNRA 4FN5A 4HXZA 4O43A 1QNTA 5GMDA 2GLIA 2BV3A 3PS3A 1F2IG 4KWYA 3K17A 3ECRA 3P3EA 4Z7CA 1VI7A 5KL4A 1H7SA 4JI6E 1R6MA 5JEAB 4PRVA 4JV5I 5IWAE 1BB8A 2UUCE 3TQMA 2K7IA 2YU8A 4BMJA 3H09A 4IZJD 2NABA 5IXMB 4OX9I 1N0UA 2JWOA 3K6QA 4IZJA 3C4TA 4KZSA 1Y60A 1T38A 4GKJI 5AASA 3GCMA 2EMWA 2X36A 1P47A 2IOQA 2NN6D 1KIJA 4J8ZA 4O5GA 5LL6R 2JE6A 1J5EI 2NN6A 4BA2A 2GS8A 1HNZI 2ELYA 3HXLA 3ZKBA 4ED4A 1XNRI 1UDSA 4DUYE 2B7VA 4R2RA 4IFDD 4JI8E 2PO0B 2VQFI 4DV2I 3THOB 4ZVIA 3P1XA 4F9BB 1EI1A 4R2SA 1AH5A 1N0VC 4L8NA 4DR2I 2D9HA 2EM5A 1IBME 3MHHC 2EPPA 2YTEA 2M7QA 1FNMA 4JI1I 2C37A 2C39A 5DNLA 4FW6A 2DEJA 4JI2E 4YHHE 5LMUI 2EPAA 1H72C 4R2AA 2EOHA 1N34E 1RR9A 2M4IA 1UDOA 2EM9A 4I8OA 3UHMA 4DV7E 1A1LA 2EMCA 2RS6A 4OZEA 5FWKA 4LF8I 4OO1D 1Z5CA 2BR2B 1YZ9A 1A1JA 1Y4SA 3PYGA 4M2ZA 5ELWA 4ZYGA 3VYXA 1USUA 1Z0BA 3VK6A 4JI0E 3L7ZB 3Q6MA 4JI3I 2PO1A 3M99B 1XNQE 5AE1A 2PO2A 4JYAE 2JOBA 3LLHA 4KQVA 4GZNC 3HKMA 2EFGA 4ZYDA 2O1TA 2JVAA 1IBKE 2LCEA 4LF9I 2Q8UA 2IERA 4B3SE 4LF6E 2EOIA 2EPRA 2E5LE 1VISA 3UK3C 4JG4A 1UHZA 4DPXA 4GKKE 1IQOA 2PNZA 3ZZTA 2JYAA 4MYUA 2F4VI 2YRHA 2VE7C 1AAYA 2EM0A 3ZZ0A 2A25A 2X7IA 2EM6A 1DARA 2EPMX 2J7JA 2EMHA 1N32I 2IESA 4IFDE 2DIXA 4OOGC 4BHCA 1T39A 2BA1D 4DKKA 3RMPA 2JOXA 4JI4E 4DPYA 2EMFA 1YUIA 4HYMA 2EQ3A 2MC6A 2M1SA 2YTGA 2HHHI 4BHBA 1XMOE 2Z5CA 4OKGA 4F6NA 1MG7A 2UUBE 2BM1A 1N33I 2GPIA 2E1RA 2EPOA 2EOJA 5LMNE 2YSPA 3WU4A 2R1FA 4WSPA 4AQYI 2UUAI 2HJJA 2EMYA 5AE2A 1H73A 3NZKA 3AUZA 5DROA 1RREA 1Y6ZA 4DR5I 2EE8A 4MU4A 4QNKA 4OO1E 2V86A 3BBGA 4BS9A 2EMZA 3M6AA 5A6BA 2YSOA 1ZBTA 3JAMQ 1PKPA 4DU7A 1DQ3A 4O24A 2EQ1A 4X65E 4LF5E 2JPAA 1YH8A 2LMZA 2LJPA 4DV3E 5K36C 3ZM7A 1NCSA 2EM3A 2EWLA 4FWHA 3IWCA 2YTDA 1PVGA 2YRKA 2G7HA 1FKAE 2JEAA 2L6MA 1OYRA 3M85G 5DRPA 3K1JA 2ZBKB 2MC5A 2GQ0A 2O1UA 2FV4B 1PDAA 4LFCE 4FW9A 1RC7A 2EN1A 2EOZA 5ADZA 4P7AA 5EL9A 3THNA 4LFAI 1PJTA 1PJSA 2ELZA 2O1VA 2EN8A 2HC5A 2EOQA 5BR8E 5DNXA 2B3TB 3JTZA 3EPHA 1HNXI 1X47A 4JI7I 3GLLA 2EOFA 1WHQA 4DPWA 4Q28A 4X62E 4TUGA 3T1YI 4NXMI 1N36I 5C0XD 5KL5A 5F3WA 3B4TA 5C0XA 2DMIA 5AC4A 3HPZA 1PIEA 2YTFA 3KZYA 2UXCE 4DR6E 4X64I 4F9AB 4LF4I 4DUZE 2L2MA 1YUJA 5K36E 1ZXMA 4R2DA 3H1CA 4LCGA 1RMDA 4GEQB 1H7UA 5FLXC 1OYSA 3T1HI 4DV5E 2WP8B 4R1FA 4IFDF 2BA0D 4F54A 3KRNA 4BA1A 2RS7A 2DLQA 4LFBE 4DV1I 3ZZUA 2YU5A 4NZVA 1KYQA 1KKHA 1Z0WA 2CSHA 1ZM9A 3B82A 4R03A 4YY3I 1Z59A 4U3BA 1FJGE 2JEBA 1YYOA 3BIDA 2B7TA 1IBLE 1OYPA 5DRQA 2WBSA 2JP9A 4JI5I 4DR3E 1NHJA 1EH6A 1YHCA 2EMGA 3VYYA 1IQSA 2C38A 2ZM6I 5IT9C 1WHNA 2LUQA 1SFEA 2A2DA 5LLQA 2UU9E 3ADLA 3FIGA 4OO1F 3LNUA 1X6EA 2KHXA 3J7AM 1BBOA 1MX0A 5JEAA 1A1IA 5A6AA 2EL5A 4IFDB 3HTXA 1WUUA 2LTRA 4DR7E 2V8QB 2NN6C 4LF7E 1E3HA 1EH7A 4WX9A 5L3JA 2GO4A 4AM3A 3D4JA 3B8HA 2EMAA 3DD6A 4BC7A 2BBGA 4F2JC 5CFFE 2DMYA 3KWRA 3OTOI 3EQ1A 4IFDC 4WXCA 4TUIA 3DF6A 4HACB 2EN6A 2AE8A 4DV0I 4DV6E 2UXDE 1YSAC 4NHRA 4B3ME 4K0KI 2MDGA 1SR9A 2EN4A 1T4LB 4OO1B 3M7NG 5GMEA 3VHTB 5KL7A 4MLVA 2VQEI 1G2FC 2PO0A 2K4VA 1XMQE 4DR1E 1ZR9A 3HULA 4KHPI 2O1WA 4IZKB 2UXBI 1OJ4A 1I94I 2CZ9A 1HNWE 3B78A 1TN9A 4RPFA 1ZU1A 2V8PA 3QG5C 1Z5BA 1NZ0A 1GZ6A 1XXEA 4OO1C 1Z1BA 4MYTA 2M9AA 2R3VA 4B3RI 4X8WA 1UDNA 2JT2A 4B3TI 5A2QC 1HR0E 4F6MA 2EMIA 2EP3A 2ZITA 2LVHA 2RSMA 2NN6E 4HY1A 2ENHA 4DR4E 4DPUA 1X6HA 1H74A 2XEXA 1P42A 2FTXB 5K36F 2L2NA 1B63A 4X66I 4Z7YA 3PS1A 4NXNI 4JV5E 1A6FA 2BR2A 1ZXNA 3QT6A 5A6KA 1HK7A 1MGTA 4R8OA 3L7ZA 4JI6I 4ZYHA 4LOMA 2Z5BB 2BM0A 5IWAI 2UUCI 3P06A 3K85A 2PRTA 2I9IA 2DB2A 3C4BA 2I13A 1EA6A 2LJUA 2CG9A 4ISAA 4FW3A 3J80C 4LCHA 3WU3A 2J7KA 4USMA 1JK1A 2YTNA 2CPNA 2L2KB 5T6JA 3T1HE 1Z0TA 5KL3A 2LV2A 2YWQA 1S16A 5K36B 2LUPB 5A6BD 1B69A 1MU5A 2V88A 1R6LA 4FWGA 1ELOA 4OX9E 1A1FA 4M9VC 3PS2A 1USVA 3LMLA 1ZM3A 4Q35B 3Q6NA 4DUYI 4DPTA 1NHHA 3BGHA 4JI8I 4GKJE 4XTJA 2EOYA 2YTPA 1Y5YA 1RHYA 2CT1A 2B9DA 3V5RA 2IHR1 2L3CA 1WRJA 2V83A 2VRDA 1J5EE 4M1KA 2EOMA 2ZM6E 3WU5A 5FLXQ 1IBMI 2ADRA 2EN7A 3MSWA 1HNZE 2LT7A 1XNRE 2RTXA 4N3OA 2EL4A 2MKDA 4JI2I 4YHHI 2VQFE 2V2ZA 2EOSA 4DV2E 3H4LA 4WUCA 2WBTA 2YTIA 3ADJA 2E72A 4IS1C 2VF3A 3J7AG 2VESA 2EJ4A 1Y4UA 4FWDA 4DR2E 4DV7I 5KL2A 1RQ0A 1JK2A 1S4EA 2HK3A 2EMLA 4JI1E 2PNLA 1TF3A 3PYFA 2F8BA 5LMUE 4JI0I 1XNQI 2J65A 2Z5EA 4JYAI 4R2PA 3Q1QA 1ZBQA 2EOEA 4HTGA 2MKNA 3V2UC 1PJQA 3JU0A 1EH8A 2EM2A 5TSEA 4ZYEA 4LF8E 2NN6F 2WNRB 1IBKI 4B3SI 2FGGA 4LF6I 2E5LI 2EOXA 2VQEE 4JI3E 4RHBB 5IV8B 2YPNA 4LCFA 3QT5A 4X9JA 4GKKI 4FW4A 4WUDA 4BCAA 5C0XC 1FWLA 4WFTA 4R2QA 2KOUA 1UEKA 4MU1A 3HPSA 4LF9E 2JY9A 4IZJB 3EPJA 1Z0GA 4JI4I 2YTQA 4P7DA 1L4SA 2LO3A 2RPCA 1A1KA 2F4VE 3M85D 1XMOI 2WBUA 2JE6B 1X3CA 2NN6B 3J81C 1K47A 2UUBI 4BA2B 4WXDA 2HKEA 2LBSB 5LMNI 4QNJA 1T4OA 2VF1A 4M30A 1N32E 2CVEA 5JEAD 3P76A 2EORA 3HJCA 1STUA 2JR1A 1YPNA 2PNMA 1ZAAC 2WP8A 4PRXA 2HHHE 1GQEA 5EKWA 2EL6A 4WYQB 5A2QQ 1B62A 2CTDA 1J26A 1QZRA 2IOPA 1N33E 2YTOA 1XHKA 3L00A 3P3CA 2C37B 1Z0VA 2C39B 1G2DC 4URLA 4X65I 4LF5I 3DJWA 4AQYE 2UUAE 2OI2A 5DRRA 5JEAC 1Z0CA 4DV3I 1TF6A 2L92A 2L8TA 4EMDA 5C0XE 1KTVA 4F9CB 4DR5E 2YT4A 3F6GA 2V85A 1LLMC 4AIDA 2ENCA 4DU8A 1ZM4A 2GHFA 2WCC3 3J7Yp 2EZ6A 4LFCI 2PO1B 4WPYA 3J80Q 4IFDA 2PO2B 1O0WA 3C6KA 2O3ZA 4RH8A 3F0NA 4LTYA 2BA1G 4NBQA 2HGHA 4WSGA 4WUBA 5BR8I 2NA2A 1UDQA 4FW5A 3LPSA 2EMKA 4LU9A 3ZKDA 2NUFA 2EPKX 4R2EA 2CGEA 2WW4A 2V89A 2MDRA 4HACA 4X62I 1QU6A 5A6JA 3EPKA 2PNZB 1X49A 1UILA 4LFAE 1NHIA 1X6FA 4J3DA
chains in the Genus database with same CATH topology
4USKA 2UXCI 4DR6I 2HFUA 2N3HA 1HNXE 4DUZI 1FWKA 4JI7E 1Z5AA 3HQ1A 4NXME 1U2RA 4IZKA 3T1YE 4DV5I 1D6TA 1N36E 2NPFA 4I3HA 4LFBI 2Z5CB 3ZOQB 3LTOA 2V2QA 4X64E 3F6HA 4LF4E 2NUGA 1FJGI 2E1MA 1IBLI 3PYDA 2WZOA 1DI2A 4DR3I 2HK2A 2HKJA 2N3GA 3QT7A 4DV1E 4YY3E 3PRYA 4UTGA 4P78A 4BC9A 1YYKA 2UU9I 2NUEA 2V87A 4M0VA 2Z5BA 4JI5E 2DSYA 4DR7I 4LF7I 1KVKA 1BKNA 1FI4A 2KONA 3GONA 2DEIA 4L5NC 1T4NA 4DV4E 3CWVA 1N34I 4DV6I 2UXDI 4DXLA 2LE2A 4B3MI 2A2CA 1EKZA 3IWBA 3J81Q 2HFSA 5IT9Q 2YZTA 2L33A 1WXRA 3OTOE 4DR1I 1XMQI 3IWDA 3ADIA 2H36X 2L3JA 4DV0E 1HNWI 5AE3A 4K0KE 2LTSA 1HR0I 2ODRD 5DNYA 4PU9A 4KHPE 2LJHA 2UXBE 4DR4I 1I94E 4BBYA 1ZM2A 2R42A 3WU6A 1YYWA 4JV5I 3OMLA 2AJ4A 3PYEA 2LRSA 3ADGA 4B3RE 4UT4A 3AV0A 4B3TE 2V34A 2V2VA 2ODRC 3JAMC 3QT8A 4DMIA 2Q2EB 1X48A 4P52A 1Z0EA 4X66E 4NXNE 4FN5A 4HXZA 5GMDA 2BV3A 3K17A 4Z7CA 1H7SA 4JI6E 4PRVA 5IWAE 2UUCE 4BMJA 3H09A 4IZJD 4OX9I 1N0UA 2JWOA 3K6QA 4IZJA 3C4TA 4KZSA 4GKJI 5AASA 2X36A 2IOQA 1KIJA 4J8ZA 5LL6R 1J5EI 2GS8A 1HNZI 3HXLA 3ZKBA 4ED4A 1XNRI 4DUYE 2B7VA 4JI8E 2VQFI 4DV2I 4ZVIA 3P1XA 4F9BB 1EI1A 1N0VC 4L8NA 4DR2I 1IBME 1FNMA 2M7QA 4JI1I 2DEJA 4JI2E 4YHHE 5LMUI 1H72C 1RR9A 1N34E 2M4IA 4I8OA 4DV7E 2RS6A 4LF8I 5FWKA 1Z5CA 1YZ9A 1Y4SA 3PYGA 4M2ZA 3VYXA 1USUA 1Z0BA 3Q6MA 3VK6A 4JI0E 4JI3I 1XNQE 5AE1A 4JYAE 2JOBA 3LLHA 4KQVA 2EFGA 2O1TA 2JVAA 1IBKE 4LF9I 4B3SE 4LF6E 2E5LE 1VISA 4JG4A 1UHZA 4DPXA 4GKKE 3ZZTA 2F4VI 4MYUA 2VE7C 3ZZ0A 2X7IA 1DARA 1N32I 2DIXA 4OOGC 4DKKA 3RMPA 2JOXA 4JI4E 4DPYA 4HYMA 2HHHI 2MC6A 2M1SA 1XMOE 2Z5CA 1MG7A 2UUBE 2BM1A 1N33I 2E1RA 5LMNE 3WU4A 4WSPA 4AQYI 2UUAI 5AE2A 1H73A 3AUZA 1RREA 1Y6ZA 4DR5I 2V86A 4BS9A 3M6AA 1ZBTA 3JAMQ 1PKPA 4DU7A 1DQ3A 4X65E 4LF5E 2LMZA 2LJPA 4DV3E 3ZM7A 2EWLA 4FWHA 3IWCA 1PVGA 2G7HA 1FKAE 2L6MA 3K1JA 2ZBKB 2MC5A 2GQ0A 2O1UA 2FV4B 4LFCE 4FW9A 1RC7A 5ADZA 4P7AA 4LFAI 2O1VA 5BR8E 1HNXI 2B3TB 3JTZA 1X47A 4JI7I 1WHQA 4DPWA 4Q28A 4X62E 4TUGA 3T1YI 4NXMI 1N36I 5F3WA 1PIEA 3HPZA 2UXCE 4X64I 4DR6E 4F9AB 4LF4I 4DUZE 2L2MA 1ZXMA 4GEQB 1H7UA 5FLXC 3T1HI 4DV5E 4R1FA 4F54A 2RS7A 4LFBE 4DV1I 3ZZUA 3B82A 4YY3I 1KKHA 1Z0WA 1ZM9A 4R03A 1Z59A 1FJGE 1YYOA 1IBLE 2B7TA 4JI5I 4DR3E 1NHJA 3VYYA 2ZM6I 5IT9C 1WHNA 2LUQA 2A2DA 2UU9E 3ADLA 3FIGA 3LNUA 2KHXA 3J7AM 1MX0A 3HTXA 1WUUA 2LTRA 4DR7E 2V8QB 4LF7E 5L3JA 3D4JA 3B8HA 4BC7A 2DMYA 3KWRA 3OTOI 4TUIA 4HACB 3DF6A 4DV0I 4DV6E 2UXDE 4B3ME 4K0KI 1SR9A 1T4LB 5GMEA 2VQEI 2K4VA 1XMQE 4DR1E 4KHPI 3HULA 2UXBI 2O1WA 4IZKB 1OJ4A 1I94I 2CZ9A 1HNWE 3B78A 4RPFA 2V8PA 1Z5BA 1NZ0A 1GZ6A 4MYTA 2R3VA 4B3RI 4X8WA 4B3TI 5A2QC 1HR0E 2ZITA 2RSMA 4HY1A 4DR4E 4DPUA 1H74A 2XEXA 2FTXB 2L2NA 1B63A 4X66I 4Z7YA 4NXNI 4JV5E 1A6FA 1ZXNA 3QT6A 1HK7A 4R8OA 4JI6I 2Z5BB 2BM0A 5IWAI 2UUCI 3P06A 3K85A 2DB2A 3C4BA 1EA6A 2CG9A 3J80C 3WU3A 2J7KA 4USMA 2CPNA 2L2KB 5T6JA 3T1HE 1Z0TA 1S16A 2LUPB 1MU5A 2V88A 4FWGA 1ELOA 4OX9E 1USVA 3LMLA 1ZM3A 4DUYI 3Q6NA 4DPTA 1NHHA 4JI8I 4GKJE 4XTJA 2B9DA 3V5RA 2IHR1 2L3CA 2V83A 1J5EE 4M1KA 3WU5A 5FLXQ 2ZM6E 1IBMI 3MSWA 1HNZE 1XNRE 4N3OA 2RTXA 4JI2I 4YHHI 2VQFE 2V2ZA 4DV2E 3H4LA 4WUCA 3ADJA 2VF3A 3J7AG 4FWDA 1Y4UA 4DR2E 4DV7I 1RQ0A 1S4EA 2HK3A 4JI1E 2PNLA 3PYFA 2F8BA 5LMUE 4JI0I 1XNQI 4JYAI 2Z5EA 3Q1QA 1ZBQA 3V2UC 3JU0A 4LF8E 1IBKI 4B3SI 2FGGA 4LF6I 2E5LI 2VQEE 4JI3E 4GKKI 3QT5A 4WUDA 4BCAA 1FWLA 4WFTA 1UEKA 2KOUA 3HPSA 4LF9E 2JY9A 4IZJB 1Z0GA 4JI4I 4P7DA 2F4VE 1XMOI 2UUBI 3J81C 1K47A 2HKEA 2LBSB 5LMNI 1T4OA 2VF1A 4M30A 1N32E 3HJCA 1STUA 2JR1A 2PNMA 4PRXA 4DV4I 2HHHE 1GQEA 4WYQB 5A2QQ 1B62A 1J26A 1QZRA 2IOPA 1N33E 1XHKA 1Z0VA 4X65I 4URLA 4LF5I 3DJWA 4AQYE 2UUAE 2OI2A 1Z0CA 4DV3I 2L92A 2L8TA 4EMDA 1KTVA 4F9CB 4DR5E 2YT4A 3F6GA 2V85A 4DU8A 1ZM4A 3J7Yp 2EZ6A 4LFCI 4WPYA 3J80Q 1O0WA 3F0NA 4LTYA 4WUBA 5BR8I 2NA2A 3LPSA 4LU9A 3ZKDA 2NUFA 2CGEA 2WW4A 2V89A 2MDRA 4HACA 4X62I 1QU6A 1X49A 1UILA 4LFAE 1NHIA 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USK A;  2UXC I;  4DR6 I;  2HFU A;  2N3H A;  1HNX E;  4DUZ I;  1FWK A;  4JI7 E;  1Z5A A;  4NXM E;  1U2R A;  4DV5 I;  3T1Y E;  1D6T A;  1N36 E;  2NPF A;  4I3H A;  4LFB I;  3LTO A;  2V2Q A;  4X64 E;  4LF4 E;  2NUG A;  1FJG I;  1IBL I;  3PYD A;  1DI2 A;  4DR3 I;  2HK2 A;  2HKJ A;  2N3G A;  3QT7 A;  4DV1 E;  4YY3 E;  4UTG A;  1YYK A;  2UU9 I;  2NUE A;  4JI5 E;  4DR7 I;  4LF7 I;  1KVK A;  1BKN A;  1FI4 A;  3GON A;  2DEI A;  1T4N A;  4DV4 E;  3CWV A;  1N34 I;  4DV6 I;  2UXD I;  4DXL A;  4B3M I;  2A2C A;  1EKZ A;  3J81 Q;  2HFS A;  5IT9 Q;  2L33 A;  3OTO E;  4DR1 I;  1XMQ I;  3ADI A;  2L3J A;  4DV0 E;  1HNW I;  4K0K E;  2LTS A;  1HR0 I;  4PU9 A;  4KHP E;  2LJH A;  2UXB E;  4DR4 I;  1I94 E;  1ZM2 A;  2R42 A;  3WU6 A;  1YYW A;  4JV5 I;  2AJ4 A;  3PYE A;  2LRS A;  3ADG A;  4B3R E;  4UT4 A;  4B3T E;  2V34 A;  2V2V A;  3JAM C;  3QT8 A;  2Q2E B;  1X48 A;  4P52 A;  1Z0E A;  4X66 E;  4NXN E;  4FN5 A;  4HXZ A;  5GMD A;  2BV3 A;  3K17 A;  4Z7C A;  1H7S A;  4JI6 E;  4PRV A;  5IWA E;  2UUC E;  4OX9 I;  1N0U A;  3C4T A;  4GKJ I;  2X36 A;  1KIJ A;  5LL6 R;  1J5E I;  2GS8 A;  1HNZ I;  1XNR I;  3ZKB A;  4ED4 A;  4DUY E;  2B7V A;  4JI8 E;  2VQF I;  4DV2 I;  4ZVI A;  3P1X A;  1EI1 A;  1N0V C;  4DR2 I;  1IBM E;  1FNM A;  4JI1 I;  2DEJ A;  4JI2 E;  4YHH E;  5LMU I;  1H72 C;  1RR9 A;  1N34 E;  4DV7 E;  2RS6 A;  4LF8 I;  1Z5C A;  1YZ9 A;  3PYG A;  4M2Z A;  3VYX A;  1Z0B A;  4JI0 E;  4JI3 I;  1XNQ E;  4JYA E;  3LLH A;  4KQV A;  2EFG A;  2JVA A;  1IBK E;  4LF9 I;  4B3S E;  4LF6 E;  2E5L E;  1VIS A;  4JG4 A;  1UHZ A;  4DPX A;  4GKK E;  3ZZT A;  2F4V I;  4MYU A;  3ZZ0 A;  2X7I A;  1DAR A;  1N32 I;  2DIX A;  4OOG C;  4DKK A;  4JI4 E;  4DPY A;  4HYM A;  2HHH I;  1XMO E;  1MG7 A;  2UUB E;  2BM1 A;  1N33 I;  2E1R A;  5LMN E;  3WU4 A;  4AQY I;  2UUA I;  1H73 A;  1RRE A;  4DR5 I;  3M6A A;  1ZBT A;  3JAM Q;  1PKP A;  4DU7 A;  4X65 E;  4LF5 E;  2LJP A;  4DV3 E;  3ZM7 A;  4FWH A;  1PVG A;  1FKA E;  3K1J A;  2ZBK B;  4FW9 A;  4LFC E;  1RC7 A;  4P7A A;  4LFA I;  5BR8 E;  1HNX I;  2B3T B;  1X47 A;  4JI7 I;  1WHQ A;  4DPW A;  4NXM I;  4X62 E;  3T1Y I;  1N36 I;  1PIE A;  2UXC E;  4X64 I;  4DR6 E;  4LF4 I;  4DUZ E;  2L2M A;  1ZXM A;  1H7U A;  5FLX C;  3T1H I;  4DV5 E;  4R1F A;  2RS7 A;  4LFB E;  4DV1 I;  3ZZU A;  3B82 A;  4YY3 I;  1KKH A;  1Z0W A;  1ZM9 A;  1Z59 A;  1FJG E;  1YYO A;  1IBL E;  2B7T A;  4JI5 I;  4DR3 E;  1NHJ A;  3VYY A;  2ZM6 I;  5IT9 C;  1WHN A;  2LUQ A;  2A2D A;  2UU9 E;  3ADL A;  3LNU A;  2KHX A;  3J7A M;  1MX0 A;  3HTX A;  1WUU A;  2LTR A;  4DR7 E;  4LF7 E;  5L3J A;  3D4J A;  3B8H A;  2DMY A;  3OTO I;  4HAC B;  4DV0 I;  4DV6 E;  2UXD E;  4B3M E;  4K0K I;  1T4L B;  5GME A;  2VQE I;  1XMQ E;  4DR1 E;  4KHP I;  3HUL A;  2UXB I;  1OJ4 A;  1I94 I;  2CZ9 A;  1HNW E;  3B78 A;  4RPF A;  2V8P A;  1Z5B A;  1NZ0 A;  4MYT A;  2R3V A;  4B3R I;  4X8W A;  4B3T I;  5A2Q C;  1HR0 E;  2ZIT A;  2RSM A;  4HY1 A;  4DR4 E;  4DPU A;  1H74 A;  2XEX A;  2L2N A;  1B63 A;  4X66 I;  4Z7Y A;  4NXN I;  4JV5 E;  1A6F A;  1ZXN A;  3QT6 A;  4JI6 I;  2BM0 A;  5IWA I;  2UUC I;  2DB2 A;  3C4B A;  1EA6 A;  3J80 C;  3WU3 A;  2J7K A;  4USM A;  2CPN A;  2L2K B;  3T1H E;  1Z0T A;  1S16 A;  2LUP B;  1MU5 A;  4FWG A;  1ELO A;  4OX9 E;  1ZM3 A;  4DUY I;  4DPT A;  1NHH A;  4JI8 I;  4GKJ E;  4XTJ A;  3V5R A;  2IHR 1;  2L3C A;  4M1K A;  1J5E E;  3WU5 A;  5FLX Q;  2ZM6 E;  1IBM I;  1HNZ E;  1XNR E;  2RTX A;  4JI2 I;  4YHH I;  2VQF E;  2V2Z A;  4DV2 E;  3H4L A;  4WUC A;  3ADJ A;  2VF3 A;  4FWD A;  3J7A G;  4DR2 E;  4DV7 I;  1RQ0 A;  1S4E A;  2HK3 A;  4JI1 E;  3PYF A;  5LMU E;  4JI0 I;  1XNQ I;  4JYA I;  3Q1Q A;  3V2U C;  4LF8 E;  1IBK I;  4B3S I;  4LF6 I;  2E5L I;  2VQE E;  4JI3 E;  4GKK I;  3QT5 A;  4WUD A;  1FWL A;  4WFT A;  1UEK A;  4LF9 E;  2JY9 A;  1Z0G A;  4JI4 I;  2F4V E;  1XMO I;  2UUB I;  1K47 A;  3J81 C;  2HKE A;  2LBS B;  5LMN I;  1T4O A;  4M30 A;  1N32 E;  1STU A;  4PRX A;  4DV4 I;  2HHH E;  1GQE A;  4WYQ B;  5A2Q Q;  1B62 A;  1J26 A;  1QZR A;  1N33 E;  1XHK A;  1Z0V A;  4X65 I;  4URL A;  4LF5 I;  4AQY E;  2UUA E;  2OI2 A;  1Z0C A;  4DV3 I;  4EMD A;  1KTV A;  4DR5 E;  2YT4 A;  4DU8 A;  1ZM4 A;  3J7Y p;  2EZ6 A;  4LFC I;  3J80 Q;  1O0W A;  3F0N A;  4WUB A;  5BR8 I;  2NA2 A;  3LPS A;  3ZKD A;  2NUF A;  2WW4 A;  4HAC A;  2MDR A;  4X62 I;  1QU6 A;  1X49 A;  1UIL A;  4LFA E;  1NHI A;  5CFF E; 
#chains in the Genus database with same CATH topology
 1NEI A;  4USK A;  2BB8 A;  2UXC I;  2DRP A;  4OO1 A;  5JEA E;  4DR6 I;  2HFU A;  2N3H A;  1HNX E;  4DUZ I;  1FWK A;  4JI7 E;  1Z5A A;  4N4R B;  3HQ1 A;  4NXM E;  1U2R A;  4IZK A;  3T1Y E;  3MHS C;  4DV5 I;  1D6T A;  1N36 E;  1KJK A;  3P3G A;  2NPF A;  4I3H A;  4LFB I;  2Z5C B;  3ZOQ B;  2F1D A;  3BF2 A;  3LTO A;  2GO3 A;  2V2Q A;  1IMU A;  4DV4 I;  4GQU A;  4X64 E;  3F6H A;  2DLK A;  4LF4 E;  2NUG A;  2EN3 A;  2E1M A;  3KZZ A;  3U1Y A;  1FJG I;  1IBL I;  2EOO A;  3PYD A;  1UBD C;  2WZO A;  1DI2 A;  4DR3 I;  2HK2 A;  2HKJ A;  2N3G A;  3QT7 A;  3M7N D;  4DV1 E;  4YY3 E;  3PRY A;  4UTG A;  4HEI A;  2EPU A;  4P78 A;  1A1H A;  4BC9 A;  1YYK A;  2UU9 I;  5KL6 A;  3CDI A;  2NUE A;  2V87 A;  4M0V A;  5A69 A;  2Z5B A;  2EMB A;  1UN6 B;  1E3P A;  1BBG A;  4JI5 E;  2DSY A;  4DR7 I;  4U3D A;  2DGC A;  4AIM A;  4LF7 I;  1KVK A;  1BKN A;  1FI4 A;  2JEA B;  2KON A;  2YTJ A;  5C0X F;  1DGC A;  2JXP A;  3GON A;  1MEY C;  2DEI A;  1N3G A;  2RSI A;  4L5N C;  1T4N A;  3C6M A;  5K36 D;  4DV4 E;  3CWV A;  5K36 A;  1N34 I;  4DV6 I;  2UXD I;  4DXL A;  2LE2 A;  4R2C A;  4O4K A;  4B3M I;  5AC5 A;  2A2C A;  1EKZ A;  2BA0 G;  3IWB A;  2N8X A;  3J81 Q;  2EM8 A;  2HFS A;  4MU0 A;  3U1K A;  5IT9 Q;  2YZT A;  2L33 A;  2EPL X;  1WXR A;  3OTO E;  4DR1 I;  1XMQ I;  3IWD A;  2EN2 A;  2H36 X;  2EPC A;  2L3J A;  3ADI A;  4DV0 E;  1HNW I;  2EM7 A;  5C0X B;  5AE3 A;  4IS9 A;  4K0K E;  3CDJ A;  2YRM A;  3GME A;  4MU3 A;  2ENA A;  4FW7 A;  2EPN A;  2LTS A;  2EPX A;  1HR0 I;  2ODR D;  2R76 A;  5DNY A;  4PU9 A;  5JEA F;  4KHP E;  2LJH A;  2UXB E;  4DR4 I;  4FK5 C;  1I94 E;  4BA1 B;  4BBY A;  1ZM2 A;  2R42 A;  1GTK A;  2EM4 A;  2EMX A;  1YFH A;  1YYW A;  3WU6 A;  3OML A;  2AJ4 A;  3PYE A;  2RQL A;  2LRS A;  4MQY A;  3ADG A;  4B3R E;  4UT4 A;  2EQ0 A;  3AV0 A;  2JEB B;  4B3T E;  1A1G A;  2V34 A;  2V2V A;  2ODR C;  4MDT A;  3EPL A;  1WJP A;  1X5W A;  4MLQ A;  2EPZ A;  3JAM C;  3QT8 A;  4LPF A;  4DMI A;  2Q2E B;  1X48 A;  4P52 A;  4IJD A;  1Z0E A;  2C38 B;  4X66 E;  4NXN E;  2WNR A;  4FN5 A;  4HXZ A;  4O43 A;  1QNT A;  5GMD A;  2GLI A;  2BV3 A;  3PS3 A;  1F2I G;  4KWY A;  3K17 A;  3ECR A;  3P3E A;  4Z7C A;  1VI7 A;  5KL4 A;  1H7S A;  4JI6 E;  1R6M A;  5JEA B;  4PRV A;  4JV5 I;  5IWA E;  1BB8 A;  2UUC E;  3TQM A;  2K7I A;  2YU8 A;  4BMJ A;  3H09 A;  4IZJ D;  2NAB A;  5IXM B;  4OX9 I;  1N0U A;  2JWO A;  3K6Q A;  4IZJ A;  3C4T A;  4KZS A;  1Y60 A;  1T38 A;  4GKJ I;  5AAS A;  3GCM A;  2EMW A;  2X36 A;  1P47 A;  2IOQ A;  2NN6 D;  1KIJ A;  4J8Z A;  4O5G A;  5LL6 R;  2JE6 A;  1J5E I;  2NN6 A;  4BA2 A;  2GS8 A;  1HNZ I;  2ELY A;  3HXL A;  3ZKB A;  4ED4 A;  1XNR I;  1UDS A;  4DUY E;  2B7V A;  4R2R A;  4IFD D;  4JI8 E;  2PO0 B;  2VQF I;  4DV2 I;  3THO B;  4ZVI A;  3P1X A;  4F9B B;  1EI1 A;  4R2S A;  1AH5 A;  1N0V C;  4L8N A;  4DR2 I;  2D9H A;  2EM5 A;  1IBM E;  3MHH C;  2EPP A;  2YTE A;  2M7Q A;  1FNM A;  4JI1 I;  2C37 A;  2C39 A;  5DNL A;  4FW6 A;  2DEJ A;  4JI2 E;  4YHH E;  5LMU I;  2EPA A;  1H72 C;  4R2A A;  2EOH A;  1N34 E;  1RR9 A;  2M4I A;  1UDO A;  2EM9 A;  4I8O A;  3UHM A;  4DV7 E;  1A1L A;  2EMC A;  2RS6 A;  4OZE A;  5FWK A;  4LF8 I;  4OO1 D;  1Z5C A;  2BR2 B;  1YZ9 A;  1A1J A;  1Y4S A;  3PYG A;  4M2Z A;  5ELW A;  4ZYG A;  3VYX A;  1USU A;  1Z0B A;  3VK6 A;  4JI0 E;  3L7Z B;  3Q6M A;  4JI3 I;  2PO1 A;  3M99 B;  1XNQ E;  5AE1 A;  2PO2 A;  4JYA E;  2JOB A;  3LLH A;  4KQV A;  4GZN C;  3HKM A;  2EFG A;  4ZYD A;  2O1T A;  2JVA A;  1IBK E;  2LCE A;  4LF9 I;  2Q8U A;  2IER A;  4B3S E;  4LF6 E;  2EOI A;  2EPR A;  2E5L E;  1VIS A;  3UK3 C;  4JG4 A;  1UHZ A;  4DPX A;  4GKK E;  1IQO A;  2PNZ A;  3ZZT A;  2JYA A;  4MYU A;  2F4V I;  2YRH A;  2VE7 C;  1AAY A;  2EM0 A;  3ZZ0 A;  2A25 A;  2X7I A;  2EM6 A;  1DAR A;  2EPM X;  2J7J A;  2EMH A;  1N32 I;  2IES A;  4IFD E;  2DIX A;  4OOG C;  4BHC A;  1T39 A;  2BA1 D;  4DKK A;  3RMP A;  2JOX A;  4JI4 E;  4DPY A;  2EMF A;  1YUI A;  4HYM A;  2EQ3 A;  2MC6 A;  2M1S A;  2YTG A;  2HHH I;  4BHB A;  1XMO E;  2Z5C A;  4OKG A;  4F6N A;  1MG7 A;  2UUB E;  2BM1 A;  1N33 I;  2GPI A;  2E1R A;  2EPO A;  2EOJ A;  5LMN E;  2YSP A;  3WU4 A;  2R1F A;  4WSP A;  4AQY I;  2UUA I;  2HJJ A;  2EMY A;  5AE2 A;  1H73 A;  3NZK A;  3AUZ A;  5DRO A;  1RRE A;  1Y6Z A;  4DR5 I;  2EE8 A;  4MU4 A;  4QNK A;  4OO1 E;  2V86 A;  3BBG A;  4BS9 A;  2EMZ A;  3M6A A;  5A6B A;  2YSO A;  1ZBT A;  3JAM Q;  1PKP A;  4DU7 A;  1DQ3 A;  4O24 A;  2EQ1 A;  4X65 E;  4LF5 E;  2JPA A;  1YH8 A;  2LMZ A;  2LJP A;  4DV3 E;  5K36 C;  3ZM7 A;  1NCS A;  2EM3 A;  2EWL A;  4FWH A;  3IWC A;  2YTD A;  1PVG A;  2YRK A;  2G7H A;  1FKA E;  2JEA A;  2L6M A;  1OYR A;  3M85 G;  5DRP A;  3K1J A;  2ZBK B;  2MC5 A;  2GQ0 A;  2O1U A;  2FV4 B;  1PDA A;  4LFC E;  4FW9 A;  1RC7 A;  2EN1 A;  2EOZ A;  5ADZ A;  4P7A A;  5EL9 A;  3THN A;  4LFA I;  1PJT A;  1PJS A;  2ELZ A;  2O1V A;  2EN8 A;  2HC5 A;  2EOQ A;  5BR8 E;  5DNX A;  2B3T B;  3JTZ A;  3EPH A;  1HNX I;  1X47 A;  4JI7 I;  3GLL A;  2EOF A;  1WHQ A;  4DPW A;  4Q28 A;  4X62 E;  4TUG A;  3T1Y I;  4NXM I;  1N36 I;  5C0X D;  5KL5 A;  5F3W A;  3B4T A;  5C0X A;  2DMI A;  5AC4 A;  3HPZ A;  1PIE A;  2YTF A;  3KZY A;  2UXC E;  4DR6 E;  4X64 I;  4F9A B;  4LF4 I;  4DUZ E;  2L2M A;  1YUJ A;  5K36 E;  1ZXM A;  4R2D A;  3H1C A;  4LCG A;  1RMD A;  4GEQ B;  1H7U A;  5FLX C;  1OYS A;  3T1H I;  4DV5 E;  2WP8 B;  4R1F A;  4IFD F;  2BA0 D;  4F54 A;  3KRN A;  4BA1 A;  2RS7 A;  2DLQ A;  4LFB E;  4DV1 I;  3ZZU A;  2YU5 A;  4NZV A;  1KYQ A;  1KKH A;  1Z0W A;  2CSH A;  1ZM9 A;  3B82 A;  4R03 A;  4YY3 I;  1Z59 A;  4U3B A;  1FJG E;  2JEB A;  1YYO A;  3BID A;  2B7T A;  1IBL E;  1OYP A;  5DRQ A;  2WBS A;  2JP9 A;  4JI5 I;  4DR3 E;  1NHJ A;  1EH6 A;  1YHC A;  2EMG A;  3VYY A;  1IQS A;  2C38 A;  2ZM6 I;  5IT9 C;  1WHN A;  2LUQ A;  1SFE A;  2A2D A;  5LLQ A;  2UU9 E;  3ADL A;  3FIG A;  4OO1 F;  3LNU A;  1X6E A;  2KHX A;  3J7A M;  1BBO A;  1MX0 A;  5JEA A;  1A1I A;  5A6A A;  2EL5 A;  4IFD B;  3HTX A;  1WUU A;  2LTR A;  4DR7 E;  2V8Q B;  2NN6 C;  4LF7 E;  1E3H A;  1EH7 A;  4WX9 A;  5L3J A;  2GO4 A;  4AM3 A;  3D4J A;  3B8H A;  2EMA A;  3DD6 A;  4BC7 A;  2BBG A;  4F2J C;  5CFF E;  2DMY A;  3KWR A;  3OTO I;  3EQ1 A;  4IFD C;  4WXC A;  4TUI A;  3DF6 A;  4HAC B;  2EN6 A;  2AE8 A;  4DV0 I;  4DV6 E;  2UXD E;  1YSA C;  4NHR A;  4B3M E;  4K0K I;  2MDG A;  1SR9 A;  2EN4 A;  1T4L B;  4OO1 B;  3M7N G;  5GME A;  3VHT B;  5KL7 A;  4MLV A;  2VQE I;  1G2F C;  2PO0 A;  2K4V A;  1XMQ E;  4DR1 E;  1ZR9 A;  3HUL A;  4KHP I;  2O1W A;  4IZK B;  2UXB I;  1OJ4 A;  1I94 I;  2CZ9 A;  1HNW E;  3B78 A;  1TN9 A;  4RPF A;  1ZU1 A;  2V8P A;  3QG5 C;  1Z5B A;  1NZ0 A;  1GZ6 A;  1XXE A;  4OO1 C;  1Z1B A;  4MYT A;  2M9A A;  2R3V A;  4B3R I;  4X8W A;  1UDN A;  2JT2 A;  4B3T I;  5A2Q C;  1HR0 E;  4F6M A;  2EMI A;  2EP3 A;  2ZIT A;  2LVH A;  2RSM A;  2NN6 E;  4HY1 A;  2ENH A;  4DR4 E;  4DPU A;  1X6H A;  1H74 A;  2XEX A;  1P42 A;  2FTX B;  5K36 F;  2L2N A;  1B63 A;  4X66 I;  4Z7Y A;  3PS1 A;  4NXN I;  4JV5 E;  1A6F A;  2BR2 A;  1ZXN A;  3QT6 A;  5A6K A;  1HK7 A;  1MGT A;  4R8O A;  3L7Z A;  4JI6 I;  4ZYH A;  4LOM A;  2Z5B B;  2BM0 A;  5IWA I;  2UUC I;  3P06 A;  3K85 A;  2PRT A;  2I9I A;  2DB2 A;  3C4B A;  2I13 A;  1EA6 A;  2LJU A;  2CG9 A;  4ISA A;  4FW3 A;  3J80 C;  4LCH A;  3WU3 A;  2J7K A;  4USM A;  1JK1 A;  2YTN A;  2CPN A;  2L2K B;  5T6J A;  3T1H E;  1Z0T A;  5KL3 A;  2LV2 A;  2YWQ A;  1S16 A;  5K36 B;  2LUP B;  5A6B D;  1B69 A;  1MU5 A;  2V88 A;  1R6L A;  4FWG A;  1ELO A;  4OX9 E;  1A1F A;  4M9V C;  3PS2 A;  1USV A;  3LML A;  1ZM3 A;  4Q35 B;  3Q6N A;  4DUY I;  4DPT A;  1NHH A;  3BGH A;  4JI8 I;  4GKJ E;  4XTJ A;  2EOY A;  2YTP A;  1Y5Y A;  1RHY A;  2CT1 A;  2B9D A;  3V5R A;  2IHR 1;  2L3C A;  1WRJ A;  2V83 A;  2VRD A;  1J5E E;  4M1K A;  2EOM A;  2ZM6 E;  3WU5 A;  5FLX Q;  1IBM I;  2ADR A;  2EN7 A;  3MSW A;  1HNZ E;  2LT7 A;  1XNR E;  2RTX A;  4N3O A;  2EL4 A;  2MKD A;  4JI2 I;  4YHH I;  2VQF E;  2V2Z A;  2EOS A;  4DV2 E;  3H4L A;  4WUC A;  2WBT A;  2YTI A;  3ADJ A;  2E72 A;  4IS1 C;  2VF3 A;  3J7A G;  2VES A;  2EJ4 A;  1Y4U A;  4FWD A;  4DR2 E;  4DV7 I;  5KL2 A;  1RQ0 A;  1JK2 A;  1S4E A;  2HK3 A;  2EML A;  4JI1 E;  2PNL A;  1TF3 A;  3PYF A;  2F8B A;  5LMU E;  4JI0 I;  1XNQ I;  2J65 A;  2Z5E A;  4JYA I;  4R2P A;  3Q1Q A;  1ZBQ A;  2EOE A;  4HTG A;  2MKN A;  3V2U C;  1PJQ A;  3JU0 A;  1EH8 A;  2EM2 A;  5TSE A;  4ZYE A;  4LF8 E;  2NN6 F;  2WNR B;  1IBK I;  4B3S I;  2FGG A;  4LF6 I;  2E5L I;  2EOX A;  2VQE E;  4JI3 E;  4RHB B;  5IV8 B;  2YPN A;  4LCF A;  3QT5 A;  4X9J A;  4GKK I;  4FW4 A;  4WUD A;  4BCA A;  5C0X C;  1FWL A;  4WFT A;  4R2Q A;  2KOU A;  1UEK A;  4MU1 A;  3HPS A;  4LF9 E;  2JY9 A;  4IZJ B;  3EPJ A;  1Z0G A;  4JI4 I;  2YTQ A;  4P7D A;  1L4S A;  2LO3 A;  2RPC A;  1A1K A;  2F4V E;  3M85 D;  1XMO I;  2WBU A;  2JE6 B;  1X3C A;  2NN6 B;  3J81 C;  1K47 A;  2UUB I;  4BA2 B;  4WXD A;  2HKE A;  2LBS B;  5LMN I;  4QNJ A;  1T4O A;  2VF1 A;  4M30 A;  1N32 E;  2CVE A;  5JEA D;  3P76 A;  2EOR A;  3HJC A;  1STU A;  2JR1 A;  1YPN A;  2PNM A;  1ZAA C;  2WP8 A;  4PRX A;  2HHH E;  1GQE A;  5EKW A;  2EL6 A;  4WYQ B;  5A2Q Q;  1B62 A;  2CTD A;  1J26 A;  1QZR A;  2IOP A;  1N33 E;  2YTO A;  1XHK A;  3L00 A;  3P3C A;  2C37 B;  1Z0V A;  2C39 B;  1G2D C;  4URL A;  4X65 I;  4LF5 I;  3DJW A;  4AQY E;  2UUA E;  2OI2 A;  5DRR A;  5JEA C;  1Z0C A;  4DV3 I;  1TF6 A;  2L92 A;  2L8T A;  4EMD A;  5C0X E;  1KTV A;  4F9C B;  4DR5 E;  2YT4 A;  3F6G A;  2V85 A;  1LLM C;  4AID A;  2ENC A;  4DU8 A;  1ZM4 A;  2GHF A;  2WCC 3;  3J7Y p;  2EZ6 A;  4LFC I;  2PO1 B;  4WPY A;  3J80 Q;  4IFD A;  2PO2 B;  1O0W A;  3C6K A;  2O3Z A;  4RH8 A;  3F0N A;  4LTY A;  2BA1 G;  4NBQ A;  2HGH A;  4WSG A;  4WUB A;  5BR8 I;  2NA2 A;  1UDQ A;  4FW5 A;  3LPS A;  2EMK A;  4LU9 A;  3ZKD A;  2NUF A;  2EPK X;  4R2E A;  2CGE A;  2WW4 A;  2V89 A;  2MDR A;  4HAC A;  4X62 I;  1QU6 A;  5A6J A;  3EPK A;  2PNZ B;  1X49 A;  1UIL A;  4LFA E;  1NHI A;  1X6F A;  4J3D A; 
#chains in the Genus database with same CATH homology
 4USK A;  2UXC I;  4DR6 I;  2HFU A;  2N3H A;  1HNX E;  4DUZ I;  1FWK A;  4JI7 E;  1Z5A A;  3HQ1 A;  4NXM E;  1U2R A;  4IZK A;  3T1Y E;  4DV5 I;  1D6T A;  1N36 E;  2NPF A;  4I3H A;  4LFB I;  2Z5C B;  3ZOQ B;  3LTO A;  2V2Q A;  4X64 E;  3F6H A;  4LF4 E;  2NUG A;  1FJG I;  2E1M A;  1IBL I;  3PYD A;  2WZO A;  1DI2 A;  4DR3 I;  2HK2 A;  2HKJ A;  2N3G A;  3QT7 A;  4DV1 E;  4YY3 E;  3PRY A;  4UTG A;  4P78 A;  4BC9 A;  1YYK A;  2UU9 I;  2NUE A;  2V87 A;  4M0V A;  2Z5B A;  4JI5 E;  2DSY A;  4DR7 I;  4LF7 I;  1KVK A;  1BKN A;  1FI4 A;  2KON A;  3GON A;  2DEI A;  4L5N C;  1T4N A;  4DV4 E;  3CWV A;  1N34 I;  4DV6 I;  2UXD I;  4DXL A;  2LE2 A;  4B3M I;  2A2C A;  1EKZ A;  3IWB A;  3J81 Q;  2HFS A;  5IT9 Q;  2YZT A;  2L33 A;  1WXR A;  3OTO E;  4DR1 I;  1XMQ I;  3IWD A;  3ADI A;  2H36 X;  2L3J A;  4DV0 E;  1HNW I;  5AE3 A;  4K0K E;  2LTS A;  1HR0 I;  2ODR D;  5DNY A;  4PU9 A;  4KHP E;  2LJH A;  2UXB E;  4DR4 I;  1I94 E;  4BBY A;  1ZM2 A;  2R42 A;  3WU6 A;  1YYW A;  4JV5 I;  3OML A;  2AJ4 A;  3PYE A;  2LRS A;  3ADG A;  4B3R E;  4UT4 A;  3AV0 A;  4B3T E;  2V34 A;  2V2V A;  2ODR C;  3JAM C;  3QT8 A;  4DMI A;  2Q2E B;  1X48 A;  4P52 A;  1Z0E A;  4X66 E;  4NXN E;  4FN5 A;  4HXZ A;  5GMD A;  2BV3 A;  3K17 A;  4Z7C A;  1H7S A;  4JI6 E;  4PRV A;  5IWA E;  2UUC E;  4BMJ A;  3H09 A;  4IZJ D;  4OX9 I;  1N0U A;  2JWO A;  3K6Q A;  4IZJ A;  3C4T A;  4KZS A;  4GKJ I;  5AAS A;  2X36 A;  2IOQ A;  1KIJ A;  4J8Z A;  5LL6 R;  1J5E I;  2GS8 A;  1HNZ I;  3HXL A;  3ZKB A;  4ED4 A;  1XNR I;  4DUY E;  2B7V A;  4JI8 E;  2VQF I;  4DV2 I;  4ZVI A;  3P1X A;  4F9B B;  1EI1 A;  1N0V C;  4L8N A;  4DR2 I;  1IBM E;  1FNM A;  2M7Q A;  4JI1 I;  2DEJ A;  4JI2 E;  4YHH E;  5LMU I;  1H72 C;  1RR9 A;  1N34 E;  2M4I A;  4I8O A;  4DV7 E;  2RS6 A;  4LF8 I;  5FWK A;  1Z5C A;  1YZ9 A;  1Y4S A;  3PYG A;  4M2Z A;  3VYX A;  1USU A;  1Z0B A;  3Q6M A;  3VK6 A;  4JI0 E;  4JI3 I;  1XNQ E;  5AE1 A;  4JYA E;  2JOB A;  3LLH A;  4KQV A;  2EFG A;  2O1T A;  2JVA A;  1IBK E;  4LF9 I;  4B3S E;  4LF6 E;  2E5L E;  1VIS A;  4JG4 A;  1UHZ A;  4DPX A;  4GKK E;  3ZZT A;  2F4V I;  4MYU A;  2VE7 C;  3ZZ0 A;  2X7I A;  1DAR A;  1N32 I;  2DIX A;  4OOG C;  4DKK A;  3RMP A;  2JOX A;  4JI4 E;  4DPY A;  4HYM A;  2HHH I;  2MC6 A;  2M1S A;  1XMO E;  2Z5C A;  1MG7 A;  2UUB E;  2BM1 A;  1N33 I;  2E1R A;  5LMN E;  3WU4 A;  4WSP A;  4AQY I;  2UUA I;  5AE2 A;  1H73 A;  3AUZ A;  1RRE A;  1Y6Z A;  4DR5 I;  2V86 A;  4BS9 A;  3M6A A;  1ZBT A;  3JAM Q;  1PKP A;  4DU7 A;  1DQ3 A;  4X65 E;  4LF5 E;  2LMZ A;  2LJP A;  4DV3 E;  3ZM7 A;  2EWL A;  4FWH A;  3IWC A;  1PVG A;  2G7H A;  1FKA E;  2L6M A;  3K1J A;  2ZBK B;  2MC5 A;  2GQ0 A;  2O1U A;  2FV4 B;  4LFC E;  4FW9 A;  1RC7 A;  5ADZ A;  4P7A A;  4LFA I;  2O1V A;  5BR8 E;  1HNX I;  2B3T B;  3JTZ A;  1X47 A;  4JI7 I;  1WHQ A;  4DPW A;  4Q28 A;  4X62 E;  4TUG A;  3T1Y I;  4NXM I;  1N36 I;  5F3W A;  1PIE A;  3HPZ A;  2UXC E;  4X64 I;  4DR6 E;  4F9A B;  4LF4 I;  4DUZ E;  2L2M A;  1ZXM A;  4GEQ B;  1H7U A;  5FLX C;  3T1H I;  4DV5 E;  4R1F A;  4F54 A;  2RS7 A;  4LFB E;  4DV1 I;  3ZZU A;  3B82 A;  4YY3 I;  1KKH A;  1Z0W A;  1ZM9 A;  4R03 A;  1Z59 A;  1FJG E;  1YYO A;  1IBL E;  2B7T A;  4JI5 I;  4DR3 E;  1NHJ A;  3VYY A;  2ZM6 I;  5IT9 C;  1WHN A;  2LUQ A;  2A2D A;  2UU9 E;  3ADL A;  3FIG A;  3LNU A;  2KHX A;  3J7A M;  1MX0 A;  3HTX A;  1WUU A;  2LTR A;  4DR7 E;  2V8Q B;  4LF7 E;  5L3J A;  3D4J A;  3B8H A;  4BC7 A;  2DMY A;  3KWR A;  3OTO I;  4TUI A;  4HAC B;  3DF6 A;  4DV0 I;  4DV6 E;  2UXD E;  4B3M E;  4K0K I;  1SR9 A;  1T4L B;  5GME A;  2VQE I;  2K4V A;  1XMQ E;  4DR1 E;  4KHP I;  3HUL A;  2UXB I;  2O1W A;  4IZK B;  1OJ4 A;  1I94 I;  2CZ9 A;  1HNW E;  3B78 A;  4RPF A;  2V8P A;  1Z5B A;  1NZ0 A;  1GZ6 A;  4MYT A;  2R3V A;  4B3R I;  4X8W A;  4B3T I;  5A2Q C;  1HR0 E;  2ZIT A;  2RSM A;  4HY1 A;  4DR4 E;  4DPU A;  1H74 A;  2XEX A;  2FTX B;  2L2N A;  1B63 A;  4X66 I;  4Z7Y A;  4NXN I;  4JV5 E;  1A6F A;  1ZXN A;  3QT6 A;  1HK7 A;  4R8O A;  4JI6 I;  2Z5B B;  2BM0 A;  5IWA I;  2UUC I;  3P06 A;  3K85 A;  2DB2 A;  3C4B A;  1EA6 A;  2CG9 A;  3J80 C;  3WU3 A;  2J7K A;  4USM A;  2CPN A;  2L2K B;  5T6J A;  3T1H E;  1Z0T A;  1S16 A;  2LUP B;  1MU5 A;  2V88 A;  4FWG A;  1ELO A;  4OX9 E;  1USV A;  3LML A;  1ZM3 A;  4DUY I;  3Q6N A;  4DPT A;  1NHH A;  4JI8 I;  4GKJ E;  4XTJ A;  2B9D A;  3V5R A;  2IHR 1;  2L3C A;  2V83 A;  1J5E E;  4M1K A;  3WU5 A;  5FLX Q;  2ZM6 E;  1IBM I;  3MSW A;  1HNZ E;  1XNR E;  4N3O A;  2RTX A;  4JI2 I;  4YHH I;  2VQF E;  2V2Z A;  4DV2 E;  3H4L A;  4WUC A;  3ADJ A;  2VF3 A;  3J7A G;  4FWD A;  1Y4U A;  4DR2 E;  4DV7 I;  1RQ0 A;  1S4E A;  2HK3 A;  4JI1 E;  2PNL A;  3PYF A;  2F8B A;  5LMU E;  4JI0 I;  1XNQ I;  4JYA I;  2Z5E A;  3Q1Q A;  1ZBQ A;  3V2U C;  3JU0 A;  4LF8 E;  1IBK I;  4B3S I;  2FGG A;  4LF6 I;  2E5L I;  2VQE E;  4JI3 E;  4GKK I;  3QT5 A;  4WUD A;  4BCA A;  1FWL A;  4WFT A;  1UEK A;  2KOU A;  3HPS A;  4LF9 E;  2JY9 A;  4IZJ B;  1Z0G A;  4JI4 I;  4P7D A;  2F4V E;  1XMO I;  2UUB I;  3J81 C;  1K47 A;  2HKE A;  2LBS B;  5LMN I;  1T4O A;  2VF1 A;  4M30 A;  1N32 E;  3HJC A;  1STU A;  2JR1 A;  2PNM A;  4PRX A;  4DV4 I;  2HHH E;  1GQE A;  4WYQ B;  5A2Q Q;  1B62 A;  1J26 A;  1QZR A;  2IOP A;  1N33 E;  1XHK A;  1Z0V A;  4X65 I;  4URL A;  4LF5 I;  3DJW A;  4AQY E;  2UUA E;  2OI2 A;  1Z0C A;  4DV3 I;  2L92 A;  2L8T A;  4EMD A;  1KTV A;  4F9C B;  4DR5 E;  2YT4 A;  3F6G A;  2V85 A;  4DU8 A;  1ZM4 A;  3J7Y p;  2EZ6 A;  4LFC I;  4WPY A;  3J80 Q;  1O0W A;  3F0N A;  4LTY A;  4WUB A;  5BR8 I;  2NA2 A;  3LPS A;  4LU9 A;  3ZKD A;  2NUF A;  2CGE A;  2WW4 A;  2V89 A;  2MDR A;  4HAC A;  4X62 I;  1QU6 A;  1X49 A;  1UIL A;  4LFA E;  1NHI A;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...